BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF011J10

Length=727
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006340784.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...    271   1e-86   Solanum tuberosum [potatoes]
ref|XP_006380560.1|  hypothetical protein POPTR_0007s09270g             271   1e-86   
ref|XP_007046593.1|  2-oxoglutarate (2OG) and Fe(II)-dependent ox...    269   5e-86   
gb|KHG30312.1|  Prolyl 4-hydroxylase subunit alpha-1                    269   8e-86   Gossypium arboreum [tree cotton]
ref|XP_011014780.1|  PREDICTED: probable prolyl 4-hydroxylase 10        268   1e-85   Populus euphratica
gb|EYU30384.1|  hypothetical protein MIMGU_mgv1a011046mg                268   2e-85   Erythranthe guttata [common monkey flower]
ref|XP_004232524.1|  PREDICTED: probable prolyl 4-hydroxylase 10        266   4e-85   Solanum lycopersicum
ref|XP_009622125.1|  PREDICTED: probable prolyl 4-hydroxylase 10        266   5e-85   Nicotiana tomentosiformis
gb|KJB43227.1|  hypothetical protein B456_007G190600                    266   6e-85   Gossypium raimondii
emb|CDP01844.1|  unnamed protein product                                265   2e-84   Coffea canephora [robusta coffee]
ref|XP_011022255.1|  PREDICTED: probable prolyl 4-hydroxylase 10        264   5e-84   Populus euphratica
ref|XP_006383041.1|  hypothetical protein POPTR_0005s10980g             264   5e-84   Populus trichocarpa [western balsam poplar]
ref|XP_009587704.1|  PREDICTED: probable prolyl 4-hydroxylase 10        263   1e-83   Nicotiana tomentosiformis
ref|XP_010485337.1|  PREDICTED: probable prolyl 4-hydroxylase 10        259   1e-83   
ref|XP_011079010.1|  PREDICTED: probable prolyl 4-hydroxylase 10        263   1e-83   Sesamum indicum [beniseed]
ref|XP_009776785.1|  PREDICTED: probable prolyl 4-hydroxylase 10        263   2e-83   Nicotiana sylvestris
emb|CDX81416.1|  BnaC09g08270D                                          262   2e-83   
ref|XP_008440878.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...    262   2e-83   Cucumis melo [Oriental melon]
ref|XP_009801759.1|  PREDICTED: probable prolyl 4-hydroxylase 10        262   3e-83   Nicotiana sylvestris
ref|XP_009112275.1|  PREDICTED: probable prolyl 4-hydroxylase 10        262   3e-83   Brassica rapa
ref|NP_201407.4|  2-oxoglutarate (2OG) and Fe(II)-dependent oxyge...    262   4e-83   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004134841.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...    261   5e-83   Cucumis sativus [cucumbers]
ref|XP_006343343.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...    261   5e-83   Solanum tuberosum [potatoes]
gb|KHN35999.1|  Prolyl 4-hydroxylase subunit alpha-1                    261   6e-83   Glycine soja [wild soybean]
ref|XP_004234520.1|  PREDICTED: probable prolyl 4-hydroxylase 10        261   6e-83   Solanum lycopersicum
ref|XP_006280909.1|  hypothetical protein CARUB_v10026902mg             261   6e-83   Capsella rubella
ref|XP_010465981.1|  PREDICTED: probable prolyl 4-hydroxylase 10 ...    261   7e-83   Camelina sativa [gold-of-pleasure]
ref|XP_010444842.1|  PREDICTED: probable prolyl 4-hydroxylase 10        261   8e-83   Camelina sativa [gold-of-pleasure]
gb|EPS71884.1|  hypothetical protein M569_02873                         261   8e-83   Genlisea aurea
ref|XP_002263060.1|  PREDICTED: probable prolyl 4-hydroxylase 10        261   8e-83   Vitis vinifera
gb|KJB48235.1|  hypothetical protein B456_008G061800                    261   9e-83   Gossypium raimondii
emb|CAN64470.1|  hypothetical protein VITISV_014644                     260   1e-82   Vitis vinifera
ref|XP_010113287.1|  Prolyl 4-hydroxylase subunit alpha-1               260   2e-82   Morus notabilis
ref|NP_001242522.1|  uncharacterized protein LOC100806046               260   2e-82   
ref|XP_006393794.1|  hypothetical protein EUTSA_v10004714mg             259   2e-82   Eutrema salsugineum [saltwater cress]
ref|XP_007046594.1|  2-oxoglutarate (2OG) and Fe(II)-dependent ox...    260   3e-82   
ref|XP_004158845.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...    259   3e-82   
gb|KDO71355.1|  hypothetical protein CISIN_1g023009mg                   255   4e-82   Citrus sinensis [apfelsine]
ref|XP_003538892.1|  PREDICTED: prolyl 4-hydroxylase subunit alpha-1    259   6e-82   Glycine max [soybeans]
ref|XP_004291329.1|  PREDICTED: probable prolyl 4-hydroxylase 3         259   9e-82   Fragaria vesca subsp. vesca
ref|XP_006425363.1|  hypothetical protein CICLE_v10026208mg             258   9e-82   Citrus clementina [clementine]
ref|XP_007202401.1|  hypothetical protein PRUPE_ppa009475mg             258   1e-81   Prunus persica
ref|XP_006425365.1|  hypothetical protein CICLE_v10026208mg             256   1e-81   
gb|KDO71350.1|  hypothetical protein CISIN_1g023009mg                   258   2e-81   Citrus sinensis [apfelsine]
gb|KDO71351.1|  hypothetical protein CISIN_1g023009mg                   258   2e-81   Citrus sinensis [apfelsine]
gb|KDP23952.1|  hypothetical protein JCGZ_25340                         257   2e-81   Jatropha curcas
ref|XP_006467024.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...    257   2e-81   Citrus sinensis [apfelsine]
ref|XP_006467023.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...    257   3e-81   Citrus sinensis [apfelsine]
ref|XP_010550487.1|  PREDICTED: probable prolyl 4-hydroxylase 10        257   3e-81   Tarenaya hassleriana [spider flower]
gb|KDO71354.1|  hypothetical protein CISIN_1g023009mg                   255   3e-81   Citrus sinensis [apfelsine]
ref|XP_009344824.1|  PREDICTED: probable prolyl 4-hydroxylase 10        257   3e-81   Pyrus x bretschneideri [bai li]
ref|XP_008242010.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...    256   5e-81   Prunus mume [ume]
gb|KHG25173.1|  P4ha[2]: Prolyl 4-hydroxylase subunit alpha-1           258   5e-81   Gossypium arboreum [tree cotton]
ref|XP_008337965.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...    256   6e-81   Malus domestica [apple tree]
ref|XP_010029633.1|  PREDICTED: probable prolyl 4-hydroxylase 10        258   9e-81   Eucalyptus grandis [rose gum]
ref|XP_002530636.1|  prolyl 4-hydroxylase alpha subunit, putative       255   1e-80   Ricinus communis
ref|XP_006342080.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...    255   1e-80   Solanum tuberosum [potatoes]
ref|XP_007157869.1|  hypothetical protein PHAVU_002G104900g             255   1e-80   Phaseolus vulgaris [French bean]
ref|XP_010266900.1|  PREDICTED: probable prolyl 4-hydroxylase 3         255   2e-80   Nelumbo nucifera [Indian lotus]
ref|XP_004512179.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...    254   2e-80   
ref|XP_004238387.1|  PREDICTED: probable prolyl 4-hydroxylase 3         254   3e-80   Solanum lycopersicum
gb|KHN09058.1|  Prolyl 4-hydroxylase subunit alpha-2                    254   3e-80   Glycine soja [wild soybean]
ref|XP_009363441.1|  PREDICTED: probable prolyl 4-hydroxylase 10        254   3e-80   Pyrus x bretschneideri [bai li]
ref|XP_006581148.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...    254   4e-80   Glycine max [soybeans]
ref|XP_007156206.1|  hypothetical protein PHAVU_003G267200g             254   4e-80   Phaseolus vulgaris [French bean]
ref|XP_003612249.1|  Prolyl 4-hydroxylase alpha-2 subunit               254   5e-80   Medicago truncatula
ref|XP_002285898.1|  PREDICTED: probable prolyl 4-hydroxylase 3         254   5e-80   Vitis vinifera
ref|XP_009337076.1|  PREDICTED: probable prolyl 4-hydroxylase 10        253   9e-80   Pyrus x bretschneideri [bai li]
ref|XP_010033532.1|  PREDICTED: probable prolyl 4-hydroxylase 10        253   2e-79   Eucalyptus grandis [rose gum]
gb|KHG25174.1|  phy-2: Prolyl 4-hydroxylase subunit alpha-2             254   2e-79   Gossypium arboreum [tree cotton]
ref|XP_008377129.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...    252   2e-79   Malus domestica [apple tree]
ref|XP_010266054.1|  PREDICTED: probable prolyl 4-hydroxylase 3         252   3e-79   Nelumbo nucifera [Indian lotus]
ref|XP_008393737.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...    252   3e-79   Malus domestica [apple tree]
ref|XP_010061109.1|  PREDICTED: probable prolyl 4-hydroxylase 3         253   4e-79   Eucalyptus grandis [rose gum]
ref|XP_007136121.1|  hypothetical protein PHAVU_009G019600g             251   6e-79   Phaseolus vulgaris [French bean]
ref|XP_010940405.1|  PREDICTED: probable prolyl 4-hydroxylase 3         251   6e-79   Elaeis guineensis
ref|XP_010918438.1|  PREDICTED: probable prolyl 4-hydroxylase 3 i...    251   7e-79   Elaeis guineensis
ref|XP_010918436.1|  PREDICTED: probable prolyl 4-hydroxylase 3 i...    251   7e-79   Elaeis guineensis
ref|XP_004287769.1|  PREDICTED: probable prolyl 4-hydroxylase 10        251   8e-79   Fragaria vesca subsp. vesca
gb|ACR34708.1|  unknown                                                 246   1e-78   Zea mays [maize]
ref|XP_010548243.1|  PREDICTED: prolyl 4-hydroxylase 5                  250   1e-78   Tarenaya hassleriana [spider flower]
ref|XP_007017902.1|  2-oxoglutarate (2OG) and Fe(II)-dependent ox...    250   1e-78   Theobroma cacao [chocolate]
ref|XP_008809395.1|  PREDICTED: probable prolyl 4-hydroxylase 3 i...    249   2e-78   Phoenix dactylifera
ref|XP_010100124.1|  Prolyl 4-hydroxylase subunit alpha-2               249   2e-78   Morus notabilis
ref|XP_010536435.1|  PREDICTED: probable prolyl 4-hydroxylase 3         249   2e-78   Tarenaya hassleriana [spider flower]
ref|XP_008221210.1|  PREDICTED: prolyl 4-hydroxylase subunit alpha-1    250   3e-78   Prunus mume [ume]
gb|ACN35795.1|  unknown                                                 246   3e-78   Zea mays [maize]
ref|XP_008809398.1|  PREDICTED: probable prolyl 4-hydroxylase 3 i...    249   3e-78   Phoenix dactylifera
ref|XP_006577956.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...    249   3e-78   Glycine max [soybeans]
gb|KJB59736.1|  hypothetical protein B456_009G269000                    248   4e-78   Gossypium raimondii
ref|XP_002893096.1|  oxidoreductase                                     249   4e-78   
ref|XP_009110235.1|  PREDICTED: probable prolyl 4-hydroxylase 3         249   4e-78   Brassica rapa
ref|XP_006305481.1|  hypothetical protein CARUB_v10009921mg             249   4e-78   Capsella rubella
ref|XP_010477260.1|  PREDICTED: probable prolyl 4-hydroxylase 3         249   4e-78   Camelina sativa [gold-of-pleasure]
emb|CDX96644.1|  BnaA08g21870D                                          249   4e-78   
ref|XP_006577957.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...    249   5e-78   Glycine max [soybeans]
ref|NP_564109.1|  2-oxoglutarate (2OG) and Fe(II)-dependent oxyge...    248   5e-78   Arabidopsis thaliana [mouse-ear cress]
gb|KJB59733.1|  hypothetical protein B456_009G269000                    248   6e-78   Gossypium raimondii
gb|KHG14293.1|  Prolyl 4-hydroxylase subunit alpha-2                    248   7e-78   Gossypium arboreum [tree cotton]
ref|XP_010459709.1|  PREDICTED: probable prolyl 4-hydroxylase 3         248   7e-78   Camelina sativa [gold-of-pleasure]
ref|XP_008778322.1|  PREDICTED: probable prolyl 4-hydroxylase 3 i...    249   7e-78   Phoenix dactylifera
emb|CDY54327.1|  BnaCnng26730D                                          248   7e-78   Brassica napus [oilseed rape]
ref|XP_010539831.1|  PREDICTED: probable prolyl 4-hydroxylase 3 i...    246   1e-77   Tarenaya hassleriana [spider flower]
ref|XP_007223346.1|  hypothetical protein PRUPE_ppa009548mg             248   1e-77   
ref|XP_010539828.1|  PREDICTED: probable prolyl 4-hydroxylase 3 i...    248   1e-77   Tarenaya hassleriana [spider flower]
ref|XP_010531576.1|  PREDICTED: prolyl 4-hydroxylase 5-like             249   2e-77   Tarenaya hassleriana [spider flower]
ref|XP_008456388.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...    247   2e-77   Cucumis melo [Oriental melon]
dbj|BAD23054.1|  putative prolyl 4-hydroxylase                          248   2e-77   Oryza sativa Japonica Group [Japonica rice]
gb|KGN60775.1|  hypothetical protein Csa_2G009620                       246   2e-77   
gb|AFK48224.1|  unknown                                                 243   2e-77   Lotus japonicus
ref|XP_008387904.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...    247   2e-77   
ref|XP_008387906.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...    247   2e-77   
ref|XP_009620049.1|  PREDICTED: probable prolyl 4-hydroxylase 3         247   2e-77   Nicotiana tomentosiformis
gb|AAM61711.1|  putative prolyl 4-hydroxylase, alpha subunit            247   3e-77   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006661912.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...    244   3e-77   Oryza brachyantha
ref|XP_004171765.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...    246   3e-77   
emb|CDY51328.1|  BnaCnng20650D                                          247   3e-77   Brassica napus [oilseed rape]
emb|CDY29362.1|  BnaA06g14340D                                          246   3e-77   Brassica napus [oilseed rape]
gb|EYU36811.1|  hypothetical protein MIMGU_mgv1a011044mg                246   4e-77   Erythranthe guttata [common monkey flower]
gb|EMT22590.1|  Prolyl 4-hydroxylase subunit alpha-1                    244   4e-77   
gb|KDP36874.1|  hypothetical protein JCGZ_08165                         246   4e-77   Jatropha curcas
ref|XP_010498461.1|  PREDICTED: probable prolyl 4-hydroxylase 3         246   5e-77   Camelina sativa [gold-of-pleasure]
ref|XP_003574128.1|  PREDICTED: probable prolyl 4-hydroxylase 3         247   5e-77   Brachypodium distachyon [annual false brome]
ref|XP_006449333.1|  hypothetical protein CICLE_v10016152mg             246   6e-77   Citrus clementina [clementine]
ref|XP_009334602.1|  PREDICTED: probable prolyl 4-hydroxylase 3         246   7e-77   Pyrus x bretschneideri [bai li]
dbj|BAJ85763.1|  predicted protein                                      246   9e-77   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_011074717.1|  PREDICTED: probable prolyl 4-hydroxylase 3         245   1e-76   Sesamum indicum [beniseed]
ref|XP_004139389.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...    245   1e-76   
gb|KJB29665.1|  hypothetical protein B456_005G112700                    245   1e-76   Gossypium raimondii
ref|XP_010446308.1|  PREDICTED: probable prolyl 4-hydroxylase 10        241   1e-76   
ref|XP_003629229.1|  Prolyl 4-hydroxylase alpha-2 subunit               244   1e-76   Medicago truncatula
ref|XP_002453082.1|  hypothetical protein SORBIDRAFT_04g038020          245   2e-76   Sorghum bicolor [broomcorn]
gb|KJB58041.1|  hypothetical protein B456_009G191400                    244   2e-76   Gossypium raimondii
ref|NP_001151238.1|  LOC100284871                                       245   2e-76   Zea mays [maize]
ref|XP_006648159.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...    245   2e-76   Oryza brachyantha
ref|XP_009798871.1|  PREDICTED: probable prolyl 4-hydroxylase 3         244   2e-76   Nicotiana sylvestris
ref|NP_001241865.1|  prolyl 4-hydroxylase 5-1                           241   2e-76   
ref|XP_006285542.1|  hypothetical protein CARUB_v10006984mg             244   2e-76   Capsella rubella
gb|KJB58040.1|  hypothetical protein B456_009G191400                    243   3e-76   Gossypium raimondii
ref|XP_009386075.1|  PREDICTED: probable prolyl 4-hydroxylase 3         244   3e-76   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001241694.1|  prolyl 4-hydroxylase 8-4                           244   3e-76   
ref|XP_006298248.1|  hypothetical protein CARUB_v10014309mg             244   4e-76   Capsella rubella
ref|NP_001159002.1|  prolyl 4-hydroxylase alpha-2 subunit               244   4e-76   Zea mays [maize]
ref|XP_010266902.1|  PREDICTED: probable prolyl 4-hydroxylase 3 i...    244   5e-76   
ref|XP_010266901.1|  PREDICTED: probable prolyl 4-hydroxylase 3 i...    244   5e-76   Nelumbo nucifera [Indian lotus]
emb|CDP07346.1|  unnamed protein product                                244   5e-76   Coffea canephora [robusta coffee]
gb|EPS68098.1|  hypothetical protein M569_06675                         243   5e-76   Genlisea aurea
ref|XP_009150770.1|  PREDICTED: prolyl 4-hydroxylase 5 isoform X1       244   5e-76   Brassica rapa
ref|XP_010489402.1|  PREDICTED: prolyl 4-hydroxylase 5                  243   5e-76   Camelina sativa [gold-of-pleasure]
ref|XP_009150771.1|  PREDICTED: prolyl 4-hydroxylase 5 isoform X2       243   5e-76   Brassica rapa
gb|AAM65040.1|  putative prolyl 4-hydroxylase, alpha subunit            243   5e-76   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008778312.1|  PREDICTED: probable prolyl 4-hydroxylase 3 i...    244   6e-76   
emb|CDY07826.1|  BnaC03g47960D                                          243   6e-76   Brassica napus [oilseed rape]
emb|CDY29194.1|  BnaA06g25630D                                          243   7e-76   Brassica napus [oilseed rape]
ref|XP_010514697.1|  PREDICTED: prolyl 4-hydroxylase 5-like             243   7e-76   Camelina sativa [gold-of-pleasure]
ref|XP_006409254.1|  hypothetical protein EUTSA_v10022796mg             243   7e-76   Eutrema salsugineum [saltwater cress]
ref|NP_179363.1|  prolyl 4-hydroxylase 5                                243   7e-76   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006828848.1|  hypothetical protein AMTR_s00001p00155640          243   8e-76   
ref|XP_009397948.1|  PREDICTED: probable prolyl 4-hydroxylase 3         243   8e-76   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003603828.1|  Prolyl 4-hydroxylase alpha-2 subunit               238   8e-76   
ref|XP_002884079.1|  oxidoreductase                                     243   9e-76   
dbj|BAK01841.1|  predicted protein                                      244   9e-76   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009121088.1|  PREDICTED: prolyl 4-hydroxylase 5-like             243   1e-75   Brassica rapa
ref|XP_010467565.1|  PREDICTED: prolyl 4-hydroxylase 5                  243   1e-75   Camelina sativa [gold-of-pleasure]
ref|XP_002467008.1|  hypothetical protein SORBIDRAFT_01g018200          243   1e-75   Sorghum bicolor [broomcorn]
emb|CDY20811.1|  BnaC07g06600D                                          243   1e-75   Brassica napus [oilseed rape]
emb|CDY24364.1|  BnaA07g02890D                                          243   1e-75   Brassica napus [oilseed rape]
ref|XP_010683036.1|  PREDICTED: probable prolyl 4-hydroxylase 10        243   1e-75   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003603827.1|  Prolyl 4-hydroxylase alpha-2 subunit               242   2e-75   Medicago truncatula
ref|XP_004954469.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...    243   2e-75   Setaria italica
ref|XP_010667434.1|  PREDICTED: probable prolyl 4-hydroxylase 3         242   2e-75   Beta vulgaris subsp. vulgaris [field beet]
gb|ABK24739.1|  unknown                                                 242   3e-75   Picea sitchensis
ref|XP_010446875.1|  PREDICTED: prolyl 4-hydroxylase 5-like             241   3e-75   Camelina sativa [gold-of-pleasure]
ref|XP_003570489.1|  PREDICTED: probable prolyl 4-hydroxylase 3         242   4e-75   Brachypodium distachyon [annual false brome]
ref|XP_002307750.2|  oxidoreductase family protein                      241   4e-75   
gb|EPS63604.1|  iron ion binding / oxidoreductase/ oxidoreductase...    241   4e-75   Genlisea aurea
ref|NP_001241695.1|  prolyl 4-hydroxylase 8-5                           241   6e-75   
ref|XP_010437420.1|  PREDICTED: prolyl 4-hydroxylase 5-like isofo...    240   1e-74   Camelina sativa [gold-of-pleasure]
ref|XP_010437419.1|  PREDICTED: prolyl 4-hydroxylase 5-like isofo...    240   1e-74   Camelina sativa [gold-of-pleasure]
ref|NP_001131953.1|  uncharacterized protein LOC100193348               240   2e-74   Zea mays [maize]
ref|XP_010432225.1|  PREDICTED: prolyl 4-hydroxylase 5-like isofo...    239   3e-74   Camelina sativa [gold-of-pleasure]
ref|XP_010432226.1|  PREDICTED: prolyl 4-hydroxylase 5-like isofo...    239   3e-74   Camelina sativa [gold-of-pleasure]
tpg|DAA49456.1|  TPA: hypothetical protein ZEAMMB73_536273              241   4e-74   
ref|XP_011003088.1|  PREDICTED: probable prolyl 4-hydroxylase 3         238   5e-74   Populus euphratica
ref|XP_010266056.1|  PREDICTED: probable prolyl 4-hydroxylase 3         239   7e-74   
ref|XP_009418644.1|  PREDICTED: probable prolyl 4-hydroxylase 3         238   9e-74   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011083428.1|  PREDICTED: probable prolyl 4-hydroxylase 3         238   9e-74   Sesamum indicum [beniseed]
ref|XP_004982729.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...    238   1e-73   Setaria italica
ref|XP_003629237.1|  Prolyl 4-hydroxylase alpha-2 subunit               237   2e-73   Medicago truncatula
ref|XP_009394475.1|  PREDICTED: probable prolyl 4-hydroxylase 3         237   2e-73   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010266057.1|  PREDICTED: probable prolyl 4-hydroxylase 10        238   2e-73   Nelumbo nucifera [Indian lotus]
ref|XP_009392830.1|  PREDICTED: probable prolyl 4-hydroxylase 3         236   5e-73   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002510597.1|  prolyl 4-hydroxylase alpha subunit, putative       235   9e-73   
ref|XP_010935631.1|  PREDICTED: probable prolyl 4-hydroxylase 3         235   1e-72   Elaeis guineensis
gb|KHG08442.1|  Prolyl 4-hydroxylase subunit alpha-1                    235   1e-72   Gossypium arboreum [tree cotton]
ref|XP_008456352.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...    234   2e-72   
ref|XP_004167095.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...    233   2e-72   
gb|EYU17561.1|  hypothetical protein MIMGU_mgv1a0210091mg               231   2e-72   Erythranthe guttata [common monkey flower]
ref|XP_008802391.1|  PREDICTED: probable prolyl 4-hydroxylase 3 i...    234   2e-72   
ref|XP_008802369.1|  PREDICTED: probable prolyl 4-hydroxylase 3 i...    234   3e-72   Phoenix dactylifera
ref|XP_002869059.1|  oxidoreductase                                     233   5e-72   Arabidopsis lyrata subsp. lyrata
ref|XP_010432223.1|  PREDICTED: prolyl 4-hydroxylase 5-like isofo...    233   8e-72   Camelina sativa [gold-of-pleasure]
ref|XP_010432224.1|  PREDICTED: prolyl 4-hydroxylase 5-like isofo...    233   1e-71   Camelina sativa [gold-of-pleasure]
gb|EEE51215.1|  hypothetical protein OsJ_32038                          229   2e-71   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009109263.1|  PREDICTED: prolyl 4-hydroxylase 5-like             232   2e-71   Brassica rapa
emb|CDY24822.1|  BnaA08g14880D                                          232   2e-71   Brassica napus [oilseed rape]
ref|NP_195306.2|  oxidoreductase, 2OG-Fe(II) oxygenase family pro...    231   3e-71   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007017903.1|  2-oxoglutarate (2OG) and Fe(II)-dependent ox...    230   3e-71   
ref|XP_002978409.1|  hypothetical protein SELMODRAFT_418273             230   3e-71   
emb|CDX69169.1|  BnaC01g02840D                                          231   3e-71   
gb|KCW70504.1|  hypothetical protein EUGRSUZ_F03711                     230   6e-71   Eucalyptus grandis [rose gum]
ref|NP_001064962.1|  Os10g0497800                                       231   8e-71   
ref|XP_002970251.1|  hypothetical protein SELMODRAFT_411114             229   9e-71   
gb|KJB43228.1|  hypothetical protein B456_007G190600                    229   1e-70   Gossypium raimondii
emb|CDX75528.1|  BnaA01g01740D                                          229   1e-70   
ref|XP_003629236.1|  Prolyl 4-hydroxylase alpha-2 subunit               230   2e-70   
ref|XP_002866777.1|  oxidoreductase                                     226   1e-69   
dbj|BAB10411.1|  prolyl 4-hydroxylase, alpha subunit-like protein       226   1e-69   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009149485.1|  PREDICTED: prolyl 4-hydroxylase 5-like isofo...    224   2e-68   Brassica rapa
ref|XP_009400627.1|  PREDICTED: probable prolyl 4-hydroxylase 3         218   2e-68   
gb|KJB48236.1|  hypothetical protein B456_008G061800                    222   5e-68   Gossypium raimondii
dbj|BAE92293.1|  putative prolyl 4-hydroxylase, alpha subunit           222   2e-67   Cryptomeria japonica
ref|XP_003629231.1|  Prolyl 4-hydroxylase alpha-2 subunit               221   3e-67   Medicago truncatula
ref|XP_006425362.1|  hypothetical protein CICLE_v10026208mg             220   3e-67   
gb|KDO71356.1|  hypothetical protein CISIN_1g023009mg                   219   7e-67   Citrus sinensis [apfelsine]
ref|XP_001754091.1|  predicted protein                                  216   2e-66   
