BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF011K20

Length=760
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

dbj|BAA34995.1|  L-Galactono-1,4-lactone dehydrogenase                  393   2e-130   Ipomoea batatas [batate]
gb|ACO57437.1|  L-galactono-1,4-lactone dehydrogenase protein           372   5e-122   Solanum tuberosum [potatoes]
gb|ADP09635.1|  L-galactono-1,4-lactone dehydrogenase                   370   2e-121   Solanum tuberosum [potatoes]
ref|NP_001275320.1|  L-galactono-1,4-lactone dehydrogenase protein      370   3e-121   Solanum tuberosum [potatoes]
dbj|BAA87934.1|  L-galactono-gamma-lactone dehydrogenase                368   2e-120   Nicotiana tabacum [American tobacco]
ref|XP_009770995.1|  PREDICTED: L-galactono-1,4-lactone dehydroge...    368   2e-120   Nicotiana sylvestris
ref|XP_009618245.1|  PREDICTED: L-galactono-1,4-lactone dehydroge...    366   8e-120   Nicotiana tomentosiformis
gb|ADP09637.1|  L-galactono-1,4-lactone dehydrogenase                   366   9e-120   Solanum lycopersicum var. cerasiforme [cherry tomato]
gb|AAS58446.2|  L-galactono-1,4-lactone dehydrogenase                   365   1e-119   Capsicum annuum
dbj|BAB13368.1|  L-galactono-1,4-lactone dehydrogenase                  365   2e-119   Nicotiana tabacum [American tobacco]
ref|NP_001234603.1|  L-galactono-1,4-lactone dehydrogenase              360   2e-117   
ref|XP_006351263.1|  PREDICTED: L-galactono-1,4-lactone dehydroge...    358   8e-117   Solanum tuberosum [potatoes]
ref|XP_011075395.1|  PREDICTED: L-galactono-1,4-lactone dehydroge...    357   3e-116   
gb|ABL75267.1|  L-galactono-1,4-lactone dehydrogenase-like protein      357   3e-116   Solanum tuberosum [potatoes]
gb|AHB11182.1|  L-galactono-1,4-lactone dehydrogenase                   350   2e-113   Camellia sinensis [black tea]
gb|KDO50126.1|  hypothetical protein CISIN_1g017772mg                   342   4e-113   Citrus sinensis [apfelsine]
ref|XP_010543521.1|  PREDICTED: L-galactono-1,4-lactone dehydroge...    345   1e-111   Tarenaya hassleriana [spider flower]
ref|XP_010543522.1|  PREDICTED: L-galactono-1,4-lactone dehydroge...    345   1e-111   Tarenaya hassleriana [spider flower]
ref|XP_006404315.1|  hypothetical protein EUTSA_v10010214mg             345   2e-111   Eutrema salsugineum [saltwater cress]
ref|XP_006491571.1|  PREDICTED: L-galactono-1,4-lactone dehydroge...    344   4e-111   
emb|CDP14214.1|  unnamed protein product                                344   6e-111   Coffea canephora [robusta coffee]
gb|EYU18653.1|  hypothetical protein MIMGU_mgv1a002885mg                343   1e-110   Erythranthe guttata [common monkey flower]
gb|ACO92659.1|  mitochondrial L-galactono-1,4-lactone dehydrogenase     342   2e-110   Citrus unshiu [satsuma mandarin]
ref|XP_009149861.1|  PREDICTED: L-galactono-1,4-lactone dehydroge...    342   3e-110   Brassica rapa
emb|CDY36916.1|  BnaA06g17010D                                          342   3e-110   Brassica napus [oilseed rape]
dbj|BAH03303.1|  L-galactono-1,4-lactone dehydrogenase                  340   1e-109   Prunus persica
sp|O47881.1|GLDH_BRAOL  RecName: Full=L-galactono-1,4-lactone deh...    339   4e-109   Brassica oleracea
ref|XP_007204591.1|  hypothetical protein PRUPE_ppa003167mg             338   1e-108   Prunus persica
ref|XP_008240731.1|  PREDICTED: L-galactono-1,4-lactone dehydroge...    337   2e-108   Prunus mume [ume]
gb|KGN53984.1|  hypothetical protein Csa_4G236360                       329   2e-108   
ref|XP_006290330.1|  hypothetical protein CARUB_v10016859mg             337   2e-108   Capsella rubella
ref|XP_010515105.1|  PREDICTED: L-galactono-1,4-lactone dehydroge...    337   2e-108   Camelina sativa [gold-of-pleasure]
ref|XP_004151495.1|  PREDICTED: L-galactono-1,4-lactone dehydroge...    328   3e-108   
ref|XP_010503409.1|  PREDICTED: L-galactono-1,4-lactone dehydroge...    337   3e-108   Camelina sativa [gold-of-pleasure]
gb|ADB85575.1|  L-galactono-1,4-lactone dehydrogenase                   328   3e-108   Actinidia deliciosa [Chinese gooseberry]
ref|XP_010922174.1|  PREDICTED: L-galactono-1,4-lactone dehydroge...    337   5e-108   Elaeis guineensis
ref|XP_008808781.1|  PREDICTED: L-galactono-1,4-lactone dehydroge...    336   5e-108   Phoenix dactylifera
dbj|BAA95212.1|  L-Galactono-1,4-lactone dehydorogenase                 335   1e-107   Arabidopsis thaliana [mouse-ear cress]
ref|NP_190376.1|  L-galactono-1,4-lactone dehydrogenase                 335   1e-107   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010426264.1|  PREDICTED: L-galactono-1,4-lactone dehydroge...    335   1e-107   Camelina sativa [gold-of-pleasure]
ref|XP_004162073.1|  PREDICTED: L-galactono-1,4-lactone dehydroge...    326   2e-107   
gb|ABR88113.1|  mitochondrial L-galactono-1,4-lactone dehydrogenase     326   3e-107   Malus domestica [apple tree]
ref|XP_002875871.1|  L-galactono-1,4-lactone dehydorogenase             334   3e-107   
dbj|BAC42562.1|  putative L-galactono-1,4-lactone dehydrogenase         334   4e-107   Arabidopsis thaliana [mouse-ear cress]
gb|AAT67210.1|  mitochondrial L-galactono-1,4-lactone dehydrogenase     332   1e-106   Rosa roxburghii [chestnut rose]
dbj|BAP75922.1|  L-galactose-1-phosphate phosphatase                    323   2e-106   Moringa oleifera [maranga]
ref|XP_004303609.1|  PREDICTED: L-galactono-1,4-lactone dehydroge...    332   2e-106   Fragaria vesca subsp. vesca
ref|XP_009405576.1|  PREDICTED: L-galactono-1,4-lactone dehydroge...    331   3e-106   Musa acuminata subsp. malaccensis [pisang utan]
gb|EEC67659.1|  hypothetical protein OsI_35074                          324   4e-106   Oryza sativa Indica Group [Indian rice]
ref|XP_008359587.1|  PREDICTED: L-galactono-1,4-lactone dehydroge...    331   5e-106   
ref|XP_010273249.1|  PREDICTED: L-galactono-1,4-lactone dehydroge...    331   5e-106   Nelumbo nucifera [Indian lotus]
gb|ADT80722.1|  L-galactono-1,4-lactone dehydrogenase                   330   6e-106   Cucumis sativus [cucumbers]
gb|KFK34094.1|  hypothetical protein AALP_AA5G101200                    330   2e-105   Arabis alpina [alpine rockcress]
ref|XP_007028561.1|  L-galactono-1,4-lactone dehydrogenase              328   4e-105   
ref|XP_009341950.1|  PREDICTED: L-galactono-1,4-lactone dehydroge...    328   5e-105   Pyrus x bretschneideri [bai li]
ref|XP_002531501.1|  galactono-1,4-lactone dehydrogenase, putative      328   6e-105   
emb|CDL93466.2|  L-galactono-1,4-lactone dehydrogenase                  328   6e-105   Lactuca sativa [cultivated lettuce]
ref|XP_010056286.1|  PREDICTED: L-galactono-1,4-lactone dehydroge...    328   7e-105   Eucalyptus grandis [rose gum]
gb|KJB46250.1|  hypothetical protein B456_007G353900                    320   1e-104   Gossypium raimondii
gb|KHN25185.1|  L-galactono-1,4-lactone dehydrogenase, mitochondrial    322   1e-104   Glycine soja [wild soybean]
gb|EEC68837.1|  hypothetical protein OsI_37417                          326   2e-104   Oryza sativa Indica Group [Indian rice]
emb|CBX24429.1|  hypothetical_protein                                   325   4e-104   Oryza glaberrima
sp|Q2RAP0.1|GLDH1_ORYSJ  RecName: Full=L-galactono-1,4-lactone de...    325   4e-104   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001065724.1|  Os11g0143500                                       326   5e-104   
gb|ABE68384.1|  mitochondrial L-galactono-1,4-lactone dehydrogenase     326   5e-104   Lotus japonicus
emb|CBX25473.1|  hypothetical_protein                                   325   8e-104   Oryza glaberrima
gb|AAM48582.1|  L-galactono-1,4-lactone dehydrogenase                   325   8e-104   Fragaria x ananassa
ref|NP_001284400.1|  L-galactono-1,4-lactone dehydrogenase, mitoc...    324   1e-103   Cucumis melo [Oriental melon]
gb|ACN88687.1|  L-galactono-1,4-lactone dehydrogenase                   325   1e-103   Malus domestica [apple tree]
ref|XP_011033135.1|  PREDICTED: L-galactono-1,4-lactone dehydroge...    324   3e-103   Populus euphratica
ref|XP_009349062.1|  PREDICTED: L-galactono-1,4-lactone dehydroge...    323   4e-103   
sp|Q2QXY1.1|GLDH2_ORYSJ  RecName: Full=L-galactono-1,4-lactone de...    323   4e-103   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004515564.1|  PREDICTED: L-galactono-1,4-lactone dehydroge...    323   6e-103   Cicer arietinum [garbanzo]
ref|XP_006574356.1|  PREDICTED: uncharacterized protein LOC100526...    322   9e-103   
emb|CBI30081.3|  unnamed protein product                                317   1e-102   Vitis vinifera
ref|XP_006663194.1|  PREDICTED: L-galactono-1,4-lactone dehydroge...    315   2e-102   
gb|KJB46249.1|  hypothetical protein B456_007G353900                    322   2e-102   Gossypium raimondii
gb|KHG09426.1|  L-galactono-1,4-lactone dehydrogenase-2C mitochon...    322   2e-102   Gossypium arboreum [tree cotton]
ref|XP_003535902.1|  PREDICTED: L-galactono-1,4-lactone dehydroge...    320   3e-102   Glycine max [soybeans]
gb|KDP26223.1|  hypothetical protein JCGZ_22469                         320   1e-101   Jatropha curcas
gb|AES60484.2|  L-galactono-1,4-lactone dehydrogenase                   319   2e-101   Medicago truncatula
ref|XP_007145549.1|  hypothetical protein PHAVU_007G247900g             318   3e-101   Phaseolus vulgaris [French bean]
gb|EPS69983.1|  l-galactono-1,4-lactone dehydrogenase                   318   5e-101   Genlisea aurea
ref|XP_006664325.1|  PREDICTED: L-galactono-1,4-lactone dehydroge...    311   7e-101   Oryza brachyantha
emb|CBX25291.1|  hypothetical_protein                                   317   1e-100   Oryza brachyantha
ref|XP_002274214.2|  PREDICTED: L-galactono-1,4-lactone dehydroge...    317   1e-100   Vitis vinifera
gb|ACN59217.1|  putative L-galactono-1,4-lactone dehydrogenase          317   2e-100   Vitis vinifera
ref|XP_008392427.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    315   1e-99    
emb|CBX25378.1|  hypothetical_protein                                   313   4e-99    Oryza brachyantha
ref|XP_004977506.1|  PREDICTED: L-galactono-1,4-lactone dehydroge...    311   8e-99    Setaria italica
ref|NP_001167748.1|  uncharacterized protein LOC100381436               309   1e-97    Zea mays [maize]
ref|XP_010238743.1|  PREDICTED: L-galactono-1,4-lactone dehydroge...    308   3e-97    Brachypodium distachyon [annual false brome]
ref|XP_010102741.1|  L-galactono-1,4-lactone dehydrogenase              307   9e-97    Morus notabilis
ref|XP_004978646.1|  PREDICTED: L-galactono-1,4-lactone dehydroge...    306   1e-96    Setaria italica
dbj|BAJ86467.1|  predicted protein                                      308   1e-96    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002322641.1|  L-GALACTONO-1 family protein                       305   6e-96    Populus trichocarpa [western balsam poplar]
gb|ACG75919.1|  L-galactono-1,4-lactone dehydrogenase                   303   3e-95    Malpighia glabra [acerola]
gb|EMS62931.1|  L-galactono-1,4-lactone dehydrogenase 2, mitochon...    306   2e-94    Triticum urartu
ref|XP_007203043.1|  hypothetical protein PRUPE_ppa022778mg             291   3e-91    
ref|XP_010672973.1|  PREDICTED: L-galactono-1,4-lactone dehydroge...    290   3e-90    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006843351.1|  hypothetical protein AMTR_s00053p00045580          276   1e-84    Amborella trichopoda
ref|XP_007203979.1|  hypothetical protein PRUPE_ppa025367mg             263   2e-81    
ref|XP_002307994.2|  hypothetical protein POPTR_0006s04170g             255   3e-80    
ref|XP_001758906.1|  predicted protein                                  261   9e-79    
ref|XP_010922175.1|  PREDICTED: L-galactono-1,4-lactone dehydroge...    258   2e-78    
gb|AJC01346.1|  L-galactono-1-4-lactone dehydrogenase                   248   3e-77    Myrciaria dubia [camu-camu]
gb|ACJ38538.1|  mitochondrial galactono-1,4-lactone dehydrogenase       248   1e-74    Oncidium hybrid cultivar
ref|NP_001236372.1|  uncharacterized protein LOC100526948               234   3e-74    
gb|KJB46251.1|  hypothetical protein B456_007G353900                    244   9e-73    Gossypium raimondii
emb|CAN78536.1|  hypothetical protein VITISV_039856                     241   5e-72    Vitis vinifera
gb|KHN28852.1|  L-galactono-1,4-lactone dehydrogenase, mitochondrial    236   2e-68    Glycine soja [wild soybean]
ref|XP_002973111.1|  hypothetical protein SELMODRAFT_98882              224   6e-65    
ref|XP_002976749.1|  hypothetical protein SELMODRAFT_105274             224   6e-65    
ref|XP_005843316.1|  hypothetical protein CHLNCDRAFT_28225              219   5e-64    Chlorella variabilis
gb|ACV71025.1|  L-galactono-1,4-lactone dehydrogenase                   206   1e-63    Agropyron cristatum [crested wheatgrass]
emb|CBJ29466.1|  L-galactono-1,4-lactone dehydrogenase                  219   2e-63    Ectocarpus siliculosus
ref|XP_004995806.1|  galactonolactone dehydrogenase                     213   4e-61    Salpingoeca rosetta
ref|XP_011401503.1|  L-galactono-1,4-lactone dehydrogenase 2, mit...    211   1e-60    Auxenochlorella protothecoides
ref|XP_005644279.1|  L-galactono-1,4-lactone dehydrogenase-like p...    202   1e-57    Coccomyxa subellipsoidea C-169
ref|XP_005535453.1|  L-Galactono-1,4-lactone dehydrogenase              201   9e-57    Cyanidioschyzon merolae strain 10D
ref|XP_002999106.1|  L-gulonolactone oxidase, putative                  187   3e-52    Phytophthora infestans T30-4
gb|ACR38105.1|  unknown                                                 172   2e-50    Zea mays [maize]
gb|KIY97008.1|  hypothetical protein MNEG_10953                         182   2e-50    Monoraphidium neglectum
ref|XP_003607624.1|  Mitochondrial L-galactono-1 4-lactone dehydr...    171   6e-50    
emb|CEF97592.1|  FAD linked oxidase, N-terminal                         183   6e-50    Ostreococcus tauri
ref|XP_008892069.1|  galactonolactone dehydrogenase                     182   9e-50    Phytophthora parasitica INRA-310
gb|ETL43034.1|  galactonolactone dehydrogenase                          182   1e-49    Phytophthora parasitica
gb|ETL96210.1|  galactonolactone dehydrogenase                          182   1e-49    Phytophthora parasitica
ref|XP_009519067.1|  hypothetical protein PHYSODRAFT_485337             179   2e-49    Phytophthora sojae
gb|ETI49748.1|  galactonolactone dehydrogenase                          181   3e-49    Phytophthora parasitica P1569
gb|ETK89633.1|  galactonolactone dehydrogenase                          181   3e-49    Phytophthora parasitica
ref|XP_009039767.1|  hypothetical protein AURANDRAFT_70295              181   3e-49    Aureococcus anophagefferens
ref|XP_005788723.1|  mitochondrial L-galactono-1,4-lactone dehydr...    179   1e-48    Emiliania huxleyi CCMP1516
ref|XP_005710519.1|  unnamed protein product                            178   5e-48    Chondrus crispus [carageen]
emb|CCA18080.1|  Lgulonolactone oxidase putative                        175   2e-47    Albugo laibachii Nc14
ref|XP_006421269.1|  hypothetical protein CICLE_v100046031mg            174   4e-47    
ref|XP_001748157.1|  hypothetical protein                               178   1e-46    Monosiga brevicollis MX1
ref|XP_003078802.1|  mitochondrial L-galactono-1,4-lactone dehydr...    176   3e-46    
ref|XP_002501872.1|  galactonolactone dehydrogenase                     172   8e-46    Micromonas commoda
gb|EWM25741.1|  l-galactono- -lactone dehydrogenase                     172   1e-45    Nannochloropsis gaditana
ref|XP_005854870.1|  L-galactono-1,4-lactone dehydrogenase              171   3e-45    Nannochloropsis gaditana CCMP526
gb|AAZ32884.1|  L-galactono-1,4-lactone dehydrogenase-like protein      158   5e-44    Medicago sativa [alfalfa]
ref|XP_009840799.1|  galactonolactone dehydrogenase                     166   8e-44    Aphanomyces astaci
emb|CCI11057.1|  unnamed protein product                                165   1e-43    Albugo candida
gb|KDO30670.1|  galactonolactone dehydrogenase                          164   2e-43    Saprolegnia parasitica CBS 223.65
ref|XP_008607943.1|  galactonolactone dehydrogenase                     162   2e-42    Saprolegnia diclina VS20
gb|KEH15833.1|  D-arabinono-1,4-lactone oxidase family protein          152   6e-42    Medicago truncatula
ref|XP_002184261.1|  L-galactono-1,4-lactone dehydrogenase              160   7e-42    Phaeodactylum tricornutum CCAP 1055/1
ref|XP_001417255.1|  predicted protein                                  157   6e-41    Ostreococcus lucimarinus CCE9901
ref|XP_008657110.1|  PREDICTED: L-galactono-1,4-lactone dehydroge...    146   2e-40    Zea mays [maize]
ref|XP_003590233.1|  Mitochondrial L-galactono-1 4-lactone dehydr...    154   1e-39    
ref|XP_006421268.1|  hypothetical protein CICLE_v100046032mg            143   2e-39    
ref|XP_002450254.1|  hypothetical protein SORBIDRAFT_05g002615          142   6e-39    
dbj|BAO94255.2|  L-galactono-1,4-lactone dehydrogenase                  150   2e-38    Euglena gracilis
gb|AFW84720.1|  hypothetical protein ZEAMMB73_482719                    148   2e-37    
gb|EJK68285.1|  hypothetical protein THAOC_10550                        147   6e-37    Thalassiosira oceanica
ref|XP_002948012.1|  hypothetical protein VOLCADRAFT_88191              145   2e-36    Volvox carteri f. nagariensis
ref|XP_008878801.1|  galactonolactone dehydrogenase                     143   1e-35    Aphanomyces invadans
ref|NP_001118789.1|  L-galactono-1,4-lactone dehydrogenase              142   2e-35    
ref|XP_007512550.1|  L-galactono-1,4-lactone dehydrogenase              140   9e-34    Bathycoccus prasinos
ref|XP_003057660.1|  predicted protein                                  139   3e-33    Micromonas pusilla CCMP1545
ref|XP_002289008.1|  probable glactonolatone dehydrogenase              133   4e-32    Thalassiosira pseudonana CCMP1335
gb|ABI26714.1|  L-galactono-1,4-lactone dehydrogenase                   122   8e-30    Vitis vinifera
gb|ETO19508.1|  putative glactonolatone dehydrogenase                   120   4e-28    Reticulomyxa filosa
gb|KDD75406.1|  hypothetical protein H632_c698p0                        114   3e-27    Helicosporidium sp. ATCC 50920
gb|ABO64439.1|  L-galactosedehydrogenase                                103   1e-22    Cucumis sativus [cucumbers]
ref|NP_001066120.2|  Os12g0139600                                     85.5    7e-18    
ref|XP_001693696.1|  L-galactono-1,4-lactone dehydrogenase            77.8    7e-13    Chlamydomonas reinhardtii
gb|ADK12916.1|  L-galactono-1,4-lacton dehydrognease                  62.8    2e-08    Actinidia eriantha
ref|XP_009051634.1|  hypothetical protein LOTGIDRAFT_208933           58.5    1e-06    Lottia gigantea
ref|XP_005707018.1|  D-arabinono-1,4-lactone oxidase                  56.6    7e-06    Galdieria sulphuraria
gb|EPY23514.1|  L-gulonolactone oxidase                               55.5    1e-05    Strigomonas culicis
gb|EPY23832.1|  L-gulonolactone oxidase                               55.1    2e-05    Strigomonas culicis
emb|CDX77878.1|  BnaC03g53410D                                        52.8    4e-05    
emb|CCC90558.1|  unnamed protein product                              50.8    6e-04    Trypanosoma congolense IL3000
ref|XP_004336118.1|  Lgulono-gamma-lactone oxidase                    50.4    7e-04    Acanthamoeba castellanii str. Neff



>dbj|BAA34995.1| L-Galactono-1,4-lactone dehydrogenase [Ipomoea batatas]
Length=581

 Score =   393 bits (1010),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 183/183 (100%), Positives = 183/183 (100%), Gaps = 0/183 (0%)
 Frame = -2

Query  726  WRKSEGYRVGWSDEILGFDCGGHQWVSETCFPAGTLSKPSMKDLEFIEQLMQLIEKESIP  547
            WRKSEGYRVGWSDEILGFDCGGHQWVSETCFPAGTLSKPSMKDLEFIEQLMQLIEKESIP
Sbjct  395  WRKSEGYRVGWSDEILGFDCGGHQWVSETCFPAGTLSKPSMKDLEFIEQLMQLIEKESIP  454

Query  546  APAPIEQRWTACSKSLMSPAYSSVDDDIFSWVGIIMYLPTMDARERKHITEEFFHYRHLT  367
            APAPIEQRWTACSKSLMSPAYSSVDDDIFSWVGIIMYLPTMDARERKHITEEFFHYRHLT
Sbjct  455  APAPIEQRWTACSKSLMSPAYSSVDDDIFSWVGIIMYLPTMDARERKHITEEFFHYRHLT  514

Query  366  QAHLWDHYSAYEHWAKIEVPKDKEELQALQARLRKKFPVDAYNRARQELDPNRILSNNML  187
            QAHLWDHYSAYEHWAKIEVPKDKEELQALQARLRKKFPVDAYNRARQELDPNRILSNNML
Sbjct  515  QAHLWDHYSAYEHWAKIEVPKDKEELQALQARLRKKFPVDAYNRARQELDPNRILSNNML  574

Query  186  EKL  178
            EKL
Sbjct  575  EKL  577



>gb|ACO57437.1| L-galactono-1,4-lactone dehydrogenase protein [Solanum tuberosum]
Length=590

 Score =   372 bits (955),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 169/183 (92%), Positives = 179/183 (98%), Gaps = 0/183 (0%)
 Frame = -2

Query  726  WRKSEGYRVGWSDEILGFDCGGHQWVSETCFPAGTLSKPSMKDLEFIEQLMQLIEKESIP  547
            WRKSEGYRVGWSDEILGFDCGGHQWVSETCFPAGTLSKPSMKDLE+IE+LMQLIEKES+P
Sbjct  401  WRKSEGYRVGWSDEILGFDCGGHQWVSETCFPAGTLSKPSMKDLEYIEELMQLIEKESVP  460

Query  546  APAPIEQRWTACSKSLMSPAYSSVDDDIFSWVGIIMYLPTMDARERKHITEEFFHYRHLT  367
            APAPIEQRWTACSKS MSPAYSSVDDDIFSWVGIIMYLPTMDAR+R+ ITEEFFHYRH+T
Sbjct  461  APAPIEQRWTACSKSRMSPAYSSVDDDIFSWVGIIMYLPTMDARQRRQITEEFFHYRHMT  520

Query  366  QAHLWDHYSAYEHWAKIEVPKDKEELQALQARLRKKFPVDAYNRARQELDPNRILSNNML  187
            QA LWDHYSA+EHWAKIEVPKDKEEL ALQARL+KKFPVDAYN+AR+ELDPNRILSNNML
Sbjct  521  QAQLWDHYSAFEHWAKIEVPKDKEELTALQARLKKKFPVDAYNQARKELDPNRILSNNML  580

Query  186  EKL  178
            EKL
Sbjct  581  EKL  583



>gb|ADP09635.1| L-galactono-1,4-lactone dehydrogenase [Solanum tuberosum]
Length=590

 Score =   370 bits (950),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 168/183 (92%), Positives = 178/183 (97%), Gaps = 0/183 (0%)
 Frame = -2

Query  726  WRKSEGYRVGWSDEILGFDCGGHQWVSETCFPAGTLSKPSMKDLEFIEQLMQLIEKESIP  547
            WRKSEGYRVGWSDEILGFDCGGHQWVSETCFPAGTLSKPSMKDLE+IE+LMQLIEKES+P
Sbjct  401  WRKSEGYRVGWSDEILGFDCGGHQWVSETCFPAGTLSKPSMKDLEYIEELMQLIEKESVP  460

Query  546  APAPIEQRWTACSKSLMSPAYSSVDDDIFSWVGIIMYLPTMDARERKHITEEFFHYRHLT  367
            APAPIEQRWTACSK  MSPAYSSVDDDIFSWVGIIMYLPTMDAR+R+ ITEEFFHYRH+T
Sbjct  461  APAPIEQRWTACSKGRMSPAYSSVDDDIFSWVGIIMYLPTMDARQRRQITEEFFHYRHMT  520

Query  366  QAHLWDHYSAYEHWAKIEVPKDKEELQALQARLRKKFPVDAYNRARQELDPNRILSNNML  187
            QA LWDHYSA+EHWAKIEVPKDKEEL ALQARL+KKFPVDAYN+AR+ELDPNRILSNNML
Sbjct  521  QAQLWDHYSAFEHWAKIEVPKDKEELTALQARLKKKFPVDAYNQARKELDPNRILSNNML  580

Query  186  EKL  178
            EKL
Sbjct  581  EKL  583



>ref|NP_001275320.1| L-galactono-1,4-lactone dehydrogenase protein [Solanum tuberosum]
 gb|ADP09636.1| L-galactono-1,4-lactone dehydrogenase [Solanum tuberosum]
Length=590

 Score =   370 bits (950),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 168/183 (92%), Positives = 178/183 (97%), Gaps = 0/183 (0%)
 Frame = -2

Query  726  WRKSEGYRVGWSDEILGFDCGGHQWVSETCFPAGTLSKPSMKDLEFIEQLMQLIEKESIP  547
            WRKSEGYRVGWSDEILGFDCGGHQWVSETCFPAGTLSKPSMKDLE+IE+LMQLIEKES+P
Sbjct  401  WRKSEGYRVGWSDEILGFDCGGHQWVSETCFPAGTLSKPSMKDLEYIEELMQLIEKESVP  460

Query  546  APAPIEQRWTACSKSLMSPAYSSVDDDIFSWVGIIMYLPTMDARERKHITEEFFHYRHLT  367
            AP PIEQRWTACSKS MSPAYSSVDDDIFSWVGIIMYLPTMDAR+R+ ITEEFFHYRH+T
Sbjct  461  APTPIEQRWTACSKSRMSPAYSSVDDDIFSWVGIIMYLPTMDARQRRQITEEFFHYRHMT  520

Query  366  QAHLWDHYSAYEHWAKIEVPKDKEELQALQARLRKKFPVDAYNRARQELDPNRILSNNML  187
            QA LWDHYSA+EHWAKIEVPKDKEEL ALQARL+KKFPVDAYN+AR+ELDPNRILSNNML
Sbjct  521  QAQLWDHYSAFEHWAKIEVPKDKEELTALQARLKKKFPVDAYNQARKELDPNRILSNNML  580

Query  186  EKL  178
            EKL
Sbjct  581  EKL  583



>dbj|BAA87934.1| L-galactono-gamma-lactone dehydrogenase [Nicotiana tabacum]
Length=587

 Score =   368 bits (944),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 167/183 (91%), Positives = 177/183 (97%), Gaps = 0/183 (0%)
 Frame = -2

Query  726  WRKSEGYRVGWSDEILGFDCGGHQWVSETCFPAGTLSKPSMKDLEFIEQLMQLIEKESIP  547
            WRKSEGYRVGWSDEILGFDCGGHQWVSETCFPAGTLSKPSMKDLE+IE+LMQLIEKES+P
Sbjct  403  WRKSEGYRVGWSDEILGFDCGGHQWVSETCFPAGTLSKPSMKDLEYIEELMQLIEKESVP  462

Query  546  APAPIEQRWTACSKSLMSPAYSSVDDDIFSWVGIIMYLPTMDARERKHITEEFFHYRHLT  367
            APAPIEQRWTACSKS MSPAYSS DDDIFSWVGIIMYLPTMDAR+R+ ITEEFFHYRH+T
Sbjct  463  APAPIEQRWTACSKSRMSPAYSSADDDIFSWVGIIMYLPTMDARQRRQITEEFFHYRHMT  522

Query  366  QAHLWDHYSAYEHWAKIEVPKDKEELQALQARLRKKFPVDAYNRARQELDPNRILSNNML  187
            QA LWDHYSA+EHWAKIEVPKDKEEL ALQ RL+KKFPVDAYN+AR+ELDPNRILSNNML
Sbjct  523  QAQLWDHYSAFEHWAKIEVPKDKEELAALQERLKKKFPVDAYNQARKELDPNRILSNNML  582

Query  186  EKL  178
            EKL
Sbjct  583  EKL  585



>ref|XP_009770995.1| PREDICTED: L-galactono-1,4-lactone dehydrogenase, mitochondrial 
[Nicotiana sylvestris]
Length=592

 Score =   368 bits (944),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 167/183 (91%), Positives = 177/183 (97%), Gaps = 0/183 (0%)
 Frame = -2

Query  726  WRKSEGYRVGWSDEILGFDCGGHQWVSETCFPAGTLSKPSMKDLEFIEQLMQLIEKESIP  547
            WRKSEGYRVGWSDEILGFDCGGHQWVSETCFPAGTLSKPSMKDLE+IE+LMQLIEKES+P
Sbjct  403  WRKSEGYRVGWSDEILGFDCGGHQWVSETCFPAGTLSKPSMKDLEYIEELMQLIEKESVP  462

Query  546  APAPIEQRWTACSKSLMSPAYSSVDDDIFSWVGIIMYLPTMDARERKHITEEFFHYRHLT  367
            APAPIEQRWTACSKS MSPAYSS DDDIFSWVGIIMYLPTMDAR+R+ ITEEFFHYRH+T
Sbjct  463  APAPIEQRWTACSKSRMSPAYSSADDDIFSWVGIIMYLPTMDARQRRQITEEFFHYRHMT  522

Query  366  QAHLWDHYSAYEHWAKIEVPKDKEELQALQARLRKKFPVDAYNRARQELDPNRILSNNML  187
            QA LWDHYSA+EHWAKIEVPKDKEEL ALQ RL+KKFPVDAYN+AR+ELDPNRILSNNML
Sbjct  523  QAQLWDHYSAFEHWAKIEVPKDKEELAALQERLKKKFPVDAYNQARKELDPNRILSNNML  582

Query  186  EKL  178
            EKL
Sbjct  583  EKL  585



>ref|XP_009618245.1| PREDICTED: L-galactono-1,4-lactone dehydrogenase, mitochondrial 
[Nicotiana tomentosiformis]
Length=592

 Score =   366 bits (940),  Expect = 8e-120, Method: Compositional matrix adjust.
 Identities = 165/183 (90%), Positives = 177/183 (97%), Gaps = 0/183 (0%)
 Frame = -2

Query  726  WRKSEGYRVGWSDEILGFDCGGHQWVSETCFPAGTLSKPSMKDLEFIEQLMQLIEKESIP  547
            WRKSEGYRVGWSDEILGFDCGGHQWVSETCFPAGTLSKPSMKDLE+IE+LMQLIEKES+P
Sbjct  403  WRKSEGYRVGWSDEILGFDCGGHQWVSETCFPAGTLSKPSMKDLEYIEELMQLIEKESVP  462

Query  546  APAPIEQRWTACSKSLMSPAYSSVDDDIFSWVGIIMYLPTMDARERKHITEEFFHYRHLT  367
            APAPIEQRWTACS+S MSPAYSS D DIFSWVGIIMYLPTMDAR+R+ ITEEFFHYRH+T
Sbjct  463  APAPIEQRWTACSRSRMSPAYSSADGDIFSWVGIIMYLPTMDARQRRQITEEFFHYRHMT  522

Query  366  QAHLWDHYSAYEHWAKIEVPKDKEELQALQARLRKKFPVDAYNRARQELDPNRILSNNML  187
            QA LWDHYSA+EHWAKIEVPKDKEEL +LQARL+KKFPVDAYN+AR+ELDPNRILSNNML
Sbjct  523  QAQLWDHYSAFEHWAKIEVPKDKEELASLQARLKKKFPVDAYNQARKELDPNRILSNNML  582

Query  186  EKL  178
            EKL
Sbjct  583  EKL  585



>gb|ADP09637.1| L-galactono-1,4-lactone dehydrogenase [Solanum lycopersicum var. 
cerasiforme]
Length=588

 Score =   366 bits (939),  Expect = 9e-120, Method: Compositional matrix adjust.
 Identities = 166/183 (91%), Positives = 177/183 (97%), Gaps = 0/183 (0%)
 Frame = -2

Query  726  WRKSEGYRVGWSDEILGFDCGGHQWVSETCFPAGTLSKPSMKDLEFIEQLMQLIEKESIP  547
            WRKSEGYRVGWSDEILGFDCGGHQWVSETCFPAGTLSKPSMKDLE+IE+LMQLIEKES+P
Sbjct  399  WRKSEGYRVGWSDEILGFDCGGHQWVSETCFPAGTLSKPSMKDLEYIEELMQLIEKESVP  458

Query  546  APAPIEQRWTACSKSLMSPAYSSVDDDIFSWVGIIMYLPTMDARERKHITEEFFHYRHLT  367
            APAPIEQRWTACSKS MSPAYSS DDDIFSWVGIIMYLPTMDAR+R+ ITEEFFHYRH+T
Sbjct  459  APAPIEQRWTACSKSRMSPAYSSADDDIFSWVGIIMYLPTMDARQRRQITEEFFHYRHMT  518

Query  366  QAHLWDHYSAYEHWAKIEVPKDKEELQALQARLRKKFPVDAYNRARQELDPNRILSNNML  187
            Q+ LWD YSA+EHWAKIEVPKDKEEL ALQARL+KKFPVDAYN+AR+ELDPNRILSNNML
Sbjct  519  QSQLWDQYSAFEHWAKIEVPKDKEELAALQARLKKKFPVDAYNQARKELDPNRILSNNML  578

Query  186  EKL  178
            EKL
Sbjct  579  EKL  581



>gb|AAS58446.2| L-galactono-1,4-lactone dehydrogenase [Capsicum annuum]
Length=586

 Score =   365 bits (938),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 167/183 (91%), Positives = 175/183 (96%), Gaps = 0/183 (0%)
 Frame = -2

Query  726  WRKSEGYRVGWSDEILGFDCGGHQWVSETCFPAGTLSKPSMKDLEFIEQLMQLIEKESIP  547
            WRKSEGYRVGWSDEILGFDCGGHQWVSETCFPAGTLSKPSMKDLE+IE+LMQLIEKES+P
Sbjct  397  WRKSEGYRVGWSDEILGFDCGGHQWVSETCFPAGTLSKPSMKDLEYIEELMQLIEKESVP  456

Query  546  APAPIEQRWTACSKSLMSPAYSSVDDDIFSWVGIIMYLPTMDARERKHITEEFFHYRHLT  367
            APAPIEQRWTACSKS MSPAYSS DDDIFSWVGIIMYLPTMDAR+RK ITEEFFHYRH+T
Sbjct  457  APAPIEQRWTACSKSQMSPAYSSADDDIFSWVGIIMYLPTMDARQRKQITEEFFHYRHMT  516

Query  366  QAHLWDHYSAYEHWAKIEVPKDKEELQALQARLRKKFPVDAYNRARQELDPNRILSNNML  187
            QA LWD YSA+EHWAKIEVPKDKEEL ALQARL+KKFPVDAYN+AR ELDPN ILSNNML
Sbjct  517  QAQLWDRYSAFEHWAKIEVPKDKEELAALQARLKKKFPVDAYNQARNELDPNHILSNNML  576

Query  186  EKL  178
            EKL
Sbjct  577  EKL  579



>dbj|BAB13368.1| L-galactono-1,4-lactone dehydrogenase [Nicotiana tabacum]
Length=587

 Score =   365 bits (937),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 165/183 (90%), Positives = 176/183 (96%), Gaps = 0/183 (0%)
 Frame = -2

Query  726  WRKSEGYRVGWSDEILGFDCGGHQWVSETCFPAGTLSKPSMKDLEFIEQLMQLIEKESIP  547
            WRKSEGYRVGWSDEILGFDCGGHQWVSETCFPAGTLSKPSMKDLE+IE+LMQLIEKES+P
Sbjct  403  WRKSEGYRVGWSDEILGFDCGGHQWVSETCFPAGTLSKPSMKDLEYIEELMQLIEKESVP  462

Query  546  APAPIEQRWTACSKSLMSPAYSSVDDDIFSWVGIIMYLPTMDARERKHITEEFFHYRHLT  367
            APAPIEQRWTACS+S MSPAYSS DDDIFSWVGIIMYLPTMDAR+R+ ITEEFFHYRH+T
Sbjct  463  APAPIEQRWTACSRSRMSPAYSSADDDIFSWVGIIMYLPTMDARQRRQITEEFFHYRHMT  522

