BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF011L01

Length=744
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

dbj|BAE96953.1|  starch branching enzyme I                              293   3e-89   Ipomoea batatas [batate]
dbj|BAE96955.1|  starch branching enzyme I                              293   3e-89   Ipomoea batatas [batate]
dbj|BAE96956.1|  starch branching enzyme I                              293   3e-89   Ipomoea batatas [batate]
dbj|BAE96954.1|  starch branching enzyme I                              293   3e-89   Ipomoea batatas [batate]
dbj|BAE96952.1|  starch branching enzyme I                              293   3e-89   Ipomoea batatas [batate]
ref|XP_002439058.1|  hypothetical protein SORBIDRAFT_10g030773          180   6e-53   
gb|ABK80499.1|  putative starch branching enzyme I                      180   7e-53   Sorghum bicolor [broomcorn]
emb|CAA70038.1|  1,4-alpha-glucan branching enzyme                      186   1e-50   Solanum tuberosum [potatoes]
gb|AGZ13546.1|  starch branching enzyme I                               172   2e-50   Malus transitoria
gb|AGZ13540.1|  starch branching enzyme I                               172   2e-50   Malus transitoria
gb|AGZ13580.1|  starch branching enzyme I                               172   2e-50   Malus toringoides [cutleaf crab apple]
gb|AGZ13608.1|  starch branching enzyme I                               171   3e-50   Malus baccata var. xiaojinensis
gb|AGZ13594.1|  starch branching enzyme I                               171   3e-50   Malus setok
gb|AGZ13591.1|  starch branching enzyme I                               171   6e-50   Malus setok
gb|AGZ13612.1|  starch branching enzyme I                               170   9e-50   Malus baccata var. xiaojinensis
gb|AGZ13571.1|  starch branching enzyme I                               170   1e-49   Malus toringoides [cutleaf crab apple]
gb|AGZ13573.1|  starch branching enzyme I                               170   1e-49   Malus toringoides [cutleaf crab apple]
gb|AGZ13539.1|  starch branching enzyme I                               169   2e-49   Malus transitoria
gb|ACF79369.1|  unknown                                                 174   2e-49   Zea mays [maize]
gb|KJB29684.1|  hypothetical protein B456_005G113800                    182   5e-49   Gossypium raimondii
gb|KJB29682.1|  hypothetical protein B456_005G113800                    182   6e-49   Gossypium raimondii
gb|AGZ13606.1|  starch branching enzyme I                               168   6e-49   Malus maerkangensis
gb|AGZ13542.1|  starch branching enzyme I                               167   7e-49   Malus transitoria
gb|AGZ13538.1|  starch branching enzyme I                               167   8e-49   Malus transitoria
gb|AGZ13605.1|  starch branching enzyme I                               167   9e-49   Malus maerkangensis
gb|AGZ13587.1|  starch branching enzyme I                               167   1e-48   Malus setok
gb|AGZ13548.1|  starch branching enzyme I                               167   1e-48   Malus kansuensis
ref|XP_002510672.1|  starch branching enzyme II, putative               182   1e-48   
gb|AGZ13588.1|  starch branching enzyme I                               166   2e-48   Malus setok
tpg|DAA34918.1|  TPA: alpha-amylase                                     181   2e-48   Glycine max [soybeans]
gb|AGZ13564.1|  starch branching enzyme I                               166   2e-48   Malus toringoides [cutleaf crab apple]
ref|XP_003523080.1|  PREDICTED: 1,4-alpha-glucan-branching enzyme...    181   3e-48   Glycine max [soybeans]
gb|AGZ13589.1|  starch branching enzyme I                               166   3e-48   Malus setok
gb|AGZ13547.1|  starch branching enzyme I                               166   4e-48   Malus transitoria
gb|KJB29683.1|  hypothetical protein B456_005G113800                    180   4e-48   Gossypium raimondii
gb|AGZ13551.1|  starch branching enzyme I                               166   4e-48   Malus kansuensis
gb|AGZ13552.1|  starch branching enzyme I                               166   5e-48   Malus kansuensis
gb|KHG01080.1|  1,4-alpha-glucan-branching enzyme                       180   5e-48   Gossypium arboreum [tree cotton]
ref|XP_008221138.1|  PREDICTED: 1,4-alpha-glucan-branching enzyme...    179   5e-48   Prunus mume [ume]
gb|AGZ13582.1|  starch branching enzyme I                               165   6e-48   Malus toringoides [cutleaf crab apple]
gb|AAD50279.2|  seed starch branching enzyme                            179   6e-48   Sorghum bicolor [broomcorn]
ref|XP_007225220.1|  hypothetical protein PRUPE_ppa001929mg             178   6e-48   
emb|CDP07294.1|  unnamed protein product                                179   8e-48   Coffea canephora [robusta coffee]
ref|XP_010556051.1|  PREDICTED: 1,4-alpha-glucan-branching enzyme...    179   9e-48   Tarenaya hassleriana [spider flower]
ref|XP_007018019.1|  Starch branching enzyme 2.2 isoform 1              179   1e-47   
ref|XP_010556050.1|  PREDICTED: 1,4-alpha-glucan-branching enzyme...    179   1e-47   Tarenaya hassleriana [spider flower]
ref|XP_010556049.1|  PREDICTED: 1,4-alpha-glucan-branching enzyme...    179   1e-47   Tarenaya hassleriana [spider flower]
ref|XP_010664077.1|  PREDICTED: 1,4-alpha-glucan-branching enzyme...    178   2e-47   Vitis vinifera
ref|XP_010664078.1|  PREDICTED: 1,4-alpha-glucan-branching enzyme...    177   2e-47   Vitis vinifera
gb|KEH36309.1|  starch branching enzyme I                               177   3e-47   Medicago truncatula
ref|XP_002284841.2|  PREDICTED: 1,4-alpha-glucan-branching enzyme...    177   3e-47   Vitis vinifera
gb|KEH36310.1|  starch branching enzyme I                               177   4e-47   Medicago truncatula
gb|KEH36308.1|  starch branching enzyme I                               177   4e-47   Medicago truncatula
ref|XP_010061163.1|  PREDICTED: 1,4-alpha-glucan-branching enzyme...    176   5e-47   Eucalyptus grandis [rose gum]
gb|AGZ13549.1|  starch branching enzyme I                               162   5e-47   Malus kansuensis
ref|XP_010061162.1|  PREDICTED: 1,4-alpha-glucan-branching enzyme...    176   6e-47   Eucalyptus grandis [rose gum]
ref|XP_004500879.1|  PREDICTED: 1,4-alpha-glucan-branching enzyme...    176   8e-47   Cicer arietinum [garbanzo]
gb|EAZ38340.1|  hypothetical protein OsJ_22715                          176   8e-47   Oryza sativa Japonica Group [Japonica rice]
pdb|3AML|A  Chain A, Structure Of The Starch Branching Enzyme I (...    175   8e-47   Oryza sativa Japonica Group [Japonica rice]
gb|KDO85087.1|  hypothetical protein CISIN_1g035501mg                   175   8e-47   Citrus sinensis [apfelsine]
ref|XP_011100531.1|  PREDICTED: 1,4-alpha-glucan-branching enzyme...    175   1e-46   Sesamum indicum [beniseed]
ref|XP_011100526.1|  PREDICTED: 1,4-alpha-glucan-branching enzyme...    176   1e-46   Sesamum indicum [beniseed]
ref|XP_011100535.1|  PREDICTED: 1,4-alpha-glucan-branching enzyme...    175   1e-46   Sesamum indicum [beniseed]
ref|XP_004500878.1|  PREDICTED: 1,4-alpha-glucan-branching enzyme...    176   1e-46   Cicer arietinum [garbanzo]
ref|XP_006473782.1|  PREDICTED: 1,4-alpha-glucan-branching enzyme...    176   1e-46   Citrus sinensis [apfelsine]
ref|XP_006435352.1|  hypothetical protein CICLE_v10000256mg             176   2e-46   Citrus clementina [clementine]
gb|AFW69578.1|  starch branching enzyme1                                174   2e-46   
ref|XP_006473780.1|  PREDICTED: 1,4-alpha-glucan-branching enzyme...    176   2e-46   Citrus sinensis [apfelsine]
ref|XP_006435353.1|  hypothetical protein CICLE_v10000256mg             175   2e-46   
ref|XP_006473781.1|  PREDICTED: 1,4-alpha-glucan-branching enzyme...    175   2e-46   Citrus sinensis [apfelsine]
ref|NP_001105370.1|  starch branching enzyme1                           175   2e-46   Zea mays [maize]
dbj|BAA01854.1|  branching enzyme-I precursor                           175   2e-46   Zea mays [maize]
gb|AAO20100.1|  starch branching enzyme I                               175   2e-46   Zea mays [maize]
gb|AGZ13568.1|  starch branching enzyme I                               161   2e-46   Malus toringoides [cutleaf crab apple]
gb|AGZ13557.1|  starch branching enzyme I                               161   3e-46   Malus toringoides [cutleaf crab apple]
gb|AGZ13570.1|  starch branching enzyme I                               160   3e-46   Malus toringoides [cutleaf crab apple]
gb|AGZ13558.1|  starch branching enzyme I                               160   4e-46   Malus toringoides [cutleaf crab apple]
ref|XP_006656510.1|  PREDICTED: 1,4-alpha-glucan-branching enzyme...    174   4e-46   
pdb|3AMK|A  Chain A, Structure Of The Starch Branching Enzyme I (...    173   4e-46   Oryza sativa Japonica Group [Japonica rice]
gb|EYU30277.1|  hypothetical protein MIMGU_mgv1a001932mg                173   4e-46   Erythranthe guttata [common monkey flower]
pdb|3VU2|A  Chain A, Structure Of The Starch Branching Enzyme I (...    173   4e-46   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004966509.1|  PREDICTED: 1,4-alpha-glucan-branching enzyme...    174   5e-46   Setaria italica
ref|NP_001289778.1|  1,4-alpha-glucan-branching enzyme 1, chlorop...    174   7e-46   Nelumbo nucifera [Indian lotus]
gb|AGZ13596.1|  starch branching enzyme I                               160   8e-46   Malus setok
gb|AAP68993.1|  starch-branching enzyme 1                               173   8e-46   Oryza sativa Japonica Group [Japonica rice]
gb|AII21924.1|  starch branching enzyme 1                               173   8e-46   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001058629.1|  Os06g0726400                                       173   9e-46   
dbj|BAA01584.1|  branching enzyme                                       173   9e-46   Oryza sativa Japonica Group [Japonica rice]
gb|ABL74558.1|  starch-branching enzyme I                               173   9e-46   Oryza sativa Japonica Group [Japonica rice]
gb|EEC81337.1|  hypothetical protein OsI_24520                          173   1e-45   Oryza sativa Indica Group [Indian rice]
ref|XP_011041237.1|  PREDICTED: 1,4-alpha-glucan-branching enzyme...    172   1e-45   Populus euphratica
ref|XP_011013898.1|  PREDICTED: 1,4-alpha-glucan-branching enzyme...    172   1e-45   Populus euphratica
ref|XP_010692551.1|  PREDICTED: 1,4-alpha-glucan-branching enzyme...    173   1e-45   Beta vulgaris subsp. vulgaris [field beet]
gb|AHW50662.1|  starch branching protein I                              172   2e-45   Lens culinaris
ref|XP_011041236.1|  PREDICTED: 1,4-alpha-glucan-branching enzyme...    172   2e-45   Populus euphratica
ref|XP_011013897.1|  PREDICTED: 1,4-alpha-glucan-branching enzyme...    172   2e-45   Populus euphratica
gb|AGZ13544.1|  starch branching enzyme I                               158   2e-45   Malus transitoria
sp|Q41059.1|GLGB2_PEA  RecName: Full=1,4-alpha-glucan-branching e...    172   2e-45   Pisum sativum [garden pea]
gb|AIC82459.1|  1,4-alpha-glucan-branching enzyme                       172   2e-45   Cocos nucifera
gb|KDP36796.1|  hypothetical protein JCGZ_08087                         172   3e-45   Jatropha curcas
gb|AAZ20130.1|  starch branching enzyme I                               172   3e-45   Malus domestica [apple tree]
ref|XP_008377077.1|  PREDICTED: 1,4-alpha-glucan-branching enzyme...    172   3e-45   
gb|ABQ15209.1|  starch branching enzyme I                               172   3e-45   Zea mays [maize]
gb|AGZ13560.1|  starch branching enzyme I                               158   3e-45   Malus toringoides [cutleaf crab apple]
emb|CAA54308.1|  1,4-alpha-glucan branching enzyme                      172   3e-45   Manihot esculenta [manioc]
emb|CAX51365.1|  starch branching enzyme                                170   4e-45   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002307789.2|  hypothetical protein POPTR_0005s27240g             171   4e-45   
gb|ABN05321.1|  starch branching enzyme I                               171   4e-45   Populus trichocarpa [western balsam poplar]
gb|AGZ13620.1|  starch branching enzyme I                               157   5e-45   Malus domestica [apple tree]
ref|XP_004291223.1|  PREDICTED: 1,4-alpha-glucan-branching enzyme...    171   7e-45   Fragaria vesca subsp. vesca
gb|AGZ13561.1|  starch branching enzyme I                               157   7e-45   Malus toringoides [cutleaf crab apple]
ref|XP_010094549.1|  1,4-alpha-glucan-branching enzyme                  170   8e-45   
gb|AAP72268.1|  starch branching enzyme I                               170   1e-44   Hordeum vulgare [barley]
ref|XP_006828735.1|  hypothetical protein AMTR_s00001p00048980          170   1e-44   
ref|XP_010935254.1|  PREDICTED: 1,4-alpha-glucan-branching enzyme...    170   1e-44   Elaeis guineensis
ref|XP_008781359.1|  PREDICTED: 1,4-alpha-glucan-branching enzyme...    172   1e-44   
gb|AAG27622.1|AF286318_1  starch branching enzyme 1                     170   2e-44   Triticum aestivum [Canadian hard winter wheat]
ref|XP_009395337.1|  PREDICTED: 1,4-alpha-glucan-branching enzyme...    170   2e-44   Musa acuminata subsp. malaccensis [pisang utan]
emb|CAB40980.1|  starch branching enzyme I                              170   2e-44   Triticum aestivum [Canadian hard winter wheat]
ref|XP_009395338.1|  PREDICTED: 1,4-alpha-glucan-branching enzyme...    170   2e-44   
emb|CAB40981.1|  starch branching enzyme I                              169   2e-44   Triticum aestivum [Canadian hard winter wheat]
emb|CAB40979.1|  starch branching enzyme I                              169   2e-44   Triticum aestivum [Canadian hard winter wheat]
gb|AGZ13622.1|  starch branching enzyme I                               155   3e-44   Malus sylvestris [European crab apple]
gb|EMS50244.1|  1,4-alpha-glucan-branching enzyme, chloroplastic/...    169   5e-44   Triticum urartu
gb|AGZ13621.1|  starch branching enzyme I                               155   5e-44   Malus asiatica [hua hong]
ref|XP_004166744.1|  PREDICTED: 1,4-alpha-glucan-branching enzyme...    168   6e-44   
ref|XP_004144236.1|  PREDICTED: 1,4-alpha-glucan-branching enzyme...    168   6e-44   Cucumis sativus [cucumbers]
gb|AGZ13626.1|  starch branching enzyme I                               154   1e-43   Malus sieboldii [Toringo crab-apple]
ref|XP_008464850.1|  PREDICTED: 1,4-alpha-glucan-branching enzyme...    166   2e-43   Cucumis melo [Oriental melon]
ref|XP_008464849.1|  PREDICTED: 1,4-alpha-glucan-branching enzyme...    166   3e-43   Cucumis melo [Oriental melon]
gb|EMT02068.1|  1,4-alpha-glucan-branching enzyme, chloroplastic/...    166   3e-43   
gb|AAG27621.1|AF286317_1  starch branching enzyme 1                     165   6e-43   Triticum aestivum [Canadian hard winter wheat]
gb|AAD30187.1|  starch branching enzyme I                               165   6e-43   Aegilops tauschii subsp. strangulata
ref|XP_007018020.1|  Starch branching enzyme II, putative isoform 2     164   1e-42   
gb|AAD30186.1|AF076679_1  starch branching enzyme-I                     164   2e-42   Triticum aestivum [Canadian hard winter wheat]
emb|CAA49372.1|  branching enzyme                                       149   6e-42   Manihot esculenta [manioc]
ref|XP_003563249.1|  PREDICTED: 1,4-alpha-glucan-branching enzyme...    162   8e-42   Brachypodium distachyon [annual false brome]
ref|XP_007018021.1|  Starch branching enzyme II, putative isoform 3     161   2e-41   
ref|XP_004291225.1|  PREDICTED: 1,4-alpha-glucan-branching enzyme...    160   3e-41   Fragaria vesca subsp. vesca
ref|XP_010266148.1|  PREDICTED: 1,4-alpha-glucan-branching enzyme...    159   9e-41   Nelumbo nucifera [Indian lotus]
ref|XP_010935255.1|  PREDICTED: 1,4-alpha-glucan-branching enzyme...    158   1e-40   
ref|XP_002960310.1|  hypothetical protein SELMODRAFT_437417             156   1e-39   Selaginella moellendorffii
ref|XP_007136017.1|  hypothetical protein PHAVU_009G011000g             153   2e-38   Phaseolus vulgaris [French bean]
gb|AGZ15384.1|  starch branching enzyme                                 152   3e-38   Phaseolus vulgaris [French bean]
gb|EPS72458.1|  hypothetical protein M569_02296                         144   7e-36   Genlisea aurea
ref|XP_009786039.1|  PREDICTED: LOW QUALITY PROTEIN: 1,4-alpha-gl...    144   9e-36   Nicotiana sylvestris
ref|XP_002967402.1|  hypothetical protein SELMODRAFT_86954              142   4e-35   
ref|XP_010320454.1|  PREDICTED: LOW QUALITY PROTEIN: 1,4-alpha-gl...    143   4e-35   
ref|XP_009631577.1|  PREDICTED: LOW QUALITY PROTEIN: 1,4-alpha-gl...    143   4e-35   
ref|NP_001275183.1|  1,4-alpha-glucan-branching enzyme                  143   4e-35   Solanum tuberosum [potatoes]
ref|XP_006342128.1|  PREDICTED: LOW QUALITY PROTEIN: 1,4-alpha-gl...    142   8e-35   
ref|XP_001754772.1|  predicted protein                                  135   2e-32   
ref|XP_001762321.1|  predicted protein                                  125   4e-29   
ref|XP_001763855.1|  predicted protein                                  118   2e-26   
dbj|BAJ89587.1|  predicted protein                                      106   4e-25   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002505138.1|  glycoside hydrolase family 13 protein              103   3e-21   Micromonas commoda
ref|XP_005649964.1|  starch branching enzyme                            102   6e-21   Coccomyxa subellipsoidea C-169
gb|AGZ13625.1|  starch branching enzyme I                             92.0    2e-20   Malus sieversii var. kirghisorum
ref|XP_003060477.1|  glycoside hydrolase family 13 protein            97.8    3e-19   Micromonas pusilla CCMP1545
gb|KHN20114.1|  1,4-alpha-glucan-branching enzyme                     92.0    3e-19   Glycine soja [wild soybean]
gb|AAT76445.1|  starch branching enzyme I                             94.0    4e-18   Vigna radiata [mung bean]
ref|XP_002955298.1|  1,4-alpha-glucan branching enzyme II             93.6    5e-18   Volvox carteri f. nagariensis
ref|XP_006435351.1|  hypothetical protein CICLE_v10000256mg           91.7    2e-17   
ref|XP_005852171.1|  hypothetical protein CHLNCDRAFT_33566            91.3    3e-17   Chlorella variabilis
ref|XP_006435350.1|  hypothetical protein CICLE_v10000256mg           89.7    1e-16   
gb|AAP05848.1|  amylose extender starch-branching enzyme              82.4    4e-16   Zea mays subsp. mays [corn]
gb|AAP05860.1|  amylose extender starch-branching enzyme              82.4    4e-16   Zea mays subsp. mays [corn]
gb|EAY86110.1|  hypothetical protein OsI_07480                        87.0    8e-16   Oryza sativa Indica Group [Indian rice]
gb|ACE88265.1|  rice starch branching enzyme                          87.0    8e-16   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001047009.1|  Os02g0528200                                     87.0    8e-16   
gb|KIZ01544.1|  1,4-alpha-glucan branching enzyme                     85.5    8e-16   Monoraphidium neglectum
gb|AFN27052.1|  starch branching enzyme 3                             87.0    9e-16   Oryza sativa Japonica Group [Japonica rice]
ref|XP_001695391.1|  starch branching enzyme                          86.7    9e-16   Chlamydomonas reinhardtii
ref|XP_003575058.1|  PREDICTED: 1,4-alpha-glucan-branching enzyme...  86.7    1e-15   Brachypodium distachyon [annual false brome]
ref|XP_006647330.1|  PREDICTED: 1,4-alpha-glucan-branching enzyme...  86.7    1e-15   
gb|AAP72267.1|  starch branching enzyme IIb                           86.3    1e-15   Sorghum bicolor [broomcorn]
dbj|BAA01616.1|  1,4-alpha-glucan branching enzyme                    85.9    2e-15   Oryza sativa Japonica Group [Japonica rice]
gb|AAW80631.1|  starch branching enzyme IIb                           85.5    2e-15   Triticum aestivum [Canadian hard winter wheat]
gb|AAP05858.1|  amylose extender starch-branching enzyme              80.1    3e-15   Zea mays subsp. mays [corn]
ref|XP_002453926.1|  hypothetical protein SORBIDRAFT_04g021540        85.1    4e-15   Sorghum bicolor [broomcorn]
emb|CAX51367.1|  starch branching enzyme                              84.3    5e-15   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009599017.1|  PREDICTED: 1,4-alpha-glucan-branching enzyme...  79.7    6e-15   Nicotiana tomentosiformis
gb|AAC69754.1|  starch branching enzyme IIb                           84.3    6e-15   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003450238.2|  PREDICTED: 1,4-alpha-glucan-branching enzyme...  84.3    6e-15   Oreochromis niloticus
ref|XP_007881428.1|  hypothetical protein PFL1_05702                  83.6    1e-14   Anthracocystis flocculosa PF-1
ref|XP_001417321.1|  predicted protein                                83.6    1e-14   Ostreococcus lucimarinus CCE9901
gb|ABK80522.1|  putative starch branching enzyme IIb                  77.4    1e-14   Sorghum bicolor [broomcorn]
gb|AAY89377.1|  starch branching enzyme 2                             77.8    1e-14   Nicotiana langsdorffii x Nicotiana sanderae
ref|XP_005926553.1|  PREDICTED: 1,4-alpha-glucan-branching enzyme...  83.2    1e-14   Haplochromis burtoni
ref|XP_005736038.1|  PREDICTED: 1,4-alpha-glucan-branching enzyme...  83.2    1e-14   Pundamilia nyererei
ref|XP_004560615.1|  PREDICTED: 1,4-alpha-glucan-branching enzyme...  83.2    1e-14   Maylandia zebra
gb|ACN30754.1|  unknown                                               82.4    2e-14   Zea mays [maize]
ref|XP_011094402.1|  PREDICTED: 1,4-alpha-glucan-branching enzyme...  82.8    2e-14   Sesamum indicum [beniseed]
ref|XP_003968717.1|  PREDICTED: 1,4-alpha-glucan-branching enzyme...  82.4    2e-14   
gb|AHW50661.1|  starch branching protein II                           82.8    2e-14   Lens culinaris
ref|XP_007572466.1|  PREDICTED: 1,4-alpha-glucan-branching enzyme...  78.2    2e-14   
ref|XP_011094401.1|  PREDICTED: 1,4-alpha-glucan-branching enzyme...  82.8    2e-14   Sesamum indicum [beniseed]
gb|KFM73565.1|  1,4-alpha-glucan-branching enzyme                     79.7    3e-14   Stegodyphus mimosarum
gb|AAB33385.1|  branching enzyme II BEII                              82.4    3e-14   Zea mays [maize]
ref|NP_001105316.1|  1,4-alpha-glucan-branching enzyme 2, chlorop...  82.0    3e-14   Zea mays [maize]
gb|KJB62213.1|  hypothetical protein B456_009G406400                  81.3    3e-14   Gossypium raimondii
ref|XP_008265433.1|  PREDICTED: LOW QUALITY PROTEIN: 1,4-alpha-gl...  82.4    3e-14   
gb|KJB62212.1|  hypothetical protein B456_009G406400                  81.6    3e-14   Gossypium raimondii
gb|AFW71659.1|  amylose extender1                                     82.0    3e-14   
gb|AAC33764.1|  starch branching enzyme IIb                           82.0    4e-14   Zea mays [maize]
gb|KJB16661.1|  hypothetical protein B456_002G241400                  82.0    4e-14   Gossypium raimondii
ref|XP_002534111.1|  starch branching enzyme II, putative             82.0    4e-14   Ricinus communis
gb|KJB62214.1|  hypothetical protein B456_009G406400                  80.9    4e-14   Gossypium raimondii
gb|KJB16660.1|  hypothetical protein B456_002G241400                  82.0    4e-14   Gossypium raimondii
gb|KJB16659.1|  hypothetical protein B456_002G241400                  81.6    4e-14   Gossypium raimondii
gb|KJB16665.1|  hypothetical protein B456_002G241400                  81.3    5e-14   Gossypium raimondii
gb|KJB62211.1|  hypothetical protein B456_009G406400                  81.3    5e-14   Gossypium raimondii
gb|KJB62209.1|  hypothetical protein B456_009G406400                  81.3    6e-14   Gossypium raimondii
gb|KJB62207.1|  hypothetical protein B456_009G406400                  81.3    6e-14   Gossypium raimondii
gb|KJB62210.1|  hypothetical protein B456_009G406400                  81.3    7e-14   Gossypium raimondii
ref|XP_008285053.1|  PREDICTED: 1,4-alpha-glucan-branching enzyme     80.9    7e-14   Stegastes partitus
ref|XP_005796937.1|  PREDICTED: 1,4-alpha-glucan-branching enzyme...  78.2    8e-14   
gb|ABO25741.1|  starch branching enzyme IIb                           80.9    8e-14   Zea mays [maize]
ref|XP_003554420.1|  PREDICTED: 1,4-alpha-glucan-branching enzyme...  80.9    9e-14   Glycine max [soybeans]
gb|KHG11831.1|  1,4-alpha-glucan-branching enzyme 2-2, chloroplas...  80.1    9e-14   Gossypium arboreum [tree cotton]
ref|XP_003579681.1|  PREDICTED: 1,4-alpha-glucan-branching enzyme...  80.9    9e-14   Brachypodium distachyon [annual false brome]
ref|XP_004952629.1|  PREDICTED: 1,4-alpha-glucan-branching enzyme...  80.9    9e-14   
ref|XP_007236767.1|  PREDICTED: 1,4-alpha-glucan-branching enzyme...  80.5    1e-13   
ref|XP_006796664.1|  PREDICTED: 1,4-alpha-glucan-branching enzyme...  80.5    1e-13   Neolamprologus brichardi [lyretail cichlid]
gb|ACN27298.1|  unknown                                               75.5    1e-13   Zea mays [maize]
gb|KHG10953.1|  1,4-alpha-glucan-branching enzyme 2-2, chloroplas...  79.7    1e-13   Gossypium arboreum [tree cotton]
gb|AAS88882.1|  SBEI                                                  80.5    1e-13   Ostreococcus tauri
ref|XP_003078929.1|  Branching Enzyme I (IC)                          80.1    1e-13   
ref|XP_004494151.1|  PREDICTED: 1,4-alpha-glucan-branching enzyme...  80.5    1e-13   Cicer arietinum [garbanzo]
ref|XP_010737101.1|  PREDICTED: 1,4-alpha-glucan-branching enzyme     80.1    1e-13   
ref|XP_004494152.1|  PREDICTED: 1,4-alpha-glucan-branching enzyme...  80.5    1e-13   Cicer arietinum [garbanzo]
emb|CEF97678.1|  Glycosyl hydrolase, family 13, catalytic domain      80.1    1e-13   Ostreococcus tauri
ref|XP_010243937.1|  PREDICTED: LOW QUALITY PROTEIN: 1,4-alpha-gl...  80.1    1e-13   
gb|EMS64965.1|  1,4-alpha-glucan-branching enzyme 2, chloroplasti...  80.1    2e-13   Triticum urartu
ref|XP_003625770.1|  Starch branching enzyme II                       79.0    2e-13   
gb|AHL84202.1|  starch branching enzyme 1                             73.9    2e-13   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009796284.1|  PREDICTED: 1,4-alpha-glucan-branching enzyme...  79.7    2e-13   Nicotiana sylvestris
emb|CAB40743.1|  starch branching enzyme II                           79.7    2e-13   Solanum tuberosum [potatoes]
ref|XP_010683852.1|  PREDICTED: 1,4-alpha-glucan-branching enzyme...  79.7    2e-13   Beta vulgaris subsp. vulgaris [field beet]
emb|CBQ68385.1|  probable branching enzyme (be1)                      79.3    2e-13   Sporisorium reilianum SRZ2
ref|XP_011018899.1|  PREDICTED: 1,4-alpha-glucan-branching enzyme...  79.7    2e-13   Populus euphratica
ref|XP_009796283.1|  PREDICTED: 1,4-alpha-glucan-branching enzyme...  79.7    2e-13   Nicotiana sylvestris
gb|AHL84210.1|  starch branching enzyme 1                             73.9    2e-13   Oryza sativa Indica Group [Indian rice]
gb|AAK26821.1|  starch branching enzyme IIa                           79.7    2e-13   Aegilops tauschii
emb|CCD41775.1|  starch branching enzyme IIa                          79.7    2e-13   Triticum aestivum [Canadian hard winter wheat]
sp|Q41058.1|GLGB1_PEA  RecName: Full=1,4-alpha-glucan-branching e...  79.7    2e-13   Pisum sativum [garden pea]
gb|EMT04009.1|  1,4-alpha-glucan-branching enzyme 2, chloroplasti...  79.7    2e-13   
ref|XP_010683853.1|  PREDICTED: 1,4-alpha-glucan-branching enzyme...  79.7    2e-13   Beta vulgaris subsp. vulgaris [field beet]
gb|AAG27623.1|AF286319_1  starch branching enzyme 2                   79.3    2e-13   Triticum aestivum [Canadian hard winter wheat]
emb|CAA72154.1|  1,4-alpha-glucan branching enzyme II                 79.3    2e-13   Triticum aestivum [Canadian hard winter wheat]
emb|CAX51366.1|  starch branching enzyme                              79.3    2e-13   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAK04311.1|  predicted protein                                    79.3    2e-13   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KDP42706.1|  hypothetical protein JCGZ_23646                       79.3    3e-13   Jatropha curcas
gb|AAK26822.1|AF338432_1  starch branching enzyme IIa variant         79.3    3e-13   Triticum aestivum [Canadian hard winter wheat]
ref|XP_007162866.1|  hypothetical protein PHAVU_001G187600g           79.3    3e-13   Phaseolus vulgaris [French bean]
gb|AHL84199.1|  starch branching enzyme 1                             73.6    3e-13   Oryza sativa Indica Group [Indian rice]
dbj|BAA82348.2|  starch branching enzyme                              79.3    3e-13   Phaseolus vulgaris [French bean]
dbj|GAC74485.1|  1,4-alpha-glucan branching enzyme/starch branchi...  79.0    3e-13   Moesziomyces antarcticus T-34
gb|ETS62400.1|  hypothetical protein PaG_03488                        79.0    3e-13   Moesziomyces aphidis DSM 70725
gb|AAB17086.1|  1,4-alpha-D-glucan 6-alpha-D-(1,4-alpha-D-glucano...  79.0    3e-13   Triticum aestivum [Canadian hard winter wheat]
ref|XP_008424574.1|  PREDICTED: 1,4-alpha-glucan-branching enzyme     79.0    3e-13   Poecilia reticulata
gb|AES81989.2|  starch branching enzyme I                             79.0    3e-13   Medicago truncatula
gb|KEH24127.1|  starch branching enzyme I                             79.0    3e-13   Medicago truncatula
gb|EYU35142.1|  hypothetical protein MIMGU_mgv1a001301mg              79.0    3e-13   Erythranthe guttata [common monkey flower]
ref|XP_003521449.1|  PREDICTED: 1,4-alpha-glucan-branching enzyme...  79.0    4e-13   Glycine max [soybeans]
emb|CDP15378.1|  unnamed protein product                              79.0    4e-13   Coffea canephora [robusta coffee]
emb|CAR95900.1|  starch branching enzyme IIa                          78.6    4e-13   Triticum aestivum [Canadian hard winter wheat]
gb|ACA35286.1|  starch branching enzyme I                             78.6    4e-13   Cucumis sativus [cucumbers]
gb|AAC69753.1|  starch branching enzyme IIa                           78.6    5e-13   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004137878.1|  PREDICTED: 1,4-alpha-glucan-branching enzyme...  78.6    5e-13   Cucumis sativus [cucumbers]
ref|XP_006071181.1|  PREDICTED: 1,4-alpha-glucan-branching enzyme...  73.2    5e-13   
ref|XP_008442810.1|  PREDICTED: 1,4-alpha-glucan-branching enzyme...  78.6    5e-13   Cucumis melo [Oriental melon]
ref|XP_004165501.1|  PREDICTED: 1,4-alpha-glucan-branching enzyme...  78.2    6e-13   
gb|ABN05322.1|  starch branching enzyme II                            78.2    7e-13   Populus trichocarpa [western balsam poplar]
dbj|BAB64912.1|  starch branching enzyme II                           78.2    7e-13   Ipomoea batatas [batate]
gb|AAT76444.1|  starch branching enzyme II                            77.8    7e-13   Vigna radiata [mung bean]
gb|EST09425.1|  1,4-alpha-glucan branching enzyme/starch branchin...  77.8    8e-13   Kalmanozyma brasiliensis GHG001
gb|AHL84206.1|  starch branching enzyme 1                             72.4    8e-13   Oryza sativa Indica Group [Indian rice]
dbj|GAC96074.1|  alpha-glucosidase                                    77.8    8e-13   Pseudozyma hubeiensis SY62
ref|XP_009122687.1|  PREDICTED: 1,4-alpha-glucan-branching enzyme...  77.8    8e-13   
ref|XP_010089398.1|  1,4-alpha-glucan-branching enzyme 2-2            77.8    1e-12   
gb|AJG44456.1|  starch branching enzyme                               77.4    1e-12   
dbj|BAB40334.1|  starch branching enzyme                              77.0    1e-12   
ref|XP_006652251.1|  PREDICTED: 1,4-alpha-glucan-branching enzyme...  77.4    1e-12   
gb|AHL84209.1|  starch branching enzyme 1                             71.6    1e-12   
ref|XP_009365356.1|  PREDICTED: 1,4-alpha-glucan-branching enzyme...  77.4    1e-12   
ref|XP_009122688.1|  PREDICTED: 1,4-alpha-glucan-branching enzyme...  77.0    1e-12   
emb|CDI55329.1|  probable branching enzyme (be1)                      77.0    1e-12   
gb|AHL84207.1|  starch branching enzyme 1                             71.6    1e-12   
ref|XP_009365357.1|  PREDICTED: 1,4-alpha-glucan-branching enzyme...  77.0    1e-12   
ref|XP_009365355.1|  PREDICTED: 1,4-alpha-glucan-branching enzyme...  77.0    1e-12   
ref|XP_004246561.1|  PREDICTED: 1,4-alpha-glucan-branching enzyme...  77.0    1e-12   
ref|XP_010325932.1|  PREDICTED: 1,4-alpha-glucan-branching enzyme...  77.0    2e-12   
emb|CAB40745.1|  starch branching enzyme II                           73.6    2e-12   
emb|CAA03846.1|  starch branching enzyme II, SBE-II                   77.0    2e-12   
ref|XP_006628303.1|  PREDICTED: 1,4-alpha-glucan-branching enzyme...  77.0    2e-12   
ref|XP_009401128.1|  PREDICTED: 1,4-alpha-glucan-branching enzyme...  76.3    2e-12   
gb|EPS64997.1|  hypothetical protein M569_09781                       75.5    2e-12   
gb|EPS64720.1|  hypothetical protein M569_10060                       75.5    2e-12   
gb|KDE03556.1|  1,4-alpha-glucan-branching enzyme                     76.6    2e-12   
ref|XP_009289774.1|  PREDICTED: 1,4-alpha-glucan-branching enzyme...  75.5    2e-12   
dbj|GAK66359.1|  glycoside hydrolase                                  76.6    2e-12   
ref|XP_010654050.1|  PREDICTED: 1,4-alpha-glucan-branching enzyme...  76.6    2e-12   
ref|XP_010654051.1|  PREDICTED: 1,4-alpha-glucan-branching enzyme...  76.6    2e-12   
ref|XP_009071686.1|  PREDICTED: 1,4-alpha-glucan-branching enzyme     75.5    2e-12   
emb|CAB40747.1|  starch branching enzyme II                           76.6    2e-12   
emb|CDX70296.1|  BnaA10g26450D                                        76.3    2e-12   
ref|XP_008307486.1|  PREDICTED: 1,4-alpha-glucan-branching enzyme     76.3    3e-12   
ref|XP_006481828.1|  PREDICTED: 1,4-alpha-glucan-branching enzyme...  76.3    3e-12   
emb|CDY10367.1|  BnaCnng02680D                                        76.3    3e-12   
gb|KDO61060.1|  hypothetical protein CISIN_1g0032301mg                76.3    3e-12   
gb|ABP96984.1|  starch branching enzyme A                             75.9    4e-12   
ref|NP_001275467.1|  1,4-alpha-glucan-branching enzyme 2-2, chlor...  75.9    4e-12   
ref|XP_010543458.1|  PREDICTED: 1,4-alpha-glucan-branching enzyme...  75.9    4e-12   
gb|KDO61055.1|  hypothetical protein CISIN_1g0032302mg                70.9    4e-12   
ref|XP_009352983.1|  PREDICTED: 1,4-alpha-glucan-branching enzyme...  75.5    4e-12   
ref|XP_009352984.1|  PREDICTED: 1,4-alpha-glucan-branching enzyme...  75.5    4e-12   
dbj|BAA82828.1|  starch branching enzyme rbe4                         75.5    5e-12   
ref|XP_010543459.1|  PREDICTED: 1,4-alpha-glucan-branching enzyme...  75.5    5e-12   
gb|KDR15603.1|  1,4-alpha-glucan-branching enzyme                     75.1    5e-12   
ref|XP_007027647.1|  Starch branching enzyme 2.1 isoform 1            75.5    5e-12   
gb|ABO31359.1|  starch branching enzyme II-2                          75.5    5e-12   
gb|AHL84200.1|  starch branching enzyme 1                             69.7    6e-12   
ref|XP_009289773.1|  PREDICTED: 1,4-alpha-glucan-branching enzyme...  75.1    6e-12   
ref|XP_005670347.1|  PREDICTED: 1,4-alpha-glucan-branching enzyme...  69.7    7e-12   
ref|XP_009403733.1|  PREDICTED: 1,4-alpha-glucan-branching enzyme...  74.7    7e-12   
gb|KDN51339.1|  glycoside hydrolase family 13 protein                 74.7    7e-12   
ref|XP_010558203.1|  PREDICTED: 1,4-alpha-glucan-branching enzyme...  74.7    7e-12   
ref|XP_004975543.1|  PREDICTED: 1,4-alpha-glucan-branching enzyme...  74.7    7e-12   
gb|AGT16902.1|  starch branching enzyme                               74.7    7e-12   
ref|XP_011466787.1|  PREDICTED: 1,4-alpha-glucan-branching enzyme...  74.7    8e-12   
ref|XP_008360546.1|  PREDICTED: 1,4-alpha-glucan-branching enzyme...  74.7    8e-12   
gb|AAB67316.1|  starch branching enzyme IIa                           74.7    8e-12   
gb|EEC77237.1|  hypothetical protein OsI_15790                        74.7    8e-12   
ref|XP_002447772.1|  hypothetical protein SORBIDRAFT_06g015360        74.7    8e-12   
tpg|DAA37956.1|  TPA: starch branching enzyme3                        74.7    8e-12   
tpg|DAA37957.1|  TPA: starch branching enzyme3                        74.7    8e-12   
gb|ABO31358.1|  starch branching enzyme II-1                          74.7    8e-12   
ref|XP_004975542.1|  PREDICTED: 1,4-alpha-glucan-branching enzyme...  74.7    8e-12   
ref|XP_006410816.1|  hypothetical protein EUTSA_v10016249mg           74.7    8e-12   
gb|AHL84203.1|  starch branching enzyme 1                             69.3    8e-12   
ref|XP_002663606.3|  PREDICTED: 1,4-alpha-glucan-branching enzyme     74.7    8e-12   
ref|XP_010558204.1|  PREDICTED: 1,4-alpha-glucan-branching enzyme...  74.7    8e-12   
ref|XP_004975541.1|  PREDICTED: 1,4-alpha-glucan-branching enzyme...  74.7    8e-12   
ref|XP_008360547.1|  PREDICTED: 1,4-alpha-glucan-branching enzyme...  74.7    8e-12   
ref|XP_006137014.1|  PREDICTED: 1,4-alpha-glucan-branching enzyme     74.3    9e-12   
emb|CAB40748.1|  starch branching enzyme II                           74.3    1e-11   
ref|XP_010558205.1|  PREDICTED: 1,4-alpha-glucan-branching enzyme...  74.3    1e-11   
ref|XP_008501511.1|  PREDICTED: LOW QUALITY PROTEIN: 1,4-alpha-gl...  74.3    1e-11   
ref|XP_010940323.1|  PREDICTED: 1,4-alpha-glucan-branching enzyme...  74.3    1e-11   
ref|XP_008241280.1|  PREDICTED: LOW QUALITY PROTEIN: 1,4-alpha-gl...  74.3    1e-11   
ref|XP_007204282.1|  hypothetical protein PRUPE_ppa001312mg           74.3    1e-11   
ref|XP_010397859.1|  PREDICTED: 1,4-alpha-glucan-branching enzyme     73.9    1e-11   
ref|XP_009405898.1|  PREDICTED: 1,4-alpha-glucan-branching enzyme...  74.3    1e-11   
ref|XP_004371433.1|  PREDICTED: 1,4-alpha-glucan-branching enzyme...  73.9    1e-11   
ref|XP_010940328.1|  PREDICTED: 1,4-alpha-glucan-branching enzyme...  73.9    1e-11   
gb|ACA26561.1|  starch branching enzyme IIb                           67.8    1e-11   
ref|XP_009064134.1|  hypothetical protein LOTGIDRAFT_195979           73.9    1e-11   
ref|XP_008669466.1|  PREDICTED: 1,4-alpha-glucan-branching enzyme...  73.9    1e-11   
ref|XP_006162668.1|  PREDICTED: 1,4-alpha-glucan-branching enzyme...  73.2    1e-11   
ref|XP_007468970.1|  PREDICTED: 1,4-alpha-glucan-branching enzyme...  73.9    2e-11   
ref|XP_008105872.1|  PREDICTED: 1,4-alpha-glucan-branching enzyme...  73.6    2e-11   
ref|XP_004440137.1|  PREDICTED: 1,4-alpha-glucan-branching enzyme...  73.6    2e-11   
ref|XP_006287076.1|  hypothetical protein CARUB_v10000235mg           73.9    2e-11   
ref|XP_005903313.1|  PREDICTED: 1,4-alpha-glucan-branching enzyme...  72.8    2e-11   
emb|CEI87953.1|  Putative Family 13 glycoside hydrolase               73.6    2e-11   
ref|XP_005308842.2|  PREDICTED: 1,4-alpha-glucan-branching enzyme     73.6    2e-11   
ref|XP_011391142.1|  putative 1,4-alpha-glucan branching enzyme       73.6    2e-11   
ref|XP_009141589.1|  PREDICTED: 1,4-alpha-glucan-branching enzyme...  73.6    2e-11   
ref|XP_006293661.1|  hypothetical protein CARUB_v10022617mg           73.6    2e-11   
ref|XP_009141588.1|  PREDICTED: 1,4-alpha-glucan-branching enzyme...  73.6    2e-11   
ref|XP_007338119.1|  glycoside hydrolase                              73.6    2e-11   
ref|XP_011434285.1|  PREDICTED: 1,4-alpha-glucan-branching enzyme...  73.2    2e-11   
ref|XP_010452258.1|  PREDICTED: LOW QUALITY PROTEIN: 1,4-alpha-gl...  73.6    2e-11   
ref|XP_006430276.1|  hypothetical protein CICLE_v10011063mg           73.6    2e-11   
ref|XP_010490856.1|  PREDICTED: 1,4-alpha-glucan-branching enzyme...  73.2    2e-11   
ref|XP_006691156.1|  1,4-alpha-glucan-branching enzyme-like protein   73.2    2e-11   
gb|EEE60949.1|  hypothetical protein OsJ_14706                        73.6    2e-11   
ref|XP_002421088.1|  1,4-alpha-glucan-branching enzyme, putative;...  73.2    2e-11   
ref|XP_010423681.1|  PREDICTED: 1,4-alpha-glucan-branching enzyme...  73.2    2e-11   
gb|KFK36343.1|  hypothetical protein AALP_AA4G110200                  73.2    3e-11   
ref|XP_007627047.1|  PREDICTED: 1,4-alpha-glucan-branching enzyme...  72.8    3e-11   
ref|XP_010423682.1|  PREDICTED: 1,4-alpha-glucan-branching enzyme...  72.8    3e-11   
emb|CCF51064.1|  probable branching enzyme (be1)                      72.8    3e-11   
ref|XP_006398822.1|  hypothetical protein EUTSA_v10012679mg           72.8    3e-11   
ref|XP_009143587.1|  PREDICTED: 1,4-alpha-glucan-branching enzyme...  72.8    3e-11   
ref|XP_005982282.1|  PREDICTED: 1,4-alpha-glucan-branching enzyme...  72.8    3e-11   
ref|XP_007646931.1|  PREDICTED: 1,4-alpha-glucan-branching enzyme...  72.8    3e-11   
ref|XP_008939966.1|  PREDICTED: 1,4-alpha-glucan-branching enzyme     72.4    3e-11   
ref|XP_006398820.1|  hypothetical protein EUTSA_v10012679mg           72.8    4e-11   
ref|XP_008524767.1|  PREDICTED: 1,4-alpha-glucan-branching enzyme     72.4    4e-11   
gb|KEI36787.1|  glycoside hydrolase family 13 protein                 72.4    4e-11   
ref|XP_007435178.1|  PREDICTED: 1,4-alpha-glucan-branching enzyme...  69.3    4e-11   
emb|CAB40744.1|  starch branching enzyme II                           69.3    4e-11   
dbj|BAD92968.1|  Glucan , branching enzyme 1 variant                  72.4    4e-11   
ref|XP_007836104.1|  1,4-alpha-glucan-branching enzyme                72.4    4e-11   
emb|CEG62793.1|  Putative 1,4-alpha-glucan-branching enzyme           72.4    4e-11   
emb|CDX75040.1|  BnaA05g07860D                                        72.4    4e-11   
ref|XP_005082110.1|  PREDICTED: 1,4-alpha-glucan-branching enzyme...  72.4    5e-11   
ref|NP_001009872.1|  1,4-alpha-glucan-branching enzyme                72.4    5e-11   
dbj|GAA96915.1|  hypothetical protein E5Q_03589                       72.4    5e-11   
ref|XP_006983667.1|  PREDICTED: 1,4-alpha-glucan-branching enzyme...  72.0    5e-11   
gb|ACA26632.1|  starch branching enzyme IIb                           66.2    5e-11   
ref|XP_008060680.1|  PREDICTED: 1,4-alpha-glucan-branching enzyme     71.6    5e-11   
ref|XP_007082067.1|  PREDICTED: 1,4-alpha-glucan-branching enzyme...  72.0    5e-11   
emb|CEI86686.1|  Putative 1,4-alpha-glucan branching enzyme           72.0    5e-11   
ref|XP_007120625.1|  PREDICTED: 1,4-alpha-glucan-branching enzyme...  71.2    5e-11   
emb|CDY43722.1|  BnaAnng07370D                                        72.4    5e-11   
ref|XP_005375597.1|  PREDICTED: 1,4-alpha-glucan-branching enzyme...  72.0    5e-11   
gb|ABH10996.1|  1,4 alpha-glucan branching enzyme                     67.4    6e-11   
emb|CCN27374.1|  1,4-alpha-glucan-branching enzyme                    72.0    6e-11   
ref|XP_516593.2|  PREDICTED: 1,4-alpha-glucan-branching enzyme        72.0    6e-11   
ref|XP_007984368.1|  PREDICTED: 1,4-alpha-glucan-branching enzyme     72.0    6e-11   
ref|XP_005027729.1|  PREDICTED: 1,4-alpha-glucan-branching enzyme...  72.0    6e-11   
ref|XP_010899847.1|  PREDICTED: 1,4-alpha-glucan-branching enzyme...  71.6    6e-11   
ref|XP_002871050.1|  1, 4-alpha-glucan branching enzyme protein s...  72.0    6e-11   
ref|XP_010222496.1|  PREDICTED: 1,4-alpha-glucan-branching enzyme     72.0    6e-11   
ref|NP_001075409.1|  1,4-alpha-glucan-branching enzyme                71.6    6e-11   
ref|XP_005998109.1|  PREDICTED: 1,4-alpha-glucan-branching enzyme...  71.6    6e-11   
ref|XP_006874807.1|  PREDICTED: 1,4-alpha-glucan-branching enzyme...  71.6    7e-11   
gb|KHN02248.1|  1,4-alpha-glucan-branching enzyme 2-2, chloroplas...  72.0    7e-11   
ref|XP_008927611.1|  PREDICTED: 1,4-alpha-glucan-branching enzyme     71.6    7e-11   
gb|ABK91832.1|  1,4-alpha-glucan starch branching enzyme              67.8    7e-11   
ref|XP_010842640.1|  PREDICTED: 1,4-alpha-glucan-branching enzyme     71.6    7e-11   
ref|NP_001116201.1|  1,4-alpha-glucan-branching enzyme                71.6    7e-11   
ref|XP_005674844.1|  PREDICTED: 1,4-alpha-glucan-branching enzyme     71.6    7e-11   
ref|XP_004002884.1|  PREDICTED: 1,4-alpha-glucan-branching enzyme     71.6    7e-11   
gb|ACI03581.1|  RE12027p                                              71.2    8e-11   
ref|XP_002732853.1|  PREDICTED: 1,4-alpha-glucan-branching enzyme...  71.6    8e-11   
ref|XP_005998107.1|  PREDICTED: 1,4-alpha-glucan-branching enzyme...  71.6    8e-11   
gb|AAL39464.1|  LD03583p                                              71.2    8e-11   
ref|XP_005511490.1|  PREDICTED: 1,4-alpha-glucan-branching enzyme     71.2    8e-11   
ref|XP_002761354.1|  PREDICTED: 1,4-alpha-glucan-branching enzyme     70.9    8e-11   
gb|ACA26531.1|  starch branching enzyme IIb                           65.5    8e-11   
gb|AHL84214.1|  starch branching enzyme 1                             66.2    9e-11   
emb|CDX84127.1|  BnaC04g08890D                                        71.6    9e-11   
ref|XP_008783983.1|  PREDICTED: 1,4-alpha-glucan-branching enzyme...  71.2    9e-11   
gb|ACA26693.1|  starch branching enzyme IIb                           65.1    1e-10   
dbj|BAE91249.1|  unnamed protein product                              70.9    1e-10   
ref|XP_004075575.1|  PREDICTED: 1,4-alpha-glucan-branching enzyme     71.2    1e-10   
ref|XP_009196475.1|  PREDICTED: 1,4-alpha-glucan-branching enzyme...  70.9    1e-10   
ref|XP_004607049.1|  PREDICTED: 1,4-alpha-glucan-branching enzyme...  71.2    1e-10   
dbj|BAG60255.1|  unnamed protein product                              70.9    1e-10   
ref|XP_002813449.3|  PREDICTED: 1,4-alpha-glucan-branching enzyme...  67.8    1e-10   
emb|CAG12774.1|  unnamed protein product                              70.9    1e-10   
gb|ACA26692.1|  starch branching enzyme IIb                           65.1    1e-10   
ref|XP_002033662.1|  GM21447                                          70.9    1e-10   
gb|AGW30431.1|  FI23925p1                                             70.9    1e-10   
ref|XP_002090952.1|  GE12519                                          70.9    1e-10   
ref|XP_001975810.1|  GG20360                                          70.9    1e-10   
gb|ACA26559.1|  starch branching enzyme IIb                           64.7    1e-10   
emb|CCO27317.1|  1,4-alpha-glucan branching enzyme                    66.2    1e-10   
ref|NP_788342.1|  1,4-Alpha-Glucan branching enzyme                   70.9    1e-10   
ref|XP_003410235.1|  PREDICTED: 1,4-alpha-glucan-branching enzyme     70.9    1e-10   
ref|XP_004325125.1|  PREDICTED: 1,4-alpha-glucan-branching enzyme...  70.1    1e-10   
ref|XP_002081295.1|  GD10945                                          70.5    1e-10   
ref|XP_005345288.1|  PREDICTED: 1,4-alpha-glucan-branching enzyme...  70.5    2e-10   
ref|XP_004354074.1|  glucan (1,4alpha-), branching enzyme 1, puta...  70.5    2e-10   
ref|XP_004665569.1|  PREDICTED: 1,4-alpha-glucan-branching enzyme...  70.5    2e-10   
gb|ACA26682.1|  starch branching enzyme IIb                           64.7    2e-10   
ref|XP_003783972.1|  PREDICTED: 1,4-alpha-glucan-branching enzyme     70.5    2e-10   
gb|AAH90037.1|  Gbe1 protein                                          70.5    2e-10   
gb|KFK24828.1|  hypothetical protein AALP_AA8G030400                  70.5    2e-10   
dbj|BAK06172.1|  predicted protein                                    65.1    2e-10   
ref|XP_005038883.1|  PREDICTED: 1,4-alpha-glucan-branching enzyme     70.1    2e-10   
ref|XP_010049752.1|  PREDICTED: 1,4-alpha-glucan-branching enzyme...  70.5    2e-10   
ref|XP_009272769.1|  PREDICTED: 1,4-alpha-glucan-branching enzyme     70.1    2e-10   
gb|EYC02842.1|  hypothetical protein Y032_0097g2968                   66.6    2e-10   
ref|NP_001086521.1|  glucan (1,4-alpha-), branching enzyme 1 (gly...  70.1    2e-10   
emb|CDR41381.1|  CYFA0S07e01398g1_1                                   70.1    2e-10   
ref|XP_010509476.1|  PREDICTED: 1,4-alpha-glucan-branching enzyme...  70.1    2e-10   
ref|XP_004870643.1|  PREDICTED: 1,4-alpha-glucan-branching enzyme...  70.1    2e-10   
ref|XP_004035964.1|  PREDICTED: 1,4-alpha-glucan-branching enzyme     70.1    2e-10   
ref|XP_001959638.1|  GF11944                                          70.1    2e-10   
ref|XP_002063437.1|  GK21909                                          70.1    2e-10   
gb|KIH43875.1|  alpha amylase, all-beta domain protein                66.6    2e-10   
ref|XP_003893849.1|  PREDICTED: 1,4-alpha-glucan-branching enzyme...  70.1    2e-10   
gb|EHH50944.1|  hypothetical protein EGM_10251                        70.1    2e-10   
ref|XP_003469368.1|  PREDICTED: 1,4-alpha-glucan-branching enzyme     70.1    2e-10   
gb|AAA58642.1|  1,4-alpha-glucan branching enzyme                     70.1    2e-10   
ref|XP_002960231.1|  hypothetical protein SELMODRAFT_437348           70.1    2e-10   
pdb|4BZY|A  Chain A, Crystal Structure Of Human Glycogen Branchin...  70.1    2e-10   
dbj|BAG54265.1|  unnamed protein product                              70.1    3e-10   
ref|NP_000149.3|  1,4-alpha-glucan-branching enzyme                   70.1    3e-10   
sp|Q04446.3|GLGB_HUMAN  RecName: Full=1,4-alpha-glucan-branching ...  70.1    3e-10   
ref|NP_001093972.1|  1,4-alpha-glucan-branching enzyme                70.1    3e-10   
ref|XP_010049760.1|  PREDICTED: 1,4-alpha-glucan-branching enzyme...  70.1    3e-10   
ref|XP_005548470.1|  PREDICTED: 1,4-alpha-glucan-branching enzyme     70.1    3e-10   
ref|XP_005324361.1|  PREDICTED: LOW QUALITY PROTEIN: 1,4-alpha-gl...  70.1    3e-10   
ref|XP_010720328.1|  PREDICTED: 1,4-alpha-glucan-branching enzyme...  69.3    3e-10   
ref|XP_004280480.1|  PREDICTED: 1,4-alpha-glucan-branching enzyme...  69.7    3e-10   
ref|XP_004634896.1|  PREDICTED: 1,4-alpha-glucan-branching enzyme...  69.7    3e-10   
ref|XP_011191634.1|  PREDICTED: 1,4-alpha-glucan-branching enzyme     69.7    3e-10   
ref|XP_008830446.1|  PREDICTED: 1,4-alpha-glucan-branching enzyme     69.7    3e-10   
ref|NP_001253216.1|  1,4-alpha-glucan-branching enzyme                69.7    3e-10   
dbj|BAG62313.1|  unnamed protein product                              69.7    3e-10   
ref|XP_010863159.1|  PREDICTED: 1,4-alpha-glucan-branching enzyme     69.7    3e-10   
ref|XP_010354369.1|  PREDICTED: 1,4-alpha-glucan-branching enzyme     69.7    3e-10   
ref|XP_003807453.1|  PREDICTED: 1,4-alpha-glucan-branching enzyme     69.7    3e-10   
gb|KGU04280.1|  1,4-alpha-glucan branching enzyme                     69.7    3e-10   