ref|XP_003520111.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...    218   3e-66   Glycine max [soybeans]
gb|AGP04974.1|  prolyl-4-hydroxylase 5                                  216   1e-65   Physcomitrella patens
gb|KJB59734.1|  hypothetical protein B456_009G269000                    217   1e-65   Gossypium raimondii
ref|XP_002989495.1|  hypothetical protein SELMODRAFT_129912             214   1e-65   
ref|XP_008809399.1|  PREDICTED: probable prolyl 4-hydroxylase 3 i...    216   1e-65   
ref|XP_008456383.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...    216   2e-65   Cucumis melo [Oriental melon]
ref|XP_007017904.1|  2-oxoglutarate (2OG) and Fe(II)-dependent ox...    216   2e-65   
ref|XP_002964648.1|  hypothetical protein SELMODRAFT_82355              214   3e-65   
emb|CDY41627.1|  BnaC03g62570D                                          215   4e-65   Brassica napus [oilseed rape]
ref|XP_001782374.1|  predicted protein                                  213   4e-65   
gb|AGP04976.1|  prolyl-4-hydroxylase 6_b                                215   5e-65   Physcomitrella patens
ref|XP_003520105.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...    215   6e-65   Glycine max [soybeans]
ref|XP_010480555.1|  PREDICTED: probable prolyl 4-hydroxylase 3         212   5e-64   
gb|AGP04975.1|  prolyl-4-hydroxylase 6_a                                213   1e-63   Physcomitrella patens
ref|XP_006598732.1|  PREDICTED: uncharacterized protein LOC100782...    209   1e-62   Glycine max [soybeans]
gb|KDO75954.1|  hypothetical protein CISIN_1g0230532mg                  208   1e-62   Citrus sinensis [apfelsine]
emb|CDY48941.1|  BnaA08g04730D                                          211   8e-62   Brassica napus [oilseed rape]
ref|NP_001242181.1|  uncharacterized protein LOC100782154               203   2e-60   
gb|EEC74283.1|  hypothetical protein OsI_09531                          205   4e-60   Oryza sativa Indica Group [Indian rice]
gb|EEE58093.1|  hypothetical protein OsJ_08962                          206   4e-60   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004487245.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...    202   7e-60   Cicer arietinum [garbanzo]
ref|XP_003629235.1|  Prolyl 4-hydroxylase alpha-2 subunit               197   5e-59   
gb|AET03711.2|  prolyl 4-hydroxylase alpha subunit, putative            197   1e-58   Medicago truncatula
emb|CAA21467.1|  putative protein                                       199   2e-58   Arabidopsis thaliana [mouse-ear cress]
gb|EMS46596.1|  Prolyl 4-hydroxylase subunit alpha-2                    197   2e-58   Triticum urartu
gb|AAL58274.1|AC068923_16  putative prolyl 4-hydroxylase, alpha s...    197   3e-57   Oryza sativa Japonica Group [Japonica rice]
gb|EMT09490.1|  Prolyl 4-hydroxylase subunit alpha-1                    193   6e-57   
gb|AES74073.2|  prolyl 4-hydroxylase alpha-like protein                 189   4e-52   Medicago truncatula
ref|XP_010684860.1|  PREDICTED: uncharacterized protein LOC104899381    187   6e-52   
ref|XP_003603823.1|  Prolyl 4-hydroxylase alpha-2 subunit               181   9e-52   
ref|XP_003603822.1|  Prolyl 4-hydroxylase alpha-2 subunit               188   1e-51   
gb|AES74074.2|  prolyl 4-hydroxylase alpha-like protein                 181   1e-51   Medicago truncatula
ref|XP_006836965.1|  hypothetical protein AMTR_s00098p00019020          174   5e-51   
ref|XP_010451037.1|  PREDICTED: probable prolyl 4-hydroxylase 11        176   7e-51   
ref|XP_006386160.1|  hypothetical protein POPTR_0002s01820g             177   2e-50   
ref|XP_010451038.1|  PREDICTED: probable prolyl 4-hydroxylase 11        176   4e-50   Camelina sativa [gold-of-pleasure]
gb|KHG25059.1|  Prolyl 4-hydroxylase subunit alpha-1                    177   4e-50   Gossypium arboreum [tree cotton]
ref|XP_002443286.1|  hypothetical protein SORBIDRAFT_08g016950          172   5e-50   
ref|XP_008341521.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...    177   5e-50   
ref|XP_005649922.1|  hypothetical protein COCSUDRAFT_35772              174   6e-50   Coccomyxa subellipsoidea C-169
gb|KJB75782.1|  hypothetical protein B456_012G057800                    177   6e-50   Gossypium raimondii
ref|XP_008460837.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...    174   6e-50   Cucumis melo [Oriental melon]
gb|ADE76168.1|  unknown                                                 175   1e-49   Picea sitchensis
gb|AAT84604.1|  prolyl 4-hydroxylase                                    176   1e-49   Dianthus caryophyllus [carnation]
ref|XP_007032350.1|  Oxoglutarate/iron-dependent oxygenase              176   2e-49   
ref|NP_001190630.1|  2-oxoglutarate (2OG) and Fe(II)-dependent ox...    174   2e-49   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008365392.1|  PREDICTED: LOW QUALITY PROTEIN: prolyl 4-hyd...    175   3e-49   
ref|XP_008379308.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...    175   3e-49   
ref|XP_009335795.1|  PREDICTED: probable prolyl 4-hydroxylase 7         175   4e-49   Pyrus x bretschneideri [bai li]
gb|KDP45441.1|  hypothetical protein JCGZ_09690                         175   5e-49   Jatropha curcas
gb|KJB40816.1|  hypothetical protein B456_007G078100                    172   6e-49   Gossypium raimondii
ref|XP_010033232.1|  PREDICTED: probable prolyl 4-hydroxylase 7         174   9e-49   Eucalyptus grandis [rose gum]
ref|XP_002517437.1|  prolyl 4-hydroxylase alpha subunit, putative       174   1e-48   Ricinus communis
emb|CDP20599.1|  unnamed protein product                                173   1e-48   
ref|XP_010437417.1|  PREDICTED: probable prolyl 4-hydroxylase 11        172   2e-48   
gb|EPS61415.1|  type 2 proly 4-hydroxylase                              172   4e-48   
gb|KJB40817.1|  hypothetical protein B456_007G078100                    171   6e-48   
ref|XP_004139390.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...    171   7e-48   
ref|XP_007215695.1|  hypothetical protein PRUPE_ppa008787mg             171   8e-48   
ref|XP_009766050.1|  PREDICTED: probable prolyl 4-hydroxylase 6         171   1e-47   
ref|XP_004167094.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...    171   1e-47   
ref|XP_008230700.1|  PREDICTED: prolyl 4-hydroxylase subunit alpha-1    171   1e-47   
gb|KHN00440.1|  Prolyl 4-hydroxylase subunit alpha-1                    175   2e-47   
ref|XP_003571778.1|  PREDICTED: probable prolyl 4-hydroxylase 7         170   2e-47   
ref|XP_002281420.1|  PREDICTED: probable prolyl 4-hydroxylase 6         170   2e-47   
ref|XP_009617950.1|  PREDICTED: probable prolyl 4-hydroxylase 6         170   3e-47   
ref|XP_006357128.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...    170   3e-47   
ref|XP_004302371.1|  PREDICTED: probable prolyl 4-hydroxylase 7         170   4e-47   
gb|KJB24936.1|  hypothetical protein B456_004G168800                    167   4e-47   
gb|EMT18067.1|  Prolyl 4-hydroxylase subunit alpha-2                    167   5e-47   
ref|XP_009403981.1|  PREDICTED: probable prolyl 4-hydroxylase 6 i...    169   5e-47   
gb|KJB15318.1|  hypothetical protein B456_002G170800                    169   7e-47   
gb|EMS64054.1|  Prolyl 4-hydroxylase subunit alpha-2                    168   7e-47   
ref|XP_010932926.1|  PREDICTED: probable prolyl 4-hydroxylase 7 i...    168   1e-46   
ref|XP_010255777.1|  PREDICTED: probable prolyl 4-hydroxylase 6         168   1e-46   
ref|XP_006291518.1|  hypothetical protein CARUB_v10017667mg             168   2e-46   
ref|XP_004233344.1|  PREDICTED: probable prolyl 4-hydroxylase 6         167   2e-46   
emb|CDO98947.1|  unnamed protein product                                167   2e-46   
ref|XP_009760981.1|  PREDICTED: probable prolyl 4-hydroxylase 4         167   3e-46   
ref|XP_010934126.1|  PREDICTED: probable prolyl 4-hydroxylase 7 i...    166   3e-46   
gb|KJB24937.1|  hypothetical protein B456_004G168800                    167   3e-46   
ref|XP_011008369.1|  PREDICTED: probable prolyl 4-hydroxylase 6         167   3e-46   
gb|EYU34687.1|  hypothetical protein MIMGU_mgv1a023388mg                166   4e-46   
ref|XP_006356692.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...    166   5e-46   
gb|EYU34124.1|  hypothetical protein MIMGU_mgv1a008232mg                168   6e-46   
dbj|BAF63493.1|  prolyl 4-hydroxylase                                   164   7e-46   
ref|XP_006650750.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...    164   8e-46   
ref|NP_001169835.1|  prolyl 4-hydroxylase 2 precursor                   166   8e-46   
ref|XP_004241065.1|  PREDICTED: probable prolyl 4-hydroxylase 4         166   8e-46   
ref|XP_010934120.1|  PREDICTED: probable prolyl 4-hydroxylase 7 i...    166   1e-45   
ref|XP_010029258.1|  PREDICTED: probable prolyl 4-hydroxylase 7         166   1e-45   
ref|XP_002954156.1|  hypothetical protein VOLCADRAFT_82641              166   1e-45   
pdb|2JIG|A  Chain A, Crystal Structure Of Chlamydomonas Reinhardt...    163   1e-45   
pdb|3GZE|A  Chain A, Algal Prolyl 4-hydroxylase Complexed With Zi...    163   1e-45   
ref|XP_004981380.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...    165   1e-45   
gb|KCW60920.1|  hypothetical protein EUGRSUZ_H03653                     164   1e-45   
gb|EMT08121.1|  Prolyl 4-hydroxylase subunit alpha-1                    165   1e-45   
pdb|2JIJ|A  Chain A, Crystal Structure Of The Apo Form Of Chlamyd...    163   2e-45   
ref|XP_010554021.1|  PREDICTED: probable prolyl 4-hydroxylase 7         166   2e-45   
ref|XP_003564301.1|  PREDICTED: probable prolyl 4-hydroxylase 6         165   2e-45   
dbj|BAJ97134.1|  predicted protein                                      165   2e-45   
ref|XP_010514553.1|  PREDICTED: probable prolyl 4-hydroxylase 7         165   2e-45   
ref|XP_010670355.1|  PREDICTED: probable prolyl 4-hydroxylase 6         165   2e-45   
gb|KGN60774.1|  hypothetical protein Csa_2G009610                       163   2e-45   
ref|XP_010425628.1|  PREDICTED: probable prolyl 4-hydroxylase 7         165   2e-45   
ref|XP_010502850.1|  PREDICTED: probable prolyl 4-hydroxylase 7         165   2e-45   
ref|XP_002467256.1|  hypothetical protein SORBIDRAFT_01g022150          165   2e-45   
ref|XP_003543632.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...    165   2e-45   
ref|XP_006365272.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...    164   2e-45   
gb|KDO72423.1|  hypothetical protein CISIN_1g021056mg                   162   3e-45   
ref|XP_002977584.1|  hypothetical protein SELMODRAFT_106693             164   3e-45   
ref|NP_001176154.1|  Os10g0415128                                       162   3e-45   
ref|XP_002975178.1|  hypothetical protein SELMODRAFT_174666             164   3e-45   
ref|XP_009602696.1|  PREDICTED: probable prolyl 4-hydroxylase 4         164   3e-45   
gb|AFW68768.1|  hypothetical protein ZEAMMB73_452923                    161   3e-45   
gb|AFW68767.1|  hypothetical protein ZEAMMB73_452923                    161   4e-45   
gb|AAV64222.1|  unknown                                                 166   4e-45   
ref|XP_006290404.1|  hypothetical protein CARUB_v10018771mg             164   4e-45   
ref|XP_004229482.1|  PREDICTED: probable prolyl 4-hydroxylase 4         164   4e-45   
ref|XP_004983172.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...    164   4e-45   
ref|XP_010693781.1|  PREDICTED: probable prolyl 4-hydroxylase 4         164   4e-45   
ref|XP_009604218.1|  PREDICTED: probable prolyl 4-hydroxylase 4         164   5e-45   
gb|ACG35468.1|  prolyl 4-hydroxylase                                    164   5e-45   
ref|XP_009149614.1|  PREDICTED: prolyl 4-hydroxylase 5-like isofo...    162   5e-45   
ref|XP_002877111.1|  oxidoreductase                                     164   5e-45   
ref|XP_002324024.1|  hypothetical protein POPTR_0017s11150g             164   6e-45   
ref|XP_010024472.1|  PREDICTED: probable prolyl 4-hydroxylase 4         164   6e-45   
ref|XP_008812319.1|  PREDICTED: probable prolyl 4-hydroxylase 6 i...    164   6e-45   
ref|XP_001697425.1|  predicted protein                                  163   8e-45   
gb|EMS60792.1|  Prolyl 4-hydroxylase subunit alpha-1                    162   8e-45   
gb|AAV64184.1|  unknown                                                 166   9e-45   
emb|CDX86429.1|  BnaA06g31460D                                          164   9e-45   
ref|XP_011098556.1|  PREDICTED: probable prolyl 4-hydroxylase 7         163   9e-45   
ref|XP_011090892.1|  PREDICTED: probable prolyl 4-hydroxylase 4         163   9e-45   
ref|XP_006395360.1|  hypothetical protein EUTSA_v10004627mg             163   1e-44   
ref|XP_009772473.1|  PREDICTED: probable prolyl 4-hydroxylase 4         164   1e-44   
ref|NP_001051610.1|  Os03g0803500                                       163   1e-44   
ref|NP_001064592.1|  Os10g0413500                                       163   1e-44   
ref|XP_006431045.1|  hypothetical protein CICLE_v10012224mg             163   1e-44   
gb|EEC66934.1|  hypothetical protein OsI_33548                          163   1e-44   
ref|XP_009151868.1|  PREDICTED: probable prolyl 4-hydroxylase 7         164   1e-44   
ref|XP_006661770.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...    160   1e-44   
ref|XP_003554232.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...    163   1e-44   
ref|NP_001132477.1|  uncharacterized protein LOC100193935 precursor     162   2e-44   
ref|XP_006482512.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...    163   2e-44   
gb|KDO72422.1|  hypothetical protein CISIN_1g021056mg                   162   2e-44   
ref|XP_002463711.1|  hypothetical protein SORBIDRAFT_01g004670          162   2e-44   
ref|NP_001241863.1|  prolyl 4-hydroxylase 4 precursor                   161   2e-44   
gb|KHG03768.1|  Prolyl 4-hydroxylase subunit alpha-1                    162   3e-44   
ref|XP_007035415.1|  2-oxoglutarate and Fe(II)-dependent oxygenas...    161   3e-44   
ref|XP_006842809.1|  hypothetical protein AMTR_s00081p00029310          162   3e-44   
gb|ACU19077.1|  unknown                                                 162   3e-44   
gb|KJB38490.1|  hypothetical protein B456_006G256500                    162   3e-44   
ref|XP_002439985.1|  hypothetical protein SORBIDRAFT_09g023860          162   4e-44   
ref|XP_010425629.1|  PREDICTED: probable prolyl 4-hydroxylase 6         161   4e-44   
ref|XP_010934134.1|  PREDICTED: probable prolyl 4-hydroxylase 7         161   4e-44   
ref|XP_010912106.1|  PREDICTED: probable prolyl 4-hydroxylase 4         161   4e-44   
ref|XP_008360309.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...    161   4e-44   
gb|ABB47602.2|  prolyl 4-hydroxylase, putative, expressed               162   4e-44   
ref|XP_010412436.1|  PREDICTED: probable prolyl 4-hydroxylase 6         161   4e-44   
ref|XP_009403381.1|  PREDICTED: probable prolyl 4-hydroxylase 7         159   5e-44   
gb|AAL57673.1|  AT3g28480/MFJ20_16                                      162   5e-44   
ref|NP_566838.1|  oxoglutarate/iron-dependent oxygenase                 162   5e-44   
ref|XP_010272176.1|  PREDICTED: probable prolyl 4-hydroxylase 7         161   5e-44   
gb|ACN36301.1|  unknown                                                 161   6e-44   
ref|XP_009352176.1|  PREDICTED: probable prolyl 4-hydroxylase 4         161   6e-44   
ref|NP_001241866.1|  prolyl 4-hydroxylase 6 precursor                   160   7e-44   
gb|KDP40054.1|  hypothetical protein JCGZ_02052                         160   7e-44   
ref|XP_010242572.1|  PREDICTED: probable prolyl 4-hydroxylase 4         160   7e-44   
ref|XP_004134175.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...    160   7e-44   
ref|NP_001189994.1|  oxoglutarate/iron-dependent oxygenase              161   7e-44   
ref|XP_002877112.1|  predicted protein                                  160   8e-44   
dbj|BAB02864.1|  prolyl 4-hydroxylase alpha subunit-like protein        161   9e-44   
ref|NP_001149322.1|  LOC100282945 precursor                             160   9e-44   
ref|NP_001141909.1|  hypothetical protein                               158   1e-43   
gb|EPS60054.1|  hypothetical protein M569_14750                         157   1e-43   
gb|KGN57053.1|  hypothetical protein Csa_3G150820                       161   1e-43   
ref|XP_002516833.1|  prolyl 4-hydroxylase alpha subunit, putative       160   1e-43   
ref|XP_002324025.2|  hypothetical protein POPTR_0017s11170g             157   1e-43   
ref|XP_008681529.1|  PREDICTED: hypothetical protein isoform X4         160   1e-43   
ref|XP_002505227.1|  predicted protein                                  159   1e-43   
ref|XP_003631980.1|  PREDICTED: probable prolyl 4-hydroxylase 4         160   2e-43   
ref|XP_008438765.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...    160   2e-43   
ref|XP_009369073.1|  PREDICTED: probable prolyl 4-hydroxylase 4         160   2e-43   
ref|XP_008340954.1|  PREDICTED: prolyl 4-hydroxylase subunit alpha-1    160   2e-43   
pdb|2V4A|A  Chain A, Crystal Structure Of The Semet-Labeled Proly...    157   2e-43   
ref|XP_010279264.1|  PREDICTED: probable prolyl 4-hydroxylase 4         159   2e-43   
gb|EMS54172.1|  Type I inositol-1,4,5-trisphosphate 5-phosphatase...    166   2e-43   
ref|NP_001055890.1|  Os05g0489100                                       160   2e-43   
gb|EAY98503.1|  hypothetical protein OsI_20415                          160   2e-43   
emb|CDY00131.1|  BnaC09g01700D                                          159   3e-43   
ref|XP_009111597.1|  PREDICTED: probable prolyl 4-hydroxylase 7         159   3e-43   
ref|XP_008681527.1|  PREDICTED: hypothetical protein isoform X2         160   3e-43   
ref|XP_011006089.1|  PREDICTED: probable prolyl 4-hydroxylase 4         159   4e-43   
emb|CDX85201.1|  BnaC07g25120D                                          164   4e-43   
ref|XP_006416415.1|  hypothetical protein EUTSA_v10010038mg             152   4e-43   
ref|XP_007223204.1|  hypothetical protein PRUPE_ppa009336mg             159   4e-43   
ref|XP_002312720.1|  oxidoreductase family protein                      159   4e-43   
ref|XP_006658366.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...    159   5e-43   
ref|XP_003618430.1|  Prolyl 4-hydroxylase subunit alpha-2               159   6e-43   
ref|XP_005644366.1|  hypothetical protein COCSUDRAFT_25518              159   6e-43   
ref|XP_008351224.1|  PREDICTED: uncharacterized protein LOC103414638    159   6e-43   
ref|XP_004233694.1|  PREDICTED: probable prolyl 4-hydroxylase 6         159   7e-43   
ref|XP_006489270.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...    155   8e-43   
gb|AAO42145.1|  putative prolyl 4-hydroxylase                           157   9e-43   
ref|XP_008681528.1|  PREDICTED: hypothetical protein isoform X3         158   9e-43   
gb|KFK26128.1|  hypothetical protein AALP_AA8G207300                    157   1e-42   
ref|NP_001059113.1|  Os07g0194500                                       158   1e-42   
gb|EEC81680.1|  hypothetical protein OsI_25242                          162   1e-42   
gb|EEC76363.1|  hypothetical protein OsI_13952                          166   1e-42   
ref|XP_008808711.1|  PREDICTED: probable prolyl 4-hydroxylase 6 i...    157   1e-42   
dbj|BAC83179.1|  prolyl 4-hydroxylase alpha-1 subunit precursor-l...    158   1e-42   
ref|XP_002461632.1|  hypothetical protein SORBIDRAFT_02g005750          157   1e-42   
gb|KHN03021.1|  Prolyl 4-hydroxylase subunit alpha-1                    157   1e-42   
ref|XP_004489361.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...    158   1e-42   
ref|XP_011401793.1|  Prolyl 4-hydroxylase subunit alpha-2               157   2e-42   
gb|KDO74949.1|  hypothetical protein CISIN_1g022406mg                   157   2e-42   
ref|XP_009759224.1|  PREDICTED: LOW QUALITY PROTEIN: probable pro...    155   2e-42   
ref|XP_009390814.1|  PREDICTED: prolyl 4-hydroxylase 1-like isofo...    155   2e-42   
ref|NP_189490.2|  Oxoglutarate/iron-dependent oxygenase                 156   2e-42   
ref|XP_008681526.1|  PREDICTED: hypothetical protein isoform X1         158   2e-42   
ref|XP_006419737.1|  hypothetical protein CICLE_v10005535mg             156   3e-42   
ref|XP_006654567.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...    157   3e-42   
gb|ABI79328.1|  prolyl 4-hydroxylase                                    156   3e-42   
ref|XP_009412183.1|  PREDICTED: probable prolyl 4-hydroxylase 4 i...    156   4e-42   
ref|XP_009126289.1|  PREDICTED: probable prolyl 4-hydroxylase 4         156   4e-42   
ref|XP_010105675.1|  Prolyl 4-hydroxylase subunit alpha-1               156   4e-42   
gb|KJB43229.1|  hypothetical protein B456_007G190600                    154   4e-42   
gb|EEE66737.1|  hypothetical protein OsJ_23428                          160   4e-42   
ref|XP_009390813.1|  PREDICTED: prolyl 4-hydroxylase 1-like isofo...    155   5e-42   
ref|XP_008223071.1|  PREDICTED: prolyl 4-hydroxylase subunit alpha-1    156   5e-42   
gb|KHG08217.1|  Prolyl 4-hydroxylase subunit alpha-1                    156   5e-42   
emb|CDY47187.1|  BnaAnng08570D                                          155   6e-42   
ref|XP_007154205.1|  hypothetical protein PHAVU_003G098900g             155   7e-42   
ref|XP_008795106.1|  PREDICTED: probable prolyl 4-hydroxylase 4         155   7e-42   
ref|XP_004296772.2|  PREDICTED: probable prolyl 4-hydroxylase 4         156   8e-42   
ref|XP_006845819.1|  hypothetical protein AMTR_s00019p00257460          155   9e-42   
ref|XP_002966127.1|  hypothetical protein SELMODRAFT_86017              152   1e-41   
ref|XP_010091922.1|  Prolyl 4-hydroxylase subunit alpha-1               156   1e-41   
dbj|BAB02865.1|  unnamed protein product                                156   1e-41   
ref|XP_002965471.1|  hypothetical protein SELMODRAFT_67344              154   1e-41   
ref|XP_002993198.1|  hypothetical protein SELMODRAFT_431327             154   1e-41   
gb|ABK23496.1|  unknown                                                 152   1e-41   
gb|KJB40815.1|  hypothetical protein B456_007G078100                    151   1e-41   
emb|CDY02598.1|  BnaC02g08370D                                          155   1e-41   
ref|NP_001242363.1|  uncharacterized protein LOC100796794 precursor     155   1e-41   
emb|CDX92575.1|  BnaA10g16140D                                          154   1e-41   
ref|XP_004168311.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...    155   2e-41   
ref|XP_004159836.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...    155   2e-41   
ref|XP_009120936.1|  PREDICTED: probable prolyl 4-hydroxylase 4         154   2e-41   
ref|XP_010420665.1|  PREDICTED: probable prolyl 4-hydroxylase 4         154   2e-41   
gb|KJB72513.1|  hypothetical protein B456_011G182800                    154   2e-41   
ref|XP_004961690.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...    155   2e-41   
gb|KJB33682.1|  hypothetical protein B456_006G026200                    154   2e-41   
ref|NP_001241485.1|  uncharacterized protein LOC100783075 precursor     154   2e-41   
ref|XP_010492924.1|  PREDICTED: probable prolyl 4-hydroxylase 4         154   2e-41   
ref|XP_008458700.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...    155   2e-41   
ref|XP_011008367.1|  PREDICTED: probable prolyl 4-hydroxylase 7         154   2e-41   
ref|XP_001775487.1|  predicted protein                                  153   2e-41   
ref|XP_004144967.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...    154   2e-41   
ref|XP_008458517.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...    154   2e-41   
ref|XP_004486084.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...    154   3e-41   
ref|XP_008647882.1|  PREDICTED: LOC100282945 isoform X1                 162   3e-41   
ref|XP_004955738.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...    154   3e-41   
ref|XP_010454140.1|  PREDICTED: probable prolyl 4-hydroxylase 4         154   3e-41   
ref|XP_007151176.1|  hypothetical protein PHAVU_004G024300g             154   3e-41   
emb|CDY13928.1|  BnaC09g38980D                                          154   4e-41   
emb|CDY38223.1|  BnaA09g11660D                                          154   4e-41   
ref|XP_002873917.1|  oxidoreductase                                     154   4e-41   
ref|XP_003594053.1|  Prolyl 4-hydroxylase alpha subunit-like protein    154   4e-41   
gb|AAO72377.1|  putative oxidoreductase                                 154   4e-41   
ref|XP_004148682.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...    153   6e-41   
gb|AAM13038.1|  unknown protein                                         153   6e-41   
ref|XP_006288327.1|  hypothetical protein CARUB_v10001574mg             153   6e-41   