Query  366  QAHLWDHYSAYEHWAKIEVPKDKEELQALQARLRKKFPVDAYNRARQELDPNRILSNNML  187
            QA LWDHYSA+EHWAKIEVPKDKEEL ALQ RL+KK PVDAYN+AR+ELDPNRILSNNML
Sbjct  523  QAQLWDHYSAFEHWAKIEVPKDKEELAALQERLKKKLPVDAYNQARKELDPNRILSNNML  582

Query  186  EKL  178
            EKL
Sbjct  583  EKL  585



>ref|NP_001234603.1| L-galactono-1,4-lactone dehydrogenase [Solanum lycopersicum]
 dbj|BAC11758.1| L-galactono-1,4-lactone dehydrogenase [Solanum lycopersicum]
Length=588

 Score =   360 bits (923),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 162/183 (89%), Positives = 175/183 (96%), Gaps = 0/183 (0%)
 Frame = -2

Query  726  WRKSEGYRVGWSDEILGFDCGGHQWVSETCFPAGTLSKPSMKDLEFIEQLMQLIEKESIP  547
            WRKSEGYRVGWSDEILGFDCGGHQWVSETCFPAGTLSKPSMKDLE+IE+LMQLIEKES+P
Sbjct  399  WRKSEGYRVGWSDEILGFDCGGHQWVSETCFPAGTLSKPSMKDLEYIEELMQLIEKESVP  458

Query  546  APAPIEQRWTACSKSLMSPAYSSVDDDIFSWVGIIMYLPTMDARERKHITEEFFHYRHLT  367
            APAPIEQRWTACSKS MSPAYSS DDDIFSWVGIIMYLPTMDAR+R+ ITEEFFHYRH+T
Sbjct  459  APAPIEQRWTACSKSQMSPAYSSADDDIFSWVGIIMYLPTMDARQRRQITEEFFHYRHMT  518

Query  366  QAHLWDHYSAYEHWAKIEVPKDKEELQALQARLRKKFPVDAYNRARQELDPNRILSNNML  187
            Q+ LWD YSA++HWAKIEVPKD E+L  LQARL+KKFPVDAYN+AR+ELDPNRILSNNML
Sbjct  519  QSQLWDQYSAFDHWAKIEVPKDIEDLAGLQARLKKKFPVDAYNQARKELDPNRILSNNML  578

Query  186  EKL  178
            EKL
Sbjct  579  EKL  581



>ref|XP_006351263.1| PREDICTED: L-galactono-1,4-lactone dehydrogenase, mitochondrial 
[Solanum tuberosum]
Length=589

 Score =   358 bits (920),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 163/183 (89%), Positives = 174/183 (95%), Gaps = 0/183 (0%)
 Frame = -2

Query  726  WRKSEGYRVGWSDEILGFDCGGHQWVSETCFPAGTLSKPSMKDLEFIEQLMQLIEKESIP  547
            WRKSEGYRVGWSDEILGFDCGGHQWVSETCFPAGTLSKPSMKDLE+IE+LMQLIEKES+P
Sbjct  403  WRKSEGYRVGWSDEILGFDCGGHQWVSETCFPAGTLSKPSMKDLEYIEELMQLIEKESVP  462

Query  546  APAPIEQRWTACSKSLMSPAYSSVDDDIFSWVGIIMYLPTMDARERKHITEEFFHYRHLT  367
            APAPIEQRWTA SKS MSPAYS  DDDIFSWVGIIMYLPTMD R+R+ ITEEFFHYRH+T
Sbjct  463  APAPIEQRWTASSKSRMSPAYSLADDDIFSWVGIIMYLPTMDTRQRRQITEEFFHYRHMT  522

Query  366  QAHLWDHYSAYEHWAKIEVPKDKEELQALQARLRKKFPVDAYNRARQELDPNRILSNNML  187
            QA LW HYSA+EHWAKIEVPKDKEEL ALQARL+KKFPVD+YN+AR+ELDPNRILSNNML
Sbjct  523  QAQLWGHYSAFEHWAKIEVPKDKEELAALQARLKKKFPVDSYNQARKELDPNRILSNNML  582

Query  186  EKL  178
            EKL
Sbjct  583  EKL  585



>ref|XP_011075395.1| PREDICTED: L-galactono-1,4-lactone dehydrogenase, mitochondrial 
[Sesamum indicum]
Length=601

 Score =   357 bits (917),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 164/183 (90%), Positives = 175/183 (96%), Gaps = 0/183 (0%)
 Frame = -2

Query  726  WRKSEGYRVGWSDEILGFDCGGHQWVSETCFPAGTLSKPSMKDLEFIEQLMQLIEKESIP  547
            WRKSEGYRVGWSDEILGFDCGG QWVSETCFPAG+LSKPSMKDLE+IEQLMQLIEKE+IP
Sbjct  412  WRKSEGYRVGWSDEILGFDCGGQQWVSETCFPAGSLSKPSMKDLEYIEQLMQLIEKENIP  471

Query  546  APAPIEQRWTACSKSLMSPAYSSVDDDIFSWVGIIMYLPTMDARERKHITEEFFHYRHLT  367
            APAPIEQRWTA S+SLMSPAYS+ +DDIFSWVGIIMYLPTMDAR+RK ITEEFFHYRHLT
Sbjct  472  APAPIEQRWTARSRSLMSPAYSASEDDIFSWVGIIMYLPTMDARQRKQITEEFFHYRHLT  531

Query  366  QAHLWDHYSAYEHWAKIEVPKDKEELQALQARLRKKFPVDAYNRARQELDPNRILSNNML  187
            QAHLWD YSAYEHWAKIEVPKDK+EL ALQARLRK+FPVDAYN+AR ELDPN ILSNN+L
Sbjct  532  QAHLWDQYSAYEHWAKIEVPKDKDELAALQARLRKRFPVDAYNKARNELDPNHILSNNVL  591

Query  186  EKL  178
            EKL
Sbjct  592  EKL  594



>gb|ABL75267.1| L-galactono-1,4-lactone dehydrogenase-like protein, partial [Solanum 
tuberosum]
Length=578

 Score =   357 bits (915),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 162/183 (89%), Positives = 173/183 (95%), Gaps = 0/183 (0%)
 Frame = -2

Query  726  WRKSEGYRVGWSDEILGFDCGGHQWVSETCFPAGTLSKPSMKDLEFIEQLMQLIEKESIP  547
            WRKSEGYRVGWSDEILGFDCGGHQWVSETCFPAGTLSKPSMKDLE+IE+LMQLIEKES+P
Sbjct  389  WRKSEGYRVGWSDEILGFDCGGHQWVSETCFPAGTLSKPSMKDLEYIEELMQLIEKESVP  448

Query  546  APAPIEQRWTACSKSLMSPAYSSVDDDIFSWVGIIMYLPTMDARERKHITEEFFHYRHLT  367
            APAPIEQRWTA  KS MSPAYS  DDDIFSWVGIIMYLPTMD R+R+ ITEEFFHYRH+T
Sbjct  449  APAPIEQRWTASGKSRMSPAYSLADDDIFSWVGIIMYLPTMDTRQRRQITEEFFHYRHMT  508

Query  366  QAHLWDHYSAYEHWAKIEVPKDKEELQALQARLRKKFPVDAYNRARQELDPNRILSNNML  187
            QA LW HYSA+EHWAKIEVPKDKEEL ALQARL+KKFPVD+YN+AR+ELDPNRILSNNML
Sbjct  509  QAQLWGHYSAFEHWAKIEVPKDKEELAALQARLKKKFPVDSYNQARKELDPNRILSNNML  568

Query  186  EKL  178
            EKL
Sbjct  569  EKL  571



>gb|AHB11182.1| L-galactono-1,4-lactone dehydrogenase [Camellia sinensis]
Length=610

 Score =   350 bits (898),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 160/183 (87%), Positives = 173/183 (95%), Gaps = 0/183 (0%)
 Frame = -2

Query  726  WRKSEGYRVGWSDEILGFDCGGHQWVSETCFPAGTLSKPSMKDLEFIEQLMQLIEKESIP  547
            WRKSEGYRVGWSDEILGFDCGG QWVSETCFPAGTLSKPSMKDLE+IE+LMQLI+KE+IP
Sbjct  421  WRKSEGYRVGWSDEILGFDCGGQQWVSETCFPAGTLSKPSMKDLEYIEELMQLIDKEAIP  480

Query  546  APAPIEQRWTACSKSLMSPAYSSVDDDIFSWVGIIMYLPTMDARERKHITEEFFHYRHLT  367
            APAPIEQRWTA SKSLMSPA S+ DDDIFSWVGIIMYLPTMDAR+RK IT+EFFHYRHL+
Sbjct  481  APAPIEQRWTARSKSLMSPASSTADDDIFSWVGIIMYLPTMDARQRKEITDEFFHYRHLS  540

Query  366  QAHLWDHYSAYEHWAKIEVPKDKEELQALQARLRKKFPVDAYNRARQELDPNRILSNNML  187
            Q+ LWD YSAYEHWAKIEVPKDK+EL  LQARLRK+FPVDAYN+AR+ELDPN ILSNNML
Sbjct  541  QSQLWDRYSAYEHWAKIEVPKDKDELATLQARLRKRFPVDAYNKARRELDPNHILSNNML  600

Query  186  EKL  178
            EKL
Sbjct  601  EKL  603



>gb|KDO50126.1| hypothetical protein CISIN_1g017772mg [Citrus sinensis]
 gb|KDO50127.1| hypothetical protein CISIN_1g017772mg [Citrus sinensis]
Length=366

 Score =   342 bits (876),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 157/183 (86%), Positives = 172/183 (94%), Gaps = 0/183 (0%)
 Frame = -2

Query  726  WRKSEGYRVGWSDEILGFDCGGHQWVSETCFPAGTLSKPSMKDLEFIEQLMQLIEKESIP  547
            WRKSEGYRVGW+DEILGFDCGG QWVSETCFP+GTL+K SMKDLE+IE+L QLIEKE IP
Sbjct  177  WRKSEGYRVGWADEILGFDCGGQQWVSETCFPSGTLAKLSMKDLEYIEELKQLIEKEDIP  236

Query  546  APAPIEQRWTACSKSLMSPAYSSVDDDIFSWVGIIMYLPTMDARERKHITEEFFHYRHLT  367
            APAPIEQRWTA S+S+MSPAYSSV DDIFSWVGIIMYLPTMDAR+RK IT+EFF+YRHL+
Sbjct  237  APAPIEQRWTARSQSVMSPAYSSVQDDIFSWVGIIMYLPTMDARQRKEITDEFFNYRHLS  296

Query  366  QAHLWDHYSAYEHWAKIEVPKDKEELQALQARLRKKFPVDAYNRARQELDPNRILSNNML  187
            Q  LWD YSAYEHWAKIEVPKDKEEL ALQARLRK+FPVD+YN+AR+ELDPNRILSNNML
Sbjct  297  QKQLWDQYSAYEHWAKIEVPKDKEELAALQARLRKRFPVDSYNKARKELDPNRILSNNML  356

Query  186  EKL  178
            EKL
Sbjct  357  EKL  359



>ref|XP_010543521.1| PREDICTED: L-galactono-1,4-lactone dehydrogenase, mitochondrial 
isoform X1 [Tarenaya hassleriana]
Length=590

 Score =   345 bits (886),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 157/183 (86%), Positives = 173/183 (95%), Gaps = 0/183 (0%)
 Frame = -2

Query  726  WRKSEGYRVGWSDEILGFDCGGHQWVSETCFPAGTLSKPSMKDLEFIEQLMQLIEKESIP  547
            W KSEGYRVGWSDEILGFDCGG QWVSETCF AGTLSKPSM+DLE+IE+L +LIEKE++P
Sbjct  401  WSKSEGYRVGWSDEILGFDCGGQQWVSETCFAAGTLSKPSMEDLEYIEELKKLIEKEAVP  460

Query  546  APAPIEQRWTACSKSLMSPAYSSVDDDIFSWVGIIMYLPTMDARERKHITEEFFHYRHLT  367
            APAPIEQRWTA SKSLMSPA+S+ DDDIFSWVGIIMYLPT DAR+RK IT+EFFHYRHLT
Sbjct  461  APAPIEQRWTARSKSLMSPAFSTADDDIFSWVGIIMYLPTTDARQRKDITDEFFHYRHLT  520

Query  366  QAHLWDHYSAYEHWAKIEVPKDKEELQALQARLRKKFPVDAYNRARQELDPNRILSNNML  187
            QA LWD YSAYEHWAKIE+PKDKEEL+ALQARLRK+FPVDAYN+AR+ELDPNRILSNNM+
Sbjct  521  QAELWDQYSAYEHWAKIEIPKDKEELEALQARLRKRFPVDAYNKARRELDPNRILSNNMV  580

Query  186  EKL  178
            EKL
Sbjct  581  EKL  583



>ref|XP_010543522.1| PREDICTED: L-galactono-1,4-lactone dehydrogenase, mitochondrial 
isoform X2 [Tarenaya hassleriana]
Length=589

 Score =   345 bits (885),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 157/183 (86%), Positives = 173/183 (95%), Gaps = 0/183 (0%)
 Frame = -2

Query  726  WRKSEGYRVGWSDEILGFDCGGHQWVSETCFPAGTLSKPSMKDLEFIEQLMQLIEKESIP  547
            W KSEGYRVGWSDEILGFDCGG QWVSETCF AGTLSKPSM+DLE+IE+L +LIEKE++P
Sbjct  400  WSKSEGYRVGWSDEILGFDCGGQQWVSETCFAAGTLSKPSMEDLEYIEELKKLIEKEAVP  459

Query  546  APAPIEQRWTACSKSLMSPAYSSVDDDIFSWVGIIMYLPTMDARERKHITEEFFHYRHLT  367
            APAPIEQRWTA SKSLMSPA+S+ DDDIFSWVGIIMYLPT DAR+RK IT+EFFHYRHLT
Sbjct  460  APAPIEQRWTARSKSLMSPAFSTADDDIFSWVGIIMYLPTTDARQRKDITDEFFHYRHLT  519

Query  366  QAHLWDHYSAYEHWAKIEVPKDKEELQALQARLRKKFPVDAYNRARQELDPNRILSNNML  187
            QA LWD YSAYEHWAKIE+PKDKEEL+ALQARLRK+FPVDAYN+AR+ELDPNRILSNNM+
Sbjct  520  QAELWDQYSAYEHWAKIEIPKDKEELEALQARLRKRFPVDAYNKARRELDPNRILSNNMV  579

Query  186  EKL  178
            EKL
Sbjct  580  EKL  582



>ref|XP_006404315.1| hypothetical protein EUTSA_v10010214mg [Eutrema salsugineum]
 gb|ESQ45768.1| hypothetical protein EUTSA_v10010214mg [Eutrema salsugineum]
Length=610

 Score =   345 bits (886),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 156/183 (85%), Positives = 173/183 (95%), Gaps = 0/183 (0%)
 Frame = -2

Query  726  WRKSEGYRVGWSDEILGFDCGGHQWVSETCFPAGTLSKPSMKDLEFIEQLMQLIEKESIP  547
            W+KSEGYRVGWSDEILGFDCGG QWVSETCFPAGTL+KPSMKDLE+IEQL +LIEKE+IP
Sbjct  421  WKKSEGYRVGWSDEILGFDCGGQQWVSETCFPAGTLAKPSMKDLEYIEQLKELIEKEAIP  480

Query  546  APAPIEQRWTACSKSLMSPAYSSVDDDIFSWVGIIMYLPTMDARERKHITEEFFHYRHLT  367
            APAPIEQRWTA SKS +SPA+S+ +DDIFSWVGIIMYLPT D R+RK IT+EFFHYRHLT
Sbjct  481  APAPIEQRWTARSKSPISPAFSTAEDDIFSWVGIIMYLPTADPRQRKDITDEFFHYRHLT  540

Query  366  QAHLWDHYSAYEHWAKIEVPKDKEELQALQARLRKKFPVDAYNRARQELDPNRILSNNML  187
            QA LWD YSAYEHWAKIE+PKDKEEL+ALQARLRK+FPVDAYN+AR+ELDPNRILSNNM+
Sbjct  541  QARLWDQYSAYEHWAKIEIPKDKEELEALQARLRKRFPVDAYNKARKELDPNRILSNNMV  600

Query  186  EKL  178
            EKL
Sbjct  601  EKL  603



>ref|XP_006491571.1| PREDICTED: L-galactono-1,4-lactone dehydrogenase, mitochondrial-like 
isoform X1 [Citrus sinensis]
 ref|XP_006491572.1| PREDICTED: L-galactono-1,4-lactone dehydrogenase, mitochondrial-like 
isoform X2 [Citrus sinensis]
 ref|XP_006491573.1| PREDICTED: L-galactono-1,4-lactone dehydrogenase, mitochondrial-like 
isoform X3 [Citrus sinensis]
Length=607

 Score =   344 bits (883),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 158/183 (86%), Positives = 172/183 (94%), Gaps = 0/183 (0%)
 Frame = -2

Query  726  WRKSEGYRVGWSDEILGFDCGGHQWVSETCFPAGTLSKPSMKDLEFIEQLMQLIEKESIP  547
            WRKSEGYRVGW+DEILGFDCGG QWVSETCFP+GTL+K SMKDLE+IE+L QLIEKE IP
Sbjct  418  WRKSEGYRVGWADEILGFDCGGQQWVSETCFPSGTLAKLSMKDLEYIEELKQLIEKEDIP  477

Query  546  APAPIEQRWTACSKSLMSPAYSSVDDDIFSWVGIIMYLPTMDARERKHITEEFFHYRHLT  367
            APAPIEQRWTA S+S+MSPAYSSV DDIFSWVGIIMYLPTMDAR+RK IT+EFF+YRHLT
Sbjct  478  APAPIEQRWTARSQSVMSPAYSSVQDDIFSWVGIIMYLPTMDARQRKEITDEFFNYRHLT  537

Query  366  QAHLWDHYSAYEHWAKIEVPKDKEELQALQARLRKKFPVDAYNRARQELDPNRILSNNML  187
            Q  LWD YSAYEHWAKIEVPKDKEEL ALQARLRK+FPVD+YN+AR+ELDPNRILSNNML
Sbjct  538  QKQLWDQYSAYEHWAKIEVPKDKEELAALQARLRKRFPVDSYNKARKELDPNRILSNNML  597

Query  186  EKL  178
            EKL
Sbjct  598  EKL  600



>emb|CDP14214.1| unnamed protein product [Coffea canephora]
Length=606

 Score =   344 bits (882),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 156/183 (85%), Positives = 167/183 (91%), Gaps = 0/183 (0%)
 Frame = -2

Query  726  WRKSEGYRVGWSDEILGFDCGGHQWVSETCFPAGTLSKPSMKDLEFIEQLMQLIEKESIP  547
            WRKSEGYR+GWSDEILGFDCGG QWVSE CFP GTLSKPSM DL +IE+L QLIE+E++P
Sbjct  416  WRKSEGYRIGWSDEILGFDCGGQQWVSEICFPTGTLSKPSMSDLGYIEELTQLIERENVP  475

Query  546  APAPIEQRWTACSKSLMSPAYSSVDDDIFSWVGIIMYLPTMDARERKHITEEFFHYRHLT  367
            APAPIEQRWTACSKS MSPA+S V+DDIFSWVGIIMYLPT DAR+RK ITEEFFHYRHLT
Sbjct  476  APAPIEQRWTACSKSFMSPAHSPVEDDIFSWVGIIMYLPTTDARQRKQITEEFFHYRHLT  535

Query  366  QAHLWDHYSAYEHWAKIEVPKDKEELQALQARLRKKFPVDAYNRARQELDPNRILSNNML  187
               LWD YSAYEHWAKIEVPKDKEEL ALQARLRK+FPVD YNRAR+ELDPNRILSNNML
Sbjct  536  YKQLWDRYSAYEHWAKIEVPKDKEELAALQARLRKRFPVDEYNRARKELDPNRILSNNML  595

Query  186  EKL  178
            EKL
Sbjct  596  EKL  598



>gb|EYU18653.1| hypothetical protein MIMGU_mgv1a002885mg [Erythranthe guttata]
Length=628

 Score =   343 bits (881),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 158/183 (86%), Positives = 171/183 (93%), Gaps = 0/183 (0%)
 Frame = -2

Query  726  WRKSEGYRVGWSDEILGFDCGGHQWVSETCFPAGTLSKPSMKDLEFIEQLMQLIEKESIP  547
            WRKSEG+RVGWSDEILGFDCGG QWVSETCFPAGTLSKPSM DLE+IE+LMQ+IEKE++P
Sbjct  438  WRKSEGFRVGWSDEILGFDCGGQQWVSETCFPAGTLSKPSMNDLEYIEKLMQIIEKENLP  497

Query  546  APAPIEQRWTACSKSLMSPAYSSVDDDIFSWVGIIMYLPTMDARERKHITEEFFHYRHLT  367
            APAPIEQRW+A SKSLMSPAYSS +DDIFSWVGIIMYLPT DARERK+ITEEFFHYR LT
Sbjct  498  APAPIEQRWSARSKSLMSPAYSSSEDDIFSWVGIIMYLPTSDARERKNITEEFFHYRRLT  557

Query  366  QAHLWDHYSAYEHWAKIEVPKDKEELQALQARLRKKFPVDAYNRARQELDPNRILSNNML  187
            Q  LWD YSAYEHWAKIEVPKDK+EL ALQARLRK+FPVDAYN AR+ELDPNRI SNN+L
Sbjct  558  QEKLWDQYSAYEHWAKIEVPKDKDELVALQARLRKRFPVDAYNEARKELDPNRIFSNNIL  617

Query  186  EKL  178
            EKL
Sbjct  618  EKL  620



>gb|ACO92659.1| mitochondrial L-galactono-1,4-lactone dehydrogenase [Citrus unshiu]
Length=605

 Score =   342 bits (878),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 157/183 (86%), Positives = 171/183 (93%), Gaps = 0/183 (0%)
 Frame = -2

Query  726  WRKSEGYRVGWSDEILGFDCGGHQWVSETCFPAGTLSKPSMKDLEFIEQLMQLIEKESIP  547
            WRKSEGYRVGW+DEILGFDCGG QWVSETCFP+GTL+K SMKDLE+ E+L QLIEKE IP
Sbjct  416  WRKSEGYRVGWADEILGFDCGGQQWVSETCFPSGTLAKLSMKDLEYTEELKQLIEKEDIP  475

Query  546  APAPIEQRWTACSKSLMSPAYSSVDDDIFSWVGIIMYLPTMDARERKHITEEFFHYRHLT  367
            APAPIEQRWTA S+S+MSPAYSSV DDIFSWVGIIMYLPTMDAR+RK IT+EFF+YRHLT
Sbjct  476  APAPIEQRWTARSQSVMSPAYSSVQDDIFSWVGIIMYLPTMDARQRKEITDEFFNYRHLT  535

Query  366  QAHLWDHYSAYEHWAKIEVPKDKEELQALQARLRKKFPVDAYNRARQELDPNRILSNNML  187
            Q  LWD YSAYEHWAKIEVPKDKEEL ALQARLRK+FPVD+YN+AR+ELDPNRILSNNML
Sbjct  536  QKQLWDQYSAYEHWAKIEVPKDKEELAALQARLRKRFPVDSYNKARKELDPNRILSNNML  595

Query  186  EKL  178
            EKL
Sbjct  596  EKL  598



>ref|XP_009149861.1| PREDICTED: L-galactono-1,4-lactone dehydrogenase, mitochondrial 
[Brassica rapa]
Length=601

 Score =   342 bits (876),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 154/183 (84%), Positives = 171/183 (93%), Gaps = 0/183 (0%)
 Frame = -2

Query  726  WRKSEGYRVGWSDEILGFDCGGHQWVSETCFPAGTLSKPSMKDLEFIEQLMQLIEKESIP  547
            W+KSEGYRVGWSDEILGFDCGG QWVSETCFPAGTL+KPSMKDLE+IEQL +LIEKE+IP
Sbjct  412  WKKSEGYRVGWSDEILGFDCGGQQWVSETCFPAGTLAKPSMKDLEYIEQLKELIEKEAIP  471

Query  546  APAPIEQRWTACSKSLMSPAYSSVDDDIFSWVGIIMYLPTMDARERKHITEEFFHYRHLT  367
            AP+PIEQRWT  SKS MSPA+S+ +DDIFSWVGIIMYLPT D R+RK IT+EFFHYRHLT
Sbjct  472  APSPIEQRWTGRSKSPMSPAFSTAEDDIFSWVGIIMYLPTADPRQRKDITDEFFHYRHLT  531

Query  366  QAHLWDHYSAYEHWAKIEVPKDKEELQALQARLRKKFPVDAYNRARQELDPNRILSNNML  187
            QA LWD YSAYEHWAKIE+PKDKEEL+ALQ RLRK+FPVDAYN+AR+ELDPNRILSNNM+
Sbjct  532  QAKLWDQYSAYEHWAKIEIPKDKEELEALQERLRKRFPVDAYNKARRELDPNRILSNNMV  591

Query  186  EKL  178
            EKL
Sbjct  592  EKL  594



>emb|CDY36916.1| BnaA06g17010D [Brassica napus]
Length=601

 Score =   342 bits (876),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 154/183 (84%), Positives = 171/183 (93%), Gaps = 0/183 (0%)
 Frame = -2

Query  726  WRKSEGYRVGWSDEILGFDCGGHQWVSETCFPAGTLSKPSMKDLEFIEQLMQLIEKESIP  547
            W+KSEGYRVGWSDEILGFDCGG QWVSETCFPAGTL+KPSMKDLE+IEQL +LIEKE+IP
Sbjct  412  WKKSEGYRVGWSDEILGFDCGGQQWVSETCFPAGTLAKPSMKDLEYIEQLKELIEKEAIP  471

Query  546  APAPIEQRWTACSKSLMSPAYSSVDDDIFSWVGIIMYLPTMDARERKHITEEFFHYRHLT  367
            AP+PIEQRWT  SKS MSPA+S+ +DDIFSWVGIIMYLPT D R+RK IT+EFFHYRHLT
Sbjct  472  APSPIEQRWTGRSKSPMSPAFSTAEDDIFSWVGIIMYLPTADPRQRKDITDEFFHYRHLT  531

Query  366  QAHLWDHYSAYEHWAKIEVPKDKEELQALQARLRKKFPVDAYNRARQELDPNRILSNNML  187
            QA LWD YSAYEHWAKIE+PKDKEEL+ALQ RLRK+FPVDAYN+AR+ELDPNRILSNNM+
Sbjct  532  QAKLWDQYSAYEHWAKIEIPKDKEELEALQERLRKRFPVDAYNKARRELDPNRILSNNMV  591

Query  186  EKL  178
            EKL
Sbjct  592  EKL  594



>dbj|BAH03303.1| L-galactono-1,4-lactone dehydrogenase [Prunus persica]
Length=589

 Score =   340 bits (872),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 155/183 (85%), Positives = 167/183 (91%), Gaps = 0/183 (0%)
 Frame = -2

Query  726  WRKSEGYRVGWSDEILGFDCGGHQWVSETCFPAGTLSKPSMKDLEFIEQLMQLIEKESIP  547
            WRKSEGYRVGWSDEILGFDCGG QWVSETCFP GTLSKPS+KDLE+IE + QLIEK  +P
Sbjct  407  WRKSEGYRVGWSDEILGFDCGGQQWVSETCFPVGTLSKPSLKDLEYIEDVKQLIEKNEVP  466

Query  546  APAPIEQRWTACSKSLMSPAYSSVDDDIFSWVGIIMYLPTMDARERKHITEEFFHYRHLT  367
            APAPIEQRWTAC+KS MSPA S+ DDDIFSWVGIIMYLPT DAR+RK ITEEFFHYR LT
Sbjct  467  APAPIEQRWTACTKSPMSPASSTKDDDIFSWVGIIMYLPTTDARQRKEITEEFFHYRRLT  526

Query  366  QAHLWDHYSAYEHWAKIEVPKDKEELQALQARLRKKFPVDAYNRARQELDPNRILSNNML  187
            Q  LWD YSAYEHWAKIEVPKDKEEL +LQARLRK+FPVDAYN+AR+ELDP+RILSNNML
Sbjct  527  QVQLWDKYSAYEHWAKIEVPKDKEELASLQARLRKRFPVDAYNKARKELDPSRILSNNML  586

Query  186  EKL  178
            EKL
Sbjct  587  EKL  589



>sp|O47881.1|GLDH_BRAOL RecName: Full=L-galactono-1,4-lactone dehydrogenase, mitochondrial; 
Flags: Precursor [Brassica oleracea]
 emb|CAB09796.1| L-galactono-1,4-lactone dehydrogenase [Brassica oleracea var. 
botrytis]
 emb|CDY24145.1| BnaC03g57320D [Brassica napus]
Length=600

 Score =   339 bits (869),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 152/183 (83%), Positives = 171/183 (93%), Gaps = 0/183 (0%)
 Frame = -2

Query  726  WRKSEGYRVGWSDEILGFDCGGHQWVSETCFPAGTLSKPSMKDLEFIEQLMQLIEKESIP  547
            W+KSEGYRVGWSDEILGFDCGG QWVSETCFPAGTL+KPSMKDLE+IEQL +LI+KE+IP
Sbjct  411  WKKSEGYRVGWSDEILGFDCGGQQWVSETCFPAGTLAKPSMKDLEYIEQLKELIQKEAIP  470

Query  546  APAPIEQRWTACSKSLMSPAYSSVDDDIFSWVGIIMYLPTMDARERKHITEEFFHYRHLT  367
            AP+PIEQRWT  SKS MSPA+S+ ++DIFSWVGIIMYLPT D R+RK IT+EFFHYRHLT
Sbjct  471  APSPIEQRWTGRSKSPMSPAFSTAEEDIFSWVGIIMYLPTADPRQRKDITDEFFHYRHLT  530

Query  366  QAHLWDHYSAYEHWAKIEVPKDKEELQALQARLRKKFPVDAYNRARQELDPNRILSNNML  187
            QA LWD YSAYEHWAKIE+PKDKEEL+ALQ RLRK+FPVDAYN+AR+ELDPNRILSNNM+
Sbjct  531  QAKLWDQYSAYEHWAKIEIPKDKEELEALQERLRKRFPVDAYNKARRELDPNRILSNNMV  590

Query  186  EKL  178
            EKL
Sbjct  591  EKL  593



>ref|XP_007204591.1| hypothetical protein PRUPE_ppa003167mg [Prunus persica]
 gb|EMJ05790.1| hypothetical protein PRUPE_ppa003167mg [Prunus persica]
Length=596

 Score =   338 bits (866),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 154/183 (84%), Positives = 166/183 (91%), Gaps = 0/183 (0%)
 Frame = -2

Query  726  WRKSEGYRVGWSDEILGFDCGGHQWVSETCFPAGTLSKPSMKDLEFIEQLMQLIEKESIP  547
            WRKSEGYRVGWSDEILGFDCGG QWVSETCFP GTLSKPS+KDLE+IE + QLIEK  +P
Sbjct  407  WRKSEGYRVGWSDEILGFDCGGQQWVSETCFPVGTLSKPSLKDLEYIEDVKQLIEKNEVP  466

Query  546  APAPIEQRWTACSKSLMSPAYSSVDDDIFSWVGIIMYLPTMDARERKHITEEFFHYRHLT  367
            APAPIEQRWTAC+KS MSPA S+ DDDIFSWVGIIMYLPT DAR+RK ITEEFFHYR LT
Sbjct  467  APAPIEQRWTACTKSPMSPASSTKDDDIFSWVGIIMYLPTTDARQRKEITEEFFHYRRLT  526

Query  366  QAHLWDHYSAYEHWAKIEVPKDKEELQALQARLRKKFPVDAYNRARQELDPNRILSNNML  187
            Q  LWD YSAYEHWAKIEVPKDKEEL +LQARLRK+FPVDAYN+AR+ELDP+RILSNN L
Sbjct  527  QVQLWDKYSAYEHWAKIEVPKDKEELASLQARLRKRFPVDAYNKARKELDPSRILSNNKL  586

Query  186  EKL  178
            EKL
Sbjct  587  EKL  589



>ref|XP_008240731.1| PREDICTED: L-galactono-1,4-lactone dehydrogenase, mitochondrial 
[Prunus mume]
Length=595

 Score =   337 bits (865),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 154/183 (84%), Positives = 166/183 (91%), Gaps = 0/183 (0%)
 Frame = -2

Query  726  WRKSEGYRVGWSDEILGFDCGGHQWVSETCFPAGTLSKPSMKDLEFIEQLMQLIEKESIP  547
            WRKSEGYRVGWSDEILGFDCGG QWVSETCFP GTLSKPS+KDLE+IE + QLIEK  +P
Sbjct  406  WRKSEGYRVGWSDEILGFDCGGQQWVSETCFPVGTLSKPSLKDLEYIEDVKQLIEKNEVP  465

Query  546  APAPIEQRWTACSKSLMSPAYSSVDDDIFSWVGIIMYLPTMDARERKHITEEFFHYRHLT  367
            APAPIEQRWTAC+KS MSPA S+ DDDIFSWVGIIMYLPT DAR+RK ITEEFFHYR LT
Sbjct  466  APAPIEQRWTACTKSPMSPASSTKDDDIFSWVGIIMYLPTTDARQRKEITEEFFHYRRLT  525

Query  366  QAHLWDHYSAYEHWAKIEVPKDKEELQALQARLRKKFPVDAYNRARQELDPNRILSNNML  187
            Q  LWD YSAYEHWAKIEVPKDKEEL +LQARLRK+FPVDAYN+AR+ELDP+RILSNN L
Sbjct  526  QVQLWDKYSAYEHWAKIEVPKDKEELASLQARLRKRFPVDAYNKARKELDPSRILSNNKL  585

Query  186  EKL  178
            EKL
Sbjct  586  EKL  588



>gb|KGN53984.1| hypothetical protein Csa_4G236360 [Cucumis sativus]
Length=357

 Score =   329 bits (844),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 151/183 (83%), Positives = 168/183 (92%), Gaps = 0/183 (0%)
 Frame = -2

Query  726  WRKSEGYRVGWSDEILGFDCGGHQWVSETCFPAGTLSKPSMKDLEFIEQLMQLIEKESIP  547
            WRKSEGYRVGWSDEILGFDCGG QWVSETCFPAGTL+KP+MKD+E+IE+L QLIEK++IP
Sbjct  168  WRKSEGYRVGWSDEILGFDCGGQQWVSETCFPAGTLAKPNMKDIEYIEELKQLIEKKNIP  227

Query  546  APAPIEQRWTACSKSLMSPAYSSVDDDIFSWVGIIMYLPTMDARERKHITEEFFHYRHLT  367
            APAP+EQRWTA SKS MSPA S+ +DDIFSWVGIIMYLPT DAR+RK ITEEFFHYRHLT
Sbjct  228  APAPLEQRWTARSKSPMSPASSTAEDDIFSWVGIIMYLPTSDARQRKEITEEFFHYRHLT  287

Query  366  QAHLWDHYSAYEHWAKIEVPKDKEELQALQARLRKKFPVDAYNRARQELDPNRILSNNML  187
            Q  LWD YSA+EHWAKIEVPKDK+EL ALQARLRK+FPVD YN+AR+ LDPN+ILSNN L
Sbjct  288  QTLLWDQYSAFEHWAKIEVPKDKDELAALQARLRKRFPVDEYNKARRALDPNKILSNNKL  347

Query  186  EKL  178
            EKL
Sbjct  348  EKL  350



>ref|XP_006290330.1| hypothetical protein CARUB_v10016859mg [Capsella rubella]
 gb|EOA23228.1| hypothetical protein CARUB_v10016859mg [Capsella rubella]
Length=610

 Score =   337 bits (865),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 152/183 (83%), Positives = 171/183 (93%), Gaps = 0/183 (0%)
 Frame = -2

Query  726  WRKSEGYRVGWSDEILGFDCGGHQWVSETCFPAGTLSKPSMKDLEFIEQLMQLIEKESIP  547
            W+KSEGYRVGWSDEILGFDCGG QWVSE+CFPAGTL+ PSMKDLE+IE+L +LIEKE+IP
Sbjct  421  WKKSEGYRVGWSDEILGFDCGGQQWVSESCFPAGTLANPSMKDLEYIEELKKLIEKEAIP  480

Query  546  APAPIEQRWTACSKSLMSPAYSSVDDDIFSWVGIIMYLPTMDARERKHITEEFFHYRHLT  367
            APAPIEQRWTA SKS +SPA+S+ +DDIFSWVGIIMYLPT D R+RK IT+EFFHYRHLT
Sbjct  481  APAPIEQRWTARSKSPISPAFSTGEDDIFSWVGIIMYLPTADPRQRKDITDEFFHYRHLT  540

Query  366  QAHLWDHYSAYEHWAKIEVPKDKEELQALQARLRKKFPVDAYNRARQELDPNRILSNNML  187
            Q  LWD YSAYEHWAKIE+PKDKEEL+ALQARLRK+FPVDAYN+AR+ELDPNRILSNNM+
Sbjct  541  QKQLWDQYSAYEHWAKIEIPKDKEELEALQARLRKRFPVDAYNKARRELDPNRILSNNMV  600

Query  186  EKL  178
            EKL
Sbjct  601  EKL  603



>ref|XP_010515105.1| PREDICTED: L-galactono-1,4-lactone dehydrogenase, mitochondrial-like 
[Camelina sativa]
Length=611

 Score =   337 bits (865),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 151/183 (83%), Positives = 170/183 (93%), Gaps = 0/183 (0%)
 Frame = -2

Query  726  WRKSEGYRVGWSDEILGFDCGGHQWVSETCFPAGTLSKPSMKDLEFIEQLMQLIEKESIP  547
            W+KSEGYRVGWSDEILGFDCGG QWVSE+CFPAGTL+ PSMKDLE+IE+L +LIEKE+IP
Sbjct  421  WKKSEGYRVGWSDEILGFDCGGQQWVSESCFPAGTLANPSMKDLEYIEELKKLIEKEAIP  480

Query  546  APAPIEQRWTACSKSLMSPAYSSVDDDIFSWVGIIMYLPTMDARERKHITEEFFHYRHLT  367
            APAPIEQRWTA SKS +SPA+S+ +DDIFSWVGIIMYLPT D R+RK IT+EFFHYRHLT
Sbjct  481  APAPIEQRWTARSKSPISPAFSTAEDDIFSWVGIIMYLPTADPRQRKDITDEFFHYRHLT  540