>dbj|BAE96953.1| starch branching enzyme I [Ipomoea batatas]
Length=875

 Score =   293 bits (751),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 152/174 (87%), Positives = 158/174 (91%), Gaps = 10/174 (6%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFHPENTYEGYKVGCDLPGKY+VALDSDAW +GGHGRVGHDV+HFTSPEGIPGV E
Sbjct  692  VFVFNFHPENTYEGYKVGCDLPGKYQVALDSDAWVFGGHGRVGHDVDHFTSPEGIPGVAE  751

Query  563  TNFNGRPNSFKVLSPPQACVAYYRVEESLDEVQD---SSFTETISTNLVLVSDDIDDLQE  393
            TNFNGRPNSFKVLSPPQACVAYYRVEESLDEVQD   +SFTETISTNLVLVSD  DDLQE
Sbjct  752  TNFNGRPNSFKVLSPPQACVAYYRVEESLDEVQDEQPASFTETISTNLVLVSD--DDLQE  809

Query  392  LPTENLQELPTMGNSDDVDDLQDLAAMGNS--DDLQELGSVANSISDVGQRKVQ  237
            LPTENLQELP +GNS DVD LQDL AMGNS  DDLQELG+VAN  SDVGQ KVQ
Sbjct  810  LPTENLQELPKVGNS-DVDGLQDLPAMGNSDVDDLQELGTVAN--SDVGQSKVQ  860



>dbj|BAE96955.1| starch branching enzyme I [Ipomoea batatas]
Length=875

 Score =   293 bits (751),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 152/174 (87%), Positives = 158/174 (91%), Gaps = 10/174 (6%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFHPENTYEGYKVGCDLPGKY+VALDSDAW +GGHGRVGHDV+HFTSPEGIPGV E
Sbjct  692  VFVFNFHPENTYEGYKVGCDLPGKYQVALDSDAWVFGGHGRVGHDVDHFTSPEGIPGVAE  751

Query  563  TNFNGRPNSFKVLSPPQACVAYYRVEESLDEVQD---SSFTETISTNLVLVSDDIDDLQE  393
            TNFNGRPNSFKVLSPPQACVAYYRVEESLDEVQD   +SFTETISTNLVLVSD  DDLQE
Sbjct  752  TNFNGRPNSFKVLSPPQACVAYYRVEESLDEVQDEQPASFTETISTNLVLVSD--DDLQE  809

Query  392  LPTENLQELPTMGNSDDVDDLQDLAAMGNS--DDLQELGSVANSISDVGQRKVQ  237
            LPTENLQELP +GNS DVD LQDL AMGNS  DDLQELG+VAN  SDVGQ KVQ
Sbjct  810  LPTENLQELPKVGNS-DVDGLQDLPAMGNSDVDDLQELGTVAN--SDVGQSKVQ  860



>dbj|BAE96956.1| starch branching enzyme I [Ipomoea batatas]
Length=875

 Score =   293 bits (751),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 152/174 (87%), Positives = 158/174 (91%), Gaps = 10/174 (6%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFHPENTYEGYKVGCDLPGKY+VALDSDAW +GGHGRVGHDV+HFTSPEGIPGV E
Sbjct  692  VFVFNFHPENTYEGYKVGCDLPGKYQVALDSDAWVFGGHGRVGHDVDHFTSPEGIPGVAE  751

Query  563  TNFNGRPNSFKVLSPPQACVAYYRVEESLDEVQD---SSFTETISTNLVLVSDDIDDLQE  393
            TNFNGRPNSFKVLSPPQACVAYYRVEESLDEVQD   +SFTETISTNLVLVSD  DDLQE
Sbjct  752  TNFNGRPNSFKVLSPPQACVAYYRVEESLDEVQDEQPASFTETISTNLVLVSD--DDLQE  809

Query  392  LPTENLQELPTMGNSDDVDDLQDLAAMGNS--DDLQELGSVANSISDVGQRKVQ  237
            LPTENLQELP +GNS DVD LQDL AMGNS  DDLQELG+VAN  SDVGQ KVQ
Sbjct  810  LPTENLQELPKVGNS-DVDGLQDLPAMGNSDVDDLQELGTVAN--SDVGQSKVQ  860



>dbj|BAE96954.1| starch branching enzyme I [Ipomoea batatas]
Length=875

 Score =   293 bits (751),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 152/174 (87%), Positives = 158/174 (91%), Gaps = 10/174 (6%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFHPENTYEGYKVGCDLPGKY+VALDSDAW +GGHGRVGHDV+HFTSPEGIPGV E
Sbjct  692  VFVFNFHPENTYEGYKVGCDLPGKYQVALDSDAWVFGGHGRVGHDVDHFTSPEGIPGVAE  751

Query  563  TNFNGRPNSFKVLSPPQACVAYYRVEESLDEVQD---SSFTETISTNLVLVSDDIDDLQE  393
            TNFNGRPNSFKVLSPPQACVAYYRVEESLDEVQD   +SFTETISTNLVLVSD  DDLQE
Sbjct  752  TNFNGRPNSFKVLSPPQACVAYYRVEESLDEVQDEQPASFTETISTNLVLVSD--DDLQE  809

Query  392  LPTENLQELPTMGNSDDVDDLQDLAAMGNS--DDLQELGSVANSISDVGQRKVQ  237
            LPTENLQELP +GNS DVD LQDL AMGNS  DDLQELG+VAN  SDVGQ KVQ
Sbjct  810  LPTENLQELPKVGNS-DVDGLQDLPAMGNSDVDDLQELGTVAN--SDVGQSKVQ  860



>dbj|BAE96952.1| starch branching enzyme I [Ipomoea batatas]
Length=875

 Score =   293 bits (751),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 152/174 (87%), Positives = 158/174 (91%), Gaps = 10/174 (6%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFHPENTYEGYKVGCDLPGKY+VALDSDAW +GGHGRVGHDV+HFTSPEGIPGV E
Sbjct  692  VFVFNFHPENTYEGYKVGCDLPGKYQVALDSDAWVFGGHGRVGHDVDHFTSPEGIPGVAE  751

Query  563  TNFNGRPNSFKVLSPPQACVAYYRVEESLDEVQD---SSFTETISTNLVLVSDDIDDLQE  393
            TNFNGRPNSFKVLSPPQACVAYYRVEESLDEVQD   +SFTETISTNLVLVSD  DDLQE
Sbjct  752  TNFNGRPNSFKVLSPPQACVAYYRVEESLDEVQDEQPASFTETISTNLVLVSD--DDLQE  809

Query  392  LPTENLQELPTMGNSDDVDDLQDLAAMGNS--DDLQELGSVANSISDVGQRKVQ  237
            LPTENLQELP +GNS DVD LQDL AMGNS  DDLQELG+VAN  SDVGQ KVQ
Sbjct  810  LPTENLQELPKVGNS-DVDGLQDLPAMGNSDVDDLQELGTVAN--SDVGQSKVQ  860



>ref|XP_002439058.1| hypothetical protein SORBIDRAFT_10g030773 [Sorghum bicolor]
 gb|EER90425.1| hypothetical protein SORBIDRAFT_10g030773 [Sorghum bicolor]
Length=164

 Score =   180 bits (457),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 84/121 (69%), Positives = 96/121 (79%), Gaps = 4/121 (3%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFHP+ TY+GYKVGCDLPGKYRVALDSDA+ +GGHGRVGHDV+HFTSPEGIPGVPE
Sbjct  12   VFVFNFHPKKTYDGYKVGCDLPGKYRVALDSDAFVFGGHGRVGHDVDHFTSPEGIPGVPE  71

Query  563  TNFNGRPNSFKVLSPPQACVAYYRVEESLDEVQDSSFTETISTNLVLVSDDIDDLQELPT  384
            TNFN RPNSFKVLSPP+ CVAYYRV+E  + +Q  + T    T     S DI D+   P 
Sbjct  72   TNFNNRPNSFKVLSPPRTCVAYYRVDEEAERLQAKAET----TGSRKTSPDIIDVDATPV  127

Query  383  E  381
            +
Sbjct  128  K  128



>gb|ABK80499.1| putative starch branching enzyme I, partial [Sorghum bicolor]
 gb|ABK80500.1| putative starch branching enzyme I, partial [Sorghum bicolor]
 gb|ABK80501.1| putative starch branching enzyme I, partial [Sorghum bicolor]
 gb|ABK80502.1| putative starch branching enzyme I, partial [Sorghum bicolor]
 gb|ABK80503.1| putative starch branching enzyme I, partial [Sorghum bicolor]
 gb|ABK80504.1| putative starch branching enzyme I, partial [Sorghum bicolor]
 gb|ABK80505.1| putative starch branching enzyme I, partial [Sorghum bicolor]
 gb|ABK80506.1| putative starch branching enzyme I, partial [Sorghum bicolor]
 gb|ABK80507.1| putative starch branching enzyme I, partial [Sorghum bicolor]
 gb|ABK80508.1| putative starch branching enzyme I, partial [Sorghum bicolor]
 gb|ABK80509.1| putative starch branching enzyme I, partial [Sorghum bicolor]
 gb|ABK80510.1| putative starch branching enzyme I, partial [Sorghum bicolor]
 gb|ABK80511.1| putative starch branching enzyme I, partial [Sorghum bicolor]
 gb|ABK80512.1| putative starch branching enzyme I, partial [Sorghum bicolor]
 gb|ABK80513.1| putative starch branching enzyme I, partial [Sorghum bicolor]
 gb|ABK80514.1| putative starch branching enzyme I, partial [Sorghum bicolor]
 gb|ABK80515.1| putative starch branching enzyme I, partial [Sorghum bicolor]
 gb|ABK80516.1| putative starch branching enzyme I, partial [Sorghum bicolor]
 gb|ABK80517.1| putative starch branching enzyme I, partial [Sorghum bicolor]
 gb|ABK80518.1| putative starch branching enzyme I, partial [Sorghum bicolor]
 gb|ABK80519.1| putative starch branching enzyme I, partial [Sorghum bicolor]
 gb|ABK80520.1| putative starch branching enzyme I, partial [Sorghum bicolor]
 gb|ABK80521.1| putative starch branching enzyme I, partial [Sorghum bicolor]
Length=162

 Score =   180 bits (456),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 84/121 (69%), Positives = 96/121 (79%), Gaps = 4/121 (3%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFHP+ TY+GYKVGCDLPGKYRVALDSDA+ +GGHGRVGHDV+HFTSPEGIPGVPE
Sbjct  10   VFVFNFHPKKTYDGYKVGCDLPGKYRVALDSDAFVFGGHGRVGHDVDHFTSPEGIPGVPE  69

Query  563  TNFNGRPNSFKVLSPPQACVAYYRVEESLDEVQDSSFTETISTNLVLVSDDIDDLQELPT  384
            TNFN RPNSFKVLSPP+ CVAYYRV+E  + +Q  + T    T     S DI D+   P 
Sbjct  70   TNFNNRPNSFKVLSPPRTCVAYYRVDEEAERLQAKAET----TGSRKTSPDIIDVDATPV  125

Query  383  E  381
            +
Sbjct  126  K  126



>emb|CAA70038.1| 1,4-alpha-glucan branching enzyme [Solanum tuberosum]
Length=830

 Score =   186 bits (473),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 87/125 (70%), Positives = 98/125 (78%), Gaps = 14/125 (11%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFHP+NTYEGYKVGCDLPGKYRVALDSDAW +GGHGR GHDV+HFTSPEGIPGVPE
Sbjct  619  VFVFNFHPKNTYEGYKVGCDLPGKYRVALDSDAWEFGGHGRTGHDVDHFTSPEGIPGVPE  678

Query  563  TNFNGRPNSFKVLSPPQACVAYYRVEESLDEVQDSSFTETISTNLVLVSDDIDDLQELPT  384
            TNFNGRPNSFKVLSP + CVAYYRV+E + E +D  +   I + L            LPT
Sbjct  679  TNFNGRPNSFKVLSPARTCVAYYRVDERMSETED--YQTDICSEL------------LPT  724

Query  383  ENLQE  369
             N++E
Sbjct  725  ANIEE  729



>gb|AGZ13546.1| starch branching enzyme I, partial [Malus transitoria]
 gb|AGZ13581.1| starch branching enzyme I, partial [Malus toringoides]
Length=107

 Score =   172 bits (435),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 76/88 (86%), Positives = 81/88 (92%), Gaps = 0/88 (0%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFHP NTYEGYKVGCDLPGKYRVALDSDAW +GGHGRVGH+V+HFT PEGIPGVPE
Sbjct  20   VFVFNFHPRNTYEGYKVGCDLPGKYRVALDSDAWGFGGHGRVGHNVDHFTFPEGIPGVPE  79

Query  563  TNFNGRPNSFKVLSPPQACVAYYRVEES  480
            TNFN RPNSFK+LSP Q CV YYRV+ES
Sbjct  80   TNFNNRPNSFKILSPAQTCVVYYRVDES  107