>ref|XP_006340784.1| PREDICTED: prolyl 4-hydroxylase subunit alpha-1-like [Solanum 
tuberosum]
Length=287

 Score =   271 bits (692),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 127/141 (90%), Positives = 132/141 (94%), Gaps = 0/141 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLD++NTKNGGQRIATV MYLSDV+E
Sbjct  147  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDEFNTKNGGQRIATVLMYLSDVDE  206

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGETVFP+AKGN SAVPW NEL ECGKGGLSVKPKMGDALL WSMKPD +LDPSSLHGGC
Sbjct  207  GGETVFPAAKGNYSAVPWWNELSECGKGGLSVKPKMGDALLFWSMKPDATLDPSSLHGGC  266

Query  363  PVIKGNKWSXTKXMRVREYKA  301
            PVIKGNKWS TK MRV EYKA
Sbjct  267  PVIKGNKWSSTKWMRVDEYKA  287



>ref|XP_006380560.1| hypothetical protein POPTR_0007s09270g, partial [Populus trichocarpa]
 gb|ERP58357.1| hypothetical protein POPTR_0007s09270g, partial [Populus trichocarpa]
Length=287

 Score =   271 bits (692),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 126/141 (89%), Positives = 133/141 (94%), Gaps = 0/141 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRIADF+FIP+EHGEGLQILHYEVGQKYEPH+DYF+DDYNT+NGGQRIATV MYLSDVEE
Sbjct  147  KRIADFSFIPSEHGEGLQILHYEVGQKYEPHFDYFMDDYNTENGGQRIATVLMYLSDVEE  206

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGETVFPSAKGNIS+VPW NEL ECGKGGLSVKPKMGDALL WSMKPD SLDPSSLHGGC
Sbjct  207  GGETVFPSAKGNISSVPWWNELSECGKGGLSVKPKMGDALLFWSMKPDASLDPSSLHGGC  266

Query  363  PVIKGNKWSXTKXMRVREYKA  301
            PVI+GNKWS TK MRV EYKA
Sbjct  267  PVIRGNKWSSTKWMRVNEYKA  287



>ref|XP_007046593.1| 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily 
protein isoform 1 [Theobroma cacao]
 ref|XP_007046596.1| 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily 
protein isoform 1 [Theobroma cacao]
 gb|EOX90750.1| 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily 
protein isoform 1 [Theobroma cacao]
 gb|EOX90753.1| 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily 
protein isoform 1 [Theobroma cacao]
Length=283

 Score =   269 bits (688),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 125/141 (89%), Positives = 131/141 (93%), Gaps = 0/141 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRIADFTFIP EHGEGLQILHYEVGQKYEPHYDYF+D++NTKNGGQRIATV MYLSDVEE
Sbjct  143  KRIADFTFIPVEHGEGLQILHYEVGQKYEPHYDYFMDEFNTKNGGQRIATVLMYLSDVEE  202

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGETVFP+AKGNISAVPW NEL ECGKGGLSVKPKMGDALL WSMKPD SLDPSSLHGGC
Sbjct  203  GGETVFPAAKGNISAVPWWNELSECGKGGLSVKPKMGDALLFWSMKPDASLDPSSLHGGC  262

Query  363  PVIKGNKWSXTKXMRVREYKA  301
            PVI+GNKWS TK +RV EYK 
Sbjct  263  PVIRGNKWSSTKWIRVNEYKV  283



>gb|KHG30312.1| Prolyl 4-hydroxylase subunit alpha-1 [Gossypium arboreum]
Length=289

 Score =   269 bits (687),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 124/141 (88%), Positives = 131/141 (93%), Gaps = 0/141 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            +RIADFTFIP EHGEGLQ+LHYEVGQKYEPHYDYF+D++NTKNGGQRIATV MYLSDVEE
Sbjct  149  QRIADFTFIPVEHGEGLQVLHYEVGQKYEPHYDYFMDEFNTKNGGQRIATVLMYLSDVEE  208

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGETVFPSAKGNISAVPW NEL ECGKGGLSVKPKMGDALL WSMKPD +LDPSSLHGGC
Sbjct  209  GGETVFPSAKGNISAVPWWNELSECGKGGLSVKPKMGDALLFWSMKPDATLDPSSLHGGC  268

Query  363  PVIKGNKWSXTKXMRVREYKA  301
            PVI+GNKWS TK MRV EYK 
Sbjct  269  PVIRGNKWSSTKWMRVNEYKV  289



>ref|XP_011014780.1| PREDICTED: probable prolyl 4-hydroxylase 10 [Populus euphratica]
Length=291

 Score =   268 bits (685),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 125/141 (89%), Positives = 131/141 (93%), Gaps = 0/141 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRIADF+FIPAEHGEGLQILHYEVGQKYEPH+DY +DDYNT+NGGQRIATV MYLSDVEE
Sbjct  151  KRIADFSFIPAEHGEGLQILHYEVGQKYEPHFDYLMDDYNTENGGQRIATVLMYLSDVEE  210

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGETVFPSAKGNIS+VPW NEL ECGKGGLSVKPKMGDALL WSMKPD SLDPSSLHGGC
Sbjct  211  GGETVFPSAKGNISSVPWWNELSECGKGGLSVKPKMGDALLFWSMKPDASLDPSSLHGGC  270

Query  363  PVIKGNKWSXTKXMRVREYKA  301
            PVI+GNKWS TK MRV EYK 
Sbjct  271  PVIRGNKWSSTKWMRVNEYKV  291



>gb|EYU30384.1| hypothetical protein MIMGU_mgv1a011046mg [Erythranthe guttata]
Length=294

 Score =   268 bits (684),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 122/141 (87%), Positives = 131/141 (93%), Gaps = 0/141 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRIADFTFIP EHGEGLQILHYEVGQKYEPHYDYF+D++NT+NGGQRIATV MYLSDVEE
Sbjct  154  KRIADFTFIPVEHGEGLQILHYEVGQKYEPHYDYFMDEFNTQNGGQRIATVLMYLSDVEE  213

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGETVFP+AKGNISAVPW NEL +CGK GLS+KPKMGDALL WSMKPD +LDPSSLHGGC
Sbjct  214  GGETVFPAAKGNISAVPWWNELSQCGKEGLSIKPKMGDALLFWSMKPDATLDPSSLHGGC  273

Query  363  PVIKGNKWSXTKXMRVREYKA  301
            PVI+GNKWS TK MRV EYKA
Sbjct  274  PVIRGNKWSSTKWMRVHEYKA  294



>ref|XP_004232524.1| PREDICTED: probable prolyl 4-hydroxylase 10 [Solanum lycopersicum]
Length=287

 Score =   266 bits (681),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 125/141 (89%), Positives = 129/141 (91%), Gaps = 0/141 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRIADFTFIP EHGEGLQILHYEVGQKYEPHYDYFLD++NTKNGGQRIATV MYLSDV+E
Sbjct  147  KRIADFTFIPVEHGEGLQILHYEVGQKYEPHYDYFLDEFNTKNGGQRIATVLMYLSDVDE  206

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGETVFP+AKGN SAVPW NEL  CGKGGLSVKPKMGDALL WSMKPD  LDPSSLHGGC
Sbjct  207  GGETVFPAAKGNYSAVPWWNELSVCGKGGLSVKPKMGDALLFWSMKPDAVLDPSSLHGGC  266

Query  363  PVIKGNKWSXTKXMRVREYKA  301
            PVIKGNKWS TK MRV EYKA
Sbjct  267  PVIKGNKWSSTKWMRVHEYKA  287



>ref|XP_009622125.1| PREDICTED: probable prolyl 4-hydroxylase 10 [Nicotiana tomentosiformis]
Length=291

 Score =   266 bits (681),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 124/141 (88%), Positives = 130/141 (92%), Gaps = 0/141 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRIADFTFIP EHGEGLQ+LHYEVGQKYEPHYDYFLD++NTKNGGQRIATV MYLSDVEE
Sbjct  151  KRIADFTFIPVEHGEGLQVLHYEVGQKYEPHYDYFLDEFNTKNGGQRIATVLMYLSDVEE  210

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGETVFP+AKGN SAVPW NEL ECGKGGLSVKPK GDALL WSMKPD +LDPSSLHGGC
Sbjct  211  GGETVFPAAKGNYSAVPWWNELSECGKGGLSVKPKRGDALLFWSMKPDATLDPSSLHGGC  270

Query  363  PVIKGNKWSXTKXMRVREYKA  301
            PVIKGNKWS TK +RV EYKA
Sbjct  271  PVIKGNKWSSTKWIRVHEYKA  291



>gb|KJB43227.1| hypothetical protein B456_007G190600 [Gossypium raimondii]
 gb|KJB43230.1| hypothetical protein B456_007G190600 [Gossypium raimondii]
 gb|KJB43231.1| hypothetical protein B456_007G190600 [Gossypium raimondii]
Length=289

 Score =   266 bits (681),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 122/141 (87%), Positives = 131/141 (93%), Gaps = 0/141 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            +RIADFTFIP EHGEGLQ+LHYEVGQKYEPH+DYF+D++NTKNGGQRIATV MYLSDVEE
Sbjct  149  QRIADFTFIPVEHGEGLQVLHYEVGQKYEPHFDYFMDEFNTKNGGQRIATVLMYLSDVEE  208

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGETVFPSAKGNISAVPW NEL ECGKGGLSVKPKMGDALL WSMKPD +LDPSSLHGGC
Sbjct  209  GGETVFPSAKGNISAVPWWNELSECGKGGLSVKPKMGDALLFWSMKPDATLDPSSLHGGC  268

Query  363  PVIKGNKWSXTKXMRVREYKA  301
            PVI+GNKWS TK +RV EYK 
Sbjct  269  PVIRGNKWSSTKWIRVNEYKV  289



>emb|CDP01844.1| unnamed protein product [Coffea canephora]
Length=291

 Score =   265 bits (678),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 122/141 (87%), Positives = 129/141 (91%), Gaps = 0/141 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRIADF FIP EHGEGLQILHYEVGQKYEPHYDYFLD++NT+NGGQRIATV MYLSD+EE
Sbjct  151  KRIADFAFIPVEHGEGLQILHYEVGQKYEPHYDYFLDEFNTRNGGQRIATVLMYLSDIEE  210

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGETVFP+AKGNISAVPW NEL ECGKGGLSVKPK GDALL WSMKPD +LDPSSLHGGC
Sbjct  211  GGETVFPAAKGNISAVPWWNELSECGKGGLSVKPKRGDALLFWSMKPDATLDPSSLHGGC  270

Query  363  PVIKGNKWSXTKXMRVREYKA  301
            PVI+GNKWS TK MRV EYK 
Sbjct  271  PVIRGNKWSSTKWMRVHEYKV  291



>ref|XP_011022255.1| PREDICTED: probable prolyl 4-hydroxylase 10 [Populus euphratica]
Length=290

 Score =   264 bits (675),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 123/141 (87%), Positives = 130/141 (92%), Gaps = 0/141 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRIADF+FIP EHGEGLQILHYEVGQ+YEPH+DYF+D+YNTKNGGQRIATV MYLSDVEE
Sbjct  150  KRIADFSFIPVEHGEGLQILHYEVGQRYEPHFDYFMDEYNTKNGGQRIATVLMYLSDVEE  209

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGETVFPSA+GNISAVPW NEL ECGKGGLSVKPKMGDALL WSM PDGS DPSSLHGGC
Sbjct  210  GGETVFPSAEGNISAVPWWNELSECGKGGLSVKPKMGDALLFWSMNPDGSPDPSSLHGGC  269

Query  363  PVIKGNKWSXTKXMRVREYKA  301
            PVI+GNKWS TK MRV EYK 
Sbjct  270  PVIRGNKWSSTKWMRVNEYKV  290



>ref|XP_006383041.1| hypothetical protein POPTR_0005s10980g [Populus trichocarpa]
 gb|ERP60838.1| hypothetical protein POPTR_0005s10980g [Populus trichocarpa]
Length=291

 Score =   264 bits (675),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 123/141 (87%), Positives = 130/141 (92%), Gaps = 0/141 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRIADF+FIP EHGEGLQILHYEVGQ+YEPH+DYF+D+YNTKNGGQRIATV MYLSDVEE
Sbjct  151  KRIADFSFIPVEHGEGLQILHYEVGQRYEPHFDYFMDEYNTKNGGQRIATVLMYLSDVEE  210

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGETVFPSA+GNISAVPW NEL ECGKGGLSVKPKMGDALL WSM PDGS DPSSLHGGC
Sbjct  211  GGETVFPSAEGNISAVPWWNELSECGKGGLSVKPKMGDALLFWSMNPDGSPDPSSLHGGC  270

Query  363  PVIKGNKWSXTKXMRVREYKA  301
            PVI+GNKWS TK MRV EYK 
Sbjct  271  PVIRGNKWSSTKWMRVNEYKV  291



>ref|XP_009587704.1| PREDICTED: probable prolyl 4-hydroxylase 10 [Nicotiana tomentosiformis]
Length=290

 Score =   263 bits (672),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 123/141 (87%), Positives = 128/141 (91%), Gaps = 0/141 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRIADFTFIP EHGEGLQILHYEVGQKYEPH+DYF D++NT NGGQRIATV MYLSDVEE
Sbjct  150  KRIADFTFIPVEHGEGLQILHYEVGQKYEPHFDYFADEFNTINGGQRIATVLMYLSDVEE  209

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGETVFP+AKGN SAVPW NEL ECGKGGLSVKPKMGDALL WSMKPD +LDPSSLHGGC
Sbjct  210  GGETVFPTAKGNFSAVPWWNELSECGKGGLSVKPKMGDALLFWSMKPDATLDPSSLHGGC  269

Query  363  PVIKGNKWSXTKXMRVREYKA  301
            PVIKGNKWS TK MRV EYK 
Sbjct  270  PVIKGNKWSSTKWMRVHEYKV  290



>ref|XP_010485337.1| PREDICTED: probable prolyl 4-hydroxylase 10 [Camelina sativa]
Length=176

 Score =   259 bits (661),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 119/141 (84%), Positives = 128/141 (91%), Gaps = 0/141 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRI+DFTFIP EHGEGLQ+LHYE+GQKYEPHYDYF+D+YNT+NGGQRIATV MYLSDVEE
Sbjct  36   KRISDFTFIPVEHGEGLQVLHYEIGQKYEPHYDYFMDEYNTRNGGQRIATVLMYLSDVEE  95

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGETVFP+AKGN SAVPW NEL ECGKGGLSVKPKMGDALL WSM PD +LDPSSLHGGC
Sbjct  96   GGETVFPAAKGNYSAVPWWNELSECGKGGLSVKPKMGDALLFWSMTPDATLDPSSLHGGC  155

Query  363  PVIKGNKWSXTKXMRVREYKA  301
             VIKGNKWS TK +RV EYK 
Sbjct  156  AVIKGNKWSSTKWLRVHEYKV  176



>ref|XP_011079010.1| PREDICTED: probable prolyl 4-hydroxylase 10 [Sesamum indicum]
Length=295

 Score =   263 bits (672),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 121/141 (86%), Positives = 130/141 (92%), Gaps = 0/141 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRIADFTF+P EHGEGLQILHYE GQKYEPHYDYFLD++NT+NGGQRIATV MYLSDVEE
Sbjct  155  KRIADFTFLPVEHGEGLQILHYEAGQKYEPHYDYFLDEFNTQNGGQRIATVLMYLSDVEE  214

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGETVFP+AKGN S+VPW NEL ECGKGGLSVKPKMGDALL WSMKPD +LDPSSLHGGC
Sbjct  215  GGETVFPAAKGNFSSVPWWNELSECGKGGLSVKPKMGDALLFWSMKPDATLDPSSLHGGC  274

Query  363  PVIKGNKWSXTKXMRVREYKA  301
            PVIKGNKWS TK +R+ EYKA
Sbjct  275  PVIKGNKWSSTKWIRIHEYKA  295



>ref|XP_009776785.1| PREDICTED: probable prolyl 4-hydroxylase 10 [Nicotiana sylvestris]
Length=290

 Score =   263 bits (671),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 122/141 (87%), Positives = 129/141 (91%), Gaps = 0/141 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            K+IADFTFIP EHGEGLQ+LHYEVGQKYEPHYDYFLD++NTKNGGQRIATV MYLSDVEE
Sbjct  150  KKIADFTFIPVEHGEGLQVLHYEVGQKYEPHYDYFLDEFNTKNGGQRIATVLMYLSDVEE  209

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGETVFP+AKGN SAVPW NEL ECGK GLSVKPK GDALL WSMKPD +LDPSSLHGGC
Sbjct  210  GGETVFPAAKGNYSAVPWWNELSECGKDGLSVKPKRGDALLFWSMKPDATLDPSSLHGGC  269

Query  363  PVIKGNKWSXTKXMRVREYKA  301
            PVIKGNKWS TK +RV EYKA
Sbjct  270  PVIKGNKWSSTKWIRVHEYKA  290



>emb|CDX81416.1| BnaC09g08270D [Brassica napus]
Length=287

 Score =   262 bits (670),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 120/140 (86%), Positives = 128/140 (91%), Gaps = 0/140 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRI+DFTFIP EHGEGLQ+LHYE+GQKYEPHYDYF+D+YNT+NGGQRIATV MYLSDVEE
Sbjct  147  KRISDFTFIPVEHGEGLQVLHYEIGQKYEPHYDYFMDEYNTRNGGQRIATVLMYLSDVEE  206

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGETVFPSAKGN SAVPW NEL ECGKGGLSVKPKMGDALL WSM PD +LDPSSLHGGC
Sbjct  207  GGETVFPSAKGNYSAVPWWNELSECGKGGLSVKPKMGDALLFWSMTPDATLDPSSLHGGC  266

Query  363  PVIKGNKWSXTKXMRVREYK  304
             VIKGNKWS TK +RV EYK
Sbjct  267  AVIKGNKWSSTKWLRVHEYK  286



>ref|XP_008440878.1| PREDICTED: prolyl 4-hydroxylase subunit alpha-1-like [Cucumis 
melo]
Length=287

 Score =   262 bits (670),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 121/141 (86%), Positives = 129/141 (91%), Gaps = 0/141 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRI+DF+FIP EHGEGLQ+LHYEVGQKYEPH+DYFLD+YNTKNGGQRIATV MYLSDVEE
Sbjct  147  KRISDFSFIPVEHGEGLQVLHYEVGQKYEPHFDYFLDEYNTKNGGQRIATVLMYLSDVEE  206

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGETVFP+AKGN S+VPW NEL +CGK GLSVKPK GDALL WSMKPD SLDPSSLHGGC
Sbjct  207  GGETVFPAAKGNFSSVPWWNELSDCGKKGLSVKPKRGDALLFWSMKPDASLDPSSLHGGC  266

Query  363  PVIKGNKWSXTKXMRVREYKA  301
            PVIKGNKWS TK MRV EYKA
Sbjct  267  PVIKGNKWSATKWMRVEEYKA  287



>ref|XP_009801759.1| PREDICTED: probable prolyl 4-hydroxylase 10 [Nicotiana sylvestris]
Length=290

 Score =   262 bits (670),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 123/141 (87%), Positives = 127/141 (90%), Gaps = 0/141 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRIADFTFIP EHGEGLQILHYEVGQKYEPHYDYF D++NT NGGQRIATV MYLSDVEE
Sbjct  150  KRIADFTFIPVEHGEGLQILHYEVGQKYEPHYDYFADEFNTINGGQRIATVLMYLSDVEE  209

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGETVFP+AKGN SAVPW NEL ECGKGGLSVKPKMGDALL WSMKPD +LDPSSLH GC
Sbjct  210  GGETVFPAAKGNFSAVPWWNELSECGKGGLSVKPKMGDALLFWSMKPDATLDPSSLHSGC  269

Query  363  PVIKGNKWSXTKXMRVREYKA  301
            PVIKGNKWS TK MRV EYK 
Sbjct  270  PVIKGNKWSSTKWMRVHEYKV  290



>ref|XP_009112275.1| PREDICTED: probable prolyl 4-hydroxylase 10 [Brassica rapa]
 ref|XP_009112276.1| PREDICTED: probable prolyl 4-hydroxylase 10 [Brassica rapa]
 emb|CDY18586.1| BnaA09g08090D [Brassica napus]
Length=287

 Score =   262 bits (669),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 120/140 (86%), Positives = 128/140 (91%), Gaps = 0/140 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRI+DFTFIP EHGEGLQ+LHYE+GQKYEPHYDYF+D+YNT+NGGQRIATV MYLSDVEE
Sbjct  147  KRISDFTFIPVEHGEGLQVLHYEIGQKYEPHYDYFMDEYNTRNGGQRIATVLMYLSDVEE  206

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGETVFPSAKGN SAVPW NEL ECGKGGLSVKPKMGDALL WSM PD +LDPSSLHGGC
Sbjct  207  GGETVFPSAKGNYSAVPWWNELSECGKGGLSVKPKMGDALLFWSMTPDATLDPSSLHGGC  266

Query  363  PVIKGNKWSXTKXMRVREYK  304
             VIKGNKWS TK +RV EYK
Sbjct  267  AVIKGNKWSSTKWLRVHEYK  286



>ref|NP_201407.4| 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily 
protein [Arabidopsis thaliana]
 sp|F4JZ24.1|P4H10_ARATH RecName: Full=Probable prolyl 4-hydroxylase 10; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AED98153.1| 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily 
protein [Arabidopsis thaliana]
Length=289

 Score =   262 bits (669),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 119/141 (84%), Positives = 128/141 (91%), Gaps = 0/141 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRI+DFTFIP EHGEGLQ+LHYE+GQKYEPHYDYF+D+YNT+NGGQRIATV MYLSDVEE
Sbjct  149  KRISDFTFIPVEHGEGLQVLHYEIGQKYEPHYDYFMDEYNTRNGGQRIATVLMYLSDVEE  208

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGETVFP+AKGN SAVPW NEL ECGKGGLSVKPKMGDALL WSM PD +LDPSSLHGGC
Sbjct  209  GGETVFPAAKGNYSAVPWWNELSECGKGGLSVKPKMGDALLFWSMTPDATLDPSSLHGGC  268

Query  363  PVIKGNKWSXTKXMRVREYKA  301
             VIKGNKWS TK +RV EYK 
Sbjct  269  AVIKGNKWSSTKWLRVHEYKV  289



>ref|XP_004134841.1| PREDICTED: prolyl 4-hydroxylase subunit alpha-1-like [Cucumis 
sativus]
 gb|KGN48959.1| hypothetical protein Csa_6G507320 [Cucumis sativus]
Length=287

 Score =   261 bits (668),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 120/141 (85%), Positives = 129/141 (91%), Gaps = 0/141 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KR++DF+FIP EHGEGLQ+LHYEVGQKYEPH+DYFLD+YNTKNGGQRIATV MYLSDVEE
Sbjct  147  KRLSDFSFIPVEHGEGLQVLHYEVGQKYEPHFDYFLDEYNTKNGGQRIATVLMYLSDVEE  206

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGETVFP+AKGN S+VPW NEL +CGK GLSVKPK GDALL WSMKPD SLDPSSLHGGC
Sbjct  207  GGETVFPAAKGNFSSVPWWNELSDCGKKGLSVKPKRGDALLFWSMKPDASLDPSSLHGGC  266

Query  363  PVIKGNKWSXTKXMRVREYKA  301
            PVIKGNKWS TK MRV EYKA
Sbjct  267  PVIKGNKWSATKWMRVEEYKA  287



>ref|XP_006343343.1| PREDICTED: prolyl 4-hydroxylase subunit alpha-1-like [Solanum 
tuberosum]
Length=289

 Score =   261 bits (668),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 121/139 (87%), Positives = 127/139 (91%), Gaps = 0/139 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRIADFTFIP EHGEGLQILHYEVGQKYEPHYDYF D++NT+NGGQRIATV MYLSDVEE
Sbjct  149  KRIADFTFIPVEHGEGLQILHYEVGQKYEPHYDYFSDEFNTQNGGQRIATVLMYLSDVEE  208

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGETVFP+A+GN SAVPW NEL ECGKGGLSVKPKMGDALL WSMKPD +LDPSSLHGGC
Sbjct  209  GGETVFPAAQGNFSAVPWWNELSECGKGGLSVKPKMGDALLFWSMKPDATLDPSSLHGGC  268

Query  363  PVIKGNKWSXTKXMRVREY  307
             VIKGNKWS TK MRV EY
Sbjct  269  AVIKGNKWSSTKWMRVHEY  287



>gb|KHN35999.1| Prolyl 4-hydroxylase subunit alpha-1 [Glycine soja]
Length=289

 Score =   261 bits (668),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 120/141 (85%), Positives = 128/141 (91%), Gaps = 0/141 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            K+I+DFTFIP EHGEGLQ+LHYEVGQKYEPHYDYFLDD+NTKNGGQRIATV MYL+DVEE
Sbjct  149  KKISDFTFIPVEHGEGLQVLHYEVGQKYEPHYDYFLDDFNTKNGGQRIATVLMYLTDVEE  208

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGETVFP+AKGN S+VPW NEL ECGK GLS+KPK GDALL WSMKPD SLDPSSLHGGC
Sbjct  209  GGETVFPAAKGNFSSVPWWNELSECGKKGLSIKPKRGDALLFWSMKPDASLDPSSLHGGC  268

Query  363  PVIKGNKWSXTKXMRVREYKA  301
            PVIKGNKWS TK MRV EY A
Sbjct  269  PVIKGNKWSSTKWMRVSEYNA  289



>ref|XP_004234520.1| PREDICTED: probable prolyl 4-hydroxylase 10 [Solanum lycopersicum]
Length=289

 Score =   261 bits (667),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 121/139 (87%), Positives = 127/139 (91%), Gaps = 0/139 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRIADFTFIP EHGEGLQILHYEVGQKYEPHYDYF D++NT+NGGQRIATV MYLSDVEE
Sbjct  149  KRIADFTFIPVEHGEGLQILHYEVGQKYEPHYDYFSDEFNTQNGGQRIATVLMYLSDVEE  208

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGETVFP+A+GN SAVPW NEL ECGKGGLSVKPKMGDALL WSMKPD +LDPSSLHGGC
Sbjct  209  GGETVFPAAQGNFSAVPWWNELSECGKGGLSVKPKMGDALLFWSMKPDATLDPSSLHGGC  268

Query  363  PVIKGNKWSXTKXMRVREY  307
             VIKGNKWS TK MRV EY
Sbjct  269  AVIKGNKWSSTKWMRVHEY  287



>ref|XP_006280909.1| hypothetical protein CARUB_v10026902mg [Capsella rubella]
 gb|EOA13807.1| hypothetical protein CARUB_v10026902mg [Capsella rubella]
Length=289