Query  366  QAHLWDHYSAYEHWAKIEVPKDKEELQALQARLRKKFPVDAYNRARQELDPNRILSNNML  187
            Q  LWD YSAYEHWAKIE+PKDKEEL+ALQ RLRK+FPVDAYN+AR+ELDPNRILSNNM+
Sbjct  541  QKQLWDQYSAYEHWAKIEIPKDKEELEALQGRLRKRFPVDAYNKARRELDPNRILSNNMV  600

Query  186  EKL  178
            EKL
Sbjct  601  EKL  603



>ref|XP_004151495.1| PREDICTED: L-galactono-1,4-lactone dehydrogenase, mitochondrial-like 
[Cucumis sativus]
Length=330

 Score =   328 bits (840),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 151/183 (83%), Positives = 168/183 (92%), Gaps = 0/183 (0%)
 Frame = -2

Query  726  WRKSEGYRVGWSDEILGFDCGGHQWVSETCFPAGTLSKPSMKDLEFIEQLMQLIEKESIP  547
            WRKSEGYRVGWSDEILGFDCGG QWVSETCFPAGTL+KP+MKD+E+IE+L QLIEK++IP
Sbjct  141  WRKSEGYRVGWSDEILGFDCGGQQWVSETCFPAGTLAKPNMKDIEYIEELKQLIEKKNIP  200

Query  546  APAPIEQRWTACSKSLMSPAYSSVDDDIFSWVGIIMYLPTMDARERKHITEEFFHYRHLT  367
            APAP+EQRWTA SKS MSPA S+ +DDIFSWVGIIMYLPT DAR+RK ITEEFFHYRHLT
Sbjct  201  APAPLEQRWTARSKSPMSPASSTAEDDIFSWVGIIMYLPTSDARQRKEITEEFFHYRHLT  260

Query  366  QAHLWDHYSAYEHWAKIEVPKDKEELQALQARLRKKFPVDAYNRARQELDPNRILSNNML  187
            Q  LWD YSA+EHWAKIEVPKDK+EL ALQARLRK+FPVD YN+AR+ LDPN+ILSNN L
Sbjct  261  QTLLWDQYSAFEHWAKIEVPKDKDELAALQARLRKRFPVDEYNKARRALDPNKILSNNKL  320

Query  186  EKL  178
            EKL
Sbjct  321  EKL  323



>ref|XP_010503409.1| PREDICTED: L-galactono-1,4-lactone dehydrogenase, mitochondrial 
[Camelina sativa]
Length=613

 Score =   337 bits (864),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 152/183 (83%), Positives = 170/183 (93%), Gaps = 0/183 (0%)
 Frame = -2

Query  726  WRKSEGYRVGWSDEILGFDCGGHQWVSETCFPAGTLSKPSMKDLEFIEQLMQLIEKESIP  547
            W+KSEGYRVGWSDEILGFDCGG QWVSE+CFPAGTL+ PSMKDLE+IE+L +LIEKE+IP
Sbjct  423  WKKSEGYRVGWSDEILGFDCGGQQWVSESCFPAGTLANPSMKDLEYIEELKKLIEKEAIP  482

Query  546  APAPIEQRWTACSKSLMSPAYSSVDDDIFSWVGIIMYLPTMDARERKHITEEFFHYRHLT  367
            APAPIEQRWTA SKS +SPA+S+ +DDIFSWVGIIMYLPT D R+RK IT+EFFHYRHLT
Sbjct  483  APAPIEQRWTARSKSPISPAFSTAEDDIFSWVGIIMYLPTADPRQRKDITDEFFHYRHLT  542

Query  366  QAHLWDHYSAYEHWAKIEVPKDKEELQALQARLRKKFPVDAYNRARQELDPNRILSNNML  187
            Q  LWD YSAYEHWAKIE+PKDKEEL+ALQARLRK FPVDAYN+AR+ELDPNRILSNNM+
Sbjct  543  QKQLWDQYSAYEHWAKIEIPKDKEELEALQARLRKHFPVDAYNKARRELDPNRILSNNMV  602

Query  186  EKL  178
            EKL
Sbjct  603  EKL  605



>gb|ADB85575.1| L-galactono-1,4-lactone dehydrogenase [Actinidia deliciosa]
Length=343

 Score =   328 bits (841),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 151/183 (83%), Positives = 167/183 (91%), Gaps = 0/183 (0%)
 Frame = -2

Query  726  WRKSEGYRVGWSDEILGFDCGGHQWVSETCFPAGTLSKPSMKDLEFIEQLMQLIEKESIP  547
            W KSEGYR+GWSDEILGFDCGG QWVSETCFPAGTLSKPSMKDL+F+E++MQLIEKE IP
Sbjct  154  WMKSEGYRLGWSDEILGFDCGGQQWVSETCFPAGTLSKPSMKDLQFMEEVMQLIEKEMIP  213

Query  546  APAPIEQRWTACSKSLMSPAYSSVDDDIFSWVGIIMYLPTMDARERKHITEEFFHYRHLT  367
            APAPIEQRWTA SKS MSPA S+ ++DIFSWVGIIMYLPTMD R+RK ITE+FFHYR LT
Sbjct  214  APAPIEQRWTARSKSPMSPASSAAEEDIFSWVGIIMYLPTMDPRQRKEITEKFFHYRRLT  273

Query  366  QAHLWDHYSAYEHWAKIEVPKDKEELQALQARLRKKFPVDAYNRARQELDPNRILSNNML  187
            Q  LWD +SAYEHWAKIEVPKDK+EL ALQARLRK+FPVD YN+AR +LDPN+ILSNNML
Sbjct  274  QTQLWDQFSAYEHWAKIEVPKDKDELAALQARLRKRFPVDTYNKARSKLDPNQILSNNML  333

Query  186  EKL  178
            EKL
Sbjct  334  EKL  336



>ref|XP_010922174.1| PREDICTED: L-galactono-1,4-lactone dehydrogenase 2, mitochondrial 
isoform X1 [Elaeis guineensis]
Length=615

 Score =   337 bits (863),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 155/183 (85%), Positives = 167/183 (91%), Gaps = 0/183 (0%)
 Frame = -2

Query  726  WRKSEGYRVGWSDEILGFDCGGHQWVSETCFPAGTLSKPSMKDLEFIEQLMQLIEKESIP  547
            WRKSEGYR+GWSDEILGFDCGG QWVSE CFPAGTL KPSMKDL++IE+LMQLI+ E IP
Sbjct  426  WRKSEGYRIGWSDEILGFDCGGQQWVSEICFPAGTLPKPSMKDLDYIEELMQLIQSEKIP  485

Query  546  APAPIEQRWTACSKSLMSPAYSSVDDDIFSWVGIIMYLPTMDARERKHITEEFFHYRHLT  367
            APAPIEQRWTA SKSLMSPA SS  DDIFSWVGIIMYLPTMDAR+RK ITEEFF YRHLT
Sbjct  486  APAPIEQRWTARSKSLMSPASSSGQDDIFSWVGIIMYLPTMDARQRKEITEEFFSYRHLT  545

Query  366  QAHLWDHYSAYEHWAKIEVPKDKEELQALQARLRKKFPVDAYNRARQELDPNRILSNNML  187
            Q  LWD YSAYEHWAKIEVPKDK+EL ALQ RLR++FPVDAYN+AR+ELDPN+ILSNNML
Sbjct  546  QTRLWDEYSAYEHWAKIEVPKDKDELAALQERLRRRFPVDAYNKARRELDPNKILSNNML  605

Query  186  EKL  178
            EKL
Sbjct  606  EKL  608



>ref|XP_008808781.1| PREDICTED: L-galactono-1,4-lactone dehydrogenase 2, mitochondrial 
[Phoenix dactylifera]
Length=585

 Score =   336 bits (861),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 156/183 (85%), Positives = 169/183 (92%), Gaps = 1/183 (1%)
 Frame = -2

Query  726  WRKSEGYRVGWSDEILGFDCGGHQWVSETCFPAGTLSKPSMKDLEFIEQLMQLIEKESIP  547
            WRKSEGYRVGWSDEILGFDCGG QWVSETCFPAGTL+KPSMKDL++IE+LMQ+I+ E IP
Sbjct  397  WRKSEGYRVGWSDEILGFDCGGQQWVSETCFPAGTLAKPSMKDLDYIEELMQIIQSEEIP  456

Query  546  APAPIEQRWTACSKSLMSPAYSSVDDDIFSWVGIIMYLPTMDARERKHITEEFFHYRHLT  367
            APAPIEQRWTA SKSLMSPA SS  +DIFSWVGIIMYLPTMDAR+RK ITEEFF YRHLT
Sbjct  457  APAPIEQRWTAHSKSLMSPASSS-GEDIFSWVGIIMYLPTMDARQRKEITEEFFSYRHLT  515

Query  366  QAHLWDHYSAYEHWAKIEVPKDKEELQALQARLRKKFPVDAYNRARQELDPNRILSNNML  187
            Q  LWD YSAYEHWAKIEVPKDK+EL ALQ RLR++FPVDAYN+AR+ELDPNRILSNNML
Sbjct  516  QTRLWDEYSAYEHWAKIEVPKDKDELAALQERLRRRFPVDAYNKARRELDPNRILSNNML  575

Query  186  EKL  178
            EKL
Sbjct  576  EKL  578



>dbj|BAA95212.1| L-Galactono-1,4-lactone dehydorogenase [Arabidopsis thaliana]
Length=610

 Score =   335 bits (860),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 150/183 (82%), Positives = 171/183 (93%), Gaps = 0/183 (0%)
 Frame = -2

Query  726  WRKSEGYRVGWSDEILGFDCGGHQWVSETCFPAGTLSKPSMKDLEFIEQLMQLIEKESIP  547
            W+KSEGYRVGWSDEILGFDCGG QWVSE+CFPAGTL+ PSMKDLE+IE+L +LIEKE+IP
Sbjct  421  WKKSEGYRVGWSDEILGFDCGGQQWVSESCFPAGTLANPSMKDLEYIEELKKLIEKEAIP  480

Query  546  APAPIEQRWTACSKSLMSPAYSSVDDDIFSWVGIIMYLPTMDARERKHITEEFFHYRHLT  367
            APAPIEQRWTA SKS +SPA+S+ +DDIFSWVGIIMYLPT D R+RK IT+EFFHYRHLT
Sbjct  481  APAPIEQRWTARSKSPISPAFSTSEDDIFSWVGIIMYLPTADPRQRKDITDEFFHYRHLT  540

Query  366  QAHLWDHYSAYEHWAKIEVPKDKEELQALQARLRKKFPVDAYNRARQELDPNRILSNNML  187
            Q  LWD +SAYEHWAKIE+PKDKEEL+ALQAR+RK+FPVDAYN+AR+ELDPNRILSNNM+
Sbjct  541  QKQLWDQFSAYEHWAKIEIPKDKEELEALQARIRKRFPVDAYNKARRELDPNRILSNNMV  600

Query  186  EKL  178
            EKL
Sbjct  601  EKL  603



>ref|NP_190376.1| L-galactono-1,4-lactone dehydrogenase [Arabidopsis thaliana]
 sp|Q9SU56.1|GLDH_ARATH RecName: Full=L-galactono-1,4-lactone dehydrogenase, mitochondrial; 
Flags: Precursor [Arabidopsis thaliana]
 emb|CAB41146.1| L-galactono-1, 4-lactone dehydrogenase-like protein [Arabidopsis 
thaliana]
 gb|AEE78347.1| L-galactono-1,4-lactone dehydrogenase [Arabidopsis thaliana]
Length=610

 Score =   335 bits (860),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 150/183 (82%), Positives = 171/183 (93%), Gaps = 0/183 (0%)
 Frame = -2

Query  726  WRKSEGYRVGWSDEILGFDCGGHQWVSETCFPAGTLSKPSMKDLEFIEQLMQLIEKESIP  547
            W+KSEGYRVGWSDEILGFDCGG QWVSE+CFPAGTL+ PSMKDLE+IE+L +LIEKE+IP
Sbjct  421  WKKSEGYRVGWSDEILGFDCGGQQWVSESCFPAGTLANPSMKDLEYIEELKKLIEKEAIP  480

Query  546  APAPIEQRWTACSKSLMSPAYSSVDDDIFSWVGIIMYLPTMDARERKHITEEFFHYRHLT  367
            APAPIEQRWTA SKS +SPA+S+ +DDIFSWVGIIMYLPT D R+RK IT+EFFHYRHLT
Sbjct  481  APAPIEQRWTARSKSPISPAFSTSEDDIFSWVGIIMYLPTADPRQRKDITDEFFHYRHLT  540

Query  366  QAHLWDHYSAYEHWAKIEVPKDKEELQALQARLRKKFPVDAYNRARQELDPNRILSNNML  187
            Q  LWD +SAYEHWAKIE+PKDKEEL+ALQAR+RK+FPVDAYN+AR+ELDPNRILSNNM+
Sbjct  541  QKQLWDQFSAYEHWAKIEIPKDKEELEALQARIRKRFPVDAYNKARRELDPNRILSNNMV  600

Query  186  EKL  178
            EKL
Sbjct  601  EKL  603



>ref|XP_010426264.1| PREDICTED: L-galactono-1,4-lactone dehydrogenase, mitochondrial-like 
[Camelina sativa]
Length=607

 Score =   335 bits (860),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 150/183 (82%), Positives = 171/183 (93%), Gaps = 0/183 (0%)
 Frame = -2

Query  726  WRKSEGYRVGWSDEILGFDCGGHQWVSETCFPAGTLSKPSMKDLEFIEQLMQLIEKESIP  547
            W+KSEGYRVGWSDE+LGFDCGG QWVSE+CFPAGTL+ PSMKDLE+IE+L +LIEKE+IP
Sbjct  418  WKKSEGYRVGWSDEMLGFDCGGQQWVSESCFPAGTLANPSMKDLEYIEELKKLIEKEAIP  477

Query  546  APAPIEQRWTACSKSLMSPAYSSVDDDIFSWVGIIMYLPTMDARERKHITEEFFHYRHLT  367
            APAPIEQRWTA SKS +SPA+S+ +D+IFSWVGIIMYLPT D R+RK IT+EFFHYRHLT
Sbjct  478  APAPIEQRWTARSKSPISPAFSTAEDEIFSWVGIIMYLPTADPRQRKDITDEFFHYRHLT  537

Query  366  QAHLWDHYSAYEHWAKIEVPKDKEELQALQARLRKKFPVDAYNRARQELDPNRILSNNML  187
            Q  LWD YSAYEHWAKIE+PKDKEEL+ALQARLRK+FPVDAYN+AR+ELDPNRILSNNM+
Sbjct  538  QKQLWDQYSAYEHWAKIEIPKDKEELEALQARLRKRFPVDAYNKARRELDPNRILSNNMV  597

Query  186  EKL  178
            EKL
Sbjct  598  EKL  600



>ref|XP_004162073.1| PREDICTED: L-galactono-1,4-lactone dehydrogenase, mitochondrial-like 
[Cucumis sativus]
Length=330

 Score =   326 bits (835),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 150/183 (82%), Positives = 167/183 (91%), Gaps = 0/183 (0%)
 Frame = -2

Query  726  WRKSEGYRVGWSDEILGFDCGGHQWVSETCFPAGTLSKPSMKDLEFIEQLMQLIEKESIP  547
            WRKSEGYRVGWSDEILGFDCGG QWVSETCFPAGTL+KP+MKD+E+IE+L QLIE ++IP
Sbjct  141  WRKSEGYRVGWSDEILGFDCGGQQWVSETCFPAGTLAKPNMKDIEYIEELKQLIETKNIP  200

Query  546  APAPIEQRWTACSKSLMSPAYSSVDDDIFSWVGIIMYLPTMDARERKHITEEFFHYRHLT  367
            APAP+EQRWTA SKS MSPA S+ +DDIFSWVGIIMYLPT DAR+RK ITEEFFHYRHLT
Sbjct  201  APAPLEQRWTARSKSPMSPASSTAEDDIFSWVGIIMYLPTSDARQRKEITEEFFHYRHLT  260

Query  366  QAHLWDHYSAYEHWAKIEVPKDKEELQALQARLRKKFPVDAYNRARQELDPNRILSNNML  187
            Q  LWD YSA+EHWAKIEVPKDK+EL ALQARLRK+FPVD YN+AR+ LDPN+ILSNN L
Sbjct  261  QTLLWDQYSAFEHWAKIEVPKDKDELAALQARLRKRFPVDEYNKARRALDPNKILSNNKL  320

Query  186  EKL  178
            EKL
Sbjct  321  EKL  323



>gb|ABR88113.1| mitochondrial L-galactono-1,4-lactone dehydrogenase [Malus domestica]
Length=338

 Score =   326 bits (835),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 151/183 (83%), Positives = 164/183 (90%), Gaps = 0/183 (0%)
 Frame = -2

Query  726  WRKSEGYRVGWSDEILGFDCGGHQWVSETCFPAGTLSKPSMKDLEFIEQLMQLIEKESIP  547
            W+KSEGYRVGWSDEILGFDCGG QWVSETCFPAGTL+KPSMKDLE+IE + QLIEK  IP
Sbjct  149  WKKSEGYRVGWSDEILGFDCGGQQWVSETCFPAGTLAKPSMKDLEYIEGVKQLIEKNEIP  208

Query  546  APAPIEQRWTACSKSLMSPAYSSVDDDIFSWVGIIMYLPTMDARERKHITEEFFHYRHLT  367
            APAPIEQRWTAC+KS MSPA S+ +DDIFSWVGIIMYLPT D R+ K ITEEFFHYR LT
Sbjct  209  APAPIEQRWTACTKSPMSPASSTREDDIFSWVGIIMYLPTTDPRQGKEITEEFFHYRRLT  268

Query  366  QAHLWDHYSAYEHWAKIEVPKDKEELQALQARLRKKFPVDAYNRARQELDPNRILSNNML  187
            Q  LWD YSAYEHWAKIEVPKDK+EL ALQ RLRK+FPVDAYN+AR+ELDPNRILSN+ L
Sbjct  269  QTQLWDKYSAYEHWAKIEVPKDKDELAALQDRLRKRFPVDAYNKARRELDPNRILSNSKL  328

Query  186  EKL  178
            EKL
Sbjct  329  EKL  331



>ref|XP_002875871.1| L-galactono-1,4-lactone dehydorogenase [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52130.1| L-galactono-1,4-lactone dehydorogenase [Arabidopsis lyrata subsp. 
lyrata]
Length=610

 Score =   334 bits (857),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 149/183 (81%), Positives = 170/183 (93%), Gaps = 0/183 (0%)
 Frame = -2

Query  726  WRKSEGYRVGWSDEILGFDCGGHQWVSETCFPAGTLSKPSMKDLEFIEQLMQLIEKESIP  547
            W+KSEGYRVGWSDEILGFDCGG QWVSE+CFPAGTL+ PSMKDLE+IE+L +LIEKE+IP
Sbjct  421  WKKSEGYRVGWSDEILGFDCGGQQWVSESCFPAGTLANPSMKDLEYIEELKKLIEKEAIP  480

Query  546  APAPIEQRWTACSKSLMSPAYSSVDDDIFSWVGIIMYLPTMDARERKHITEEFFHYRHLT  367
            AP+PIEQRWTA SKS +SPA+S+ +DDIFSWVGIIMYLPT D R+RK IT+EFFHYRHLT
Sbjct  481  APSPIEQRWTARSKSPISPAFSTAEDDIFSWVGIIMYLPTADPRQRKDITDEFFHYRHLT  540

Query  366  QAHLWDHYSAYEHWAKIEVPKDKEELQALQARLRKKFPVDAYNRARQELDPNRILSNNML  187
            Q  LWD YSAYEHWAKIE+PKDKEEL+ALQAR+RK+FPVD YN+AR+ELDPNRILSNNM+
Sbjct  541  QKQLWDQYSAYEHWAKIEIPKDKEELEALQARIRKRFPVDEYNKARRELDPNRILSNNMV  600

Query  186  EKL  178
            EKL
Sbjct  601  EKL  603



>dbj|BAC42562.1| putative L-galactono-1,4-lactone dehydrogenase [Arabidopsis thaliana]
 gb|AAO64860.1| At3g47930 [Arabidopsis thaliana]
Length=610

 Score =   334 bits (857),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 150/183 (82%), Positives = 170/183 (93%), Gaps = 0/183 (0%)
 Frame = -2

Query  726  WRKSEGYRVGWSDEILGFDCGGHQWVSETCFPAGTLSKPSMKDLEFIEQLMQLIEKESIP  547
            W+KSEGYRVGWSDEILGFDCGG QWVSE+CFPAGTL+ PSMKDLE+IE+L +LIEKE+IP
Sbjct  421  WKKSEGYRVGWSDEILGFDCGGQQWVSESCFPAGTLANPSMKDLEYIEELKKLIEKEAIP  480

Query  546  APAPIEQRWTACSKSLMSPAYSSVDDDIFSWVGIIMYLPTMDARERKHITEEFFHYRHLT  367
            APAPIEQRWTA SKS +SPA+S+ +DDIFSWVGIIMYLPT D R RK IT+EFFHYRHLT
Sbjct  481  APAPIEQRWTARSKSPISPAFSTSEDDIFSWVGIIMYLPTADPRHRKDITDEFFHYRHLT  540

Query  366  QAHLWDHYSAYEHWAKIEVPKDKEELQALQARLRKKFPVDAYNRARQELDPNRILSNNML  187
            Q  LWD +SAYEHWAKIE+PKDKEEL+ALQAR+RK+FPVDAYN+AR+ELDPNRILSNNM+
Sbjct  541  QKQLWDQFSAYEHWAKIEIPKDKEELEALQARIRKRFPVDAYNKARRELDPNRILSNNMV  600

Query  186  EKL  178
            EKL
Sbjct  601  EKL  603



>gb|AAT67210.1| mitochondrial L-galactono-1,4-lactone dehydrogenase [Rosa roxburghii]
Length=589

 Score =   332 bits (851),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 154/183 (84%), Positives = 164/183 (90%), Gaps = 0/183 (0%)
 Frame = -2

Query  726  WRKSEGYRVGWSDEILGFDCGGHQWVSETCFPAGTLSKPSMKDLEFIEQLMQLIEKESIP  547
            WRKSEGYRVGWSDEILGFDCGG QWVSETCFPAGTL+KPSMKDLE+I  L QLIEKE IP
Sbjct  400  WRKSEGYRVGWSDEILGFDCGGQQWVSETCFPAGTLAKPSMKDLEYIADLKQLIEKEEIP  459

Query  546  APAPIEQRWTACSKSLMSPAYSSVDDDIFSWVGIIMYLPTMDARERKHITEEFFHYRHLT  367
            APAPIEQRWTA +K  MSPA SS +DDIFSWVGIIMYLPT DAR+RK ITEEFFHYRHLT
Sbjct  460  APAPIEQRWTASTKGPMSPASSSREDDIFSWVGIIMYLPTTDARQRKDITEEFFHYRHLT  519

Query  366  QAHLWDHYSAYEHWAKIEVPKDKEELQALQARLRKKFPVDAYNRARQELDPNRILSNNML  187
            Q  LWD YS+YEHWAKIEVPKD+E+L ALQARLRK+FPVDAYN+AR ELDPNRILSN  L
Sbjct  520  QTRLWDTYSSYEHWAKIEVPKDREQLTALQARLRKRFPVDAYNKARTELDPNRILSNIKL  579

Query  186  EKL  178
            EKL
Sbjct  580  EKL  582



>dbj|BAP75922.1| L-galactose-1-phosphate phosphatase, partial [Moringa oleifera]
Length=335

 Score =   323 bits (829),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 149/176 (85%), Positives = 162/176 (92%), Gaps = 0/176 (0%)
 Frame = -2

Query  726  WRKSEGYRVGWSDEILGFDCGGHQWVSETCFPAGTLSKPSMKDLEFIEQLMQLIEKESIP  547
            W KS+GYRVGWSDEILGFDCGG QWVSETCFPAGTL+KPSMKDLE+I++L QLIEKE IP
Sbjct  159  WSKSQGYRVGWSDEILGFDCGGQQWVSETCFPAGTLAKPSMKDLEYIQELKQLIEKEEIP  218

Query  546  APAPIEQRWTACSKSLMSPAYSSVDDDIFSWVGIIMYLPTMDARERKHITEEFFHYRHLT  367
            APAPIEQRWTA S+SLMSPA SS +DDIFSWVGII+YLPTMDAR+RK ITEEFFHYRHLT
Sbjct  219  APAPIEQRWTARSQSLMSPASSSAEDDIFSWVGIILYLPTMDARQRKEITEEFFHYRHLT  278

Query  366  QAHLWDHYSAYEHWAKIEVPKDKEELQALQARLRKKFPVDAYNRARQELDPNRILS  199
            Q  LWD YSAYEHWAKIEVPKDK+EL ALQARLRK+FPVDAY +AR+E DPNRILS
Sbjct  279  QTQLWDRYSAYEHWAKIEVPKDKDELSALQARLRKRFPVDAYIKARREFDPNRILS  334



>ref|XP_004303609.1| PREDICTED: L-galactono-1,4-lactone dehydrogenase, mitochondrial 
[Fragaria vesca subsp. vesca]
Length=582

 Score =   332 bits (850),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 154/183 (84%), Positives = 164/183 (90%), Gaps = 0/183 (0%)
 Frame = -2

Query  726  WRKSEGYRVGWSDEILGFDCGGHQWVSETCFPAGTLSKPSMKDLEFIEQLMQLIEKESIP  547
            WRKSEGYRVGWSDEILGFDCGG QWVSETCFPAGT++KPSMKDLE+IE L QLIEKE IP
Sbjct  393  WRKSEGYRVGWSDEILGFDCGGQQWVSETCFPAGTIAKPSMKDLEYIEDLKQLIEKEEIP  452

Query  546  APAPIEQRWTACSKSLMSPAYSSVDDDIFSWVGIIMYLPTMDARERKHITEEFFHYRHLT  367
            APAPIEQRWTA SKS MSPA S  +DDIFSWVGIIMYLPT DAR+RK ITEEFFHYRHLT
Sbjct  453  APAPIEQRWTASSKSPMSPASSLKEDDIFSWVGIIMYLPTTDARQRKDITEEFFHYRHLT  512

Query  366  QAHLWDHYSAYEHWAKIEVPKDKEELQALQARLRKKFPVDAYNRARQELDPNRILSNNML  187
            Q  LWD YS+YEHWAKIEVPKDKE+L  LQARLRK+FPVDAYN+AR ELDPN+ILSN  L
Sbjct  513  QTRLWDTYSSYEHWAKIEVPKDKEQLTTLQARLRKRFPVDAYNKARSELDPNQILSNVKL  572

Query  186  EKL  178
            EKL
Sbjct  573  EKL  575



>ref|XP_009405576.1| PREDICTED: L-galactono-1,4-lactone dehydrogenase 2, mitochondrial 
[Musa acuminata subsp. malaccensis]
Length=590

 Score =   331 bits (849),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 153/183 (84%), Positives = 166/183 (91%), Gaps = 0/183 (0%)
 Frame = -2

Query  726  WRKSEGYRVGWSDEILGFDCGGHQWVSETCFPAGTLSKPSMKDLEFIEQLMQLIEKESIP  547
            W+KSEGYRVGWSDEILGFDCGG QWVSETCFPAGTL  P+MKDL++IE+L QLIE+E IP
Sbjct  397  WKKSEGYRVGWSDEILGFDCGGQQWVSETCFPAGTLKMPNMKDLDYIEELKQLIEQEDIP  456

Query  546  APAPIEQRWTACSKSLMSPAYSSVDDDIFSWVGIIMYLPTMDARERKHITEEFFHYRHLT  367
            APAPIEQRWTACSKSLMSPA SS +DDIFSWVGIIMYLPT+DAR+RK ITEEFFHYR+LT
Sbjct  457  APAPIEQRWTACSKSLMSPASSSEEDDIFSWVGIIMYLPTIDARQRKDITEEFFHYRYLT  516

Query  366  QAHLWDHYSAYEHWAKIEVPKDKEELQALQARLRKKFPVDAYNRARQELDPNRILSNNML  187
            Q  LWD YSAYEHWAKIEVPKDKEEL ALQ RLRK+FPVD YN+ R ELDPNRILSN +L
Sbjct  517  QTRLWDEYSAYEHWAKIEVPKDKEELAALQERLRKRFPVDTYNKVRGELDPNRILSNAVL  576

Query  186  EKL  178
            EKL
Sbjct  577  EKL  579



>gb|EEC67659.1| hypothetical protein OsI_35074 [Oryza sativa Indica Group]
Length=388

 Score =   324 bits (831),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 149/183 (81%), Positives = 167/183 (91%), Gaps = 0/183 (0%)
 Frame = -2

Query  726  WRKSEGYRVGWSDEILGFDCGGHQWVSETCFPAGTLSKPSMKDLEFIEQLMQLIEKESIP  547
            W+KSEGYR+GWSDEILGFDCGG QWVSETCFPAGTL+KP+MKDL++IE+L+QLIEKE IP
Sbjct  196  WKKSEGYRMGWSDEILGFDCGGQQWVSETCFPAGTLAKPNMKDLDYIEELLQLIEKEDIP  255

Query  546  APAPIEQRWTACSKSLMSPAYSSVDDDIFSWVGIIMYLPTMDARERKHITEEFFHYRHLT  367
            APAPIEQRWTACS+S MSPA SS +DDIFSWVGIIMYLPT DAR+RK ITEEFF+YR  T
Sbjct  256  APAPIEQRWTACSRSPMSPASSSQEDDIFSWVGIIMYLPTSDARQRKEITEEFFNYRSKT  315

Query  366  QAHLWDHYSAYEHWAKIEVPKDKEELQALQARLRKKFPVDAYNRARQELDPNRILSNNML  187
            Q +LWD YSAYEHWAKIEVPKDK+EL  LQARLRK+FPVDAYN+AR ELDPN++LSN  L
Sbjct  316  QTNLWDGYSAYEHWAKIEVPKDKDELAELQARLRKRFPVDAYNKARMELDPNKVLSNAKL  375

Query  186  EKL  178
            EKL
Sbjct  376  EKL  378



>ref|XP_008359587.1| PREDICTED: L-galactono-1,4-lactone dehydrogenase, mitochondrial-like 
[Malus domestica]
Length=599

 Score =   331 bits (848),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 152/183 (83%), Positives = 164/183 (90%), Gaps = 0/183 (0%)
 Frame = -2

Query  726  WRKSEGYRVGWSDEILGFDCGGHQWVSETCFPAGTLSKPSMKDLEFIEQLMQLIEKESIP  547
            W+KSEGYRVGWSDEILGFDCGG QWVSETCFPAGTL+KPSMKDLE+IE + QLIEK  IP
Sbjct  410  WKKSEGYRVGWSDEILGFDCGGQQWVSETCFPAGTLAKPSMKDLEYIEGVKQLIEKNEIP  469

Query  546  APAPIEQRWTACSKSLMSPAYSSVDDDIFSWVGIIMYLPTMDARERKHITEEFFHYRHLT  367
            APAPIEQRWTAC+KS MSPA S+ +DDIFSWVGIIMYLPT D R+RK ITEEFFHYR LT
Sbjct  470  APAPIEQRWTACTKSPMSPASSTREDDIFSWVGIIMYLPTTDPRQRKEITEEFFHYRRLT  529

Query  366  QAHLWDHYSAYEHWAKIEVPKDKEELQALQARLRKKFPVDAYNRARQELDPNRILSNNML  187
            Q  LWD YSAYEHWAKIEVPKDK+EL ALQ RLRK+FPVDAYN+AR+ELDPNRILSN  L
Sbjct  530  QTQLWDKYSAYEHWAKIEVPKDKDELAALQDRLRKRFPVDAYNKARRELDPNRILSNXKL  589

Query  186  EKL  178
            EKL
Sbjct  590  EKL  592



>ref|XP_010273249.1| PREDICTED: L-galactono-1,4-lactone dehydrogenase, mitochondrial 
[Nelumbo nucifera]
Length=612

 Score =   331 bits (849),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 149/183 (81%), Positives = 167/183 (91%), Gaps = 0/183 (0%)
 Frame = -2

Query  726  WRKSEGYRVGWSDEILGFDCGGHQWVSETCFPAGTLSKPSMKDLEFIEQLMQLIEKESIP  547
            WRKSEGYRVGWSDEILGFDCGG QWVSETCFPAGTL+KP+MKD+E+IE+L +LI+ E IP
Sbjct  423  WRKSEGYRVGWSDEILGFDCGGQQWVSETCFPAGTLAKPNMKDIEYIEELKKLIQNEGIP  482

Query  546  APAPIEQRWTACSKSLMSPAYSSVDDDIFSWVGIIMYLPTMDARERKHITEEFFHYRHLT  367
            APAPIEQRWT CS+S MSPA+SS +DDIFSWVGIIMYLPTMDAR+RK ITEEFF+YRHLT
Sbjct  483  APAPIEQRWTVCSRSPMSPAFSSAEDDIFSWVGIIMYLPTMDARQRKEITEEFFNYRHLT  542

Query  366  QAHLWDHYSAYEHWAKIEVPKDKEELQALQARLRKKFPVDAYNRARQELDPNRILSNNML  187
            Q  LWD YS+ EHWAKIEVPKDKEEL  LQARLRK+FPVD YN+AR+ELDPN+ILSN M+
Sbjct  543  QKQLWDQYSSCEHWAKIEVPKDKEELATLQARLRKRFPVDEYNKARRELDPNKILSNGMV  602

Query  186  EKL  178
            EKL
Sbjct  603  EKL  605



>gb|ADT80722.1| L-galactono-1,4-lactone dehydrogenase [Cucumis sativus]
Length=590

 Score =   330 bits (847),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 151/183 (83%), Positives = 168/183 (92%), Gaps = 0/183 (0%)
 Frame = -2

Query  726  WRKSEGYRVGWSDEILGFDCGGHQWVSETCFPAGTLSKPSMKDLEFIEQLMQLIEKESIP  547
            WRKSEGYRVGWSDEILGFDCGG QWVSETCFPAGTL+KP+MKD+E+IE+L QLIEK++IP
Sbjct  401  WRKSEGYRVGWSDEILGFDCGGQQWVSETCFPAGTLAKPNMKDIEYIEELKQLIEKKNIP  460

Query  546  APAPIEQRWTACSKSLMSPAYSSVDDDIFSWVGIIMYLPTMDARERKHITEEFFHYRHLT  367
            APAP+EQRWTA SKS MSPA S+ +DDIFSWVGIIMYLPT DAR+RK ITEEFFHYRHLT
Sbjct  461  APAPLEQRWTARSKSPMSPASSTAEDDIFSWVGIIMYLPTSDARQRKEITEEFFHYRHLT  520

Query  366  QAHLWDHYSAYEHWAKIEVPKDKEELQALQARLRKKFPVDAYNRARQELDPNRILSNNML  187
            Q  LWD YSA+EHWAKIEVPKDK+EL ALQARLRK+FPVD YN+AR+ LDPN+ILSNN L
Sbjct  521  QTLLWDQYSAFEHWAKIEVPKDKDELAALQARLRKRFPVDEYNKARRALDPNKILSNNKL  580

Query  186  EKL  178
            EKL
Sbjct  581  EKL  583



>gb|KFK34094.1| hypothetical protein AALP_AA5G101200 [Arabis alpina]
Length=607

 Score =   330 bits (845),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 148/183 (81%), Positives = 169/183 (92%), Gaps = 0/183 (0%)
 Frame = -2

Query  726  WRKSEGYRVGWSDEILGFDCGGHQWVSETCFPAGTLSKPSMKDLEFIEQLMQLIEKESIP  547
            W+KSEGYRVGWSDEILGFDCGG QWVSETCFPAGTL+KP+MKDLE+IEQL +LIEKE++P
Sbjct  417  WKKSEGYRVGWSDEILGFDCGGQQWVSETCFPAGTLAKPNMKDLEYIEQLKELIEKEAMP  476

Query  546  APAPIEQRWTACSKSLMSPAYSSVDDDIFSWVGIIMYLPTMDARERKHITEEFFHYRHLT  367
            A +PIEQRWTA SKS +SPA+S+ +DDIFSWVGIIMYLPT D R+RK IT+EFFHYR LT
Sbjct  477  AHSPIEQRWTARSKSPISPAFSTAEDDIFSWVGIIMYLPTADPRQRKDITDEFFHYRRLT  536

Query  366  QAHLWDHYSAYEHWAKIEVPKDKEELQALQARLRKKFPVDAYNRARQELDPNRILSNNML  187
            Q  LWD YSAYEHWAKIE+PKDKEEL+ LQAR+RK+FPVDAYN+AR+ELDPNRILSNNM+
Sbjct  537  QTRLWDQYSAYEHWAKIEIPKDKEELEGLQARIRKRFPVDAYNKARRELDPNRILSNNMV  596

Query  186  EKL  178
            EKL
Sbjct  597  EKL  599



>ref|XP_007028561.1| L-galactono-1,4-lactone dehydrogenase [Theobroma cacao]
 gb|EOY09063.1| L-galactono-1,4-lactone dehydrogenase [Theobroma cacao]
Length=593

 Score =   328 bits (842),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 158/183 (86%), Positives = 172/183 (94%), Gaps = 0/183 (0%)
 Frame = -2

Query  726  WRKSEGYRVGWSDEILGFDCGGHQWVSETCFPAGTLSKPSMKDLEFIEQLMQLIEKESIP  547
            WR+SEGYRV WSDEILGFDCGG QWVSETCFPAGTLSKPSMKDLE+IE+L QLIEKE IP
Sbjct  404  WRRSEGYRVEWSDEILGFDCGGQQWVSETCFPAGTLSKPSMKDLEYIEELKQLIEKEEIP  463

Query  546  APAPIEQRWTACSKSLMSPAYSSVDDDIFSWVGIIMYLPTMDARERKHITEEFFHYRHLT  367
            APAPIEQRWTACS+S MSPA SS +DDIFSWVGIIMYLP+MDAR+RK ITEEFFHYRHLT
Sbjct  464  APAPIEQRWTACSQSPMSPASSSAEDDIFSWVGIIMYLPSMDARQRKEITEEFFHYRHLT  523

Query  366  QAHLWDHYSAYEHWAKIEVPKDKEELQALQARLRKKFPVDAYNRARQELDPNRILSNNML  187
            QA LWD Y+AYEHWAKIEVPKDKEEL+ALQARL+ +FPV+AYN+AR+ELDPNRILSNNML
Sbjct  524  QAQLWDKYAAYEHWAKIEVPKDKEELEALQARLKNRFPVEAYNKARRELDPNRILSNNML  583