>gb|AGZ13540.1| starch branching enzyme I, partial [Malus transitoria]
 gb|AGZ13541.1| starch branching enzyme I, partial [Malus transitoria]
 gb|AGZ13593.1| starch branching enzyme I, partial [Malus setok]
 gb|AGZ13602.1| starch branching enzyme I, partial [Malus maerkangensis]
 gb|AGZ13615.1| starch branching enzyme I, partial [Malus baccata var. xiaojinensis]
Length=108

 Score =   172 bits (435),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 76/88 (86%), Positives = 81/88 (92%), Gaps = 0/88 (0%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFHP NTYEGYKVGCDLPGKYRVALDSDAW +GGHGRVGH+V+HFT PEGIPGVPE
Sbjct  20   VFVFNFHPRNTYEGYKVGCDLPGKYRVALDSDAWGFGGHGRVGHNVDHFTFPEGIPGVPE  79

Query  563  TNFNGRPNSFKVLSPPQACVAYYRVEES  480
            TNFN RPNSFK+LSP Q CV YYRV+ES
Sbjct  80   TNFNNRPNSFKILSPAQTCVVYYRVDES  107



>gb|AGZ13580.1| starch branching enzyme I, partial [Malus toringoides]
Length=107

 Score =   172 bits (435),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 76/88 (86%), Positives = 81/88 (92%), Gaps = 0/88 (0%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFHP NTYEGYKVGCDLPGKYRVALDSDAW +GGHGRVGH+V+HFT PEGIPGVPE
Sbjct  19   VFVFNFHPRNTYEGYKVGCDLPGKYRVALDSDAWGFGGHGRVGHNVDHFTFPEGIPGVPE  78

Query  563  TNFNGRPNSFKVLSPPQACVAYYRVEES  480
            TNFN RPNSFK+LSP Q CV YYRV+ES
Sbjct  79   TNFNNRPNSFKILSPAQTCVVYYRVDES  106



>gb|AGZ13608.1| starch branching enzyme I, partial [Malus baccata var. xiaojinensis]
Length=107

 Score =   171 bits (434),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 76/88 (86%), Positives = 81/88 (92%), Gaps = 0/88 (0%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFHP NTYEGYKVGCDLPGKYRVALDSDAW +GGHGRVGH+V+HFT PEGIPGVPE
Sbjct  20   VFVFNFHPRNTYEGYKVGCDLPGKYRVALDSDAWEFGGHGRVGHNVDHFTFPEGIPGVPE  79

Query  563  TNFNGRPNSFKVLSPPQACVAYYRVEES  480
            TNFN RPNSFK+LSP Q CV YYRV+ES
Sbjct  80   TNFNNRPNSFKILSPAQTCVVYYRVDES  107



>gb|AGZ13594.1| starch branching enzyme I, partial [Malus setok]
 gb|AGZ13599.1| starch branching enzyme I, partial [Malus maerkangensis]
 gb|AGZ13600.1| starch branching enzyme I, partial [Malus maerkangensis]
 gb|AGZ13603.1| starch branching enzyme I, partial [Malus maerkangensis]
 gb|AGZ13614.1| starch branching enzyme I, partial [Malus baccata var. xiaojinensis]
 gb|AGZ13616.1| starch branching enzyme I, partial [Malus baccata var. xiaojinensis]
Length=108

 Score =   171 bits (434),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 76/88 (86%), Positives = 81/88 (92%), Gaps = 0/88 (0%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFHP NTYEGYKVGCDLPGKYRVALDSDAW +GGHGRVGH+V+HFT PEGIPGVPE
Sbjct  20   VFVFNFHPRNTYEGYKVGCDLPGKYRVALDSDAWEFGGHGRVGHNVDHFTFPEGIPGVPE  79

Query  563  TNFNGRPNSFKVLSPPQACVAYYRVEES  480
            TNFN RPNSFK+LSP Q CV YYRV+ES
Sbjct  80   TNFNNRPNSFKILSPAQTCVVYYRVDES  107



>gb|AGZ13591.1| starch branching enzyme I, partial [Malus setok]
 gb|AGZ13592.1| starch branching enzyme I, partial [Malus setok]
Length=108

 Score =   171 bits (432),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 75/88 (85%), Positives = 81/88 (92%), Gaps = 0/88 (0%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFHP NTYEGYKVGCDLPGKYRVALDSDAW +GGHG+VGH+V+HFT PEGIPGVPE
Sbjct  20   VFVFNFHPRNTYEGYKVGCDLPGKYRVALDSDAWGFGGHGKVGHNVDHFTFPEGIPGVPE  79

Query  563  TNFNGRPNSFKVLSPPQACVAYYRVEES  480
            TNFN RPNSFK+LSP Q CV YYRV+ES
Sbjct  80   TNFNNRPNSFKILSPAQTCVVYYRVDES  107



>gb|AGZ13612.1| starch branching enzyme I, partial [Malus baccata var. xiaojinensis]
Length=106

 Score =   170 bits (431),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 75/87 (86%), Positives = 80/87 (92%), Gaps = 0/87 (0%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFHP NTYEGYKVGCDLPGKYRVALDSDAW +GGHGRVGH+V+HFT PEGIPGVPE
Sbjct  20   VFVFNFHPRNTYEGYKVGCDLPGKYRVALDSDAWGFGGHGRVGHNVDHFTFPEGIPGVPE  79

Query  563  TNFNGRPNSFKVLSPPQACVAYYRVEE  483
            TNFN RPNSFK+LSP Q CV YYRV+E
Sbjct  80   TNFNNRPNSFKILSPAQTCVVYYRVDE  106



>gb|AGZ13571.1| starch branching enzyme I, partial [Malus toringoides]
 gb|AGZ13572.1| starch branching enzyme I, partial [Malus toringoides]
Length=104

 Score =   170 bits (430),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 75/87 (86%), Positives = 80/87 (92%), Gaps = 0/87 (0%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFHP NTYEGYKVGCDLPGKYRVALDSDAW +GGHGRVGH+V+HFT PEGIPGVPE
Sbjct  18   VFVFNFHPRNTYEGYKVGCDLPGKYRVALDSDAWGFGGHGRVGHNVDHFTFPEGIPGVPE  77

Query  563  TNFNGRPNSFKVLSPPQACVAYYRVEE  483
            TNFN RPNSFK+LSP Q CV YYRV+E
Sbjct  78   TNFNNRPNSFKILSPAQTCVVYYRVDE  104



>gb|AGZ13573.1| starch branching enzyme I, partial [Malus toringoides]
 gb|AGZ13611.1| starch branching enzyme I, partial [Malus baccata var. xiaojinensis]
 gb|AGZ13613.1| starch branching enzyme I, partial [Malus baccata var. xiaojinensis]
Length=106

 Score =   170 bits (430),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 75/87 (86%), Positives = 80/87 (92%), Gaps = 0/87 (0%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFHP NTYEGYKVGCDLPGKYRVALDSDAW +GGHGRVGH+V+HFT PEGIPGVPE
Sbjct  20   VFVFNFHPRNTYEGYKVGCDLPGKYRVALDSDAWEFGGHGRVGHNVDHFTFPEGIPGVPE  79

Query  563  TNFNGRPNSFKVLSPPQACVAYYRVEE  483
            TNFN RPNSFK+LSP Q CV YYRV+E
Sbjct  80   TNFNNRPNSFKILSPAQTCVVYYRVDE  106



>gb|AGZ13539.1| starch branching enzyme I, partial [Malus transitoria]
Length=100

 Score =   169 bits (428),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 75/87 (86%), Positives = 80/87 (92%), Gaps = 0/87 (0%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFHP NTYEGYKVGCDLPGKYRVALDSDAW +GGHGRVGH+V+HFT PEGIPGVPE
Sbjct  14   VFVFNFHPRNTYEGYKVGCDLPGKYRVALDSDAWGFGGHGRVGHNVDHFTFPEGIPGVPE  73

Query  563  TNFNGRPNSFKVLSPPQACVAYYRVEE  483
            TNFN RPNSFK+LSP Q CV YYRV+E
Sbjct  74   TNFNNRPNSFKILSPAQTCVVYYRVDE  100



>gb|ACF79369.1| unknown [Zea mays]
Length=244

 Score =   174 bits (440),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 76/88 (86%), Positives = 83/88 (94%), Gaps = 0/88 (0%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFHP+ TYEGYKVGCDLPGKYRVALDSDA  +GGHGRVGHDV+HFTSPEG+PGVPE
Sbjct  101  VFVFNFHPKKTYEGYKVGCDLPGKYRVALDSDALVFGGHGRVGHDVDHFTSPEGVPGVPE  160

Query  563  TNFNGRPNSFKVLSPPQACVAYYRVEES  480
            TNFN RPNSFKVLSPP+ CVAYYRV+E+
Sbjct  161  TNFNNRPNSFKVLSPPRTCVAYYRVDEA  188



>gb|KJB29684.1| hypothetical protein B456_005G113800 [Gossypium raimondii]
Length=849

 Score =   182 bits (462),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 92/164 (56%), Positives = 116/164 (71%), Gaps = 10/164 (6%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFHPENTY+GYKVGCDLPGKYRVALDSDAW +GGHGRVGHDV+HFTSPEGIPGVPE
Sbjct  664  VFVFNFHPENTYDGYKVGCDLPGKYRVALDSDAWEFGGHGRVGHDVDHFTSPEGIPGVPE  723

Query  563  TNFNGRPNSFKVLSPPQACVAYYRVEESLDEVQDSSFTETISTNLVLVSD--DIDDLQEL  390
            TNFN RPNSFKVLSP + CV YY+V+ES++        ET   N++ VS+  ++D  ++ 
Sbjct  724  TNFNNRPNSFKVLSPARTCVVYYKVDESVE--------ETNGINVISVSETLEMDASKQK  775

Query  389  PTENLQELPTMGNSDDVDDLQDLAAMGNSDDLQELGSVANSISD  258
              E    L   G+ ++  +  D       ++LQ+ G+   SI +
Sbjct  776  NAEESAILVDHGDKENPQETTDRDTSSFDEELQKDGAKQESIEE  819



>gb|KJB29682.1| hypothetical protein B456_005G113800 [Gossypium raimondii]
Length=873

 Score =   182 bits (462),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 92/164 (56%), Positives = 116/164 (71%), Gaps = 10/164 (6%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFHPENTY+GYKVGCDLPGKYRVALDSDAW +GGHGRVGHDV+HFTSPEGIPGVPE
Sbjct  688  VFVFNFHPENTYDGYKVGCDLPGKYRVALDSDAWEFGGHGRVGHDVDHFTSPEGIPGVPE  747

Query  563  TNFNGRPNSFKVLSPPQACVAYYRVEESLDEVQDSSFTETISTNLVLVSD--DIDDLQEL  390
            TNFN RPNSFKVLSP + CV YY+V+ES++        ET   N++ VS+  ++D  ++ 
Sbjct  748  TNFNNRPNSFKVLSPARTCVVYYKVDESVE--------ETNGINVISVSETLEMDASKQK  799

Query  389  PTENLQELPTMGNSDDVDDLQDLAAMGNSDDLQELGSVANSISD  258
              E    L   G+ ++  +  D       ++LQ+ G+   SI +
Sbjct  800  NAEESAILVDHGDKENPQETTDRDTSSFDEELQKDGAKQESIEE  843



>gb|AGZ13606.1| starch branching enzyme I, partial [Malus maerkangensis]
Length=102

 Score =   168 bits (425),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 74/86 (86%), Positives = 79/86 (92%), Gaps = 0/86 (0%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFHP NTYEGYKVGCDLPGKYRVALDSDAW +GGHGRVGH+V+HFT PEGIPGVPE
Sbjct  17   VFVFNFHPRNTYEGYKVGCDLPGKYRVALDSDAWGFGGHGRVGHNVDHFTFPEGIPGVPE  76

Query  563  TNFNGRPNSFKVLSPPQACVAYYRVE  486
            TNFN RPNSFK+LSP Q CV YYRV+
Sbjct  77   TNFNNRPNSFKILSPAQTCVVYYRVD  102



>gb|AGZ13542.1| starch branching enzyme I, partial [Malus transitoria]
 gb|AGZ13543.1| starch branching enzyme I, partial [Malus transitoria]
 gb|AGZ13601.1| starch branching enzyme I, partial [Malus maerkangensis]
Length=102

 Score =   167 bits (424),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 74/85 (87%), Positives = 78/85 (92%), Gaps = 0/85 (0%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFHP NTYEGYKVGCDLPGKYRVALDSDAW +GGHGRVGH+V+HFT PEGIPGVPE
Sbjct  18   VFVFNFHPRNTYEGYKVGCDLPGKYRVALDSDAWGFGGHGRVGHNVDHFTFPEGIPGVPE  77

Query  563  TNFNGRPNSFKVLSPPQACVAYYRV  489
            TNFN RPNSFK+LSP Q CV YYRV
Sbjct  78   TNFNNRPNSFKILSPAQTCVVYYRV  102



>gb|AGZ13538.1| starch branching enzyme I, partial [Malus transitoria]
 gb|AGZ13563.1| starch branching enzyme I, partial [Malus toringoides]
 gb|AGZ13566.1| starch branching enzyme I, partial [Malus toringoides]
 gb|AGZ13618.1| starch branching enzyme I, partial [Malus baccata var. xiaojinensis]
Length=101

 Score =   167 bits (424),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 74/85 (87%), Positives = 78/85 (92%), Gaps = 0/85 (0%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFHP NTYEGYKVGCDLPGKYRVALDSDAW +GGHGRVGH+V+HFT PEGIPGVPE
Sbjct  17   VFVFNFHPRNTYEGYKVGCDLPGKYRVALDSDAWGFGGHGRVGHNVDHFTFPEGIPGVPE  76

Query  563  TNFNGRPNSFKVLSPPQACVAYYRV  489
            TNFN RPNSFK+LSP Q CV YYRV
Sbjct  77   TNFNNRPNSFKILSPAQTCVVYYRV  101



>gb|AGZ13605.1| starch branching enzyme I, partial [Malus maerkangensis]
 gb|AGZ13607.1| starch branching enzyme I, partial [Malus maerkangensis]
Length=102

 Score =   167 bits (424),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 74/86 (86%), Positives = 79/86 (92%), Gaps = 0/86 (0%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFHP NTYEGYKVGCDLPGKYRVALDSDAW +GGHGRVGH+V+HFT PEGIPGVPE
Sbjct  17   VFVFNFHPRNTYEGYKVGCDLPGKYRVALDSDAWEFGGHGRVGHNVDHFTFPEGIPGVPE  76

Query  563  TNFNGRPNSFKVLSPPQACVAYYRVE  486
            TNFN RPNSFK+LSP Q CV YYRV+
Sbjct  77   TNFNNRPNSFKILSPAQTCVVYYRVD  102



>gb|AGZ13587.1| starch branching enzyme I, partial [Malus setok]
Length=95

 Score =   167 bits (423),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 74/86 (86%), Positives = 79/86 (92%), Gaps = 0/86 (0%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFHP NTYEGYKVGCDLPGKYRVALDSDAW +GGHGRVGH+V+HFT PEGIPGVPE
Sbjct  10   VFVFNFHPRNTYEGYKVGCDLPGKYRVALDSDAWGFGGHGRVGHNVDHFTFPEGIPGVPE  69

Query  563  TNFNGRPNSFKVLSPPQACVAYYRVE  486
            TNFN RPNSFK+LSP Q CV YYRV+
Sbjct  70   TNFNNRPNSFKILSPAQTCVVYYRVD  95



>gb|AGZ13548.1| starch branching enzyme I, partial [Malus kansuensis]
 gb|AGZ13565.1| starch branching enzyme I, partial [Malus toringoides]
 gb|AGZ13567.1| starch branching enzyme I, partial [Malus toringoides]
 gb|AGZ13617.1| starch branching enzyme I, partial [Malus baccata var. xiaojinensis]
Length=101

 Score =   167 bits (423),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 74/85 (87%), Positives = 78/85 (92%), Gaps = 0/85 (0%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFHP NTYEGYKVGCDLPGKYRVALDSDAW +GGHGRVGH+V+HFT PEGIPGVPE
Sbjct  17   VFVFNFHPRNTYEGYKVGCDLPGKYRVALDSDAWEFGGHGRVGHNVDHFTFPEGIPGVPE  76

Query  563  TNFNGRPNSFKVLSPPQACVAYYRV  489
            TNFN RPNSFK+LSP Q CV YYRV
Sbjct  77   TNFNNRPNSFKILSPAQTCVVYYRV  101



>ref|XP_002510672.1| starch branching enzyme II, putative [Ricinus communis]
 gb|EEF52859.1| starch branching enzyme II, putative [Ricinus communis]
Length=914

 Score =   182 bits (461),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 85/126 (67%), Positives = 100/126 (79%), Gaps = 3/126 (2%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFHPENTY+GYKVGCDLPGKY+VALDSDAW +GG GRVGHDV+HFTSPEGIPGVPE
Sbjct  736  VFVFNFHPENTYDGYKVGCDLPGKYKVALDSDAWEFGGQGRVGHDVDHFTSPEGIPGVPE  795

Query  563  TNFNGRPNSFKVLSPPQACVAYYRVEESLDEVQDSSFTETISTNLVLVSDDIDDLQELPT  384
            TNFN RPNSFKVLSPPQ CVAYYRV+ES    + ++     + N +  +DD+  L+++  
Sbjct  796  TNFNNRPNSFKVLSPPQTCVAYYRVQESQ---ESNNSINPGARNEISTADDVPKLRDIEV  852

Query  383  ENLQEL  366
               Q L
Sbjct  853  GMKQTL  858



>gb|AGZ13588.1| starch branching enzyme I, partial [Malus setok]
Length=95

 Score =   166 bits (421),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 74/86 (86%), Positives = 79/86 (92%), Gaps = 0/86 (0%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFHP NTYEGYKVGCDLPGKYRVALDSDAW +GGHGRVGH+V+HFT PEGIPGVPE
Sbjct  10   VFVFNFHPRNTYEGYKVGCDLPGKYRVALDSDAWEFGGHGRVGHNVDHFTFPEGIPGVPE  69

Query  563  TNFNGRPNSFKVLSPPQACVAYYRVE  486
            TNFN RPNSFK+LSP Q CV YYRV+
Sbjct  70   TNFNNRPNSFKILSPAQTCVVYYRVD  95



>tpg|DAA34918.1| TPA_inf: alpha-amylase [Glycine max]
Length=883

 Score =   181 bits (459),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 79/88 (90%), Positives = 83/88 (94%), Gaps = 0/88 (0%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            +FVFNFHPENTYEGYKVGCDLPGKYRVALDSDAW +GG GRVGHDV+HFTSPEGIPGVPE
Sbjct  672  IFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWEFGGRGRVGHDVDHFTSPEGIPGVPE  731

Query  563  TNFNGRPNSFKVLSPPQACVAYYRVEES  480
            TNFN RPNSFKVLSP + CVAYYRVEES
Sbjct  732  TNFNNRPNSFKVLSPARTCVAYYRVEES  759



>gb|AGZ13564.1| starch branching enzyme I, partial [Malus toringoides]
 gb|AGZ13590.1| starch branching enzyme I, partial [Malus setok]
Length=101

 Score =   166 bits (421),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 73/85 (86%), Positives = 78/85 (92%), Gaps = 0/85 (0%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFHP NTYEGYKVGCDLPGKYRVALDSDAW +GGHG+VGH+V+HFT PEGIPGVPE
Sbjct  17   VFVFNFHPRNTYEGYKVGCDLPGKYRVALDSDAWGFGGHGKVGHNVDHFTFPEGIPGVPE  76

Query  563  TNFNGRPNSFKVLSPPQACVAYYRV  489
            TNFN RPNSFK+LSP Q CV YYRV
Sbjct  77   TNFNNRPNSFKILSPAQTCVVYYRV  101



>ref|XP_003523080.1| PREDICTED: 1,4-alpha-glucan-branching enzyme-like [Glycine max]
 gb|KHN33802.1| 1,4-alpha-glucan-branching enzyme [Glycine soja]
Length=898

 Score =   181 bits (458),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 79/88 (90%), Positives = 83/88 (94%), Gaps = 0/88 (0%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            +FVFNFHPENTYEGYKVGCDLPGKYRVALDSDAW +GG GRVGHDV+HFTSPEGIPGVPE
Sbjct  687  IFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWEFGGRGRVGHDVDHFTSPEGIPGVPE  746

Query  563  TNFNGRPNSFKVLSPPQACVAYYRVEES  480
            TNFN RPNSFKVLSP + CVAYYRVEES
Sbjct  747  TNFNNRPNSFKVLSPARTCVAYYRVEES  774



>gb|AGZ13589.1| starch branching enzyme I, partial [Malus setok]
Length=95

 Score =   166 bits (419),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 73/86 (85%), Positives = 79/86 (92%), Gaps = 0/86 (0%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFHP NTYEGYKVGCDLPGKYRVALDSDAW +GGHG+VGH+V+HFT PEGIPGVPE
Sbjct  10   VFVFNFHPRNTYEGYKVGCDLPGKYRVALDSDAWGFGGHGKVGHNVDHFTFPEGIPGVPE  69

Query  563  TNFNGRPNSFKVLSPPQACVAYYRVE  486
            TNFN RPNSFK+LSP Q CV YYRV+
Sbjct  70   TNFNNRPNSFKILSPAQTCVVYYRVD  95



>gb|AGZ13547.1| starch branching enzyme I, partial [Malus transitoria]
 gb|AGZ13554.1| starch branching enzyme I, partial [Malus toringoides]
 gb|AGZ13555.1| starch branching enzyme I, partial [Malus toringoides]
 gb|AGZ13574.1| starch branching enzyme I, partial [Malus toringoides]
 gb|AGZ13576.1| starch branching enzyme I, partial [Malus toringoides]
 gb|AGZ13609.1| starch branching enzyme I, partial [Malus baccata var. xiaojinensis]
Length=100

 Score =   166 bits (419),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 73/84 (87%), Positives = 77/84 (92%), Gaps = 0/84 (0%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFHP NTYEGYKVGCDLPGKYRVALDSDAW +GGHGRVGH+V+HFT PEGIPGVPE
Sbjct  17   VFVFNFHPRNTYEGYKVGCDLPGKYRVALDSDAWGFGGHGRVGHNVDHFTFPEGIPGVPE  76

Query  563  TNFNGRPNSFKVLSPPQACVAYYR  492
            TNFN RPNSFK+LSP Q CV YYR
Sbjct  77   TNFNNRPNSFKILSPAQTCVVYYR  100



>gb|KJB29683.1| hypothetical protein B456_005G113800 [Gossypium raimondii]
Length=852

 Score =   180 bits (456),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 82/113 (73%), Positives = 95/113 (84%), Gaps = 8/113 (7%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFHPENTY+GYKVGCDLPGKYRVALDSDAW +GGHGRVGHDV+HFTSPEGIPGVPE
Sbjct  688  VFVFNFHPENTYDGYKVGCDLPGKYRVALDSDAWEFGGHGRVGHDVDHFTSPEGIPGVPE  747

Query  563  TNFNGRPNSFKVLSPPQACVAYYRVEESLDEVQDSSFTETISTNLVLVSDDID  405
            TNFN RPNSFKVLSP + CV YY+V+ES++        ET   N++ VS+ ++
Sbjct  748  TNFNNRPNSFKVLSPARTCVVYYKVDESVE--------ETNGINVISVSETLE  792



>gb|AGZ13551.1| starch branching enzyme I, partial [Malus kansuensis]
Length=101

 Score =   166 bits (419),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 73/84 (87%), Positives = 77/84 (92%), Gaps = 0/84 (0%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFHP NTYEGYKVGCDLPGKYRVALDSDAW +GGHGRVGH+V+HFT PEGIPGVPE
Sbjct  18   VFVFNFHPRNTYEGYKVGCDLPGKYRVALDSDAWEFGGHGRVGHNVDHFTFPEGIPGVPE  77

Query  563  TNFNGRPNSFKVLSPPQACVAYYR  492
            TNFN RPNSFK+LSP Q CV YYR
Sbjct  78   TNFNNRPNSFKILSPAQTCVVYYR  101



>gb|AGZ13552.1| starch branching enzyme I, partial [Malus kansuensis]
 gb|AGZ13553.1| starch branching enzyme I, partial [Malus kansuensis]
 gb|AGZ13556.1| starch branching enzyme I, partial [Malus toringoides]
 gb|AGZ13575.1| starch branching enzyme I, partial [Malus toringoides]
 gb|AGZ13610.1| starch branching enzyme I, partial [Malus baccata var. xiaojinensis]
Length=100

 Score =   166 bits (419),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 73/84 (87%), Positives = 77/84 (92%), Gaps = 0/84 (0%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFHP NTYEGYKVGCDLPGKYRVALDSDAW +GGHGRVGH+V+HFT PEGIPGVPE
Sbjct  17   VFVFNFHPRNTYEGYKVGCDLPGKYRVALDSDAWEFGGHGRVGHNVDHFTFPEGIPGVPE  76

Query  563  TNFNGRPNSFKVLSPPQACVAYYR  492
            TNFN RPNSFK+LSP Q CV YYR
Sbjct  77   TNFNNRPNSFKILSPAQTCVVYYR  100



>gb|KHG01080.1| 1,4-alpha-glucan-branching enzyme [Gossypium arboreum]
Length=873

 Score =   180 bits (456),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 91/164 (55%), Positives = 115/164 (70%), Gaps = 10/164 (6%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFH ENTY+GYKVGCDLPGKYRVALDSDAW +GGHGRVGHDV+HFTSPEGIPGVPE
Sbjct  688  VFVFNFHSENTYDGYKVGCDLPGKYRVALDSDAWEFGGHGRVGHDVDHFTSPEGIPGVPE  747

Query  563  TNFNGRPNSFKVLSPPQACVAYYRVEESLDEVQDSSFTETISTNLVLVSD--DIDDLQEL  390
            TNFN RPNSFKVLSP + CV YY+V+ES++        ET   N++ VS+  ++D  ++ 
Sbjct  748  TNFNNRPNSFKVLSPARTCVVYYKVDESVE--------ETNGINVISVSETLEMDASKQK  799

Query  389  PTENLQELPTMGNSDDVDDLQDLAAMGNSDDLQELGSVANSISD  258
              E    L   G+ ++  +  D       ++LQ+ G+   SI +
Sbjct  800  NAEESAILVDHGDKENPQETNDRDTASFDEELQKDGAKQESIEE  843



>ref|XP_008221138.1| PREDICTED: 1,4-alpha-glucan-branching enzyme 1, chloroplastic/amyloplastic-like 
[Prunus mume]
Length=831

 Score =   179 bits (455),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 88/150 (59%), Positives = 109/150 (73%), Gaps = 17/150 (11%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFHPENTY+GYKVGCDLPGKYRVALDSDA+ +GGHGRVGHDV+HFT PEGIPGVPE
Sbjct  698  VFVFNFHPENTYDGYKVGCDLPGKYRVALDSDAFEFGGHGRVGHDVDHFTFPEGIPGVPE  757

Query  563  TNFNGRPNSFKVLSPPQACVAYYRVEESLD-EVQDSSFTETISTNLVLVSDDIDDLQELP  387
            TNFN RPNSFKVLSPP  CV YYRV+ES + +V ++S  E +                + 
Sbjct  758  TNFNNRPNSFKVLSPPHTCVVYYRVDESREADVDETSIAEVV----------------VG  801

Query  386  TENLQELPTMGNSDDVDDLQDLAAMGNSDD  297
             EN +EL ++ +  +++   + +  G+SDD
Sbjct  802  KENFEELGSVIDDGNINPKAEKSGEGSSDD  831



>gb|AGZ13582.1| starch branching enzyme I, partial [Malus toringoides]
Length=99

 Score =   165 bits (418),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 73/84 (87%), Positives = 77/84 (92%), Gaps = 0/84 (0%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFHP NTYEGYKVGCDLPGKYRVALDSDAW +GGHGRVGH+V+HFT PEGIPGVPE
Sbjct  16   VFVFNFHPRNTYEGYKVGCDLPGKYRVALDSDAWEFGGHGRVGHNVDHFTFPEGIPGVPE  75

Query  563  TNFNGRPNSFKVLSPPQACVAYYR  492
            TNFN RPNSFK+LSP Q CV YYR
Sbjct  76   TNFNNRPNSFKILSPAQTCVVYYR  99



>gb|AAD50279.2| seed starch branching enzyme [Sorghum bicolor]
Length=832

 Score =   179 bits (454),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 84/121 (69%), Positives = 96/121 (79%), Gaps = 4/121 (3%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFHP+ TY+GYKVGCDLPGKYRVALDSDA+ +GGHGRVGHDV+HFTSPEGIPGVPE
Sbjct  680  VFVFNFHPKKTYDGYKVGCDLPGKYRVALDSDAFVFGGHGRVGHDVDHFTSPEGIPGVPE  739

Query  563  TNFNGRPNSFKVLSPPQACVAYYRVEESLDEVQDSSFTETISTNLVLVSDDIDDLQELPT  384
            TNFN RPNSFKVLSPP+ CVAYYRV+E  + +Q  + T    T     S DI D+   P 
Sbjct  740  TNFNNRPNSFKVLSPPRTCVAYYRVDEEAERLQAKAET----TGSRKTSPDIIDVDATPV  795

Query  383  E  381
            +
Sbjct  796  K  796



>ref|XP_007225220.1| hypothetical protein PRUPE_ppa001929mg [Prunus persica]
 gb|EMJ26419.1| hypothetical protein PRUPE_ppa001929mg [Prunus persica]
Length=740

 Score =   178 bits (452),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 89/150 (59%), Positives = 108/150 (72%), Gaps = 17/150 (11%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFHPENTY+GYKVGCDLPGKYRVALDSDA+ +GGHGRVGHDV+HFT PEGIPGVPE
Sbjct  607  VFVFNFHPENTYDGYKVGCDLPGKYRVALDSDAYEFGGHGRVGHDVDHFTFPEGIPGVPE  666

Query  563  TNFNGRPNSFKVLSPPQACVAYYRVEESLD-EVQDSSFTETISTNLVLVSDDIDDLQELP  387
            TNFN RPNSFKVLSP   CV YYRV+ESL+ +V ++S  E +                + 
Sbjct  667  TNFNNRPNSFKVLSPAHTCVVYYRVDESLEADVDETSIAEVV----------------VG  710

Query  386  TENLQELPTMGNSDDVDDLQDLAAMGNSDD  297
             EN +EL ++ +  +V    + +  G+SDD
Sbjct  711  KENFEELGSVIDDGNVGPRAEKSGEGSSDD  740



>emb|CDP07294.1| unnamed protein product [Coffea canephora]
Length=850

 Score =   179 bits (454),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 81/118 (69%), Positives = 98/118 (83%), Gaps = 3/118 (3%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFHPEN Y+GYKVGCDLPGKYRVALDSDAW +GGHGRVGHDV+HFT+PEG+PGVPE
Sbjct  691  VFVFNFHPENMYDGYKVGCDLPGKYRVALDSDAWEFGGHGRVGHDVDHFTTPEGVPGVPE  750

Query  563  TNFNGRPNSFKVLSPPQACVAYYRVEESLDE---VQDSSFTETISTNLVLVSDDIDDL  399
            TNFN RPNSFKVLSPP+  + YY VEE+L+E    + ++F+E  +  LV   ++I+ L
Sbjct  751  TNFNNRPNSFKVLSPPRTALVYYMVEETLEENNHNKSTTFSEAGTATLVEDEENIEKL  808



>ref|XP_010556051.1| PREDICTED: 1,4-alpha-glucan-branching enzyme 1, chloroplastic/amyloplastic-like 
isoform X3 [Tarenaya hassleriana]
Length=863

 Score =   179 bits (454),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 79/89 (89%), Positives = 82/89 (92%), Gaps = 0/89 (0%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFHPE TYEGYKVGCDLPGKY+VALDSDAW +GG GRVGHDVEHFTSPEGIPGVPE
Sbjct  669  VFVFNFHPEITYEGYKVGCDLPGKYKVALDSDAWEFGGRGRVGHDVEHFTSPEGIPGVPE  728

Query  563  TNFNGRPNSFKVLSPPQACVAYYRVEESL  477
            TNFN RPNSFKVLSPP+ CV YYRVEE L
Sbjct  729  TNFNNRPNSFKVLSPPRTCVVYYRVEEDL  757



>ref|XP_007018019.1| Starch branching enzyme 2.2 isoform 1 [Theobroma cacao]
 gb|EOY15244.1| Starch branching enzyme 2.2 isoform 1 [Theobroma cacao]
Length=886

 Score =   179 bits (454),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 81/109 (74%), Positives = 93/109 (85%), Gaps = 3/109 (3%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFHP+NTY+GYKVGCDLPGKYRVALDSDAW +GGHGRVGHDV+HFTSPEGIPGVPE
Sbjct  690  VFVFNFHPKNTYDGYKVGCDLPGKYRVALDSDAWEFGGHGRVGHDVDHFTSPEGIPGVPE  749

Query  563  TNFNGRPNSFKVLSPPQACVAYYRVEESLDEVQDSSFT---ETISTNLV  426
            TNFN RPNSF VLSP + CV YYRVEE+ +++ D + T   ET+  + V
Sbjct  750  TNFNNRPNSFIVLSPARTCVVYYRVEENPEDINDGNLTSANETLQVDAV  798



>ref|XP_010556050.1| PREDICTED: 1,4-alpha-glucan-branching enzyme 1, chloroplastic/amyloplastic-like 
isoform X2 [Tarenaya hassleriana]
Length=883

 Score =   179 bits (454),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 79/89 (89%), Positives = 82/89 (92%), Gaps = 0/89 (0%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFHPE TYEGYKVGCDLPGKY+VALDSDAW +GG GRVGHDVEHFTSPEGIPGVPE
Sbjct  689  VFVFNFHPEITYEGYKVGCDLPGKYKVALDSDAWEFGGRGRVGHDVEHFTSPEGIPGVPE  748

Query  563  TNFNGRPNSFKVLSPPQACVAYYRVEESL  477
            TNFN RPNSFKVLSPP+ CV YYRVEE L
Sbjct  749  TNFNNRPNSFKVLSPPRTCVVYYRVEEDL  777



>ref|XP_010556049.1| PREDICTED: 1,4-alpha-glucan-branching enzyme 1, chloroplastic/amyloplastic-like 
isoform X1 [Tarenaya hassleriana]
Length=884

 Score =   179 bits (453),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 79/89 (89%), Positives = 82/89 (92%), Gaps = 0/89 (0%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFHPE TYEGYKVGCDLPGKY+VALDSDAW +GG GRVGHDVEHFTSPEGIPGVPE
Sbjct  690  VFVFNFHPEITYEGYKVGCDLPGKYKVALDSDAWEFGGRGRVGHDVEHFTSPEGIPGVPE  749

Query  563  TNFNGRPNSFKVLSPPQACVAYYRVEESL  477
            TNFN RPNSFKVLSPP+ CV YYRVEE L
Sbjct  750  TNFNNRPNSFKVLSPPRTCVVYYRVEEDL  778



>ref|XP_010664077.1| PREDICTED: 1,4-alpha-glucan-branching enzyme 1, chloroplastic/amyloplastic 
isoform X2 [Vitis vinifera]
Length=804