 Score =   261 bits (667),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 118/141 (84%), Positives = 128/141 (91%), Gaps = 0/141 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRI+DFTFIP EHGEGLQ+LHYE+GQKYEPHYDYF+D+YNT+NGGQRIATV MYLSDVEE
Sbjct  149  KRISDFTFIPVEHGEGLQVLHYEIGQKYEPHYDYFMDEYNTRNGGQRIATVLMYLSDVEE  208

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGETVFP+AKGN SAVPW NEL ECGKGGLSVKPKMGDALL WSM PD +LDPSSLHGGC
Sbjct  209  GGETVFPAAKGNYSAVPWWNELSECGKGGLSVKPKMGDALLFWSMTPDATLDPSSLHGGC  268

Query  363  PVIKGNKWSXTKXMRVREYKA  301
             VIKGNKWS TK +RV EY+ 
Sbjct  269  AVIKGNKWSSTKWLRVHEYRV  289



>ref|XP_010465981.1| PREDICTED: probable prolyl 4-hydroxylase 10 isoform X1 [Camelina 
sativa]
 ref|XP_010465989.1| PREDICTED: probable prolyl 4-hydroxylase 10 isoform X1 [Camelina 
sativa]
 ref|XP_010465996.1| PREDICTED: probable prolyl 4-hydroxylase 10 isoform X2 [Camelina 
sativa]
Length=290

 Score =   261 bits (667),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 119/141 (84%), Positives = 128/141 (91%), Gaps = 0/141 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRI+DFTFIP EHGEGLQ+LHYE+GQKYEPHYDYF+D+YNT+NGGQRIATV MYLSDVEE
Sbjct  150  KRISDFTFIPVEHGEGLQVLHYEIGQKYEPHYDYFMDEYNTRNGGQRIATVLMYLSDVEE  209

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGETVFP+AKGN SAVPW NEL ECGKGGLSVKPKMGDALL WSM PD +LDPSSLHGGC
Sbjct  210  GGETVFPAAKGNYSAVPWWNELSECGKGGLSVKPKMGDALLFWSMTPDATLDPSSLHGGC  269

Query  363  PVIKGNKWSXTKXMRVREYKA  301
             VIKGNKWS TK +RV EYK 
Sbjct  270  AVIKGNKWSSTKWLRVHEYKV  290



>ref|XP_010444842.1| PREDICTED: probable prolyl 4-hydroxylase 10 [Camelina sativa]
 ref|XP_010444843.1| PREDICTED: probable prolyl 4-hydroxylase 10 [Camelina sativa]
Length=290

 Score =   261 bits (667),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 119/141 (84%), Positives = 128/141 (91%), Gaps = 0/141 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRI+DFTFIP EHGEGLQ+LHYE+GQKYEPHYDYF+D+YNT+NGGQRIATV MYLSDVEE
Sbjct  150  KRISDFTFIPVEHGEGLQVLHYEIGQKYEPHYDYFMDEYNTRNGGQRIATVLMYLSDVEE  209

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGETVFP+AKGN SAVPW NEL ECGKGGLSVKPKMGDALL WSM PD +LDPSSLHGGC
Sbjct  210  GGETVFPAAKGNYSAVPWWNELSECGKGGLSVKPKMGDALLFWSMTPDATLDPSSLHGGC  269

Query  363  PVIKGNKWSXTKXMRVREYKA  301
             VIKGNKWS TK +RV EYK 
Sbjct  270  AVIKGNKWSSTKWLRVHEYKV  290



>gb|EPS71884.1| hypothetical protein M569_02873 [Genlisea aurea]
Length=292

 Score =   261 bits (667),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 118/141 (84%), Positives = 130/141 (92%), Gaps = 0/141 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRIADFTFIP EHGEGLQILHYEVGQKYEPH+DYF+D++NT+NGGQRIAT+ MYLSDVEE
Sbjct  152  KRIADFTFIPVEHGEGLQILHYEVGQKYEPHFDYFMDEFNTQNGGQRIATLLMYLSDVEE  211

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGETVFP+A GN S++PW NEL ECG+GGLSVKPKMGDALL WSM+PD +LDPSSLHGGC
Sbjct  212  GGETVFPAAAGNFSSLPWWNELSECGRGGLSVKPKMGDALLFWSMRPDATLDPSSLHGGC  271

Query  363  PVIKGNKWSXTKXMRVREYKA  301
            PVIKGNKWS TK MRV EYKA
Sbjct  272  PVIKGNKWSSTKWMRVHEYKA  292



>ref|XP_002263060.1| PREDICTED: probable prolyl 4-hydroxylase 10 [Vitis vinifera]
 emb|CBI24447.3| unnamed protein product [Vitis vinifera]
Length=288

 Score =   261 bits (666),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 121/140 (86%), Positives = 129/140 (92%), Gaps = 0/140 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KR++DFTF+P EHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQR+ATV MYLSDVEE
Sbjct  148  KRLSDFTFLPVEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRMATVLMYLSDVEE  207

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGETVFP+AKGN S+VPW NEL +CGK GLSVKPKMGDALL WSMKPD SLDPSSLHGGC
Sbjct  208  GGETVFPAAKGNFSSVPWWNELSDCGKEGLSVKPKMGDALLFWSMKPDASLDPSSLHGGC  267

Query  363  PVIKGNKWSXTKXMRVREYK  304
            PVIKGNKWS TK +RV EYK
Sbjct  268  PVIKGNKWSSTKWIRVNEYK  287



>gb|KJB48235.1| hypothetical protein B456_008G061800 [Gossypium raimondii]
 gb|KJB48237.1| hypothetical protein B456_008G061800 [Gossypium raimondii]
 gb|KJB48238.1| hypothetical protein B456_008G061800 [Gossypium raimondii]
 gb|KJB48239.1| hypothetical protein B456_008G061800 [Gossypium raimondii]
Length=289

 Score =   261 bits (666),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 122/141 (87%), Positives = 128/141 (91%), Gaps = 0/141 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRIADFTFIP EHGEGLQ+LHYEVGQKYEPHYDYF D+ NT+NGGQRIATV MYLSDVEE
Sbjct  149  KRIADFTFIPVEHGEGLQVLHYEVGQKYEPHYDYFKDEVNTRNGGQRIATVLMYLSDVEE  208

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGETVFPSAKGNISAVPW NEL ECGKGGLSV+PKMGDALL WSMKPD +LD SSLHGGC
Sbjct  209  GGETVFPSAKGNISAVPWWNELSECGKGGLSVRPKMGDALLFWSMKPDATLDLSSLHGGC  268

Query  363  PVIKGNKWSXTKXMRVREYKA  301
            PVI+GNKWS TK MRV EYK 
Sbjct  269  PVIRGNKWSSTKWMRVNEYKV  289



>emb|CAN64470.1| hypothetical protein VITISV_014644 [Vitis vinifera]
Length=288

 Score =   260 bits (665),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 121/140 (86%), Positives = 128/140 (91%), Gaps = 0/140 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KR++DFTF+P EHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQR+ATV MYLSDVEE
Sbjct  148  KRLSDFTFLPVEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRMATVLMYLSDVEE  207

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGETVFP+AKGN S+VPW NEL  CGK GLSVKPKMGDALL WSMKPD SLDPSSLHGGC
Sbjct  208  GGETVFPAAKGNFSSVPWWNELSXCGKEGLSVKPKMGDALLFWSMKPDASLDPSSLHGGC  267

Query  363  PVIKGNKWSXTKXMRVREYK  304
            PVIKGNKWS TK +RV EYK
Sbjct  268  PVIKGNKWSSTKWIRVNEYK  287



>ref|XP_010113287.1| Prolyl 4-hydroxylase subunit alpha-1 [Morus notabilis]
 gb|EXC35294.1| Prolyl 4-hydroxylase subunit alpha-1 [Morus notabilis]
Length=291

 Score =   260 bits (664),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 119/141 (84%), Positives = 128/141 (91%), Gaps = 0/141 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRIADFTFIP EHGEGLQILHYEVGQKYEPH+DYFLDD+NT+NGGQR+AT+ MYLSDVEE
Sbjct  151  KRIADFTFIPVEHGEGLQILHYEVGQKYEPHFDYFLDDFNTQNGGQRMATLLMYLSDVEE  210

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGETVFP+AKGN S+VPW NEL +CGK GLSVKPK GDALL WSMKPD +LDPSSLHGGC
Sbjct  211  GGETVFPAAKGNFSSVPWWNELSDCGKKGLSVKPKRGDALLFWSMKPDATLDPSSLHGGC  270

Query  363  PVIKGNKWSXTKXMRVREYKA  301
            PVIKGNKWS TK MR  EYKA
Sbjct  271  PVIKGNKWSSTKWMRANEYKA  291



>ref|NP_001242522.1| uncharacterized protein LOC100806046 [Glycine max]
 gb|ACU24023.1| unknown [Glycine max]
Length=289

 Score =   260 bits (664),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 120/141 (85%), Positives = 127/141 (90%), Gaps = 0/141 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            K+I+DFTFIP EHGEGLQ+LHYEVGQKYEPHYDYFLDD+NTKNGGQRIATV MYL+DVEE
Sbjct  149  KKISDFTFIPVEHGEGLQVLHYEVGQKYEPHYDYFLDDFNTKNGGQRIATVLMYLTDVEE  208

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGETVFP+AKGN S VPW NEL ECGK GLS+KPK GDALL WSMKPD SLDPSSLHGGC
Sbjct  209  GGETVFPAAKGNFSFVPWWNELFECGKKGLSIKPKRGDALLFWSMKPDASLDPSSLHGGC  268

Query  363  PVIKGNKWSXTKXMRVREYKA  301
            PVIKGNKWS TK MRV EY A
Sbjct  269  PVIKGNKWSSTKWMRVSEYNA  289



>ref|XP_006393794.1| hypothetical protein EUTSA_v10004714mg [Eutrema salsugineum]
 gb|ESQ31080.1| hypothetical protein EUTSA_v10004714mg [Eutrema salsugineum]
Length=289

 Score =   259 bits (663),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 118/141 (84%), Positives = 128/141 (91%), Gaps = 0/141 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRI+DFTFIP EHGEGLQ+LHYE+GQKYEPHYDYF+D+YNT+NGGQRIATV MYLSDVEE
Sbjct  149  KRISDFTFIPVEHGEGLQVLHYEIGQKYEPHYDYFMDEYNTRNGGQRIATVLMYLSDVEE  208

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGETVFP+AKGN SAVPW +EL ECGKGGLSVKPKMGDALL WSM PD +LDPSSLHGGC
Sbjct  209  GGETVFPAAKGNYSAVPWWSELSECGKGGLSVKPKMGDALLFWSMTPDATLDPSSLHGGC  268

Query  363  PVIKGNKWSXTKXMRVREYKA  301
             VIKGNKWS TK +RV EYK 
Sbjct  269  AVIKGNKWSSTKWLRVHEYKV  289



>ref|XP_007046594.1| 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily 
protein isoform 2 [Theobroma cacao]
 ref|XP_007046595.1| 2-oxoglutarate and Fe(II)-dependent oxygenase superfamily protein 
isoform 2 [Theobroma cacao]
 gb|EOX90751.1| 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily 
protein isoform 2 [Theobroma cacao]
 gb|EOX90752.1| 2-oxoglutarate and Fe(II)-dependent oxygenase superfamily protein 
isoform 2 [Theobroma cacao]
Length=296

 Score =   260 bits (664),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 125/154 (81%), Positives = 131/154 (85%), Gaps = 13/154 (8%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLS----  556
            KRIADFTFIP EHGEGLQILHYEVGQKYEPHYDYF+D++NTKNGGQRIATV MYLS    
Sbjct  143  KRIADFTFIPVEHGEGLQILHYEVGQKYEPHYDYFMDEFNTKNGGQRIATVLMYLSVLFF  202

Query  555  ---------DVEEGGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKP  403
                     DVEEGGETVFP+AKGNISAVPW NEL ECGKGGLSVKPKMGDALL WSMKP
Sbjct  203  FCVLPFYSSDVEEGGETVFPAAKGNISAVPWWNELSECGKGGLSVKPKMGDALLFWSMKP  262

Query  402  DGSLDPSSLHGGCPVIKGNKWSXTKXMRVREYKA  301
            D SLDPSSLHGGCPVI+GNKWS TK +RV EYK 
Sbjct  263  DASLDPSSLHGGCPVIRGNKWSSTKWIRVNEYKV  296



>ref|XP_004158845.1| PREDICTED: prolyl 4-hydroxylase subunit alpha-1-like [Cucumis 
sativus]
Length=287

 Score =   259 bits (663),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 119/141 (84%), Positives = 129/141 (91%), Gaps = 0/141 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KR++DF+FIP EHGEGLQ+LHYEVGQKYEPH+DYFLD+YNTKNGGQRIATV MYLSDVEE
Sbjct  147  KRLSDFSFIPVEHGEGLQVLHYEVGQKYEPHFDYFLDEYNTKNGGQRIATVLMYLSDVEE  206

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGETVFP+AKGN S+VPW NEL +CGK GLSVKPK GDALL WSMKPD SLDPSSLHGGC
Sbjct  207  GGETVFPAAKGNFSSVPWWNELSDCGKKGLSVKPKRGDALLFWSMKPDASLDPSSLHGGC  266

Query  363  PVIKGNKWSXTKXMRVREYKA  301
            PVIKGNKWS TK +RV EYKA
Sbjct  267  PVIKGNKWSATKWVRVEEYKA  287



>gb|KDO71355.1| hypothetical protein CISIN_1g023009mg [Citrus sinensis]
Length=180

 Score =   255 bits (652),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 117/141 (83%), Positives = 128/141 (91%), Gaps = 0/141 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRIADFTF P E+GEGLQ+LHYE GQKYEPH+DYF+D++NTKNGGQR+ATV MYLSDVEE
Sbjct  40   KRIADFTFFPLENGEGLQVLHYEAGQKYEPHFDYFMDEFNTKNGGQRMATVLMYLSDVEE  99

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGETVFP+A+GNISAVPW NEL ECGK GLS+KPKMGDALL WSMKPD SLDPSSLHGGC
Sbjct  100  GGETVFPNAQGNISAVPWWNELSECGKTGLSIKPKMGDALLFWSMKPDASLDPSSLHGGC  159

Query  363  PVIKGNKWSXTKXMRVREYKA  301
            PVIKGNKWS TK +RV EYK 
Sbjct  160  PVIKGNKWSSTKWIRVNEYKV  180



>ref|XP_003538892.1| PREDICTED: prolyl 4-hydroxylase subunit alpha-1 [Glycine max]
 gb|KHN41867.1| Prolyl 4-hydroxylase subunit alpha-1 [Glycine soja]
Length=290

 Score =   259 bits (661),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 119/141 (84%), Positives = 128/141 (91%), Gaps = 0/141 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRIA ++FIP EHGEGLQ+LHYEVGQKYEPHYDYFLDD+NTKNGGQRIATV MYL+DVEE
Sbjct  150  KRIAHYSFIPVEHGEGLQVLHYEVGQKYEPHYDYFLDDFNTKNGGQRIATVLMYLTDVEE  209

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGETVFP+AKGN S+VPW NEL ECGK GLS+KPK GDALL WSMKPD +LDPSSLHGGC
Sbjct  210  GGETVFPAAKGNFSSVPWWNELSECGKKGLSIKPKRGDALLFWSMKPDATLDPSSLHGGC  269

Query  363  PVIKGNKWSXTKXMRVREYKA  301
            PVIKGNKWS TK MRV EYKA
Sbjct  270  PVIKGNKWSSTKWMRVSEYKA  290



>ref|XP_004291329.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Fragaria vesca subsp. 
vesca]
Length=308

 Score =   259 bits (661),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 119/141 (84%), Positives = 128/141 (91%), Gaps = 0/141 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRIADFTFIP EHGEGLQILHYEVGQKY+ H+DYFLD+YNTKNGGQRIAT+ MYLSDVEE
Sbjct  168  KRIADFTFIPVEHGEGLQILHYEVGQKYDAHFDYFLDEYNTKNGGQRIATLLMYLSDVEE  227

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGETVFP+AKGNISAVPW NEL ECGK GL+VKPKMGDALL WSM+PD SLDPSSLHGGC
Sbjct  228  GGETVFPAAKGNISAVPWWNELSECGKKGLAVKPKMGDALLFWSMRPDASLDPSSLHGGC  287

Query  363  PVIKGNKWSXTKXMRVREYKA  301
            PVI+GNKWS TK M + EYK 
Sbjct  288  PVIRGNKWSSTKWMHLEEYKV  308



>ref|XP_006425363.1| hypothetical protein CICLE_v10026208mg [Citrus clementina]
 ref|XP_006425364.1| hypothetical protein CICLE_v10026208mg [Citrus clementina]
 gb|ESR38603.1| hypothetical protein CICLE_v10026208mg [Citrus clementina]
 gb|ESR38604.1| hypothetical protein CICLE_v10026208mg [Citrus clementina]
Length=288

 Score =   258 bits (659),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 117/141 (83%), Positives = 129/141 (91%), Gaps = 0/141 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRIADFTF+P E+GEGLQ+LHYE GQKYEPH+DYF+D++NTKNGGQR+ATV MYLSDVEE
Sbjct  148  KRIADFTFLPLENGEGLQVLHYEAGQKYEPHFDYFMDEFNTKNGGQRMATVLMYLSDVEE  207

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGETVFP+A+GNISAVPW NEL ECGK GLS+KPKMGDALL WSMKPD SLDPSSLHGGC
Sbjct  208  GGETVFPNAQGNISAVPWWNELSECGKTGLSIKPKMGDALLFWSMKPDASLDPSSLHGGC  267

Query  363  PVIKGNKWSXTKXMRVREYKA  301
            PVIKGNKWS TK +RV EYK 
Sbjct  268  PVIKGNKWSSTKWIRVNEYKV  288



>ref|XP_007202401.1| hypothetical protein PRUPE_ppa009475mg [Prunus persica]
 gb|EMJ03600.1| hypothetical protein PRUPE_ppa009475mg [Prunus persica]
Length=291

 Score =   258 bits (659),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 118/140 (84%), Positives = 129/140 (92%), Gaps = 0/140 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRIA+FTF+P EHGEGLQ+LHYEVGQKYEPHYDYF D++NT+NGGQRIATV MYLSDVEE
Sbjct  151  KRIANFTFLPVEHGEGLQVLHYEVGQKYEPHYDYFQDEFNTRNGGQRIATVLMYLSDVEE  210

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGETVFP+AKGNIS+VPW +EL ECGK GLSVKPKMGDALL WSM+PD SLDPSSLHGGC
Sbjct  211  GGETVFPAAKGNISSVPWWDELSECGKKGLSVKPKMGDALLFWSMRPDASLDPSSLHGGC  270

Query  363  PVIKGNKWSXTKXMRVREYK  304
            PVIKGNKWS TK +RV EYK
Sbjct  271  PVIKGNKWSSTKWVRVNEYK  290



>ref|XP_006425365.1| hypothetical protein CICLE_v10026208mg [Citrus clementina]
 gb|ESR38605.1| hypothetical protein CICLE_v10026208mg [Citrus clementina]
Length=235

 Score =   256 bits (653),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 117/141 (83%), Positives = 129/141 (91%), Gaps = 0/141 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRIADFTF+P E+GEGLQ+LHYE GQKYEPH+DYF+D++NTKNGGQR+ATV MYLSDVEE
Sbjct  95   KRIADFTFLPLENGEGLQVLHYEAGQKYEPHFDYFMDEFNTKNGGQRMATVLMYLSDVEE  154

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGETVFP+A+GNISAVPW NEL ECGK GLS+KPKMGDALL WSMKPD SLDPSSLHGGC
Sbjct  155  GGETVFPNAQGNISAVPWWNELSECGKTGLSIKPKMGDALLFWSMKPDASLDPSSLHGGC  214

Query  363  PVIKGNKWSXTKXMRVREYKA  301
            PVIKGNKWS TK +RV EYK 
Sbjct  215  PVIKGNKWSSTKWIRVNEYKV  235



>gb|KDO71350.1| hypothetical protein CISIN_1g023009mg [Citrus sinensis]
Length=287

 Score =   258 bits (658),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 117/141 (83%), Positives = 128/141 (91%), Gaps = 0/141 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRIADFTF P E+GEGLQ+LHYE GQKYEPH+DYF+D++NTKNGGQR+ATV MYLSDVEE
Sbjct  147  KRIADFTFFPLENGEGLQVLHYEAGQKYEPHFDYFMDEFNTKNGGQRMATVLMYLSDVEE  206

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGETVFP+A+GNISAVPW NEL ECGK GLS+KPKMGDALL WSMKPD SLDPSSLHGGC
Sbjct  207  GGETVFPNAQGNISAVPWWNELSECGKTGLSIKPKMGDALLFWSMKPDASLDPSSLHGGC  266

Query  363  PVIKGNKWSXTKXMRVREYKA  301
            PVIKGNKWS TK +RV EYK 
Sbjct  267  PVIKGNKWSSTKWIRVNEYKV  287



>gb|KDO71351.1| hypothetical protein CISIN_1g023009mg [Citrus sinensis]
 gb|KDO71352.1| hypothetical protein CISIN_1g023009mg [Citrus sinensis]
 gb|KDO71353.1| hypothetical protein CISIN_1g023009mg [Citrus sinensis]
Length=288

 Score =   258 bits (658),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 117/141 (83%), Positives = 128/141 (91%), Gaps = 0/141 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRIADFTF P E+GEGLQ+LHYE GQKYEPH+DYF+D++NTKNGGQR+ATV MYLSDVEE
Sbjct  148  KRIADFTFFPLENGEGLQVLHYEAGQKYEPHFDYFMDEFNTKNGGQRMATVLMYLSDVEE  207

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGETVFP+A+GNISAVPW NEL ECGK GLS+KPKMGDALL WSMKPD SLDPSSLHGGC
Sbjct  208  GGETVFPNAQGNISAVPWWNELSECGKTGLSIKPKMGDALLFWSMKPDASLDPSSLHGGC  267

Query  363  PVIKGNKWSXTKXMRVREYKA  301
            PVIKGNKWS TK +RV EYK 
Sbjct  268  PVIKGNKWSSTKWIRVNEYKV  288



>gb|KDP23952.1| hypothetical protein JCGZ_25340 [Jatropha curcas]
Length=289

 Score =   257 bits (657),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 118/141 (84%), Positives = 128/141 (91%), Gaps = 0/141 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRIADFTFIP EHGEGLQ+LHYEVGQKYEPH+DYF D++NT+NGGQRIAT+ MYLSDVEE
Sbjct  149  KRIADFTFIPVEHGEGLQVLHYEVGQKYEPHFDYFNDEFNTRNGGQRIATLLMYLSDVEE  208

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGETVFP+A+GN+S VPW NEL ECGKGGLSVKPK GDALL WSMKPD SLDPSSLHGGC
Sbjct  209  GGETVFPAAEGNVSDVPWWNELSECGKGGLSVKPKRGDALLFWSMKPDASLDPSSLHGGC  268

Query  363  PVIKGNKWSXTKXMRVREYKA  301
             VIKGNKWS TK MRV EY+A
Sbjct  269  AVIKGNKWSATKWMRVNEYQA  289



>ref|XP_006467024.1| PREDICTED: prolyl 4-hydroxylase subunit alpha-1-like isoform 
X2 [Citrus sinensis]
Length=287

 Score =   257 bits (657),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 116/141 (82%), Positives = 129/141 (91%), Gaps = 0/141 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRIADFTF+P E+GEGLQ+LHYE GQKYEPH+DYF+D++NTKNGGQR+ATV MYLSDVEE
Sbjct  147  KRIADFTFLPLENGEGLQVLHYEAGQKYEPHFDYFMDEFNTKNGGQRMATVLMYLSDVEE  206

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGETVFP+A+GNISAVPW NEL ECGK GLS+KPKMGDALL WSMKPD +LDPSSLHGGC
Sbjct  207  GGETVFPNAQGNISAVPWWNELSECGKTGLSIKPKMGDALLFWSMKPDAALDPSSLHGGC  266

Query  363  PVIKGNKWSXTKXMRVREYKA  301
            PVIKGNKWS TK +RV EYK 
Sbjct  267  PVIKGNKWSSTKWIRVNEYKV  287



>ref|XP_006467023.1| PREDICTED: prolyl 4-hydroxylase subunit alpha-1-like isoform 
X1 [Citrus sinensis]
Length=288

 Score =   257 bits (656),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 116/141 (82%), Positives = 129/141 (91%), Gaps = 0/141 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRIADFTF+P E+GEGLQ+LHYE GQKYEPH+DYF+D++NTKNGGQR+ATV MYLSDVEE
Sbjct  148  KRIADFTFLPLENGEGLQVLHYEAGQKYEPHFDYFMDEFNTKNGGQRMATVLMYLSDVEE  207

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGETVFP+A+GNISAVPW NEL ECGK GLS+KPKMGDALL WSMKPD +LDPSSLHGGC
Sbjct  208  GGETVFPNAQGNISAVPWWNELSECGKTGLSIKPKMGDALLFWSMKPDAALDPSSLHGGC  267

Query  363  PVIKGNKWSXTKXMRVREYKA  301
            PVIKGNKWS TK +RV EYK 
Sbjct  268  PVIKGNKWSSTKWIRVNEYKV  288



>ref|XP_010550487.1| PREDICTED: probable prolyl 4-hydroxylase 10 [Tarenaya hassleriana]
Length=285

 Score =   257 bits (656),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 118/141 (84%), Positives = 126/141 (89%), Gaps = 0/141 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRIAD TFIP EHGEGLQ+LHYE GQKYEPHYDYF+D+YNT+NGGQR ATV MYLSDVEE
Sbjct  145  KRIADLTFIPVEHGEGLQVLHYEAGQKYEPHYDYFMDEYNTRNGGQRTATVLMYLSDVEE  204

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGETVFP+AKGN SAVPW NEL ECGKGGLSVKPKMGDALL WS  PD +LDPSSLHGGC
Sbjct  205  GGETVFPAAKGNYSAVPWWNELSECGKGGLSVKPKMGDALLFWSTTPDATLDPSSLHGGC  264

Query  363  PVIKGNKWSXTKXMRVREYKA  301
            PVIKGNKWS TK +R+ EYKA
Sbjct  265  PVIKGNKWSSTKWLRLHEYKA  285



>gb|KDO71354.1| hypothetical protein CISIN_1g023009mg [Citrus sinensis]
Length=235

 Score =   255 bits (652),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 117/141 (83%), Positives = 128/141 (91%), Gaps = 0/141 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRIADFTF P E+GEGLQ+LHYE GQKYEPH+DYF+D++NTKNGGQR+ATV MYLSDVEE
Sbjct  95   KRIADFTFFPLENGEGLQVLHYEAGQKYEPHFDYFMDEFNTKNGGQRMATVLMYLSDVEE  154