Query  186  EKL  178
            EKL
Sbjct  584  EKL  586



>ref|XP_009341950.1| PREDICTED: L-galactono-1,4-lactone dehydrogenase, mitochondrial-like 
[Pyrus x bretschneideri]
 ref|XP_009341951.1| PREDICTED: L-galactono-1,4-lactone dehydrogenase, mitochondrial-like 
[Pyrus x bretschneideri]
 ref|XP_009341952.1| PREDICTED: L-galactono-1,4-lactone dehydrogenase, mitochondrial-like 
[Pyrus x bretschneideri]
 ref|XP_009341953.1| PREDICTED: L-galactono-1,4-lactone dehydrogenase, mitochondrial-like 
[Pyrus x bretschneideri]
Length=599

 Score =   328 bits (841),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 151/183 (83%), Positives = 163/183 (89%), Gaps = 0/183 (0%)
 Frame = -2

Query  726  WRKSEGYRVGWSDEILGFDCGGHQWVSETCFPAGTLSKPSMKDLEFIEQLMQLIEKESIP  547
            W+KSEGYRVGWSDEILGFDCGG QWVSETCFP GTL+KPSMKDLE+IE L QLIEK  IP
Sbjct  410  WKKSEGYRVGWSDEILGFDCGGQQWVSETCFPVGTLAKPSMKDLEYIEGLKQLIEKVEIP  469

Query  546  APAPIEQRWTACSKSLMSPAYSSVDDDIFSWVGIIMYLPTMDARERKHITEEFFHYRHLT  367
            APAPIEQRWTAC+KS MSPA S+ +DD+FSWVGIIMYLPT D R+RK ITEEFFHYR LT
Sbjct  470  APAPIEQRWTACTKSPMSPASSTREDDVFSWVGIIMYLPTTDPRQRKEITEEFFHYRRLT  529

Query  366  QAHLWDHYSAYEHWAKIEVPKDKEELQALQARLRKKFPVDAYNRARQELDPNRILSNNML  187
            Q  LWD YSAYEHWAKIEVPKDK+EL ALQ RLRK+FPVDAYN+AR+ELDPNRILS N L
Sbjct  530  QTQLWDKYSAYEHWAKIEVPKDKDELAALQDRLRKRFPVDAYNKARRELDPNRILSINKL  589

Query  186  EKL  178
            EKL
Sbjct  590  EKL  592



>ref|XP_002531501.1| galactono-1,4-lactone dehydrogenase, putative [Ricinus communis]
 gb|EEF30888.1| galactono-1,4-lactone dehydrogenase, putative [Ricinus communis]
Length=603

 Score =   328 bits (841),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 160/183 (87%), Positives = 171/183 (93%), Gaps = 0/183 (0%)
 Frame = -2

Query  726  WRKSEGYRVGWSDEILGFDCGGHQWVSETCFPAGTLSKPSMKDLEFIEQLMQLIEKESIP  547
            WRKSEGYRVGWSDEILGFDCGG QWVSETCFPAGTLSKPSMKDLE+IE+L QLIEKE IP
Sbjct  414  WRKSEGYRVGWSDEILGFDCGGQQWVSETCFPAGTLSKPSMKDLEYIEELKQLIEKEEIP  473

Query  546  APAPIEQRWTACSKSLMSPAYSSVDDDIFSWVGIIMYLPTMDARERKHITEEFFHYRHLT  367
            APAPIEQRWTA S+S MSPA SS +DDIFSWVGIIMYLPTMDAR+RK ITEEFFHYRHLT
Sbjct  474  APAPIEQRWTARSQSSMSPASSSAEDDIFSWVGIIMYLPTMDARQRKDITEEFFHYRHLT  533

Query  366  QAHLWDHYSAYEHWAKIEVPKDKEELQALQARLRKKFPVDAYNRARQELDPNRILSNNML  187
            QA LWD YS +EHWAKIEVPKDKEE+ ALQARLRK+FPVDAYN+AR+ELDPNRILSNN+L
Sbjct  534  QAQLWDKYSCFEHWAKIEVPKDKEEIAALQARLRKRFPVDAYNKARKELDPNRILSNNIL  593

Query  186  EKL  178
            EKL
Sbjct  594  EKL  596



>emb|CDL93466.2| L-galactono-1,4-lactone dehydrogenase [Lactuca sativa]
Length=610

 Score =   328 bits (842),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 146/183 (80%), Positives = 166/183 (91%), Gaps = 0/183 (0%)
 Frame = -2

Query  726  WRKSEGYRVGWSDEILGFDCGGHQWVSETCFPAGTLSKPSMKDLEFIEQLMQLIEKESIP  547
            W++SEG+RVGWSDEILGFDCGG QWVSETCFPAGTLSKP+MKDL+FIE++M+LIEKE IP
Sbjct  420  WKRSEGFRVGWSDEILGFDCGGQQWVSETCFPAGTLSKPNMKDLKFIEEVMELIEKEEIP  479

Query  546  APAPIEQRWTACSKSLMSPAYSSVDDDIFSWVGIIMYLPTMDARERKHITEEFFHYRHLT  367
            AP+PIEQRW+A SKSLMSPA S  +DDIFSWVGIIMYLPT DAR+RK ITEEFFHYRHLT
Sbjct  480  APSPIEQRWSASSKSLMSPASSESNDDIFSWVGIIMYLPTSDARQRKQITEEFFHYRHLT  539

Query  366  QAHLWDHYSAYEHWAKIEVPKDKEELQALQARLRKKFPVDAYNRARQELDPNRILSNNML  187
            Q   W+ YSA+EHWAKIEVPKDK EL ALQ RLR +FPVDA+N+AR+ELDPNRILSN M+
Sbjct  540  QTRFWNQYSAFEHWAKIEVPKDKNELAALQERLRARFPVDAFNKARKELDPNRILSNAMV  599

Query  186  EKL  178
            EK+
Sbjct  600  EKM  602



>ref|XP_010056286.1| PREDICTED: L-galactono-1,4-lactone dehydrogenase, mitochondrial 
[Eucalyptus grandis]
 ref|XP_010056293.1| PREDICTED: L-galactono-1,4-lactone dehydrogenase, mitochondrial 
[Eucalyptus grandis]
 gb|KCW90072.1| hypothetical protein EUGRSUZ_A02267 [Eucalyptus grandis]
 gb|KCW90073.1| hypothetical protein EUGRSUZ_A02267 [Eucalyptus grandis]
Length=595

 Score =   328 bits (840),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 153/183 (84%), Positives = 164/183 (90%), Gaps = 0/183 (0%)
 Frame = -2

Query  726  WRKSEGYRVGWSDEILGFDCGGHQWVSETCFPAGTLSKPSMKDLEFIEQLMQLIEKESIP  547
            W+KSEGYRVGWSDEILGFDCGG QWVSETCFPAGTLSKPSMKDLE+IE+L +LIEKE IP
Sbjct  406  WKKSEGYRVGWSDEILGFDCGGQQWVSETCFPAGTLSKPSMKDLEYIEELKRLIEKEDIP  465

Query  546  APAPIEQRWTACSKSLMSPAYSSVDDDIFSWVGIIMYLPTMDARERKHITEEFFHYRHLT  367
            APAPIEQRWTA SKS MS A S  +DDIFSWVG+IMYLPT DAR+RK ITEEFFHYR LT
Sbjct  466  APAPIEQRWTARSKSPMSLASSPAEDDIFSWVGVIMYLPTSDARQRKEITEEFFHYRRLT  525

Query  366  QAHLWDHYSAYEHWAKIEVPKDKEELQALQARLRKKFPVDAYNRARQELDPNRILSNNML  187
            Q  LWD YSAYEHWAKIEVPKD EEL ALQARLRK+FPVDAYN+AR+ELDPN+IL NN L
Sbjct  526  QERLWDRYSAYEHWAKIEVPKDNEELAALQARLRKRFPVDAYNKARRELDPNKILCNNKL  585

Query  186  EKL  178
            EKL
Sbjct  586  EKL  588



>gb|KJB46250.1| hypothetical protein B456_007G353900 [Gossypium raimondii]
Length=366

 Score =   320 bits (820),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 155/183 (85%), Positives = 170/183 (93%), Gaps = 0/183 (0%)
 Frame = -2

Query  726  WRKSEGYRVGWSDEILGFDCGGHQWVSETCFPAGTLSKPSMKDLEFIEQLMQLIEKESIP  547
            WRKSEGYRVGWSD+ILGFDCGG QWVSETCFPAGTLSKPSMKDLE+IE+L +LIE   +P
Sbjct  177  WRKSEGYRVGWSDDILGFDCGGQQWVSETCFPAGTLSKPSMKDLEYIEELKKLIETNELP  236

Query  546  APAPIEQRWTACSKSLMSPAYSSVDDDIFSWVGIIMYLPTMDARERKHITEEFFHYRHLT  367
            APAPIEQRWTA S+S MSPA SS +DDIFSWVGIIMYLPTMDAR+RK ITEEFFHYRHLT
Sbjct  237  APAPIEQRWTARSQSPMSPASSSAEDDIFSWVGIIMYLPTMDARQRKEITEEFFHYRHLT  296

Query  366  QAHLWDHYSAYEHWAKIEVPKDKEELQALQARLRKKFPVDAYNRARQELDPNRILSNNML  187
            Q+ LWD YSAYEHWAKIEVPKDKEEL+ALQARL+ +FPVDAYN+AR+ELDPNRILSNN+L
Sbjct  297  QSQLWDKYSAYEHWAKIEVPKDKEELEALQARLKTRFPVDAYNKARRELDPNRILSNNIL  356

Query  186  EKL  178
            EKL
Sbjct  357  EKL  359



>gb|KHN25185.1| L-galactono-1,4-lactone dehydrogenase, mitochondrial [Glycine 
soja]
Length=443

 Score =   322 bits (826),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 157/183 (86%), Positives = 168/183 (92%), Gaps = 0/183 (0%)
 Frame = -2

Query  726  WRKSEGYRVGWSDEILGFDCGGHQWVSETCFPAGTLSKPSMKDLEFIEQLMQLIEKESIP  547
            WRKSEGYRVGWSDEILGFDCGG QWVSETCFPAG L+ PSMKDLE+IE+L QLIEKE IP
Sbjct  254  WRKSEGYRVGWSDEILGFDCGGQQWVSETCFPAGKLANPSMKDLEYIEELKQLIEKEEIP  313

Query  546  APAPIEQRWTACSKSLMSPAYSSVDDDIFSWVGIIMYLPTMDARERKHITEEFFHYRHLT  367
            APAPIEQRWTA S+S +SPA S  +DDIFSWVGIIMYLPTMDAR+RK ITEEFFHYRHLT
Sbjct  314  APAPIEQRWTASSRSSLSPASSPSEDDIFSWVGIIMYLPTMDARQRKDITEEFFHYRHLT  373

Query  366  QAHLWDHYSAYEHWAKIEVPKDKEELQALQARLRKKFPVDAYNRARQELDPNRILSNNML  187
            QA LWD YSAYEHWAKIEVPKDK+EL ALQ RLRK+FPVDAYN+AR+ELDPNRILSNNML
Sbjct  374  QAKLWDCYSAYEHWAKIEVPKDKKELAALQERLRKRFPVDAYNKARKELDPNRILSNNML  433

Query  186  EKL  178
            EKL
Sbjct  434  EKL  436



>gb|EEC68837.1| hypothetical protein OsI_37417 [Oryza sativa Indica Group]
Length=583

 Score =   326 bits (836),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 149/183 (81%), Positives = 167/183 (91%), Gaps = 0/183 (0%)
 Frame = -2

Query  726  WRKSEGYRVGWSDEILGFDCGGHQWVSETCFPAGTLSKPSMKDLEFIEQLMQLIEKESIP  547
            W+KSEGYR+GWSDEILGFDCGG QWVSETCFPAGTL+KP+MKDL++IE+L+QLIEKE IP
Sbjct  391  WKKSEGYRMGWSDEILGFDCGGQQWVSETCFPAGTLAKPNMKDLDYIEELLQLIEKEDIP  450

Query  546  APAPIEQRWTACSKSLMSPAYSSVDDDIFSWVGIIMYLPTMDARERKHITEEFFHYRHLT  367
            APAPIEQRWTACS+S MSPA SS +DDIFSWVGIIMYLPT DAR+RK ITEEFF+YR  T
Sbjct  451  APAPIEQRWTACSRSPMSPASSSQEDDIFSWVGIIMYLPTSDARQRKEITEEFFNYRSKT  510

Query  366  QAHLWDHYSAYEHWAKIEVPKDKEELQALQARLRKKFPVDAYNRARQELDPNRILSNNML  187
            Q +LWD YSAYEHWAKIEVPKDK+EL  LQARLRK+FPVDAYN+AR ELDPN++LSN  L
Sbjct  511  QTNLWDGYSAYEHWAKIEVPKDKDELTELQARLRKRFPVDAYNKARMELDPNKVLSNAKL  570

Query  186  EKL  178
            EKL
Sbjct  571  EKL  573



>emb|CBX24429.1| hypothetical_protein [Oryza glaberrima]
Length=580

 Score =   325 bits (834),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 149/183 (81%), Positives = 167/183 (91%), Gaps = 0/183 (0%)
 Frame = -2

Query  726  WRKSEGYRVGWSDEILGFDCGGHQWVSETCFPAGTLSKPSMKDLEFIEQLMQLIEKESIP  547
            W+KSEGYR+GWSDEILGFDCGG QWVSETCFPAGTL+KP+MKDL++IE+L+QLIEKE IP
Sbjct  388  WKKSEGYRMGWSDEILGFDCGGQQWVSETCFPAGTLAKPNMKDLDYIEELLQLIEKEDIP  447

Query  546  APAPIEQRWTACSKSLMSPAYSSVDDDIFSWVGIIMYLPTMDARERKHITEEFFHYRHLT  367
            APAPIEQRWTACS+S MSPA SS +DDIFSWVGIIMYLPT DAR+RK ITEEFF+YR  T
Sbjct  448  APAPIEQRWTACSRSPMSPASSSQEDDIFSWVGIIMYLPTSDARQRKEITEEFFNYRSKT  507

Query  366  QAHLWDHYSAYEHWAKIEVPKDKEELQALQARLRKKFPVDAYNRARQELDPNRILSNNML  187
            Q +LWD YSAYEHWAKIEVPKDK+EL  LQARLRK+FPVDAYN+AR ELDPN++LSN  L
Sbjct  508  QTNLWDGYSAYEHWAKIEVPKDKDELTELQARLRKRFPVDAYNKARMELDPNKVLSNAKL  567

Query  186  EKL  178
            EKL
Sbjct  568  EKL  570



>sp|Q2RAP0.1|GLDH1_ORYSJ RecName: Full=L-galactono-1,4-lactone dehydrogenase 1, mitochondrial; 
Flags: Precursor [Oryza sativa Japonica Group]
 gb|ABA91419.1| L-galactono-1,4-lactone dehydrogenase, putative, expressed [Oryza 
sativa Japonica Group]
 gb|EAZ17409.1| hypothetical protein OsJ_32931 [Oryza sativa Japonica Group]
 dbj|BAG95677.1| unnamed protein product [Oryza sativa Japonica Group]
Length=583

 Score =   325 bits (834),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 149/183 (81%), Positives = 167/183 (91%), Gaps = 0/183 (0%)
 Frame = -2

Query  726  WRKSEGYRVGWSDEILGFDCGGHQWVSETCFPAGTLSKPSMKDLEFIEQLMQLIEKESIP  547
            W+KSEGYR+GWSDEILGFDCGG QWVSETCFPAGTL+KP+MKDL++IE+L+QLIEKE IP
Sbjct  391  WKKSEGYRMGWSDEILGFDCGGQQWVSETCFPAGTLAKPNMKDLDYIEELLQLIEKEDIP  450

Query  546  APAPIEQRWTACSKSLMSPAYSSVDDDIFSWVGIIMYLPTMDARERKHITEEFFHYRHLT  367
            APAPIEQRWTACS+S MSPA SS +DDIFSWVGIIMYLPT DAR+RK ITEEFF+YR  T
Sbjct  451  APAPIEQRWTACSRSPMSPASSSQEDDIFSWVGIIMYLPTSDARQRKEITEEFFNYRSKT  510

Query  366  QAHLWDHYSAYEHWAKIEVPKDKEELQALQARLRKKFPVDAYNRARQELDPNRILSNNML  187
            Q +LWD YSAYEHWAKIEVPKDK+EL  LQARLRK+FPVDAYN+AR ELDPN++LSN  L
Sbjct  511  QTNLWDGYSAYEHWAKIEVPKDKDELAELQARLRKRFPVDAYNKARMELDPNKVLSNAKL  570

Query  186  EKL  178
            EKL
Sbjct  571  EKL  573



>ref|NP_001065724.1| Os11g0143500 [Oryza sativa Japonica Group]
 dbj|BAF27569.1| Os11g0143500, partial [Oryza sativa Japonica Group]
Length=597

 Score =   326 bits (835),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 149/183 (81%), Positives = 167/183 (91%), Gaps = 0/183 (0%)
 Frame = -2

Query  726  WRKSEGYRVGWSDEILGFDCGGHQWVSETCFPAGTLSKPSMKDLEFIEQLMQLIEKESIP  547
            W+KSEGYR+GWSDEILGFDCGG QWVSETCFPAGTL+KP+MKDL++IE+L+QLIEKE IP
Sbjct  405  WKKSEGYRMGWSDEILGFDCGGQQWVSETCFPAGTLAKPNMKDLDYIEELLQLIEKEDIP  464

Query  546  APAPIEQRWTACSKSLMSPAYSSVDDDIFSWVGIIMYLPTMDARERKHITEEFFHYRHLT  367
            APAPIEQRWTACS+S MSPA SS +DDIFSWVGIIMYLPT DAR+RK ITEEFF+YR  T
Sbjct  465  APAPIEQRWTACSRSPMSPASSSQEDDIFSWVGIIMYLPTSDARQRKEITEEFFNYRSKT  524

Query  366  QAHLWDHYSAYEHWAKIEVPKDKEELQALQARLRKKFPVDAYNRARQELDPNRILSNNML  187
            Q +LWD YSAYEHWAKIEVPKDK+EL  LQARLRK+FPVDAYN+AR ELDPN++LSN  L
Sbjct  525  QTNLWDGYSAYEHWAKIEVPKDKDELAELQARLRKRFPVDAYNKARMELDPNKVLSNAKL  584

Query  186  EKL  178
            EKL
Sbjct  585  EKL  587



>gb|ABE68384.1| mitochondrial L-galactono-1,4-lactone dehydrogenase [Lotus japonicus]
Length=609

 Score =   326 bits (836),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 154/183 (84%), Positives = 170/183 (93%), Gaps = 0/183 (0%)
 Frame = -2

Query  726  WRKSEGYRVGWSDEILGFDCGGHQWVSETCFPAGTLSKPSMKDLEFIEQLMQLIEKESIP  547
            W+KSEGYRVGWSDEILGFDCGG QWVSETCFPAG L+KPSMKDLE+IE+L Q+IEKE IP
Sbjct  420  WKKSEGYRVGWSDEILGFDCGGQQWVSETCFPAGKLAKPSMKDLEYIEELKQVIEKEEIP  479

Query  546  APAPIEQRWTACSKSLMSPAYSSVDDDIFSWVGIIMYLPTMDARERKHITEEFFHYRHLT  367
            APAPIEQRWT+ S+S +SPA S  +DDIFSWVGIIMYLPTMDAR+RK ITEEFFHYRHL+
Sbjct  480  APAPIEQRWTSSSRSPLSPASSPSEDDIFSWVGIIMYLPTMDARQRKDITEEFFHYRHLS  539

Query  366  QAHLWDHYSAYEHWAKIEVPKDKEELQALQARLRKKFPVDAYNRARQELDPNRILSNNML  187
            QA LWDHYSAYEHWAK+EVPKDKEEL ALQ RLRK+FPVDAYN+AR+ELDPNR+LSNNML
Sbjct  540  QAKLWDHYSAYEHWAKVEVPKDKEELAALQGRLRKRFPVDAYNKARKELDPNRVLSNNML  599

Query  186  EKL  178
            EKL
Sbjct  600  EKL  602



>emb|CBX25473.1| hypothetical_protein [Oryza glaberrima]
Length=583

 Score =   325 bits (832),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 148/183 (81%), Positives = 167/183 (91%), Gaps = 0/183 (0%)
 Frame = -2

Query  726  WRKSEGYRVGWSDEILGFDCGGHQWVSETCFPAGTLSKPSMKDLEFIEQLMQLIEKESIP  547
            W+KSEGYR+GWSDEILGFDCGG QWVSETCFPAGTL+KP+MKDL++IE+L+QLIEKE IP
Sbjct  391  WKKSEGYRMGWSDEILGFDCGGQQWVSETCFPAGTLAKPNMKDLDYIEELLQLIEKEDIP  450

Query  546  APAPIEQRWTACSKSLMSPAYSSVDDDIFSWVGIIMYLPTMDARERKHITEEFFHYRHLT  367
            APAPIEQRWTACS+S M+PA SS +DDIFSWVGIIMYLPT DAR+RK ITEEFF+YR  T
Sbjct  451  APAPIEQRWTACSRSPMNPASSSQEDDIFSWVGIIMYLPTSDARQRKEITEEFFNYRSKT  510

Query  366  QAHLWDHYSAYEHWAKIEVPKDKEELQALQARLRKKFPVDAYNRARQELDPNRILSNNML  187
            Q +LWD YSAYEHWAKIEVPKDK+EL  LQARLRK+FPVDAYN+AR ELDPN++LSN  L
Sbjct  511  QTNLWDGYSAYEHWAKIEVPKDKDELAELQARLRKRFPVDAYNKARMELDPNKVLSNAKL  570

Query  186  EKL  178
            EKL
Sbjct  571  EKL  573



>gb|AAM48582.1| L-galactono-1,4-lactone dehydrogenase [Fragaria x ananassa]
Length=582

 Score =   325 bits (832),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 151/183 (83%), Positives = 163/183 (89%), Gaps = 0/183 (0%)
 Frame = -2

Query  726  WRKSEGYRVGWSDEILGFDCGGHQWVSETCFPAGTLSKPSMKDLEFIEQLMQLIEKESIP  547
            WRKSEGYRVGWSDEILGFDCGG QWVSETCFPAGT++KPSMKDLE+IE L QLIEKE IP
Sbjct  393  WRKSEGYRVGWSDEILGFDCGGQQWVSETCFPAGTIAKPSMKDLEYIEDLKQLIEKEEIP  452

Query  546  APAPIEQRWTACSKSLMSPAYSSVDDDIFSWVGIIMYLPTMDARERKHITEEFFHYRHLT  367
            APAPIEQRWTA SKS MSPA S   D+IFSWVGIIMYLPT DAR+RK ITEEFFHYRHLT
Sbjct  453  APAPIEQRWTASSKSPMSPASSLKGDNIFSWVGIIMYLPTTDARQRKDITEEFFHYRHLT  512

Query  366  QAHLWDHYSAYEHWAKIEVPKDKEELQALQARLRKKFPVDAYNRARQELDPNRILSNNML  187
            Q  LWD YS+YEHWAKIEVPKDKE+L AL+ARLRK++PVDAYN+AR ELDP+RILSN  L
Sbjct  513  QTRLWDTYSSYEHWAKIEVPKDKEQLTALRARLRKRYPVDAYNKARSELDPSRILSNVKL  572

Query  186  EKL  178
             KL
Sbjct  573  GKL  575



>ref|NP_001284400.1| L-galactono-1,4-lactone dehydrogenase, mitochondrial [Cucumis 
melo]
 gb|AAF64319.2|AF252339_1 L-galactono-1,4-lactone dehydrogenase [Cucumis melo]
Length=589

 Score =   324 bits (831),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 148/183 (81%), Positives = 166/183 (91%), Gaps = 0/183 (0%)
 Frame = -2

Query  726  WRKSEGYRVGWSDEILGFDCGGHQWVSETCFPAGTLSKPSMKDLEFIEQLMQLIEKESIP  547
            WRKSEGY+VGWSDEILGFDCGG QWVSETCFPAGTL+KP+MKD+E+IE+L QLIEKE+IP
Sbjct  400  WRKSEGYKVGWSDEILGFDCGGQQWVSETCFPAGTLAKPNMKDIEYIEELKQLIEKENIP  459

Query  546  APAPIEQRWTACSKSLMSPAYSSVDDDIFSWVGIIMYLPTMDARERKHITEEFFHYRHLT  367
            APAP+EQRWT  SKS MSPA S+ +DDIFSWVGIIMYLPT DAR+RK ITEEFFHYRHLT
Sbjct  460  APAPLEQRWTGRSKSPMSPASSTAEDDIFSWVGIIMYLPTSDARQRKEITEEFFHYRHLT  519

Query  366  QAHLWDHYSAYEHWAKIEVPKDKEELQALQARLRKKFPVDAYNRARQELDPNRILSNNML  187
            Q  LWD +SA+EHWAKIEVPKDK+EL ALQARLRK+FPVD  N+AR+ LDPN+ILSNN L
Sbjct  520  QTLLWDKFSAFEHWAKIEVPKDKDELAALQARLRKRFPVDESNKARRALDPNKILSNNKL  579

Query  186  EKL  178
            EKL
Sbjct  580  EKL  582



>gb|ACN88687.1| L-galactono-1,4-lactone dehydrogenase [Malus domestica]
Length=599

 Score =   325 bits (832),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 147/183 (80%), Positives = 162/183 (89%), Gaps = 0/183 (0%)
 Frame = -2

Query  726  WRKSEGYRVGWSDEILGFDCGGHQWVSETCFPAGTLSKPSMKDLEFIEQLMQLIEKESIP  547
            W+KSEGYRVGWSDEILGFDCGG QWVSETCFPAGTL+KPSMKDLE+IE + QLIEK  IP
Sbjct  410  WKKSEGYRVGWSDEILGFDCGGQQWVSETCFPAGTLAKPSMKDLEYIEGVKQLIEKNEIP  469

Query  546  APAPIEQRWTACSKSLMSPAYSSVDDDIFSWVGIIMYLPTMDARERKHITEEFFHYRHLT  367
            APAPIEQRW AC++  MSPA S+ +DDI SWVGIIMYLPT D R+RK ITEEFFHYR LT
Sbjct  470  APAPIEQRWAACTRRPMSPASSTREDDILSWVGIIMYLPTTDPRQRKEITEEFFHYRRLT  529

Query  366  QAHLWDHYSAYEHWAKIEVPKDKEELQALQARLRKKFPVDAYNRARQELDPNRILSNNML  187
            Q  LWD YSAYEHWAKIEVPKDK+EL ALQ RLRK+FPVDAYN+AR+ELDPNR+LSN+ L
Sbjct  530  QTQLWDKYSAYEHWAKIEVPKDKDELAALQDRLRKRFPVDAYNKARRELDPNRVLSNSKL  589

Query  186  EKL  178
            EKL
Sbjct  590  EKL  592



>ref|XP_011033135.1| PREDICTED: L-galactono-1,4-lactone dehydrogenase, mitochondrial 
[Populus euphratica]
Length=609

 Score =   324 bits (830),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 157/183 (86%), Positives = 170/183 (93%), Gaps = 0/183 (0%)
 Frame = -2

Query  726  WRKSEGYRVGWSDEILGFDCGGHQWVSETCFPAGTLSKPSMKDLEFIEQLMQLIEKESIP  547
            WRKSEGYRVGWSDEILGFDCGG QWVSE CFPAGTL+KPS+KDLEFIE+L QLIEKE IP
Sbjct  420  WRKSEGYRVGWSDEILGFDCGGQQWVSENCFPAGTLAKPSLKDLEFIEKLKQLIEKEEIP  479

Query  546  APAPIEQRWTACSKSLMSPAYSSVDDDIFSWVGIIMYLPTMDARERKHITEEFFHYRHLT  367
            APAPIEQRWTA S+S MSPA SS +DDIFSWVGIIMYLPTMDAR+RK ITEEFFHYRHLT
Sbjct  480  APAPIEQRWTARSQSSMSPASSSAEDDIFSWVGIIMYLPTMDARQRKEITEEFFHYRHLT  539

Query  366  QAHLWDHYSAYEHWAKIEVPKDKEELQALQARLRKKFPVDAYNRARQELDPNRILSNNML  187
            QA LWD YSAYEHWAKIEVPKDK+EL AL+ RLR++FPVDAYN+AR+ELDPN+ILSNNML
Sbjct  540  QAELWDMYSAYEHWAKIEVPKDKDELAALKERLRRRFPVDAYNKARKELDPNKILSNNML  599

Query  186  EKL  178
            EKL
Sbjct  600  EKL  602



>ref|XP_009349062.1| PREDICTED: L-galactono-1,4-lactone dehydrogenase, mitochondrial-like 
[Pyrus x bretschneideri]
 ref|XP_009349063.1| PREDICTED: L-galactono-1,4-lactone dehydrogenase, mitochondrial-like 
[Pyrus x bretschneideri]
 ref|XP_009349064.1| PREDICTED: L-galactono-1,4-lactone dehydrogenase, mitochondrial-like 
[Pyrus x bretschneideri]
Length=599

 Score =   323 bits (829),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 149/183 (81%), Positives = 162/183 (89%), Gaps = 0/183 (0%)
 Frame = -2

Query  726  WRKSEGYRVGWSDEILGFDCGGHQWVSETCFPAGTLSKPSMKDLEFIEQLMQLIEKESIP  547
            W+KSEGYRVGWSDEILGFDCGG QWVSETCFPAGTL+KPSMKDLE+IE L QLIEK  IP
Sbjct  410  WKKSEGYRVGWSDEILGFDCGGQQWVSETCFPAGTLAKPSMKDLEYIEGLKQLIEKVEIP  469

Query  546  APAPIEQRWTACSKSLMSPAYSSVDDDIFSWVGIIMYLPTMDARERKHITEEFFHYRHLT  367
            APAPIEQRWTAC+KS MSPA S+ +DD+FSWVGIIMYLPT D R+RK ITE+FFHYR LT
Sbjct  470  APAPIEQRWTACTKSPMSPASSTREDDVFSWVGIIMYLPTTDPRQRKEITEKFFHYRRLT  529

Query  366  QAHLWDHYSAYEHWAKIEVPKDKEELQALQARLRKKFPVDAYNRARQELDPNRILSNNML  187
            Q  LWD YSAYEHWAKIEVPKDK+EL ALQ RLRK+FPVD YN+AR+ELDPN ILS N L
Sbjct  530  QTQLWDKYSAYEHWAKIEVPKDKDELAALQDRLRKRFPVDVYNKARRELDPNGILSINKL  589

Query  186  EKL  178
            EKL
Sbjct  590  EKL  592



>sp|Q2QXY1.1|GLDH2_ORYSJ RecName: Full=L-galactono-1,4-lactone dehydrogenase 2, mitochondrial; 
Flags: Precursor [Oryza sativa Japonica Group]
 gb|ABA96408.1| mitochondrial L-galactono-1,4-lactone dehydrogenase, putative 
[Oryza sativa Japonica Group]
 gb|EAZ19601.1| hypothetical protein OsJ_35179 [Oryza sativa Japonica Group]
Length=583

 Score =   323 bits (828),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 148/183 (81%), Positives = 166/183 (91%), Gaps = 0/183 (0%)
 Frame = -2

Query  726  WRKSEGYRVGWSDEILGFDCGGHQWVSETCFPAGTLSKPSMKDLEFIEQLMQLIEKESIP  547
            W+KSEGYR+GWSDEILGFDCGG QWVSETCFPAGTL+KP+MKDL++IE+L+QLIEKE IP
Sbjct  391  WKKSEGYRMGWSDEILGFDCGGQQWVSETCFPAGTLAKPNMKDLDYIEELLQLIEKEDIP  450

Query  546  APAPIEQRWTACSKSLMSPAYSSVDDDIFSWVGIIMYLPTMDARERKHITEEFFHYRHLT  367
            APAPIEQRWTACS+S MSPA SS +DDIFSWVGIIMYLPT DAR+RK ITEEFF+YR  T
Sbjct  451  APAPIEQRWTACSRSPMSPASSSQEDDIFSWVGIIMYLPTSDARQRKEITEEFFNYRSKT  510

Query  366  QAHLWDHYSAYEHWAKIEVPKDKEELQALQARLRKKFPVDAYNRARQELDPNRILSNNML  187
            Q +LWD YSAYEHWAKIEVPKDK+EL  L ARLRK+FPVDAYN+AR ELDPN++LSN  L
Sbjct  511  QTNLWDGYSAYEHWAKIEVPKDKDELTELLARLRKRFPVDAYNKARMELDPNKVLSNAKL  570

Query  186  EKL  178
            EKL
Sbjct  571  EKL  573



>ref|XP_004515564.1| PREDICTED: L-galactono-1,4-lactone dehydrogenase, mitochondrial-like 
[Cicer arietinum]
Length=599

 Score =   323 bits (828),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 153/183 (84%), Positives = 168/183 (92%), Gaps = 0/183 (0%)
 Frame = -2

Query  726  WRKSEGYRVGWSDEILGFDCGGHQWVSETCFPAGTLSKPSMKDLEFIEQLMQLIEKESIP  547
            W+KSEGYRVGWSDEILGFDCGG QWVSETCFPAG L+ PSMKDLE+IE L +LIEKE IP
Sbjct  410  WKKSEGYRVGWSDEILGFDCGGQQWVSETCFPAGKLANPSMKDLEYIEDLKKLIEKEEIP  469

Query  546  APAPIEQRWTACSKSLMSPAYSSVDDDIFSWVGIIMYLPTMDARERKHITEEFFHYRHLT  367
            APAPIEQRWTA ++S +SPA S   DDIFSWVGIIMYLPTMDAR+RK IT+EFFHYRHLT
Sbjct  470  APAPIEQRWTASTRSPLSPASSPSADDIFSWVGIIMYLPTMDARQRKDITDEFFHYRHLT  529

Query  366  QAHLWDHYSAYEHWAKIEVPKDKEELQALQARLRKKFPVDAYNRARQELDPNRILSNNML  187
            QA LWD+YSAYEHWAKIEVPK+KEEL ALQARLRK+FPVDAYN+AR+ELDPNRILSNNM+
Sbjct  530  QAKLWDNYSAYEHWAKIEVPKNKEELVALQARLRKRFPVDAYNKARKELDPNRILSNNMV  589

Query  186  EKL  178
            EKL
Sbjct  590  EKL  592



>ref|XP_006574356.1| PREDICTED: uncharacterized protein LOC100526948 isoform X1 [Glycine 
max]
Length=584

 Score =   322 bits (825),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 157/183 (86%), Positives = 168/183 (92%), Gaps = 0/183 (0%)
 Frame = -2

Query  726  WRKSEGYRVGWSDEILGFDCGGHQWVSETCFPAGTLSKPSMKDLEFIEQLMQLIEKESIP  547
            WRKSEGYRVGWSDEILGFDCGG QWVSETCFPAG L+ PSMKDLE+IE+L QLIEKE IP
Sbjct  395  WRKSEGYRVGWSDEILGFDCGGQQWVSETCFPAGKLANPSMKDLEYIEELKQLIEKEEIP  454

Query  546  APAPIEQRWTACSKSLMSPAYSSVDDDIFSWVGIIMYLPTMDARERKHITEEFFHYRHLT  367
            APAPIEQRWTA S+S +SPA S  +DDIFSWVGIIMYLPTMDAR+RK ITEEFFHYRHLT
Sbjct  455  APAPIEQRWTASSRSSLSPASSPSEDDIFSWVGIIMYLPTMDARQRKDITEEFFHYRHLT  514

Query  366  QAHLWDHYSAYEHWAKIEVPKDKEELQALQARLRKKFPVDAYNRARQELDPNRILSNNML  187
            QA LWD YSAYEHWAKIEVPKDK+EL ALQ RLRK+FPVDAYN+AR+ELDPNRILSNNML
Sbjct  515  QAKLWDCYSAYEHWAKIEVPKDKKELAALQERLRKRFPVDAYNKARKELDPNRILSNNML  574

Query  186  EKL  178
            EKL
Sbjct  575  EKL  577



>emb|CBI30081.3| unnamed protein product [Vitis vinifera]
Length=443

 Score =   317 bits (813),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 156/183 (85%), Positives = 166/183 (91%), Gaps = 0/183 (0%)
 Frame = -2

Query  726  WRKSEGYRVGWSDEILGFDCGGHQWVSETCFPAGTLSKPSMKDLEFIEQLMQLIEKESIP  547
            WRKSEGYRVGWSDEILGFDCGG QWVSETCFPAGTL+KPSMKDLE+IE L +LIEKE IP
Sbjct  254  WRKSEGYRVGWSDEILGFDCGGQQWVSETCFPAGTLAKPSMKDLEYIEDLKKLIEKEEIP  313

Query  546  APAPIEQRWTACSKSLMSPAYSSVDDDIFSWVGIIMYLPTMDARERKHITEEFFHYRHLT  367
            APAPIEQRWT  SKS MSPA SS +DDIFSWVGIIMYLPTMDAR+RK ITEEFFHYR L+
Sbjct  314  APAPIEQRWTQSSKSPMSPASSSAEDDIFSWVGIIMYLPTMDARQRKEITEEFFHYRRLS  373

Query  366  QAHLWDHYSAYEHWAKIEVPKDKEELQALQARLRKKFPVDAYNRARQELDPNRILSNNML  187
            Q  LWD YSAYEHWAKIEVPKDK+EL ALQARLRK+FPVD YN+AR+ELDPNRILSNNML
Sbjct  374  QTQLWDLYSAYEHWAKIEVPKDKDELAALQARLRKRFPVDEYNKARKELDPNRILSNNML  433

Query  186  EKL  178
             KL
Sbjct  434  GKL  436



>ref|XP_006663194.1| PREDICTED: L-galactono-1,4-lactone dehydrogenase 2, mitochondrial-like, 
partial [Oryza brachyantha]
Length=384

 Score =   315 bits (807),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 144/183 (79%), Positives = 165/183 (90%), Gaps = 0/183 (0%)
 Frame = -2

Query  726  WRKSEGYRVGWSDEILGFDCGGHQWVSETCFPAGTLSKPSMKDLEFIEQLMQLIEKESIP  547
            W+KSEGYR+GWSDEILGFDCGG QWVSETCFPAGTL+KP++KDL+++E+L+QLIEKE IP
Sbjct  191  WKKSEGYRMGWSDEILGFDCGGQQWVSETCFPAGTLAKPNLKDLDYMEELLQLIEKEDIP  250