 Score =   178 bits (451),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 84/118 (71%), Positives = 94/118 (80%), Gaps = 2/118 (2%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFHPENTY+GYKVGCDLPGKYRVALDSDA  +GG GRVGHD +HFTSPEGIPGVPE
Sbjct  658  VFVFNFHPENTYDGYKVGCDLPGKYRVALDSDACVFGGQGRVGHDADHFTSPEGIPGVPE  717

Query  563  TNFNGRPNSFKVLSPPQACVAYYRVEESLDEVQDSSFTETISTNLVLVSDDIDDLQEL  390
            TNFN RPNSFKVLSP + CV YYRVEESL+E  D     +   N  LV+D + + + L
Sbjct  718  TNFNNRPNSFKVLSPARTCVVYYRVEESLEESDDDH--NSTGANATLVADVVAEQESL  773



>ref|XP_010664078.1| PREDICTED: 1,4-alpha-glucan-branching enzyme 1, chloroplastic/amyloplastic 
isoform X3 [Vitis vinifera]
Length=755

 Score =   177 bits (450),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 84/118 (71%), Positives = 94/118 (80%), Gaps = 2/118 (2%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFHPENTY+GYKVGCDLPGKYRVALDSDA  +GG GRVGHD +HFTSPEGIPGVPE
Sbjct  609  VFVFNFHPENTYDGYKVGCDLPGKYRVALDSDACVFGGQGRVGHDADHFTSPEGIPGVPE  668

Query  563  TNFNGRPNSFKVLSPPQACVAYYRVEESLDEVQDSSFTETISTNLVLVSDDIDDLQEL  390
            TNFN RPNSFKVLSP + CV YYRVEESL+E  D     +   N  LV+D + + + L
Sbjct  669  TNFNNRPNSFKVLSPARTCVVYYRVEESLEESDDDH--NSTGANATLVADVVAEQESL  724



>gb|KEH36309.1| starch branching enzyme I [Medicago truncatula]
Length=744

 Score =   177 bits (448),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 82/125 (66%), Positives = 98/125 (78%), Gaps = 3/125 (2%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFHPENTY+GYK+GCDLPGKYRVALDSDA  +GGHGRVGHD +HFTSPEGIPGVPE
Sbjct  616  VFVFNFHPENTYKGYKIGCDLPGKYRVALDSDAREFGGHGRVGHDADHFTSPEGIPGVPE  675

Query  563  TNFNGRPNSFKVLSPPQACVAYYRVEESLDEVQDSSFTETISTNLVLVSDDIDDLQELPT  384
            TNFN RPNSFKVLSPP+ CV YYRV+ES +E   ++      +     + D D + ++ T
Sbjct  676  TNFNNRPNSFKVLSPPRTCVVYYRVDESQEESNSANLGGVEES---FAAADTDAIPDVST  732

Query  383  ENLQE  369
            EN ++
Sbjct  733  ENKED  737



>ref|XP_002284841.2| PREDICTED: 1,4-alpha-glucan-branching enzyme 1, chloroplastic/amyloplastic 
isoform X1 [Vitis vinifera]
 emb|CBI18866.3| unnamed protein product [Vitis vinifera]
Length=840

 Score =   177 bits (450),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 84/118 (71%), Positives = 94/118 (80%), Gaps = 2/118 (2%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFHPENTY+GYKVGCDLPGKYRVALDSDA  +GG GRVGHD +HFTSPEGIPGVPE
Sbjct  694  VFVFNFHPENTYDGYKVGCDLPGKYRVALDSDACVFGGQGRVGHDADHFTSPEGIPGVPE  753

Query  563  TNFNGRPNSFKVLSPPQACVAYYRVEESLDEVQDSSFTETISTNLVLVSDDIDDLQEL  390
            TNFN RPNSFKVLSP + CV YYRVEESL+E  D     +   N  LV+D + + + L
Sbjct  754  TNFNNRPNSFKVLSPARTCVVYYRVEESLEESDDDH--NSTGANATLVADVVAEQESL  809



>gb|KEH36310.1| starch branching enzyme I [Medicago truncatula]
Length=828

 Score =   177 bits (448),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 82/125 (66%), Positives = 98/125 (78%), Gaps = 3/125 (2%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFHPENTY+GYK+GCDLPGKYRVALDSDA  +GGHGRVGHD +HFTSPEGIPGVPE
Sbjct  700  VFVFNFHPENTYKGYKIGCDLPGKYRVALDSDAREFGGHGRVGHDADHFTSPEGIPGVPE  759

Query  563  TNFNGRPNSFKVLSPPQACVAYYRVEESLDEVQDSSFTETISTNLVLVSDDIDDLQELPT  384
            TNFN RPNSFKVLSPP+ CV YYRV+ES +E   ++      +     + D D + ++ T
Sbjct  760  TNFNNRPNSFKVLSPPRTCVVYYRVDESQEESNSANLGGVEES---FAAADTDAIPDVST  816

Query  383  ENLQE  369
            EN ++
Sbjct  817  ENKED  821



>gb|KEH36308.1| starch branching enzyme I [Medicago truncatula]
Length=815

 Score =   177 bits (448),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 82/125 (66%), Positives = 98/125 (78%), Gaps = 3/125 (2%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFHPENTY+GYK+GCDLPGKYRVALDSDA  +GGHGRVGHD +HFTSPEGIPGVPE
Sbjct  687  VFVFNFHPENTYKGYKIGCDLPGKYRVALDSDAREFGGHGRVGHDADHFTSPEGIPGVPE  746

Query  563  TNFNGRPNSFKVLSPPQACVAYYRVEESLDEVQDSSFTETISTNLVLVSDDIDDLQELPT  384
            TNFN RPNSFKVLSPP+ CV YYRV+ES +E   ++      +     + D D + ++ T
Sbjct  747  TNFNNRPNSFKVLSPPRTCVVYYRVDESQEESNSANLGGVEES---FAAADTDAIPDVST  803

Query  383  ENLQE  369
            EN ++
Sbjct  804  ENKED  808



>ref|XP_010061163.1| PREDICTED: 1,4-alpha-glucan-branching enzyme 1, chloroplastic/amyloplastic-like 
isoform X2 [Eucalyptus grandis]
Length=761

 Score =   176 bits (446),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 77/92 (84%), Positives = 85/92 (92%), Gaps = 0/92 (0%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFHPENTY+GYKVGCDLPGKYRVALDSDAW +GGHGRVGH  +HFT PEGIPGVPE
Sbjct  609  VFVFNFHPENTYDGYKVGCDLPGKYRVALDSDAWDFGGHGRVGHGFDHFTCPEGIPGVPE  668

Query  563  TNFNGRPNSFKVLSPPQACVAYYRVEESLDEV  468
            TNFN RPNSFKVLSP + CVAYYRV+ESL+++
Sbjct  669  TNFNNRPNSFKVLSPARTCVAYYRVDESLEDI  700



>gb|AGZ13549.1| starch branching enzyme I, partial [Malus kansuensis]
 gb|AGZ13550.1| starch branching enzyme I, partial [Malus kansuensis]
Length=96

 Score =   162 bits (411),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 72/83 (87%), Positives = 76/83 (92%), Gaps = 0/83 (0%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFHP NTYEGYKVGCDLPGKYRVALDSDAW +GGHGRVGH+V+HFT PEGIPGVPE
Sbjct  14   VFVFNFHPRNTYEGYKVGCDLPGKYRVALDSDAWEFGGHGRVGHNVDHFTFPEGIPGVPE  73

Query  563  TNFNGRPNSFKVLSPPQACVAYY  495
            TNFN RPNSFK+LSP Q CV YY
Sbjct  74   TNFNNRPNSFKILSPAQTCVVYY  96



>ref|XP_010061162.1| PREDICTED: 1,4-alpha-glucan-branching enzyme 1, chloroplastic/amyloplastic-like 
isoform X1 [Eucalyptus grandis]
 gb|KCW68085.1| hypothetical protein EUGRSUZ_F01770 [Eucalyptus grandis]
Length=845

 Score =   176 bits (447),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 77/92 (84%), Positives = 85/92 (92%), Gaps = 0/92 (0%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFHPENTY+GYKVGCDLPGKYRVALDSDAW +GGHGRVGH  +HFT PEGIPGVPE
Sbjct  693  VFVFNFHPENTYDGYKVGCDLPGKYRVALDSDAWDFGGHGRVGHGFDHFTCPEGIPGVPE  752

Query  563  TNFNGRPNSFKVLSPPQACVAYYRVEESLDEV  468
            TNFN RPNSFKVLSP + CVAYYRV+ESL+++
Sbjct  753  TNFNNRPNSFKVLSPARTCVAYYRVDESLEDI  784



>ref|XP_004500879.1| PREDICTED: 1,4-alpha-glucan-branching enzyme-like isoform X2 
[Cicer arietinum]
Length=776

 Score =   176 bits (445),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 78/91 (86%), Positives = 84/91 (92%), Gaps = 0/91 (0%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFHP+NTYEGYKVGCDLPGKYRVALDSDA  +GGHGRVGHD +HFTSPEGIPGVPE
Sbjct  615  VFVFNFHPDNTYEGYKVGCDLPGKYRVALDSDAREFGGHGRVGHDADHFTSPEGIPGVPE  674

Query  563  TNFNGRPNSFKVLSPPQACVAYYRVEESLDE  471
            TNFN RPNSFKVLSPP+ CV YYRV+ES +E
Sbjct  675  TNFNNRPNSFKVLSPPRTCVVYYRVDESHEE  705



>gb|EAZ38340.1| hypothetical protein OsJ_22715 [Oryza sativa Japonica Group]
Length=762

 Score =   176 bits (445),  Expect = 8e-47, Method: Composition-based stats.
 Identities = 76/93 (82%), Positives = 85/93 (91%), Gaps = 0/93 (0%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFHP  TY+GYKVGCDLPGKYRVALDSDA  +GGHGRVGHDV+HFTSPEG+PGVPE
Sbjct  616  VFVFNFHPNKTYKGYKVGCDLPGKYRVALDSDALVFGGHGRVGHDVDHFTSPEGMPGVPE  675

Query  563  TNFNGRPNSFKVLSPPQACVAYYRVEESLDEVQ  465
            TNFN RPNSFKVLSPP+ CVAYYRV+E  +E++
Sbjct  676  TNFNNRPNSFKVLSPPRTCVAYYRVDEDREELR  708



>pdb|3AML|A Chain A, Structure Of The Starch Branching Enzyme I (Bei) From 
Oryza Sativa L
 dbj|BAD61713.1| putative 1,4-alpha-glucan branching enzyme I precursor [Oryza 
sativa Japonica Group]
 dbj|BAD61805.1| putative 1,4-alpha-glucan branching enzyme I precursor [Oryza 
sativa Japonica Group]
 dbj|BAG89369.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|AEB33747.1| starch branching enzyme 1 [Oryza sativa Japonica Group]
 gb|AEB33748.1| starch branching enzyme 1 [Oryza sativa Japonica Group]
 gb|AEB33749.1| starch branching enzyme 1 [Oryza sativa Japonica Group]
 gb|AEB33750.1| starch branching enzyme 1 [Oryza sativa Japonica Group]
 gb|AEB33751.1| starch branching enzyme 1 [Oryza sativa Japonica Group]
 gb|AEB33752.1| starch branching enzyme 1 [Oryza sativa Japonica Group]
 gb|AEB33753.1| starch branching enzyme 1 [Oryza sativa Japonica Group]
 gb|AEB33754.1| starch branching enzyme 1 [Oryza sativa Japonica Group]
Length=755

 Score =   175 bits (444),  Expect = 8e-47, Method: Composition-based stats.
 Identities = 76/93 (82%), Positives = 85/93 (91%), Gaps = 0/93 (0%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFHP  TY+GYKVGCDLPGKYRVALDSDA  +GGHGRVGHDV+HFTSPEG+PGVPE
Sbjct  609  VFVFNFHPNKTYKGYKVGCDLPGKYRVALDSDALVFGGHGRVGHDVDHFTSPEGMPGVPE  668

Query  563  TNFNGRPNSFKVLSPPQACVAYYRVEESLDEVQ  465
            TNFN RPNSFKVLSPP+ CVAYYRV+E  +E++
Sbjct  669  TNFNNRPNSFKVLSPPRTCVAYYRVDEDREELR  701



>gb|KDO85087.1| hypothetical protein CISIN_1g035501mg [Citrus sinensis]
Length=732

 Score =   175 bits (444),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 85/149 (57%), Positives = 105/149 (70%), Gaps = 14/149 (9%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAW +GG GRVGH+++HFTSPEGIPGV E
Sbjct  584  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWGFGGDGRVGHNIDHFTSPEGIPGVAE  643

Query  563  TNFNGRPNSFKVLSPPQACVAYYRVEESLDEVQDS--------------SFTETISTNLV  426
            TNFN RPNSF+VLSPP+  V YYRVEES +   +S              +  E+  ++  
Sbjct  644  TNFNNRPNSFRVLSPPRTSVVYYRVEESQEGHNNSEPVNVQGKLAADVPAELESPESSAT  703

Query  425  LVSDDIDDLQELPTENLQELPTMGNSDDV  339
            L +DD+DD+     E+ ++   +G   +V
Sbjct  704  LAADDVDDVTARKIEDQKQNRIVGGESNV  732



>ref|XP_011100531.1| PREDICTED: 1,4-alpha-glucan-branching enzyme-like isoform X2 
[Sesamum indicum]
Length=792

 Score =   175 bits (444),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 77/96 (80%), Positives = 85/96 (89%), Gaps = 0/96 (0%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFH ENTYEGYKVGCDLPGKYRVALDSDAW +GGHGRVGHDV+HFT+PEG+PGVPE
Sbjct  651  VFVFNFHSENTYEGYKVGCDLPGKYRVALDSDAWEFGGHGRVGHDVDHFTTPEGVPGVPE  710

Query  563  TNFNGRPNSFKVLSPPQACVAYYRVEESLDEVQDSS  456
            TNFN RPNSFKVLSP + CV YYRVEE   E ++ +
Sbjct  711  TNFNNRPNSFKVLSPLRTCVVYYRVEEDSQESKNEA  746



>ref|XP_011100526.1| PREDICTED: 1,4-alpha-glucan-branching enzyme-like isoform X1 
[Sesamum indicum]
Length=831

 Score =   176 bits (445),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 77/96 (80%), Positives = 85/96 (89%), Gaps = 0/96 (0%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFH ENTYEGYKVGCDLPGKYRVALDSDAW +GGHGRVGHDV+HFT+PEG+PGVPE
Sbjct  690  VFVFNFHSENTYEGYKVGCDLPGKYRVALDSDAWEFGGHGRVGHDVDHFTTPEGVPGVPE  749

Query  563  TNFNGRPNSFKVLSPPQACVAYYRVEESLDEVQDSS  456
            TNFN RPNSFKVLSP + CV YYRVEE   E ++ +
Sbjct  750  TNFNNRPNSFKVLSPLRTCVVYYRVEEDSQESKNEA  785



>ref|XP_011100535.1| PREDICTED: 1,4-alpha-glucan-branching enzyme-like isoform X3 
[Sesamum indicum]
Length=747

 Score =   175 bits (443),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 77/96 (80%), Positives = 85/96 (89%), Gaps = 0/96 (0%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFH ENTYEGYKVGCDLPGKYRVALDSDAW +GGHGRVGHDV+HFT+PEG+PGVPE
Sbjct  606  VFVFNFHSENTYEGYKVGCDLPGKYRVALDSDAWEFGGHGRVGHDVDHFTTPEGVPGVPE  665

Query  563  TNFNGRPNSFKVLSPPQACVAYYRVEESLDEVQDSS  456
            TNFN RPNSFKVLSP + CV YYRVEE   E ++ +
Sbjct  666  TNFNNRPNSFKVLSPLRTCVVYYRVEEDSQESKNEA  701



>ref|XP_004500878.1| PREDICTED: 1,4-alpha-glucan-branching enzyme-like isoform X1 
[Cicer arietinum]
Length=848

 Score =   176 bits (445),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 78/91 (86%), Positives = 84/91 (92%), Gaps = 0/91 (0%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFHP+NTYEGYKVGCDLPGKYRVALDSDA  +GGHGRVGHD +HFTSPEGIPGVPE
Sbjct  687  VFVFNFHPDNTYEGYKVGCDLPGKYRVALDSDAREFGGHGRVGHDADHFTSPEGIPGVPE  746

Query  563  TNFNGRPNSFKVLSPPQACVAYYRVEESLDE  471
            TNFN RPNSFKVLSPP+ CV YYRV+ES +E
Sbjct  747  TNFNNRPNSFKVLSPPRTCVVYYRVDESHEE  777



>ref|XP_006473782.1| PREDICTED: 1,4-alpha-glucan-branching enzyme-like isoform X3 
[Citrus sinensis]
Length=837

 Score =   176 bits (445),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 85/149 (57%), Positives = 105/149 (70%), Gaps = 14/149 (9%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAW +GG GRVGH+++HFTSPEGIPGV E
Sbjct  689  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWGFGGDGRVGHNIDHFTSPEGIPGVAE  748

Query  563  TNFNGRPNSFKVLSPPQACVAYYRVEESLDEVQDS--------------SFTETISTNLV  426
            TNFN RPNSF+VLSPP+  V YYRVEES +   +S              +  E+  ++  
Sbjct  749  TNFNNRPNSFRVLSPPRTSVVYYRVEESQEGHNNSEPVNVQGKLAADVPAELESPESSAT  808

Query  425  LVSDDIDDLQELPTENLQELPTMGNSDDV  339
            L +DD+DD+     E+ ++   +G   +V
Sbjct  809  LAADDVDDVTARKIEDQKQNRIVGGESNV  837



>ref|XP_006435352.1| hypothetical protein CICLE_v10000256mg [Citrus clementina]
 gb|ESR48592.1| hypothetical protein CICLE_v10000256mg [Citrus clementina]
Length=856

 Score =   176 bits (445),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 85/149 (57%), Positives = 105/149 (70%), Gaps = 14/149 (9%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAW +GG GRVGH+++HFTSPEGIPGV E
Sbjct  708  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWGFGGDGRVGHNIDHFTSPEGIPGVAE  767

Query  563  TNFNGRPNSFKVLSPPQACVAYYRVEESLDEVQDS--------------SFTETISTNLV  426
            TNFN RPNSF+VLSPP+  V YYRVEES +   +S              +  E+  ++  
Sbjct  768  TNFNNRPNSFRVLSPPRTSVVYYRVEESQEGHNNSEPVNVQGKLAADVPAELESPESSAT  827

Query  425  LVSDDIDDLQELPTENLQELPTMGNSDDV  339
            L +DD+DD+     E+ ++   +G   +V
Sbjct  828  LAADDVDDVTARKIEDQKQNRIVGGESNV  856



>gb|AFW69578.1| starch branching enzyme1 [Zea mays]
Length=751

 Score =   174 bits (442),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 76/88 (86%), Positives = 83/88 (94%), Gaps = 0/88 (0%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFHP+ TYEGYKVGCDLPGKYRVALDSDA  +GGHGRVGHDV+HFTSPEG+PGVPE
Sbjct  608  VFVFNFHPKKTYEGYKVGCDLPGKYRVALDSDALVFGGHGRVGHDVDHFTSPEGVPGVPE  667

Query  563  TNFNGRPNSFKVLSPPQACVAYYRVEES  480
            TNFN RPNSFKVLSPP+ CVAYYRV+E+
Sbjct  668  TNFNNRPNSFKVLSPPRTCVAYYRVDEA  695



>ref|XP_006473780.1| PREDICTED: 1,4-alpha-glucan-branching enzyme-like isoform X1 
[Citrus sinensis]
Length=857

 Score =   176 bits (445),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 85/149 (57%), Positives = 105/149 (70%), Gaps = 14/149 (9%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAW +GG GRVGH+++HFTSPEGIPGV E
Sbjct  709  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWGFGGDGRVGHNIDHFTSPEGIPGVAE  768

Query  563  TNFNGRPNSFKVLSPPQACVAYYRVEESLDEVQDS--------------SFTETISTNLV  426
            TNFN RPNSF+VLSPP+  V YYRVEES +   +S              +  E+  ++  
Sbjct  769  TNFNNRPNSFRVLSPPRTSVVYYRVEESQEGHNNSEPVNVQGKLAADVPAELESPESSAT  828

Query  425  LVSDDIDDLQELPTENLQELPTMGNSDDV  339
            L +DD+DD+     E+ ++   +G   +V
Sbjct  829  LAADDVDDVTARKIEDQKQNRIVGGESNV  857



>ref|XP_006435353.1| hypothetical protein CICLE_v10000256mg [Citrus clementina]
 gb|ESR48593.1| hypothetical protein CICLE_v10000256mg [Citrus clementina]
Length=836

 Score =   175 bits (444),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 85/149 (57%), Positives = 105/149 (70%), Gaps = 14/149 (9%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAW +GG GRVGH+++HFTSPEGIPGV E
Sbjct  688  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWGFGGDGRVGHNIDHFTSPEGIPGVAE  747

Query  563  TNFNGRPNSFKVLSPPQACVAYYRVEESLDEVQDS--------------SFTETISTNLV  426
            TNFN RPNSF+VLSPP+  V YYRVEES +   +S              +  E+  ++  
Sbjct  748  TNFNNRPNSFRVLSPPRTSVVYYRVEESQEGHNNSEPVNVQGKLAADVPAELESPESSAT  807

Query  425  LVSDDIDDLQELPTENLQELPTMGNSDDV  339
            L +DD+DD+     E+ ++   +G   +V
Sbjct  808  LAADDVDDVTARKIEDQKQNRIVGGESNV  836



>ref|XP_006473781.1| PREDICTED: 1,4-alpha-glucan-branching enzyme-like isoform X2 
[Citrus sinensis]
Length=856

 Score =   175 bits (444),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 85/149 (57%), Positives = 105/149 (70%), Gaps = 14/149 (9%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAW +GG GRVGH+++HFTSPEGIPGV E
Sbjct  708  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWGFGGDGRVGHNIDHFTSPEGIPGVAE  767

Query  563  TNFNGRPNSFKVLSPPQACVAYYRVEESLDEVQDS--------------SFTETISTNLV  426
            TNFN RPNSF+VLSPP+  V YYRVEES +   +S              +  E+  ++  
Sbjct  768  TNFNNRPNSFRVLSPPRTSVVYYRVEESQEGHNNSEPVNVQGKLAADVPAELESPESSAT  827

Query  425  LVSDDIDDLQELPTENLQELPTMGNSDDV  339
            L +DD+DD+     E+ ++   +G   +V
Sbjct  828  LAADDVDDVTARKIEDQKQNRIVGGESNV  856



>ref|NP_001105370.1| starch branching enzyme1 [Zea mays]
 gb|AAA82735.1| starch branching enzyme I [Zea mays]
 gb|AAC36471.1| starch branching enzyme I [Zea mays]
 gb|ACG32270.1| 1,4-alpha-glucan branching enzyme [Zea mays]
 gb|ACN28680.1| unknown [Zea mays]
 gb|AFW69579.1| starch branching enzyme1 [Zea mays]
Length=823

 Score =   175 bits (443),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 76/88 (86%), Positives = 83/88 (94%), Gaps = 0/88 (0%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFHP+ TYEGYKVGCDLPGKYRVALDSDA  +GGHGRVGHDV+HFTSPEG+PGVPE
Sbjct  680  VFVFNFHPKKTYEGYKVGCDLPGKYRVALDSDALVFGGHGRVGHDVDHFTSPEGVPGVPE  739

Query  563  TNFNGRPNSFKVLSPPQACVAYYRVEES  480
            TNFN RPNSFKVLSPP+ CVAYYRV+E+
Sbjct  740  TNFNNRPNSFKVLSPPRTCVAYYRVDEA  767



>dbj|BAA01854.1| branching enzyme-I precursor [Zea mays]
Length=822

 Score =   175 bits (443),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 76/88 (86%), Positives = 83/88 (94%), Gaps = 0/88 (0%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFHP+ TYEGYKVGCDLPGKYRVALDSDA  +GGHGRVGHDV+HFTSPEG+PGVPE
Sbjct  679  VFVFNFHPKKTYEGYKVGCDLPGKYRVALDSDALVFGGHGRVGHDVDHFTSPEGVPGVPE  738

Query  563  TNFNGRPNSFKVLSPPQACVAYYRVEES  480
            TNFN RPNSFKVLSPP+ CVAYYRV+E+
Sbjct  739  TNFNNRPNSFKVLSPPRTCVAYYRVDEA  766



>gb|AAO20100.1| starch branching enzyme I [Zea mays]
Length=823

 Score =   175 bits (443),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 76/88 (86%), Positives = 83/88 (94%), Gaps = 0/88 (0%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFHP+ TYEGYKVGCDLPGKYRVALDSDA  +GGHGRVGHDV+HFTSPEG+PGVPE
Sbjct  680  VFVFNFHPKKTYEGYKVGCDLPGKYRVALDSDALVFGGHGRVGHDVDHFTSPEGVPGVPE  739

Query  563  TNFNGRPNSFKVLSPPQACVAYYRVEES  480
            TNFN RPNSFKVLSPP+ CVAYYRV+E+
Sbjct  740  TNFNNRPNSFKVLSPPRTCVAYYRVDEA  767



>gb|AGZ13568.1| starch branching enzyme I, partial [Malus toringoides]
 gb|AGZ13569.1| starch branching enzyme I, partial [Malus toringoides]
 gb|AGZ13598.1| starch branching enzyme I, partial [Malus setok]
Length=98

 Score =   161 bits (407),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 71/82 (87%), Positives = 75/82 (91%), Gaps = 0/82 (0%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFHP NTYEGYKVGCDLPGKYRVALDSDAW +GGHGRVGH+V+HFT PEGIPGVPE
Sbjct  17   VFVFNFHPRNTYEGYKVGCDLPGKYRVALDSDAWGFGGHGRVGHNVDHFTFPEGIPGVPE  76

Query  563  TNFNGRPNSFKVLSPPQACVAY  498
            TNFN RPNSFK+LSP Q CV Y
Sbjct  77   TNFNNRPNSFKILSPAQTCVVY  98



>gb|AGZ13557.1| starch branching enzyme I, partial [Malus toringoides]
 gb|AGZ13559.1| starch branching enzyme I, partial [Malus toringoides]
Length=97

 Score =   161 bits (407),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 71/82 (87%), Positives = 75/82 (91%), Gaps = 0/82 (0%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFHP NTYEGYKVGCDLPGKYRVALDSDAW +GGHGRVGH+V+HFT PEGIPGVPE
Sbjct  16   VFVFNFHPRNTYEGYKVGCDLPGKYRVALDSDAWGFGGHGRVGHNVDHFTFPEGIPGVPE  75

Query  563  TNFNGRPNSFKVLSPPQACVAY  498
            TNFN RPNSFK+LSP Q CV Y
Sbjct  76   TNFNNRPNSFKILSPAQTCVVY  97



>gb|AGZ13570.1| starch branching enzyme I, partial [Malus toringoides]
 gb|AGZ13595.1| starch branching enzyme I, partial [Malus setok]
 gb|AGZ13604.1| starch branching enzyme I, partial [Malus maerkangensis]
Length=98

 Score =   160 bits (406),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 71/82 (87%), Positives = 75/82 (91%), Gaps = 0/82 (0%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFHP NTYEGYKVGCDLPGKYRVALDSDAW +GGHGRVGH+V+HFT PEGIPGVPE
Sbjct  17   VFVFNFHPRNTYEGYKVGCDLPGKYRVALDSDAWEFGGHGRVGHNVDHFTFPEGIPGVPE  76

Query  563  TNFNGRPNSFKVLSPPQACVAY  498
            TNFN RPNSFK+LSP Q CV Y
Sbjct  77   TNFNNRPNSFKILSPAQTCVVY  98



>gb|AGZ13558.1| starch branching enzyme I, partial [Malus toringoides]
Length=97

 Score =   160 bits (406),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 71/82 (87%), Positives = 75/82 (91%), Gaps = 0/82 (0%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFHP NTYEGYKVGCDLPGKYRVALDSDAW +GGHGRVGH+V+HFT PEGIPGVPE
Sbjct  16   VFVFNFHPRNTYEGYKVGCDLPGKYRVALDSDAWEFGGHGRVGHNVDHFTFPEGIPGVPE  75

Query  563  TNFNGRPNSFKVLSPPQACVAY  498
            TNFN RPNSFK+LSP Q CV Y
Sbjct  76   TNFNNRPNSFKILSPAQTCVVY  97



>ref|XP_006656510.1| PREDICTED: 1,4-alpha-glucan-branching enzyme, chloroplastic/amyloplastic-like 
[Oryza brachyantha]
Length=769

 Score =   174 bits (440),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 76/92 (83%), Positives = 84/92 (91%), Gaps = 0/92 (0%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFHP+ TY+GYKVGCDLPGKYRVALDSDA  +GGHGRVGHDV+HFTSPEG+PGVPE
Sbjct  609  VFVFNFHPKKTYQGYKVGCDLPGKYRVALDSDALVFGGHGRVGHDVDHFTSPEGVPGVPE  668

Query  563  TNFNGRPNSFKVLSPPQACVAYYRVEESLDEV  468
            TNFN RPNSFKVLSPP+ CVAYYRV+E   E+
Sbjct  669  TNFNNRPNSFKVLSPPRTCVAYYRVDEDCQEL  700



>pdb|3AMK|A Chain A, Structure Of The Starch Branching Enzyme I (Bei) From 
Oryza Sativa L
Length=702

 Score =   173 bits (439),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 76/93 (82%), Positives = 85/93 (91%), Gaps = 0/93 (0%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFHP  TY+GYKVGCDLPGKYRVALDSDA  +GGHGRVGHDV+HFTSPEG+PGVPE
Sbjct  609  VFVFNFHPNKTYKGYKVGCDLPGKYRVALDSDALVFGGHGRVGHDVDHFTSPEGMPGVPE  668

Query  563  TNFNGRPNSFKVLSPPQACVAYYRVEESLDEVQ  465
            TNFN RPNSFKVLSPP+ CVAYYRV+E  +E++
Sbjct  669  TNFNNRPNSFKVLSPPRTCVAYYRVDEDREELR  701



>gb|EYU30277.1| hypothetical protein MIMGU_mgv1a001932mg [Erythranthe guttata]
Length=738

 Score =   173 bits (439),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 76/91 (84%), Positives = 83/91 (91%), Gaps = 0/91 (0%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAW +GG GRV HDV+HFT+PEG+PGVPE
Sbjct  612  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWEFGGPGRVSHDVDHFTTPEGVPGVPE  671

Query  563  TNFNGRPNSFKVLSPPQACVAYYRVEESLDE  471
            TNFN RPNSFKVLSPP+ CV Y RVEE ++E
Sbjct  672  TNFNNRPNSFKVLSPPRTCVVYNRVEEGVNE  702



>pdb|3VU2|A Chain A, Structure Of The Starch Branching Enzyme I (bei) Complexed 
With Maltopentaose From Oryza Sativa L
 pdb|3VU2|B Chain B, Structure Of The Starch Branching Enzyme I (bei) Complexed 
With Maltopentaose From Oryza Sativa L
Length=702

 Score =   173 bits (438),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 76/93 (82%), Positives = 85/93 (91%), Gaps = 0/93 (0%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFHP  TY+GYKVGCDLPGKYRVALDSDA  +GGHGRVGHDV+HFTSPEG+PGVPE
Sbjct  609  VFVFNFHPNKTYKGYKVGCDLPGKYRVALDSDALVFGGHGRVGHDVDHFTSPEGMPGVPE  668

Query  563  TNFNGRPNSFKVLSPPQACVAYYRVEESLDEVQ  465
            TNFN RPNSFKVLSPP+ CVAYYRV+E  +E++
Sbjct  669  TNFNNRPNSFKVLSPPRTCVAYYRVDEDREELR  701



>ref|XP_004966509.1| PREDICTED: 1,4-alpha-glucan-branching enzyme, chloroplastic/amyloplastic-like 
[Setaria italica]
Length=901

 Score =   174 bits (442),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 80/110 (73%), Positives = 94/110 (85%), Gaps = 2/110 (2%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFHP+ TY+GYKVGCDLPGKYRVALDSDA+ +GGHGRVGHDV+HFTSPEG+PGVPE
Sbjct  747  VFVFNFHPKKTYDGYKVGCDLPGKYRVALDSDAFVFGGHGRVGHDVDHFTSPEGVPGVPE  806

Query  563  TNFNGRPNSFKVLSPPQACVAYYRVEESLDEVQDSSFTETISTNLVLVSD  414
            TNFN RPNSFKVLSPP+ CVAYYRV+E  + ++  +  ET S+  V+  D
Sbjct  807  TNFNNRPNSFKVLSPPRTCVAYYRVDEEAEGLEGKA--ETASSPEVIEVD  854



>ref|NP_001289778.1| 1,4-alpha-glucan-branching enzyme 1, chloroplastic/amyloplastic-like 
[Nelumbo nucifera]
 gb|ACM07441.1| starch-branching enzyme I [Nelumbo nucifera]
Length=858

 Score =   174 bits (440),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 76/92 (83%), Positives = 85/92 (92%), Gaps = 0/92 (0%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFHPENTY+GYKVGCDLPGKY+V+LDSDAW +GG GRVGHDV+HFTSPEGIPGVPE
Sbjct  694  VFVFNFHPENTYDGYKVGCDLPGKYKVSLDSDAWEFGGQGRVGHDVDHFTSPEGIPGVPE  753

Query  563  TNFNGRPNSFKVLSPPQACVAYYRVEESLDEV  468
            TNFN RPNSFKVLSP + CVAYY+VEES  ++
Sbjct  754  TNFNNRPNSFKVLSPARTCVAYYKVEESPQDI  785



>gb|AGZ13596.1| starch branching enzyme I, partial [Malus setok]
 gb|AGZ13597.1| starch branching enzyme I, partial [Malus setok]
Length=98

 Score =   160 bits (404),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 70/82 (85%), Positives = 75/82 (91%), Gaps = 0/82 (0%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFHP NTYEGYKVGCDLPGKYRVALDSDAW +GGHG+VGH+V+HFT PEGIPGVPE
Sbjct  17   VFVFNFHPRNTYEGYKVGCDLPGKYRVALDSDAWGFGGHGKVGHNVDHFTFPEGIPGVPE  76

Query  563  TNFNGRPNSFKVLSPPQACVAY  498
            TNFN RPNSFK+LSP Q CV Y
Sbjct  77   TNFNNRPNSFKILSPAQTCVVY  98



>gb|AAP68993.1| starch-branching enzyme 1 [Oryza sativa Japonica Group]
Length=820

 Score =   173 bits (439),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 76/93 (82%), Positives = 85/93 (91%), Gaps = 0/93 (0%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFHP  TY+GYKVGCDLPGKYRVALDSDA  +GGHGRVGHDV+HFTSPEG+PGVPE
Sbjct  674  VFVFNFHPNKTYKGYKVGCDLPGKYRVALDSDALVFGGHGRVGHDVDHFTSPEGMPGVPE  733

Query  563  TNFNGRPNSFKVLSPPQACVAYYRVEESLDEVQ  465
            TNFN RPNSFKVLSPP+ CVAYYRV+E  +E++
Sbjct  734  TNFNSRPNSFKVLSPPRTCVAYYRVDEDREELR  766



>gb|AII21924.1| starch branching enzyme 1 [Oryza sativa Japonica Group]
Length=820