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGETVFP+A+GNISAVPW NEL ECGK GLS+KPKMGDALL WSMKPD SLDPSSLHGGC
Sbjct  155  GGETVFPNAQGNISAVPWWNELSECGKTGLSIKPKMGDALLFWSMKPDASLDPSSLHGGC  214

Query  363  PVIKGNKWSXTKXMRVREYKA  301
            PVIKGNKWS TK +RV EYK 
Sbjct  215  PVIKGNKWSSTKWIRVNEYKV  235



>ref|XP_009344824.1| PREDICTED: probable prolyl 4-hydroxylase 10 [Pyrus x bretschneideri]
Length=292

 Score =   257 bits (656),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 117/139 (84%), Positives = 127/139 (91%), Gaps = 0/139 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            K+IA+FTF+P E GEGLQ+LHYEVGQKYEPH+DYF DD+NTKNGGQRIATV MYLSDVEE
Sbjct  152  KKIANFTFLPVEQGEGLQVLHYEVGQKYEPHFDYFQDDFNTKNGGQRIATVLMYLSDVEE  211

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGETVFP+AKGNIS+VPW NEL ECGK GLSVKPKMGDALL WSM+PD SLDPSSLHGGC
Sbjct  212  GGETVFPAAKGNISSVPWWNELSECGKKGLSVKPKMGDALLFWSMRPDASLDPSSLHGGC  271

Query  363  PVIKGNKWSXTKXMRVREY  307
            PVIKGNKWS TK +RV EY
Sbjct  272  PVIKGNKWSSTKWIRVSEY  290



>ref|XP_008242010.1| PREDICTED: prolyl 4-hydroxylase subunit alpha-1-like [Prunus 
mume]
Length=291

 Score =   256 bits (655),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 117/140 (84%), Positives = 129/140 (92%), Gaps = 0/140 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRIA+FTF+P EHGEGLQ+LHYEVGQKYEPHYDYF D++NT+NGGQRIATV MYLSDVEE
Sbjct  151  KRIANFTFLPVEHGEGLQVLHYEVGQKYEPHYDYFQDEFNTRNGGQRIATVLMYLSDVEE  210

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGETVFP+A+GNIS+VPW +EL ECGK GLSVKPKMGDALL WSM+PD SLDPSSLHGGC
Sbjct  211  GGETVFPAAEGNISSVPWWDELSECGKKGLSVKPKMGDALLFWSMRPDASLDPSSLHGGC  270

Query  363  PVIKGNKWSXTKXMRVREYK  304
            PVIKGNKWS TK +RV EYK
Sbjct  271  PVIKGNKWSSTKWVRVNEYK  290



>gb|KHG25173.1| P4ha[2]: Prolyl 4-hydroxylase subunit alpha-1 [Gossypium arboreum]
Length=347

 Score =   258 bits (660),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 121/140 (86%), Positives = 127/140 (91%), Gaps = 0/140 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRIADFTFIP EHGEGLQ+LHYEVGQKYEPHYDYF D+ NT+NGGQRIATV MYLSDVEE
Sbjct  149  KRIADFTFIPVEHGEGLQVLHYEVGQKYEPHYDYFKDEVNTRNGGQRIATVLMYLSDVEE  208

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGETVFPSAKGNISAVPW NEL ECGKGGLSV+PKMGDALL WSMKPD +LD  SLHGGC
Sbjct  209  GGETVFPSAKGNISAVPWWNELSECGKGGLSVRPKMGDALLFWSMKPDATLDLLSLHGGC  268

Query  363  PVIKGNKWSXTKXMRVREYK  304
            PVI+GNKWS TK MRV EYK
Sbjct  269  PVIRGNKWSSTKWMRVNEYK  288



>ref|XP_008337965.1| PREDICTED: prolyl 4-hydroxylase subunit alpha-1-like [Malus domestica]
Length=291

 Score =   256 bits (654),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 118/139 (85%), Positives = 127/139 (91%), Gaps = 0/139 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            K+IA+FTF+P EHGEGLQ+LHYEVGQKYEPHYDYF DD+NTKNGGQRI TV MYLSDVEE
Sbjct  151  KKIANFTFLPVEHGEGLQVLHYEVGQKYEPHYDYFQDDFNTKNGGQRIGTVLMYLSDVEE  210

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGETVFP+AKGNIS+VPW NEL ECGK GLSVKPKMGDALL WSM+PD SLDPSSLHGGC
Sbjct  211  GGETVFPAAKGNISSVPWWNELSECGKKGLSVKPKMGDALLFWSMRPDASLDPSSLHGGC  270

Query  363  PVIKGNKWSXTKXMRVREY  307
            PVIKGNKWS TK +RV EY
Sbjct  271  PVIKGNKWSSTKWIRVNEY  289



>ref|XP_010029633.1| PREDICTED: probable prolyl 4-hydroxylase 10 [Eucalyptus grandis]
 gb|KCW56575.1| hypothetical protein EUGRSUZ_I02306 [Eucalyptus grandis]
Length=343

 Score =   258 bits (658),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 121/141 (86%), Positives = 128/141 (91%), Gaps = 0/141 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRIADFTFIP EHGEGLQ+LHYEVGQKYEPHYDYF D+YNTKNGGQR+AT+ MYLSDVEE
Sbjct  203  KRIADFTFIPIEHGEGLQMLHYEVGQKYEPHYDYFQDEYNTKNGGQRMATILMYLSDVEE  262

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGETVFP+AKGN SAVPW NEL +CGK GLSVKPKMGDALL WSMKPDGSLD SSLHGGC
Sbjct  263  GGETVFPTAKGNFSAVPWWNELSDCGKEGLSVKPKMGDALLFWSMKPDGSLDKSSLHGGC  322

Query  363  PVIKGNKWSXTKXMRVREYKA  301
            PVIKGNKWS TK +RV EYK 
Sbjct  323  PVIKGNKWSSTKWLRVHEYKV  343



>ref|XP_002530636.1| prolyl 4-hydroxylase alpha subunit, putative [Ricinus communis]
 gb|EEF31744.1| prolyl 4-hydroxylase alpha subunit, putative [Ricinus communis]
Length=287

 Score =   255 bits (652),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 116/141 (82%), Positives = 126/141 (89%), Gaps = 0/141 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRIADF+FIP EHGEGLQ+LHYEVGQKYEPH+DYF D++NTKNGGQR+AT+ MYLSDVEE
Sbjct  147  KRIADFSFIPVEHGEGLQVLHYEVGQKYEPHFDYFNDEFNTKNGGQRVATLLMYLSDVEE  206

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGETVFP+AKGN SAVPW NEL ECGK GLSVKP MGDALL WSMKPD +LDPSSLHGGC
Sbjct  207  GGETVFPAAKGNFSAVPWWNELSECGKKGLSVKPNMGDALLFWSMKPDATLDPSSLHGGC  266

Query  363  PVIKGNKWSXTKXMRVREYKA  301
            PVI GNKWS TK MRV EY+ 
Sbjct  267  PVINGNKWSATKWMRVNEYRV  287



>ref|XP_006342080.1| PREDICTED: prolyl 4-hydroxylase subunit alpha-1-like [Solanum 
tuberosum]
Length=292

 Score =   255 bits (652),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 119/141 (84%), Positives = 128/141 (91%), Gaps = 0/141 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRIAD+TFIPAEHGEGLQ+LHYEVGQKYEPHYDYFLDD+NTKNGGQRIAT+ MYLSDVEE
Sbjct  152  KRIADYTFIPAEHGEGLQVLHYEVGQKYEPHYDYFLDDFNTKNGGQRIATILMYLSDVEE  211

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGETVFP+AKGN S+ P  NEL EC KGGLSVKPKMGDALL WSM+PD +LDPSSLHGGC
Sbjct  212  GGETVFPAAKGNFSSSPGWNELSECAKGGLSVKPKMGDALLFWSMRPDATLDPSSLHGGC  271

Query  363  PVIKGNKWSXTKXMRVREYKA  301
            PVIKGNKWS TK M V EYK+
Sbjct  272  PVIKGNKWSSTKWMHVGEYKS  292



>ref|XP_007157869.1| hypothetical protein PHAVU_002G104900g [Phaseolus vulgaris]
 gb|ESW29863.1| hypothetical protein PHAVU_002G104900g [Phaseolus vulgaris]
Length=290

 Score =   255 bits (652),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 116/141 (82%), Positives = 128/141 (91%), Gaps = 0/141 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            K+IADF+FIP EHGEGLQ+LHYEVGQKYEPHYDYFLDD+NTKNGGQRIATV MYL+DVEE
Sbjct  150  KKIADFSFIPVEHGEGLQVLHYEVGQKYEPHYDYFLDDFNTKNGGQRIATVLMYLTDVEE  209

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGETVFP+AKGN S+VPW NEL +CGK GLS+KP+ GDALL WSMKPD +LD SSLHGGC
Sbjct  210  GGETVFPAAKGNFSSVPWWNELSDCGKKGLSIKPRRGDALLFWSMKPDATLDSSSLHGGC  269

Query  363  PVIKGNKWSXTKXMRVREYKA  301
            PVIKGNKWS TK +RV EYKA
Sbjct  270  PVIKGNKWSSTKWLRVNEYKA  290



>ref|XP_010266900.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Nelumbo nucifera]
Length=289

 Score =   255 bits (651),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 116/141 (82%), Positives = 125/141 (89%), Gaps = 0/141 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRIADFTFIP EHGEGLQILHYEVGQKYEPHYDYFLD++NTKNGGQR+AT+ MYLSDVEE
Sbjct  149  KRIADFTFIPVEHGEGLQILHYEVGQKYEPHYDYFLDEFNTKNGGQRMATLLMYLSDVEE  208

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGET+FPS   N S+VPW NEL ECGK GLSVKPKMGDALL WSM+PD +LDPSSLHGGC
Sbjct  209  GGETIFPSTNTNFSSVPWYNELSECGKKGLSVKPKMGDALLFWSMRPDATLDPSSLHGGC  268

Query  363  PVIKGNKWSXTKXMRVREYKA  301
            PVIKGNKWS TK M + EYK 
Sbjct  269  PVIKGNKWSSTKWMHINEYKV  289



>ref|XP_004512179.1| PREDICTED: prolyl 4-hydroxylase subunit alpha-1-like isoform 
X1 [Cicer arietinum]
 ref|XP_004512180.1| PREDICTED: prolyl 4-hydroxylase subunit alpha-1-like isoform 
X2 [Cicer arietinum]
Length=292

 Score =   254 bits (650),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 115/141 (82%), Positives = 127/141 (90%), Gaps = 0/141 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRIADFTFIP EHGEGLQ+LHYEVGQKYEPHYDYFLDD+NT+NGGQRIAT+ MYL+DVEE
Sbjct  152  KRIADFTFIPVEHGEGLQVLHYEVGQKYEPHYDYFLDDFNTQNGGQRIATILMYLTDVEE  211

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGETVFP+AKGN S+VPW N+L +CGK GLS+KPK GDALL WSMKPD +LD SSLHGGC
Sbjct  212  GGETVFPAAKGNFSSVPWYNDLSDCGKKGLSIKPKRGDALLFWSMKPDATLDASSLHGGC  271

Query  363  PVIKGNKWSXTKXMRVREYKA  301
            PVIKGNKWS TK +RV EYK 
Sbjct  272  PVIKGNKWSSTKWIRVSEYKT  292



>ref|XP_004238387.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Solanum lycopersicum]
Length=292

 Score =   254 bits (650),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 119/141 (84%), Positives = 128/141 (91%), Gaps = 0/141 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRIAD+TFIPAEHGEGLQ+LHYEVGQKYEPHYDYFLDD+NTKNGGQRIAT+ MYLSDVEE
Sbjct  152  KRIADYTFIPAEHGEGLQVLHYEVGQKYEPHYDYFLDDFNTKNGGQRIATLLMYLSDVEE  211

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGETVFP+AKGN S+ P  NEL EC KGGLSVKPKMGDALL WSM+PD +LDPSSLHGGC
Sbjct  212  GGETVFPAAKGNFSSSPGWNELSECAKGGLSVKPKMGDALLFWSMRPDATLDPSSLHGGC  271

Query  363  PVIKGNKWSXTKXMRVREYKA  301
            PVIKGNKWS TK M V EYK+
Sbjct  272  PVIKGNKWSSTKWMHVGEYKS  292



>gb|KHN09058.1| Prolyl 4-hydroxylase subunit alpha-2 [Glycine soja]
Length=290

 Score =   254 bits (649),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 115/141 (82%), Positives = 126/141 (89%), Gaps = 0/141 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRIADFTFIP E+GEGLQILHYEVGQKYEPHYDYFLD++NTKNGGQRIATV MYLSDVEE
Sbjct  150  KRIADFTFIPEENGEGLQILHYEVGQKYEPHYDYFLDEFNTKNGGQRIATVLMYLSDVEE  209

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGETVFP+A  N S+VPW N+L +C + GLSVKPKMGDALL WSM+PD +LDPSSLHGGC
Sbjct  210  GGETVFPAANANFSSVPWWNDLSQCARKGLSVKPKMGDALLFWSMRPDATLDPSSLHGGC  269

Query  363  PVIKGNKWSXTKXMRVREYKA  301
            PVIKGNKWS TK M +REYK 
Sbjct  270  PVIKGNKWSSTKWMHLREYKV  290



>ref|XP_009363441.1| PREDICTED: probable prolyl 4-hydroxylase 10 [Pyrus x bretschneideri]
Length=291

 Score =   254 bits (649),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 117/139 (84%), Positives = 126/139 (91%), Gaps = 0/139 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            K+IA+FTF+P EHGEGLQ+LHYEVGQKYEPHYDYF DD+NTKNGGQRI TV MYLSDVEE
Sbjct  151  KKIANFTFLPVEHGEGLQVLHYEVGQKYEPHYDYFQDDFNTKNGGQRIGTVLMYLSDVEE  210

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGETVFP+AKGNIS+VPW  EL ECGK GLSVKPKMGDALL WSM+PD SLDPSSLHGGC
Sbjct  211  GGETVFPAAKGNISSVPWWYELSECGKKGLSVKPKMGDALLFWSMRPDASLDPSSLHGGC  270

Query  363  PVIKGNKWSXTKXMRVREY  307
            PVIKGNKWS TK +RV EY
Sbjct  271  PVIKGNKWSSTKWIRVNEY  289



>ref|XP_006581148.1| PREDICTED: prolyl 4-hydroxylase subunit alpha-1 isoform X1 [Glycine 
max]
 ref|XP_006581149.1| PREDICTED: prolyl 4-hydroxylase subunit alpha-1 isoform X2 [Glycine 
max]
 ref|XP_006581150.1| PREDICTED: prolyl 4-hydroxylase subunit alpha-1 isoform X3 [Glycine 
max]
 ref|XP_006581151.1| PREDICTED: prolyl 4-hydroxylase subunit alpha-1 isoform X4 [Glycine 
max]
Length=290

 Score =   254 bits (649),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 115/141 (82%), Positives = 126/141 (89%), Gaps = 0/141 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRIADFTFIP E+GEGLQILHYEVGQKYEPHYDYFLD++NTKNGGQRIATV MYLSDVEE
Sbjct  150  KRIADFTFIPEENGEGLQILHYEVGQKYEPHYDYFLDEFNTKNGGQRIATVLMYLSDVEE  209

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGETVFP+A  N S+VPW N+L +C + GLSVKPKMGDALL WSM+PD +LDPSSLHGGC
Sbjct  210  GGETVFPAANANFSSVPWWNDLSQCARKGLSVKPKMGDALLFWSMRPDATLDPSSLHGGC  269

Query  363  PVIKGNKWSXTKXMRVREYKA  301
            PVIKGNKWS TK M +REYK 
Sbjct  270  PVIKGNKWSSTKWMHLREYKV  290



>ref|XP_007156206.1| hypothetical protein PHAVU_003G267200g [Phaseolus vulgaris]
 ref|XP_007156207.1| hypothetical protein PHAVU_003G267200g [Phaseolus vulgaris]
 gb|ESW28200.1| hypothetical protein PHAVU_003G267200g [Phaseolus vulgaris]
 gb|ESW28201.1| hypothetical protein PHAVU_003G267200g [Phaseolus vulgaris]
Length=289

 Score =   254 bits (648),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 115/141 (82%), Positives = 127/141 (90%), Gaps = 0/141 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRI+D TFIP EHGEGLQ+LHYEVGQKYE H+DYF+D+ NTKNGGQRIAT+ MYLSDVEE
Sbjct  149  KRISDLTFIPVEHGEGLQVLHYEVGQKYESHFDYFMDNINTKNGGQRIATMLMYLSDVEE  208

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGETVFP AKGN+S+VPW NEL ECGK GLS+KPKMGDALL WSMKPD +LDP SLHGGC
Sbjct  209  GGETVFPDAKGNVSSVPWWNELSECGKKGLSIKPKMGDALLFWSMKPDATLDPLSLHGGC  268

Query  363  PVIKGNKWSXTKXMRVREYKA  301
            PVIKGNKWS TK MR++EYKA
Sbjct  269  PVIKGNKWSSTKWMRLKEYKA  289



>ref|XP_003612249.1| Prolyl 4-hydroxylase alpha-2 subunit [Medicago truncatula]
 gb|AES95207.1| prolyl 4-hydroxylase alpha-like protein [Medicago truncatula]
Length=289

 Score =   254 bits (648),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 116/141 (82%), Positives = 126/141 (89%), Gaps = 0/141 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            K+IADFTFIP EHGEGLQ+LHYEVGQKYEPHYDYFLD++NTKNGGQRIATV MYL+DVEE
Sbjct  149  KKIADFTFIPVEHGEGLQVLHYEVGQKYEPHYDYFLDEFNTKNGGQRIATVLMYLTDVEE  208

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGETVFP+AKGN S VPW NEL +CGK GLS+KPK GDALL WSMKPD +LD SSLHGGC
Sbjct  209  GGETVFPAAKGNFSNVPWYNELSDCGKKGLSIKPKRGDALLFWSMKPDATLDASSLHGGC  268

Query  363  PVIKGNKWSXTKXMRVREYKA  301
            PVIKGNKWS TK +RV EYK 
Sbjct  269  PVIKGNKWSSTKWIRVNEYKT  289



>ref|XP_002285898.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Vitis vinifera]
 ref|XP_010664132.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Vitis vinifera]
 ref|XP_010664133.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Vitis vinifera]
 emb|CBI18919.3| unnamed protein product [Vitis vinifera]
Length=288

 Score =   254 bits (648),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 117/141 (83%), Positives = 126/141 (89%), Gaps = 0/141 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRIADFTFIP EHGEGLQ+LHYEVGQKY+ HYDYFLD++NTKNGGQRIAT+ MYLSDVEE
Sbjct  148  KRIADFTFIPVEHGEGLQVLHYEVGQKYDAHYDYFLDEFNTKNGGQRIATLLMYLSDVEE  207

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGETVFP+ K N S+VPW NEL ECGK GLSVKPKMGDALL WSM+PD +LDPSSLHGGC
Sbjct  208  GGETVFPATKANFSSVPWWNELSECGKKGLSVKPKMGDALLFWSMRPDATLDPSSLHGGC  267

Query  363  PVIKGNKWSXTKXMRVREYKA  301
            PVIKGNKWS TK M V EYKA
Sbjct  268  PVIKGNKWSSTKWMHVEEYKA  288



>ref|XP_009337076.1| PREDICTED: probable prolyl 4-hydroxylase 10 [Pyrus x bretschneideri]
Length=291

 Score =   253 bits (646),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 117/139 (84%), Positives = 126/139 (91%), Gaps = 0/139 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            K+IA+FTF+P EHGEGLQ+LHYEVGQKYEPHYDYF DD+NTKNGGQRI TV MYLSDVEE
Sbjct  151  KKIANFTFLPVEHGEGLQVLHYEVGQKYEPHYDYFQDDFNTKNGGQRIGTVLMYLSDVEE  210

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGETVFP+AKGNIS+VPW  EL ECGK GLSVKPKMGDALL WSM+PD SLDPSSLHGGC
Sbjct  211  GGETVFPAAKGNISSVPWWYELSECGKKGLSVKPKMGDALLFWSMRPDASLDPSSLHGGC  270

Query  363  PVIKGNKWSXTKXMRVREY  307
            PVIKGNKWS TK +RV EY
Sbjct  271  PVIKGNKWSSTKWIRVNEY  289



>ref|XP_010033532.1| PREDICTED: probable prolyl 4-hydroxylase 10 [Eucalyptus grandis]
 ref|XP_010033534.1| PREDICTED: probable prolyl 4-hydroxylase 10 [Eucalyptus grandis]
 gb|KCW53223.1| hypothetical protein EUGRSUZ_J02489 [Eucalyptus grandis]
 gb|KCW53224.1| hypothetical protein EUGRSUZ_J02489 [Eucalyptus grandis]
Length=294

 Score =   253 bits (645),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 115/141 (82%), Positives = 128/141 (91%), Gaps = 0/141 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRIAD+TFIP E+GEGLQ+LHYEVGQKYEPH+DYFLD+YNT+NGGQR+AT+ MYLSDVEE
Sbjct  154  KRIADYTFIPVENGEGLQVLHYEVGQKYEPHFDYFLDEYNTRNGGQRMATLLMYLSDVEE  213

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGETVFP+AKGN S+VPW NEL +CGK GLSVKPKMGDALL WSM+PD +LD SSLHGGC
Sbjct  214  GGETVFPAAKGNFSSVPWWNELSDCGKKGLSVKPKMGDALLFWSMRPDATLDESSLHGGC  273

Query  363  PVIKGNKWSXTKXMRVREYKA  301
            PVIKGNKWS TK MRV EYK 
Sbjct  274  PVIKGNKWSSTKWMRVHEYKV  294



>gb|KHG25174.1| phy-2: Prolyl 4-hydroxylase subunit alpha-2 [Gossypium arboreum]
Length=339

 Score =   254 bits (649),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 119/138 (86%), Positives = 125/138 (91%), Gaps = 0/138 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRIADFTFIP EHGEGLQ+LHYEVGQKYEPHYDYF D+ NT+NGGQRIATV MYLSDVEE
Sbjct  149  KRIADFTFIPVEHGEGLQVLHYEVGQKYEPHYDYFKDEVNTRNGGQRIATVLMYLSDVEE  208

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGETVFPSAKGNISAVPW NEL ECGKGGLSV+PKMGDALL WSMKPD +LD  SLHGGC
Sbjct  209  GGETVFPSAKGNISAVPWWNELSECGKGGLSVRPKMGDALLFWSMKPDATLDLLSLHGGC  268

Query  363  PVIKGNKWSXTKXMRVRE  310
            PVI+GNKWS TK MRV E
Sbjct  269  PVIRGNKWSSTKWMRVNE  286



>ref|XP_008377129.1| PREDICTED: prolyl 4-hydroxylase subunit alpha-2-like [Malus domestica]
Length=287

 Score =   252 bits (643),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 115/141 (82%), Positives = 127/141 (90%), Gaps = 0/141 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRIADFTFIP EHGEGLQILHYEVGQKY+ H+DYFLD++NTKNGGQR+AT+ MYLSDVEE
Sbjct  147  KRIADFTFIPVEHGEGLQILHYEVGQKYDAHFDYFLDEFNTKNGGQRVATLLMYLSDVEE  206

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGETVFP+AKGNIS+VPW NEL ECGK GL+VKPKMGDALL WSM+PD +LDPSSLHGGC
Sbjct  207  GGETVFPAAKGNISSVPWWNELSECGKQGLAVKPKMGDALLFWSMRPDATLDPSSLHGGC  266

Query  363  PVIKGNKWSXTKXMRVREYKA  301
            PVI GNKWS TK M + EYK 
Sbjct  267  PVIIGNKWSSTKWMHLEEYKV  287



>ref|XP_010266054.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Nelumbo nucifera]
 ref|XP_010266055.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Nelumbo nucifera]
Length=289

 Score =   252 bits (643),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 115/141 (82%), Positives = 125/141 (89%), Gaps = 0/141 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRIAD+TFIP EHGEGLQILHYEVGQKYE HYDYFLD++NTKNGGQR+AT+ MYLSDVEE
Sbjct  149  KRIADYTFIPVEHGEGLQILHYEVGQKYESHYDYFLDEFNTKNGGQRMATLLMYLSDVEE  208

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGET FP+AK N S+VPW NEL ECGK GLSVKPKMGDALL WSM+PD +LDPSSLHGGC
Sbjct  209  GGETAFPNAKANFSSVPWYNELSECGKKGLSVKPKMGDALLFWSMRPDATLDPSSLHGGC  268

Query  363  PVIKGNKWSXTKXMRVREYKA  301
            PVIKGNKWS TK M + EYK 
Sbjct  269  PVIKGNKWSSTKWMHINEYKV  289



>ref|XP_008393737.1| PREDICTED: prolyl 4-hydroxylase subunit alpha-1-like [Malus domestica]
Length=292

 Score =   252 bits (643),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 116/139 (83%), Positives = 126/139 (91%), Gaps = 0/139 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            K+IA+FTF+P E GEGLQ+LHYEVGQKYEPH+DYF DD+NTKNGGQRIATV MYLSDVEE
Sbjct  152  KKIANFTFLPVEQGEGLQVLHYEVGQKYEPHFDYFQDDFNTKNGGQRIATVLMYLSDVEE  211

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGETVFP+AKGNIS+VPW  EL ECGK GLSVKPKMGDALL WSM+PD SLDPSSLHGGC
Sbjct  212  GGETVFPAAKGNISSVPWWYELSECGKKGLSVKPKMGDALLFWSMRPDASLDPSSLHGGC  271

Query  363  PVIKGNKWSXTKXMRVREY  307
            PVIKGNKWS TK +RV EY
Sbjct  272  PVIKGNKWSSTKWIRVSEY  290



>ref|XP_010061109.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Eucalyptus grandis]
 ref|XP_010061110.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Eucalyptus grandis]
 gb|KCW68007.1| hypothetical protein EUGRSUZ_F01696 [Eucalyptus grandis]
 gb|KCW68008.1| hypothetical protein EUGRSUZ_F01696 [Eucalyptus grandis]
 gb|KCW68009.1| hypothetical protein EUGRSUZ_F01696 [Eucalyptus grandis]
Length=321

 Score =   253 bits (645),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 115/141 (82%), Positives = 128/141 (91%), Gaps = 0/141 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRIADFTFIP EHGEGLQ+LHYEVGQKY+ HYDYFLD++NTKNGGQRIAT+ MYLSDVEE
Sbjct  181  KRIADFTFIPVEHGEGLQVLHYEVGQKYDAHYDYFLDEFNTKNGGQRIATLLMYLSDVEE  240