Query  546  APAPIEQRWTACSKSLMSPAYSSVDDDIFSWVGIIMYLPTMDARERKHITEEFFHYRHLT  367
            APAPIEQRWTA S+S MSPA SS +DDIFSWVGIIMYLPT DAR+RK ITEEFF+YR +T
Sbjct  251  APAPIEQRWTARSRSPMSPASSSQEDDIFSWVGIIMYLPTSDARQRKEITEEFFNYRSMT  310

Query  366  QAHLWDHYSAYEHWAKIEVPKDKEELQALQARLRKKFPVDAYNRARQELDPNRILSNNML  187
            Q +LWD YSAYEHWAKIEVPKDK+EL  LQ RLRK+FPVD YN+AR ELDPN++LSN  L
Sbjct  311  QTNLWDGYSAYEHWAKIEVPKDKDELAELQVRLRKRFPVDEYNKARMELDPNKVLSNAKL  370

Query  186  EKL  178
            EKL
Sbjct  371  EKL  373



>gb|KJB46249.1| hypothetical protein B456_007G353900 [Gossypium raimondii]
Length=602

 Score =   322 bits (824),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 155/183 (85%), Positives = 170/183 (93%), Gaps = 0/183 (0%)
 Frame = -2

Query  726  WRKSEGYRVGWSDEILGFDCGGHQWVSETCFPAGTLSKPSMKDLEFIEQLMQLIEKESIP  547
            WRKSEGYRVGWSD+ILGFDCGG QWVSETCFPAGTLSKPSMKDLE+IE+L +LIE   +P
Sbjct  413  WRKSEGYRVGWSDDILGFDCGGQQWVSETCFPAGTLSKPSMKDLEYIEELKKLIETNELP  472

Query  546  APAPIEQRWTACSKSLMSPAYSSVDDDIFSWVGIIMYLPTMDARERKHITEEFFHYRHLT  367
            APAPIEQRWTA S+S MSPA SS +DDIFSWVGIIMYLPTMDAR+RK ITEEFFHYRHLT
Sbjct  473  APAPIEQRWTARSQSPMSPASSSAEDDIFSWVGIIMYLPTMDARQRKEITEEFFHYRHLT  532

Query  366  QAHLWDHYSAYEHWAKIEVPKDKEELQALQARLRKKFPVDAYNRARQELDPNRILSNNML  187
            Q+ LWD YSAYEHWAKIEVPKDKEEL+ALQARL+ +FPVDAYN+AR+ELDPNRILSNN+L
Sbjct  533  QSQLWDKYSAYEHWAKIEVPKDKEELEALQARLKTRFPVDAYNKARRELDPNRILSNNIL  592

Query  186  EKL  178
            EKL
Sbjct  593  EKL  595



>gb|KHG09426.1| L-galactono-1,4-lactone dehydrogenase-2C mitochondrial -like 
protein [Gossypium arboreum]
Length=603

 Score =   322 bits (824),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 155/183 (85%), Positives = 170/183 (93%), Gaps = 0/183 (0%)
 Frame = -2

Query  726  WRKSEGYRVGWSDEILGFDCGGHQWVSETCFPAGTLSKPSMKDLEFIEQLMQLIEKESIP  547
            WRKSEGYRVGWSD+ILGFDCGG QWVSETCFPAGTLSKPSMKDLE+IE+L +LIE   +P
Sbjct  414  WRKSEGYRVGWSDDILGFDCGGQQWVSETCFPAGTLSKPSMKDLEYIEELKKLIETNELP  473

Query  546  APAPIEQRWTACSKSLMSPAYSSVDDDIFSWVGIIMYLPTMDARERKHITEEFFHYRHLT  367
            APAPIEQRWTA S+S MSPA SS +DDIFSWVGIIMYLPTMDAR+RK ITEEFFHYRHLT
Sbjct  474  APAPIEQRWTARSQSPMSPASSSAEDDIFSWVGIIMYLPTMDARQRKEITEEFFHYRHLT  533

Query  366  QAHLWDHYSAYEHWAKIEVPKDKEELQALQARLRKKFPVDAYNRARQELDPNRILSNNML  187
            Q+ LWD YSAYEHWAKIEVPKDKEEL+ALQARL+ +FPVDAYN+AR+ELDPNRILSNN+L
Sbjct  534  QSQLWDKYSAYEHWAKIEVPKDKEELEALQARLKARFPVDAYNKARRELDPNRILSNNIL  593

Query  186  EKL  178
            EKL
Sbjct  594  EKL  596



>ref|XP_003535902.1| PREDICTED: L-galactono-1,4-lactone dehydrogenase, mitochondrial-like 
[Glycine max]
Length=581

 Score =   320 bits (821),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 156/183 (85%), Positives = 165/183 (90%), Gaps = 0/183 (0%)
 Frame = -2

Query  726  WRKSEGYRVGWSDEILGFDCGGHQWVSETCFPAGTLSKPSMKDLEFIEQLMQLIEKESIP  547
            WRKSEGYRVGWSDEILGFDCGG QWVSE CFPAG L+ PSMKDLE+IE+L  LIEKE IP
Sbjct  392  WRKSEGYRVGWSDEILGFDCGGQQWVSEACFPAGKLANPSMKDLEYIEELKLLIEKEDIP  451

Query  546  APAPIEQRWTACSKSLMSPAYSSVDDDIFSWVGIIMYLPTMDARERKHITEEFFHYRHLT  367
            APAPIEQRWTA S+S +SPA S   DDIFSWVGIIMYLPTMD R+RK ITEEFFHYRHLT
Sbjct  452  APAPIEQRWTASSRSSLSPASSPSGDDIFSWVGIIMYLPTMDGRQRKDITEEFFHYRHLT  511

Query  366  QAHLWDHYSAYEHWAKIEVPKDKEELQALQARLRKKFPVDAYNRARQELDPNRILSNNML  187
            QA LWD YSAYEHWAKIEVPKDKEEL ALQARLRK+FPVDAYN+AR+ELDPNRILSNNML
Sbjct  512  QAKLWDRYSAYEHWAKIEVPKDKEELAALQARLRKRFPVDAYNKARKELDPNRILSNNML  571

Query  186  EKL  178
            EKL
Sbjct  572  EKL  574



>gb|KDP26223.1| hypothetical protein JCGZ_22469 [Jatropha curcas]
Length=601

 Score =   320 bits (819),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 155/183 (85%), Positives = 167/183 (91%), Gaps = 0/183 (0%)
 Frame = -2

Query  726  WRKSEGYRVGWSDEILGFDCGGHQWVSETCFPAGTLSKPSMKDLEFIEQLMQLIEKESIP  547
            W+KSEGYRVGWSDEILGFDCGG QWVSETCFPAGTLSKPSMKDLE+IE+L QLI+KE IP
Sbjct  412  WKKSEGYRVGWSDEILGFDCGGQQWVSETCFPAGTLSKPSMKDLEYIEELKQLIDKEDIP  471

Query  546  APAPIEQRWTACSKSLMSPAYSSVDDDIFSWVGIIMYLPTMDARERKHITEEFFHYRHLT  367
            APAPIEQRWTACS+S MSPA SS  DDIFSWVGIIMYLPTMDAR+RK ITEEFFHYR LT
Sbjct  472  APAPIEQRWTACSQSPMSPASSSAKDDIFSWVGIIMYLPTMDARQRKEITEEFFHYRQLT  531

Query  366  QAHLWDHYSAYEHWAKIEVPKDKEELQALQARLRKKFPVDAYNRARQELDPNRILSNNML  187
            Q  LWD Y  +EHWAKIEVPKD EEL +LQARLRK+FPVDAYN+AR+ELDPNRILSNN+L
Sbjct  532  QKQLWDKYYCFEHWAKIEVPKDMEELASLQARLRKRFPVDAYNKARKELDPNRILSNNVL  591

Query  186  EKL  178
            EKL
Sbjct  592  EKL  594



>gb|AES60484.2| L-galactono-1,4-lactone dehydrogenase [Medicago truncatula]
Length=603

 Score =   319 bits (817),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 152/183 (83%), Positives = 167/183 (91%), Gaps = 0/183 (0%)
 Frame = -2

Query  726  WRKSEGYRVGWSDEILGFDCGGHQWVSETCFPAGTLSKPSMKDLEFIEQLMQLIEKESIP  547
            W+KSEGYRVGWSDEILGFDCGG QWVSETCFPAG L+ PSMKDLE+IE+L +LIEKE IP
Sbjct  414  WKKSEGYRVGWSDEILGFDCGGQQWVSETCFPAGKLATPSMKDLEYIEELKKLIEKEEIP  473

Query  546  APAPIEQRWTACSKSLMSPAYSSVDDDIFSWVGIIMYLPTMDARERKHITEEFFHYRHLT  367
            APAPIEQRWTA ++S MSPA S   DDIFSWVGIIMYLPTMDAR+RK ITEEFFHYRHLT
Sbjct  474  APAPIEQRWTASTRSPMSPASSPSQDDIFSWVGIIMYLPTMDARQRKDITEEFFHYRHLT  533

Query  366  QAHLWDHYSAYEHWAKIEVPKDKEELQALQARLRKKFPVDAYNRARQELDPNRILSNNML  187
            QA LWD+YSAYEHWAKIEVPK+K+EL ALQARLRK+FPVDAYN+AR ELDPN++LSNN L
Sbjct  534  QAKLWDNYSAYEHWAKIEVPKNKDELIALQARLRKRFPVDAYNKARNELDPNKVLSNNKL  593

Query  186  EKL  178
            EKL
Sbjct  594  EKL  596



>ref|XP_007145549.1| hypothetical protein PHAVU_007G247900g [Phaseolus vulgaris]
 gb|ESW17543.1| hypothetical protein PHAVU_007G247900g [Phaseolus vulgaris]
Length=585

 Score =   318 bits (815),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 152/183 (83%), Positives = 166/183 (91%), Gaps = 0/183 (0%)
 Frame = -2

Query  726  WRKSEGYRVGWSDEILGFDCGGHQWVSETCFPAGTLSKPSMKDLEFIEQLMQLIEKESIP  547
            WRKSEGYRVGWSDEILGFDCGG QWVSETCFPAG L+ PSMKDLE+IE+L QLIE E IP
Sbjct  396  WRKSEGYRVGWSDEILGFDCGGQQWVSETCFPAGKLANPSMKDLEYIEELKQLIENEEIP  455

Query  546  APAPIEQRWTACSKSLMSPAYSSVDDDIFSWVGIIMYLPTMDARERKHITEEFFHYRHLT  367
            APAPIEQRWTA S+S +SPA S  +DDIFSWVGIIMYLP+ DAR+RK ITEEFFHYRHLT
Sbjct  456  APAPIEQRWTASSRSPLSPASSPSEDDIFSWVGIIMYLPSTDARQRKDITEEFFHYRHLT  515

Query  366  QAHLWDHYSAYEHWAKIEVPKDKEELQALQARLRKKFPVDAYNRARQELDPNRILSNNML  187
            Q  LWD YSA+EHWAKIEVPKDKEEL ALQARLRK+FPVD+YN+AR+ELDPNRILSNNML
Sbjct  516  QEKLWDRYSAFEHWAKIEVPKDKEELAALQARLRKRFPVDSYNKARKELDPNRILSNNML  575

Query  186  EKL  178
            +KL
Sbjct  576  QKL  578



>gb|EPS69983.1| l-galactono-1,4-lactone dehydrogenase [Genlisea aurea]
Length=587

 Score =   318 bits (814),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 145/183 (79%), Positives = 161/183 (88%), Gaps = 0/183 (0%)
 Frame = -2

Query  726  WRKSEGYRVGWSDEILGFDCGGHQWVSETCFPAGTLSKPSMKDLEFIEQLMQLIEKESIP  547
            WRKSEGYRVGWSDEILGFDCGG QWVSETCFPAGTLS PSMKDLE++E L++LIEK  +P
Sbjct  400  WRKSEGYRVGWSDEILGFDCGGQQWVSETCFPAGTLSNPSMKDLEYVENLLELIEKNDVP  459

Query  546  APAPIEQRWTACSKSLMSPAYSSVDDDIFSWVGIIMYLPTMDARERKHITEEFFHYRHLT  367
            +PAPIEQRWT  S+S+MSPAYSS  DDIFSWVGIIMYLPTMD R RK ITEEFFHYR LT
Sbjct  460  SPAPIEQRWTGRSRSVMSPAYSSSTDDIFSWVGIIMYLPTMDPRGRKRITEEFFHYRWLT  519

Query  366  QAHLWDHYSAYEHWAKIEVPKDKEELQALQARLRKKFPVDAYNRARQELDPNRILSNNML  187
            Q  LWD +SAYEHWAK+E+PK+K+EL  LQ RLRKKFPVD YNRAR+ELDPN ILSN++L
Sbjct  520  QKQLWDDFSAYEHWAKVEIPKEKDELTWLQTRLRKKFPVDEYNRARKELDPNNILSNSIL  579

Query  186  EKL  178
             KL
Sbjct  580  GKL  582



>ref|XP_006664325.1| PREDICTED: L-galactono-1,4-lactone dehydrogenase 2, mitochondrial-like, 
partial [Oryza brachyantha]
Length=384

 Score =   311 bits (796),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 143/183 (78%), Positives = 164/183 (90%), Gaps = 0/183 (0%)
 Frame = -2

Query  726  WRKSEGYRVGWSDEILGFDCGGHQWVSETCFPAGTLSKPSMKDLEFIEQLMQLIEKESIP  547
            W+KSEGYR+GWSDEILGFDCGG Q VSETCFPAGTL+KP++KDL+++E+L+QLIEKE IP
Sbjct  191  WKKSEGYRMGWSDEILGFDCGGQQSVSETCFPAGTLAKPNLKDLDYMEELLQLIEKEDIP  250

Query  546  APAPIEQRWTACSKSLMSPAYSSVDDDIFSWVGIIMYLPTMDARERKHITEEFFHYRHLT  367
            APAPIEQRWTA S+S MSPA SS +DDIFSWVGIIMYLPT DAR+RK ITEEFF+YR +T
Sbjct  251  APAPIEQRWTARSRSPMSPASSSQEDDIFSWVGIIMYLPTSDARQRKEITEEFFNYRSMT  310

Query  366  QAHLWDHYSAYEHWAKIEVPKDKEELQALQARLRKKFPVDAYNRARQELDPNRILSNNML  187
            Q +LWD YSAYEHWAKIEVPKDK+EL  LQ RLRK+FPVD YN+AR ELDPN++LSN  L
Sbjct  311  QTNLWDGYSAYEHWAKIEVPKDKDELAELQVRLRKRFPVDEYNKARMELDPNKVLSNAKL  370

Query  186  EKL  178
            EKL
Sbjct  371  EKL  373



>emb|CBX25291.1| hypothetical_protein [Oryza brachyantha]
Length=582

 Score =   317 bits (811),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 144/183 (79%), Positives = 165/183 (90%), Gaps = 0/183 (0%)
 Frame = -2

Query  726  WRKSEGYRVGWSDEILGFDCGGHQWVSETCFPAGTLSKPSMKDLEFIEQLMQLIEKESIP  547
            W+KSEGYR+GWSDEILGFDCGG QWVSETCFPAGTL+KP++KDL+++E+L+QLIEKE IP
Sbjct  389  WKKSEGYRMGWSDEILGFDCGGQQWVSETCFPAGTLAKPNLKDLDYMEELLQLIEKEDIP  448

Query  546  APAPIEQRWTACSKSLMSPAYSSVDDDIFSWVGIIMYLPTMDARERKHITEEFFHYRHLT  367
            APAPIEQRWTA S+S MSPA SS +DDIFSWVGIIMYLPT DAR+RK ITEEFF+YR +T
Sbjct  449  APAPIEQRWTARSRSPMSPASSSQEDDIFSWVGIIMYLPTSDARQRKEITEEFFNYRSMT  508

Query  366  QAHLWDHYSAYEHWAKIEVPKDKEELQALQARLRKKFPVDAYNRARQELDPNRILSNNML  187
            Q +LWD YSAYEHWAKIEVPKDK+EL  LQ RLRK+FPVD YN+AR ELDPN++LSN  L
Sbjct  509  QTNLWDGYSAYEHWAKIEVPKDKDELAELQVRLRKRFPVDEYNKARMELDPNKVLSNAKL  568

Query  186  EKL  178
            EKL
Sbjct  569  EKL  571



>ref|XP_002274214.2| PREDICTED: L-galactono-1,4-lactone dehydrogenase, mitochondrial 
[Vitis vinifera]
Length=609

 Score =   317 bits (813),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 156/183 (85%), Positives = 166/183 (91%), Gaps = 0/183 (0%)
 Frame = -2

Query  726  WRKSEGYRVGWSDEILGFDCGGHQWVSETCFPAGTLSKPSMKDLEFIEQLMQLIEKESIP  547
            WRKSEGYRVGWSDEILGFDCGG QWVSETCFPAGTL+KPSMKDLE+IE L +LIEKE IP
Sbjct  420  WRKSEGYRVGWSDEILGFDCGGQQWVSETCFPAGTLAKPSMKDLEYIEDLKKLIEKEEIP  479

Query  546  APAPIEQRWTACSKSLMSPAYSSVDDDIFSWVGIIMYLPTMDARERKHITEEFFHYRHLT  367
            APAPIEQRWT  SKS MSPA SS +DDIFSWVGIIMYLPTMDAR+RK ITEEFFHYR L+
Sbjct  480  APAPIEQRWTQSSKSPMSPASSSAEDDIFSWVGIIMYLPTMDARQRKEITEEFFHYRRLS  539

Query  366  QAHLWDHYSAYEHWAKIEVPKDKEELQALQARLRKKFPVDAYNRARQELDPNRILSNNML  187
            Q  LWD YSAYEHWAKIEVPKDK+EL ALQARLRK+FPVD YN+AR+ELDPNRILSNNML
Sbjct  540  QTQLWDLYSAYEHWAKIEVPKDKDELAALQARLRKRFPVDEYNKARKELDPNRILSNNML  599

Query  186  EKL  178
             KL
Sbjct  600  GKL  602



>gb|ACN59217.1| putative L-galactono-1,4-lactone dehydrogenase [Vitis vinifera]
Length=611

 Score =   317 bits (812),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 156/183 (85%), Positives = 166/183 (91%), Gaps = 0/183 (0%)
 Frame = -2

Query  726  WRKSEGYRVGWSDEILGFDCGGHQWVSETCFPAGTLSKPSMKDLEFIEQLMQLIEKESIP  547
            WRKSEGYRVGWSDEILGFDCGG QWVSETCFPAGTL+KPSMKDLE+IE L +LIEKE IP
Sbjct  422  WRKSEGYRVGWSDEILGFDCGGQQWVSETCFPAGTLAKPSMKDLEYIEDLKKLIEKEEIP  481

Query  546  APAPIEQRWTACSKSLMSPAYSSVDDDIFSWVGIIMYLPTMDARERKHITEEFFHYRHLT  367
            APAPIEQRWTA SKS MSPA SS +DDIFSWVGIIMYLPTMDAR+RK ITEEFFHYR L+
Sbjct  482  APAPIEQRWTASSKSPMSPASSSAEDDIFSWVGIIMYLPTMDARQRKEITEEFFHYRRLS  541

Query  366  QAHLWDHYSAYEHWAKIEVPKDKEELQALQARLRKKFPVDAYNRARQELDPNRILSNNML  187
            Q  LWD YSAYEHWAKIEVPKDK+EL ALQARLRK+FPVD YN+AR+ELDPNRILSNNM 
Sbjct  542  QTQLWDLYSAYEHWAKIEVPKDKDELAALQARLRKRFPVDEYNKARKELDPNRILSNNMQ  601

Query  186  EKL  178
             KL
Sbjct  602  GKL  604



>ref|XP_008392427.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103454610 
[Malus domestica]
Length=608

 Score =   315 bits (807),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 148/183 (81%), Positives = 159/183 (87%), Gaps = 0/183 (0%)
 Frame = -2

Query  726  WRKSEGYRVGWSDEILGFDCGGHQWVSETCFPAGTLSKPSMKDLEFIEQLMQLIEKESIP  547
            W+K EGYRVGWSDEILGFDCGG QWVSETCF AGTL+KPSMKDLE+IE L QLIEK  IP
Sbjct  419  WKKLEGYRVGWSDEILGFDCGGQQWVSETCFLAGTLAKPSMKDLEYIEGLKQLIEKVEIP  478

Query  546  APAPIEQRWTACSKSLMSPAYSSVDDDIFSWVGIIMYLPTMDARERKHITEEFFHYRHLT  367
            APAPIEQ WTAC+KS MSPA S+ +DDIFSWVGIIMYLPT D R+RK ITEEFFHYR LT
Sbjct  479  APAPIEQLWTACTKSPMSPASSTREDDIFSWVGIIMYLPTTDPRQRKEITEEFFHYRRLT  538

Query  366  QAHLWDHYSAYEHWAKIEVPKDKEELQALQARLRKKFPVDAYNRARQELDPNRILSNNML  187
            Q  LWD YSAYEHWAKIEVPKDK+EL ALQ  LRK+FPVDAYN+A +ELDPNRILS N L
Sbjct  539  QTQLWDKYSAYEHWAKIEVPKDKDELAALQDGLRKRFPVDAYNKAXRELDPNRILSINKL  598

Query  186  EKL  178
            EKL
Sbjct  599  EKL  601



>emb|CBX25378.1| hypothetical_protein [Oryza brachyantha]
Length=582

 Score =   313 bits (801),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 143/183 (78%), Positives = 164/183 (90%), Gaps = 0/183 (0%)
 Frame = -2

Query  726  WRKSEGYRVGWSDEILGFDCGGHQWVSETCFPAGTLSKPSMKDLEFIEQLMQLIEKESIP  547
            W+KSEGYR+GWSDEILGFDCGG Q VSETCFPAGTL+KP++KDL+++E+L+QLIEKE IP
Sbjct  389  WKKSEGYRMGWSDEILGFDCGGQQSVSETCFPAGTLAKPNLKDLDYMEELLQLIEKEDIP  448

Query  546  APAPIEQRWTACSKSLMSPAYSSVDDDIFSWVGIIMYLPTMDARERKHITEEFFHYRHLT  367
            APAPIEQRWTA S+S MSPA SS +DDIFSWVGIIMYLPT DAR+RK ITEEFF+YR +T
Sbjct  449  APAPIEQRWTARSRSPMSPASSSQEDDIFSWVGIIMYLPTSDARQRKEITEEFFNYRSMT  508

Query  366  QAHLWDHYSAYEHWAKIEVPKDKEELQALQARLRKKFPVDAYNRARQELDPNRILSNNML  187
            Q +LWD YSAYEHWAKIEVPKDK+EL  LQ RLRK+FPVD YN+AR ELDPN++LSN  L
Sbjct  509  QTNLWDGYSAYEHWAKIEVPKDKDELAELQVRLRKRFPVDEYNKARMELDPNKVLSNAKL  568

Query  186  EKL  178
            EKL
Sbjct  569  EKL  571



>ref|XP_004977506.1| PREDICTED: L-galactono-1,4-lactone dehydrogenase 1, mitochondrial-like 
[Setaria italica]
Length=580

 Score =   311 bits (798),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 145/183 (79%), Positives = 162/183 (89%), Gaps = 1/183 (1%)
 Frame = -2

Query  726  WRKSEGYRVGWSDEILGFDCGGHQWVSETCFPAGTLSKPSMKDLEFIEQLMQLIEKESIP  547
            W+KSEGYR+GWSDEILGFDCGG QWVSE CFP GTL+KPS KDL++IE+L+QLIEKE IP
Sbjct  391  WKKSEGYRMGWSDEILGFDCGGQQWVSENCFPTGTLAKPSTKDLDYIEKLLQLIEKEDIP  450

Query  546  APAPIEQRWTACSKSLMSPAYSSVDDDIFSWVGIIMYLPTMDARERKHITEEFFHYRHLT  367
            APAPIEQRWTA SKS MSPA SS +DD+FSWVGIIMYLPT DAR+RK ITEEFF+YR L 
Sbjct  451  APAPIEQRWTAHSKSPMSPASSSEEDDVFSWVGIIMYLPTSDARQRKEITEEFFNYRSLA  510

Query  366  QAHLWDHYSAYEHWAKIEVPKDKEELQALQARLRKKFPVDAYNRARQELDPNRILSNNML  187
            Q  LWD YSAYEHWAKIEVPKDK+EL  LQARLRK+FPVDAYN+AR ELDPN++LSN  +
Sbjct  511  QT-LWDDYSAYEHWAKIEVPKDKDELAELQARLRKRFPVDAYNKARMELDPNKVLSNAKI  569

Query  186  EKL  178
            EKL
Sbjct  570  EKL  572



>ref|NP_001167748.1| uncharacterized protein LOC100381436 [Zea mays]
 gb|ACN25816.1| unknown [Zea mays]
 gb|ACN25949.1| unknown [Zea mays]
 tpg|DAA39209.1| TPA: hypothetical protein ZEAMMB73_624254 [Zea mays]
Length=586

 Score =   309 bits (792),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 143/183 (78%), Positives = 162/183 (89%), Gaps = 1/183 (1%)
 Frame = -2

Query  726  WRKSEGYRVGWSDEILGFDCGGHQWVSETCFPAGTLSKPSMKDLEFIEQLMQLIEKESIP  547
            W+KSEGYR+GWSDEILGFDCGG QWVSE CFP GTL+KPSMKDL++I++L+QLIEKE IP
Sbjct  394  WKKSEGYRMGWSDEILGFDCGGQQWVSENCFPTGTLAKPSMKDLDYIDKLLQLIEKEEIP  453

Query  546  APAPIEQRWTACSKSLMSPAYSSVDDDIFSWVGIIMYLPTMDARERKHITEEFFHYRHLT  367
            AP PIEQRWTA SKS MSPA SS +DD+FSWVGIIMYLPT DAR+RK ITEEFF YR L 
Sbjct  454  APGPIEQRWTARSKSPMSPASSSEEDDVFSWVGIIMYLPTSDARQRKEITEEFFSYRSLA  513

Query  366  QAHLWDHYSAYEHWAKIEVPKDKEELQALQARLRKKFPVDAYNRARQELDPNRILSNNML  187
            ++ LWD YSAYEHWAKIEVPKDK+EL  LQARLRK+FPVDAYN+AR ELDPN++LSN  L
Sbjct  514  RS-LWDDYSAYEHWAKIEVPKDKDELAELQARLRKRFPVDAYNKARMELDPNKVLSNAKL  572

Query  186  EKL  178
            EK+
Sbjct  573  EKM  575



>ref|XP_010238743.1| PREDICTED: L-galactono-1,4-lactone dehydrogenase 2, mitochondrial 
[Brachypodium distachyon]
Length=584

 Score =   308 bits (789),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 141/183 (77%), Positives = 162/183 (89%), Gaps = 0/183 (0%)
 Frame = -2

Query  726  WRKSEGYRVGWSDEILGFDCGGHQWVSETCFPAGTLSKPSMKDLEFIEQLMQLIEKESIP  547
            W+KSEGY +GWSDEILGFDCGG QWVSETCFP GTL+KPSMKDL+++E+L+QLIEKE IP
Sbjct  391  WKKSEGYHMGWSDEILGFDCGGQQWVSETCFPTGTLAKPSMKDLDYMEELLQLIEKEDIP  450

Query  546  APAPIEQRWTACSKSLMSPAYSSVDDDIFSWVGIIMYLPTMDARERKHITEEFFHYRHLT  367
            APAPIEQRWTA S+S MSPA SS +DDIFSWVGIIMYLPT D R+RK ITEEFF+YR L 
Sbjct  451  APAPIEQRWTARSRSPMSPASSSEEDDIFSWVGIIMYLPTSDPRQRKDITEEFFNYRSLA  510

Query  366  QAHLWDHYSAYEHWAKIEVPKDKEELQALQARLRKKFPVDAYNRARQELDPNRILSNNML  187
            Q  LW+ YSAYEHWAKIE+PKDK+EL  LQARLRK+FPV+AYN+AR ELDPN++LS+  L
Sbjct  511  QTSLWNDYSAYEHWAKIEIPKDKDELAELQARLRKRFPVNAYNKARMELDPNKVLSSARL  570

Query  186  EKL  178
            EKL
Sbjct  571  EKL  573



>ref|XP_010102741.1| L-galactono-1,4-lactone dehydrogenase [Morus notabilis]
 gb|EXB93993.1| L-galactono-1,4-lactone dehydrogenase [Morus notabilis]
Length=599

 Score =   307 bits (786),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 146/183 (80%), Positives = 165/183 (90%), Gaps = 0/183 (0%)
 Frame = -2

Query  726  WRKSEGYRVGWSDEILGFDCGGHQWVSETCFPAGTLSKPSMKDLEFIEQLMQLIEKESIP  547
            WRKSEGYRVGWSDEILGFDCGG QWVSETCFP GT++KP+MKDL++IE + +LIEKE +P
Sbjct  410  WRKSEGYRVGWSDEILGFDCGGQQWVSETCFPVGTVAKPNMKDLQYIEDVKKLIEKEKVP  469

Query  546  APAPIEQRWTACSKSLMSPAYSSVDDDIFSWVGIIMYLPTMDARERKHITEEFFHYRHLT  367
            APAPIEQRWTA SKS MSPA S  +DDIFSWVGIIMYLPT DAR+RK IT+EFFHYRH+T
Sbjct  470  APAPIEQRWTARSKSPMSPASSPSEDDIFSWVGIIMYLPTSDARQRKEITDEFFHYRHMT  529

Query  366  QAHLWDHYSAYEHWAKIEVPKDKEELQALQARLRKKFPVDAYNRARQELDPNRILSNNML  187
            Q  LWD YSAYEHWAKIEVPK+KEEL ALQARLR++FPVDAYN+AR+ELDP+ ILSNN L
Sbjct  530  QTELWDQYSAYEHWAKIEVPKEKEELAALQARLRRRFPVDAYNKARKELDPHGILSNNKL  589

Query  186  EKL  178
            +KL
Sbjct  590  DKL  592



>ref|XP_004978646.1| PREDICTED: L-galactono-1,4-lactone dehydrogenase 1, mitochondrial-like 
[Setaria italica]
Length=582

 Score =   306 bits (784),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 144/183 (79%), Positives = 162/183 (89%), Gaps = 2/183 (1%)
 Frame = -2

Query  726  WRKSEGYRVGWSDEILGFDCGGHQWVSETCFPAGTLSKPSMKDLEFIEQLMQLIEKESIP  547
            W+KSEGYR+GWSDEILGFDCGG QWVSE CFP GTL+KPS KDL++IE+L+QLIEKE IP
Sbjct  394  WKKSEGYRMGWSDEILGFDCGGQQWVSENCFPTGTLAKPSTKDLDYIEKLLQLIEKEDIP  453

Query  546  APAPIEQRWTACSKSLMSPAYSSVDDDIFSWVGIIMYLPTMDARERKHITEEFFHYRHLT  367
            APAPIEQRWTA SKS MSPA SS ++D+FSWVGIIMYLPT DAR+RK ITEEFF+YR L 
Sbjct  454  APAPIEQRWTARSKSPMSPASSS-EEDVFSWVGIIMYLPTSDARQRKEITEEFFNYRSLA  512

Query  366  QAHLWDHYSAYEHWAKIEVPKDKEELQALQARLRKKFPVDAYNRARQELDPNRILSNNML  187
            Q  LWD YSAYEHWAKIEVPKD++EL  LQARLRK+FPVDAYN+AR ELDPN++LSN  L
Sbjct  513  QT-LWDDYSAYEHWAKIEVPKDRDELAELQARLRKRFPVDAYNKARMELDPNKVLSNAKL  571

Query  186  EKL  178
            EKL
Sbjct  572  EKL  574



>dbj|BAJ86467.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=640

 Score =   308 bits (788),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 141/183 (77%), Positives = 162/183 (89%), Gaps = 0/183 (0%)
 Frame = -2

Query  726  WRKSEGYRVGWSDEILGFDCGGHQWVSETCFPAGTLSKPSMKDLEFIEQLMQLIEKESIP  547
            W+KSEGYR+GWSDEILGFDCGG QWVSETCFP GTL+KP+MKDL ++E+L+QLI+KE IP
Sbjct  447  WKKSEGYRMGWSDEILGFDCGGQQWVSETCFPTGTLAKPNMKDLYYMEELLQLIKKEDIP  506

Query  546  APAPIEQRWTACSKSLMSPAYSSVDDDIFSWVGIIMYLPTMDARERKHITEEFFHYRHLT  367
            APAPIEQRWTA S+S MSPA SS +DDIFSWVGIIMYLPT + R+RK ITEEFF+YR LT
Sbjct  507  APAPIEQRWTARSRSPMSPASSSEEDDIFSWVGIIMYLPTSNPRQRKDITEEFFNYRSLT  566

Query  366  QAHLWDHYSAYEHWAKIEVPKDKEELQALQARLRKKFPVDAYNRARQELDPNRILSNNML  187
            Q  LWD YSAYEHWAKIEVPKDK+EL  LQARLRK+FP+D YN+AR ELDPN++LS+  L
Sbjct  567  QTSLWDDYSAYEHWAKIEVPKDKDELAELQARLRKRFPIDVYNKARMELDPNKVLSSAKL  626

Query  186  EKL  178
            EKL
Sbjct  627  EKL  629



>ref|XP_002322641.1| L-GALACTONO-1 family protein [Populus trichocarpa]
 gb|EEF04402.1| L-GALACTONO-1 family protein [Populus trichocarpa]
Length=603

 Score =   305 bits (781),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 156/183 (85%), Positives = 169/183 (92%), Gaps = 0/183 (0%)
 Frame = -2

Query  726  WRKSEGYRVGWSDEILGFDCGGHQWVSETCFPAGTLSKPSMKDLEFIEQLMQLIEKESIP  547
            WRKSEGYRVGWSDEILGFDCGG QWVSE CFPAGTL+KPS+KDLEFIE+L QLIEKE IP
Sbjct  414  WRKSEGYRVGWSDEILGFDCGGQQWVSENCFPAGTLAKPSLKDLEFIEKLKQLIEKEEIP  473

Query  546  APAPIEQRWTACSKSLMSPAYSSVDDDIFSWVGIIMYLPTMDARERKHITEEFFHYRHLT  367
            APAPIEQRWTA S+S MSPA SS +DDIFSWVGIIMYLPTMDAR+RK ITEEFFHYRHLT
Sbjct  474  APAPIEQRWTARSQSSMSPASSSAEDDIFSWVGIIMYLPTMDARQRKEITEEFFHYRHLT  533

Query  366  QAHLWDHYSAYEHWAKIEVPKDKEELQALQARLRKKFPVDAYNRARQELDPNRILSNNML  187
            Q  LWD YSAYEHWAKIEVPKDK+EL AL+ RLR++FPVDAYN+AR+ELDPN+ILSNNML
Sbjct  534  QVELWDKYSAYEHWAKIEVPKDKDELAALRERLRRRFPVDAYNKARKELDPNKILSNNML  593

Query  186  EKL  178
            EKL
Sbjct  594  EKL  596



>gb|ACG75919.1| L-galactono-1,4-lactone dehydrogenase [Malpighia glabra]
Length=592

 Score =   303 bits (775),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 154/183 (84%), Positives = 167/183 (91%), Gaps = 0/183 (0%)
 Frame = -2

Query  726  WRKSEGYRVGWSDEILGFDCGGHQWVSETCFPAGTLSKPSMKDLEFIEQLMQLIEKESIP  547
            WRKSEGYRVGWSDEILGFDCGG QWVSETCFPAGTL+ PSM+DL++IE L QLIEKE IP
Sbjct  403  WRKSEGYRVGWSDEILGFDCGGQQWVSETCFPAGTLANPSMQDLDYIEDLKQLIEKEDIP  462

Query  546  APAPIEQRWTACSKSLMSPAYSSVDDDIFSWVGIIMYLPTMDARERKHITEEFFHYRHLT  367
            APAPIEQRWTA S+S MS A SS +DDIFSWVGIIMYLPTMDAR+RK ITEEFFHYRHLT
Sbjct  463  APAPIEQRWTARSQSSMSVASSSKEDDIFSWVGIIMYLPTMDARQRKEITEEFFHYRHLT  522

Query  366  QAHLWDHYSAYEHWAKIEVPKDKEELQALQARLRKKFPVDAYNRARQELDPNRILSNNML  187
            QA LWD YSAYEHWAKIEVPKDKEEL+AL  RL+K+FPVDAYN+AR+ELDPN+ILSNN L
Sbjct  523  QAELWDKYSAYEHWAKIEVPKDKEELEALLERLKKRFPVDAYNKARKELDPNKILSNNKL  582

Query  186  EKL  178
            EKL
Sbjct  583  EKL  585



>gb|EMS62931.1| L-galactono-1,4-lactone dehydrogenase 2, mitochondrial [Triticum 
urartu]
Length=838

 Score =   306 bits (785),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 143/183 (78%), Positives = 161/183 (88%), Gaps = 0/183 (0%)
 Frame = -2

Query  726  WRKSEGYRVGWSDEILGFDCGGHQWVSETCFPAGTLSKPSMKDLEFIEQLMQLIEKESIP  547
            W+KSEGYR+ WSDEILGFDCGG QWVSETCFP GTL+KP+MKDL ++E+L+QLIEKE IP
Sbjct  416  WKKSEGYRMCWSDEILGFDCGGQQWVSETCFPTGTLAKPNMKDLYYMEELLQLIEKEDIP  475

Query  546  APAPIEQRWTACSKSLMSPAYSSVDDDIFSWVGIIMYLPTMDARERKHITEEFFHYRHLT  367
            APAPIEQRWTA S+S MSPA SS +DDIFSWVGIIMYLPT D R+RK ITEEFF+YR LT
Sbjct  476  APAPIEQRWTARSRSPMSPASSSEEDDIFSWVGIIMYLPTSDPRQRKDITEEFFNYRSLT  535

Query  366  QAHLWDHYSAYEHWAKIEVPKDKEELQALQARLRKKFPVDAYNRARQELDPNRILSNNML  187
            Q  LWD YSAYEHWAKIEVPKDK+EL  LQARLRK+FPVDAYN+AR ELDPN++LS+  L
Sbjct  536  QTSLWDDYSAYEHWAKIEVPKDKDELAQLQARLRKRFPVDAYNKARMELDPNKVLSSAKL  595

Query  186  EKL  178
            EK 
Sbjct  596  EKF  598



>ref|XP_007203043.1| hypothetical protein PRUPE_ppa022778mg [Prunus persica]
 gb|EMJ04242.1| hypothetical protein PRUPE_ppa022778mg [Prunus persica]
Length=523