 Score =   173 bits (439),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 76/93 (82%), Positives = 85/93 (91%), Gaps = 0/93 (0%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFHP  TY+GYKVGCDLPGKYRVALDSDA  +GGHGRVGHDV+HFTSPEG+PGVPE
Sbjct  674  VFVFNFHPNKTYKGYKVGCDLPGKYRVALDSDALVFGGHGRVGHDVDHFTSPEGMPGVPE  733

Query  563  TNFNGRPNSFKVLSPPQACVAYYRVEESLDEVQ  465
            TNFN RPNSFKVLSPP+ CVAYYRV+E  +E++
Sbjct  734  TNFNNRPNSFKVLSPPRTCVAYYRVDEDREELR  766



>ref|NP_001058629.1| Os06g0726400 [Oryza sativa Japonica Group]
 sp|Q01401.2|GLGB_ORYSJ RecName: Full=1,4-alpha-glucan-branching enzyme, chloroplastic/amyloplastic; 
AltName: Full=Q-enzyme; AltName: Full=Starch-branching 
enzyme; Flags: Precursor [Oryza sativa Japonica Group]
 gb|AAD28284.1|AF136268_1 starch-branching enzyme I [Oryza sativa Japonica Group]
 dbj|BAA01855.1| branching enzyme-I precursor [Oryza sativa Japonica Group]
 dbj|BAD61712.1| 1,4-alpha-glucan branching enzyme I precursor [Oryza sativa Japonica 
Group]
 dbj|BAD61804.1| 1,4-alpha-glucan branching enzyme I precursor [Oryza sativa Japonica 
Group]
 dbj|BAF20543.1| Os06g0726400 [Oryza sativa Japonica Group]
 gb|ABL74557.1| starch-branching enzyme I [Oryza sativa Japonica Group]
 gb|ACY56114.1| starch branching enzyme 1 [Oryza sativa Japonica Group]
 gb|ACY56115.1| starch branching enzyme 1 [Oryza sativa Japonica Group]
 gb|ACY56116.1| starch branching enzyme 1 [Oryza sativa Japonica Group]
 gb|ACY56117.1| starch branching enzyme 1 [Oryza sativa Japonica Group]
 gb|ACY56118.1| starch branching enzyme 1 [Oryza sativa Japonica Group]
 gb|ACY56119.1| starch branching enzyme 1 [Oryza sativa Japonica Group]
 gb|ACY56120.1| starch branching enzyme 1 [Oryza sativa Indica Group]
 gb|ACY56121.1| starch branching enzyme 1 [Oryza sativa Indica Group]
 gb|ACY56122.1| starch branching enzyme 1 [Oryza sativa Indica Group]
 gb|ACY56123.1| starch branching enzyme 1 [Oryza sativa Indica Group]
 gb|ACY56124.1| starch branching enzyme 1 [Oryza sativa Indica Group]
 gb|ACY56125.1| starch branching enzyme 1 [Oryza sativa Indica Group]
 gb|ACY56126.1| starch branching enzyme 1 [Oryza sativa Indica Group]
 gb|ACY56127.1| starch branching enzyme 1 [Oryza sativa Indica Group]
 gb|AII21928.1| starch branching enzyme 1 [Oryza sativa Indica Group]
Length=820

 Score =   173 bits (439),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 76/93 (82%), Positives = 85/93 (91%), Gaps = 0/93 (0%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFHP  TY+GYKVGCDLPGKYRVALDSDA  +GGHGRVGHDV+HFTSPEG+PGVPE
Sbjct  674  VFVFNFHPNKTYKGYKVGCDLPGKYRVALDSDALVFGGHGRVGHDVDHFTSPEGMPGVPE  733

Query  563  TNFNGRPNSFKVLSPPQACVAYYRVEESLDEVQ  465
            TNFN RPNSFKVLSPP+ CVAYYRV+E  +E++
Sbjct  734  TNFNNRPNSFKVLSPPRTCVAYYRVDEDREELR  766



>dbj|BAA01584.1| branching enzyme [Oryza sativa Japonica Group]
 prf||1905427A starch-branching enzyme
Length=820

 Score =   173 bits (439),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 76/93 (82%), Positives = 85/93 (91%), Gaps = 0/93 (0%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFHP  TY+GYKVGCDLPGKYRVALDSDA  +GGHGRVGHDV+HFTSPEG+PGVPE
Sbjct  674  VFVFNFHPNKTYKGYKVGCDLPGKYRVALDSDALVFGGHGRVGHDVDHFTSPEGMPGVPE  733

Query  563  TNFNGRPNSFKVLSPPQACVAYYRVEESLDEVQ  465
            TNFN RPNSFKVLSPP+ CVAYYRV+E  +E++
Sbjct  734  TNFNNRPNSFKVLSPPRTCVAYYRVDEDREELR  766



>gb|ABL74558.1| starch-branching enzyme I [Oryza sativa Japonica Group]
Length=818

 Score =   173 bits (438),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 76/93 (82%), Positives = 85/93 (91%), Gaps = 0/93 (0%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFHP  TY+GYKVGCDLPGKYRVALDSDA  +GGHGRVGHDV+HFTSPEG+PGVPE
Sbjct  672  VFVFNFHPNKTYKGYKVGCDLPGKYRVALDSDALVFGGHGRVGHDVDHFTSPEGMPGVPE  731

Query  563  TNFNGRPNSFKVLSPPQACVAYYRVEESLDEVQ  465
            TNFN RPNSFKVLSPP+ CVAYYRV+E  +E++
Sbjct  732  TNFNNRPNSFKVLSPPRTCVAYYRVDEDREELR  764



>gb|EEC81337.1| hypothetical protein OsI_24520 [Oryza sativa Indica Group]
Length=827

 Score =   173 bits (438),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 76/93 (82%), Positives = 85/93 (91%), Gaps = 0/93 (0%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFHP  TY+GYKVGCDLPGKYRVALDSDA  +GGHGRVGHDV+HFTSPEG+PGVPE
Sbjct  681  VFVFNFHPNKTYKGYKVGCDLPGKYRVALDSDALVFGGHGRVGHDVDHFTSPEGMPGVPE  740

Query  563  TNFNGRPNSFKVLSPPQACVAYYRVEESLDEVQ  465
            TNFN RPNSFKVLSPP+ CVAYYRV+E  +E++
Sbjct  741  TNFNNRPNSFKVLSPPRTCVAYYRVDEDREELR  773



>ref|XP_011041237.1| PREDICTED: 1,4-alpha-glucan-branching enzyme 1, chloroplastic/amyloplastic-like 
isoform X2 [Populus euphratica]
Length=805

 Score =   172 bits (437),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 81/118 (69%), Positives = 95/118 (81%), Gaps = 3/118 (3%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFHPE TY+GYKVGCDLPGKYRVALDSDA  +GGHGRVGHD +HFTSPEGIPGVPE
Sbjct  649  VFVFNFHPEKTYDGYKVGCDLPGKYRVALDSDALEFGGHGRVGHDADHFTSPEGIPGVPE  708

Query  563  TNFNGRPNSFKVLSPPQACVAYYRVEESLDEVQDSSFTETISTNLVLVSDDIDDLQEL  390
            TNFN RPNSFKVLSP + CV YYRVEES +   D+   + +  N +L +D I + +++
Sbjct  709  TNFNNRPNSFKVLSPARTCVVYYRVEESEESHDDN---DEMGVNEILAADVITEQEDV  763



>ref|XP_011013898.1| PREDICTED: 1,4-alpha-glucan-branching enzyme 1, chloroplastic/amyloplastic-like 
isoform X2 [Populus euphratica]
Length=805

 Score =   172 bits (437),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 81/118 (69%), Positives = 95/118 (81%), Gaps = 3/118 (3%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFHPE TY+GYKVGCDLPGKYRVALDSDA  +GGHGRVGHD +HFTSPEGIPGVPE
Sbjct  649  VFVFNFHPEKTYDGYKVGCDLPGKYRVALDSDALEFGGHGRVGHDADHFTSPEGIPGVPE  708

Query  563  TNFNGRPNSFKVLSPPQACVAYYRVEESLDEVQDSSFTETISTNLVLVSDDIDDLQEL  390
            TNFN RPNSFKVLSP + CV YYRVEES +   D+   + +  N +L +D I + +++
Sbjct  709  TNFNNRPNSFKVLSPARTCVVYYRVEESEESHDDN---DEMGVNEILAADVITEQEDV  763



>ref|XP_010692551.1| PREDICTED: 1,4-alpha-glucan-branching enzyme 1, chloroplastic/amyloplastic-like 
[Beta vulgaris subsp. vulgaris]
Length=867

 Score =   173 bits (438),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 89/151 (59%), Positives = 105/151 (70%), Gaps = 3/151 (2%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFHP NTYEGYKVGCDLPGKYRVALDSDA  +GG GRVGHD  HFTSPEGIPGVPE
Sbjct  689  VFVFNFHPVNTYEGYKVGCDLPGKYRVALDSDALEFGGRGRVGHDANHFTSPEGIPGVPE  748

Query  563  TNFNGRPNSFKVLSPPQACVAYYRVEESLDEVQDSSFTETISTNLVLVSDDIDDLQELPT  384
            TNFN RPNSFKVL+P + CVAYYRVE+  +E   SS   TI+   V   +++DD  EL  
Sbjct  749  TNFNNRPNSFKVLAPARTCVAYYRVEDCPEESISSS---TINAINVREEEEVDDSPELKE  805

Query  383  ENLQELPTMGNSDDVDDLQDLAAMGNSDDLQ  291
                E     +++D+   ++    G  DD +
Sbjct  806  PVPLEASVGPSTEDIPSTEEEVDTGRPDDTE  836



>gb|AHW50662.1| starch branching protein I [Lens culinaris]
Length=847

 Score =   172 bits (437),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 81/122 (66%), Positives = 95/122 (78%), Gaps = 1/122 (1%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDA  +GGHGRVGHD +HFTSPEGIPGVPE
Sbjct  689  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAREFGGHGRVGHDADHFTSPEGIPGVPE  748

Query  563  TNFNGRPNSFKVLSPPQACVAYYRVEESLDEVQDSSFTETISTNLVLVSDDIDDLQELPT  384
            TNF+ RPNSFKVLSPP+ CV Y RV+E  +E ++S    T+      V  D+  + ++  
Sbjct  749  TNFSNRPNSFKVLSPPRTCVVYNRVDERQEE-RNSPNLSTVEETFAAVDTDVATIPDVSV  807

Query  383  EN  378
            E+
Sbjct  808  ES  809



>ref|XP_011041236.1| PREDICTED: 1,4-alpha-glucan-branching enzyme 1, chloroplastic/amyloplastic-like 
isoform X1 [Populus euphratica]
Length=846

 Score =   172 bits (437),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 81/118 (69%), Positives = 95/118 (81%), Gaps = 3/118 (3%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFHPE TY+GYKVGCDLPGKYRVALDSDA  +GGHGRVGHD +HFTSPEGIPGVPE
Sbjct  690  VFVFNFHPEKTYDGYKVGCDLPGKYRVALDSDALEFGGHGRVGHDADHFTSPEGIPGVPE  749

Query  563  TNFNGRPNSFKVLSPPQACVAYYRVEESLDEVQDSSFTETISTNLVLVSDDIDDLQEL  390
            TNFN RPNSFKVLSP + CV YYRVEES +   D+   + +  N +L +D I + +++
Sbjct  750  TNFNNRPNSFKVLSPARTCVVYYRVEESEESHDDN---DEMGVNEILAADVITEQEDV  804



>ref|XP_011013897.1| PREDICTED: 1,4-alpha-glucan-branching enzyme 1, chloroplastic/amyloplastic-like 
isoform X1 [Populus euphratica]
Length=846

 Score =   172 bits (436),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 81/118 (69%), Positives = 95/118 (81%), Gaps = 3/118 (3%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFHPE TY+GYKVGCDLPGKYRVALDSDA  +GGHGRVGHD +HFTSPEGIPGVPE
Sbjct  690  VFVFNFHPEKTYDGYKVGCDLPGKYRVALDSDALEFGGHGRVGHDADHFTSPEGIPGVPE  749

Query  563  TNFNGRPNSFKVLSPPQACVAYYRVEESLDEVQDSSFTETISTNLVLVSDDIDDLQEL  390
            TNFN RPNSFKVLSP + CV YYRVEES +   D+   + +  N +L +D I + +++
Sbjct  750  TNFNNRPNSFKVLSPARTCVVYYRVEESEESHDDN---DEMGVNEILAADVITEQEDV  804



>gb|AGZ13544.1| starch branching enzyme I, partial [Malus transitoria]
 gb|AGZ13545.1| starch branching enzyme I, partial [Malus transitoria]
 gb|AGZ13562.1| starch branching enzyme I, partial [Malus toringoides]
 gb|AGZ13577.1| starch branching enzyme I, partial [Malus toringoides]
 gb|AGZ13578.1| starch branching enzyme I, partial [Malus toringoides]
 gb|AGZ13584.1| starch branching enzyme I, partial [Malus setok]
Length=96

 Score =   158 bits (400),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 70/80 (88%), Positives = 74/80 (93%), Gaps = 0/80 (0%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFHP NTYEGYKVGCDLPGKYRVALDSDAW +GGHGRVGH+V+HFT PEGIPGVPE
Sbjct  17   VFVFNFHPRNTYEGYKVGCDLPGKYRVALDSDAWGFGGHGRVGHNVDHFTFPEGIPGVPE  76

Query  563  TNFNGRPNSFKVLSPPQACV  504
            TNFN RPNSFK+LSP Q CV
Sbjct  77   TNFNNRPNSFKILSPAQTCV  96



>sp|Q41059.1|GLGB2_PEA RecName: Full=1,4-alpha-glucan-branching enzyme 1, chloroplastic/amyloplastic; 
AltName: Full=Starch branching enzyme I; Flags: 
Precursor, partial [Pisum sativum]
 emb|CAA56320.1| starch branching enzyme II [Pisum sativum]
Length=826

 Score =   172 bits (436),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 76/91 (84%), Positives = 81/91 (89%), Gaps = 0/91 (0%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDA  +GGHGRVGHD + FTSPEGIPG+PE
Sbjct  675  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDATEFGGHGRVGHDADQFTSPEGIPGIPE  734

Query  563  TNFNGRPNSFKVLSPPQACVAYYRVEESLDE  471
            TNFN RPNSFKVLSPP  CV YYRV+E  +E
Sbjct  735  TNFNNRPNSFKVLSPPHTCVVYYRVDERQEE  765



>gb|AIC82459.1| 1,4-alpha-glucan-branching enzyme [Cocos nucifera]
Length=819

 Score =   172 bits (435),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 78/100 (78%), Positives = 90/100 (90%), Gaps = 1/100 (1%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFHPENTY+GYK+GCDLPGKYRVALDSDA  +GGHGRVGHDV+HFT+PEGIPGVPE
Sbjct  687  VFVFNFHPENTYDGYKIGCDLPGKYRVALDSDALEFGGHGRVGHDVDHFTTPEGIPGVPE  746

Query  563  TNFNGRPNSFKVLSPPQACVAYYRVEESLDEVQDSSFTET  444
            TNFN RPNSFKVLSP ++CVAYY+VEE+ ++  D   T+T
Sbjct  747  TNFNNRPNSFKVLSPSRSCVAYYKVEENPEDF-DEEMTDT  785



>gb|KDP36796.1| hypothetical protein JCGZ_08087 [Jatropha curcas]
Length=871

 Score =   172 bits (436),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 90/159 (57%), Positives = 114/159 (72%), Gaps = 11/159 (7%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFHPENTY+GYK+GCDLPGKYRVALDSDAW +GG GRV H+ EHFTSPEGIPGV E
Sbjct  687  VFVFNFHPENTYDGYKIGCDLPGKYRVALDSDAWEFGGQGRVSHEAEHFTSPEGIPGVAE  746

Query  563  TNFNGRPNSFKVLSPPQACVAYYRVEESLDEVQDSSFTETISTNLVLVSDDIDDL---QE  393
            TNFN RPNSFKVLSP + CVAYYRV+ES  E+ +      +     L +D ++ L   +E
Sbjct  747  TNFNNRPNSFKVLSPARTCVAYYRVDES-QEINNGGNLGAVDE--TLTADAVEKLEVSEE  803

Query  392  LPTENLQELPTMGNSDDVDDL--QDLAA--MGNSDDLQE  288
            +  +NL    TM   D+++++  + LAA    N +D++E
Sbjct  804  VVKQNLA-TDTMEKKDNLEEVNTKKLAADTAVNQEDIKE  841



>gb|AAZ20130.1| starch branching enzyme I [Malus domestica]
Length=838

 Score =   172 bits (436),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 74/85 (87%), Positives = 78/85 (92%), Gaps = 0/85 (0%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFHP NTYEGYKVGCDLPGKYRVALDSDAW +GGHGRVGH+V+HFT PEGIPGVPE
Sbjct  703  VFVFNFHPRNTYEGYKVGCDLPGKYRVALDSDAWEFGGHGRVGHNVDHFTFPEGIPGVPE  762

Query  563  TNFNGRPNSFKVLSPPQACVAYYRV  489
            TNFN RPNSFK+LSP Q CV YYRV
Sbjct  763  TNFNNRPNSFKILSPAQTCVVYYRV  787



>ref|XP_008377077.1| PREDICTED: 1,4-alpha-glucan-branching enzyme 1, chloroplastic/amyloplastic-like 
[Malus domestica]
Length=838

 Score =   172 bits (435),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 74/85 (87%), Positives = 78/85 (92%), Gaps = 0/85 (0%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFHP NTYEGYKVGCDLPGKYRVALDSDAW +GGHGRVGH+V+HFT PEGIPGVPE
Sbjct  703  VFVFNFHPRNTYEGYKVGCDLPGKYRVALDSDAWEFGGHGRVGHNVDHFTFPEGIPGVPE  762

Query  563  TNFNGRPNSFKVLSPPQACVAYYRV  489
            TNFN RPNSFK+LSP Q CV YYRV
Sbjct  763  TNFNNRPNSFKILSPAQTCVVYYRV  787



>gb|ABQ15209.1| starch branching enzyme I [Zea mays]
Length=823

 Score =   172 bits (435),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 75/88 (85%), Positives = 83/88 (94%), Gaps = 0/88 (0%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFHP+ TYEGYKVGCDLPGKYRVALDSDA  +GG+GRVGHDV+HFTSPEG+PGVPE
Sbjct  680  VFVFNFHPKKTYEGYKVGCDLPGKYRVALDSDALVFGGNGRVGHDVDHFTSPEGVPGVPE  739

Query  563  TNFNGRPNSFKVLSPPQACVAYYRVEES  480
            TNFN RPNSFKVLSPP+ CVAYYRV+E+
Sbjct  740  TNFNNRPNSFKVLSPPRTCVAYYRVDEA  767



>gb|AGZ13560.1| starch branching enzyme I, partial [Malus toringoides]
 gb|AGZ13579.1| starch branching enzyme I, partial [Malus toringoides]
 gb|AGZ13585.1| starch branching enzyme I, partial [Malus setok]
 gb|AGZ13619.1| starch branching enzyme I, partial [Malus baccata var. xiaojinensis]
Length=96

 Score =   158 bits (399),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 70/80 (88%), Positives = 74/80 (93%), Gaps = 0/80 (0%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFHP NTYEGYKVGCDLPGKYRVALDSDAW +GGHGRVGH+V+HFT PEGIPGVPE
Sbjct  17   VFVFNFHPRNTYEGYKVGCDLPGKYRVALDSDAWEFGGHGRVGHNVDHFTFPEGIPGVPE  76

Query  563  TNFNGRPNSFKVLSPPQACV  504
            TNFN RPNSFK+LSP Q CV
Sbjct  77   TNFNNRPNSFKILSPAQTCV  96



>emb|CAA54308.1| 1,4-alpha-glucan branching enzyme [Manihot esculenta]
Length=852

 Score =   172 bits (435),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 75/88 (85%), Positives = 80/88 (91%), Gaps = 0/88 (0%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFHPENTY+GYKVGCDLPGKYRVALDSDAW +GG GRVGHDV+HFTSPEGIPGVPE
Sbjct  691  VFVFNFHPENTYDGYKVGCDLPGKYRVALDSDAWEFGGRGRVGHDVDHFTSPEGIPGVPE  750

Query  563  TNFNGRPNSFKVLSPPQACVAYYRVEES  480
            TNFN RPNSFK+LS  + CV YYRVEE 
Sbjct  751  TNFNNRPNSFKILSAARTCVVYYRVEEK  778



>emb|CAX51365.1| starch branching enzyme [Hordeum vulgare subsp. vulgare]
Length=599

 Score =   170 bits (430),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 74/94 (79%), Positives = 83/94 (88%), Gaps = 0/94 (0%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFHP  TY+GYKVGCDLPGKY+VALDSDA  +GGHGRV HD +HFTSPEGIPGVPE
Sbjct  447  VFVFNFHPNKTYDGYKVGCDLPGKYKVALDSDALMFGGHGRVAHDSDHFTSPEGIPGVPE  506

Query  563  TNFNGRPNSFKVLSPPQACVAYYRVEESLDEVQD  462
            TNFN RPNSFK+LSPP+ CVAYYRVEE  ++ +D
Sbjct  507  TNFNNRPNSFKILSPPRTCVAYYRVEEKAEKPKD  540



>ref|XP_002307789.2| hypothetical protein POPTR_0005s27240g [Populus trichocarpa]
 gb|EEE94785.2| hypothetical protein POPTR_0005s27240g [Populus trichocarpa]
Length=859

 Score =   171 bits (434),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 83/124 (67%), Positives = 97/124 (78%), Gaps = 6/124 (5%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFHPE TY+GYKVGCDLPGKYRVALDSDA  +GGHGRVGHD +HFTSPEGIPGVPE
Sbjct  690  VFVFNFHPEKTYDGYKVGCDLPGKYRVALDSDALEFGGHGRVGHDADHFTSPEGIPGVPE  749

Query  563  TNFNGRPNSFKVLSPPQACVAYYRVEESLDEVQDSSFTETISTNLVLVSDDI---DDLQE  393
            TNFN RPNSFKVLSP + CV YYRVEES +   D    + +  N +L +D I   +D++E
Sbjct  750  TNFNNRPNSFKVLSPARTCVVYYRVEESEESHDDD---DEMGLNEILAADVIPEQEDVEE  806

Query  392  LPTE  381
              ++
Sbjct  807  AASQ  810



>gb|ABN05321.1| starch branching enzyme I [Populus trichocarpa]
Length=838

 Score =   171 bits (434),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 83/124 (67%), Positives = 97/124 (78%), Gaps = 6/124 (5%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFHPE TY+GYKVGCDLPGKYRVALDSDA  +GGHGRVGHD +HFTSPEGIPGVPE
Sbjct  690  VFVFNFHPEKTYDGYKVGCDLPGKYRVALDSDALEFGGHGRVGHDADHFTSPEGIPGVPE  749

Query  563  TNFNGRPNSFKVLSPPQACVAYYRVEESLDEVQDSSFTETISTNLVLVSDDI---DDLQE  393
            TNFN RPNSFKVLSP + CV YYRVEES +   D    + +  N +L +D I   +D++E
Sbjct  750  TNFNNRPNSFKVLSPARTCVVYYRVEESEESHDDD---DEMGLNEILAADVIPEQEDVEE  806

Query  392  LPTE  381
              ++
Sbjct  807  AASQ  810



>gb|AGZ13620.1| starch branching enzyme I, partial [Malus domestica]
 gb|AGZ13623.1| starch branching enzyme I, partial [Malus sieversii]
Length=89

 Score =   157 bits (397),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 70/80 (88%), Positives = 74/80 (93%), Gaps = 0/80 (0%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFHP NTYEGYKVGCDLPGKYRVALDSDAW +GGHGRVGH+V+HFT PEGIPGVPE
Sbjct  10   VFVFNFHPRNTYEGYKVGCDLPGKYRVALDSDAWEFGGHGRVGHNVDHFTFPEGIPGVPE  69

Query  563  TNFNGRPNSFKVLSPPQACV  504
            TNFN RPNSFK+LSP Q CV
Sbjct  70   TNFNNRPNSFKILSPAQTCV  89



>ref|XP_004291223.1| PREDICTED: 1,4-alpha-glucan-branching enzyme 1, chloroplastic/amyloplastic-like 
[Fragaria vesca subsp. vesca]
Length=837

 Score =   171 bits (433),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 77/91 (85%), Positives = 84/91 (92%), Gaps = 0/91 (0%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFHP NTY+GYKVGCDLPGKYRVALDSDA+ +GGHGRVGHDV+HFT PEGIPGVPE
Sbjct  682  VFVFNFHPVNTYDGYKVGCDLPGKYRVALDSDAFEFGGHGRVGHDVDHFTFPEGIPGVPE  741

Query  563  TNFNGRPNSFKVLSPPQACVAYYRVEESLDE  471
            TNFNGRPNSFKVLSPP+  V YYRV+ES +E
Sbjct  742  TNFNGRPNSFKVLSPPRTSVVYYRVDESKEE  772



>gb|AGZ13561.1| starch branching enzyme I, partial [Malus toringoides]
 gb|AGZ13583.1| starch branching enzyme I, partial [Malus setok]
 gb|AGZ13586.1| starch branching enzyme I, partial [Malus setok]
Length=96

 Score =   157 bits (397),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 69/80 (86%), Positives = 74/80 (93%), Gaps = 0/80 (0%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFHP NTYEGYKVGCDLPGKYRVALDSDAW +GGHG+VGH+V+HFT PEGIPGVPE
Sbjct  17   VFVFNFHPRNTYEGYKVGCDLPGKYRVALDSDAWGFGGHGKVGHNVDHFTFPEGIPGVPE  76

Query  563  TNFNGRPNSFKVLSPPQACV  504
            TNFN RPNSFK+LSP Q CV
Sbjct  77   TNFNNRPNSFKILSPAQTCV  96



>ref|XP_010094549.1| 1,4-alpha-glucan-branching enzyme [Morus notabilis]
 gb|EXB56303.1| 1,4-alpha-glucan-branching enzyme [Morus notabilis]
Length=758

 Score =   170 bits (430),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 82/128 (64%), Positives = 97/128 (76%), Gaps = 21/128 (16%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFHPEN Y+GYKVGCDLPGKYRVALDSDA  +GGHGRVGH+++HFTSPEGIPGVPE
Sbjct  624  VFVFNFHPENAYDGYKVGCDLPGKYRVALDSDAREFGGHGRVGHNIDHFTSPEGIPGVPE  683

Query  563  TNFNGRPNSFKVLSPPQACVAYYRVEESLDEVQDSSFTETISTNLVLVSDDIDDLQELPT  384
            TNFN RPNSFKVLSP + CV YYRV+ES +                LV++D+D+      
Sbjct  684  TNFNNRPNSFKVLSPSRTCVVYYRVDESKE---------------TLVAEDVDE------  722

Query  383  ENLQELPT  360
            +NL+EL +
Sbjct  723  DNLEELAS  730



>gb|AAP72268.1| starch branching enzyme I [Hordeum vulgare]
Length=775

 Score =   170 bits (430),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 74/94 (79%), Positives = 83/94 (88%), Gaps = 0/94 (0%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFHP  TY+GYKVGCDLPGKY+VALDSDA  +GGHGRV HD +HFTSPEGIPGVPE
Sbjct  623  VFVFNFHPNKTYDGYKVGCDLPGKYKVALDSDALMFGGHGRVAHDSDHFTSPEGIPGVPE  682

Query  563  TNFNGRPNSFKVLSPPQACVAYYRVEESLDEVQD  462
            TNFN RPNSFK+LSPP+ CVAYYRVEE  ++ +D
Sbjct  683  TNFNNRPNSFKILSPPRTCVAYYRVEEKAEKPKD  716



>ref|XP_006828735.1| hypothetical protein AMTR_s00001p00048980 [Amborella trichopoda]
 gb|ERM96151.1| hypothetical protein AMTR_s00001p00048980 [Amborella trichopoda]
Length=823

 Score =   170 bits (430),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 76/93 (82%), Positives = 85/93 (91%), Gaps = 0/93 (0%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFH ENTY+G+KVGCDLPGKYRVALDSDA  +GGHGRVGHDV+HFTSPEG PG PE
Sbjct  666  VFVFNFHTENTYDGFKVGCDLPGKYRVALDSDALEFGGHGRVGHDVDHFTSPEGEPGKPE  725

Query  563  TNFNGRPNSFKVLSPPQACVAYYRVEESLDEVQ  465
            TNFN RPNSFKVLSPPQ CVAYY+V+ESL+ ++
Sbjct  726  TNFNNRPNSFKVLSPPQTCVAYYKVDESLNGIE  758



>ref|XP_010935254.1| PREDICTED: 1,4-alpha-glucan-branching enzyme, chloroplastic/amyloplastic-like 
isoform X1 [Elaeis guineensis]
Length=819

 Score =   170 bits (430),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 74/88 (84%), Positives = 82/88 (93%), Gaps = 0/88 (0%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFHPENTY+GYK+GCDLPGKYRVALDSDA  +GGHGRVGHDV+HFT+PEGIPGVPE
Sbjct  687  VFVFNFHPENTYDGYKIGCDLPGKYRVALDSDALQFGGHGRVGHDVDHFTTPEGIPGVPE  746

Query  563  TNFNGRPNSFKVLSPPQACVAYYRVEES  480
            TNFN RPNSFKVLSP + CV YY+VEE+
Sbjct  747  TNFNNRPNSFKVLSPARTCVVYYKVEEN  774



>ref|XP_008781359.1| PREDICTED: 1,4-alpha-glucan-branching enzyme, chloroplastic/amyloplastic-like 
[Phoenix dactylifera]
Length=1395

 Score =   172 bits (435),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 86/148 (58%), Positives = 106/148 (72%), Gaps = 8/148 (5%)
 Frame = -2

Query  743   VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
             VFVFNFHPENTY+GYKVGCDLPGKYRVALDSDA  +GG GRVGHDV+HFT+PEGIPGVPE
Sbjct  1253  VFVFNFHPENTYDGYKVGCDLPGKYRVALDSDASEFGGRGRVGHDVDHFTTPEGIPGVPE  1312

Query  563   TNFNGRPNSFKVLSPPQACVAYYRVEESLDEVQDSSFTETISTNLVLVSDDIDDLQELPT  384
             TNFN RPNSFKVLSP   CVAYY+VEE+        F E ++     V+ D +  +E   
Sbjct  1313  TNFNNRPNSFKVLSPAHTCVAYYKVEEN-----SEGFDEEMTDTEEAVARDKEPERETSY  1367

Query  383   ENLQELPT---MGNSDDVDDLQDLAAMG  309
             +   ++     +G+ D+++D+ D  A G
Sbjct  1368  QTAAKVLVPMRVGDEDEIEDMGDAEADG  1395



>gb|AAG27622.1|AF286318_1 starch branching enzyme 1 [Triticum aestivum]
Length=833

 Score =   170 bits (430),  Expect = 2e-44, Method: Composition-based stats.
 Identities = 74/94 (79%), Positives = 83/94 (88%), Gaps = 0/94 (0%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFHP  TY+GYKVGCDLPGKY+VALDSDA  +GGHGRV HD +HFTSPEG+PGVPE
Sbjct  681  VFVFNFHPSKTYDGYKVGCDLPGKYKVALDSDALMFGGHGRVAHDNDHFTSPEGVPGVPE  740

Query  563  TNFNGRPNSFKVLSPPQACVAYYRVEESLDEVQD  462
            TNFN RPNSFKVLSPP+ CVAYYRVEE  ++ +D
Sbjct  741  TNFNNRPNSFKVLSPPRTCVAYYRVEEKAEKPKD  774



>ref|XP_009395337.1| PREDICTED: 1,4-alpha-glucan-branching enzyme, chloroplastic/amyloplastic-like 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=850

 Score =   170 bits (430),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 77/119 (65%), Positives = 91/119 (76%), Gaps = 0/119 (0%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFHPENTY GYKVGCDLPGKYRV LDSDA+ +GGHGRVGHD++HFTSPEGIPGV E
Sbjct  684  VFVFNFHPENTYSGYKVGCDLPGKYRVTLDSDAFEFGGHGRVGHDIDHFTSPEGIPGVSE  743

Query  563  TNFNGRPNSFKVLSPPQACVAYYRVEESLDEVQDSSFTETISTNLVLVSDDIDDLQELP  387
            TNFN RPNSFK+LSP + CV YY+V+E+L +  + +     +   VL    +D   E P
Sbjct  744  TNFNNRPNSFKILSPARTCVVYYKVDETLQQPDEDTTGTETTVTQVLQDSQVDKTAESP  802



>emb|CAB40980.1| starch branching enzyme I [Triticum aestivum]
Length=865

 Score =   170 bits (430),  Expect = 2e-44, Method: Composition-based stats.
 Identities = 74/94 (79%), Positives = 83/94 (88%), Gaps = 0/94 (0%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFHP  TY+GYKVGCDLPGKY+VALDSDA  +GGHGRV HD +HFTSPEG+PGVPE
Sbjct  713  VFVFNFHPSKTYDGYKVGCDLPGKYKVALDSDALMFGGHGRVAHDNDHFTSPEGVPGVPE  772

Query  563  TNFNGRPNSFKVLSPPQACVAYYRVEESLDEVQD  462
            TNFN RPNSFKVLSPP+ CVAYYRVEE  ++ +D
Sbjct  773  TNFNNRPNSFKVLSPPRTCVAYYRVEEKAEKPKD  806



>ref|XP_009395338.1| PREDICTED: 1,4-alpha-glucan-branching enzyme, chloroplastic/amyloplastic-like 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=848

 Score =   170 bits (430),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 77/119 (65%), Positives = 91/119 (76%), Gaps = 0/119 (0%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFHPENTY GYKVGCDLPGKYRV LDSDA+ +GGHGRVGHD++HFTSPEGIPGV E
Sbjct  682  VFVFNFHPENTYSGYKVGCDLPGKYRVTLDSDAFEFGGHGRVGHDIDHFTSPEGIPGVSE  741

Query  563  TNFNGRPNSFKVLSPPQACVAYYRVEESLDEVQDSSFTETISTNLVLVSDDIDDLQELP  387
            TNFN RPNSFK+LSP + CV YY+V+E+L +  + +     +   VL    +D   E P
Sbjct  742  TNFNNRPNSFKILSPARTCVVYYKVDETLQQPDEDTTGTETTVTQVLQDSQVDKTAESP  800



>emb|CAB40981.1| starch branching enzyme I [Triticum aestivum]
Length=810

 Score =   169 bits (428),  Expect = 2e-44, Method: Composition-based stats.
 Identities = 74/94 (79%), Positives = 83/94 (88%), Gaps = 0/94 (0%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFHP  TY+GYKVGCDLPGKY+VALDSDA  +GGHGRV HD +HFTSPEG+PGVPE
Sbjct  658  VFVFNFHPSKTYDGYKVGCDLPGKYKVALDSDALMFGGHGRVAHDNDHFTSPEGVPGVPE  717

Query  563  TNFNGRPNSFKVLSPPQACVAYYRVEESLDEVQD  462
            TNFN RPNSFKVLSPP+ CVAYYRVEE  ++ +D
Sbjct  718  TNFNNRPNSFKVLSPPRTCVAYYRVEEKAEKPKD  751