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGETVFP AKGNIS+VPW ++L ECGK GL+VKPKMGDALL WSM+P+G+LDPSSLHGGC
Sbjct  241  GGETVFPDAKGNISSVPWWDQLSECGKQGLAVKPKMGDALLFWSMRPEGTLDPSSLHGGC  300

Query  363  PVIKGNKWSXTKXMRVREYKA  301
            PVI GNKWS TK M +REYK 
Sbjct  301  PVISGNKWSSTKWMHLREYKV  321



>ref|XP_007136121.1| hypothetical protein PHAVU_009G019600g [Phaseolus vulgaris]
 gb|ESW08115.1| hypothetical protein PHAVU_009G019600g [Phaseolus vulgaris]
Length=289

 Score =   251 bits (641),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 113/141 (80%), Positives = 125/141 (89%), Gaps = 0/141 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRIADFTFIP E+GEGLQILHYEVGQKYEPHYDYF+D++NTKNGGQRIATV MYLSDVEE
Sbjct  149  KRIADFTFIPVENGEGLQILHYEVGQKYEPHYDYFIDEFNTKNGGQRIATVLMYLSDVEE  208

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGETVFP+A  N S+VPW N+L +C + GLSVKPKMGDALL WSM+PD +LDPSSLHGGC
Sbjct  209  GGETVFPAANANFSSVPWWNDLSQCARKGLSVKPKMGDALLFWSMRPDATLDPSSLHGGC  268

Query  363  PVIKGNKWSXTKXMRVREYKA  301
            PVIKGNKWS TK M + EYK 
Sbjct  269  PVIKGNKWSSTKWMHLHEYKV  289



>ref|XP_010940405.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Elaeis guineensis]
Length=295

 Score =   251 bits (641),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 115/141 (82%), Positives = 126/141 (89%), Gaps = 0/141 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRIAD+TFIP EHGEG Q+LHYEVGQKYEPH+DYFLD++NTKNGGQR+AT+ MYLSDVEE
Sbjct  155  KRIADYTFIPVEHGEGFQVLHYEVGQKYEPHFDYFLDEFNTKNGGQRMATLLMYLSDVEE  214

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGETVFPSAK N S++PW NEL ECGK GLSVKPKMGDALL WSMKPD +LDP SLHGGC
Sbjct  215  GGETVFPSAKVNSSSLPWFNELSECGKKGLSVKPKMGDALLFWSMKPDATLDPLSLHGGC  274

Query  363  PVIKGNKWSXTKXMRVREYKA  301
            P+IKGNKWS TK MRV EYK 
Sbjct  275  PMIKGNKWSATKWMRVHEYKV  295



>ref|XP_010918438.1| PREDICTED: probable prolyl 4-hydroxylase 3 isoform X2 [Elaeis 
guineensis]
Length=289

 Score =   251 bits (641),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 115/141 (82%), Positives = 125/141 (89%), Gaps = 0/141 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRIADFTFIP EHGEGLQILHYEVGQKYEPH+DYFLD++N KNGGQRIAT+ MYLSDVEE
Sbjct  149  KRIADFTFIPVEHGEGLQILHYEVGQKYEPHFDYFLDEFNVKNGGQRIATLLMYLSDVEE  208

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGETVFPS + N S++PW NEL ECGK GLSVKPKMGDALL WSM+PD +LDPSSLHGGC
Sbjct  209  GGETVFPSVRVNSSSLPWYNELSECGKKGLSVKPKMGDALLFWSMRPDATLDPSSLHGGC  268

Query  363  PVIKGNKWSXTKXMRVREYKA  301
            PV+KGNKWS TK M V EYK 
Sbjct  269  PVLKGNKWSSTKWMHVYEYKV  289



>ref|XP_010918436.1| PREDICTED: probable prolyl 4-hydroxylase 3 isoform X1 [Elaeis 
guineensis]
 ref|XP_010918437.1| PREDICTED: probable prolyl 4-hydroxylase 3 isoform X1 [Elaeis 
guineensis]
Length=290

 Score =   251 bits (640),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 115/141 (82%), Positives = 125/141 (89%), Gaps = 0/141 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRIADFTFIP EHGEGLQILHYEVGQKYEPH+DYFLD++N KNGGQRIAT+ MYLSDVEE
Sbjct  150  KRIADFTFIPVEHGEGLQILHYEVGQKYEPHFDYFLDEFNVKNGGQRIATLLMYLSDVEE  209

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGETVFPS + N S++PW NEL ECGK GLSVKPKMGDALL WSM+PD +LDPSSLHGGC
Sbjct  210  GGETVFPSVRVNSSSLPWYNELSECGKKGLSVKPKMGDALLFWSMRPDATLDPSSLHGGC  269

Query  363  PVIKGNKWSXTKXMRVREYKA  301
            PV+KGNKWS TK M V EYK 
Sbjct  270  PVLKGNKWSSTKWMHVYEYKV  290



>ref|XP_004287769.1| PREDICTED: probable prolyl 4-hydroxylase 10 [Fragaria vesca subsp. 
vesca]
Length=292

 Score =   251 bits (640),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 113/141 (80%), Positives = 128/141 (91%), Gaps = 0/141 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            ++IA+FTF+P EHGEGLQILHYEVGQKYEPH+DYF D+YNT+NGGQR+AT+ MYLSDVEE
Sbjct  152  RKIANFTFLPVEHGEGLQILHYEVGQKYEPHFDYFQDEYNTRNGGQRMATILMYLSDVEE  211

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGETVFP+AKGNIS+VPW +EL ECGK GLSVKPKMGDALL WSM PD +LDPSSLHGGC
Sbjct  212  GGETVFPNAKGNISSVPWWDELSECGKKGLSVKPKMGDALLFWSMNPDATLDPSSLHGGC  271

Query  363  PVIKGNKWSXTKXMRVREYKA  301
            PVI+GNKWS TK +RV EYK 
Sbjct  272  PVIRGNKWSSTKWIRVDEYKV  292



>gb|ACR34708.1| unknown [Zea mays]
Length=180

 Score =   246 bits (629),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 110/141 (78%), Positives = 125/141 (89%), Gaps = 0/141 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRIAD+TFIP +HGEGLQ+LHYEVGQKYEPH+DYFLD++NTKNGGQR+AT+ MYLSDVEE
Sbjct  40   KRIADYTFIPVDHGEGLQVLHYEVGQKYEPHFDYFLDEFNTKNGGQRMATLLMYLSDVEE  99

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGET+FP A  N+S++PW NEL EC K GLSVKPKMGDALL WSMKPD +LDP SLHGGC
Sbjct  100  GGETIFPDANVNVSSLPWYNELSECAKRGLSVKPKMGDALLFWSMKPDATLDPLSLHGGC  159

Query  363  PVIKGNKWSXTKXMRVREYKA  301
            PVI+GNKWS TK M + EYKA
Sbjct  160  PVIRGNKWSSTKWMHIHEYKA  180



>ref|XP_010548243.1| PREDICTED: prolyl 4-hydroxylase 5 [Tarenaya hassleriana]
Length=290

 Score =   250 bits (639),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 115/141 (82%), Positives = 125/141 (89%), Gaps = 0/141 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            +RI+DFTFIP E+GEGLQ+LHYEVGQKYEPH+DYFLD++N KNGGQRIATV MYLSDVEE
Sbjct  150  QRISDFTFIPVENGEGLQVLHYEVGQKYEPHFDYFLDEFNVKNGGQRIATVLMYLSDVEE  209

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGETVFP+AKGNISAVPW NEL +CGK GLSV PKMGDALL WSM PD SLDPSSLHGGC
Sbjct  210  GGETVFPAAKGNISAVPWWNELSQCGKEGLSVMPKMGDALLFWSMTPDASLDPSSLHGGC  269

Query  363  PVIKGNKWSXTKXMRVREYKA  301
            PVIKGNKWS TK   V E+K 
Sbjct  270  PVIKGNKWSSTKWFHVHEFKV  290



>ref|XP_007017902.1| 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily 
protein isoform 1 [Theobroma cacao]
 gb|EOY15127.1| 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily 
protein isoform 1 [Theobroma cacao]
Length=287

 Score =   250 bits (638),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 113/141 (80%), Positives = 126/141 (89%), Gaps = 0/141 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRIAD+TFIP EHGEGLQ+LHYEVGQKY+ H+DYFLD++NTKNGGQR+AT+ MYLSDVEE
Sbjct  147  KRIADYTFIPVEHGEGLQVLHYEVGQKYDAHFDYFLDEFNTKNGGQRMATMLMYLSDVEE  206

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGET+FP+AKGN SAVPW NEL ECGK GLSVKPKMGDALL WSM+PD +LDPSSLHGGC
Sbjct  207  GGETIFPAAKGNFSAVPWWNELSECGKQGLSVKPKMGDALLFWSMRPDATLDPSSLHGGC  266

Query  363  PVIKGNKWSXTKXMRVREYKA  301
            PVI GNKWS TK + V EYK 
Sbjct  267  PVIMGNKWSSTKWIHVEEYKV  287



>ref|XP_008809395.1| PREDICTED: probable prolyl 4-hydroxylase 3 isoform X1 [Phoenix 
dactylifera]
 ref|XP_008809396.1| PREDICTED: probable prolyl 4-hydroxylase 3 isoform X1 [Phoenix 
dactylifera]
 ref|XP_008809397.1| PREDICTED: probable prolyl 4-hydroxylase 3 isoform X1 [Phoenix 
dactylifera]
Length=290

 Score =   249 bits (637),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 113/141 (80%), Positives = 126/141 (89%), Gaps = 0/141 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRIADFTFIP EHGEGLQILHYEVGQKYEPH+DYFLD++N KNGGQRIAT+ MYLSDVEE
Sbjct  150  KRIADFTFIPVEHGEGLQILHYEVGQKYEPHFDYFLDEFNIKNGGQRIATLLMYLSDVEE  209

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGETVFP+A+ N S++PW NEL ECGK GLSVKPKMGDALL WSM+PD +LDPSSLHGGC
Sbjct  210  GGETVFPAARVNSSSLPWYNELSECGKKGLSVKPKMGDALLFWSMRPDATLDPSSLHGGC  269

Query  363  PVIKGNKWSXTKXMRVREYKA  301
            PV+KGNKWS TK + + EYK 
Sbjct  270  PVLKGNKWSSTKWIHIHEYKV  290



>ref|XP_010100124.1| Prolyl 4-hydroxylase subunit alpha-2 [Morus notabilis]
 gb|EXB81507.1| Prolyl 4-hydroxylase subunit alpha-2 [Morus notabilis]
Length=287

 Score =   249 bits (637),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 115/141 (82%), Positives = 127/141 (90%), Gaps = 0/141 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRIADFTFIP EHGEGLQILHYEVGQKY+ H+DYFLDD+NTKNGGQR+AT+ MYLSDVEE
Sbjct  147  KRIADFTFIPVEHGEGLQILHYEVGQKYDEHFDYFLDDFNTKNGGQRVATLLMYLSDVEE  206

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGETVFPSAKGN S++P+ NEL ECGK GL+VKPKMGDALL WSM+PD +LDPSSLHGGC
Sbjct  207  GGETVFPSAKGNFSSLPYWNELSECGKQGLAVKPKMGDALLFWSMRPDATLDPSSLHGGC  266

Query  363  PVIKGNKWSXTKXMRVREYKA  301
            PVIKGNKWS TK M + EYK 
Sbjct  267  PVIKGNKWSSTKWMHLGEYKV  287



>ref|XP_010536435.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Tarenaya hassleriana]
Length=289

 Score =   249 bits (637),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 115/140 (82%), Positives = 125/140 (89%), Gaps = 0/140 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRIAD+TFIPAEHGEGLQ+LHYE GQKYEPHYDYFLD++NTKNGGQR+AT+ MYLSDVEE
Sbjct  149  KRIADYTFIPAEHGEGLQVLHYEEGQKYEPHYDYFLDEFNTKNGGQRMATMLMYLSDVEE  208

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGETVFPSA  N ++VPW NEL  CGK GLSVKPKMGDALL WSM+PD SLDP+SLHGGC
Sbjct  209  GGETVFPSANMNYTSVPWYNELSLCGKKGLSVKPKMGDALLFWSMRPDASLDPTSLHGGC  268

Query  363  PVIKGNKWSXTKXMRVREYK  304
            PVIKGNKWS TK M V EYK
Sbjct  269  PVIKGNKWSSTKWMHVGEYK  288



>ref|XP_008221210.1| PREDICTED: prolyl 4-hydroxylase subunit alpha-1 [Prunus mume]
Length=299

 Score =   250 bits (638),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 114/141 (81%), Positives = 125/141 (89%), Gaps = 0/141 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRIADFTFIP EHGEGLQILHYEVGQKY+ H+DYFLD++NTKNGGQRIAT+ MYLSDVEE
Sbjct  159  KRIADFTFIPVEHGEGLQILHYEVGQKYDAHFDYFLDEFNTKNGGQRIATLLMYLSDVEE  218

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGETVFP+AKG+  +V W NEL ECGK GLSVKPKMGDALL WSM+PD SLDPSSLHGGC
Sbjct  219  GGETVFPAAKGSFKSVRWWNELSECGKQGLSVKPKMGDALLFWSMRPDASLDPSSLHGGC  278

Query  363  PVIKGNKWSXTKXMRVREYKA  301
            PVI+GNKWS TK M + EYK 
Sbjct  279  PVIRGNKWSSTKWMHIEEYKV  299



>gb|ACN35795.1| unknown [Zea mays]
Length=180

 Score =   246 bits (627),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 111/141 (79%), Positives = 124/141 (88%), Gaps = 0/141 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRIAD+TFIP +HGEGLQ+LHYEVGQKYEPH+DYFLD++NTKNGGQRIAT+ MYLSDVEE
Sbjct  40   KRIADYTFIPVDHGEGLQVLHYEVGQKYEPHFDYFLDEFNTKNGGQRIATLLMYLSDVEE  99

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGET+FP A  N S++PW NEL +C K GLSVKPKMGDALL WSMKPD +LDP SLHGGC
Sbjct  100  GGETIFPDANVNASSLPWYNELSDCAKRGLSVKPKMGDALLFWSMKPDATLDPLSLHGGC  159

Query  363  PVIKGNKWSXTKXMRVREYKA  301
            PVIKGNKWS TK M + EYKA
Sbjct  160  PVIKGNKWSSTKWMHIHEYKA  180



>ref|XP_008809398.1| PREDICTED: probable prolyl 4-hydroxylase 3 isoform X2 [Phoenix 
dactylifera]
Length=289

 Score =   249 bits (637),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 113/141 (80%), Positives = 126/141 (89%), Gaps = 0/141 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRIADFTFIP EHGEGLQILHYEVGQKYEPH+DYFLD++N KNGGQRIAT+ MYLSDVEE
Sbjct  149  KRIADFTFIPVEHGEGLQILHYEVGQKYEPHFDYFLDEFNIKNGGQRIATLLMYLSDVEE  208

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGETVFP+A+ N S++PW NEL ECGK GLSVKPKMGDALL WSM+PD +LDPSSLHGGC
Sbjct  209  GGETVFPAARVNSSSLPWYNELSECGKKGLSVKPKMGDALLFWSMRPDATLDPSSLHGGC  268

Query  363  PVIKGNKWSXTKXMRVREYKA  301
            PV+KGNKWS TK + + EYK 
Sbjct  269  PVLKGNKWSSTKWIHIHEYKV  289



>ref|XP_006577956.1| PREDICTED: prolyl 4-hydroxylase subunit alpha-1-like isoform 
X1 [Glycine max]
 gb|KHN45959.1| Prolyl 4-hydroxylase subunit alpha-1 [Glycine soja]
Length=289

 Score =   249 bits (636),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 112/141 (79%), Positives = 124/141 (88%), Gaps = 0/141 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRIADFTFIP E+GEGLQILHYE GQKYEPHYDYFLD++NTKNGGQRIATV MYLSDVEE
Sbjct  149  KRIADFTFIPVENGEGLQILHYEAGQKYEPHYDYFLDEFNTKNGGQRIATVLMYLSDVEE  208

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGETVFP+A  N S+VPW N+L +C + GLSVKPKMGDALL WSM+PD +LDPSSLHGGC
Sbjct  209  GGETVFPAANANFSSVPWWNDLSQCARKGLSVKPKMGDALLFWSMRPDATLDPSSLHGGC  268

Query  363  PVIKGNKWSXTKXMRVREYKA  301
            PVIKGNKWS TK + + EYK 
Sbjct  269  PVIKGNKWSSTKWLHLHEYKV  289



>gb|KJB59736.1| hypothetical protein B456_009G269000 [Gossypium raimondii]
Length=276

 Score =   248 bits (634),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 111/141 (79%), Positives = 127/141 (90%), Gaps = 0/141 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRIAD++FIP EHGEGLQ+LHYEVGQKY+ H+DYFLD++NTKNGGQR+AT+ MYLSDVEE
Sbjct  136  KRIADYSFIPVEHGEGLQVLHYEVGQKYDAHFDYFLDEFNTKNGGQRMATMLMYLSDVEE  195

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGET+FP+AKGNIS+VPW NEL ECGK GL+VKPKMGDALL WSM+PD +LDPSSLHGGC
Sbjct  196  GGETIFPAAKGNISSVPWWNELSECGKQGLAVKPKMGDALLFWSMRPDATLDPSSLHGGC  255

Query  363  PVIKGNKWSXTKXMRVREYKA  301
            PVI GNKWS TK M + EYK 
Sbjct  256  PVIMGNKWSSTKWMHLEEYKV  276



>ref|XP_002893096.1| oxidoreductase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69355.1| oxidoreductase [Arabidopsis lyrata subsp. lyrata]
Length=287

 Score =   249 bits (635),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 112/140 (80%), Positives = 126/140 (90%), Gaps = 0/140 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRIAD+TFIPA+HGEGLQILHYE GQKYEPHYDYF+D++NTKNGGQR+AT+ MYLSDVEE
Sbjct  147  KRIADYTFIPADHGEGLQILHYEAGQKYEPHYDYFVDEFNTKNGGQRMATMLMYLSDVEE  206

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGETVFP+A  N S+VPW NEL ECGK GLSVKP+MGDALL WSM+PD +LDP+SLHGGC
Sbjct  207  GGETVFPAANMNFSSVPWYNELSECGKKGLSVKPRMGDALLFWSMRPDATLDPTSLHGGC  266

Query  363  PVIKGNKWSXTKXMRVREYK  304
            PVI+GNKWS TK M V EYK
Sbjct  267  PVIRGNKWSSTKWMHVGEYK  286



>ref|XP_009110235.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Brassica rapa]
Length=290

 Score =   249 bits (636),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 113/140 (81%), Positives = 126/140 (90%), Gaps = 0/140 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRIAD+TFIPA+HGEGLQ+LHYE GQKYEPHYDYF+D++NTKNGGQR+AT+ MYLSDVEE
Sbjct  150  KRIADYTFIPADHGEGLQVLHYEEGQKYEPHYDYFVDEFNTKNGGQRMATMLMYLSDVEE  209

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGETVFP+A  N S+VPW NEL ECGK GLSVKP+MGDALL WSM+PD +LDPSSLHGGC
Sbjct  210  GGETVFPAANMNFSSVPWYNELSECGKKGLSVKPRMGDALLFWSMRPDATLDPSSLHGGC  269

Query  363  PVIKGNKWSXTKXMRVREYK  304
            PVIKGNKWS TK M V EYK
Sbjct  270  PVIKGNKWSSTKWMHVGEYK  289



>ref|XP_006305481.1| hypothetical protein CARUB_v10009921mg [Capsella rubella]
 gb|EOA38379.1| hypothetical protein CARUB_v10009921mg [Capsella rubella]
Length=287

 Score =   249 bits (635),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 111/141 (79%), Positives = 126/141 (89%), Gaps = 0/141 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRIAD+TFIPA+HGEGLQ+LHYE GQKYEPHYDYF+D++NTKNGGQR+AT+ MYLSDVEE
Sbjct  147  KRIADYTFIPADHGEGLQVLHYEAGQKYEPHYDYFVDEFNTKNGGQRMATMLMYLSDVEE  206

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGETVFP+A  N S+VPW NEL ECGK GLSVKP+MGDALL WSM+PD +LDP+SLHGGC
Sbjct  207  GGETVFPAANMNFSSVPWYNELSECGKKGLSVKPRMGDALLFWSMRPDATLDPTSLHGGC  266

Query  363  PVIKGNKWSXTKXMRVREYKA  301
            PVI+GNKWS TK M V EYK 
Sbjct  267  PVIRGNKWSSTKWMHVGEYKV  287



>ref|XP_010477260.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Camelina sativa]
 ref|XP_010477261.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Camelina sativa]
Length=291

 Score =   249 bits (635),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 112/141 (79%), Positives = 125/141 (89%), Gaps = 0/141 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRIAD+TFIPA+HGEGLQ+LHYE GQKYEPHYDYF+D +NTKNGGQR+AT+ MYLSDVEE
Sbjct  151  KRIADYTFIPADHGEGLQVLHYEAGQKYEPHYDYFVDTFNTKNGGQRMATMLMYLSDVEE  210

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGETVFPSA  N S+VPW NEL ECGK GLSVKP+MGDALL WSM+PD +LDP+SLHGGC
Sbjct  211  GGETVFPSANMNFSSVPWYNELSECGKKGLSVKPRMGDALLFWSMRPDATLDPTSLHGGC  270

Query  363  PVIKGNKWSXTKXMRVREYKA  301
            PVI+GNKWS TK M V EYK 
Sbjct  271  PVIRGNKWSSTKWMHVGEYKV  291



>emb|CDX96644.1| BnaA08g21870D [Brassica napus]
Length=290

 Score =   249 bits (635),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 113/140 (81%), Positives = 126/140 (90%), Gaps = 0/140 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRIAD+TFIPA+HGEGLQ+LHYE GQKYEPHYDYF+D++NTKNGGQR+AT+ MYLSDVEE
Sbjct  150  KRIADYTFIPADHGEGLQVLHYEEGQKYEPHYDYFVDEFNTKNGGQRMATMLMYLSDVEE  209

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGETVFP+A  N S+VPW NEL ECGK GLSVKP+MGDALL WSM+PD +LDPSSLHGGC
Sbjct  210  GGETVFPAANMNFSSVPWYNELSECGKKGLSVKPRMGDALLFWSMRPDATLDPSSLHGGC  269

Query  363  PVIKGNKWSXTKXMRVREYK  304
            PVIKGNKWS TK M V EYK
Sbjct  270  PVIKGNKWSSTKWMHVGEYK  289



>ref|XP_006577957.1| PREDICTED: prolyl 4-hydroxylase subunit alpha-1-like isoform 
X2 [Glycine max]
Length=289

 Score =   249 bits (635),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 112/140 (80%), Positives = 124/140 (89%), Gaps = 0/140 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRIADFTFIP E+GEGLQILHYE GQKYEPHYDYFLD++NTKNGGQRIATV MYLSDVEE
Sbjct  149  KRIADFTFIPVENGEGLQILHYEAGQKYEPHYDYFLDEFNTKNGGQRIATVLMYLSDVEE  208

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGETVFP+A  N S+VPW N+L +C + GLSVKPKMGDALL WSM+PD +LDPSSLHGGC
Sbjct  209  GGETVFPAANANFSSVPWWNDLSQCARKGLSVKPKMGDALLFWSMRPDATLDPSSLHGGC  268

Query  363  PVIKGNKWSXTKXMRVREYK  304
            PVIKGNKWS TK + + EYK
Sbjct  269  PVIKGNKWSSTKWLHLHEYK  288



>ref|NP_564109.1| 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily 
protein [Arabidopsis thaliana]
 sp|Q9LN20.1|P4H3_ARATH RecName: Full=Probable prolyl 4-hydroxylase 3; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAF88161.1|AC026234_12 Contains similarity to a prolyl 4-hydroxylase alpha subunit protein 
from Gallus gallus gi|212530 [Arabidopsis thaliana]
 gb|ABE02413.1| At1g20270 [Arabidopsis thaliana]
 gb|AEE29956.1| 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily 
protein [Arabidopsis thaliana]
Length=287

 Score =   248 bits (634),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 111/140 (79%), Positives = 126/140 (90%), Gaps = 0/140 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRIAD+TFIPA+HGEGLQ+LHYE GQKYEPHYDYF+D++NTKNGGQR+AT+ MYLSDVEE
Sbjct  147  KRIADYTFIPADHGEGLQVLHYEAGQKYEPHYDYFVDEFNTKNGGQRMATMLMYLSDVEE  206

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGETVFP+A  N S+VPW NEL ECGK GLSVKP+MGDALL WSM+PD +LDP+SLHGGC
Sbjct  207  GGETVFPAANMNFSSVPWYNELSECGKKGLSVKPRMGDALLFWSMRPDATLDPTSLHGGC  266

Query  363  PVIKGNKWSXTKXMRVREYK  304
            PVI+GNKWS TK M V EYK
Sbjct  267  PVIRGNKWSSTKWMHVGEYK  286



>gb|KJB59733.1| hypothetical protein B456_009G269000 [Gossypium raimondii]
Length=287

 Score =   248 bits (634),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 111/141 (79%), Positives = 127/141 (90%), Gaps = 0/141 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRIAD++FIP EHGEGLQ+LHYEVGQKY+ H+DYFLD++NTKNGGQR+AT+ MYLSDVEE
Sbjct  147  KRIADYSFIPVEHGEGLQVLHYEVGQKYDAHFDYFLDEFNTKNGGQRMATMLMYLSDVEE  206

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGET+FP+AKGNIS+VPW NEL ECGK GL+VKPKMGDALL WSM+PD +LDPSSLHGGC
Sbjct  207  GGETIFPAAKGNISSVPWWNELSECGKQGLAVKPKMGDALLFWSMRPDATLDPSSLHGGC  266

Query  363  PVIKGNKWSXTKXMRVREYKA  301
            PVI GNKWS TK M + EYK 
Sbjct  267  PVIMGNKWSSTKWMHLEEYKV  287



>gb|KHG14293.1| Prolyl 4-hydroxylase subunit alpha-2 [Gossypium arboreum]
Length=287

 Score =   248 bits (634),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 111/140 (79%), Positives = 126/140 (90%), Gaps = 0/140 (0%)
 Frame = -2

Query  720  RIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEEG  541
            RIAD++FIP EHGEGLQ+LHYEVGQKY+ H+DYFLD++NTKNGGQR+AT+ MYLSDVEEG
Sbjct  148  RIADYSFIPVEHGEGLQVLHYEVGQKYDAHFDYFLDEFNTKNGGQRMATMLMYLSDVEEG  207