 Score =   291 bits (744),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 140/183 (77%), Positives = 152/183 (83%), Gaps = 10/183 (5%)
 Frame = -2

Query  726  WRKSEGYRVGWSDEILGFDCGGHQWVSETCFPAGTLSKPSMKDLEFIEQLMQLIEKESIP  547
            WRKSEGYRVGWSDEILGFDCGG Q V    F         +KDLE+IE + QLIEK  +P
Sbjct  344  WRKSEGYRVGWSDEILGFDCGG-QTVGFRNF---------LKDLEYIEDVKQLIEKNEVP  393

Query  546  APAPIEQRWTACSKSLMSPAYSSVDDDIFSWVGIIMYLPTMDARERKHITEEFFHYRHLT  367
            APAPIEQRWTAC+KS MSPA S+ DDDIFSWVGIIMYLPTM+AR+RK ITEEFFHYR LT
Sbjct  394  APAPIEQRWTACTKSPMSPASSTKDDDIFSWVGIIMYLPTMNARQRKEITEEFFHYRRLT  453

Query  366  QAHLWDHYSAYEHWAKIEVPKDKEELQALQARLRKKFPVDAYNRARQELDPNRILSNNML  187
            Q  LWD YSAYEHWAKIEVPKDKEEL +LQ RLRK FPVDAYN+AR+ELDP+RILSNN L
Sbjct  454  QVQLWDKYSAYEHWAKIEVPKDKEELASLQTRLRKGFPVDAYNKARKELDPSRILSNNKL  513

Query  186  EKL  178
            EKL
Sbjct  514  EKL  516



>ref|XP_010672973.1| PREDICTED: L-galactono-1,4-lactone dehydrogenase, mitochondrial 
[Beta vulgaris subsp. vulgaris]
Length=588

 Score =   290 bits (741),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 151/183 (83%), Positives = 164/183 (90%), Gaps = 0/183 (0%)
 Frame = -2

Query  726  WRKSEGYRVGWSDEILGFDCGGHQWVSETCFPAGTLSKPSMKDLEFIEQLMQLIEKESIP  547
            W KSEGYRVGWSDEILGFDCGG QWVSETCFPAGTL+KP+MKDLE+IE+L QLIEKE IP
Sbjct  399  WTKSEGYRVGWSDEILGFDCGGQQWVSETCFPAGTLAKPTMKDLEYIEKLKQLIEKERIP  458

Query  546  APAPIEQRWTACSKSLMSPAYSSVDDDIFSWVGIIMYLPTMDARERKHITEEFFHYRHLT  367
            APAPIEQRWTA SKS MSPA SS DDDIFSWVGIIMYLPTMD R+RK ITE+FFHYR LT
Sbjct  459  APAPIEQRWTARSKSPMSPASSSSDDDIFSWVGIIMYLPTMDPRQRKEITEKFFHYRFLT  518

Query  366  QAHLWDHYSAYEHWAKIEVPKDKEELQALQARLRKKFPVDAYNRARQELDPNRILSNNML  187
            Q  LWD YSAYEHWAKIE+PKDK+E   LQARL+K+FPVDAY +AR+ELDPN ILSNNM+
Sbjct  519  QTRLWDIYSAYEHWAKIEIPKDKDERIDLQARLKKRFPVDAYVKARKELDPNTILSNNMI  578

Query  186  EKL  178
            EKL
Sbjct  579  EKL  581



>ref|XP_006843351.1| hypothetical protein AMTR_s00053p00045580 [Amborella trichopoda]
 gb|ERN05026.1| hypothetical protein AMTR_s00053p00045580 [Amborella trichopoda]
Length=601

 Score =   276 bits (705),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 135/183 (74%), Positives = 155/183 (85%), Gaps = 0/183 (0%)
 Frame = -2

Query  726  WRKSEGYRVGWSDEILGFDCGGHQWVSETCFPAGTLSKPSMKDLEFIEQLMQLIEKESIP  547
            WRKSEG+RVGWSDEIL FDCGG QWVSE CFP GTL+KP+MKD+ ++E+L +LI+ E IP
Sbjct  413  WRKSEGFRVGWSDEILSFDCGGQQWVSEICFPVGTLAKPTMKDISYMEELNKLIKNEGIP  472

Query  546  APAPIEQRWTACSKSLMSPAYSSVDDDIFSWVGIIMYLPTMDARERKHITEEFFHYRHLT  367
            APAPIEQRWTA S SLMSPA SS + D+FSWVGIIMYLPT +AR+RK IT+ FF YR+LT
Sbjct  473  APAPIEQRWTARSTSLMSPASSSSESDVFSWVGIIMYLPTAEARQRKDITDAFFKYRYLT  532

Query  366  QAHLWDHYSAYEHWAKIEVPKDKEELQALQARLRKKFPVDAYNRARQELDPNRILSNNML  187
            Q  LWD YS+YEHWAKIEVP+DKEEL  LQ R+RK FPVD YN+  +ELDPNRILSN ML
Sbjct  533  QHELWDAYSSYEHWAKIEVPRDKEELAWLQGRIRKCFPVDLYNKTCRELDPNRILSNRML  592

Query  186  EKL  178
            EKL
Sbjct  593  EKL  595



>ref|XP_007203979.1| hypothetical protein PRUPE_ppa025367mg [Prunus persica]
 gb|EMJ05178.1| hypothetical protein PRUPE_ppa025367mg [Prunus persica]
Length=457

 Score =   263 bits (672),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 124/165 (75%), Positives = 132/165 (80%), Gaps = 16/165 (10%)
 Frame = -2

Query  726  WRKSEGYRVGWSDEILGFDCGGHQWVSETCFPAGTLSKPSMKDLEFIEQLMQLIEKESIP  547
            WRKSEGYRVGWSDEILGFDCGG QWVSETCFP GTLSKPS+KDLE+IE + QLIE   +P
Sbjct  309  WRKSEGYRVGWSDEILGFDCGGQQWVSETCFPVGTLSKPSLKDLEYIEDVKQLIETNEVP  368

Query  546  APAPIEQRWTACSKSLMSPAYSSVDDDIFSWVGIIMYLPTMDARERKHITEEFFHYRHLT  367
            APAPIEQRWTAC+KS MSPA S+ DDDIFSWVGIIMYLPT DAR                
Sbjct  369  APAPIEQRWTACTKSPMSPASSTKDDDIFSWVGIIMYLPTTDAR----------------  412

Query  366  QAHLWDHYSAYEHWAKIEVPKDKEELQALQARLRKKFPVDAYNRA  232
            Q  LWD YSAYEHWAKIEVPK KEEL +LQARLRK FPVDAYN+A
Sbjct  413  QVQLWDKYSAYEHWAKIEVPKGKEELASLQARLRKGFPVDAYNKA  457



>ref|XP_002307994.2| hypothetical protein POPTR_0006s04170g [Populus trichocarpa]
 gb|EEE91517.2| hypothetical protein POPTR_0006s04170g [Populus trichocarpa]
Length=295

 Score =   255 bits (651),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 130/173 (75%), Positives = 148/173 (86%), Gaps = 2/173 (1%)
 Frame = -2

Query  690  DEILGFD--CGGHQWVSETCFPAGTLSKPSMKDLEFIEQLMQLIEKESIPAPAPIEQRWT  517
            D++L  D     H W SETCFP G L+KPSMKDLEFIE+L QLIEKE +P PAP+EQRWT
Sbjct  88   DKLLAVDPLNKDHVWFSETCFPVGNLAKPSMKDLEFIEELKQLIEKEEMPPPAPMEQRWT  147

Query  516  ACSKSLMSPAYSSVDDDIFSWVGIIMYLPTMDARERKHITEEFFHYRHLTQAHLWDHYSA  337
            ACS+S MSPA SS +DDIFSWVGIIM+LPT  AR+RK IT+EFFHYRHLTQA LWD YSA
Sbjct  148  ACSQSSMSPASSSAEDDIFSWVGIIMHLPTTVARQRKEITDEFFHYRHLTQAELWDKYSA  207

Query  336  YEHWAKIEVPKDKEELQALQARLRKKFPVDAYNRARQELDPNRILSNNMLEKL  178
            Y+ WAKIEVPKDK+EL ALQARLRK+FPVDAYN+AR+ELDPNRILSNNML+ +
Sbjct  208  YKLWAKIEVPKDKDELAALQARLRKRFPVDAYNKARKELDPNRILSNNMLDPI  260



>ref|XP_001758906.1| predicted protein [Physcomitrella patens]
 gb|EDQ76412.1| predicted protein [Physcomitrella patens]
Length=647

 Score =   261 bits (667),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 116/183 (63%), Positives = 146/183 (80%), Gaps = 0/183 (0%)
 Frame = -2

Query  726  WRKSEGYRVGWSDEILGFDCGGHQWVSETCFPAGTLSKPSMKDLEFIEQLMQLIEKESIP  547
            W+KSEG RVGWSDEILGFDCGG QWVSETCFP GT+ KP M+DL+FIEQ+M LI+KE IP
Sbjct  452  WKKSEGIRVGWSDEILGFDCGGQQWVSETCFPTGTIQKPDMQDLKFIEQVMGLIKKEGIP  511

Query  546  APAPIEQRWTACSKSLMSPAYSSVDDDIFSWVGIIMYLPTMDARERKHITEEFFHYRHLT  367
            AP+PIEQRWTA S+S +SPA+    D+I+SWVGIIMYLPT D ++R+ IT+ FF YR  T
Sbjct  512  APSPIEQRWTARSRSPLSPAFDPSPDNIYSWVGIIMYLPTADEKQREAITQRFFEYRKST  571

Query  366  QAHLWDHYSAYEHWAKIEVPKDKEELQALQARLRKKFPVDAYNRARQELDPNRILSNNML  187
            Q  LWD Y A+EHWAKIEVP ++  L  ++ RLR ++P+D + +AR++LDP  IL N ++
Sbjct  572  QYLLWDSYGAHEHWAKIEVPTNENALAWVRERLRHRYPLDEFYKAREQLDPKNILVNGVV  631

Query  186  EKL  178
            EKL
Sbjct  632  EKL  634



>ref|XP_010922175.1| PREDICTED: L-galactono-1,4-lactone dehydrogenase 2, mitochondrial 
isoform X2 [Elaeis guineensis]
Length=570

 Score =   258 bits (660),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 118/138 (86%), Positives = 124/138 (90%), Gaps = 0/138 (0%)
 Frame = -2

Query  726  WRKSEGYRVGWSDEILGFDCGGHQWVSETCFPAGTLSKPSMKDLEFIEQLMQLIEKESIP  547
            WRKSEGYR+GWSDEILGFDCGG QWVSE CFPAGTL KPSMKDL++IE+LMQLI+ E IP
Sbjct  426  WRKSEGYRIGWSDEILGFDCGGQQWVSEICFPAGTLPKPSMKDLDYIEELMQLIQSEKIP  485

Query  546  APAPIEQRWTACSKSLMSPAYSSVDDDIFSWVGIIMYLPTMDARERKHITEEFFHYRHLT  367
            APAPIEQRWTA SKSLMSPA SS  DDIFSWVGIIMYLPTMDAR+RK ITEEFF YRHLT
Sbjct  486  APAPIEQRWTARSKSLMSPASSSGQDDIFSWVGIIMYLPTMDARQRKEITEEFFSYRHLT  545

Query  366  QAHLWDHYSAYEHWAKIE  313
            Q  LWD YSAYEHWAKIE
Sbjct  546  QTRLWDEYSAYEHWAKIE  563



>gb|AJC01346.1| L-galactono-1-4-lactone dehydrogenase, partial [Myrciaria dubia]
Length=309

 Score =   248 bits (632),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 114/137 (83%), Positives = 123/137 (90%), Gaps = 0/137 (0%)
 Frame = -2

Query  726  WRKSEGYRVGWSDEILGFDCGGHQWVSETCFPAGTLSKPSMKDLEFIEQLMQLIEKESIP  547
            W+KSEGYRVGWSDEILGFDCGG QWVSETC+PAGTLSKPSMKD+E+IE+L QLIEKE IP
Sbjct  171  WKKSEGYRVGWSDEILGFDCGGQQWVSETCYPAGTLSKPSMKDIEYIEELKQLIEKEHIP  230

Query  546  APAPIEQRWTACSKSLMSPAYSSVDDDIFSWVGIIMYLPTMDARERKHITEEFFHYRHLT  367
            APAPIEQRWTA SKS MSPA S  +DDIFSWVGIIMYLPT DAR+RK ITEEFFHYR LT
Sbjct  231  APAPIEQRWTARSKSPMSPASSPAEDDIFSWVGIIMYLPTSDARQRKEITEEFFHYRRLT  290

Query  366  QAHLWDHYSAYEHWAKI  316
            Q  LWD YSAYEHWA++
Sbjct  291  QEWLWDRYSAYEHWARL  307



>gb|ACJ38538.1| mitochondrial galactono-1,4-lactone dehydrogenase [Oncidium hybrid 
cultivar]
Length=544

 Score =   248 bits (633),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 111/143 (78%), Positives = 126/143 (88%), Gaps = 0/143 (0%)
 Frame = -2

Query  726  WRKSEGYRVGWSDEILGFDCGGHQWVSETCFPAGTLSKPSMKDLEFIEQLMQLIEKESIP  547
            W+KSEGY+VGWSDEILGFDCGG QWVSE CFP GTL  PSM DLEF+E+L +LIE+E++P
Sbjct  395  WKKSEGYQVGWSDEILGFDCGGQQWVSEICFPVGTLVSPSMADLEFMEELKKLIERENVP  454

Query  546  APAPIEQRWTACSKSLMSPAYSSVDDDIFSWVGIIMYLPTMDARERKHITEEFFHYRHLT  367
            APAP+EQRWTA S+SLMSPA SS +DDIFSWVGIIMYLPTMDAR+RK ITEEFF YR L 
Sbjct  455  APAPLEQRWTARSRSLMSPASSSQEDDIFSWVGIIMYLPTMDARQRKEITEEFFLYRDLV  514

Query  366  QAHLWDHYSAYEHWAKIEVPKDK  298
            Q+ LWD YSAYEHWAKIEVP+ +
Sbjct  515  QSRLWDKYSAYEHWAKIEVPRTR  537



>ref|NP_001236372.1| uncharacterized protein LOC100526948 [Glycine max]
 gb|ACU15982.1| unknown [Glycine max]
Length=150

 Score =   234 bits (598),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 121/143 (85%), Positives = 131/143 (92%), Gaps = 0/143 (0%)
 Frame = -2

Query  606  MKDLEFIEQLMQLIEKESIPAPAPIEQRWTACSKSLMSPAYSSVDDDIFSWVGIIMYLPT  427
            MKDLE+IE+L QLIEKE IPAPAPIEQRWTA S+S +SPA S  +DDIFSWVGIIMYLPT
Sbjct  1    MKDLEYIEELKQLIEKEEIPAPAPIEQRWTASSRSSLSPASSPSEDDIFSWVGIIMYLPT  60

Query  426  MDARERKHITEEFFHYRHLTQAHLWDHYSAYEHWAKIEVPKDKEELQALQARLRKKFPVD  247
            MDAR+RK ITEEFFHYRHLTQA LWD YSAYEHWAKIEVPKDK+EL ALQ RLRK+FPVD
Sbjct  61   MDARQRKDITEEFFHYRHLTQAKLWDCYSAYEHWAKIEVPKDKKELAALQERLRKRFPVD  120

Query  246  AYNRARQELDPNRILSNNMLEKL  178
            AYN+AR+ELDPNRILSNNMLEKL
Sbjct  121  AYNKARKELDPNRILSNNMLEKL  143



>gb|KJB46251.1| hypothetical protein B456_007G353900 [Gossypium raimondii]
Length=576

 Score =   244 bits (622),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 118/139 (85%), Positives = 127/139 (91%), Gaps = 0/139 (0%)
 Frame = -2

Query  726  WRKSEGYRVGWSDEILGFDCGGHQWVSETCFPAGTLSKPSMKDLEFIEQLMQLIEKESIP  547
            WRKSEGYRVGWSD+ILGFDCGG QWVSETCFPAGTLSKPSMKDLE+IE+L +LIE   +P
Sbjct  413  WRKSEGYRVGWSDDILGFDCGGQQWVSETCFPAGTLSKPSMKDLEYIEELKKLIETNELP  472

Query  546  APAPIEQRWTACSKSLMSPAYSSVDDDIFSWVGIIMYLPTMDARERKHITEEFFHYRHLT  367
            APAPIEQRWTA S+S MSPA SS +DDIFSWVGIIMYLPTMDAR+RK ITEEFFHYRHLT
Sbjct  473  APAPIEQRWTARSQSPMSPASSSAEDDIFSWVGIIMYLPTMDARQRKEITEEFFHYRHLT  532

Query  366  QAHLWDHYSAYEHWAKIEV  310
            Q+ LWD YSAYEHWAKIEV
Sbjct  533  QSQLWDKYSAYEHWAKIEV  551



>emb|CAN78536.1| hypothetical protein VITISV_039856 [Vitis vinifera]
Length=550

 Score =   241 bits (615),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 119/139 (86%), Positives = 125/139 (90%), Gaps = 0/139 (0%)
 Frame = -2

Query  726  WRKSEGYRVGWSDEILGFDCGGHQWVSETCFPAGTLSKPSMKDLEFIEQLMQLIEKESIP  547
            WRKSEGYRVGWSDEILGFDCGG QWVSETCFPAGTL+KPSMKDLE+IE L +LIEKE IP
Sbjct  408  WRKSEGYRVGWSDEILGFDCGGQQWVSETCFPAGTLAKPSMKDLEYIEDLKKLIEKEEIP  467

Query  546  APAPIEQRWTACSKSLMSPAYSSVDDDIFSWVGIIMYLPTMDARERKHITEEFFHYRHLT  367
            APAPIEQRWT  SKS MSPA SS +DDIFSWVGIIMYLPTMDAR+RK ITEEFFHYR L+
Sbjct  468  APAPIEQRWTQSSKSPMSPASSSAEDDIFSWVGIIMYLPTMDARQRKEITEEFFHYRRLS  527

Query  366  QAHLWDHYSAYEHWAKIEV  310
            Q  LWD YSAYEHWAKIEV
Sbjct  528  QTQLWDLYSAYEHWAKIEV  546



>gb|KHN28852.1| L-galactono-1,4-lactone dehydrogenase, mitochondrial [Glycine 
soja]
Length=798

 Score =   236 bits (603),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 121/161 (75%), Positives = 131/161 (81%), Gaps = 3/161 (2%)
 Frame = -2

Query  726  WRKSEGYRVGWSDEILGFDCGGHQWVSETCFPAGTLSKPSMKDLEFIEQLMQLIEKESIP  547
            WRKSEGYRVGWSDEILGFDCGG QWVSE CFPAG L+ PSMKDLE+IE+L  LIEKE IP
Sbjct  375  WRKSEGYRVGWSDEILGFDCGGQQWVSEACFPAGKLANPSMKDLEYIEELKLLIEKEDIP  434

Query  546  APAPIEQRWTACSKSLMSPAYSSVDDDIFSWVGIIMYLPTMDARERKHITEEFFHYRHLT  367
            APAPIEQRWTA S+S +SPA S   DDIFSWVGIIMYLPTMD R+RK ITEEFFHYRHLT
Sbjct  435  APAPIEQRWTASSRSSLSPASSPSGDDIFSWVGIIMYLPTMDGRQRKDITEEFFHYRHLT  494

Query  366  QAHLWDHYSAYEHWAKIEVPKDK---EELQALQARLRKKFP  253
            QA LWD YSAYEHWAKIE  + K   +E  A+   L  K+P
Sbjct  495  QAKLWDRYSAYEHWAKIEGGRIKFWEDEWIAVGGVLAAKYP  535



>ref|XP_002973111.1| hypothetical protein SELMODRAFT_98882 [Selaginella moellendorffii]
 gb|EFJ25485.1| hypothetical protein SELMODRAFT_98882 [Selaginella moellendorffii]
Length=648

 Score =   224 bits (572),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 108/184 (59%), Positives = 139/184 (76%), Gaps = 1/184 (1%)
 Frame = -2

Query  726  WRKSEGYRVGWSDEILGFDCGGHQWVSETCFPAGTLSKPSMKDLEFIEQLMQLIEKESIP  547
            WR++ GYRVGWS EIL FDCGG QWVSE CFPAGT+ +P M D++F+E+L++LI K +IP
Sbjct  455  WRRNTGYRVGWSHEILSFDCGGQQWVSEVCFPAGTVDEPDMSDIKFMEELLELIRKRNIP  514

Query  546  APAPIEQRWTACSKSLMSPAYSSVDDDIFSWVGIIMYLPTMDARERKHITEEFFHYRHLT  367
            AP PIEQRWT+ S+S MSPA     D +FSWVGIIMYLPT D  +R+ ITE FF YR   
Sbjct  515  APGPIEQRWTSSSRSSMSPASDPSPDRLFSWVGIIMYLPTEDPAQRQAITESFFDYRGAV  574

Query  366  QAHLWDHYSAYEHWAKIEVPK-DKEELQALQARLRKKFPVDAYNRARQELDPNRILSNNM  190
            Q +LWD Y AYEHWAK+EV   +KEE +  + RL+K+FPVD++ +A+ E+DP  I +N +
Sbjct  575  QKNLWDPYGAYEHWAKVEVRDINKEEAEWSRERLKKRFPVDSFVKAQIEIDPRGIFTNEL  634

Query  189  LEKL  178
            +E L
Sbjct  635  IETL  638



>ref|XP_002976749.1| hypothetical protein SELMODRAFT_105274 [Selaginella moellendorffii]
 gb|EFJ22418.1| hypothetical protein SELMODRAFT_105274 [Selaginella moellendorffii]
Length=649

 Score =   224 bits (572),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 108/184 (59%), Positives = 139/184 (76%), Gaps = 1/184 (1%)
 Frame = -2

Query  726  WRKSEGYRVGWSDEILGFDCGGHQWVSETCFPAGTLSKPSMKDLEFIEQLMQLIEKESIP  547
            WR++ GYRVGWS EIL FDCGG QWVSE CFPAGT+ +P M D++F+E+L++LI K +IP
Sbjct  456  WRRNTGYRVGWSHEILSFDCGGQQWVSEVCFPAGTVDEPDMSDIKFMEELLELIRKRNIP  515

Query  546  APAPIEQRWTACSKSLMSPAYSSVDDDIFSWVGIIMYLPTMDARERKHITEEFFHYRHLT  367
            AP PIEQRWT+ S+S MSPA     D +FSWVGIIMYLPT D  +R+ ITE FF YR   
Sbjct  516  APGPIEQRWTSSSRSSMSPASDPSPDRLFSWVGIIMYLPTEDPAQRQAITESFFDYRGAV  575

Query  366  QAHLWDHYSAYEHWAKIEVPK-DKEELQALQARLRKKFPVDAYNRARQELDPNRILSNNM  190
            Q +LWD Y AYEHWAK+EV   +KEE +  + RL+K+FPVD++ +A+ E+DP  I +N +
Sbjct  576  QKNLWDPYGAYEHWAKVEVRDINKEEAEWSRERLKKRFPVDSFVKAQIEIDPRGIFTNEL  635

Query  189  LEKL  178
            +E L
Sbjct  636  IETL  639



>ref|XP_005843316.1| hypothetical protein CHLNCDRAFT_28225 [Chlorella variabilis]
 gb|EFN51214.1| hypothetical protein CHLNCDRAFT_28225 [Chlorella variabilis]
Length=513

 Score =   219 bits (559),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 98/183 (54%), Positives = 128/183 (70%), Gaps = 1/183 (1%)
 Frame = -2

Query  726  WRKSEGYRVGWSDEILGFDCGGHQWVSETCFPAGTLSKPSMKDLEFIEQLMQLIEKESIP  547
            WR+ EG RVGWSDE+LGFDCGG QWV ET FPAGTL KP  +D+ ++E L++L+   S+P
Sbjct  323  WRRCEGMRVGWSDELLGFDCGGQQWVLETAFPAGTLDKPDGRDIAYMEDLLRLVAARSVP  382

Query  546  APAPIEQRWTACSKSLMSPAYSSVDDDIFSWVGIIMYLPTMDARERKHITEEFFHYRHLT  367
            APAPIEQRWTA S + MSPA+      + SWVG+IMYL  +   +R+ +T+ F  Y  L 
Sbjct  383  APAPIEQRWTAGSSAAMSPAHGP-PGSLHSWVGVIMYLAELAPEQRQAVTDSFRQYAQLV  441

Query  366  QAHLWDHYSAYEHWAKIEVPKDKEELQALQARLRKKFPVDAYNRARQELDPNRILSNNML  187
            +  L   Y A EHWAKIEVP D  +L+ +Q RL +++PV A+N ARQ LDPN IL + M+
Sbjct  442  ERELMPKYGAVEHWAKIEVPSDPAQLEVVQQRLAQRYPVAAFNAARQRLDPNDILGSPMM  501

Query  186  EKL  178
            + L
Sbjct  502  DAL  504



>gb|ACV71025.1| L-galactono-1,4-lactone dehydrogenase [Agropyron cristatum]
Length=121

 Score =   206 bits (524),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 95/121 (79%), Positives = 106/121 (88%), Gaps = 0/121 (0%)
 Frame = -2

Query  702  VGWSDEILGFDCGGHQWVSETCFPAGTLSKPSMKDLEFIEQLMQLIEKESIPAPAPIEQR  523
            +GWSDEILGFDCGG QWVSETCFP GTL+KP+MKDL ++E+L+QLIEKE IPAPAPIEQR
Sbjct  1    MGWSDEILGFDCGGQQWVSETCFPTGTLAKPNMKDLYYMEELLQLIEKEDIPAPAPIEQR  60

Query  522  WTACSKSLMSPAYSSVDDDIFSWVGIIMYLPTMDARERKHITEEFFHYRHLTQAHLWDHY  343
            WTA S+S MSPA SS +DDIFSWVGIIMYLPT D R+RK ITEEFF+YR LTQ  LWD Y
Sbjct  61   WTARSRSPMSPASSSEEDDIFSWVGIIMYLPTSDPRQRKDITEEFFNYRSLTQTSLWDDY  120

Query  342  S  340
            S
Sbjct  121  S  121



>emb|CBJ29466.1| L-galactono-1,4-lactone dehydrogenase [Ectocarpus siliculosus]
Length=576

 Score =   219 bits (558),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 96/182 (53%), Positives = 130/182 (71%), Gaps = 1/182 (1%)
 Frame = -2

Query  726  WRKSEGYRVGWSDEILGFDCGGHQWVSETCFPAGTLSKPSMKDLEFIEQLMQLIEKESIP  547
            WR+S+G RV +SD+ILGF+CGG QWV+E  FP GTL +P+ KDL+++++LM+LIE+E IP
Sbjct  388  WRRSQGTRVDYSDKILGFECGGQQWVNEVSFPVGTLEEPNGKDLDYMDELMRLIEREGIP  447

Query  546  APAPIEQRWTACSKSLMSPAYSSVD-DDIFSWVGIIMYLPTMDARERKHITEEFFHYRHL  370
            APAPIEQRWT+ S + +SPA+     + +FSWVG+IMYLP  D   RK +TE FF YR L
Sbjct  448  APAPIEQRWTSSSNATLSPAHDGASPETVFSWVGVIMYLPADDVDARKRVTEAFFAYRDL  507

Query  369  TQAHLWDHYSAYEHWAKIEVPKDKEELQALQARLRKKFPVDAYNRARQELDPNRILSNNM  190
             +  LWD Y    HWAKIE P+   E +  +ARL ++FPV A+N  R  LDP  I++N+ 
Sbjct  508  CKVRLWDRYDCAVHWAKIEKPRTAREAEDTRARLGRRFPVGAFNSVRALLDPKNIMANDH  567

Query  189  LE  184
            + 
Sbjct  568  IN  569



>ref|XP_004995806.1| galactonolactone dehydrogenase [Salpingoeca rosetta]
 gb|EGD82570.1| galactonolactone dehydrogenase [Salpingoeca rosetta]
Length=585

 Score =   213 bits (543),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 103/190 (54%), Positives = 129/190 (68%), Gaps = 7/190 (4%)
 Frame = -2

Query  726  WRKSEGY-RVGWSDEILGFDCGGHQWVSETCFPAGTLSKPSMKDLEFIEQLMQLIEKESI  550
            WR+++G   VG+SDE+LGF+CGG QWV+E CFPAGTL  P M D+ F+  L+ LIE   +
Sbjct  379  WRRNQGITSVGYSDEVLGFECGGQQWVNEVCFPAGTLQAPDMADMAFMADLLALIEDNHV  438

Query  549  PAPAPIEQRWTACSKSLMS---PAYSSV---DDDIFSWVGIIMYLPTMDARERKHITEEF  388
            PAPAPIEQRWT  S S MS   P    V   +D I +W GIIMYL T D RER+ IT+ F
Sbjct  439  PAPAPIEQRWTRTSTSAMSVGGPGPGRVPAHEDGIHAWAGIIMYLCTADTREREAITQAF  498

Query  387  FHYRHLTQAHLWDHYSAYEHWAKIEVPKDKEELQALQARLRKKFPVDAYNRARQELDPNR  208
            F YR L   +L   Y AY HWAK+EVP D  EL+ L+AR+R++FPVD +N  R+ LDP  
Sbjct  499  FKYRQLVADNLDAKYDAYVHWAKLEVPTDPAELRELRARMRERFPVDRFNHFRRRLDPRG  558

Query  207  ILSNNMLEKL  178
            +LSN  + KL
Sbjct  559  VLSNTFIAKL  568



>ref|XP_011401503.1| L-galactono-1,4-lactone dehydrogenase 2, mitochondrial [Auxenochlorella 
protothecoides]
 gb|KFM28484.1| L-galactono-1,4-lactone dehydrogenase 2, mitochondrial [Auxenochlorella 
protothecoides]
Length=554

 Score =   211 bits (538),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 102/189 (54%), Positives = 125/189 (66%), Gaps = 7/189 (4%)
 Frame = -2

Query  726  WRKSEGYRVGWSDEILGFDCGGHQWVSETCFPAGTLSKPSMKDLEFIEQLMQLIEKESIP  547
            WR S G+RVGWSDE+LGFDCGG Q VSE CF  GT + P+  DL +   L+ L+E+E +P
Sbjct  343  WRGSAGHRVGWSDEVLGFDCGGQQCVSEACFATGTRAAPAGADLAYARDLLALVEREGLP  402

Query  546  APAPIEQRWTACSKSLMSPAYSSVDDDIFSWVGIIMYLPT---MDA---RERKHITEEFF  385
            APAPIEQRWTA S S MSPA      D+FSWVGII YLP     DA   R R  + + F 
Sbjct  403  APAPIEQRWTAGSASAMSPARGGA-ADLFSWVGIIQYLPVPEDGDAEGERRRDAVVQSFK  461

Query  384  HYRHLTQAHLWDHYSAYEHWAKIEVPKDKEELQALQARLRKKFPVDAYNRARQELDPNRI  205
             YR L    L+D Y A EHWAK+E P+D  EL+AL+ RL ++FPV A+  AR+ LDP  I
Sbjct  462  RYRTLVSEALFDKYDAVEHWAKVEPPEDAAELEALRQRLGRRFPVAAFQAARRRLDPKNI  521

Query  204  LSNNMLEKL  178
            LSN+ +  L
Sbjct  522  LSNDWVNAL  530



>ref|XP_005644279.1| L-galactono-1,4-lactone dehydrogenase-like protein [Coccomyxa 
subellipsoidea C-169]
 gb|EIE19735.1| L-galactono-1,4-lactone dehydrogenase-like protein [Coccomyxa 
subellipsoidea C-169]
Length=512

 Score =   202 bits (514),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 108/185 (58%), Positives = 131/185 (71%), Gaps = 5/185 (3%)
 Frame = -2

Query  726  WRKSEGYRVGWSDEILGFDCGGHQWVSETCFPAGTLSKPSMKDLEFIEQLMQLIEKESIP  547
            W++SEGYRVGWSDEILGFDCGG QWV E  FP GTL KPS  DL F++ LMQ IE+  IP
Sbjct  306  WKRSEGYRVGWSDEILGFDCGGEQWVLEVAFPTGTLKKPSHADLNFMKDLMQQIEENGIP  365

Query  546  APAPIEQRWTACSKSLMSPAYS-SVDDDIFSWVGIIMYLPTMDARERKHITEEFFHYRHL  370
            A +PIEQRWTA S S MSPA +    D + SWVGIIMYLPT +  +RK IT+ FF Y  L
Sbjct  366  AASPIEQRWTASSSSPMSPAAARGQPDTVHSWVGIIMYLPTEEEAQRKAITDRFFEYCKL  425

Query  369  TQAHLWDHYSAYEHWAKIEVPK-DKEELQALQARLRKKFPVDAYNRARQELDPNRILSNN  193
             +  L   Y A EHWAKIEVP  DK   QA + R+  ++PVD +N AR+ELDP  IL+N+
Sbjct  426  VEQKLVPKYDATEHWAKIEVPYLDK---QAARERIAGRYPVDKFNAARRELDPKNILAND  482

Query  192  MLEKL  178
            +++ L
Sbjct  483  IIDTL  487



>ref|XP_005535453.1| L-Galactono-1,4-lactone dehydrogenase [Cyanidioschyzon merolae 
strain 10D]
 dbj|BAM79167.1| L-Galactono-1,4-lactone dehydrogenase [Cyanidioschyzon merolae 
strain 10D]
Length=556

 Score =   201 bits (511),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 100/196 (51%), Positives = 134/196 (68%), Gaps = 17/196 (9%)
 Frame = -2

Query  726  WRKSEGYRVGWSDEILGFDCGGHQWVSETCFPAGTLSKPSMKDLEFIEQLMQLIEKESIP  547
            W++SEG R+ WSD ILGFDCGGHQWVSE  F A    +   +DLE++ +L++LI+   IP
Sbjct  346  WKRSEGIRIDWSDRILGFDCGGHQWVSEVAFHAPLGQR---RDLEYMTKLLRLIQDHQIP  402

Query  546  APAPIEQRWTACSKSLMSPAYSS-----VDDDIFSWVGIIMYLPTMDARERKHITEEFFH  382
            APAPIEQRWT+ S SLMSP Y        D D++SWVGIIMYLPT D   R+ IT EF+ 
Sbjct  403  APAPIEQRWTSGSGSLMSPVYRGPDTLPPDQDVYSWVGIIMYLPTDDEAARQSITREFWR  462

Query  381  YRHLTQAHLWDHYSAYEHWAKIEVPK-----DKEELQA---LQARLRKKFPVDAYNRARQ  226
            YRHL  A LW+ Y A EHWAKIE+P       ++ L+    +  R+R+K+P+D + RA +
Sbjct  463  YRHLC-AKLWEAYDAAEHWAKIEIPSPSYMGSEDALRYKNFILKRVREKYPLDNFGRAHR  521

Query  225  ELDPNRILSNNMLEKL  178
             LDPNRI++N  ++++
Sbjct  522  MLDPNRIMTNAFIDEV  537



>ref|XP_002999106.1| L-gulonolactone oxidase, putative [Phytophthora infestans T30-4]
 gb|EEY69252.1| L-gulonolactone oxidase, putative [Phytophthora infestans T30-4]
Length=448

 Score =   187 bits (475),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 91/184 (49%), Positives = 131/184 (71%), Gaps = 8/184 (4%)
 Frame = -2

Query  726  WRKSEGYRVGWSDEILGFDCGGHQWVSETCFPA-GTLSKPSMKDLEFIEQLMQLIEKESI  550
            W+ SEGYRV +SD+I+GFDCGG Q V E  FP  GTL      DL+F+E+L++ I++E I
Sbjct  270  WKLSEGYRVAYSDDIIGFDCGGQQLVEEVSFPTTGTL------DLDFMEKLLKRIDEEDI  323

Query  549  PAPAPIEQRWTACSKSLMSPAYSSVDDDIFSWVGIIMYLPTMDARERKHITEEFFHYRHL  370
            PA +PIEQRW+A S SLMSPA +S  D IFSWVG+I+YLPT + + R  I + F  +  +
Sbjct  324  PAHSPIEQRWSARSTSLMSPASASNPDQIFSWVGVILYLPTAEKKVRTAIKDRFMEFYAM  383

Query  369  TQAHLWDHYSAYEHWAKIEVPKDKEELQALQARLRKKFPVDAYNRARQELDPNRILSNNM  190
             +  + + Y A EHWAKIE P+D  E + ++ RL K++P+D + +AR ELDP+ ILSN++
Sbjct  384  YRDFM-EPYGATEHWAKIEWPQDAAERKKMRERLNKRYPLDKFKKARDELDPHHILSNHI  442

Query  189  LEKL  178
            ++++
Sbjct  443  VDEM  446



>gb|ACR38105.1| unknown [Zea mays]
Length=117

 Score =   172 bits (437),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 82/107 (77%), Positives = 93/107 (87%), Gaps = 1/107 (1%)
 Frame = -2

Query  498  MSPAYSSVDDDIFSWVGIIMYLPTMDARERKHITEEFFHYRHLTQAHLWDHYSAYEHWAK  319
            MSPA SS +DD+FSWVGIIMYLPT DAR+RK ITEEFF YR L ++ LWD YSAYEHWAK
Sbjct  1    MSPASSSEEDDVFSWVGIIMYLPTSDARQRKEITEEFFSYRSLARS-LWDDYSAYEHWAK  59

Query  318  IEVPKDKEELQALQARLRKKFPVDAYNRARQELDPNRILSNNMLEKL  178
            IEVPKDK+EL  LQARLRK+FPVDAYN+AR ELDPN++LSN  LEK+
Sbjct  60   IEVPKDKDELAELQARLRKRFPVDAYNKARMELDPNKVLSNAKLEKM  106



>gb|KIY97008.1| hypothetical protein MNEG_10953 [Monoraphidium neglectum]
Length=467

 Score =   182 bits (462),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 95/199 (48%), Positives = 118/199 (59%), Gaps = 16/199 (8%)
 Frame = -2

Query  726  WRKSEGYRVGWSDEILGFDCGGHQWVSETCFPAGTLSKPSM------KDLEFIEQLMQLI  565
            WR+S G RVG +DEILGFDCGG QWV E  FP G LS+         KD+ +++ L++ I
Sbjct  251  WRRSAGTRVGLADEILGFDCGGQQWVLEVAFPVGRLSRIGGWGAGPPKDISYMKDLLEEI  310