>emb|CAB40979.1| starch branching enzyme I [Triticum aestivum]
Length=833

 Score =   169 bits (429),  Expect = 2e-44, Method: Composition-based stats.
 Identities = 74/94 (79%), Positives = 83/94 (88%), Gaps = 0/94 (0%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFHP  TY+GYKVGCDLPGKY+VALDSDA  +GGHGRV HD +HFTSPEG+PGVPE
Sbjct  681  VFVFNFHPSKTYDGYKVGCDLPGKYKVALDSDALMFGGHGRVAHDNDHFTSPEGVPGVPE  740

Query  563  TNFNGRPNSFKVLSPPQACVAYYRVEESLDEVQD  462
            TNFN RPNSFKVLSPP+ CVAYYRVEE  ++ +D
Sbjct  741  TNFNNRPNSFKVLSPPRTCVAYYRVEEKAEKPKD  774



>gb|AGZ13622.1| starch branching enzyme I, partial [Malus sylvestris]
 gb|AGZ13624.1| starch branching enzyme I, partial [Malus orientalis]
Length=89

 Score =   155 bits (392),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 69/80 (86%), Positives = 73/80 (91%), Gaps = 0/80 (0%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFHP NTYEGYKVGCDLPGKYRVALDSDAW +GGHGRVGH+V+HFT PEGIPGVPE
Sbjct  10   VFVFNFHPRNTYEGYKVGCDLPGKYRVALDSDAWEFGGHGRVGHNVDHFTFPEGIPGVPE  69

Query  563  TNFNGRPNSFKVLSPPQACV  504
            TNFN RPNS K+LSP Q CV
Sbjct  70   TNFNNRPNSLKILSPAQTCV  89



>gb|EMS50244.1| 1,4-alpha-glucan-branching enzyme, chloroplastic/amyloplastic 
[Triticum urartu]
Length=911

 Score =   169 bits (428),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 74/94 (79%), Positives = 83/94 (88%), Gaps = 0/94 (0%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFHP  TY+GYKVGCDLPGKY+VALDSDA  +GGHGRV HD +HFTSPEG+PGVPE
Sbjct  609  VFVFNFHPSKTYDGYKVGCDLPGKYKVALDSDALMFGGHGRVAHDNDHFTSPEGVPGVPE  668

Query  563  TNFNGRPNSFKVLSPPQACVAYYRVEESLDEVQD  462
            TNFN RPNSFKVLSPP+ CVAYYRVEE  ++ +D
Sbjct  669  TNFNNRPNSFKVLSPPRTCVAYYRVEEKAEKPKD  702



>gb|AGZ13621.1| starch branching enzyme I, partial [Malus asiatica]
Length=89

 Score =   155 bits (391),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 69/80 (86%), Positives = 73/80 (91%), Gaps = 0/80 (0%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFHP NTYEGYKVGCDLP KYRVALDSDAW +GGHGRVGH+V+HFT PEGIPGVPE
Sbjct  10   VFVFNFHPRNTYEGYKVGCDLPRKYRVALDSDAWEFGGHGRVGHNVDHFTFPEGIPGVPE  69

Query  563  TNFNGRPNSFKVLSPPQACV  504
            TNFN RPNSFK+LSP Q CV
Sbjct  70   TNFNNRPNSFKILSPAQTCV  89



>ref|XP_004166744.1| PREDICTED: 1,4-alpha-glucan-branching enzyme-like [Cucumis sativus]
Length=850

 Score =   168 bits (426),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 74/94 (79%), Positives = 85/94 (90%), Gaps = 0/94 (0%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFHP NTY+GYKVGCDLPGKYRVALDSDA  +GGHGRVGHD++HFTSPEGIPGVPE
Sbjct  690  VFVFNFHPVNTYDGYKVGCDLPGKYRVALDSDASDFGGHGRVGHDIDHFTSPEGIPGVPE  749

Query  563  TNFNGRPNSFKVLSPPQACVAYYRVEESLDEVQD  462
            TNFN RPNSFK+LSP + CV YY+V+ES ++ +D
Sbjct  750  TNFNNRPNSFKILSPARTCVVYYKVDESKEKEKD  783



>ref|XP_004144236.1| PREDICTED: 1,4-alpha-glucan-branching enzyme-like [Cucumis sativus]
 gb|KGN47537.1| hypothetical protein Csa_6G357030 [Cucumis sativus]
Length=850

 Score =   168 bits (426),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 74/94 (79%), Positives = 85/94 (90%), Gaps = 0/94 (0%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFHP NTY+GYKVGCDLPGKYRVALDSDA  +GGHGRVGHD++HFTSPEGIPGVPE
Sbjct  690  VFVFNFHPVNTYDGYKVGCDLPGKYRVALDSDASDFGGHGRVGHDIDHFTSPEGIPGVPE  749

Query  563  TNFNGRPNSFKVLSPPQACVAYYRVEESLDEVQD  462
            TNFN RPNSFK+LSP + CV YY+V+ES ++ +D
Sbjct  750  TNFNNRPNSFKILSPARTCVVYYKVDESKEKEKD  783



>gb|AGZ13626.1| starch branching enzyme I, partial [Malus sieboldii]
Length=89

 Score =   154 bits (389),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 69/80 (86%), Positives = 73/80 (91%), Gaps = 0/80 (0%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFHP NTYEGYKVGCDLPGKYRVALDSDAW +GGHGRVGH+V+HFT PEGIPGVPE
Sbjct  10   VFVFNFHPGNTYEGYKVGCDLPGKYRVALDSDAWEFGGHGRVGHNVDHFTFPEGIPGVPE  69

Query  563  TNFNGRPNSFKVLSPPQACV  504
            TNFN RPNS K+LSP Q CV
Sbjct  70   TNFNNRPNSLKILSPAQTCV  89



>ref|XP_008464850.1| PREDICTED: 1,4-alpha-glucan-branching enzyme 1, chloroplastic/amyloplastic-like 
isoform X2 [Cucumis melo]
Length=768

 Score =   166 bits (420),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 78/109 (72%), Positives = 91/109 (83%), Gaps = 3/109 (3%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFHP NTY+GYKVGCDLPGKYRVALDSDA  +GG+GRVGHD++HFTSPEGIPGVPE
Sbjct  602  VFVFNFHPINTYDGYKVGCDLPGKYRVALDSDAGDFGGYGRVGHDIDHFTSPEGIPGVPE  661

Query  563  TNFNGRPNSFKVLSPPQACVAYYRVEESLDEVQD---SSFTETISTNLV  426
            TNFN RPNSFKVLSP + CV YY+V+ES ++ +D   +S  E +S   V
Sbjct  662  TNFNNRPNSFKVLSPARTCVVYYKVDESKEKEKDDLVASVHEDVSARHV  710



>ref|XP_008464849.1| PREDICTED: 1,4-alpha-glucan-branching enzyme 1, chloroplastic/amyloplastic-like 
isoform X1 [Cucumis melo]
 gb|ADN33992.1| starch branching enzyme [Cucumis melo subsp. melo]
Length=856

 Score =   166 bits (421),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 74/94 (79%), Positives = 85/94 (90%), Gaps = 0/94 (0%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFHP NTY+GYKVGCDLPGKYRVALDSDA  +GG+GRVGHD++HFTSPEGIPGVPE
Sbjct  690  VFVFNFHPINTYDGYKVGCDLPGKYRVALDSDAGDFGGYGRVGHDIDHFTSPEGIPGVPE  749

Query  563  TNFNGRPNSFKVLSPPQACVAYYRVEESLDEVQD  462
            TNFN RPNSFKVLSP + CV YY+V+ES ++ +D
Sbjct  750  TNFNNRPNSFKVLSPARTCVVYYKVDESKEKEKD  783



>gb|EMT02068.1| 1,4-alpha-glucan-branching enzyme, chloroplastic/amyloplastic 
[Aegilops tauschii]
Length=779

 Score =   166 bits (419),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 72/94 (77%), Positives = 82/94 (87%), Gaps = 0/94 (0%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFHP  TY+GYKVGCDLPGKY+VALDSDA  +GGHGRV HD +HFTSPEG+PGVPE
Sbjct  627  VFVFNFHPSKTYDGYKVGCDLPGKYKVALDSDALMFGGHGRVAHDNDHFTSPEGVPGVPE  686

Query  563  TNFNGRPNSFKVLSPPQACVAYYRVEESLDEVQD  462
            TNFN RPNSFK+LSP + CVAYYRVEE  ++ +D
Sbjct  687  TNFNNRPNSFKILSPSRTCVAYYRVEEKAEKPKD  720



>gb|AAG27621.1|AF286317_1 starch branching enzyme 1 [Triticum aestivum]
 emb|CAA72987.1| starch branching enzyme I [Triticum aestivum]
Length=830

 Score =   165 bits (418),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 72/94 (77%), Positives = 82/94 (87%), Gaps = 0/94 (0%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFHP  TY+GYKVGCDLPGKY+VALDSDA  +GGHGRV HD +HFTSPEG+PGVPE
Sbjct  678  VFVFNFHPSKTYDGYKVGCDLPGKYKVALDSDALMFGGHGRVAHDNDHFTSPEGVPGVPE  737

Query  563  TNFNGRPNSFKVLSPPQACVAYYRVEESLDEVQD  462
            TNFN RPNSFK+LSP + CVAYYRVEE  ++ +D
Sbjct  738  TNFNNRPNSFKILSPSRTCVAYYRVEEKAEKPKD  771



>gb|AAD30187.1| starch branching enzyme I [Aegilops tauschii subsp. strangulata]
Length=829

 Score =   165 bits (418),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 72/94 (77%), Positives = 82/94 (87%), Gaps = 0/94 (0%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFHP  TY+GYKVGCDLPGKY+VALDSDA  +GGHGRV HD +HFTSPEG+PGVPE
Sbjct  677  VFVFNFHPSKTYDGYKVGCDLPGKYKVALDSDALMFGGHGRVAHDNDHFTSPEGVPGVPE  736

Query  563  TNFNGRPNSFKVLSPPQACVAYYRVEESLDEVQD  462
            TNFN RPNSFK+LSP + CVAYYRVEE  ++ +D
Sbjct  737  TNFNNRPNSFKILSPSRTCVAYYRVEEKAEKPKD  770



>ref|XP_007018020.1| Starch branching enzyme II, putative isoform 2 [Theobroma cacao]
 gb|EOY15245.1| Starch branching enzyme II, putative isoform 2 [Theobroma cacao]
Length=778

 Score =   164 bits (414),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 71/82 (87%), Positives = 77/82 (94%), Gaps = 0/82 (0%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFHP+NTY+GYKVGCDLPGKYRVALDSDAW +GGHGRVGHDV+HFTSPEGIPGVPE
Sbjct  690  VFVFNFHPKNTYDGYKVGCDLPGKYRVALDSDAWEFGGHGRVGHDVDHFTSPEGIPGVPE  749

Query  563  TNFNGRPNSFKVLSPPQACVAY  498
            TNFN RPNSF VLSP + CVA+
Sbjct  750  TNFNNRPNSFIVLSPARTCVAW  771



>gb|AAD30186.1|AF076679_1 starch branching enzyme-I [Triticum aestivum]
Length=807

 Score =   164 bits (414),  Expect = 2e-42, Method: Composition-based stats.
 Identities = 72/94 (77%), Positives = 81/94 (86%), Gaps = 0/94 (0%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFHP  TY+GYKVGCDLPGKY+VALDSDA  +GGHGRV    +HFTSPEG+PGVPE
Sbjct  655  VFVFNFHPSKTYDGYKVGCDLPGKYKVALDSDALMFGGHGRVAQYNDHFTSPEGVPGVPE  714

Query  563  TNFNGRPNSFKVLSPPQACVAYYRVEESLDEVQD  462
            TNFN RPNSFKVLSPP+ CVAYYRVEE  ++ +D
Sbjct  715  TNFNNRPNSFKVLSPPRTCVAYYRVEEKAEKPKD  748



>emb|CAA49372.1| branching enzyme [Manihot esculenta]
Length=85

 Score =   149 bits (376),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 67/74 (91%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFHPENTY+GYKVGCDLPGKYRVALDSDAW +GG GRVGHDV+HFTSPEGIPGVPE
Sbjct  11   VFVFNFHPENTYDGYKVGCDLPGKYRVALDSDAWEFGGRGRVGHDVDHFTSPEGIPGVPE  70

Query  563  TNFNGRPNSFKVLS  522
            TNFN RPNSFK+LS
Sbjct  71   TNFNNRPNSFKILS  84



>ref|XP_003563249.1| PREDICTED: 1,4-alpha-glucan-branching enzyme, chloroplastic/amyloplastic-like 
[Brachypodium distachyon]
Length=829

 Score =   162 bits (410),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 70/90 (78%), Positives = 79/90 (88%), Gaps = 0/90 (0%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFHP  TYEGYKVGCDLPGKYRVALDSDA+ +GGHGRVGHD++HFTSPEG+PGV +
Sbjct  677  VFVFNFHPNKTYEGYKVGCDLPGKYRVALDSDAFLFGGHGRVGHDIDHFTSPEGVPGVAK  736

Query  563  TNFNGRPNSFKVLSPPQACVAYYRVEESLD  474
            TNFN RPNSFKVLSPP+ CV Y R +E  +
Sbjct  737  TNFNNRPNSFKVLSPPRTCVVYKRADEKAE  766



>ref|XP_007018021.1| Starch branching enzyme II, putative isoform 3 [Theobroma cacao]
 ref|XP_007018023.1| Starch branching enzyme II, putative isoform 3 [Theobroma cacao]
 gb|EOY15246.1| Starch branching enzyme II, putative isoform 3 [Theobroma cacao]
 gb|EOY15248.1| Starch branching enzyme II, putative isoform 3 [Theobroma cacao]
Length=770

 Score =   161 bits (407),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 70/80 (88%), Positives = 75/80 (94%), Gaps = 0/80 (0%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFHP+NTY+GYKVGCDLPGKYRVALDSDAW +GGHGRVGHDV+HFTSPEGIPGVPE
Sbjct  690  VFVFNFHPKNTYDGYKVGCDLPGKYRVALDSDAWEFGGHGRVGHDVDHFTSPEGIPGVPE  749

Query  563  TNFNGRPNSFKVLSPPQACV  504
            TNFN RPNSF VLSP + CV
Sbjct  750  TNFNNRPNSFIVLSPARTCV  769



>ref|XP_004291225.1| PREDICTED: 1,4-alpha-glucan-branching enzyme 1, chloroplastic/amyloplastic-like 
[Fragaria vesca subsp. vesca]
Length=800

 Score =   160 bits (405),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 73/92 (79%), Positives = 80/92 (87%), Gaps = 0/92 (0%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFHP NTY+ YKVGCDLPGKYRVALDSDA+ +GGHGRVGHDV+HFT PEGIPGVP 
Sbjct  682  VFVFNFHPVNTYDRYKVGCDLPGKYRVALDSDAFEFGGHGRVGHDVDHFTFPEGIPGVPG  741

Query  563  TNFNGRPNSFKVLSPPQACVAYYRVEESLDEV  468
            TNFN RPNSF+VLSPP+  V YYRVE S  +V
Sbjct  742  TNFNRRPNSFRVLSPPRTSVVYYRVENSTAKV  773



>ref|XP_010266148.1| PREDICTED: 1,4-alpha-glucan-branching enzyme 1, chloroplastic/amyloplastic-like 
isoform X2 [Nelumbo nucifera]
Length=783

 Score =   159 bits (402),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 69/80 (86%), Positives = 75/80 (94%), Gaps = 0/80 (0%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFHPENTY+GYKVGCDLPGKY+V+LDSDAW +GG GRVGHDV+HFTSPEGIPGVPE
Sbjct  694  VFVFNFHPENTYDGYKVGCDLPGKYKVSLDSDAWEFGGQGRVGHDVDHFTSPEGIPGVPE  753

Query  563  TNFNGRPNSFKVLSPPQACV  504
            TNFN RPNSFKVLSP + CV
Sbjct  754  TNFNNRPNSFKVLSPARTCV  773



>ref|XP_010935255.1| PREDICTED: 1,4-alpha-glucan-branching enzyme, chloroplastic/amyloplastic-like 
isoform X2 [Elaeis guineensis]
Length=767

 Score =   158 bits (400),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 69/81 (85%), Positives = 75/81 (93%), Gaps = 0/81 (0%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFHPENTY+GYK+GCDLPGKYRVALDSDA  +GGHGRVGHDV+HFT+PEGIPGVPE
Sbjct  687  VFVFNFHPENTYDGYKIGCDLPGKYRVALDSDALQFGGHGRVGHDVDHFTTPEGIPGVPE  746

Query  563  TNFNGRPNSFKVLSPPQACVA  501
            TNFN RPNSFKVLSP + CV 
Sbjct  747  TNFNNRPNSFKVLSPARTCVV  767



>ref|XP_002960310.1| hypothetical protein SELMODRAFT_437417 [Selaginella moellendorffii]
 gb|EFJ37849.1| hypothetical protein SELMODRAFT_437417 [Selaginella moellendorffii]
Length=798

 Score =   156 bits (394),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 93/127 (73%), Gaps = 2/127 (2%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFHPE TYEGYK+GCDLPGKY++ALDSDA+ +GG GRVGHDV+HFTSPEGIPG PE
Sbjct  669  VFVFNFHPETTYEGYKIGCDLPGKYKIALDSDAFDFGGRGRVGHDVDHFTSPEGIPGRPE  728

Query  563  TNFNGRPNSFKVLSPPQACVAYYRVEESLDEVQDSSFTETISTNLVLVSDDIDDLQELPT  384
            TNFN RP+SF VLSP + C  Y++V E  D VQ     E  + +++ +       ++LP 
Sbjct  729  TNFNNRPSSFLVLSPARTCQVYFKVPE--DAVQSEEENEEPAASVLQLISQSAAQKDLPF  786

Query  383  ENLQELP  363
              + ++P
Sbjct  787  NFMDDIP  793



>ref|XP_007136017.1| hypothetical protein PHAVU_009G011000g [Phaseolus vulgaris]
 dbj|BAA82349.1| starch branching enzyme [Phaseolus vulgaris]
 gb|ESW08011.1| hypothetical protein PHAVU_009G011000g [Phaseolus vulgaris]
Length=847

 Score =   153 bits (386),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 78/95 (82%), Positives = 85/95 (89%), Gaps = 0/95 (0%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            +FVFNFHPENTYEGYKVGCDLPGKYRVALDSDAW +GGHGRVGH V+HFTSPEGIPGVPE
Sbjct  687  IFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWKFGGHGRVGHGVDHFTSPEGIPGVPE  746

Query  563  TNFNGRPNSFKVLSPPQACVAYYRVEESLDEVQDS  459
            TNFN RPNSFKVLSP + CV YYRV+E+ +   DS
Sbjct  747  TNFNNRPNSFKVLSPARTCVVYYRVDENQEGSNDS  781



>gb|AGZ15384.1| starch branching enzyme [Phaseolus vulgaris]
Length=847

 Score =   152 bits (385),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 78/95 (82%), Positives = 85/95 (89%), Gaps = 0/95 (0%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            +FVFNFHPENTYEGYKVGCDLPGKYRVALDSDAW +GGHGRVGH V+HFTSPEGIPGVPE
Sbjct  687  IFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWKFGGHGRVGHGVDHFTSPEGIPGVPE  746

Query  563  TNFNGRPNSFKVLSPPQACVAYYRVEESLDEVQDS  459
            TNFN RPNSFKVLSP + CV YYRV+E+ +   DS
Sbjct  747  TNFNNRPNSFKVLSPARTCVVYYRVDENQEGSNDS  781



>gb|EPS72458.1| hypothetical protein M569_02296, partial [Genlisea aurea]
Length=704

 Score =   144 bits (364),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 65/87 (75%), Positives = 73/87 (84%), Gaps = 0/87 (0%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFH ENTY GYKVGCD PGKYRVALDSD+  +GG+ R+   V+HFTSPEGIPGV E
Sbjct  618  VFVFNFHSENTYGGYKVGCDAPGKYRVALDSDSKEFGGYSRIQRGVDHFTSPEGIPGVAE  677

Query  563  TNFNGRPNSFKVLSPPQACVAYYRVEE  483
            TN+  RPNSFKVLSPP+ C AYYRV+E
Sbjct  678  TNYKNRPNSFKVLSPPRTCQAYYRVQE  704



>ref|XP_009786039.1| PREDICTED: LOW QUALITY PROTEIN: 1,4-alpha-glucan-branching enzyme-like 
[Nicotiana sylvestris]
Length=740

 Score =   144 bits (364),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 67/85 (79%), Positives = 74/85 (87%), Gaps = 6/85 (7%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAW +GGHGRVGHDV+HFTSPEGIPGVPE
Sbjct  653  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWDFGGHGRVGHDVDHFTSPEGIPGVPE  712

Query  563  TNFNGRPNSFKVLSPPQACVAYYRV  489
            TNFNGR    ++LS  + C+ +  V
Sbjct  713  TNFNGR----QILS--KCCLLHAHV  731



>ref|XP_002967402.1| hypothetical protein SELMODRAFT_86954 [Selaginella moellendorffii]
 gb|EFJ32001.1| hypothetical protein SELMODRAFT_86954 [Selaginella moellendorffii]
Length=714

 Score =   142 bits (359),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 62/79 (78%), Positives = 70/79 (89%), Gaps = 0/79 (0%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFHPE TYEGYK+GCDLPGKY++ALDSDA+ +GG  RVGHDV+HFTSPEGIPG PE
Sbjct  624  VFVFNFHPETTYEGYKIGCDLPGKYKIALDSDAFDFGGRVRVGHDVDHFTSPEGIPGRPE  683

Query  563  TNFNGRPNSFKVLSPPQAC  507
            TNFN RP+SF VLSP + C
Sbjct  684  TNFNNRPSSFLVLSPARTC  702



>ref|XP_010320454.1| PREDICTED: LOW QUALITY PROTEIN: 1,4-alpha-glucan-branching enzyme-like 
[Solanum lycopersicum]
Length=847

 Score =   143 bits (361),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 68/102 (67%), Positives = 74/102 (73%), Gaps = 9/102 (9%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFHP NTYEGYKVGCDLPGKYRVALDSDAW +GGHGRVGHDV+HFTSPEGIPGVPE
Sbjct  717  VFVFNFHPNNTYEGYKVGCDLPGKYRVALDSDAWEFGGHGRVGHDVDHFTSPEGIPGVPE  776

Query  563  TNFNGRPNSFKVLSPPQACVA---YYRVEESLDEVQDSSFTE  447
            TNFNGR        P   C+     + + E  +  Q   FT 
Sbjct  777  TNFNGRQ------IPSNCCLLRTHVWLITELTNACQKLKFTR  812



>ref|XP_009631577.1| PREDICTED: LOW QUALITY PROTEIN: 1,4-alpha-glucan-branching enzyme-like 
[Nicotiana tomentosiformis]
Length=823

 Score =   143 bits (361),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 70/109 (64%), Positives = 84/109 (77%), Gaps = 7/109 (6%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNF PENTYEGYKVGCDLPGKYRVALDSDAW +GGHGRVGHDV+HFTSPEGIPGVPE
Sbjct  694  VFVFNFQPENTYEGYKVGCDLPGKYRVALDSDAWDFGGHGRVGHDVDHFTSPEGIPGVPE  753

Query  563  TNFNGRPNSFKVLSPPQACVAYYRVEESLDEVQDSSFTETISTNLVLVS  417
            TNFNGR    ++LS  + C+ +  V   + E++ +   + ++    LVS
Sbjct  754  TNFNGR----QILS--KCCLLHAHV-WLITELKKTXQKQKMTRQSFLVS  795



>ref|NP_001275183.1| 1,4-alpha-glucan-branching enzyme [Solanum tuberosum]
 sp|P30924.2|GLGB_SOLTU RecName: Full=1,4-alpha-glucan-branching enzyme; AltName: Full=Q-enzyme; 
AltName: Full=Starch-branching enzyme [Solanum tuberosum]
 emb|CAA49463.1| 1,4-alpha-glucan branching enzyme [Solanum tuberosum]
Length=861

 Score =   143 bits (361),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 70/124 (56%), Positives = 81/124 (65%), Gaps = 7/124 (6%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFHP+NTYEGYKVGCDLPGKYRVALDSDAW +GGHGR GHDV+HFTSPEGIPGVPE
Sbjct  694  VFVFNFHPKNTYEGYKVGCDLPGKYRVALDSDAWEFGGHGRTGHDVDHFTSPEGIPGVPE  753

Query  563  TNFNGRPNSFKVLSPPQACVAYYRVEESLDEVQDSSFTETISTNLVLVSDDIDDLQELPT  384
            TNFNGR         P  C         + E+ ++     I+    +VS     +    T
Sbjct  754  TNFNGR-------QIPSKCCLLREHVWLITELMNACQKLKITRQTFVVSYYQQPISRRVT  806

Query  383  ENLQ  372
             NL+
Sbjct  807  RNLK  810



>ref|XP_006342128.1| PREDICTED: LOW QUALITY PROTEIN: 1,4-alpha-glucan-branching enzyme-like 
[Solanum tuberosum]
Length=875

 Score =   142 bits (359),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 70/124 (56%), Positives = 80/124 (65%), Gaps = 7/124 (6%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFHP NTYEGYKVGCDLPGKYRVALDSDAW +GGHGR GHDV+HFTSPEGIPGVPE
Sbjct  694  VFVFNFHPNNTYEGYKVGCDLPGKYRVALDSDAWEFGGHGRAGHDVDHFTSPEGIPGVPE  753

Query  563  TNFNGRPNSFKVLSPPQACVAYYRVEESLDEVQDSSFTETISTNLVLVSDDIDDLQELPT  384
            TNFNGR         P  C         + E+ ++     I+    +VS     +    T
Sbjct  754  TNFNGR-------QIPSKCCLLREHVWLITELMNACQKLKITRQTFVVSYYQQPISRKVT  806

Query  383  ENLQ  372
             NL+
Sbjct  807  RNLK  810



>ref|XP_001754772.1| predicted protein [Physcomitrella patens]
 gb|EDQ80226.1| predicted protein [Physcomitrella patens]
Length=688

 Score =   135 bits (340),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 58/87 (67%), Positives = 71/87 (82%), Gaps = 0/87 (0%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFHP NTY G KVGC++PGKYR+ LDSDA  +GGH RV H+V+HFTSPEG PG PE
Sbjct  602  VFVFNFHPTNTYSGLKVGCEIPGKYRICLDSDAAEFGGHSRVDHNVDHFTSPEGEPGRPE  661

Query  563  TNFNGRPNSFKVLSPPQACVAYYRVEE  483
            TN+N RP+SF V++P ++C  YY+V E
Sbjct  662  TNYNNRPHSFMVMAPSRSCQVYYKVPE  688



>ref|XP_001762321.1| predicted protein [Physcomitrella patens]
 gb|EDQ72788.1| predicted protein [Physcomitrella patens]
Length=688

 Score =   125 bits (315),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 53/79 (67%), Positives = 64/79 (81%), Gaps = 0/79 (0%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            V VFNFHP NTY G KVGCD+PGKYR+ LDSDA  +GGH RV H V+HFTSPEG PG PE
Sbjct  602  VVVFNFHPTNTYSGLKVGCDVPGKYRICLDSDAAEFGGHSRVDHKVDHFTSPEGEPGKPE  661

Query  563  TNFNGRPNSFKVLSPPQAC  507
            TN+N RP+SF +++P ++C
Sbjct  662  TNYNNRPHSFMIMAPSRSC  680



>ref|XP_001763855.1| predicted protein [Physcomitrella patens]
 gb|EDQ71259.1| predicted protein [Physcomitrella patens]
Length=688

 Score =   118 bits (295),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 52/87 (60%), Positives = 65/87 (75%), Gaps = 0/87 (0%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFH  NTY   KVGC++PG YR+ LDSDA  +GGH RV H+V H T+PEG PG PE
Sbjct  602  VFVFNFHSTNTYPELKVGCEIPGNYRICLDSDAAEFGGHSRVDHEVNHCTNPEGEPGKPE  661

Query  563  TNFNGRPNSFKVLSPPQACVAYYRVEE  483
            T +N RP+SF V+SP ++C  Y++V E
Sbjct  662  TGYNNRPHSFMVMSPSRSCQVYHKVSE  688



>dbj|BAJ89587.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=118

 Score =   106 bits (265),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 45/59 (76%), Positives = 52/59 (88%), Gaps = 0/59 (0%)
 Frame = -2

Query  638  YGGHGRVGHDVEHFTSPEGIPGVPETNFNGRPNSFKVLSPPQACVAYYRVEESLDEVQD  462
            +GGHGRV HD +HFTSPEGIPGVPETNFN RPNSFK+LSPP+ CVAYYRVEE  ++ +D
Sbjct  1    FGGHGRVAHDSDHFTSPEGIPGVPETNFNNRPNSFKILSPPRTCVAYYRVEEKAEKPKD  59



>ref|XP_002505138.1| glycoside hydrolase family 13 protein [Micromonas sp. RCC299]
 gb|ACO66396.1| glycoside hydrolase family 13 protein [Micromonas sp. RCC299]
Length=980

 Score =   103 bits (257),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 54/107 (50%), Positives = 70/107 (65%), Gaps = 11/107 (10%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            +FVFNFHP  +YEG +VG  +PGKYR+ LD+DAW +GG GRVGHD +HFTSP G    P+
Sbjct  679  LFVFNFHPTESYEGLEVGLGMPGKYRICLDTDAWNFGGAGRVGHDEDHFTSPGG----PK  734

Query  563  TNFNG------RPNSFKVLSPPQACVAYYRVEESLDEVQDSSFTETI  441
            T F G      RP S KVLSP ++   +Y+V E   ++  SS  E +
Sbjct  735  T-FVGPYEQEPRPCSLKVLSPSRSAQVFYKVPEDDIDMSLSSAGENV  780



>ref|XP_005649964.1| starch branching enzyme [Coccomyxa subellipsoidea C-169]
 gb|EIE25420.1| starch branching enzyme [Coccomyxa subellipsoidea C-169]
Length=760

 Score =   102 bits (254),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 47/82 (57%), Positives = 54/82 (66%), Gaps = 0/82 (0%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            +FVFNF P N+YEGYKVG   PG+Y+  L SD   +GG GR+ HD EHFT PEG PG PE
Sbjct  667  LFVFNFSPFNSYEGYKVGTPEPGRYKAVLTSDDVEFGGRGRINHDTEHFTHPEGTPGAPE  726

Query  563  TNFNGRPNSFKVLSPPQACVAY  498
            TNFN R  S  V SP +    Y
Sbjct  727  TNFNDRAFSMLVASPSRTVAVY  748



>gb|AGZ13625.1| starch branching enzyme I, partial [Malus sieversii var. kirghisorum]
Length=50

 Score = 92.0 bits (227),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 38/41 (93%), Positives = 39/41 (95%), Gaps = 0/41 (0%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGR  621
            VFVFNFHP NTYEGYKVGCDLPGKYRVALDSDAW +GGHGR
Sbjct  10   VFVFNFHPRNTYEGYKVGCDLPGKYRVALDSDAWEFGGHGR  50



>ref|XP_003060477.1| glycoside hydrolase family 13 protein [Micromonas pusilla CCMP1545]
 gb|EEH55246.1| glycoside hydrolase family 13 protein [Micromonas pusilla CCMP1545]
Length=887

 Score = 97.8 bits (242),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 44/88 (50%), Positives = 61/88 (69%), Gaps = 1/88 (1%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEG-IPGVP  567
            +FVFNFHP  +YEG +VG  + GKYR+ LD+DAW++GG GRVGHD +HF++P G +  V 
Sbjct  642  LFVFNFHPTESYEGLEVGVGMGGKYRIVLDTDAWSFGGQGRVGHDFDHFSNPGGPVTFVG  701

Query  566  ETNFNGRPNSFKVLSPPQACVAYYRVEE  483
                  RP S KVLSP +    Y++++E
Sbjct  702  PYEQEPRPASLKVLSPCRCAQVYFKIDE  729



>gb|KHN20114.1| 1,4-alpha-glucan-branching enzyme [Glycine soja]
Length=158

 Score = 92.0 bits (227),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 38/42 (90%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRV  618
            +FVFNFHPENTYEGYKVGCDLPGKYRV LDSDAW +GGHGRV
Sbjct  71   IFVFNFHPENTYEGYKVGCDLPGKYRVVLDSDAWEFGGHGRV  112



>gb|AAT76445.1| starch branching enzyme I [Vigna radiata]
Length=735

 Score = 94.0 bits (232),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 39/42 (93%), Positives = 41/42 (98%), Gaps = 0/42 (0%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRV  618
            +FVFNFHPENTYEGYKVGCDLPGKYRVALDSDAW +GGHGRV
Sbjct  687  IFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWEFGGHGRV  728



>ref|XP_002955298.1| 1,4-alpha-glucan branching enzyme II [Volvox carteri f. nagariensis]
 gb|EFJ43598.1| 1,4-alpha-glucan branching enzyme II [Volvox carteri f. nagariensis]
Length=824

 Score = 93.6 bits (231),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 43/83 (52%), Positives = 57/83 (69%), Gaps = 5/83 (6%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFN+ P +++EGY+V    PGK+RVALDSDAW +GG GRVGHD++HF+ PE     P 
Sbjct  687  VFVFNWSPFSSFEGYRVAVPCPGKWRVALDSDAWDFGGEGRVGHDMDHFSDPE-----PA  741

Query  563  TNFNGRPNSFKVLSPPQACVAYY  495
                 R +S +VL+P +  V YY
Sbjct  742  GTSRDRQHSIRVLAPSRTAVVYY  764



>ref|XP_006435351.1| hypothetical protein CICLE_v10000256mg [Citrus clementina]
 gb|ESR48591.1| hypothetical protein CICLE_v10000256mg [Citrus clementina]
Length=760

 Score = 91.7 bits (226),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 39/44 (89%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGH  612
            VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAW +GG GR G+
Sbjct  688  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWGFGGDGRKGY  731



>ref|XP_005852171.1| hypothetical protein CHLNCDRAFT_33566 [Chlorella variabilis]
 gb|EFN60069.1| hypothetical protein CHLNCDRAFT_33566 [Chlorella variabilis]
Length=794

 Score = 91.3 bits (225),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 47/98 (48%), Positives = 58/98 (59%), Gaps = 11/98 (11%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKV-----------GCDLPGKYRVALDSDAWAYGGHGRVGHDVEHF  597
            V+VFNF P + YEG +            G   PGKYRV LDSDAW +GG GRVGHDV+HF
Sbjct  674  VWVFNFSPHSDYEGLQARRLAGAGAGDPGAASPGKYRVILDSDAWDFGGAGRVGHDVDHF  733

Query  596  TSPEGIPGVPETNFNGRPNSFKVLSPPQACVAYYRVEE  483
            ++P G    P+  +  R     VLSP +  VAY +VEE
Sbjct  734  SAPAGTEEEPDKTYYSRGQFIYVLSPSRTVVAYKKVEE  771



>ref|XP_006435350.1| hypothetical protein CICLE_v10000256mg [Citrus clementina]
 gb|ESR48590.1| hypothetical protein CICLE_v10000256mg [Citrus clementina]
Length=731

 Score = 89.7 bits (221),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 38/41 (93%), Positives = 39/41 (95%), Gaps = 0/41 (0%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGR  621
            VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAW +GG GR
Sbjct  688  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWGFGGDGR  728