Query  540  GETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGCP  361
            GET+FP+AKGNISAVPW NEL ECGK GL+VKPKMGDALL WSM+PD +LDPSSLHGGCP
Sbjct  208  GETIFPAAKGNISAVPWWNELSECGKQGLAVKPKMGDALLFWSMRPDATLDPSSLHGGCP  267

Query  360  VIKGNKWSXTKXMRVREYKA  301
            VI GNKWS TK M + EYK 
Sbjct  268  VITGNKWSSTKWMHLEEYKV  287



>ref|XP_010459709.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Camelina sativa]
 ref|XP_010459710.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Camelina sativa]
Length=292

 Score =   248 bits (634),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 111/141 (79%), Positives = 125/141 (89%), Gaps = 0/141 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRIAD+TFIPA+HGEGLQ+LHYE GQKYEPHYDYF+D +NTKNGGQR+AT+ MYLSDVEE
Sbjct  152  KRIADYTFIPADHGEGLQVLHYEAGQKYEPHYDYFVDTFNTKNGGQRMATMLMYLSDVEE  211

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGETVFP+A  N S+VPW NEL ECGK GLSVKP+MGDALL WSM+PD +LDP+SLHGGC
Sbjct  212  GGETVFPAANMNFSSVPWYNELSECGKKGLSVKPRMGDALLFWSMRPDATLDPTSLHGGC  271

Query  363  PVIKGNKWSXTKXMRVREYKA  301
            PVI+GNKWS TK M V EYK 
Sbjct  272  PVIRGNKWSSTKWMHVGEYKV  292



>ref|XP_008778322.1| PREDICTED: probable prolyl 4-hydroxylase 3 isoform X2 [Phoenix 
dactylifera]
Length=301

 Score =   249 bits (635),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 114/141 (81%), Positives = 126/141 (89%), Gaps = 0/141 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRIAD+TFIP EHGEGLQ+LHYEVGQKYEPH+DYFLD++NTKNGGQR+AT+ MYLSDVEE
Sbjct  161  KRIADYTFIPVEHGEGLQVLHYEVGQKYEPHFDYFLDEFNTKNGGQRMATLLMYLSDVEE  220

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGET FPSAK N S++PW NEL ECGK GLSVKPKMGDALL WSMKPD +LDP SLHGGC
Sbjct  221  GGETGFPSAKVNSSSLPWFNELSECGKKGLSVKPKMGDALLFWSMKPDATLDPLSLHGGC  280

Query  363  PVIKGNKWSXTKXMRVREYKA  301
            P+IKGNKWS TK +RV EYK 
Sbjct  281  PLIKGNKWSATKWIRVHEYKV  301



>emb|CDY54327.1| BnaCnng26730D [Brassica napus]
Length=290

 Score =   248 bits (634),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 112/141 (79%), Positives = 126/141 (89%), Gaps = 0/141 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRIAD+TFIPA+HGEGLQ+LHYE GQKYEPHYDYF+D++NTKNGGQR+AT+ MYLSDVEE
Sbjct  150  KRIADYTFIPADHGEGLQVLHYEEGQKYEPHYDYFVDEFNTKNGGQRMATMLMYLSDVEE  209

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGETVFP+A  N S+VPW NEL ECGK GLSVKP+MGDALL WSM+PD +LDPSSLHGGC
Sbjct  210  GGETVFPAANMNFSSVPWYNELSECGKKGLSVKPRMGDALLFWSMRPDATLDPSSLHGGC  269

Query  363  PVIKGNKWSXTKXMRVREYKA  301
            PVI+GNKWS TK M V EYK 
Sbjct  270  PVIRGNKWSSTKWMHVGEYKV  290



>ref|XP_010539831.1| PREDICTED: probable prolyl 4-hydroxylase 3 isoform X2 [Tarenaya 
hassleriana]
Length=248

 Score =   246 bits (629),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 113/141 (80%), Positives = 125/141 (89%), Gaps = 0/141 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRIAD+TFIP E+GEGLQ+LHYE GQKYEPHYDYF+D++NTKNGGQR+AT+ MYLSDVEE
Sbjct  108  KRIADYTFIPVENGEGLQVLHYEEGQKYEPHYDYFVDEFNTKNGGQRMATMLMYLSDVEE  167

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGETVFP+A  N ++VPW NEL ECGK GLSVKPKMGDALL WSM+PD SLDPSSLHGGC
Sbjct  168  GGETVFPAANMNYTSVPWYNELSECGKKGLSVKPKMGDALLFWSMRPDASLDPSSLHGGC  227

Query  363  PVIKGNKWSXTKXMRVREYKA  301
            PVIKGNKWS TK MR  EYK 
Sbjct  228  PVIKGNKWSSTKWMRAGEYKV  248



>ref|XP_007223346.1| hypothetical protein PRUPE_ppa009548mg [Prunus persica]
 gb|EMJ24545.1| hypothetical protein PRUPE_ppa009548mg [Prunus persica]
Length=287

 Score =   248 bits (632),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 113/141 (80%), Positives = 125/141 (89%), Gaps = 0/141 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRIADFTFIP EHGEGLQILHYEVGQKY+ H+DYFLD++NTKNGGQRIAT+ MYLSDVEE
Sbjct  147  KRIADFTFIPVEHGEGLQILHYEVGQKYDAHFDYFLDEFNTKNGGQRIATLLMYLSDVEE  206

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGETVFP+AKG+ ++V W  EL ECGK GLSVKPKMGDALL WSM+PD SLDPSSLHGGC
Sbjct  207  GGETVFPAAKGSFNSVRWWKELSECGKQGLSVKPKMGDALLFWSMRPDASLDPSSLHGGC  266

Query  363  PVIKGNKWSXTKXMRVREYKA  301
            PVI+GNKWS TK M + EYK 
Sbjct  267  PVIRGNKWSSTKWMHIEEYKV  287



>ref|XP_010539828.1| PREDICTED: probable prolyl 4-hydroxylase 3 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010539829.1| PREDICTED: probable prolyl 4-hydroxylase 3 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010539830.1| PREDICTED: probable prolyl 4-hydroxylase 3 isoform X1 [Tarenaya 
hassleriana]
Length=288

 Score =   248 bits (632),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 113/141 (80%), Positives = 125/141 (89%), Gaps = 0/141 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRIAD+TFIP E+GEGLQ+LHYE GQKYEPHYDYF+D++NTKNGGQR+AT+ MYLSDVEE
Sbjct  148  KRIADYTFIPVENGEGLQVLHYEEGQKYEPHYDYFVDEFNTKNGGQRMATMLMYLSDVEE  207

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGETVFP+A  N ++VPW NEL ECGK GLSVKPKMGDALL WSM+PD SLDPSSLHGGC
Sbjct  208  GGETVFPAANMNYTSVPWYNELSECGKKGLSVKPKMGDALLFWSMRPDASLDPSSLHGGC  267

Query  363  PVIKGNKWSXTKXMRVREYKA  301
            PVIKGNKWS TK MR  EYK 
Sbjct  268  PVIKGNKWSSTKWMRAGEYKV  288



>ref|XP_010531576.1| PREDICTED: prolyl 4-hydroxylase 5-like [Tarenaya hassleriana]
Length=337

 Score =   249 bits (635),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 113/140 (81%), Positives = 125/140 (89%), Gaps = 0/140 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            +RI+DFTFIP E+GEGLQ+LHYEVGQKYEPH+DYFLD++N KNGGQR+ATV MYLS+VEE
Sbjct  197  QRISDFTFIPVENGEGLQVLHYEVGQKYEPHFDYFLDEFNIKNGGQRVATVLMYLSEVEE  256

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGETVFP+AKGNISAVPW NEL +CGK GLSV PKMGDALL WSM PD SLDPSSLHGGC
Sbjct  257  GGETVFPAAKGNISAVPWWNELSQCGKEGLSVMPKMGDALLFWSMTPDASLDPSSLHGGC  316

Query  363  PVIKGNKWSXTKXMRVREYK  304
            PVIKGNKWS TK   V E+K
Sbjct  317  PVIKGNKWSSTKWFHVHEFK  336



>ref|XP_008456388.1| PREDICTED: prolyl 4-hydroxylase subunit alpha-1-like isoform 
X2 [Cucumis melo]
Length=284

 Score =   247 bits (631),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 113/139 (81%), Positives = 124/139 (89%), Gaps = 0/139 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRIADFTFIP EHGEGLQILHYEVGQKY+ HYDYF+D+YN K GGQR+AT+ MYLSDVEE
Sbjct  145  KRIADFTFIPIEHGEGLQILHYEVGQKYDAHYDYFVDEYNIKKGGQRMATLLMYLSDVEE  204

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGETVFP+AKGN S+VPW NEL ECGKGGLSVKPKMGDALL WSMKPD +LDP+SLHG C
Sbjct  205  GGETVFPAAKGNFSSVPWWNELSECGKGGLSVKPKMGDALLFWSMKPDATLDPTSLHGAC  264

Query  363  PVIKGNKWSXTKXMRVREY  307
            PVI+GNKWS TK M V +Y
Sbjct  265  PVIRGNKWSCTKWMHVNKY  283



>dbj|BAD23054.1| putative prolyl 4-hydroxylase [Oryza sativa Japonica Group]
Length=310

 Score =   248 bits (633),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 113/141 (80%), Positives = 125/141 (89%), Gaps = 0/141 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRIAD+TFIP EHGEGLQ+LHYEVGQKYEPH+DYFLD+YNTKNGGQR+AT+ MYLSDVEE
Sbjct  170  KRIADYTFIPMEHGEGLQVLHYEVGQKYEPHFDYFLDEYNTKNGGQRMATLLMYLSDVEE  229

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGET+FP A  N S++PW NEL EC + GL+VKPKMGDALL WSMKPD +LDP SLHGGC
Sbjct  230  GGETIFPDANVNSSSLPWYNELSECARKGLAVKPKMGDALLFWSMKPDATLDPLSLHGGC  289

Query  363  PVIKGNKWSXTKXMRVREYKA  301
            PVIKGNKWS TK M VREYKA
Sbjct  290  PVIKGNKWSSTKWMHVREYKA  310



>gb|KGN60775.1| hypothetical protein Csa_2G009620 [Cucumis sativus]
Length=259

 Score =   246 bits (628),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 113/139 (81%), Positives = 124/139 (89%), Gaps = 0/139 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRIADFTFIP EHGEGLQILHYEVGQKY+ HYDYF+D+YN K GGQR+AT+ MYLSDVEE
Sbjct  120  KRIADFTFIPIEHGEGLQILHYEVGQKYDAHYDYFVDEYNIKKGGQRMATLLMYLSDVEE  179

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGETVFP+AKGN S+VPW NEL ECGKGGLSVKPKMGDALL WSMKPD +LDP+SLHG C
Sbjct  180  GGETVFPAAKGNFSSVPWWNELSECGKGGLSVKPKMGDALLFWSMKPDATLDPTSLHGAC  239

Query  363  PVIKGNKWSXTKXMRVREY  307
            PVI+GNKWS TK M V +Y
Sbjct  240  PVIRGNKWSCTKWMHVDKY  258



>gb|AFK48224.1| unknown [Lotus japonicus]
Length=188

 Score =   243 bits (621),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 110/141 (78%), Positives = 123/141 (87%), Gaps = 0/141 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRIADF FIP E+GEGLQ+LHYEVGQKYEPHYDYFLD++NTKNGGQRIATV MYLSDVEE
Sbjct  48   KRIADFAFIPVENGEGLQVLHYEVGQKYEPHYDYFLDEFNTKNGGQRIATVLMYLSDVEE  107

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGET+FP+AK N S+VPW N+L  C K GLSVKPK GDALL WS++PD +LDPSSLHGGC
Sbjct  108  GGETIFPAAKANFSSVPWYNDLSVCAKKGLSVKPKRGDALLFWSIRPDATLDPSSLHGGC  167

Query  363  PVIKGNKWSXTKXMRVREYKA  301
            PVI+GNKWS TK M + EYK 
Sbjct  168  PVIRGNKWSSTKWMHLEEYKV  188



>ref|XP_008387904.1| PREDICTED: prolyl 4-hydroxylase subunit alpha-1-like isoform 
X1 [Malus domestica]
 ref|XP_008350486.1| PREDICTED: prolyl 4-hydroxylase subunit alpha-1-like isoform 
X1 [Malus domestica]
Length=291

 Score =   247 bits (631),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 110/141 (78%), Positives = 127/141 (90%), Gaps = 0/141 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRIADFTFIP EHGEGLQ+LHYEVGQKY+ H+DYF D++NTKNGGQR+AT+ MYLSDVEE
Sbjct  151  KRIADFTFIPVEHGEGLQVLHYEVGQKYDAHFDYFADEFNTKNGGQRVATLLMYLSDVEE  210

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGETVFP+AKG+IS+VPW NEL ECGK GL++KPKMGDALL WSM+PD +LDPSSLHG C
Sbjct  211  GGETVFPTAKGSISSVPWWNELSECGKQGLALKPKMGDALLFWSMRPDATLDPSSLHGAC  270

Query  363  PVIKGNKWSXTKXMRVREYKA  301
            PVI+GNKWS TK M ++EYK 
Sbjct  271  PVIRGNKWSCTKWMHLQEYKV  291



>ref|XP_008387906.1| PREDICTED: prolyl 4-hydroxylase subunit alpha-1-like isoform 
X2 [Malus domestica]
 ref|XP_008350487.1| PREDICTED: prolyl 4-hydroxylase subunit alpha-1-like isoform 
X2 [Malus domestica]
Length=286

 Score =   247 bits (630),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 110/141 (78%), Positives = 127/141 (90%), Gaps = 0/141 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRIADFTFIP EHGEGLQ+LHYEVGQKY+ H+DYF D++NTKNGGQR+AT+ MYLSDVEE
Sbjct  146  KRIADFTFIPVEHGEGLQVLHYEVGQKYDAHFDYFADEFNTKNGGQRVATLLMYLSDVEE  205

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGETVFP+AKG+IS+VPW NEL ECGK GL++KPKMGDALL WSM+PD +LDPSSLHG C
Sbjct  206  GGETVFPTAKGSISSVPWWNELSECGKQGLALKPKMGDALLFWSMRPDATLDPSSLHGAC  265

Query  363  PVIKGNKWSXTKXMRVREYKA  301
            PVI+GNKWS TK M ++EYK 
Sbjct  266  PVIRGNKWSCTKWMHLQEYKV  286



>ref|XP_009620049.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Nicotiana tomentosiformis]
Length=291

 Score =   247 bits (631),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 116/140 (83%), Positives = 125/140 (89%), Gaps = 0/140 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRIAD+TFIP EHGEGLQ+LHYEVGQKYEPH+DYFLD++NTKNGGQRIAT+ MYLSDVEE
Sbjct  151  KRIADYTFIPVEHGEGLQVLHYEVGQKYEPHFDYFLDEFNTKNGGQRIATLLMYLSDVEE  210

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGETVFP+AKGN S+ P  NEL EC K GLSVKPKMGDALL WSM+PD SLDPSSLHGGC
Sbjct  211  GGETVFPAAKGNFSSSPGWNELSECAKRGLSVKPKMGDALLFWSMRPDASLDPSSLHGGC  270

Query  363  PVIKGNKWSXTKXMRVREYK  304
            PVIKGNKWS TK M V EYK
Sbjct  271  PVIKGNKWSSTKWMHVGEYK  290



>gb|AAM61711.1| putative prolyl 4-hydroxylase, alpha subunit [Arabidopsis thaliana]
Length=287

 Score =   247 bits (630),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 110/140 (79%), Positives = 126/140 (90%), Gaps = 0/140 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRIAD+TFIPA+HGEGLQ+LHYE GQKYEPHYDYF+D++NTKNGGQR+AT+ MYLSDVEE
Sbjct  147  KRIADYTFIPADHGEGLQVLHYEAGQKYEPHYDYFVDEFNTKNGGQRMATMLMYLSDVEE  206

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGETVFP+A  N S+VPW NEL ECGK GLSVKP+MGDALL WSM+PD +LDP+SLHGGC
Sbjct  207  GGETVFPAANMNFSSVPWYNELSECGKKGLSVKPRMGDALLFWSMRPDATLDPTSLHGGC  266

Query  363  PVIKGNKWSXTKXMRVREYK  304
            PVI+GNKWS TK + V EYK
Sbjct  267  PVIRGNKWSSTKWIHVGEYK  286



>ref|XP_006661912.1| PREDICTED: prolyl 4-hydroxylase subunit alpha-2-like [Oryza brachyantha]
Length=221

 Score =   244 bits (624),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 113/140 (81%), Positives = 126/140 (90%), Gaps = 0/140 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRI+D+TFIP E+GEGLQ+LHYEVGQKYEPH+DYF D++NTKNGGQRIAT+ MYLSDVEE
Sbjct  81   KRISDYTFIPVENGEGLQVLHYEVGQKYEPHFDYFHDEFNTKNGGQRIATLLMYLSDVEE  140

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGETVFP++K N S+ P+ NEL EC K GLSVKPKMGDALL WSM+PDGSLDPSSLHGGC
Sbjct  141  GGETVFPTSKANSSSSPFYNELSECAKRGLSVKPKMGDALLFWSMRPDGSLDPSSLHGGC  200

Query  363  PVIKGNKWSXTKXMRVREYK  304
            PVIKGNKWS TK MRV EYK
Sbjct  201  PVIKGNKWSSTKWMRVHEYK  220



>ref|XP_004171765.1| PREDICTED: prolyl 4-hydroxylase subunit alpha-1-like [Cucumis 
sativus]
Length=284

 Score =   246 bits (629),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 113/139 (81%), Positives = 124/139 (89%), Gaps = 0/139 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRIADFTFIP EHGEGLQILHYEVGQKY+ HYDYF+D+YN K GGQR+AT+ MYLSDVEE
Sbjct  145  KRIADFTFIPIEHGEGLQILHYEVGQKYDAHYDYFVDEYNIKKGGQRMATLLMYLSDVEE  204

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGETVFP+AKGN S+VPW NEL ECGKGGLSVKPKMGDALL WSMKPD +LDP+SLHG C
Sbjct  205  GGETVFPAAKGNFSSVPWWNELSECGKGGLSVKPKMGDALLFWSMKPDATLDPTSLHGAC  264

Query  363  PVIKGNKWSXTKXMRVREY  307
            PVI+GNKWS TK M V +Y
Sbjct  265  PVIRGNKWSCTKWMHVDKY  283



>emb|CDY51328.1| BnaCnng20650D [Brassica napus]
Length=291

 Score =   247 bits (630),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 111/140 (79%), Positives = 125/140 (89%), Gaps = 0/140 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRIAD+TFIPA+HGEGLQ+LHYE GQKYEPHYDYF+D++NTKNGGQR+AT+ MYLSDVEE
Sbjct  151  KRIADYTFIPADHGEGLQVLHYEEGQKYEPHYDYFVDEFNTKNGGQRMATMLMYLSDVEE  210

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGETVFP+A  N S+VPW NEL  CGK GLSVKP+MGDALL WSM+PD +LDPSSLHGGC
Sbjct  211  GGETVFPAANMNFSSVPWYNELSACGKKGLSVKPRMGDALLFWSMRPDATLDPSSLHGGC  270

Query  363  PVIKGNKWSXTKXMRVREYK  304
            PVI+GNKWS TK M V EYK
Sbjct  271  PVIRGNKWSSTKWMHVGEYK  290



>emb|CDY29362.1| BnaA06g14340D [Brassica napus]
Length=291

 Score =   246 bits (629),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 111/140 (79%), Positives = 125/140 (89%), Gaps = 0/140 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRIAD+TFIPA+HGEGLQ+LHYE GQKYEPHYDYF+D++NTKNGGQR+AT+ MYLSDVEE
Sbjct  151  KRIADYTFIPADHGEGLQVLHYEEGQKYEPHYDYFVDEFNTKNGGQRMATMLMYLSDVEE  210

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGETVFP+A  N S+VPW NEL  CGK GLSVKP+MGDALL WSM+PD +LDPSSLHGGC
Sbjct  211  GGETVFPAANMNFSSVPWYNELSACGKKGLSVKPRMGDALLFWSMRPDATLDPSSLHGGC  270

Query  363  PVIKGNKWSXTKXMRVREYK  304
            PVI+GNKWS TK M V EYK
Sbjct  271  PVIRGNKWSSTKWMHVGEYK  290



>gb|EYU36811.1| hypothetical protein MIMGU_mgv1a011044mg [Erythranthe guttata]
Length=294

 Score =   246 bits (629),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 115/141 (82%), Positives = 124/141 (88%), Gaps = 0/141 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRIAD+TFIPAEHGEGLQ+LHYEVGQKYEPHYDYFLDD+NTKNGGQRIATV MYLSDVEE
Sbjct  154  KRIADYTFIPAEHGEGLQVLHYEVGQKYEPHYDYFLDDFNTKNGGQRIATVLMYLSDVEE  213

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGET+FP+AKGN S VP  NE  EC K GL+VKPKMGDALL WSM+PD +LDP+SLHGGC
Sbjct  214  GGETIFPAAKGNFSTVPGWNEKSECAKRGLAVKPKMGDALLFWSMRPDATLDPTSLHGGC  273

Query  363  PVIKGNKWSXTKXMRVREYKA  301
            PVI GNKWS TK M V EYK 
Sbjct  274  PVIVGNKWSSTKWMHVGEYKV  294



>gb|EMT22590.1| Prolyl 4-hydroxylase subunit alpha-1 [Aegilops tauschii]
Length=224

 Score =   244 bits (623),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 110/141 (78%), Positives = 125/141 (89%), Gaps = 0/141 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            +RIAD+TFIPAEHGEGLQ+LHYEVGQKYEPH+DYFLD++NTKNGGQR+AT+ MYLSDVEE
Sbjct  84   RRIADYTFIPAEHGEGLQVLHYEVGQKYEPHFDYFLDEFNTKNGGQRMATILMYLSDVEE  143

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGET+FP A  N S++PW NEL EC + GL+VKPKMGDALL WSMKPD +LDP SLHGGC
Sbjct  144  GGETIFPDANVNSSSLPWYNELSECARKGLAVKPKMGDALLFWSMKPDATLDPLSLHGGC  203

Query  363  PVIKGNKWSXTKXMRVREYKA  301
            PVIKGNKWS TK + V EYKA
Sbjct  204  PVIKGNKWSSTKWLHVHEYKA  224



>gb|KDP36874.1| hypothetical protein JCGZ_08165 [Jatropha curcas]
Length=289

 Score =   246 bits (628),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 112/141 (79%), Positives = 124/141 (88%), Gaps = 0/141 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRIADF+FIP EHGEGLQILHYEVGQKYE HYDYFLD++NTKNGGQR AT+ MYLSDVEE
Sbjct  149  KRIADFSFIPVEHGEGLQILHYEVGQKYEAHYDYFLDEFNTKNGGQRTATLLMYLSDVEE  208

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGETVFP+A+ NIS+VPW NEL ECGK GLSVKPKMG+ALL WS +PD +LDPSSLHG C
Sbjct  209  GGETVFPAAQANISSVPWWNELSECGKRGLSVKPKMGNALLFWSTRPDATLDPSSLHGSC  268

Query  363  PVIKGNKWSXTKXMRVREYKA  301
            PVI+GNKWS TK M + EYK 
Sbjct  269  PVIRGNKWSATKWMHLGEYKV  289



>ref|XP_010498461.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Camelina sativa]
 ref|XP_010498463.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Camelina sativa]
Length=292

 Score =   246 bits (628),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 111/141 (79%), Positives = 124/141 (88%), Gaps = 0/141 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRIAD+TFIPA+HGEGLQ+LHYE GQKYEPHYDYF+D +NTKNGGQR+AT+ MYLSDVEE
Sbjct  152  KRIADYTFIPADHGEGLQVLHYEAGQKYEPHYDYFVDTFNTKNGGQRMATMLMYLSDVEE  211

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGETVFP+A  N S+V W NEL ECGK GLSVKP+MGDALL WSM+PD +LDP+SLHGGC
Sbjct  212  GGETVFPAANMNFSSVSWYNELSECGKKGLSVKPRMGDALLFWSMRPDATLDPTSLHGGC  271

Query  363  PVIKGNKWSXTKXMRVREYKA  301
            PVIKGNKWS TK M V EYK 
Sbjct  272  PVIKGNKWSSTKWMHVGEYKV  292



>ref|XP_003574128.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Brachypodium distachyon]
Length=306

 Score =   247 bits (630),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 113/141 (80%), Positives = 128/141 (91%), Gaps = 0/141 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRI+DFTFIPAE+GEGLQ+LHYEVGQKYEPH+DYF DD+NTKNGGQRIAT+ MYLSDVEE
Sbjct  166  KRISDFTFIPAENGEGLQVLHYEVGQKYEPHFDYFHDDFNTKNGGQRIATLLMYLSDVEE  225

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGETVFPSAK N S++P+ NEL EC K G+SVKPKMGDALL WSM+PDG+LDP+SLHGGC
Sbjct  226  GGETVFPSAKVNSSSIPFYNELSECAKRGISVKPKMGDALLFWSMRPDGTLDPTSLHGGC  285

Query  363  PVIKGNKWSXTKXMRVREYKA  301
            PVIKG+KWS TK +RV EYK 
Sbjct  286  PVIKGDKWSSTKWIRVHEYKV  306



>ref|XP_006449333.1| hypothetical protein CICLE_v10016152mg [Citrus clementina]
 ref|XP_006467805.1| PREDICTED: prolyl 4-hydroxylase subunit alpha-1-like [Citrus 
sinensis]
 gb|ESR62573.1| hypothetical protein CICLE_v10016152mg [Citrus clementina]
 gb|KDO75953.1| hypothetical protein CISIN_1g0230532mg [Citrus sinensis]
Length=288

 Score =   246 bits (627),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 111/141 (79%), Positives = 124/141 (88%), Gaps = 0/141 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRIADFTFIP EHGEG+Q+LHYEVGQKY+ HYDYFLD++NTKNGGQR+AT+ MYLSDVEE
Sbjct  148  KRIADFTFIPMEHGEGIQVLHYEVGQKYDAHYDYFLDEFNTKNGGQRMATLLMYLSDVEE  207

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGETVFP+A  N ++V W NEL ECGK GLSVKPK GDALL WSM+PD +LDPSSLHGGC
Sbjct  208  GGETVFPAANANFTSVRWWNELSECGKQGLSVKPKRGDALLFWSMRPDATLDPSSLHGGC  267

Query  363  PVIKGNKWSXTKXMRVREYKA  301
            PVI+GNKWS TK M V EYKA
Sbjct  268  PVIRGNKWSATKWMHVHEYKA  288



>ref|XP_009334602.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Pyrus x bretschneideri]
Length=287