Query  564  EKESIPAPAPIEQRWTACSKSLMSPAYSSVD---DDIFSWVGIIMYLPTMDARERKHITE  394
             +  I AP PIEQRWTA S S MSPA ++     D++ SWVG+IMYLPT D  +R  IT 
Sbjct  311  RRSEIAAPCPIEQRWTAASSSPMSPAAATPGGGADEVHSWVGVIMYLPTDDESQRAKITA  370

Query  393  EFFHYRHLTQAHLWDHYSAYEHWAKIEVPKDKEE-------LQALQARLRKKFPVDAYNR  235
             F  Y  L +  L   Y A  HWAKIE P D  +       L  +QA L  +FP+D  N 
Sbjct  371  AFKRYAALVEDRLMPRYGASWHWAKIEPPTDGGDAAAAAARLAHMQAALAARFPLDELNA  430

Query  234  ARQELDPNRILSNNMLEKL  178
            AR  LDP  IL+NNM + L
Sbjct  431  ARARLDPKNILANNMFDTL  449



>ref|XP_003607624.1| Mitochondrial L-galactono-1 4-lactone dehydrogenase [Medicago 
truncatula]
Length=101

 Score =   171 bits (432),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 79/93 (85%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = -2

Query  456  WVGIIMYLPTMDARERKHITEEFFHYRHLTQAHLWDHYSAYEHWAKIEVPKDKEELQALQ  277
            +VGIIMYLPTMDAR+RK ITEEFFHYRHLTQA LWD+YSAYEHWAKIEVPK+K+EL ALQ
Sbjct  2    FVGIIMYLPTMDARQRKDITEEFFHYRHLTQAKLWDNYSAYEHWAKIEVPKNKDELIALQ  61

Query  276  ARLRKKFPVDAYNRARQELDPNRILSNNMLEKL  178
            ARLRK+FPVDAYN+AR ELDPN++LSNN LEKL
Sbjct  62   ARLRKRFPVDAYNKARNELDPNKVLSNNKLEKL  94



>emb|CEF97592.1| FAD linked oxidase, N-terminal [Ostreococcus tauri]
Length=579

 Score =   183 bits (464),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 94/190 (49%), Positives = 120/190 (63%), Gaps = 8/190 (4%)
 Frame = -2

Query  726  WRKSEGYRVGWSDEILGFDCGGHQWVSETCFPAGTLSK-------PSMKDLEFIEQLMQL  568
            W++S G RV WSD+ILGFDCGG Q V E  FPAG L++       P   DL+F+ +L ++
Sbjct  389  WKRSAGTRVDWSDQILGFDCGGQQHVLEVAFPAGNLAEEPPAAGAPLRSDLQFMRELRKM  448

Query  567  IEKESIPAPAPIEQRWTACSKSLMSPAYSSVDDDIFSWVGIIMYLPTMDARERKHITEEF  388
            IE + IPA APIEQRWT+ S S MSPA +   D + SWVGIIMYLPT D +ER  IT  F
Sbjct  449  IEDDEIPAHAPIEQRWTSGSSSPMSPA-AGAPDSLHSWVGIIMYLPTADEKERDAITRAF  507

Query  387  FHYRHLTQAHLWDHYSAYEHWAKIEVPKDKEELQALQARLRKKFPVDAYNRARQELDPNR  208
              Y       L D Y+   HWAKIEVP+D   L   +ARLR+ +PV  +N AR+ LDP+ 
Sbjct  508  RAYGEKEFDALGDAYALRAHWAKIEVPEDPARLARDKARLREHYPVKEFNAARRYLDPHG  567

Query  207  ILSNNMLEKL  178
              +N ++  L
Sbjct  568  AFTNALVAAL  577



>ref|XP_008892069.1| galactonolactone dehydrogenase [Phytophthora parasitica INRA-310]
 gb|ETN22845.1| galactonolactone dehydrogenase [Phytophthora parasitica INRA-310]
Length=560

 Score =   182 bits (462),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 89/184 (48%), Positives = 131/184 (71%), Gaps = 8/184 (4%)
 Frame = -2

Query  726  WRKSEGYRVGWSDEILGFDCGGHQWVSETCFP-AGTLSKPSMKDLEFIEQLMQLIEKESI  550
            W+ SEGYRV +SD+I+GFDCGG Q V E  FP AGTL      +L+F+E+L++ I++E I
Sbjct  382  WKLSEGYRVAYSDDIIGFDCGGQQLVEEVSFPTAGTL------ELDFMEKLLKRIDEEDI  435

Query  549  PAPAPIEQRWTACSKSLMSPAYSSVDDDIFSWVGIIMYLPTMDARERKHITEEFFHYRHL  370
            PA +PIEQRW+A S SLMSPA S   D IFSWVG+I+YLPT + + R  I + F  +  +
Sbjct  436  PAHSPIEQRWSARSNSLMSPASSPNPDQIFSWVGVILYLPTAEKKIRTAIKDRFMEFYAM  495

Query  369  TQAHLWDHYSAYEHWAKIEVPKDKEELQALQARLRKKFPVDAYNRARQELDPNRILSNNM  190
             +  + + + A EHWAKIE P+D  E + ++ RL K++P++ + +AR ELDP+ ILSN++
Sbjct  496  YRDFM-EPFGATEHWAKIEWPEDAAERKKIRDRLNKRYPLNKFKKARDELDPHHILSNHI  554

Query  189  LEKL  178
            ++++
Sbjct  555  VDEM  558



>gb|ETL43034.1| galactonolactone dehydrogenase [Phytophthora parasitica]
 gb|ETP47460.1| galactonolactone dehydrogenase [Phytophthora parasitica P10297]
Length=560

 Score =   182 bits (462),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 89/184 (48%), Positives = 131/184 (71%), Gaps = 8/184 (4%)
 Frame = -2

Query  726  WRKSEGYRVGWSDEILGFDCGGHQWVSETCFP-AGTLSKPSMKDLEFIEQLMQLIEKESI  550
            W+ SEGYRV +SD+I+GFDCGG Q V E  FP AGTL      +L+F+E+L++ I++E I
Sbjct  382  WKLSEGYRVAYSDDIIGFDCGGQQLVEEVSFPTAGTL------ELDFMEKLLKRIDEEDI  435

Query  549  PAPAPIEQRWTACSKSLMSPAYSSVDDDIFSWVGIIMYLPTMDARERKHITEEFFHYRHL  370
            PA +PIEQRW+A S SLMSPA S   D IFSWVG+I+YLPT + + R  I + F  +  +
Sbjct  436  PAHSPIEQRWSARSNSLMSPASSPNPDQIFSWVGVILYLPTAEKKIRTAIKDRFMEFYAM  495

Query  369  TQAHLWDHYSAYEHWAKIEVPKDKEELQALQARLRKKFPVDAYNRARQELDPNRILSNNM  190
             +  + + + A EHWAKIE P+D  E + ++ RL K++P++ + +AR ELDP+ ILSN++
Sbjct  496  YRDFM-EPFGATEHWAKIEWPEDAAERKKIRDRLNKRYPLNKFKKARDELDPHHILSNHI  554

Query  189  LEKL  178
            ++++
Sbjct  555  VDEM  558



>gb|ETL96210.1| galactonolactone dehydrogenase [Phytophthora parasitica]
Length=560

 Score =   182 bits (462),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 89/184 (48%), Positives = 131/184 (71%), Gaps = 8/184 (4%)
 Frame = -2

Query  726  WRKSEGYRVGWSDEILGFDCGGHQWVSETCFP-AGTLSKPSMKDLEFIEQLMQLIEKESI  550
            W+ SEGYRV +SD+I+GFDCGG Q V E  FP AGTL      +L+F+E+L++ I++E I
Sbjct  382  WKLSEGYRVAYSDDIIGFDCGGQQLVEEVSFPTAGTL------ELDFMEKLLKRIDEEDI  435

Query  549  PAPAPIEQRWTACSKSLMSPAYSSVDDDIFSWVGIIMYLPTMDARERKHITEEFFHYRHL  370
            PA +PIEQRW+A S SLMSPA S   D IFSWVG+I+YLPT + + R  I + F  +  +
Sbjct  436  PAHSPIEQRWSARSNSLMSPASSPNPDQIFSWVGVILYLPTAEKKIRTAIKDRFMEFYAM  495

Query  369  TQAHLWDHYSAYEHWAKIEVPKDKEELQALQARLRKKFPVDAYNRARQELDPNRILSNNM  190
             +  + + + A EHWAKIE P+D  E + ++ RL K++P++ + +AR ELDP+ ILSN++
Sbjct  496  YRDFM-EPFGATEHWAKIEWPEDAAERKKIRDRLNKRYPLNKFKKARDELDPHHILSNHI  554

Query  189  LEKL  178
            ++++
Sbjct  555  VDEM  558



>ref|XP_009519067.1| hypothetical protein PHYSODRAFT_485337 [Phytophthora sojae]
 gb|EGZ23779.1| hypothetical protein PHYSODRAFT_485337 [Phytophthora sojae]
Length=448

 Score =   179 bits (455),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 88/184 (48%), Positives = 128/184 (70%), Gaps = 8/184 (4%)
 Frame = -2

Query  726  WRKSEGYRVGWSDEILGFDCGGHQWVSETCFP-AGTLSKPSMKDLEFIEQLMQLIEKESI  550
            W+ SEGYRV +SD+I+GFDCGG Q V E  FP  G+L      +L+F+E+L++ I+ E I
Sbjct  270  WKLSEGYRVAYSDDIIGFDCGGQQLVEEVSFPCTGSL------ELDFMEKLLKRIDAEDI  323

Query  549  PAPAPIEQRWTACSKSLMSPAYSSVDDDIFSWVGIIMYLPTMDARERKHITEEFFHYRHL  370
            PA +PIEQRWTA S SLMSPA S   + IFSWVG+I+YLPT + + R  I   F  +  +
Sbjct  324  PAHSPIEQRWTARSTSLMSPASSPNPEQIFSWVGVILYLPTAEKKVRTAIRNRFMDFYAM  383

Query  369  TQAHLWDHYSAYEHWAKIEVPKDKEELQALQARLRKKFPVDAYNRARQELDPNRILSNNM  190
             +  + + Y A EHWAKIE P D  E + ++ RL+K++P+D + +AR E+DP+ ILSN++
Sbjct  384  YRDFM-EPYGATEHWAKIEWPADAAERKQIRDRLKKRYPLDKFKKARDEVDPHHILSNHI  442

Query  189  LEKL  178
            ++++
Sbjct  443  VDEM  446



>gb|ETI49748.1| galactonolactone dehydrogenase [Phytophthora parasitica P1569]
 gb|ETM49380.1| galactonolactone dehydrogenase [Phytophthora parasitica]
 gb|ETO78462.1| galactonolactone dehydrogenase [Phytophthora parasitica P1976]
Length=560

 Score =   181 bits (459),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 86/183 (47%), Positives = 128/183 (70%), Gaps = 6/183 (3%)
 Frame = -2

Query  726  WRKSEGYRVGWSDEILGFDCGGHQWVSETCFPAGTLSKPSMKDLEFIEQLMQLIEKESIP  547
            W+ SEGYRV +SD+I+GFDCGG Q V E  FP G        +L+F+E+L++ I++E IP
Sbjct  382  WKLSEGYRVAYSDDIIGFDCGGQQLVEEVSFPTG-----GTLELDFMEKLLKRIDEEDIP  436

Query  546  APAPIEQRWTACSKSLMSPAYSSVDDDIFSWVGIIMYLPTMDARERKHITEEFFHYRHLT  367
            A +PIEQRW+A S SLMSPA S   D IFSWVG+I+YLPT + + R  I + F  +  + 
Sbjct  437  AHSPIEQRWSARSNSLMSPASSPNPDQIFSWVGVILYLPTAEKKIRTAIKDRFMEFYAMY  496

Query  366  QAHLWDHYSAYEHWAKIEVPKDKEELQALQARLRKKFPVDAYNRARQELDPNRILSNNML  187
            +  + + + A EHWAKIE P+D  E + ++ RL K++P++ + +AR ELDP+ ILSN+++
Sbjct  497  RDFM-EPFGATEHWAKIEWPEDAAERKKIRDRLNKRYPLNKFKKARDELDPHHILSNHIV  555

Query  186  EKL  178
            +++
Sbjct  556  DEM  558



>gb|ETK89633.1| galactonolactone dehydrogenase [Phytophthora parasitica]
 gb|ETP19519.1| galactonolactone dehydrogenase [Phytophthora parasitica CJ01A1]
Length=560

 Score =   181 bits (459),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 86/183 (47%), Positives = 128/183 (70%), Gaps = 6/183 (3%)
 Frame = -2

Query  726  WRKSEGYRVGWSDEILGFDCGGHQWVSETCFPAGTLSKPSMKDLEFIEQLMQLIEKESIP  547
            W+ SEGYRV +SD+I+GFDCGG Q V E  FP G        +L+F+E+L++ I++E IP
Sbjct  382  WKLSEGYRVAYSDDIIGFDCGGQQLVEEVSFPTG-----GTLELDFMEKLLKRIDEEDIP  436

Query  546  APAPIEQRWTACSKSLMSPAYSSVDDDIFSWVGIIMYLPTMDARERKHITEEFFHYRHLT  367
            A +PIEQRW+A S SLMSPA S   D IFSWVG+I+YLPT + + R  I + F  +  + 
Sbjct  437  AHSPIEQRWSARSNSLMSPASSPNPDQIFSWVGVILYLPTAEKKIRTAIKDRFMEFYAMY  496

Query  366  QAHLWDHYSAYEHWAKIEVPKDKEELQALQARLRKKFPVDAYNRARQELDPNRILSNNML  187
            +  + + + A EHWAKIE P+D  E + ++ RL K++P++ + +AR ELDP+ ILSN+++
Sbjct  497  RDFM-EPFGATEHWAKIEWPEDAAERKKIRDRLNKRYPLNKFKKARDELDPHHILSNHIV  555

Query  186  EKL  178
            +++
Sbjct  556  DEM  558



>ref|XP_009039767.1| hypothetical protein AURANDRAFT_70295 [Aureococcus anophagefferens]
 gb|EGB05639.1| hypothetical protein AURANDRAFT_70295 [Aureococcus anophagefferens]
Length=533

 Score =   181 bits (458),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 93/186 (50%), Positives = 118/186 (63%), Gaps = 3/186 (2%)
 Frame = -2

Query  726  WRKSEGYRVGWSDEILGFDCGGHQWVSETCFPAGTLSKPSMKDLEFIEQLMQLIEKESIP  547
            WR+S+G  V  S   L F+CGG QWV+E CFPAG+LS+PS  D+ ++  L+ LIE+E IP
Sbjct  343  WRRSQGTDVADSSRKLNFECGGQQWVNECCFPAGSLSQPSGADVRYMLDLLDLIEREEIP  402

Query  546  APAPIEQRWTACSKSLMSPAYSSV---DDDIFSWVGIIMYLPTMDARERKHITEEFFHYR  376
            APAPIEQRWT+ S+SL+SPA S     DD IFSWVG+IMYLPT +  +R  IT  F  Y+
Sbjct  403  APAPIEQRWTSGSRSLLSPASSKAPLPDDAIFSWVGVIMYLPTDEPTQRAAITAAFDGYK  462

Query  375  HLTQAHLWDHYSAYEHWAKIEVPKDKEELQALQARLRKKFPVDAYNRARQELDPNRILSN  196
               +  LW  Y A EHWAKIE P D +      ARL  KF    +   R   DP+ ILS 
Sbjct  463  KHCERSLWPAYGAVEHWAKIEEPADADAAATAVARLAAKFDTAKFAALRDVYDPDNILST  522

Query  195  NMLEKL  178
             +L+ +
Sbjct  523  PLLDAV  528



>ref|XP_005788723.1| mitochondrial L-galactono-1,4-lactone dehydrogenase [Emiliania 
huxleyi CCMP1516]
 gb|EOD36294.1| mitochondrial L-galactono-1,4-lactone dehydrogenase [Emiliania 
huxleyi CCMP1516]
Length=577

 Score =   179 bits (455),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 93/181 (51%), Positives = 121/181 (67%), Gaps = 5/181 (3%)
 Frame = -2

Query  705  RVGWSDEILGFDCGGHQWVSETCFPAGTL-----SKPSMKDLEFIEQLMQLIEKESIPAP  541
            RV WSD ILGF+CGG QWVSE   P G       ++   +DL+++  L+ LIE   IPAP
Sbjct  392  RVDWSDRILGFECGGQQWVSEVALPCGARGSRRSAESCRRDLQYMTDLLALIEASDIPAP  451

Query  540  APIEQRWTACSKSLMSPAYSSVDDDIFSWVGIIMYLPTMDARERKHITEEFFHYRHLTQA  361
            +PIEQRW+  S S MSPA+S+ +DD+ SWVGIIMYLP      R+ IT+ F+ Y  + + 
Sbjct  452  SPIEQRWSRRSASPMSPAHSAGEDDLHSWVGIIMYLPIDRPEARQAITDAFWDYNAVCRR  511

Query  360  HLWDHYSAYEHWAKIEVPKDKEELQALQARLRKKFPVDAYNRARQELDPNRILSNNMLEK  181
             LW  Y A++HWAKIE P D  E  A++ RLR +FPVD +N AR+ELDP  ILSN +L+ 
Sbjct  512  QLWPKYDAHQHWAKIEPPADAAERAAVRRRLRDRFPVDEFNAARRELDPKNILSNRLLDA  571

Query  180  L  178
            L
Sbjct  572  L  572



>ref|XP_005710519.1| unnamed protein product [Chondrus crispus]
 emb|CDF40225.1| unnamed protein product [Chondrus crispus]
Length=605

 Score =   178 bits (451),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 90/188 (48%), Positives = 120/188 (64%), Gaps = 6/188 (3%)
 Frame = -2

Query  726  WRKSEGYRVGWSDEILGFDCGGHQWVSETCFPAGTLSKPSMKDLEFIEQLMQLIEKESIP  547
            W++SEG RV WSD IL FDCGG QWVSE  FPA + +     D++F++ L++LIEKE IP
Sbjct  401  WKRSEGTRVDWSDRILQFDCGGQQWVSEVAFPAPS-NDAKNSDVQFVQDLLELIEKEGIP  459

Query  546  APAPIEQRWTACSKSLMSPAYSSVDD---DIFSWVGIIMYLP--TMDARERKHITEEFFH  382
            APAPIEQRW+A S S MSPA         DI+SWVGIIMYLP  ++    R+ IT  F  
Sbjct  460  APAPIEQRWSAPSHSPMSPAGEKPPKELADIYSWVGIIMYLPDASLGNETRERITGAFKE  519

Query  381  YRHLTQAHLWDHYSAYEHWAKIEVPKDKEELQALQARLRKKFPVDAYNRARQELDPNRIL  202
            Y+ L +  LW + SA EHWAK+E+P  +E    L+ R   K+P +A+       DP+ IL
Sbjct  520  YKSLCEERLWKNASAVEHWAKVELPDTEEGKTRLRTRTFHKYPTEAFKAICAIFDPHGIL  579

Query  201  SNNMLEKL  178
             N +++ +
Sbjct  580  RNELMDTI  587



>emb|CCA18080.1| Lgulonolactone oxidase putative [Albugo laibachii Nc14]
Length=516

 Score =   175 bits (444),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 80/183 (44%), Positives = 125/183 (68%), Gaps = 6/183 (3%)
 Frame = -2

Query  726  WRKSEGYRVGWSDEILGFDCGGHQWVSETCFPAGTLSKPSMKDLEFIEQLMQLIEKESIP  547
            W+  EGYR+G SD+I+GFDCGG Q V E  FP        M+D++ +  L+Q I++ +IP
Sbjct  337  WKLGEGYRIGLSDDIIGFDCGGQQLVQEFAFPVN-----DMEDIDCVVNLLQEIDRANIP  391

Query  546  APAPIEQRWTACSKSLMSPAYSSVDDDIFSWVGIIMYLPTMDARERKHITEEFFHYRHLT  367
            +PAPIEQRW+A S S MSPA S   + ++ W+G IMYLP+ +   R  IT++F  Y  + 
Sbjct  392  SPAPIEQRWSARSTSTMSPASSPDPNQVYCWLGTIMYLPSSERNVRDSITKQFEDYNDVV  451

Query  366  QAHLWDHYSAYEHWAKIEVPKDKEELQALQARLRKKFPVDAYNRARQELDPNRILSNNML  187
            ++ + + Y+ +EHWAK+E PKD+E+ + +Q R++K++P++++ +AR  LDP  ILSN  +
Sbjct  452  RS-VMNRYNGFEHWAKLEWPKDEEDRRKVQKRIQKRYPLESFRQARDVLDPKHILSNEFI  510

Query  186  EKL  178
            + L
Sbjct  511  DLL  513



>ref|XP_006421269.1| hypothetical protein CICLE_v100046031mg, partial [Citrus clementina]
 gb|ESR34509.1| hypothetical protein CICLE_v100046031mg, partial [Citrus clementina]
Length=506

 Score =   174 bits (442),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 78/91 (86%), Positives = 85/91 (93%), Gaps = 0/91 (0%)
 Frame = -2

Query  726  WRKSEGYRVGWSDEILGFDCGGHQWVSETCFPAGTLSKPSMKDLEFIEQLMQLIEKESIP  547
            WRKSEGYRVGW+DEILGFDCGG QWVSETCFP+GTL+K SMKDLE+IE+L QLIEKE IP
Sbjct  416  WRKSEGYRVGWADEILGFDCGGQQWVSETCFPSGTLAKLSMKDLEYIEELKQLIEKEDIP  475

Query  546  APAPIEQRWTACSKSLMSPAYSSVDDDIFSW  454
            APAPIEQRWTA S+S+MSPAYSSV DDIFSW
Sbjct  476  APAPIEQRWTARSQSVMSPAYSSVQDDIFSW  506



>ref|XP_001748157.1| hypothetical protein [Monosiga brevicollis MX1]
 gb|EDQ86918.1| predicted protein [Monosiga brevicollis MX1]
Length=1193

 Score =   178 bits (451),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 93/185 (50%), Positives = 126/185 (68%), Gaps = 4/185 (2%)
 Frame = -2

Query  726   WRKSEGYR-VGWSDEILGFDCGGHQWVSETCFPAGTLSKPSMKDLEFIEQLMQLIEKESI  550
             WR+S+G   +G SD ILGF+CGG QWV+E C PAGTL +P+  DL F+E+++ LIE  ++
Sbjct  1007  WRRSQGVTDIGASDRILGFECGGQQWVNEVCLPAGTLDQPTGHDLAFVERILALIEDHNV  1066

Query  549   PAPAPIEQRWTACSKSLMSPAYSSVDDD-IFSWVGIIMYLPTMDARERKHITEEFFHYRH  373
              AP PIEQRWT+ S S +S A+   +   + SWVGIIMYL   D  +R  IT  F  YR 
Sbjct  1067  AAPCPIEQRWTSASASTLSHAHGDENGPALASWVGIIMYLCRED--QRPAITAAFHAYRA  1124

Query  372   LTQAHLWDHYSAYEHWAKIEVPKDKEELQALQARLRKKFPVDAYNRARQELDPNRILSNN  193
             L +A L D + A+ HWAK+E+P +   L  L+ARLR +F VDA+NRAR +LDP+ +LSN+
Sbjct  1125  LVEASLDDEFDAFVHWAKLEIPSEAAALARLRARLRARFDVDAFNRARHKLDPHGVLSND  1184

Query  192   MLEKL  178
              +  L
Sbjct  1185  FIRAL  1189



>ref|XP_003078802.1| mitochondrial L-galactono-1,4-lactone dehydrogenase (ISS) [Ostreococcus 
tauri]
Length=917

 Score =   176 bits (445),  Expect = 3e-46, Method: Composition-based stats.
 Identities = 91/177 (51%), Positives = 111/177 (63%), Gaps = 8/177 (5%)
 Frame = -2

Query  726  WRKSEGYRVGWSDEILGFDCGGHQWVSETCFPAGTLSK-------PSMKDLEFIEQLMQL  568
            W++S G RV WSD+ILGFDCGG Q V E  FPAG L++       P   DL+F+ +L ++
Sbjct  389  WKRSAGTRVDWSDQILGFDCGGQQHVLEVAFPAGNLAEEPPAAGAPLRSDLQFMRELRKM  448

Query  567  IEKESIPAPAPIEQRWTACSKSLMSPAYSSVDDDIFSWVGIIMYLPTMDARERKHITEEF  388
            IE + IPA APIEQRWT+ S S MSPA +   D + SWVGIIMYLPT D +ER  IT  F
Sbjct  449  IEDDEIPAHAPIEQRWTSGSSSPMSPA-AGAPDSLHSWVGIIMYLPTADEKERDAITRAF  507

Query  387  FHYRHLTQAHLWDHYSAYEHWAKIEVPKDKEELQALQARLRKKFPVDAYNRARQELD  217
              Y       L D Y+   HWAKIEVP+D   L   +ARLR   PV  +N AR+ LD
Sbjct  508  RAYGEKEFDALGDAYALRAHWAKIEVPEDPARLARDKARLRGALPVKEFNAARRYLD  564



>ref|XP_002501872.1| galactonolactone dehydrogenase [Micromonas sp. RCC299]
 gb|ACO63130.1| galactonolactone dehydrogenase [Micromonas sp. RCC299]
Length=692

 Score =   172 bits (437),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 85/189 (45%), Positives = 118/189 (62%), Gaps = 6/189 (3%)
 Frame = -2

Query  726  WRKSEGYRVGWSDEILGFDCGGHQWVSETCFPAGT-LSKPSMKDLEFIEQLMQLIEKESI  550
            WR++ G R  WSD+ILGFDCGG Q V E  F  G  +   +  DL ++++L+ +IE+E I
Sbjct  445  WRRNAGTRCDWSDQILGFDCGGEQHVYEVAFRTGDDVDSNTGADLAYMKELLAMIEREGI  504

Query  549  PAPAPIEQRWTACSKSLMSPAYSSVDD----DIFSWVGIIMYLPTMDARERKHITEEFFH  382
            PAPAPIEQRW+A SKS +SPA +   D     + SW+GIIMYLP+ D   R  ITE F  
Sbjct  505  PAPAPIEQRWSAGSKSPLSPATNDGHDPSKPGLHSWIGIIMYLPSPDPSSRAAITEAFKS  564

Query  381  YRHLTQAHLWDHYSAYEHWAKIEVPKDKEELQALQARLRKKFP-VDAYNRARQELDPNRI  205
            Y    +A L D Y    HWAKIE+P+  EE +  + R+  ++P  D + + R ELDP  +
Sbjct  565  YAKKEEAALGDKYGIRTHWAKIELPEGDEERKEARRRIESRYPGADRFRKIRAELDPKGV  624

Query  204  LSNNMLEKL  178
            + N+++E L
Sbjct  625  MGNDLIEGL  633



>gb|EWM25741.1| l-galactono- -lactone dehydrogenase [Nannochloropsis gaditana]
Length=687

 Score =   172 bits (436),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 90/212 (42%), Positives = 123/212 (58%), Gaps = 28/212 (13%)
 Frame = -2

Query  732  RXWRKSEGYRVGWSDEILGFDCGGHQWVSETCFPAGTLS---------------------  616
            R W +S+GYR G S EILGFDCGG QWV E  FP G L                      
Sbjct  470  RFWEQSQGYRRGPSTEILGFDCGGQQWVLEVAFPIGPLPALESVDTGKGGRRRWFSLGQE  529

Query  615  -----KPSMKDLEFIEQLMQLIEKESIPAPAPIEQRWTACSKSLMSPAYSSVDDDIFSWV  451
                 + +  DL+F+++L +LI ++++PAP PIEQRWTA S + MSPAYSS  + +FSWV
Sbjct  530  KRRMPEAATPDLDFVDRLRRLIREKNLPAPCPIEQRWTASSTAPMSPAYSSDRNAVFSWV  589

Query  450  GIIMYLPTMDARERK-HITEEFFHYRHLTQAHLWDHYSAYEHWAKIEVPKDKEELQALQA  274
            G+IMYLP     ER+  I   F  Y    +  L + + A+ HWAKIEVP++    + L+A
Sbjct  590  GVIMYLPPGQEPERREEIGTAFREYVEAMEP-LCEEFEAFPHWAKIEVPEEAGRRERLKA  648

Query  273  RLRKKFPVDAYNRARQELDPNRILSNNMLEKL  178
            RL K++PV A+N  R+  DP  +L N  ++ L
Sbjct  649  RLAKRYPVPAFNYVRKGFDPKGVLGNKTVDVL  680



>ref|XP_005854870.1| L-galactono-1,4-lactone dehydrogenase, partial [Nannochloropsis 
gaditana CCMP526]
 gb|EKU21491.1| L-galactono-1,4-lactone dehydrogenase, partial [Nannochloropsis 
gaditana CCMP526]
Length=645

 Score =   171 bits (432),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 89/212 (42%), Positives = 123/212 (58%), Gaps = 28/212 (13%)
 Frame = -2

Query  732  RXWRKSEGYRVGWSDEILGFDCGGHQWVSETCFPAGTLS---------------------  616
            R W +S+GYR G S EILGFDCGG QWV E  FP G L                      
Sbjct  428  RFWEQSQGYRRGPSTEILGFDCGGQQWVLEVAFPIGPLPALESVDTGKGGRRRWFSLGQE  487

Query  615  -----KPSMKDLEFIEQLMQLIEKESIPAPAPIEQRWTACSKSLMSPAYSSVDDDIFSWV  451
                 + +  DL+F+++L +LI ++++PAP PIEQRWTA S + MSPAYSS  + +FSWV
Sbjct  488  KRRMPEAATPDLDFVDRLRRLIREKNLPAPCPIEQRWTASSTAPMSPAYSSDRNAVFSWV  547

Query  450  GIIMYLPTMDARERK-HITEEFFHYRHLTQAHLWDHYSAYEHWAKIEVPKDKEELQALQA  274
            G+I+YLP     ER+  I   F  Y    +  L + + A+ HWAKIEVP++    + L+A
Sbjct  548  GVIIYLPPGQEPERREEIGTAFREYVEAMEP-LCEEFEAFPHWAKIEVPEEAGRRERLKA  606

Query  273  RLRKKFPVDAYNRARQELDPNRILSNNMLEKL  178
            RL K++PV A+N  R+  DP  +L N  ++ L
Sbjct  607  RLAKRYPVPAFNYVRKGFDPKGVLGNKTVDVL  638



>gb|AAZ32884.1| L-galactono-1,4-lactone dehydrogenase-like protein [Medicago 
sativa]
Length=198

 Score =   158 bits (400),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 77/97 (79%), Positives = 85/97 (88%), Gaps = 0/97 (0%)
 Frame = -2

Query  726  WRKSEGYRVGWSDEILGFDCGGHQWVSETCFPAGTLSKPSMKDLEFIEQLMQLIEKESIP  547
            W+KSEGYRVGWSDEILGFDCGG QWVSETCFPAG L+ PSMKDLE+IE+L +LIEKE IP
Sbjct  102  WKKSEGYRVGWSDEILGFDCGGQQWVSETCFPAGKLATPSMKDLEYIEELKKLIEKEEIP  161

Query  546  APAPIEQRWTACSKSLMSPAYSSVDDDIFSWVGIIMY  436
            APAPIEQRWT+ ++S MSPA S   DDIFSW GIIMY
Sbjct  162  APAPIEQRWTSSTRSPMSPASSPSQDDIFSWGGIIMY  198



>ref|XP_009840799.1| galactonolactone dehydrogenase [Aphanomyces astaci]
 gb|ETV69785.1| galactonolactone dehydrogenase [Aphanomyces astaci]
Length=552

 Score =   166 bits (420),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 88/186 (47%), Positives = 122/186 (66%), Gaps = 9/186 (5%)
 Frame = -2

Query  726  WRKSEGYRVGWSDEILGFDCGGHQWVSETCFPAGTLSKPSMKDLEFIEQLMQLIEKESIP  547
            WR+S+G RV  SD+++GFDCGG Q VSE  FP   +S  S  DL+F+E L+  I+ + +P
Sbjct  371  WRRSQGTRVALSDDVVGFDCGGQQLVSEVAFP---MSNGSSTDLDFMEALLARIQADHVP  427

Query  546  APAPIEQRWTACSKSLMSPAYSSVDDDIFSWVGIIMYLPTMDARERKHITEEFF-HYRHL  370
            A  PIEQRWTA S++ +SPA+S+ D  +FSWVGII+YL   DA + +  T+ +F  Y  L
Sbjct  428  AHTPIEQRWTARSRAALSPAHSAEDATLFSWVGIILYL--QDADDTRAATQAYFAEYSKL  485

Query  369  TQAHLWDHYSAYEHWAKIEV-PKDKEELQALQARLRKKFPV-DAYNRARQELDPNRILSN  196
             +  +   Y A EHWAK+EV  K KEE++AL+ RL  +FP   A+   R E DPN +LSN
Sbjct  486  LE-DVMAPYGATEHWAKLEVQSKSKEEIEALRTRLSARFPAWKAFKTLRDEWDPNHVLSN  544

Query  195  NMLEKL  178
              ++ L
Sbjct  545  EFVDVL  550



>emb|CCI11057.1| unnamed protein product [Albugo candida]
Length=565

 Score =   165 bits (418),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 82/185 (44%), Positives = 124/185 (67%), Gaps = 6/185 (3%)
 Frame = -2

Query  732  RXWRKSEGYRVGWSDEILGFDCGGHQWVSETCFPAGTLSKPSMKDLEFIEQLMQLIEKES  553
            + W+  EGYR+G SD I+ FDCGG Q V E  FP        M D++ + +++Q +++ +
Sbjct  384  KFWKLGEGYRIGLSDNIISFDCGGQQLVHEIAFPVY-----DMNDIDCVAEILQEVDRAN  438

Query  552  IPAPAPIEQRWTACSKSLMSPAYSSVDDDIFSWVGIIMYLPTMDARERKHITEEFFHYRH  373
            IP PAPIEQRW+A S S MSPA SS  + +F W+G IMYLPT +   RK IT++F  Y  
Sbjct  439  IPCPAPIEQRWSARSTSSMSPASSSDPNQVFCWIGTIMYLPTSEINSRKAITKQFGEYNE  498

Query  372  LTQAHLWDHYSAYEHWAKIEVPKDKEELQALQARLRKKFPVDAYNRARQELDPNRILSNN  193
            + + ++ D Y+ +EHWAK+E P+D+E+ + LQ + R ++P+D++ +AR  LDP  ILSN 
Sbjct  499  IVR-NVKDRYNGFEHWAKLEWPEDEEKRRKLQEKFRARYPLDSFRKARDTLDPKHILSNE  557

Query  192  MLEKL  178
             +++L
Sbjct  558  FVDRL  562



>gb|KDO30670.1| galactonolactone dehydrogenase [Saprolegnia parasitica CBS 223.65]
Length=541

 Score =   164 bits (416),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 88/188 (47%), Positives = 118/188 (63%), Gaps = 16/188 (9%)
 Frame = -2

Query  726  WRKSEGYRVGWSDEILGFDCGGHQWVSETCFPAGTLSKPSMKDLEFIEQLMQLIEKESIP  547
            W KS+G RV  SD+++GFDCGG Q VSE  FP+   S     DL F+E L+  IE++ IP
Sbjct  360  WEKSQGSRVALSDDVIGFDCGGQQLVSEVAFPSANGS-----DLTFMEDLLARIERDQIP  414

Query  546  APAPIEQRWTACSKSLMSPAYSSVDDDIFSWVGIIMYL----PTMDARERKHITEEFFHY  379
            A  PIEQRWTA S++ MSPA S + + +FSWVGII YL    P++DA     I + F  Y
Sbjct  415  AHTPIEQRWTASSRAAMSPASSPLQEQVFSWVGIIYYLHEASPSLDA-----IKDAFVDY  469

Query  378  RHLTQAHLWDHYSAYEHWAKIE-VPKDKEELQALQARLRKKFPVDAYNRARQELDPNRIL  202
              L +  +   Y A EHWAK+E  P+   E   L+ RLR +FP++AY   R E DP+ IL
Sbjct  470  SKLFE-DVMAPYGAAEHWAKLEFAPRSALERHVLKDRLRSRFPLEAYRTLRNEWDPHHIL  528

Query  201  SNNMLEKL  178
            SN+ +++L
Sbjct  529  SNDFVDEL  536



>ref|XP_008607943.1| galactonolactone dehydrogenase [Saprolegnia diclina VS20]
 gb|EQC38351.1| galactonolactone dehydrogenase [Saprolegnia diclina VS20]
Length=541

 Score =   162 bits (410),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 87/188 (46%), Positives = 118/188 (63%), Gaps = 16/188 (9%)
 Frame = -2

Query  726  WRKSEGYRVGWSDEILGFDCGGHQWVSETCFPAGTLSKPSMKDLEFIEQLMQLIEKESIP  547
            W KS+G RV  SD+++GFDCGG Q VSE  FP+   S     DL F+E L+  IE++ IP
Sbjct  360  WEKSQGSRVALSDDVIGFDCGGQQLVSEVAFPSADGS-----DLTFMEDLLARIERDQIP  414

Query  546  APAPIEQRWTACSKSLMSPAYSSVDDDIFSWVGIIMYL----PTMDARERKHITEEFFHY  379
            A  PIEQRWTA S+++MSPA S + + +FSWVGII YL    P++DA     I + F  Y
Sbjct  415  AHTPIEQRWTASSRAVMSPASSPLHNQVFSWVGIIYYLHEASPSLDA-----IKDAFVDY  469

Query  378  RHLTQAHLWDHYSAYEHWAKIE-VPKDKEELQALQARLRKKFPVDAYNRARQELDPNRIL  202
              + +  +   Y A EHWAK+E  P+   E   L+ RLR +FP+ AY   R E DP+ IL
Sbjct  470  SKVFE-DVMAPYGATEHWAKLEFAPRSVLERHVLKDRLRSRFPLHAYRALRNEWDPHHIL  528

Query  201  SNNMLEKL  178
            SN+ +++L
Sbjct  529  SNDFVDEL  536



>gb|KEH15833.1| D-arabinono-1,4-lactone oxidase family protein, partial [Medicago 
truncatula]
Length=151

 Score =   152 bits (383),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 74/92 (80%), Positives = 81/92 (88%), Gaps = 0/92 (0%)
 Frame = -2

Query  726  WRKSEGYRVGWSDEILGFDCGGHQWVSETCFPAGTLSKPSMKDLEFIEQLMQLIEKESIP  547
            W+KSEGYRVGWSDEILGFDCGG QWVSETCFPAG L+ PSMKDLE+IE+L +LIEKE IP
Sbjct  59   WKKSEGYRVGWSDEILGFDCGGQQWVSETCFPAGKLATPSMKDLEYIEELKKLIEKEEIP  118