>gb|AAP05848.1| amylose extender starch-branching enzyme, partial [Zea mays subsp. 
mays]
 gb|AAP05849.1| amylose extender starch-branching enzyme, partial [Zea mays subsp. 
mays]
 gb|AAP05850.1| amylose extender starch-branching enzyme, partial [Zea mays subsp. 
mays]
 gb|AAP05851.1| amylose extender starch-branching enzyme, partial [Zea mays subsp. 
mays]
 gb|AAP05852.1| amylose extender starch-branching enzyme, partial [Zea mays subsp. 
mays]
 gb|AAP05853.1| amylose extender starch-branching enzyme, partial [Zea mays subsp. 
mays]
 gb|AAP05854.1| amylose extender starch-branching enzyme, partial [Zea mays subsp. 
mays]
 gb|AAP05855.1| amylose extender starch-branching enzyme, partial [Zea mays subsp. 
mays]
 gb|AAP05856.1| amylose extender starch-branching enzyme, partial [Zea mays subsp. 
mays]
 gb|AAP05857.1| amylose extender starch-branching enzyme, partial [Zea mays subsp. 
mays]
 gb|AAP05859.1| amylose extender starch-branching enzyme, partial [Zea mays subsp. 
mays]
 gb|AAP05861.1| amylose extender starch-branching enzyme, partial [Zea mays subsp. 
mays]
 gb|AAP05862.1| amylose extender starch-branching enzyme, partial [Zea mays subsp. 
mays]
 gb|AAP05863.1| amylose extender starch-branching enzyme, partial [Zea mays subsp. 
mays]
 gb|AAP05864.1| amylose extender starch-branching enzyme, partial [Zea mays subsp. 
mays]
 gb|AAP05865.1| amylose extender starch-branching enzyme, partial [Zea mays subsp. 
mays]
 gb|AAP05866.1| amylose extender starch-branching enzyme, partial [Zea mays subsp. 
mays]
 gb|AAP05867.1| amylose extender starch-branching enzyme, partial [Zea mays subsp. 
mays]
 gb|AAP05868.1| amylose extender starch-branching enzyme, partial [Zea mays subsp. 
mays]
 gb|AAP05869.1| amylose extender starch-branching enzyme, partial [Zea mays subsp. 
mays]
 gb|AAP05870.1| amylose extender starch-branching enzyme, partial [Zea mays subsp. 
mays]
 gb|AAP05871.1| amylose extender starch-branching enzyme, partial [Zea mays subsp. 
mays]
 gb|AAP05872.1| amylose extender starch-branching enzyme, partial [Zea mays subsp. 
mays]
 gb|AAP05873.1| amylose extender starch-branching enzyme, partial [Zea mays subsp. 
mays]
 gb|AAP05874.1| amylose extender starch-branching enzyme, partial [Zea mays subsp. 
mays]
 gb|AAP05875.1| amylose extender starch-branching enzyme, partial [Zea mays subsp. 
mays]
 gb|AAP05876.1| amylose extender starch-branching enzyme, partial [Zea mays subsp. 
mays]
Length=130

 Score = 82.4 bits (202),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 40/86 (47%), Positives = 52/86 (60%), Gaps = 8/86 (9%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFH  N+Y  Y++GC  PG Y+V LDSDA  +GG  R+ H  EHFT+        +
Sbjct  53   VFVFNFHCNNSYFDYRIGCRKPGVYKVVLDSDAGLFGGFSRIHHAAEHFTA--------D  104

Query  563  TNFNGRPNSFKVLSPPQACVAYYRVE  486
             + + RP SF V +P + CV Y  VE
Sbjct  105  CSHDNRPYSFSVYTPSRTCVVYAPVE  130



>gb|AAP05860.1| amylose extender starch-branching enzyme, partial [Zea mays subsp. 
mays]
Length=130

 Score = 82.4 bits (202),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 40/86 (47%), Positives = 52/86 (60%), Gaps = 8/86 (9%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFH  N+Y  Y++GC  PG Y+V LDSDA  +GG  R+ H  EHFT+        +
Sbjct  53   VFVFNFHCNNSYFDYRIGCRKPGVYKVVLDSDAGLFGGFSRIHHAAEHFTA--------D  104

Query  563  TNFNGRPNSFKVLSPPQACVAYYRVE  486
             + + RP SF V +P + CV Y  VE
Sbjct  105  CSHDNRPYSFSVYTPSRTCVVYAPVE  130



>gb|EAY86110.1| hypothetical protein OsI_07480 [Oryza sativa Indica Group]
 gb|ACY56134.1| starch branching enzyme 3 [Oryza sativa Indica Group]
 gb|ACY56135.1| starch branching enzyme 3 [Oryza sativa Indica Group]
 gb|ACY56136.1| starch branching enzyme 3 [Oryza sativa Indica Group]
 gb|ACY56138.1| starch branching enzyme 3 [Oryza sativa Indica Group]
 gb|ACY56141.1| starch branching enzyme 3 [Oryza sativa Indica Group]
Length=825

 Score = 87.0 bits (214),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 42/82 (51%), Positives = 52/82 (63%), Gaps = 8/82 (10%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFH  N+Y  Y+VGC  PGKY+V LDSDA  +GG GR+ H  EHFT+        +
Sbjct  748  VFVFNFHWSNSYFDYRVGCLKPGKYKVVLDSDAGLFGGFGRIHHTAEHFTA--------D  799

Query  563  TNFNGRPNSFKVLSPPQACVAY  498
             + + RP SF V SP + CV Y
Sbjct  800  CSHDNRPYSFSVYSPSRTCVVY  821



>gb|ACE88265.1| rice starch branching enzyme [Oryza sativa Japonica Group]
Length=825

 Score = 87.0 bits (214),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 42/82 (51%), Positives = 52/82 (63%), Gaps = 8/82 (10%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFH  N+Y  Y+VGC  PGKY+V LDSDA  +GG GR+ H  EHFT+        +
Sbjct  748  VFVFNFHWSNSYFDYRVGCLKPGKYKVVLDSDAGLFGGFGRIHHTAEHFTA--------D  799

Query  563  TNFNGRPNSFKVLSPPQACVAY  498
             + + RP SF V SP + CV Y
Sbjct  800  CSHDNRPYSFSVYSPSRTCVVY  821



>ref|NP_001047009.1| Os02g0528200 [Oryza sativa Japonica Group]
 dbj|BAA03738.1| branching enzyme-3 precursor [Oryza sativa]
 dbj|BAD25601.1| branching enzyme-3 precursor [Oryza sativa Japonica Group]
 dbj|BAF08923.1| Os02g0528200 [Oryza sativa Japonica Group]
 gb|EAZ23285.1| hypothetical protein OsJ_06982 [Oryza sativa Japonica Group]
 gb|ACY56128.1| starch branching enzyme 3 [Oryza sativa Japonica Group]
 gb|ACY56129.1| starch branching enzyme 3 [Oryza sativa Japonica Group]
 gb|ACY56130.1| starch branching enzyme 3 [Oryza sativa Japonica Group]
 gb|ACY56131.1| starch branching enzyme 3 [Oryza sativa Japonica Group]
 gb|ACY56132.1| starch branching enzyme 3 [Oryza sativa Japonica Group]
 gb|ACY56133.1| starch branching enzyme 3 [Oryza sativa Japonica Group]
 gb|ACY56137.1| starch branching enzyme 3 [Oryza sativa Indica Group]
 gb|ACY56139.1| starch branching enzyme 3 [Oryza sativa Indica Group]
 gb|ACY56140.1| starch branching enzyme 3 [Oryza sativa Indica Group]
Length=825

 Score = 87.0 bits (214),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 42/82 (51%), Positives = 52/82 (63%), Gaps = 8/82 (10%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFH  N+Y  Y+VGC  PGKY+V LDSDA  +GG GR+ H  EHFT+        +
Sbjct  748  VFVFNFHWSNSYFDYRVGCLKPGKYKVVLDSDAGLFGGFGRIHHTAEHFTA--------D  799

Query  563  TNFNGRPNSFKVLSPPQACVAY  498
             + + RP SF V SP + CV Y
Sbjct  800  CSHDNRPYSFSVYSPSRTCVVY  821



>gb|KIZ01544.1| 1,4-alpha-glucan branching enzyme [Monoraphidium neglectum]
Length=392

 Score = 85.5 bits (210),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 43/89 (48%), Positives = 54/89 (61%), Gaps = 3/89 (3%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPG---  573
            VFVFNF P   +EG KV    PGK+RV +DSD   +GG GRVGHD +HFTSP    G   
Sbjct  138  VFVFNFSPHTDHEGLKVATPEPGKWRVIIDSDDPRFGGQGRVGHDTDHFTSPAAEAGEAE  197

Query  572  VPETNFNGRPNSFKVLSPPQACVAYYRVE  486
            + E  F+ R    +VL+P +  V Y RV+
Sbjct  198  LKEGRFHDRDQFMQVLAPARTVVGYTRVK  226



>gb|AFN27052.1| starch branching enzyme 3 [Oryza sativa Japonica Group]
Length=825

 Score = 87.0 bits (214),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 42/82 (51%), Positives = 52/82 (63%), Gaps = 8/82 (10%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFH  N+Y  Y+VGC  PGKY+V LDSDA  +GG GR+ H  EHFT+        +
Sbjct  748  VFVFNFHWSNSYFDYRVGCLKPGKYKVVLDSDAGLFGGFGRIHHTAEHFTA--------D  799

Query  563  TNFNGRPNSFKVLSPPQACVAY  498
             + + RP SF V SP + CV Y
Sbjct  800  CSHDNRPYSFSVYSPSRTCVVY  821



>ref|XP_001695391.1| starch branching enzyme [Chlamydomonas reinhardtii]
 gb|EDP01649.1| starch branching enzyme, partial [Chlamydomonas reinhardtii]
Length=690

 Score = 86.7 bits (213),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 41/83 (49%), Positives = 51/83 (61%), Gaps = 5/83 (6%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            +FVFN+ P    E Y+V    PGK+RVALDSDAW YGG GRV HD +HF+ PE     P 
Sbjct  610  LFVFNWSPIADREAYRVAVPAPGKWRVALDSDAWDYGGAGRVFHDADHFSDPE-----PA  664

Query  563  TNFNGRPNSFKVLSPPQACVAYY  495
                 R +S +VL+P + C  YY
Sbjct  665  GTSRDREHSIRVLAPARTCAVYY  687



>ref|XP_003575058.1| PREDICTED: 1,4-alpha-glucan-branching enzyme 2, chloroplastic/amyloplastic-like 
[Brachypodium distachyon]
Length=835

 Score = 86.7 bits (213),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 41/82 (50%), Positives = 52/82 (63%), Gaps = 8/82 (10%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFH  N+Y  Y+VGC  PGKY+V LDSDA  +GG GR+ H  +HFTS        +
Sbjct  758  VFVFNFHCSNSYFDYRVGCLKPGKYKVVLDSDAGVFGGFGRIHHTADHFTS--------D  809

Query  563  TNFNGRPNSFKVLSPPQACVAY  498
               + RP+SF V +P + CV Y
Sbjct  810  CQHDNRPHSFSVYTPSRTCVVY  831



>ref|XP_006647330.1| PREDICTED: 1,4-alpha-glucan-branching enzyme 2, chloroplastic/amyloplastic-like, 
partial [Oryza brachyantha]
Length=789

 Score = 86.7 bits (213),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 41/82 (50%), Positives = 52/82 (63%), Gaps = 8/82 (10%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFH  N+Y  Y++GC  PGKY+V LDSDA  +GG GR+ H  EHFT+        +
Sbjct  712  VFVFNFHWSNSYFDYRIGCLKPGKYKVVLDSDAGLFGGFGRIHHTAEHFTA--------D  763

Query  563  TNFNGRPNSFKVLSPPQACVAY  498
             + + RP SF V SP + CV Y
Sbjct  764  CSHDNRPYSFSVYSPSRTCVVY  785



>gb|AAP72267.1| starch branching enzyme IIb [Sorghum bicolor]
Length=803

 Score = 86.3 bits (212),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 41/86 (48%), Positives = 54/86 (63%), Gaps = 8/86 (9%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFH  N+Y  Y++GC  PG Y+V LDSDA  +GG GR+ H  EHFT+        +
Sbjct  726  VFVFNFHCNNSYFDYRIGCRKPGMYKVVLDSDAGLFGGFGRIHHAAEHFTT--------D  777

Query  563  TNFNGRPNSFKVLSPPQACVAYYRVE  486
             + + RP+SF V +P + CV Y  VE
Sbjct  778  CSHDNRPHSFSVYTPSRTCVVYAPVE  803



>dbj|BAA01616.1| 1,4-alpha-glucan branching enzyme [Oryza sativa Japonica Group]
Length=820

 Score = 85.9 bits (211),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 45/93 (48%), Positives = 53/93 (57%), Gaps = 0/93 (0%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFHP  TY+GYKVGCDLPGKYRVALDSDA  +GGHGR+         P       +
Sbjct  674  VFVFNFHPNKTYKGYKVGCDLPGKYRVALDSDALVFGGHGRLAMMWITSRLPRECQEYQK  733

Query  563  TNFNGRPNSFKVLSPPQACVAYYRVEESLDEVQ  465
                      K    P    AYYRV+E  +E++
Sbjct  734  QISTTALTHSKSFPRPVPVWAYYRVDEDREELR  766



>gb|AAW80631.1| starch branching enzyme IIb [Triticum aestivum]
Length=836

 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 41/82 (50%), Positives = 52/82 (63%), Gaps = 8/82 (10%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFH  ++Y  Y+VGC  PGKY+V LDSDA  +GG GR+ H  EHFTS        +
Sbjct  759  VFVFNFHWSSSYFDYRVGCLKPGKYKVVLDSDAGLFGGFGRIHHTAEHFTS--------D  810

Query  563  TNFNGRPNSFKVLSPPQACVAY  498
               + RP+SF V +P + CV Y
Sbjct  811  CQHDNRPHSFSVYTPSRTCVVY  832



>gb|AAP05858.1| amylose extender starch-branching enzyme, partial [Zea mays subsp. 
mays]
Length=130

 Score = 80.1 bits (196),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 39/86 (45%), Positives = 51/86 (59%), Gaps = 8/86 (9%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFH  N+Y  Y++GC  PG Y+V LDSDA  +GG  R+ H  EHF +        +
Sbjct  53   VFVFNFHCNNSYFDYRIGCRKPGVYKVVLDSDAGLFGGFSRIHHAAEHFXA--------D  104

Query  563  TNFNGRPNSFKVLSPPQACVAYYRVE  486
             + + RP SF V +P + CV Y  VE
Sbjct  105  CSHDNRPYSFSVYTPSRTCVVYAPVE  130



>ref|XP_002453926.1| hypothetical protein SORBIDRAFT_04g021540 [Sorghum bicolor]
 gb|EES06902.1| hypothetical protein SORBIDRAFT_04g021540 [Sorghum bicolor]
Length=803

 Score = 85.1 bits (209),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 39/82 (48%), Positives = 52/82 (63%), Gaps = 8/82 (10%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFH  N+Y  Y++GC  PG Y+V LDSDA  +GG GR+ H  EHFT+        +
Sbjct  726  VFVFNFHCNNSYFDYRIGCRKPGMYKVVLDSDAGLFGGFGRIHHAAEHFTT--------D  777

Query  563  TNFNGRPNSFKVLSPPQACVAY  498
             + + RP+SF V +P + CV Y
Sbjct  778  CSHDNRPHSFSVYTPSRTCVVY  799



>emb|CAX51367.1| starch branching enzyme [Hordeum vulgare subsp. vulgare]
Length=601

 Score = 84.3 bits (207),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 43/82 (52%), Positives = 52/82 (63%), Gaps = 8/82 (10%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFH  N+Y  Y+VGC  PGKY+V LDSDA  +GG GR+ H  EHFT+     G   
Sbjct  524  VFVFNFHWSNSYFDYRVGCLKPGKYKVVLDSDAGLFGGFGRIHHTGEHFTN-----GCQH  578

Query  563  TNFNGRPNSFKVLSPPQACVAY  498
             N   RP+SF V +P + CV Y
Sbjct  579  DN---RPHSFSVYTPSRTCVVY  597



>ref|XP_009599017.1| PREDICTED: 1,4-alpha-glucan-branching enzyme 1, chloroplastic/amyloplastic-like, 
partial [Nicotiana tomentosiformis]
Length=144

 Score = 79.7 bits (195),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 41/92 (45%), Positives = 56/92 (61%), Gaps = 8/92 (9%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFH  N+Y  Y++GC  PGKY+V LDSD   +GG GR+ H+ E FT         E
Sbjct  57   VFVFNFHWTNSYSDYRIGCLKPGKYKVVLDSDDPLFGGFGRIDHNAEFFTF--------E  108

Query  563  TNFNGRPNSFKVLSPPQACVAYYRVEESLDEV  468
              ++ RP+SF V +P +  V Y  V++  +EV
Sbjct  109  GWYDDRPSSFMVYAPSRTAVVYALVDKVEEEV  140



>gb|AAC69754.1| starch branching enzyme IIb [Hordeum vulgare subsp. vulgare]
Length=829

 Score = 84.3 bits (207),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 43/82 (52%), Positives = 52/82 (63%), Gaps = 8/82 (10%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFH  N+Y  Y+VGC  PGKY+V LDSDA  +GG GR+ H  EHFT+     G   
Sbjct  752  VFVFNFHWSNSYFDYRVGCLKPGKYKVVLDSDAGLFGGFGRIHHTGEHFTN-----GCQH  806

Query  563  TNFNGRPNSFKVLSPPQACVAY  498
             N   RP+SF V +P + CV Y
Sbjct  807  DN---RPHSFSVYTPSRTCVVY  825



>ref|XP_003450238.2| PREDICTED: 1,4-alpha-glucan-branching enzyme-like [Oreochromis 
niloticus]
Length=717

 Score = 84.3 bits (207),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 38/81 (47%), Positives = 51/81 (63%), Gaps = 8/81 (10%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            +F+FNFHP  +++ Y+V  + PGKY++ LDSDA  YGGHGR+ H+ E FT PE       
Sbjct  635  LFIFNFHPNKSFQDYRVAVEAPGKYKIKLDSDAVQYGGHGRLDHNTEFFTYPE-------  687

Query  563  TNFNGRPNSFKVLSPPQACVA  501
              FNGR NS KV  P +  + 
Sbjct  688  -PFNGRSNSIKVYIPCRTAIV  707



>ref|XP_007881428.1| hypothetical protein PFL1_05702 [Pseudozyma flocculosa PF-1]
 gb|EPQ26723.1| hypothetical protein PFL1_05702 [Pseudozyma flocculosa PF-1]
Length=701

 Score = 83.6 bits (205),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 39/84 (46%), Positives = 53/84 (63%), Gaps = 8/84 (10%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            +F+FNFHP N+Y  Y+VG +LPGKY+V LDSD   +GGH RV H VE+FT+        +
Sbjct  624  LFIFNFHPTNSYTDYRVGVELPGKYKVLLDSDEKRFGGHDRVDHSVEYFTT--------D  675

Query  563  TNFNGRPNSFKVLSPPQACVAYYR  492
              +NGR N  +V  P + C+   R
Sbjct  676  MPWNGRANFLQVYLPTRTCLVLER  699



>ref|XP_001417321.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO95614.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=751

 Score = 83.6 bits (205),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 44/88 (50%), Positives = 54/88 (61%), Gaps = 1/88 (1%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPG-VP  567
            +FVFNFHP NTYEG ++G    GKYR+ALD+DA  +GG  R G  V+HFTSPE +   V 
Sbjct  639  LFVFNFHPTNTYEGLEIGVPEQGKYRLALDTDAGEFGGASRCGFGVDHFTSPEPVESWVG  698

Query  566  ETNFNGRPNSFKVLSPPQACVAYYRVEE  483
                  R     VLSP ++   YYRV E
Sbjct  699  PYEQTPRAAKMFVLSPSRSAQVYYRVHE  726



>gb|ABK80522.1| putative starch branching enzyme IIb, partial [Sorghum bicolor]
 gb|ABK80523.1| putative starch branching enzyme IIb, partial [Sorghum bicolor]
 gb|ABK80524.1| putative starch branching enzyme IIb, partial [Sorghum bicolor]
 gb|ABK80525.1| putative starch branching enzyme IIb, partial [Sorghum bicolor]
 gb|ABK80526.1| putative starch branching enzyme IIb, partial [Sorghum bicolor]
 gb|ABK80527.1| putative starch branching enzyme IIb, partial [Sorghum bicolor]
 gb|ABK80528.1| putative starch branching enzyme IIb, partial [Sorghum bicolor]
 gb|ABK80529.1| putative starch branching enzyme IIb, partial [Sorghum bicolor]
 gb|ABK80530.1| putative starch branching enzyme IIb, partial [Sorghum bicolor]
 gb|ABK80531.1| putative starch branching enzyme IIb, partial [Sorghum bicolor]
 gb|ABK80532.1| putative starch branching enzyme IIb, partial [Sorghum bicolor]
 gb|ABK80533.1| putative starch branching enzyme IIb, partial [Sorghum bicolor]
 gb|ABK80534.1| putative starch branching enzyme IIb, partial [Sorghum bicolor]
 gb|ABK80535.1| putative starch branching enzyme IIb, partial [Sorghum bicolor]
 gb|ABK80536.1| putative starch branching enzyme IIb, partial [Sorghum bicolor]
 gb|ABK80537.1| putative starch branching enzyme IIb, partial [Sorghum bicolor]
 gb|ABK80538.1| putative starch branching enzyme IIb, partial [Sorghum bicolor]
 gb|ABK80539.1| putative starch branching enzyme IIb, partial [Sorghum bicolor]
 gb|ABK80540.1| putative starch branching enzyme IIb, partial [Sorghum bicolor]
 gb|ABK80541.1| putative starch branching enzyme IIb, partial [Sorghum bicolor]
 gb|ABK80542.1| putative starch branching enzyme IIb, partial [Sorghum bicolor]
 gb|ABK80543.1| putative starch branching enzyme IIb, partial [Sorghum bicolor]
 gb|ABK80544.1| putative starch branching enzyme IIb, partial [Sorghum bicolor]
 gb|ABK80545.1| putative starch branching enzyme IIb, partial [Sorghum bicolor]
Length=95

 Score = 77.4 bits (189),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/77 (47%), Positives = 49/77 (64%), Gaps = 8/77 (10%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFH  N+Y  Y++GC  PG Y+V LDSDA  +GG GR+ H  EHFT+        +
Sbjct  27   VFVFNFHCNNSYFDYRIGCRKPGMYKVVLDSDAGLFGGFGRIHHAAEHFTT--------D  78

Query  563  TNFNGRPNSFKVLSPPQ  513
             + + RP+SF V +P +
Sbjct  79   CSHDNRPHSFSVYTPSR  95



>gb|AAY89377.1| starch branching enzyme 2 [Nicotiana langsdorffii x Nicotiana 
sanderae]
Length=115

 Score = 77.8 bits (190),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 50/82 (61%), Gaps = 8/82 (10%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFH  N Y  Y++GC  PGKY++ LDSD   +GG GR+ H+ E+FT         E
Sbjct  29   VFVFNFHWTNNYSDYRIGCLKPGKYKIVLDSDDPLFGGFGRIDHNAEYFTF--------E  80

Query  563  TNFNGRPNSFKVLSPPQACVAY  498
              ++ RP+SF V +P +  V Y
Sbjct  81   GWYDDRPSSFMVYAPSRTAVVY  102



>ref|XP_005926553.1| PREDICTED: 1,4-alpha-glucan-branching enzyme-like [Haplochromis 
burtoni]
Length=717

 Score = 83.2 bits (204),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 37/81 (46%), Positives = 51/81 (63%), Gaps = 8/81 (10%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            +F+FNFHP  +++ Y+V  + PGKY++ LDSDA  YGGHGR+ H+ E FT PE       
Sbjct  635  LFIFNFHPSKSFQDYRVAVEAPGKYKIKLDSDAAQYGGHGRLDHNTEFFTQPE-------  687

Query  563  TNFNGRPNSFKVLSPPQACVA  501
              FNGR NS +V  P +  + 
Sbjct  688  -PFNGRSNSIQVYIPCRTAIV  707



>ref|XP_005736038.1| PREDICTED: 1,4-alpha-glucan-branching enzyme-like [Pundamilia 
nyererei]
Length=717

 Score = 83.2 bits (204),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 37/81 (46%), Positives = 51/81 (63%), Gaps = 8/81 (10%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            +F+FNFHP  +++ Y+V  + PGKY++ LDSDA  YGGHGR+ H+ E FT PE       
Sbjct  635  LFIFNFHPSKSFQDYRVAVEAPGKYKIKLDSDAAQYGGHGRLDHNTEFFTQPE-------  687

Query  563  TNFNGRPNSFKVLSPPQACVA  501
              FNGR NS +V  P +  + 
Sbjct  688  -PFNGRSNSIQVYIPCRTAIV  707



>ref|XP_004560615.1| PREDICTED: 1,4-alpha-glucan-branching enzyme-like [Maylandia 
zebra]
Length=717

 Score = 83.2 bits (204),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 37/81 (46%), Positives = 51/81 (63%), Gaps = 8/81 (10%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            +F+FNFHP  +++ Y+V  + PGKY++ LDSDA  YGGHGR+ H+ E FT PE       
Sbjct  635  LFIFNFHPSKSFQDYRVAVEAPGKYKIKLDSDAAQYGGHGRLDHNTEFFTQPE-------  687

Query  563  TNFNGRPNSFKVLSPPQACVA  501
              FNGR NS +V  P +  + 
Sbjct  688  -PFNGRSNSIQVYIPCRTAIV  707



>gb|ACN30754.1| unknown [Zea mays]
Length=472

 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 40/86 (47%), Positives = 52/86 (60%), Gaps = 8/86 (9%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFH  N+Y  Y++GC  PG Y+V LDSDA  +GG  R+ H  EHFT+        +
Sbjct  395  VFVFNFHCNNSYFDYRIGCRKPGVYKVVLDSDAGLFGGFSRIHHAAEHFTA--------D  446

Query  563  TNFNGRPNSFKVLSPPQACVAYYRVE  486
             + + RP SF V +P + CV Y  VE
Sbjct  447  CSHDNRPYSFSVYTPSRTCVVYAPVE  472



>ref|XP_011094402.1| PREDICTED: 1,4-alpha-glucan-branching enzyme 2-2, chloroplastic/amyloplastic 
isoform X2 [Sesamum indicum]
Length=875

 Score = 82.8 bits (203),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 42/92 (46%), Positives = 57/92 (62%), Gaps = 8/92 (9%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFH  N+Y  Y+VGC  PGKY+V LDSD   +GG  R+ H+ E+FTS EG+     
Sbjct  781  VFVFNFHWSNSYSDYRVGCLKPGKYKVVLDSDDPLFGGFSRINHEAEYFTS-EGL-----  834

Query  563  TNFNGRPNSFKVLSPPQACVAYYRVEESLDEV  468
               +GRP SF + +P +  V Y   E+ ++ V
Sbjct  835  --HDGRPRSFFIYAPSRTAVVYALAEDKVEPV  864



>ref|XP_003968717.1| PREDICTED: 1,4-alpha-glucan-branching enzyme-like [Takifugu rubripes]
Length=689

 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/81 (44%), Positives = 50/81 (62%), Gaps = 8/81 (10%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            +F+FNFHP  +++ Y+V  + PGKY++ LDSD   YGGHGR+ H  E FT P+       
Sbjct  607  LFIFNFHPTKSFQDYRVAVEAPGKYKIKLDSDDARYGGHGRLDHSTEFFTEPKA------  660

Query  563  TNFNGRPNSFKVLSPPQACVA  501
              FNGRPNS +V  P +  + 
Sbjct  661  --FNGRPNSVQVYIPCRTAIV  679



>gb|AHW50661.1| starch branching protein II [Lens culinaris]
Length=894

 Score = 82.8 bits (203),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 48/125 (38%), Positives = 69/125 (55%), Gaps = 16/125 (13%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFH  N+Y  Y+VGC  PGKY++ALDSD   +GG  R+ H  E+FT        PE
Sbjct  769  VFVFNFHWTNSYSDYRVGCLKPGKYKIALDSDDTLFGGFNRLNHTAEYFT--------PE  820

Query  563  TNFNGRPNSFKVLSPPQACVAYYRVEESLDEVQDSSFTETISTNLVLVSDDIDDLQELPT  384
              ++ RP SF V +P +  V Y         + D   +E I  ++ + S+ ID   E+ +
Sbjct  821  GWYDDRPRSFLVYAPCRTAVVY--------ALADGVESEPIELSVGVESEPIDLSVEVES  872

Query  383  ENLQE  369
            E +Q+
Sbjct  873  EPIQQ  877



>ref|XP_007572466.1| PREDICTED: 1,4-alpha-glucan-branching enzyme-like, partial [Poecilia 
formosa]
Length=164

 Score = 78.2 bits (191),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 50/81 (62%), Gaps = 8/81 (10%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            +F+FNFHP  +++ Y+VG + PGKY++ LDSD   YGGHGR+ H+ + FT P+       
Sbjct  82   LFIFNFHPNKSFQDYRVGVEAPGKYKIKLDSDEVQYGGHGRLDHNTDFFTEPQP------  135

Query  563  TNFNGRPNSFKVLSPPQACVA  501
              FNGR NS  V  P +  + 
Sbjct  136  --FNGRSNSMLVYIPCRTAIV  154



>ref|XP_011094401.1| PREDICTED: 1,4-alpha-glucan-branching enzyme 2-2, chloroplastic/amyloplastic 
isoform X1 [Sesamum indicum]
Length=884

 Score = 82.8 bits (203),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 42/92 (46%), Positives = 57/92 (62%), Gaps = 8/92 (9%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFH  N+Y  Y+VGC  PGKY+V LDSD   +GG  R+ H+ E+FTS EG+     
Sbjct  790  VFVFNFHWSNSYSDYRVGCLKPGKYKVVLDSDDPLFGGFSRINHEAEYFTS-EGL-----  843

Query  563  TNFNGRPNSFKVLSPPQACVAYYRVEESLDEV  468
               +GRP SF + +P +  V Y   E+ ++ V
Sbjct  844  --HDGRPRSFFIYAPSRTAVVYALAEDKVEPV  873



>gb|KFM73565.1| 1,4-alpha-glucan-branching enzyme, partial [Stegodyphus mimosarum]
Length=263

 Score = 79.7 bits (195),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 36/86 (42%), Positives = 53/86 (62%), Gaps = 8/86 (9%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VF FNFH   ++  YK+G ++PGKY++ LDSDA  +GGH R+ H+ + FT PE       
Sbjct  186  VFAFNFHSTKSFPDYKIGVEIPGKYKIVLDSDAEEFGGHKRLDHNTDFFTFPE-------  238

Query  563  TNFNGRPNSFKVLSPPQACVAYYRVE  486
             +++GR NS  V  P +  + Y RV+
Sbjct  239  -HYSGRQNSMMVYIPSRVGIVYARVD  263



>gb|AAB33385.1| branching enzyme II BEII [Zea mays, cultivar B73, endosperms, 
Peptide, 738 aa]
Length=738

 Score = 82.4 bits (202),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 40/86 (47%), Positives = 52/86 (60%), Gaps = 8/86 (9%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFH  N+Y  Y++GC  PG Y+V LDSDA  +GG  R+ H  EHFT+        +
Sbjct  661  VFVFNFHCNNSYFDYRIGCRKPGVYKVVLDSDAGLFGGFSRIHHAAEHFTA--------D  712

Query  563  TNFNGRPNSFKVLSPPQACVAYYRVE  486
             + + RP SF V +P + CV Y  VE
Sbjct  713  CSHDNRPYSFSVYTPSRTCVVYAPVE  738



>ref|NP_001105316.1| 1,4-alpha-glucan-branching enzyme 2, chloroplastic/amyloplastic 
precursor [Zea mays]
 sp|Q08047.1|GLGB_MAIZE RecName: Full=1,4-alpha-glucan-branching enzyme 2, chloroplastic/amyloplastic; 
AltName: Full=Q-enzyme; AltName: Full=Starch-branching 
enzyme IIB; Flags: Precursor [Zea mays]
 gb|AAA18571.1| starch branching enzyme II [Zea mays]
Length=799

 Score = 82.0 bits (201),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 40/86 (47%), Positives = 52/86 (60%), Gaps = 8/86 (9%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFH  N+Y  Y++GC  PG Y+V LDSDA  +GG  R+ H  EHFT+        +
Sbjct  722  VFVFNFHCNNSYFDYRIGCRKPGVYKVVLDSDAGLFGGFSRIHHAAEHFTA--------D  773

Query  563  TNFNGRPNSFKVLSPPQACVAYYRVE  486
             + + RP SF V +P + CV Y  VE
Sbjct  774  CSHDNRPYSFSVYTPSRTCVVYAPVE  799



>gb|KJB62213.1| hypothetical protein B456_009G406400 [Gossypium raimondii]
Length=442

 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 41/102 (40%), Positives = 56/102 (55%), Gaps = 8/102 (8%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFH   +Y GY+VGC  PGKY++ LDSD   +GG  R+ HDVE F++        E
Sbjct  347  VFVFNFHWHESYGGYRVGCSKPGKYKIVLDSDDLLFGGFNRLNHDVEFFST--------E  398

Query  563  TNFNGRPNSFKVLSPPQACVAYYRVEESLDEVQDSSFTETIS  438
              ++ RP S  V +P +  V Y  VE+      +   TE + 
Sbjct  399  GWYDNRPRSLLVYAPNRTAVVYALVEDEPKATGNLQLTENVK  440



>ref|XP_008265433.1| PREDICTED: LOW QUALITY PROTEIN: 1,4-alpha-glucan-branching enzyme 
[Oryctolagus cuniculus]
Length=971

 Score = 82.4 bits (202),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 37/86 (43%), Positives = 51/86 (59%), Gaps = 8/86 (9%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            +F+FNFHP  +Y  Y+VG  LPGK+++ LDSDA  YGGH R+ H+ + F+ P G      
Sbjct  891  LFIFNFHPSKSYTDYRVGTALPGKFKIVLDSDAAEYGGHHRLDHNTDFFSEPFG------  944

Query  563  TNFNGRPNSFKVLSPPQACVAYYRVE  486
               NGRPNS  V  P +  +    V+
Sbjct  945  --HNGRPNSLLVYIPNRVALVLQNVD  968



>gb|KJB62212.1| hypothetical protein B456_009G406400 [Gossypium raimondii]
Length=527

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 41/102 (40%), Positives = 56/102 (55%), Gaps = 8/102 (8%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFH   +Y GY+VGC  PGKY++ LDSD   +GG  R+ HDVE F++        E
Sbjct  432  VFVFNFHWHESYGGYRVGCSKPGKYKIVLDSDDLLFGGFNRLNHDVEFFST--------E  483

Query  563  TNFNGRPNSFKVLSPPQACVAYYRVEESLDEVQDSSFTETIS  438
              ++ RP S  V +P +  V Y  VE+      +   TE + 
Sbjct  484  GWYDNRPRSLLVYAPNRTAVVYALVEDEPKATGNLQLTENVK  525



>gb|AFW71659.1| amylose extender1 [Zea mays]
Length=799

 Score = 82.0 bits (201),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 40/86 (47%), Positives = 52/86 (60%), Gaps = 8/86 (9%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFH  N+Y  Y++GC  PG Y+V LDSDA  +GG  R+ H  EHFT+        +
Sbjct  722  VFVFNFHCNNSYFDYRIGCRKPGVYKVVLDSDAGLFGGFSRIHHAAEHFTA--------D  773

Query  563  TNFNGRPNSFKVLSPPQACVAYYRVE  486
             + + RP SF V +P + CV Y  VE
Sbjct  774  CSHDNRPYSFSVYTPSRTCVVYAPVE  799



>gb|AAC33764.1| starch branching enzyme IIb [Zea mays]
Length=799

 Score = 82.0 bits (201),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 40/86 (47%), Positives = 52/86 (60%), Gaps = 8/86 (9%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFH  N+Y  Y++GC  PG Y+V LDSDA  +GG  R+ H  EHFT+        +
Sbjct  722  VFVFNFHCNNSYFDYRIGCRKPGVYKVVLDSDAGLFGGFSRIHHAAEHFTA--------D  773

Query  563  TNFNGRPNSFKVLSPPQACVAYYRVE  486
             + + RP SF V +P + CV Y  VE
Sbjct  774  CSHDNRPYSFSVYTPSRTCVVYAPVE  799



>gb|KJB16661.1| hypothetical protein B456_002G241400 [Gossypium raimondii]
 gb|KJB16662.1| hypothetical protein B456_002G241400 [Gossypium raimondii]
Length=766

 Score = 82.0 bits (201),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 44/103 (43%), Positives = 57/103 (55%), Gaps = 8/103 (8%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFH  N+Y  Y+VGC  PGKY++ LDSD   +GG GR+ H+ E+F+         E
Sbjct  649  VFVFNFHWNNSYFDYRVGCAKPGKYKIVLDSDDPLFGGFGRLDHNAEYFSF--------E  700

Query  563  TNFNGRPNSFKVLSPPQACVAYYRVEESLDEVQDSSFTETIST  435
              F+ RP SF V +P +  V Y  VE+    V D    E   T
Sbjct  701  GWFDDRPRSFMVYAPNRTAVVYALVEDEPKVVNDLELVEIPET  743



>ref|XP_002534111.1| starch branching enzyme II, putative [Ricinus communis]
 gb|EEF28271.1| starch branching enzyme II, putative [Ricinus communis]
Length=863

 Score = 82.0 bits (201),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 40/95 (42%), Positives = 56/95 (59%), Gaps = 8/95 (8%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFH  N+Y  Y+VGC  PGKY++ LDSD   +GG  R+ H  E+F+         E
Sbjct  761  VFVFNFHWNNSYSDYQVGCLKPGKYKIVLDSDNSLFGGFSRINHSAEYFSF--------E  812

Query  563  TNFNGRPNSFKVLSPPQACVAYYRVEESLDEVQDS  459
              ++ RP SF V +P +  V Y  VE+  + +QD+
Sbjct  813  GWYDNRPRSFLVYAPSRTAVVYALVEDEKEHLQDA  847



>gb|KJB62214.1| hypothetical protein B456_009G406400 [Gossypium raimondii]
Length=426

 Score = 80.9 bits (198),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 41/102 (40%), Positives = 56/102 (55%), Gaps = 8/102 (8%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFH   +Y GY+VGC  PGKY++ LDSD   +GG  R+ HDVE F++        E
Sbjct  331  VFVFNFHWHESYGGYRVGCSKPGKYKIVLDSDDLLFGGFNRLNHDVEFFST--------E  382

Query  563  TNFNGRPNSFKVLSPPQACVAYYRVEESLDEVQDSSFTETIS  438
              ++ RP S  V +P +  V Y  VE+      +   TE + 
Sbjct  383  GWYDNRPRSLLVYAPNRTAVVYALVEDEPKATGNLQLTENVK  424



>gb|KJB16660.1| hypothetical protein B456_002G241400 [Gossypium raimondii]
 gb|KJB16663.1| hypothetical protein B456_002G241400 [Gossypium raimondii]
Length=870

 Score = 82.0 bits (201),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 44/103 (43%), Positives = 57/103 (55%), Gaps = 8/103 (8%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFH  N+Y  Y+VGC  PGKY++ LDSD   +GG GR+ H+ E+F+         E
Sbjct  753  VFVFNFHWNNSYFDYRVGCAKPGKYKIVLDSDDPLFGGFGRLDHNAEYFSF--------E  804

Query  563  TNFNGRPNSFKVLSPPQACVAYYRVEESLDEVQDSSFTETIST  435
              F+ RP SF V +P +  V Y  VE+    V D    E   T
Sbjct  805  GWFDDRPRSFMVYAPNRTAVVYALVEDEPKVVNDLELVEIPET  847



>gb|KJB16659.1| hypothetical protein B456_002G241400 [Gossypium raimondii]
Length=830

 Score = 81.6 bits (200),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 44/103 (43%), Positives = 57/103 (55%), Gaps = 8/103 (8%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFH  N+Y  Y+VGC  PGKY++ LDSD   +GG GR+ H+ E+F+         E
Sbjct  713  VFVFNFHWNNSYFDYRVGCAKPGKYKIVLDSDDPLFGGFGRLDHNAEYFSF--------E  764

Query  563  TNFNGRPNSFKVLSPPQACVAYYRVEESLDEVQDSSFTETIST  435
              F+ RP SF V +P +  V Y  VE+    V D    E   T
Sbjct  765  GWFDDRPRSFMVYAPNRTAVVYALVEDEPKVVNDLELVEIPET  807



>gb|KJB16665.1| hypothetical protein B456_002G241400 [Gossypium raimondii]
Length=637

 Score = 81.3 bits (199),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 44/103 (43%), Positives = 57/103 (55%), Gaps = 8/103 (8%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFH  N+Y  Y+VGC  PGKY++ LDSD   +GG GR+ H+ E+F+         E
Sbjct  520  VFVFNFHWNNSYFDYRVGCAKPGKYKIVLDSDDPLFGGFGRLDHNAEYFSF--------E  571

Query  563  TNFNGRPNSFKVLSPPQACVAYYRVEESLDEVQDSSFTETIST  435
              F+ RP SF V +P +  V Y  VE+    V D    E   T
Sbjct  572  GWFDDRPRSFMVYAPNRTAVVYALVEDEPKVVNDLELVEIPET  614



>gb|KJB62211.1| hypothetical protein B456_009G406400 [Gossypium raimondii]
Length=583

 Score = 81.3 bits (199),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 41/102 (40%), Positives = 56/102 (55%), Gaps = 8/102 (8%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFH   +Y GY+VGC  PGKY++ LDSD   +GG  R+ HDVE F++        E
Sbjct  488  VFVFNFHWHESYGGYRVGCSKPGKYKIVLDSDDLLFGGFNRLNHDVEFFST--------E  539

Query  563  TNFNGRPNSFKVLSPPQACVAYYRVEESLDEVQDSSFTETIS  438
              ++ RP S  V +P +  V Y  VE+      +   TE + 
Sbjct  540  GWYDNRPRSLLVYAPNRTAVVYALVEDEPKATGNLQLTENVK  581



>gb|KJB62209.1| hypothetical protein B456_009G406400 [Gossypium raimondii]
Length=781

 Score = 81.3 bits (199),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 41/102 (40%), Positives = 56/102 (55%), Gaps = 8/102 (8%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFH   +Y GY+VGC  PGKY++ LDSD   +GG  R+ HDVE F++        E
Sbjct  686  VFVFNFHWHESYGGYRVGCSKPGKYKIVLDSDDLLFGGFNRLNHDVEFFST--------E  737

Query  563  TNFNGRPNSFKVLSPPQACVAYYRVEESLDEVQDSSFTETIS  438
              ++ RP S  V +P +  V Y  VE+      +   TE + 
Sbjct  738  GWYDNRPRSLLVYAPNRTAVVYALVEDEPKATGNLQLTENVK  779



>gb|KJB62207.1| hypothetical protein B456_009G406400 [Gossypium raimondii]
Length=861

 Score = 81.3 bits (199),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 41/102 (40%), Positives = 56/102 (55%), Gaps = 8/102 (8%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFH   +Y GY+VGC  PGKY++ LDSD   +GG  R+ HDVE F++        E
Sbjct  766  VFVFNFHWHESYGGYRVGCSKPGKYKIVLDSDDLLFGGFNRLNHDVEFFST--------E  817

Query  563  TNFNGRPNSFKVLSPPQACVAYYRVEESLDEVQDSSFTETIS  438
              ++ RP S  V +P +  V Y  VE+      +   TE + 
Sbjct  818  GWYDNRPRSLLVYAPNRTAVVYALVEDEPKATGNLQLTENVK  859



>gb|KJB62210.1| hypothetical protein B456_009G406400 [Gossypium raimondii]
Length=849

 Score = 81.3 bits (199),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 41/102 (40%), Positives = 56/102 (55%), Gaps = 8/102 (8%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFH   +Y GY+VGC  PGKY++ LDSD   +GG  R+ HDVE F++        E
Sbjct  754  VFVFNFHWHESYGGYRVGCSKPGKYKIVLDSDDLLFGGFNRLNHDVEFFST--------E  805

Query  563  TNFNGRPNSFKVLSPPQACVAYYRVEESLDEVQDSSFTETIS  438
              ++ RP S  V +P +  V Y  VE+      +   TE + 
Sbjct  806  GWYDNRPRSLLVYAPNRTAVVYALVEDEPKATGNLQLTENVK  847



>ref|XP_008285053.1| PREDICTED: 1,4-alpha-glucan-branching enzyme [Stegastes partitus]
Length=689

 Score = 80.9 bits (198),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 38/81 (47%), Positives = 50/81 (62%), Gaps = 8/81 (10%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VF+FNFHP  +++ Y+VG ++PGKY++ LDSD   YGGHGR+ H  E FT  E  P    
Sbjct  607  VFIFNFHPSKSFQAYRVGVEVPGKYKIKLDSDMHHYGGHGRLDHSTEFFT--EAQP----  660

Query  563  TNFNGRPNSFKVLSPPQACVA  501
              FNGR NS  V  P +  + 
Sbjct  661  --FNGRSNSILVYIPCRTAIV  679



>ref|XP_005796937.1| PREDICTED: 1,4-alpha-glucan-branching enzyme-like [Xiphophorus 
maculatus]
Length=263

 Score = 78.2 bits (191),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 35/80 (44%), Positives = 50/80 (63%), Gaps = 8/80 (10%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            +F+FNFHP  +++ Y+VG + PGKY++ LDSD   YGGHGR+ H+ + FT P+       
Sbjct  181  LFIFNFHPNKSFQDYRVGVEAPGKYKIKLDSDEVQYGGHGRLDHNTDFFTEPQP------  234

Query  563  TNFNGRPNSFKVLSPPQACV  504
              FNGR NS  V  P +  +
Sbjct  235  --FNGRSNSMLVYIPCRTAI  252



>gb|ABO25741.1| starch branching enzyme IIb [Zea mays]
Length=799

 Score = 80.9 bits (198),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 39/86 (45%), Positives = 52/86 (60%), Gaps = 8/86 (9%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFV+NFH  N+Y  Y++GC  PG Y+V LDSDA  +GG  R+ H  EHFT+        +
Sbjct  722  VFVYNFHCNNSYFDYRIGCRKPGVYKVVLDSDAGLFGGFSRIHHAAEHFTA--------D  773

Query  563  TNFNGRPNSFKVLSPPQACVAYYRVE  486
             + + RP SF V +P + CV Y  VE
Sbjct  774  CSHDNRPYSFSVYTPSRTCVVYAPVE  799



>ref|XP_003554420.1| PREDICTED: 1,4-alpha-glucan-branching enzyme 2-1, chloroplastic/amyloplastic-like 
[Glycine max]
Length=868

 Score = 80.9 bits (198),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 39/101 (39%), Positives = 58/101 (57%), Gaps = 8/101 (8%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            +FVFNFH  N+Y  Y+VGC  PGKY++ LDSD   +GG  R+ H  E+FTS        E
Sbjct  768  IFVFNFHWTNSYSDYRVGCSTPGKYKIVLDSDDALFGGFSRLNHAAEYFTS--------E  819

Query  563  TNFNGRPNSFKVLSPPQACVAYYRVEESLDEVQDSSFTETI  441
              ++ RP SF + +P +  V Y   +E+   + D++  E +
Sbjct  820  GWYDDRPRSFLIYAPSRTAVVYALADEAEPALADATEPEPV  860



>gb|KHG11831.1| 1,4-alpha-glucan-branching enzyme 2-2, chloroplastic/amyloplastic 
-like protein [Gossypium arboreum]
Length=538

 Score = 80.1 bits (196),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 43/103 (42%), Positives = 57/103 (55%), Gaps = 8/103 (8%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFH  N+Y  Y+VGC  PGKY++ LDSD   +GG GR+ H+ E+F+         E
Sbjct  421  VFVFNFHWNNSYFDYRVGCAKPGKYKIVLDSDDPLFGGFGRLDHNAEYFSF--------E  472

Query  563  TNFNGRPNSFKVLSPPQACVAYYRVEESLDEVQDSSFTETIST  435
              ++ RP SF V +P +  V Y  VE+    V D    E   T
Sbjct  473  GWYDDRPRSFMVYAPNRTAVVYALVEDEPKVVNDLELVEIPET  515



>ref|XP_003579681.1| PREDICTED: 1,4-alpha-glucan-branching enzyme 2, chloroplastic/amyloplastic-like 
[Brachypodium distachyon]
Length=831

 Score = 80.9 bits (198),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 42/86 (49%), Positives = 53/86 (62%), Gaps = 8/86 (9%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFH  N++  Y+VGC  PGKY+VALDSD   +GG  R+ HDVE+FT+ +     P 
Sbjct  754  VFVFNFHWSNSFFDYRVGCSKPGKYKVALDSDDVLFGGFSRLDHDVEYFTTED-----PH  808

Query  563  TNFNGRPNSFKVLSPPQACVAYYRVE  486
             N   RP SF V +P +  V Y   E
Sbjct  809  DN---RPRSFSVYTPSRTVVVYALTE  831



>ref|XP_004952629.1| PREDICTED: 1,4-alpha-glucan-branching enzyme 2, chloroplastic/amyloplastic-like 
[Setaria italica]
Length=797

 Score = 80.9 bits (198),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 39/82 (48%), Positives = 50/82 (61%), Gaps = 9/82 (11%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFH  N+Y  Y+VGC   G Y+V LDSDA  +GG GR+ H  EHFT         +
Sbjct  708  VFVFNFHCNNSYFDYRVGCRRSGVYKVVLDSDAGLFGGFGRIHHTAEHFT---------D  758

Query  563  TNFNGRPNSFKVLSPPQACVAY  498
             + + RP+SF V +P + CV Y
Sbjct  759  GSHDNRPHSFSVYTPSRTCVVY  780



>ref|XP_007236767.1| PREDICTED: 1,4-alpha-glucan-branching enzyme-like [Astyanax mexicanus]
Length=689

 Score = 80.5 bits (197),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 39/81 (48%), Positives = 50/81 (62%), Gaps = 8/81 (10%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            +F+FNFHP N+Y  Y+V  +  GKY++ LDSD   YGGHGR+ H+ E FT  E IP    
Sbjct  607  IFIFNFHPVNSYSSYRVAVEAAGKYKIKLDSDEVQYGGHGRLDHNTEFFT--ESIP----  660

Query  563  TNFNGRPNSFKVLSPPQACVA  501
              FNGR NS +V  P +  V 
Sbjct  661  --FNGRANSMQVYIPCRTAVV  679



>ref|XP_006796664.1| PREDICTED: 1,4-alpha-glucan-branching enzyme-like [Neolamprologus 
brichardi]
Length=717

 Score = 80.5 bits (197),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 36/81 (44%), Positives = 50/81 (62%), Gaps = 8/81 (10%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            +F+FNFHP  +++ Y+V  + PGKY++ LDSDA  YGGHGR+ H+ E FT  E       
Sbjct  635  LFIFNFHPSKSFQDYRVAVETPGKYKIKLDSDAAQYGGHGRLDHNTEFFTQAE-------  687

Query  563  TNFNGRPNSFKVLSPPQACVA  501
              FNGR NS +V  P +  + 
Sbjct  688  -PFNGRSNSIQVYIPCRTAIV  707



>gb|ACN27298.1| unknown [Zea mays]
Length=124

 Score = 75.5 bits (184),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 39/82 (48%), Positives = 49/82 (60%), Gaps = 8/82 (10%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFH  N+Y  Y+VGC  PGKY++ LDSD   +GG  R+ HD E+FT+       P 
Sbjct  43   VFVFNFHWSNSYFDYRVGCFKPGKYKIVLDSDDGLFGGFSRLDHDAEYFTA-----DWPH  97

Query  563  TNFNGRPNSFKVLSPPQACVAY  498
             N   RP SF V +P +  V Y
Sbjct  98   DN---RPCSFSVYAPSRTAVVY  116



>gb|KHG10953.1| 1,4-alpha-glucan-branching enzyme 2-2, chloroplastic/amyloplastic 
-like protein [Gossypium arboreum]
Length=519

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 40/101 (40%), Positives = 56/101 (55%), Gaps = 8/101 (8%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFH   +Y GY+VGC  PGKY++ LDSD   +GG  R+ HDVE F++        E
Sbjct  427  VFVFNFHWHESYCGYRVGCSKPGKYKIVLDSDDLLFGGFNRLNHDVEFFST--------E  478

Query  563  TNFNGRPNSFKVLSPPQACVAYYRVEESLDEVQDSSFTETI  441
              ++ RP S  V +P +  V Y  VE+      +   T+ +
Sbjct  479  GWYDNRPRSLLVYAPNRTAVVYALVEDEPKATGNLQLTQNV  519



>gb|AAS88882.1| SBEI [Ostreococcus tauri]
Length=817

 Score = 80.5 bits (197),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 43/92 (47%), Positives = 58/92 (63%), Gaps = 9/92 (10%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFHP  TYEG ++G   PGKY++A D+DA  +GG  R G  V+HFTSP+G    PE
Sbjct  706  VFVFNFHPHQTYEGLEIGVPEPGKYQLAFDTDAREFGGKSRCGFSVDHFTSPDG----PE  761

Query  563  TN---FNGRPNSFK--VLSPPQACVAYYRVEE  483
            +    +   P + K  VLSP ++   Y++V E
Sbjct  762  SWVGPYEQPPRAAKMLVLSPARSAQVYFKVPE  793



>ref|XP_003078929.1| Branching Enzyme I (IC) [Ostreococcus tauri]
Length=776

 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 43/92 (47%), Positives = 58/92 (63%), Gaps = 9/92 (10%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFHP  TYEG ++G   PGKY++A D+DA  +GG  R G  V+HFTSP+G    PE
Sbjct  665  VFVFNFHPHQTYEGLEIGVPEPGKYQLAFDTDAREFGGKSRCGFSVDHFTSPDG----PE  720

Query  563  TN---FNGRPNSFK--VLSPPQACVAYYRVEE  483
            +    +   P + K  VLSP ++   Y++V E
Sbjct  721  SWVGPYEQPPRAAKMLVLSPARSAQVYFKVPE  752



>ref|XP_004494151.1| PREDICTED: 1,4-alpha-glucan-branching enzyme 2-1, chloroplastic/amyloplastic-like 
isoform X1 [Cicer arietinum]
Length=885

 Score = 80.5 bits (197),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 39/86 (45%), Positives = 52/86 (60%), Gaps = 8/86 (9%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFH  N+Y  Y+VGC +PGKY++ LDSD   +GG  R+ H  E+FTS        E
Sbjct  775  VFVFNFHWTNSYSDYRVGCLMPGKYKIVLDSDDALFGGFNRINHTAEYFTS--------E  826

Query  563  TNFNGRPNSFKVLSPPQACVAYYRVE  486
              ++ RP SF V +P +  V Y  V+
Sbjct  827  GWYDDRPRSFLVYAPCRTAVVYALVD  852



>ref|XP_010737101.1| PREDICTED: 1,4-alpha-glucan-branching enzyme [Larimichthys crocea]
Length=687

 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 37/81 (46%), Positives = 52/81 (64%), Gaps = 8/81 (10%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VF+FNFHP  +++ Y+V  ++PGKY++ LDSD   YGGHGR+ H+ E FT  EG      
Sbjct  605  VFIFNFHPSKSFQDYRVAVEVPGKYKIKLDSDEILYGGHGRLDHNTEFFT--EG------  656

Query  563  TNFNGRPNSFKVLSPPQACVA  501
             +FNGR NS +V  P +  + 
Sbjct  657  QSFNGRSNSMRVYIPCRTAIV  677



>ref|XP_004494152.1| PREDICTED: 1,4-alpha-glucan-branching enzyme 2-1, chloroplastic/amyloplastic-like 
isoform X2 [Cicer arietinum]
Length=882

 Score = 80.5 bits (197),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 39/86 (45%), Positives = 52/86 (60%), Gaps = 8/86 (9%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFH  N+Y  Y+VGC +PGKY++ LDSD   +GG  R+ H  E+FTS        E
Sbjct  772  VFVFNFHWTNSYSDYRVGCLMPGKYKIVLDSDDALFGGFNRINHTAEYFTS--------E  823

Query  563  TNFNGRPNSFKVLSPPQACVAYYRVE  486
              ++ RP SF V +P +  V Y  V+
Sbjct  824  GWYDDRPRSFLVYAPCRTAVVYALVD  849



>emb|CEF97678.1| Glycosyl hydrolase, family 13, catalytic domain [Ostreococcus 
tauri]
Length=710

 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 43/92 (47%), Positives = 58/92 (63%), Gaps = 9/92 (10%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFHP  TYEG ++G   PGKY++A D+DA  +GG  R G  V+HFTSP+G    PE
Sbjct  599  VFVFNFHPHQTYEGLEIGVPEPGKYQLAFDTDAREFGGKSRCGFSVDHFTSPDG----PE  654

Query  563  TN---FNGRPNSFK--VLSPPQACVAYYRVEE  483
            +    +   P + K  VLSP ++   Y++V E
Sbjct  655  SWVGPYEQPPRAAKMLVLSPARSAQVYFKVPE  686



>ref|XP_010243937.1| PREDICTED: LOW QUALITY PROTEIN: 1,4-alpha-glucan-branching enzyme 
1, chloroplastic/amyloplastic [Nelumbo nucifera]
Length=850

 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 41/106 (39%), Positives = 58/106 (55%), Gaps = 8/106 (8%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFH   +Y  Y+VGC  PGKY+V LDSD   +GG GR+ H  E+F+S        E
Sbjct  751  VFVFNFHWTKSYSDYRVGCLKPGKYKVVLDSDDKLFGGFGRIDHTAEYFSS--------E  802

Query  563  TNFNGRPNSFKVLSPPQACVAYYRVEESLDEVQDSSFTETISTNLV  426
               + RP SF+V +P +  V Y   E+ +  ++      + +T L 
Sbjct  803  YQHDNRPRSFRVYAPSRTAVVYALAEDXIKPLKICGCCPSKATFLC  848



>gb|EMS64965.1| 1,4-alpha-glucan-branching enzyme 2, chloroplastic/amyloplastic 
[Triticum urartu]
Length=1050

 Score = 80.1 bits (196),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 40/86 (47%), Positives = 52/86 (60%), Gaps = 8/86 (9%)
 Frame = -2

Query  743   VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
             VFVFNFH  N++  Y+VGC  PGKY+VALDSD   +GG  R+ HDV++FT+        E
Sbjct  973   VFVFNFHWSNSFFDYRVGCSRPGKYKVALDSDDALFGGFSRLDHDVDYFTT--------E  1024

Query  563   TNFNGRPNSFKVLSPPQACVAYYRVE  486
                + RP SF V +P +  V Y   E
Sbjct  1025  HPHDNRPRSFSVYTPSRTAVVYALTE  1050



>ref|XP_003625770.1| Starch branching enzyme II [Medicago truncatula]
Length=420

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 40/86 (47%), Positives = 51/86 (59%), Gaps = 8/86 (9%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFH  N+Y  YKVGC  PGKY++ LDSD   +GG  R+ H  E+FTS        E
Sbjct  317  VFVFNFHWTNSYSDYKVGCLKPGKYKIVLDSDESLFGGFNRLNHTAEYFTS--------E  368

Query  563  TNFNGRPNSFKVLSPPQACVAYYRVE  486
              ++ RP SF V +P +  V Y  V+
Sbjct  369  GWYDDRPRSFLVYAPCRTAVVYALVD  394



>gb|AHL84202.1| starch branching enzyme 1, partial [Oryza sativa Japonica Group]
Length=98

 Score = 73.9 bits (180),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = -2

Query  590  PEGIPGVPETNFNGRPNSFKVLSPPQACVAYYRVEESLDEVQ  465
            PEG PGVPETNFN RPNSFKVLSPP+ CVAYYRV+E  +E++
Sbjct  3    PEGNPGVPETNFNNRPNSFKVLSPPRTCVAYYRVDEDREELR  44



>ref|XP_009796284.1| PREDICTED: 1,4-alpha-glucan-branching enzyme 2-2, chloroplastic/amyloplastic-like 
isoform X2 [Nicotiana sylvestris]
Length=851

 Score = 79.7 bits (195),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/87 (45%), Positives = 54/87 (62%), Gaps = 8/87 (9%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFH  N+Y  Y++GC  PGKY+V LDSD   +GG GR+ H+ E+FT         E
Sbjct  765  VFVFNFHWTNSYSDYRIGCLKPGKYKVVLDSDDPLFGGFGRIDHNAEYFTF--------E  816

Query  563  TNFNGRPNSFKVLSPPQACVAYYRVEE  483
              ++ RP+SF V +P +  V Y  V++
Sbjct  817  GWYDDRPSSFMVYAPSRTAVVYALVDK  843



>emb|CAB40743.1| starch branching enzyme II [Solanum tuberosum]
Length=871

 Score = 79.7 bits (195),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/87 (45%), Positives = 54/87 (62%), Gaps = 8/87 (9%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFH  N+Y  Y++GC  PGKY+V LDSD   +GG GR+ H+ E+FTS        E
Sbjct  781  VFVFNFHWTNSYSDYRIGCLKPGKYKVVLDSDDPLFGGFGRIDHNAEYFTS--------E  832

Query  563  TNFNGRPNSFKVLSPPQACVAYYRVEE  483
             +++ RP S  V +P +  V Y  V++
Sbjct  833  GSYDDRPCSIMVYAPSRTAVVYALVDK  859



>ref|XP_010683852.1| PREDICTED: 1,4-alpha-glucan-branching enzyme 2-2, chloroplastic/amyloplastic-like 
isoform X1 [Beta vulgaris subsp. vulgaris]
Length=869

 Score = 79.7 bits (195),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 40/87 (46%), Positives = 51/87 (59%), Gaps = 8/87 (9%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFH  N+Y  Y+VGC  PGKY++ LDSD   +GG  R+ H  EHFT         E
Sbjct  760  VFVFNFHWSNSYFDYQVGCLKPGKYKIVLDSDDALFGGFNRLDHTAEHFTF--------E  811

Query  563  TNFNGRPNSFKVLSPPQACVAYYRVEE  483
              ++ RP SF V +P +A V Y   E+
Sbjct  812  GTYDNRPRSFLVYAPSRAAVVYALAED  838



>emb|CBQ68385.1| probable branching enzyme (be1) [Sporisorium reilianum SRZ2]
Length=700

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 37/86 (43%), Positives = 54/86 (63%), Gaps = 8/86 (9%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            +FVFN+H  N+Y  Y+VG D+PGKY+V LD+DA   GGHGRV H  E+FT+        +
Sbjct  623  LFVFNWHATNSYTDYRVGVDVPGKYKVLLDTDAKELGGHGRVDHATEYFTT--------D  674

Query  563  TNFNGRPNSFKVLSPPQACVAYYRVE  486
              +NGR N  +V  P ++ +  Y+ +
Sbjct  675  MEWNGRRNFVQVYLPSRSAIVLYKAD  700



>ref|XP_011018899.1| PREDICTED: 1,4-alpha-glucan-branching enzyme 2-2, chloroplastic/amyloplastic 
[Populus euphratica]
Length=840

 Score = 79.7 bits (195),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 41/93 (44%), Positives = 55/93 (59%), Gaps = 8/93 (9%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFH  N+Y  Y+VGC  PGKY++ LDSD   +GG  R+  D E+FTS        E
Sbjct  748  VFVFNFHWTNSYSDYRVGCLKPGKYKIVLDSDDPLFGGFKRLDQDAEYFTS--------E  799

Query  563  TNFNGRPNSFKVLSPPQACVAYYRVEESLDEVQ  465
              ++ RP SF V +P +  V Y  VE+ L+  +
Sbjct  800  GWYDDRPRSFLVYAPSRTAVVYALVEDELEPAE  832



>ref|XP_009796283.1| PREDICTED: 1,4-alpha-glucan-branching enzyme 2-2, chloroplastic/amyloplastic-like 
isoform X1 [Nicotiana sylvestris]
Length=867

 Score = 79.7 bits (195),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/87 (45%), Positives = 54/87 (62%), Gaps = 8/87 (9%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFH  N+Y  Y++GC  PGKY+V LDSD   +GG GR+ H+ E+FT         E
Sbjct  781  VFVFNFHWTNSYSDYRIGCLKPGKYKVVLDSDDPLFGGFGRIDHNAEYFTF--------E  832

Query  563  TNFNGRPNSFKVLSPPQACVAYYRVEE  483
              ++ RP+SF V +P +  V Y  V++
Sbjct  833  GWYDDRPSSFMVYAPSRTAVVYALVDK  859



>gb|AHL84210.1| starch branching enzyme 1, partial [Oryza sativa Indica Group]
Length=96

 Score = 73.9 bits (180),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = -2

Query  590  PEGIPGVPETNFNGRPNSFKVLSPPQACVAYYRVEESLDEVQ  465
            PEG PG PETNFN RPNSFKVLSPP+ CVAYYRV+E  +E++
Sbjct  1    PEGTPGAPETNFNNRPNSFKVLSPPRTCVAYYRVDEDREELR  42



>gb|AAK26821.1| starch branching enzyme IIa [Aegilops tauschii]
Length=819

 Score = 79.7 bits (195),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 40/86 (47%), Positives = 52/86 (60%), Gaps = 8/86 (9%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFH  N++  Y+VGC  PGKY+VALDSD   +GG  R+ HDV++FT+        E
Sbjct  742  VFVFNFHWSNSFFDYRVGCSKPGKYKVALDSDDALFGGFSRLDHDVDYFTT--------E  793

Query  563  TNFNGRPNSFKVLSPPQACVAYYRVE  486
               + RP SF V +P +  V Y   E
Sbjct  794  HPHDNRPRSFSVYTPSRTAVVYALTE  819



>emb|CCD41775.1| starch branching enzyme IIa [Triticum aestivum]
Length=823

 Score = 79.7 bits (195),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 40/86 (47%), Positives = 52/86 (60%), Gaps = 8/86 (9%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFH  N++  Y+VGC  PGKY+VALDSD   +GG  R+ HDV++FT+        E
Sbjct  746  VFVFNFHWSNSFFDYRVGCSRPGKYKVALDSDDALFGGFSRLDHDVDYFTT--------E  797

Query  563  TNFNGRPNSFKVLSPPQACVAYYRVE  486
               + RP SF V +P +  V Y   E
Sbjct  798  HPHDNRPRSFSVYTPSRTAVVYALTE  823



>sp|Q41058.1|GLGB1_PEA RecName: Full=1,4-alpha-glucan-branching enzyme 1, chloroplastic/amyloplastic; 
AltName: Full=Starch branching enzyme I; Flags: 
Precursor [Pisum sativum]
 emb|CAA56319.1| starch branching enzyme I [Pisum sativum]
Length=922

 Score = 79.7 bits (195),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 47/116 (41%), Positives = 64/116 (55%), Gaps = 11/116 (9%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFH  N+Y  YKVGC  PGKY++ LDSD   +GG  R+ H  E+FTS        E
Sbjct  769  VFVFNFHWTNSYSDYKVGCLKPGKYKIVLDSDDTLFGGFNRLNHTAEYFTS--------E  820

Query  563  TNFNGRPNSFKVLSPPQACVAYYR---VEESLDEVQDSSFTETISTNLVLVSDDID  405
              ++ RP SF V +P +  V Y     VE    E+ D   +E I  ++ + S+ I+
Sbjct  821  GWYDDRPRSFLVYAPSRTAVVYALADGVESEPIELSDGVESEPIELSVGVESEPIE  876



>gb|EMT04009.1| 1,4-alpha-glucan-branching enzyme 2, chloroplastic/amyloplastic 
[Aegilops tauschii]
Length=786

 Score = 79.7 bits (195),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 40/86 (47%), Positives = 52/86 (60%), Gaps = 8/86 (9%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFH  N++  Y+VGC  PGKY+VALDSD   +GG  R+ HDV++FT+        E
Sbjct  709  VFVFNFHWSNSFFDYRVGCSKPGKYKVALDSDDALFGGFSRLDHDVDYFTT--------E  760

Query  563  TNFNGRPNSFKVLSPPQACVAYYRVE  486
               + RP SF V +P +  V Y   E
Sbjct  761  HPHDNRPRSFSVYTPSRTAVVYALTE  786



>ref|XP_010683853.1| PREDICTED: 1,4-alpha-glucan-branching enzyme 2-2, chloroplastic/amyloplastic-like 
isoform X2 [Beta vulgaris subsp. vulgaris]
Length=846

 Score = 79.7 bits (195),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 40/87 (46%), Positives = 51/87 (59%), Gaps = 8/87 (9%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFH  N+Y  Y+VGC  PGKY++ LDSD   +GG  R+ H  EHFT         E
Sbjct  737  VFVFNFHWSNSYFDYQVGCLKPGKYKIVLDSDDALFGGFNRLDHTAEHFTF--------E  788

Query  563  TNFNGRPNSFKVLSPPQACVAYYRVEE  483
              ++ RP SF V +P +A V Y   E+
Sbjct  789  GTYDNRPRSFLVYAPSRAAVVYALAED  815



>gb|AAG27623.1|AF286319_1 starch branching enzyme 2 [Triticum aestivum]
Length=823

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 40/86 (47%), Positives = 52/86 (60%), Gaps = 8/86 (9%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFH  N++  Y+VGC  PGKY+VALDSD   +GG  R+ HDV++FT+        E
Sbjct  746  VFVFNFHWSNSFFDYRVGCSRPGKYKVALDSDDALFGGFSRLDHDVDYFTT--------E  797

Query  563  TNFNGRPNSFKVLSPPQACVAYYRVE  486
               + RP SF V +P +  V Y   E
Sbjct  798  HPHDNRPRSFSVYTPSRTAVVYALTE  823



>emb|CAA72154.1| 1,4-alpha-glucan branching enzyme II [Triticum aestivum]
Length=823

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 40/86 (47%), Positives = 52/86 (60%), Gaps = 8/86 (9%)
 Frame = -2

Query  743  VFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAWAYGGHGRVGHDVEHFTSPEGIPGVPE  564
            VFVFNFH  N++  Y+VGC  PGKY+VALDSD   +GG  R+ HDV++FT+        E
Sbjct  746  VFVFNFHWSNSFFDYRVGCSRPGKYKVALDSDDALFGGFSRLDHDVDYFTT--------E  797

Query  563  TNFNGRPNSFKVLSPPQACVAYYRVE  486
               + RP SF V +P +  V Y   E
Sbjct  798  HPHDNRPRSFSVYTPSRTAVVYALTE  823



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1360982043420