Query  546  APAPIEQRWTACSKSLMSPAYSSVDDDIFSWV  451
            APAPIEQRWTA ++S MSPA S   DDIFSWV
Sbjct  119  APAPIEQRWTASTRSPMSPASSPSQDDIFSWV  150



>ref|XP_002184261.1| L-galactono-1,4-lactone dehydrogenase [Phaeodactylum tricornutum 
CCAP 1055/1]
 gb|EEC44439.1| L-galactono-1,4-lactone dehydrogenase [Phaeodactylum tricornutum 
CCAP 1055/1]
Length=572

 Score =   160 bits (406),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 88/180 (49%), Positives = 115/180 (64%), Gaps = 1/180 (1%)
 Frame = -2

Query  726  WRKSEGYRVGWSDEILGFDCGGHQWVSETCFPAGTLSKPSMKDLEFIEQLMQLIEKESIP  547
            W++SEGY+V  SDE+L FDCGG QWV E CFP GT  K S  D++F+ +L+  IE+E IP
Sbjct  384  WKRSEGYQVRPSDELLQFDCGGQQWVWEVCFPTGTQEKSSGNDMDFMTELLAGIEREEIP  443

Query  546  APAPIEQRWTACSKSLMSPAYSSVDDDIFSWVGIIMYLPTMDARERKHITEEFFHYRHLT  367
            A +PIEQRW+A S SLMSPAY    D + SWVGII YLP+ D  +R+ I+E F       
Sbjct  444  AHSPIEQRWSASSSSLMSPAYGP-KDGLHSWVGIINYLPSEDEGQRRDISELFTGRYCNL  502

Query  366  QAHLWDHYSAYEHWAKIEVPKDKEELQALQARLRKKFPVDAYNRARQELDPNRILSNNML  187
              ++    SA  HWAK+E PK   +L   Q  L+ +FP+  +N AR   DP  IL N++L
Sbjct  503  MRNVGQAVSATSHWAKLERPKSMWQLVDTQLFLQTRFPLRLFNEARDIYDPKNILGNDLL  562



>ref|XP_001417255.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
 gb|ABO95548.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
Length=483

 Score =   157 bits (397),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 88/190 (46%), Positives = 111/190 (58%), Gaps = 8/190 (4%)
 Frame = -2

Query  726  WRKSEGYRVGWSDEILGFDCGGHQWVSETCFPAGTLSK-------PSMKDLEFIEQLMQL  568
            W++S G RV WSD+ILGFDCGG Q V E  FPAG L         P   DL F+  L +L
Sbjct  294  WKRSTGTRVDWSDQILGFDCGGQQHVLEVAFPAGELESTPPASDAPLRADLRFMRDLRRL  353

Query  567  IEKESIPAPAPIEQRWTACSKSLMSPAYSSVDDDIFSWVGIIMYLPTMDARERKHITEEF  388
            I +  IPA APIEQRWT+ S S MS   +   + + SWVGIIMYLPT    ER+ IT  F
Sbjct  354  IVENQIPAHAPIEQRWTSGSSSPMS-PSAGSPNSLHSWVGIIMYLPTTVEAEREAITNAF  412

Query  387  FHYRHLTQAHLWDHYSAYEHWAKIEVPKDKEELQALQARLRKKFPVDAYNRARQELDPNR  208
              Y +     L D Y    HWAKIEVP+D   L   + +LR+ +PV  +N AR+ LDP  
Sbjct  413  TEYGYKEFDALGDKYELRTHWAKIEVPEDIRRLDKTRTKLREHYPVKEFNAARKYLDPYG  472

Query  207  ILSNNMLEKL  178
            + +N ++  L
Sbjct  473  VFTNGIIASL  482



>ref|XP_008657110.1| PREDICTED: L-galactono-1,4-lactone dehydrogenase 1, mitochondrial-like 
[Zea mays]
Length=104

 Score =   146 bits (369),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 70/92 (76%), Positives = 78/92 (85%), Gaps = 1/92 (1%)
 Frame = -2

Query  453  VGIIMYLPTMDARERKHITEEFFHYRHLTQAHLWDHYSAYEHWAKIEVPKDKEELQALQA  274
            VGIIMYLPT DAR+RK ITEEFF YR L ++ LWD YS YEHWAKIEVPKDK EL  LQA
Sbjct  3    VGIIMYLPTSDARQRKEITEEFFSYRSLARS-LWDDYSTYEHWAKIEVPKDKAELAELQA  61

Query  273  RLRKKFPVDAYNRARQELDPNRILSNNMLEKL  178
            RLRK+FPVDAYN+AR ELDPN++LSN  LEK+
Sbjct  62   RLRKRFPVDAYNKARMELDPNKVLSNAKLEKM  93



>ref|XP_003590233.1| Mitochondrial L-galactono-1 4-lactone dehydrogenase [Medicago 
truncatula]
 ref|XP_003607634.1| Mitochondrial L-galactono-1 4-lactone dehydrogenase [Medicago 
truncatula]
Length=506

 Score =   154 bits (388),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 74/92 (80%), Positives = 81/92 (88%), Gaps = 0/92 (0%)
 Frame = -2

Query  726  WRKSEGYRVGWSDEILGFDCGGHQWVSETCFPAGTLSKPSMKDLEFIEQLMQLIEKESIP  547
            W+KSEGYRVGWSDEILGFDCGG QWVSETCFPAG L+ PSMKDLE+IE+L +LIEKE IP
Sbjct  414  WKKSEGYRVGWSDEILGFDCGGQQWVSETCFPAGKLATPSMKDLEYIEELKKLIEKEEIP  473

Query  546  APAPIEQRWTACSKSLMSPAYSSVDDDIFSWV  451
            APAPIEQRWTA ++S MSPA S   DDIFSWV
Sbjct  474  APAPIEQRWTASTRSPMSPASSPSQDDIFSWV  505



>ref|XP_006421268.1| hypothetical protein CICLE_v100046032mg, partial [Citrus clementina]
 gb|ESR34508.1| hypothetical protein CICLE_v100046032mg, partial [Citrus clementina]
Length=85

 Score =   143 bits (360),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 66/78 (85%), Positives = 73/78 (94%), Gaps = 0/78 (0%)
 Frame = -2

Query  411  RKHITEEFFHYRHLTQAHLWDHYSAYEHWAKIEVPKDKEELQALQARLRKKFPVDAYNRA  232
            RK IT+EFF+YRHL+Q  LWD YSAYEHWAKIEVPKDKEEL ALQARLRK+FPVD+YN+A
Sbjct  1    RKEITDEFFNYRHLSQKQLWDQYSAYEHWAKIEVPKDKEELAALQARLRKRFPVDSYNKA  60

Query  231  RQELDPNRILSNNMLEKL  178
            R+ELDPNRILSNNMLEKL
Sbjct  61   RKELDPNRILSNNMLEKL  78



>ref|XP_002450254.1| hypothetical protein SORBIDRAFT_05g002615 [Sorghum bicolor]
 gb|EES09242.1| hypothetical protein SORBIDRAFT_05g002615 [Sorghum bicolor]
Length=108

 Score =   142 bits (359),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 69/109 (63%), Positives = 83/109 (76%), Gaps = 1/109 (1%)
 Frame = -2

Query  633  PAGTLSKPSMKDLEFIEQLMQLIEKESIPAPAPIEQRWTACSKSLMSPAYSSVDDDIFSW  454
            P GTL+KPSMK L++IE+L+QLIEKE IPAP PIEQRWTACSKS M P  SS +D +FSW
Sbjct  1    PTGTLAKPSMKGLDYIEKLLQLIEKEDIPAPGPIEQRWTACSKSSMFPVSSSEEDGVFSW  60

Query  453  VGIIMYLPTMDARERKHITEEFFHYRHLTQAHLWDHYSAYEHWAKIEVP  307
              + + +PT DA +   I EEFF+YR   Q +LWD YSA+EHWAK EVP
Sbjct  61   GSMQVGIPTSDACQWTEIIEEFFNYRSQAQ-NLWDDYSAHEHWAKTEVP  108



>dbj|BAO94255.2| L-galactono-1,4-lactone dehydrogenase [Euglena gracilis]
Length=524

 Score =   150 bits (380),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 76/184 (41%), Positives = 111/184 (60%), Gaps = 6/184 (3%)
 Frame = -2

Query  726  WRKSEGYRVGWSDEILGFDCGGHQWVSETCFPAGTLSKPSMKDLEFIEQLMQLIEKESIP  547
            W+++   R+  S E+LGF+CGG Q V E  FP  T     + D+EF+E+++ +IE   IP
Sbjct  343  WQRNSAQRLSDSTEVLGFECGGSQRVLEVAFPIKT----PLADIEFMEKVLAVIEARGIP  398

Query  546  APAPIEQRWTACSKSLMSPAYSSVDDDIFSWVGIIMY-LPTMDARERKHITEEFFHYRHL  370
            APAP+EQRWTA S++ MSPA+S    D FSWVGIIMY  P  D +  + + + F  Y   
Sbjct  399  APAPLEQRWTARSQAPMSPAFSPTPGDPFSWVGIIMYNTPGQDEQGLEKVAKAFKSYCAA  458

Query  369  TQAHLWDHYSAYEHWAKIEVPKDKEELQALQARLRKKFPVDAYNRARQELDPNRILSNNM  190
             +  +   Y A  HWAK+E   D    Q L+ RL  ++P+  +   R +LDP  ILSN++
Sbjct  459  LEG-VHQEYGAVPHWAKVEPCDDPAAAQRLRDRLEARYPIAKFKYMRAQLDPKNILSNDL  517

Query  189  LEKL  178
            +E++
Sbjct  518  IERV  521



>gb|AFW84720.1| hypothetical protein ZEAMMB73_482719 [Zea mays]
Length=625

 Score =   148 bits (373),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 70/92 (76%), Positives = 78/92 (85%), Gaps = 1/92 (1%)
 Frame = -2

Query  453  VGIIMYLPTMDARERKHITEEFFHYRHLTQAHLWDHYSAYEHWAKIEVPKDKEELQALQA  274
            VGIIMYLPT DAR+RK ITEEFF YR L ++ LWD YS YEHWAKIEVPKDK EL  LQA
Sbjct  524  VGIIMYLPTSDARQRKEITEEFFSYRSLARS-LWDDYSTYEHWAKIEVPKDKAELAELQA  582

Query  273  RLRKKFPVDAYNRARQELDPNRILSNNMLEKL  178
            RLRK+FPVDAYN+AR ELDPN++LSN  LEK+
Sbjct  583  RLRKRFPVDAYNKARMELDPNKVLSNAKLEKM  614



>gb|EJK68285.1| hypothetical protein THAOC_10550 [Thalassiosira oceanica]
Length=610

 Score =   147 bits (370),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 80/199 (40%), Positives = 113/199 (57%), Gaps = 16/199 (8%)
 Frame = -2

Query  726  WRKSEGYRVGWSDEILGFDCGGHQWVSETCFPAGTLSKPSMKDLEFIEQLMQLIEKESIP  547
            W +++G  +  S++ L FDCGG QWV E CFP GT   P  K ++F+E+L++ +E   I 
Sbjct  407  WFRAQGLDIAPSEQKLQFDCGGQQWVYEVCFPTGTYGLPGSKSIDFMEELLREVESSGIA  466

Query  546  APAPIEQRWTACSKSLMSPAYSSVDDD--------IFSWVGIIMYLPTMD----ARERKH  403
            AP+PIEQRWT  S+S +SPA  S++ D        +FSWVG+IMYLP+ D       R+ 
Sbjct  467  APSPIEQRWTRSSRSPLSPASPSLESDNGYESENALFSWVGVIMYLPSEDTDPTGSRREF  526

Query  402  ITEEFFHYRHLTQAHLWDHYSAYEHWAKIEVPKDKEELQALQAR-LRKKFP---VDAYNR  235
            ITE F          +   Y    HWAKIEV  D ++     A  +R +F    V AYN 
Sbjct  527  ITESFKDQYCTLVRRVGKKYGIMCHWAKIEVSDDPKDANGGVAEDVRARFGPRVVAAYND  586

Query  234  ARQELDPNRILSNNMLEKL  178
            AR+  DP  +LS + L+++
Sbjct  587  ARKAYDPRGVLSCDKLDQI  605



>ref|XP_002948012.1| hypothetical protein VOLCADRAFT_88191 [Volvox carteri f. nagariensis]
 gb|EFJ51000.1| hypothetical protein VOLCADRAFT_88191 [Volvox carteri f. nagariensis]
Length=579

 Score =   145 bits (367),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 85/192 (44%), Positives = 116/192 (60%), Gaps = 11/192 (6%)
 Frame = -2

Query  726  WRKSEGYRVGWSDEILGFDCGGHQWVSETCFP-AGTLS--KPS--MKDLEFIEQLMQLIE  562
            WR+S G RVG+SD++L FDCGG QWV E  FP A +L   KP    +DLEF+E LM  I+
Sbjct  372  WRRSAGVRVGFSDDLLAFDCGGQQWVLEVAFPVAASLDGLKPGARTRDLEFLEALMAEIK  431

Query  561  KESIPAPAPIEQRWTACSKSLMSPAYSSVDDDIFSWVGIIMYLPTMDARERKHITEEFFH  382
            K  +PAP+PIE RWT+ S S +SPA +   + +  WVGIIMYLP  +   R+ +T+ F  
Sbjct  432  KARLPAPSPIEVRWTSGSSSPLSPA-AGPPESVHCWVGIIMYLPE-EPEAREKVTQAFRG  489

Query  381  YRHLTQAHLWDHYSAYEHWAKIEVPKDKE-ELQAL-QARLRKKF--PVDAYNRARQELDP  214
            Y  L ++ L   + A  HWAK+E     E EL+ L + RL  +F   + A +R R  LDP
Sbjct  490  YTRLVESKLMPRFDATWHWAKLETSSRPEGELEGLVRPRLASRFGSALGALSRYRAVLDP  549

Query  213  NRILSNNMLEKL  178
               L+N  L+ +
Sbjct  550  QGTLANKWLDAV  561



>ref|XP_008878801.1| galactonolactone dehydrogenase [Aphanomyces invadans]
 gb|ETV92494.1| galactonolactone dehydrogenase [Aphanomyces invadans]
Length=552

 Score =   143 bits (361),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 81/188 (43%), Positives = 119/188 (63%), Gaps = 10/188 (5%)
 Frame = -2

Query  726  WRKSEGYRVGWSDEILGFDCGGHQWVSETCFPAGTLSKPSMKDLEFIEQLMQLIEKESIP  547
            WR+S+G RV  SD+++GFDCGG Q VSE  FP   +SK  + DL+F++ L+  I+   +P
Sbjct  368  WRRSQGTRVALSDDVVGFDCGGQQLVSEVAFP---ISKDHL-DLDFMDALLARIQANQVP  423

Query  546  APAPIEQRWTACSKSLMSPAYSSVDDDIFSWVGIIMYLPTM--DARERKHITEEFF-HYR  376
            A  PIEQRWTA S++ +SPA S+    +FSWVGII+YL     +A   +  T ++F  Y 
Sbjct  424  AHTPIEQRWTARSRAALSPAQSTDAAAVFSWVGIILYLQDGGDEAPGARDATRKYFGKYS  483

Query  375  HLTQAHLWDHYSAYEHWAKIEV-PKDKEELQALQARLRKKFPV-DAYNRARQELDPNRIL  202
            +L +  +   Y A EHWAK+EV  K   E+ A++ RLR +F   +A+   R E DP+ +L
Sbjct  484  NLLE-DVMAPYGATEHWAKLEVTSKSAVEIDAIRQRLRARFAAWEAFKALRNEWDPHHVL  542

Query  201  SNNMLEKL  178
            SN +++ L
Sbjct  543  SNEIVDVL  550



>ref|NP_001118789.1| L-galactono-1,4-lactone dehydrogenase [Arabidopsis thaliana]
 gb|AEE78348.1| L-galactono-1,4-lactone dehydrogenase [Arabidopsis thaliana]
Length=512

 Score =   142 bits (359),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 62/73 (85%), Positives = 69/73 (95%), Gaps = 0/73 (0%)
 Frame = -2

Query  726  WRKSEGYRVGWSDEILGFDCGGHQWVSETCFPAGTLSKPSMKDLEFIEQLMQLIEKESIP  547
            W+KSEGYRVGWSDEILGFDCGG QWVSE+CFPAGTL+ PSMKDLE+IE+L +LIEKE+IP
Sbjct  421  WKKSEGYRVGWSDEILGFDCGGQQWVSESCFPAGTLANPSMKDLEYIEELKKLIEKEAIP  480

Query  546  APAPIEQRWTACS  508
            APAPIEQRWTA S
Sbjct  481  APAPIEQRWTARS  493



>ref|XP_007512550.1| L-galactono-1,4-lactone dehydrogenase [Bathycoccus prasinos]
 emb|CCO17150.1| L-galactono-1,4-lactone dehydrogenase [Bathycoccus prasinos]
Length=818

 Score =   140 bits (352),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 87/203 (43%), Positives = 113/203 (56%), Gaps = 21/203 (10%)
 Frame = -2

Query  726  WRKSEGYRVGWSDEILGFDCGGHQWVSETCFPAGTL---------------SKPS--MKD  598
            W++S G RV WSD+ILGFDCGG Q V E  FP GTL               S PS   KD
Sbjct  613  WKRSHGTRVDWSDQILGFDCGGQQHVLEVAFPCGTLEEKGENLVSSANAGVSHPSSLRKD  672

Query  597  LEFIEQLMQLIEKESIPAPAPIEQRWTACSKSLMSPAYSSVDDDIFSWVGIIMYLPTMDA  418
            L F+  L ++I + +IPA APIEQRWT+ S S+MSP++    D + SWVGIIMYLPT   
Sbjct  673  LLFMRDLRKMIAENNIPAHAPIEQRWTSGSSSIMSPSHGE-KDSLHSWVGIIMYLPTQVE  731

Query  417  RERKHITEEFFHYRHLTQAHLWDHYSAYEHWAKIEVPKDKEELQALQARLRKKFPVD---  247
             ER+ IT  F  Y    +  L D Y    HWAKIE+ K+         RL+  +  +   
Sbjct  732  AEREEITARFTEYGEQMRDALGDEYLLKTHWAKIELEKNMVRRSKQVERLKTAYGKENFR  791

Query  246  AYNRARQELDPNRILSNNMLEKL  178
            A+   R++ DP  +L N ++E L
Sbjct  792  AFRDLRRKFDPKGVLMNELIEGL  814



>ref|XP_003057660.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH57611.1| predicted protein [Micromonas pusilla CCMP1545]
Length=870

 Score =   139 bits (349),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 69/148 (47%), Positives = 90/148 (61%), Gaps = 5/148 (3%)
 Frame = -2

Query  735  GRXWRKSEGYRVGWSDEILGFDCGGHQWVSETCFPAG-TLSKPSMKDLEFIEQLMQLIEK  559
            G  W+++ G R  WSD+ILGFDCGG Q V E  F  G ++     +DL +++ L+++IE+
Sbjct  454  GEFWKRNAGTRCDWSDQILGFDCGGQQHVYEIAFRTGDSVETNDGRDLAYMKDLLEMIER  513

Query  558  ESIPAPAPIEQRWTACSKSLMSPAYSSVDDD----IFSWVGIIMYLPTMDARERKHITEE  391
            E IPAPAPIEQRW+A S S MSP  +   DD    + SW+GIIMYLPT     R  IT  
Sbjct  514  EGIPAPAPIEQRWSAGSSSPMSPVSNDGKDDAGPGLHSWIGIIMYLPTSVKETRDEITAA  573

Query  390  FFHYRHLTQAHLWDHYSAYEHWAKIEVP  307
            F  Y    +  L + Y+   HWAKIE P
Sbjct  574  FKAYAKREEELLGEKYAIRTHWAKIESP  601



>ref|XP_002289008.1| probable glactonolatone dehydrogenase [Thalassiosira pseudonana 
CCMP1335]
 gb|EED94444.1| probable glactonolatone dehydrogenase [Thalassiosira pseudonana 
CCMP1335]
Length=618

 Score =   133 bits (335),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 73/198 (37%), Positives = 113/198 (57%), Gaps = 15/198 (8%)
 Frame = -2

Query  726  WRKSEGYRVGWSDEILGFDCGGHQWVSETCFPAGTLSKPSMKDLEFIEQLMQLIEKESIP  547
            W K++G RV  SD++L FDCGG QWV E CFP GT   P+   ++F++ L++ IE   IP
Sbjct  417  WVKAQGIRVAPSDQLLQFDCGGQQWVYEVCFPVGTYGLPNSNSMDFMDDLLKEIESSGIP  476

Query  546  APAPIEQRW-----TACSKSLMSPA-YSSVDDD--IFSWVGIIMYLPTMD----ARERKH  403
            AP+PIEQRW     +  S + + P  + S D    + SWVG+IMYLP+ D       R+ 
Sbjct  477  APSPIEQRWSSSSSSPLSPTSVGPCEHESYDTKHALSSWVGVIMYLPSEDNDPTGYRREF  536

Query  402  ITEEFFHYRHLTQAHLWDHYSAYEHWAKIEVPKDKEELQALQARLRKKFP---VDAYNRA  232
            IT  F          + + Y    HWAK+E+ +  ++ + +   +R++F    V+ +N A
Sbjct  537  ITRSFKDRYCKLVRKVGEKYGIMCHWAKLEINEANDKEEGVTESVRRRFGPKVVEEFNAA  596

Query  231  RQELDPNRILSNNMLEKL  178
            R   DP R+LS ++L+++
Sbjct  597  RDLYDPKRVLSCSLLDQI  614



>gb|ABI26714.1| L-galactono-1,4-lactone dehydrogenase [Vitis vinifera]
Length=249

 Score =   122 bits (307),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 54/61 (89%), Positives = 57/61 (93%), Gaps = 0/61 (0%)
 Frame = -2

Query  726  WRKSEGYRVGWSDEILGFDCGGHQWVSETCFPAGTLSKPSMKDLEFIEQLMQLIEKESIP  547
            WRKSEGYRVGWSDEILGFDCGG QWVSETCFPAGTL+KPSMKDLE+IE L +LIEKE IP
Sbjct  186  WRKSEGYRVGWSDEILGFDCGGQQWVSETCFPAGTLAKPSMKDLEYIEDLKKLIEKEEIP  245

Query  546  A  544
            A
Sbjct  246  A  246



>gb|ETO19508.1| putative glactonolatone dehydrogenase [Reticulomyxa filosa]
Length=426

 Score =   120 bits (302),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 66/155 (43%), Positives = 92/155 (59%), Gaps = 10/155 (6%)
 Frame = -2

Query  717  SEGYRVGWSDEILGFDCGGHQWVSETCFPAGTLSKPSMKDLEFIEQLMQLIEKESIPAPA  538
            +EG  V W+D+ILGF+CGG Q V E CFP       +  D   +  L+  I+K  IPAPA
Sbjct  276  TEGDHVAWNDDILGFECGGQQLVYEICFPH------TQNDALIVLDLLHHIQKLQIPAPA  329

Query  537  PIEQRWTACSKSLMSPAYSSVDDDIFSWVGIIMYLPTMDARERKHITEEFFHY-RHLTQA  361
            PIEQRWTA S S+MSPAYS  + D F W+GI+ YL T D + R  I + F  Y R L Q 
Sbjct  330  PIEQRWTARSASVMSPAYSPNEKDKFMWLGIVFYLSTQDQKIRDDIIKNFAVYERALDQ-  388

Query  360  HLWDHYSAYEHWAKIEVP-KDKEELQALQARLRKK  259
             +   Y    HWAK+ +  + K++++ ++  ++ K
Sbjct  389  -VSQKYGGIGHWAKLNLQHRSKDDVKLVKQHIQLK  422



>gb|KDD75406.1| hypothetical protein H632_c698p0, partial [Helicosporidium sp. 
ATCC 50920]
Length=197

 Score =   114 bits (286),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 63/186 (34%), Positives = 92/186 (49%), Gaps = 36/186 (19%)
 Frame = -2

Query  630  AGTLSKPSMKDLEFIEQLMQLIEKESIPAPAPIEQRWTACSKSLMSPAYSSVDDDIFSWV  451
            AGTL +PS  D+ ++++L+ L+E+  IPAP P+EQRW+A S S MSPA     + + SWV
Sbjct  1    AGTLDRPSGADMRYVQELLALVERHRIPAPGPVEQRWSAGSASPMSPARGPP-ESVHSWV  59

Query  450  GIIMYLP--------TMDARE---------------------------RKHITEEFFHYR  376
            GIIMY P        T D  E                           R  + + F  Y 
Sbjct  60   GIIMYAPPDEAEGRGTKDGAEKAADGSVGDGEREISRPVTTKTRPAGVRGEVQQAFERYA  119

Query  375  HLTQAHLWDHYSAYEHWAKIEVPKDKEELQALQARLRKKFPVDAYNRARQELDPNRILSN  196
             L    L + Y A  HWAK+E+P D  + + ++  +  + PV A+ R R +LDP  IL +
Sbjct  120  LLVDRELSERYGALSHWAKLELPDDPRDRERVRRLIASRLPVGAFQRYRADLDPKNILGS  179

Query  195  NMLEKL  178
              ++ L
Sbjct  180  PEIDAL  185



>gb|ABO64439.1| L-galactosedehydrogenase [Cucumis sativus]
Length=267

 Score =   103 bits (257),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 43/44 (98%), Positives = 44/44 (100%), Gaps = 0/44 (0%)
 Frame = -2

Query  726  WRKSEGYRVGWSDEILGFDCGGHQWVSETCFPAGTLSKPSMKDL  595
            WRKSEGYRVGWSDEILGFDCGGHQWVSETCFPAGTL+KPSMKDL
Sbjct  224  WRKSEGYRVGWSDEILGFDCGGHQWVSETCFPAGTLTKPSMKDL  267



>ref|NP_001066120.2| Os12g0139600 [Oryza sativa Japonica Group]
 dbj|BAF29139.2| Os12g0139600 [Oryza sativa Japonica Group]
Length=63

 Score = 85.5 bits (210),  Expect = 7e-18, Method: Composition-based stats.
 Identities = 39/48 (81%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = -2

Query  453  VGIIMYLPTMDARERKHITEEFFHYRHLTQAHLWDHYSAYEHWAKIEV  310
            VGIIMYLPT DAR+RK ITEEFF+YR  TQ +LWD YSAYEHWAKIEV
Sbjct  11   VGIIMYLPTSDARQRKEITEEFFNYRSKTQTNLWDGYSAYEHWAKIEV  58



>ref|XP_001693696.1| L-galactono-1,4-lactone dehydrogenase [Chlamydomonas reinhardtii]
 gb|EDP08950.1| L-galactono-1,4-lactone dehydrogenase [Chlamydomonas reinhardtii]
Length=504

 Score = 77.8 bits (190),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 62/183 (34%), Positives = 84/183 (46%), Gaps = 43/183 (23%)
 Frame = -2

Query  726  WRKSEGYRVGWSDEILGFDCGGHQWVSETCF---PAGTLSKPS--MKDLEFIEQLMQLIE  562
            WR++ G RVGWSD+ILGFDCGG QWV E  F   P+    KP    +DL+F++ L+  I+
Sbjct  139  WRRATGTRVGWSDQILGFDCGGQQWVLEVAFQVAPSLDALKPGAQTRDLQFMDDLLAEIK  198

Query  561  KESIPAPAPIEQRWTACSKSLMSPAYSSVDDDIFSWVGIIMYLPTMDARERKHITEEFFH  382
            K  I A +P+E            PA           +G   Y+P   A E     E   H
Sbjct  199  KNKIAAASPLE------------PAL----------LGGRHYVPAARAGE-----EGGGH  231

Query  381  YRHLTQAHLWDHYSAYEHWAKIEVPK-----DKEELQALQARLRKKF--PVDAYNRARQE  223
             R      L   Y+A  HWAK+E        + E    ++ RL  ++   + A  R R  
Sbjct  232  GR----TRLMPKYNAAWHWAKLEAGAASGRPEAEMAAVVRPRLAARYGPALAALKRYRAV  287

Query  222  LDP  214
            LDP
Sbjct  288  LDP  290



>gb|ADK12916.1| L-galactono-1,4-lacton dehydrognease [Actinidia eriantha]
Length=220

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 25/28 (89%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = -2

Query  726  WRKSEGYRVGWSDEILGFDCGGHQWVSE  643
            W KSEGYR+GWSDEILGFDCGG QWVSE
Sbjct  193  WMKSEGYRLGWSDEILGFDCGGQQWVSE  220



>ref|XP_009051634.1| hypothetical protein LOTGIDRAFT_208933 [Lottia gigantea]
 gb|ESO97787.1| hypothetical protein LOTGIDRAFT_208933 [Lottia gigantea]
Length=456

 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 52/181 (29%), Positives = 78/181 (43%), Gaps = 27/181 (15%)
 Frame = -2

Query  720  KSEGYRVGWSDEILGFDCGGHQWVSETCFPAGTLSKPSMKDLEFIEQLMQLIEKESIPAP  541
            KSE  +V  SD I  F+C   Q+VSE        S P  K    ++++ + I   + PA 
Sbjct  292  KSE--KVDRSDHIFNFNCLFKQYVSE-------WSIPREKTSYVLKEIQKWIIDNNFPAH  342

Query  540  APIEQRWTACSKSLMSPAYSSVDDDIFSWVGIIMYLPTMDARERKHITEEFFHYRHLTQA  361
             PIE R+       +SPAY   D     ++ IIMY P      R+   + F         
Sbjct  343  VPIEVRFVKGDDLYLSPAYGWKDT---CYINIIMYTPFNKIVPREKYWKAF--------E  391

Query  360  HLWDHYSAYEHWAKIEVPKDKEELQALQARLRKKFPVDAYNRARQELDPNRILSNNMLEK  181
             +        HWAK +    +EE Q L  +       D + + R+ LDPN +  N+ LE+
Sbjct  392  KIMSDVGGRPHWAK-DHKYGREEFQNLYPQF------DTFCKIRERLDPNGMFLNSNLER  444

Query  180  L  178
            +
Sbjct  445  V  445



>ref|XP_005707018.1| D-arabinono-1,4-lactone oxidase [Galdieria sulphuraria]
 gb|EME30498.1| D-arabinono-1,4-lactone oxidase [Galdieria sulphuraria]
Length=495

 Score = 56.6 bits (135),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 46/177 (26%), Positives = 73/177 (41%), Gaps = 28/177 (16%)
 Frame = -2

Query  705  RVGWSDEILGFDCGGHQWVSETCFPAGTLSKPSMKDLEFIEQLMQLIEKESIPAPAPIEQ  526
            +V  SD++  FDC   Q+V E   P           +E +++L  LIE   +    PIE 
Sbjct  343  KVDQSDKVFNFDCLFRQYVDEWAIP-------RRHTVEAMKRLRNLIETSGLYVHFPIEV  395

Query  525  RWTACSKSLMSPAYSSVDDDIFSWVGIIMYLPTMDARERKHITEEFFHYRHLTQAHLWDH  346
            R+T+     +SP+Y         W+GIIMY P       K+  E+F          +   
Sbjct  396  RFTSADDIWLSPSYGRES----CWIGIIMYRPYSKDVPFKYYFEQF--------EQIMQS  443

Query  345  YSAYEHWAKIEVPKDKEELQALQARLRKKFP-VDAYNRARQELDPNRILSNNMLEKL  178
                 HWAK              ++  K +P    + + R+ LDP  I SN  ++++
Sbjct  444  LDGRPHWAKPH--------GCNSSQFSKMYPRFLEFKQIRERLDPEHIFSNQYIDRV  492



>gb|EPY23514.1| L-gulonolactone oxidase [Strigomonas culicis]
Length=406

 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 53/185 (29%), Positives = 75/185 (41%), Gaps = 24/185 (13%)
 Frame = -2

Query  732  RXWRKSEGYRVGWSDEILGFDCGGHQWVSETCFPAGTLSKPSMKDLEFIEQLMQLIEKES  553
            R +  S   + G + E   FDC   QW +E    A   S P     E + +L  +IEK++
Sbjct  231  RAFYSSAQTQFGSALECFTFDCLFKQWANEWAVDAA--SAP-----EVLRRLQDMIEKDN  283

Query  552  IPAPAPIEQRWTACSKSLMSPAYSSVDDDIFSWVGIIMYLPTMDARERKHITEEFFHYRH  373
            +    PIE R++   ++L+SPA          WVG++MY P    RE       +  +  
Sbjct  284  LHLHFPIEFRFSGADETLLSPAAGRQT----CWVGVVMYRPL--GREAPDTIRCYNRFCE  337

Query  372  LTQAHLWDHYSAYEHWAKIEVPKDKEELQALQARLRKKFPVDAYNRARQELDPNRILSNN  193
            L  A          HWAK     +KE  +A            A+ R R ELDP  I  N 
Sbjct  338  LMTA-----MGGRPHWAKYYQWGEKEMERAYGENW------SAFLRLRAELDPKDIFVNE  386

Query  192  MLEKL  178
                L
Sbjct  387  WFNNL  391



>gb|EPY23832.1| L-gulonolactone oxidase [Strigomonas culicis]
 gb|EPY24788.1| L-gulonolactone oxidase [Strigomonas culicis]
Length=471

 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 53/185 (29%), Positives = 75/185 (41%), Gaps = 24/185 (13%)
 Frame = -2

Query  732  RXWRKSEGYRVGWSDEILGFDCGGHQWVSETCFPAGTLSKPSMKDLEFIEQLMQLIEKES  553
            R +  S   + G + E   FDC   QW +E    A   S P     E + +L  +IEK++
Sbjct  296  RAFYSSAQTQFGSALECFTFDCLFKQWANEWAVDAA--SAP-----EVLRRLQDMIEKDN  348

Query  552  IPAPAPIEQRWTACSKSLMSPAYSSVDDDIFSWVGIIMYLPTMDARERKHITEEFFHYRH  373
            +    PIE R++   ++L+SPA          WVG++MY P    RE       +  +  
Sbjct  349  LHLHFPIEFRFSGADETLLSPAAGRQT----CWVGVVMYRPL--GREAPDTIRCYNRFCE  402

Query  372  LTQAHLWDHYSAYEHWAKIEVPKDKEELQALQARLRKKFPVDAYNRARQELDPNRILSNN  193
            L  A          HWAK     +KE  +A            A+ R R ELDP  I  N 
Sbjct  403  LMTA-----MGGRPHWAKYYQWGEKEMERAYGENW------SAFLRLRAELDPKDIFVNE  451

Query  192  MLEKL  178
                L
Sbjct  452  WFNNL  456



>emb|CDX77878.1| BnaC03g53410D [Brassica napus]
Length=190

 Score = 52.8 bits (125),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 29/75 (39%), Positives = 45/75 (60%), Gaps = 10/75 (13%)
 Frame = -2

Query  645  ETCFPA----GTLSKPSMKDLEFIEQLMQLIEKESIPAPAPIEQRWTACSKSLMSPAYSS  478
            + CF +     T  KP     + ++ L ++IEKE+       EQRWTA SKS +SPA+S+
Sbjct  95   QICFSSKWSGATKDKPKYTTHDALKHLKEVIEKEAT------EQRWTAPSKSPISPAFST  148

Query  477  VDDDIFSWVGIIMYL  433
             +D++FSWV ++  L
Sbjct  149  AEDELFSWVTLVFSL  163



>emb|CCC90558.1| unnamed protein product [Trypanosoma congolense IL3000]
Length=506

 Score = 50.8 bits (120),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 53/196 (27%), Positives = 75/196 (38%), Gaps = 32/196 (16%)
 Frame = -2

Query  747  QPS*GRXWR----KSEGYRVGWSDEILGFDCGGHQWVSETCFPAGTLSKPSMKDLEFIEQ  580
            QP   R +R     +   + G S E   FDC   QW  E               L+    
Sbjct  323  QPYINRAYRYIFYSTSDVQYGTSLECFSFDCLFKQWACEWAIDIDNA-------LQAFHY  375

Query  579  LMQLIEKESIPAPAPIEQRWTACSKSLMSPAYSSVDDDIFSWVGIIMYLPTMDARERKHI  400
            L  LI+ E++    P+E R+T    + +SPA+         W+GI+MY P M      H 
Sbjct  376  LRDLIKSENLRVHFPVEFRFTGADSTALSPAHGRKT----CWIGIVMYRPHM-----LHA  426

Query  399  TEEFFHYRHLTQAHLWDHYSAYEHWAKIEV--PKDKEELQALQARLRKKFPVDAYNRARQ  226
             +   +Y   +QA          HWAK     P D   ++A   R  + F      R R 
Sbjct  427  PDTMRYYDAFSQA--MTAIGGRPHWAKYYTWGPAD---VKAAYGRNWEDFL-----RLRT  476

Query  225  ELDPNRILSNNMLEKL  178
            ++DPN I  N     L
Sbjct  477  KMDPNDIFLNGWFNSL  492



>ref|XP_004336118.1| Lgulono-gamma-lactone oxidase [Acanthamoeba castellanii str. 
Neff]
 gb|ELR14105.1| Lgulono-gamma-lactone oxidase [Acanthamoeba castellanii str. 
Neff]
Length=497

 Score = 50.4 bits (119),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 46/173 (27%), Positives = 68/173 (39%), Gaps = 27/173 (16%)
 Frame = -2

Query  693  SDEILGFDCGGHQWVSETCFPAGTLSKPSMKDLEFIEQLMQLIEKESIPAPAPIEQRWTA  514
            SD+ L FDC   Q VSE   P    +   ++       L  LI+   +     +E R+T 
Sbjct  342  SDKQLTFDCLFQQHVSEWSIPVANTATAMLR-------LRDLIKDLDLKVHFSVEVRFTK  394

Query  513  CSKSLMSPAYSSVDDDIFSWVGIIMYLPTMDARERKHITEEFFHYRHLTQAHLWDHYSAY  334
                 +SP+Y        +W+GIIMY P    R+       F  +  L +          
Sbjct  395  ADDIWLSPSYGRDS----AWIGIIMYRPY--GRDMPGTKVYFDAFEELMK-----ELDGR  443

Query  333  EHWAKIEVPKDKEELQALQARLRKKFPV-DAYNRARQELDPNRILSNNMLEKL  178
             HWAK          +  +   R+  P  D + R R E+DP    SN  L++L
Sbjct  444  PHWAK--------AFKMSEVEFRQTLPHWDDFKRVRAEMDPTSTFSNAYLDRL  488



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1427696849470