 Score =   246 bits (627),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 110/141 (78%), Positives = 126/141 (89%), Gaps = 0/141 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRIADFTFIP EHGEGLQ+LHYEVGQKY+ H+DYF D++NTKNGGQR+AT+ MYLSDVE+
Sbjct  147  KRIADFTFIPVEHGEGLQVLHYEVGQKYDAHFDYFADEFNTKNGGQRVATLLMYLSDVEQ  206

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGETVFP+AKG+IS+VPW NEL ECGK GL+VKPKMGDALL WSM PD +LDPSSLHG C
Sbjct  207  GGETVFPTAKGSISSVPWWNELSECGKQGLAVKPKMGDALLFWSMTPDATLDPSSLHGAC  266

Query  363  PVIKGNKWSXTKXMRVREYKA  301
            PVI+GNKWS TK M ++EYK 
Sbjct  267  PVIRGNKWSCTKWMHLQEYKV  287



>dbj|BAJ85763.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=300

 Score =   246 bits (627),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 113/141 (80%), Positives = 127/141 (90%), Gaps = 0/141 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRI+DFTFIP E+GEGLQ+LHYEVGQKYEPH+DYF DD+NTKNGGQRIATV MYLSDVEE
Sbjct  160  KRISDFTFIPVENGEGLQVLHYEVGQKYEPHFDYFHDDFNTKNGGQRIATVLMYLSDVEE  219

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGETVFPSAK N S++P+ NEL EC K G+SVKPKMGDALL WSM+PDG+LDP+SLHGGC
Sbjct  220  GGETVFPSAKVNSSSIPFYNELSECAKRGISVKPKMGDALLFWSMRPDGTLDPTSLHGGC  279

Query  363  PVIKGNKWSXTKXMRVREYKA  301
            PVIKG+KWS TK +RV EYK 
Sbjct  280  PVIKGDKWSSTKWIRVHEYKV  300



>ref|XP_011074717.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Sesamum indicum]
 ref|XP_011074718.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Sesamum indicum]
Length=289

 Score =   245 bits (626),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 116/141 (82%), Positives = 125/141 (89%), Gaps = 3/141 (2%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRIAD+TFIPAEHGEGLQ+LHYEVGQKYEPHYDYFLD++NTKNGGQRIAT+ MYLSDVEE
Sbjct  152  KRIADYTFIPAEHGEGLQVLHYEVGQKYEPHYDYFLDEFNTKNGGQRIATILMYLSDVEE  211

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGET+FPSAKGN S+ P    L ECGK GL+VKPKMGDALL WSM+PD SLDPSSLHGGC
Sbjct  212  GGETIFPSAKGNFSSAP---NLSECGKRGLAVKPKMGDALLFWSMRPDASLDPSSLHGGC  268

Query  363  PVIKGNKWSXTKXMRVREYKA  301
            PVIKGNKWS TK M V EYK 
Sbjct  269  PVIKGNKWSSTKWMHVGEYKV  289



>ref|XP_004139389.1| PREDICTED: prolyl 4-hydroxylase subunit alpha-1-like [Cucumis 
sativus]
Length=284

 Score =   245 bits (626),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 112/139 (81%), Positives = 124/139 (89%), Gaps = 0/139 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRIADFTFIP EHGEGLQILHYEVGQKY+ HYDYF+D+YN K GGQR+AT+ MYLSDVEE
Sbjct  145  KRIADFTFIPIEHGEGLQILHYEVGQKYDAHYDYFVDEYNIKKGGQRMATLLMYLSDVEE  204

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGETVFP+AKGN S+VPW NEL +CGKGGLSVKPKMGDALL WSMKPD +LDP+SLHG C
Sbjct  205  GGETVFPAAKGNFSSVPWWNELSKCGKGGLSVKPKMGDALLFWSMKPDATLDPTSLHGAC  264

Query  363  PVIKGNKWSXTKXMRVREY  307
            PVI+GNKWS TK M V +Y
Sbjct  265  PVIRGNKWSCTKWMHVDKY  283



>gb|KJB29665.1| hypothetical protein B456_005G112700 [Gossypium raimondii]
Length=286

 Score =   245 bits (625),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 109/140 (78%), Positives = 128/140 (91%), Gaps = 0/140 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRIA+++FIP EHGEGLQ+LHYEVGQKYEPH+DYF+D+YNT++GGQR+AT+ MYLSDVEE
Sbjct  146  KRIAEYSFIPIEHGEGLQVLHYEVGQKYEPHFDYFVDEYNTRHGGQRLATMLMYLSDVEE  205

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGET+FP+AKGNISAVPW + L +CGKGGL+VKPKMGDALL WSMKPD ++DPSSLHGGC
Sbjct  206  GGETIFPNAKGNISAVPWWDALSKCGKGGLAVKPKMGDALLFWSMKPDATVDPSSLHGGC  265

Query  363  PVIKGNKWSXTKXMRVREYK  304
            PVI G+KWS TK M V EYK
Sbjct  266  PVIVGDKWSSTKWMHVNEYK  285



>ref|XP_010446308.1| PREDICTED: probable prolyl 4-hydroxylase 10 [Camelina sativa]
Length=178

 Score =   241 bits (615),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 112/134 (84%), Positives = 120/134 (90%), Gaps = 0/134 (0%)
 Frame = -2

Query  702  FIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEEGGETVFP  523
              PAEHGEGLQ+LHYE+GQKYEPHYDYF+D+YNT+NGGQRIATV MYLSDVEEGGETVFP
Sbjct  45   IFPAEHGEGLQVLHYEIGQKYEPHYDYFMDEYNTRNGGQRIATVLMYLSDVEEGGETVFP  104

Query  522  SAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGCPVIKGNK  343
            +AKGN SAVPW NEL ECGKGGLSVKPKMGDALL WSM PD +LDPSSLHGGC VIKGNK
Sbjct  105  AAKGNYSAVPWWNELSECGKGGLSVKPKMGDALLFWSMTPDATLDPSSLHGGCAVIKGNK  164

Query  342  WSXTKXMRVREYKA  301
            WS TK +RV EYK 
Sbjct  165  WSSTKWLRVHEYKV  178


 Score = 67.8 bits (164),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/36 (89%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -2

Query  558  SDVEEGGETVFPSAKGNISAVPWXNELXECGKGGLS  451
            SDVEEGGETVFP+AKGN SAVPW NEL ECGKGGLS
Sbjct  7    SDVEEGGETVFPAAKGNYSAVPWWNELSECGKGGLS  42



>ref|XP_003629229.1| Prolyl 4-hydroxylase alpha-2 subunit [Medicago truncatula]
 gb|AET03705.1| prolyl 4-hydroxylase alpha-like protein [Medicago truncatula]
Length=278

 Score =   244 bits (624),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 111/141 (79%), Positives = 124/141 (88%), Gaps = 0/141 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRIADFTFIP E+GE   +L YEVGQKY+PH DYF DDYNT NGGQRIAT+ MYLSDVEE
Sbjct  138  KRIADFTFIPVENGESFNVLRYEVGQKYDPHLDYFADDYNTVNGGQRIATMLMYLSDVEE  197

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGETVFP+AKGNIS+VPW NEL +CGK GLS+KPKMGDALL WSMKPDG+LDPSSLHG C
Sbjct  198  GGETVFPAAKGNISSVPWWNELSDCGKKGLSIKPKMGDALLFWSMKPDGTLDPSSLHGAC  257

Query  363  PVIKGNKWSXTKXMRVREYKA  301
            PVIKG+KWS TK MR+ E++A
Sbjct  258  PVIKGDKWSCTKWMRINEFRA  278



>ref|XP_002453082.1| hypothetical protein SORBIDRAFT_04g038020 [Sorghum bicolor]
 gb|EES06058.1| hypothetical protein SORBIDRAFT_04g038020 [Sorghum bicolor]
Length=307

 Score =   245 bits (626),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 111/141 (79%), Positives = 125/141 (89%), Gaps = 0/141 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRIAD+TFIPA+HGEGLQ+LHYEVGQKYEPH+DYFLD++NTKNGGQR+AT+ MYLSDVEE
Sbjct  167  KRIADYTFIPADHGEGLQVLHYEVGQKYEPHFDYFLDEFNTKNGGQRMATLLMYLSDVEE  226

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGET+FP A  N S++PW NEL EC K GLSVKPKMGDALL WSMKPD +LDP SLHGGC
Sbjct  227  GGETIFPDANVNASSLPWYNELSECAKRGLSVKPKMGDALLFWSMKPDATLDPLSLHGGC  286

Query  363  PVIKGNKWSXTKXMRVREYKA  301
            PVI+GNKWS TK M + EYKA
Sbjct  287  PVIRGNKWSSTKWMHIHEYKA  307



>gb|KJB58041.1| hypothetical protein B456_009G191400 [Gossypium raimondii]
 gb|KJB58042.1| hypothetical protein B456_009G191400 [Gossypium raimondii]
 gb|KJB58043.1| hypothetical protein B456_009G191400 [Gossypium raimondii]
Length=287

 Score =   244 bits (624),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 111/140 (79%), Positives = 125/140 (89%), Gaps = 0/140 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRIAD+TFIP E+GEGLQ+LHYEV QKY+ H+DYFLD+ NTKNGGQR+ATV MYLSDVEE
Sbjct  147  KRIADYTFIPVENGEGLQVLHYEVEQKYDAHFDYFLDEINTKNGGQRMATVLMYLSDVEE  206

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGET+FP+AKGN+SAVPW NEL ECGK GL+VKPKMGDALL WSM+PD +LDPSSLHGGC
Sbjct  207  GGETIFPAAKGNVSAVPWWNELSECGKKGLAVKPKMGDALLFWSMRPDATLDPSSLHGGC  266

Query  363  PVIKGNKWSXTKXMRVREYK  304
            PVI GNKWS TK + V EYK
Sbjct  267  PVISGNKWSSTKWLHVEEYK  286



>ref|NP_001151238.1| LOC100284871 [Zea mays]
 ref|XP_008677412.1| PREDICTED: auxin-independent growth promoter protein isoform 
X1 [Zea mays]
 gb|ACG42089.1| prolyl 4-hydroxylase alpha-2 subunit precursor [Zea mays]
 gb|AEP37748.1| prolyl 4-hydroxylase 5 [Zea mays]
 gb|AFW63915.1| prolyl 4-hydroxylase alpha-2 subunit [Zea mays]
Length=308

 Score =   245 bits (626),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 110/141 (78%), Positives = 125/141 (89%), Gaps = 0/141 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRIAD+TFIP +HGEGLQ+LHYEVGQKYEPH+DYFLD++NTKNGGQR+AT+ MYLSDVEE
Sbjct  168  KRIADYTFIPVDHGEGLQVLHYEVGQKYEPHFDYFLDEFNTKNGGQRMATLLMYLSDVEE  227

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGET+FP A  N+S++PW NEL EC K GLSVKPKMGDALL WSMKPD +LDP SLHGGC
Sbjct  228  GGETIFPDANVNVSSLPWYNELSECAKRGLSVKPKMGDALLFWSMKPDATLDPLSLHGGC  287

Query  363  PVIKGNKWSXTKXMRVREYKA  301
            PVI+GNKWS TK M + EYKA
Sbjct  288  PVIRGNKWSSTKWMHIHEYKA  308



>ref|XP_006648159.1| PREDICTED: prolyl 4-hydroxylase subunit alpha-1-like [Oryza brachyantha]
Length=306

 Score =   245 bits (625),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 112/141 (79%), Positives = 124/141 (88%), Gaps = 0/141 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRIAD+TFIP EHGEGLQ+LHYEVGQKYEPH+DYFLD+YNTKNGGQR+AT+ MYLSDVEE
Sbjct  166  KRIADYTFIPMEHGEGLQVLHYEVGQKYEPHFDYFLDEYNTKNGGQRMATLLMYLSDVEE  225

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGET+FP A  N S++PW NEL EC + GL+VKPKMGDALL WSMKPD +LDP SLHGGC
Sbjct  226  GGETIFPDANVNSSSLPWYNELSECARKGLAVKPKMGDALLFWSMKPDATLDPLSLHGGC  285

Query  363  PVIKGNKWSXTKXMRVREYKA  301
            PVIKGNKWS TK M V EYKA
Sbjct  286  PVIKGNKWSSTKWMHVHEYKA  306



>ref|XP_009798871.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Nicotiana sylvestris]
 ref|XP_009798872.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Nicotiana sylvestris]
Length=291

 Score =   244 bits (624),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 115/140 (82%), Positives = 124/140 (89%), Gaps = 0/140 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRIAD+TFIP EHGEGLQ+LHYEVGQKYEPH+DYFLD++NTKNGGQRIAT+ MYLSDVEE
Sbjct  151  KRIADYTFIPVEHGEGLQVLHYEVGQKYEPHFDYFLDEFNTKNGGQRIATLLMYLSDVEE  210

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGETVFP+AKGN S+ P  NEL EC K GLSVKPK GDALL WSM+PD SLDPSSLHGGC
Sbjct  211  GGETVFPAAKGNFSSSPGWNELSECAKRGLSVKPKRGDALLFWSMRPDASLDPSSLHGGC  270

Query  363  PVIKGNKWSXTKXMRVREYK  304
            PVIKGNKWS TK M V EYK
Sbjct  271  PVIKGNKWSSTKWMHVGEYK  290



>ref|NP_001241865.1| prolyl 4-hydroxylase 5-1 [Zea mays]
 gb|AEP37749.1| prolyl 4-hydroxylase 5-1 [Zea mays]
Length=180

 Score =   241 bits (614),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 108/141 (77%), Positives = 123/141 (87%), Gaps = 0/141 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRI D+TFIP +HGEGLQ+LHYEVGQKYEPH+DYFLD++NTKNGGQR+AT+ M+LSDVEE
Sbjct  40   KRITDYTFIPVDHGEGLQVLHYEVGQKYEPHFDYFLDEFNTKNGGQRMATLLMHLSDVEE  99

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGET+FP A  N S++PW NEL EC K GLSVKPKMGDALL WSMKPD +LDP SLHGGC
Sbjct  100  GGETIFPDANVNDSSLPWYNELSECAKRGLSVKPKMGDALLFWSMKPDATLDPLSLHGGC  159

Query  363  PVIKGNKWSXTKXMRVREYKA  301
            PVI+GNKWS TK M + EYKA
Sbjct  160  PVIRGNKWSSTKWMHIHEYKA  180



>ref|XP_006285542.1| hypothetical protein CARUB_v10006984mg [Capsella rubella]
 gb|EOA18440.1| hypothetical protein CARUB_v10006984mg [Capsella rubella]
Length=293

 Score =   244 bits (624),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 114/141 (81%), Positives = 123/141 (87%), Gaps = 0/141 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRI+DFTFIP EHGEGLQ+LHYEVGQKYEPH+DYF D++NT+ GGQRIATV MYLSDVEE
Sbjct  153  KRISDFTFIPIEHGEGLQVLHYEVGQKYEPHHDYFFDEFNTRKGGQRIATVLMYLSDVEE  212

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGETVFP+AKGNIS VPW +EL ECGK GLSV PK  DALL WSM+PD SLDPSSLHGGC
Sbjct  213  GGETVFPTAKGNISDVPWWDELSECGKTGLSVLPKKRDALLFWSMQPDASLDPSSLHGGC  272

Query  363  PVIKGNKWSXTKXMRVREYKA  301
            PVIKGNKWS TK   V EYKA
Sbjct  273  PVIKGNKWSSTKWFHVHEYKA  293



>gb|KJB58040.1| hypothetical protein B456_009G191400 [Gossypium raimondii]
Length=265

 Score =   243 bits (621),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 111/140 (79%), Positives = 125/140 (89%), Gaps = 0/140 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRIAD+TFIP E+GEGLQ+LHYEV QKY+ H+DYFLD+ NTKNGGQR+ATV MYLSDVEE
Sbjct  125  KRIADYTFIPVENGEGLQVLHYEVEQKYDAHFDYFLDEINTKNGGQRMATVLMYLSDVEE  184

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGET+FP+AKGN+SAVPW NEL ECGK GL+VKPKMGDALL WSM+PD +LDPSSLHGGC
Sbjct  185  GGETIFPAAKGNVSAVPWWNELSECGKKGLAVKPKMGDALLFWSMRPDATLDPSSLHGGC  244

Query  363  PVIKGNKWSXTKXMRVREYK  304
            PVI GNKWS TK + V EYK
Sbjct  245  PVISGNKWSSTKWLHVEEYK  264



>ref|XP_009386075.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Musa acuminata subsp. 
malaccensis]
 ref|XP_009386076.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Musa acuminata subsp. 
malaccensis]
Length=288

 Score =   244 bits (623),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 111/141 (79%), Positives = 126/141 (89%), Gaps = 0/141 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRIAD+TFIP E+GEGLQ+LHYEVGQKYEPH+DYFLD++NTKNGGQRIAT+ MYLSDVEE
Sbjct  148  KRIADYTFIPVENGEGLQVLHYEVGQKYEPHFDYFLDEFNTKNGGQRIATLLMYLSDVEE  207

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGETVFPSAK N S++P  NEL +C K G+SVKPKMGDALL WSM+PD +LDPSSLH GC
Sbjct  208  GGETVFPSAKVNSSSLPGYNELSDCAKKGISVKPKMGDALLFWSMRPDATLDPSSLHAGC  267

Query  363  PVIKGNKWSXTKXMRVREYKA  301
            PVIKGNKWS TK MR+ EY+A
Sbjct  268  PVIKGNKWSSTKWMRIHEYRA  288



>ref|NP_001241694.1| prolyl 4-hydroxylase 8-4 [Zea mays]
 gb|AEP37761.1| prolyl 4-hydroxylase 8-4 [Zea mays]
Length=307

 Score =   244 bits (624),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 111/141 (79%), Positives = 124/141 (88%), Gaps = 0/141 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRIAD+TFIP +HGEGLQ+LHYEVGQKYEPH+DYFLD++NTKNGGQRIAT+ MYLSDVEE
Sbjct  167  KRIADYTFIPVDHGEGLQVLHYEVGQKYEPHFDYFLDEFNTKNGGQRIATLLMYLSDVEE  226

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGET+FP A  N S++PW NEL +C K GLSVKPKMGDALL WSMKPD +LDP SLHGGC
Sbjct  227  GGETIFPDANVNASSLPWYNELSDCAKRGLSVKPKMGDALLFWSMKPDATLDPLSLHGGC  286

Query  363  PVIKGNKWSXTKXMRVREYKA  301
            PVIKGNKWS TK M + EYKA
Sbjct  287  PVIKGNKWSSTKWMHIHEYKA  307



>ref|XP_006298248.1| hypothetical protein CARUB_v10014309mg [Capsella rubella]
 gb|EOA31146.1| hypothetical protein CARUB_v10014309mg [Capsella rubella]
Length=289

 Score =   244 bits (622),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 111/141 (79%), Positives = 125/141 (89%), Gaps = 0/141 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRI+DFTFIP E+GEGLQ+LHY+VGQKYEPHYDYFLD++NTKNGGQRIATV MYLSDV++
Sbjct  149  KRISDFTFIPVENGEGLQVLHYQVGQKYEPHYDYFLDEFNTKNGGQRIATVLMYLSDVDD  208

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGETVFP+AKGNISAVPW NEL +CGK GLSV PK  DALL W+M+PD SLDPSSLHGGC
Sbjct  209  GGETVFPAAKGNISAVPWWNELSKCGKEGLSVLPKKRDALLFWNMRPDASLDPSSLHGGC  268

Query  363  PVIKGNKWSXTKXMRVREYKA  301
            PV+KGNKWS TK   V E+K 
Sbjct  269  PVVKGNKWSSTKWFHVHEFKV  289



>ref|NP_001159002.1| prolyl 4-hydroxylase alpha-2 subunit [Zea mays]
 ref|XP_008643888.1| PREDICTED: prolyl 4-hydroxylase alpha-2 subunit isoform X1 [Zea 
mays]
 gb|ACG35031.1| prolyl 4-hydroxylase alpha-2 subunit precursor [Zea mays]
 gb|AEP37757.1| prolyl 4-hydroxylase 8 [Zea mays]
 gb|AEP37758.1| prolyl 4-hydroxylase 8-1 [Zea mays]
 gb|AFW74120.1| prolyl 4-hydroxylase alpha-2 subunit isoform 1 [Zea mays]
 gb|AFW74121.1| prolyl 4-hydroxylase alpha-2 subunit isoform 2 [Zea mays]
 gb|AFW74122.1| prolyl 4-hydroxylase alpha-2 subunit isoform 3 [Zea mays]
 gb|AFW74123.1| prolyl 4-hydroxylase alpha-2 subunit isoform 4 [Zea mays]
Length=307

 Score =   244 bits (623),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 111/141 (79%), Positives = 124/141 (88%), Gaps = 0/141 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRIAD+TFIP +HGEGLQ+LHYEVGQKYEPH+DYFLD++NTKNGGQRIAT+ MYLSDVEE
Sbjct  167  KRIADYTFIPVDHGEGLQVLHYEVGQKYEPHFDYFLDEFNTKNGGQRIATLLMYLSDVEE  226

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGET+FP A  N S++PW NEL +C K GLSVKPKMGDALL WSMKPD +LDP SLHGGC
Sbjct  227  GGETIFPDANVNASSLPWYNELSDCAKRGLSVKPKMGDALLFWSMKPDATLDPLSLHGGC  286

Query  363  PVIKGNKWSXTKXMRVREYKA  301
            PVIKGNKWS TK M + EYKA
Sbjct  287  PVIKGNKWSSTKWMHIHEYKA  307



>ref|XP_010266902.1| PREDICTED: probable prolyl 4-hydroxylase 3 isoform X2 [Nelumbo 
nucifera]
Length=309

 Score =   244 bits (623),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 112/140 (80%), Positives = 123/140 (88%), Gaps = 0/140 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRIADFTFIP E+GEGLQIL YE+GQ YEPHYDYF+D++NTKNGG R+ATV MYLSDVEE
Sbjct  169  KRIADFTFIPVENGEGLQILRYELGQMYEPHYDYFVDEFNTKNGGNRMATVLMYLSDVEE  228

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGETVFP+AKGNIS+VPW NEL ECGK GLSVKPKMGDA+L WSM+PD +LDPSSLHG C
Sbjct  229  GGETVFPNAKGNISSVPWWNELSECGKRGLSVKPKMGDAILFWSMRPDATLDPSSLHGAC  288

Query  363  PVIKGNKWSXTKXMRVREYK  304
            PVIKG KWS  K M V EYK
Sbjct  289  PVIKGTKWSCAKWMHVNEYK  308



>ref|XP_010266901.1| PREDICTED: probable prolyl 4-hydroxylase 3 isoform X1 [Nelumbo 
nucifera]
Length=309

 Score =   244 bits (623),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 112/140 (80%), Positives = 123/140 (88%), Gaps = 0/140 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRIADFTFIP E+GEGLQIL YE+GQ YEPHYDYF+D++NTKNGG R+ATV MYLSDVEE
Sbjct  169  KRIADFTFIPVENGEGLQILRYELGQMYEPHYDYFVDEFNTKNGGNRMATVLMYLSDVEE  228

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGETVFP+AKGNIS+VPW NEL ECGK GLSVKPKMGDA+L WSM+PD +LDPSSLHG C
Sbjct  229  GGETVFPNAKGNISSVPWWNELSECGKRGLSVKPKMGDAILFWSMRPDATLDPSSLHGAC  288

Query  363  PVIKGNKWSXTKXMRVREYK  304
            PVIKG KWS  K M V EYK
Sbjct  289  PVIKGTKWSCAKWMHVNEYK  308



>emb|CDP07346.1| unnamed protein product [Coffea canephora]
Length=293

 Score =   244 bits (622),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 112/141 (79%), Positives = 122/141 (87%), Gaps = 0/141 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRIAD+TFIP +HGEGLQ+LHYEVGQKYEPHYDYFLD YNTKNGGQRIAT+ MYLSDVEE
Sbjct  153  KRIADYTFIPVDHGEGLQVLHYEVGQKYEPHYDYFLDKYNTKNGGQRIATLLMYLSDVEE  212

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGETVFP++ GN S  P  NE+ EC K GLSVKPKMGDALL WSM+PD +LDPSSLHGGC
Sbjct  213  GGETVFPASTGNFSTAPGWNEMSECAKRGLSVKPKMGDALLFWSMRPDATLDPSSLHGGC  272

Query  363  PVIKGNKWSXTKXMRVREYKA  301
            PVI+GNKWS TK M V EYK 
Sbjct  273  PVIRGNKWSSTKWMHVEEYKV  293



>gb|EPS68098.1| hypothetical protein M569_06675 [Genlisea aurea]
Length=283

 Score =   243 bits (621),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 115/141 (82%), Positives = 123/141 (87%), Gaps = 3/141 (2%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRIADFTFIP EHGEGLQ+LHYE GQKYEPH+DYFLD+YNTKNGGQRIAT+ MYLSDVEE
Sbjct  146  KRIADFTFIPVEHGEGLQVLHYEQGQKYEPHFDYFLDEYNTKNGGQRIATLLMYLSDVEE  205

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGET+FP+AKGN SA P   EL ECGK GLSVKP+MGDALL WSM PD +LDPSSLHGGC
Sbjct  206  GGETIFPAAKGNFSAAP---ELSECGKRGLSVKPRMGDALLFWSMHPDATLDPSSLHGGC  262

Query  363  PVIKGNKWSXTKXMRVREYKA  301
            PVIKGNKWS TK M V EYK 
Sbjct  263  PVIKGNKWSSTKWMHVGEYKV  283



>ref|XP_009150770.1| PREDICTED: prolyl 4-hydroxylase 5 isoform X1 [Brassica rapa]
Length=293

 Score =   244 bits (622),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 111/141 (79%), Positives = 125/141 (89%), Gaps = 0/141 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRI+DFTFIP E+GEGLQ+LHY+VGQKYEPHYDYFLD++NTKNGGQRIATV MYLSDV++
Sbjct  153  KRISDFTFIPVENGEGLQVLHYQVGQKYEPHYDYFLDEFNTKNGGQRIATVLMYLSDVDD  212

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGETVFP+AKGNISAVPW NEL +CGK GLSV PK  DALL W+M+PD SLDPSSLHGGC
Sbjct  213  GGETVFPAAKGNISAVPWWNELSKCGKEGLSVLPKKRDALLFWNMRPDASLDPSSLHGGC  272

Query  363  PVIKGNKWSXTKXMRVREYKA  301
            PV+KGNKWS TK   V E+K 
Sbjct  273  PVVKGNKWSSTKWFHVHEFKV  293



>ref|XP_010489402.1| PREDICTED: prolyl 4-hydroxylase 5 [Camelina sativa]
Length=291

 Score =   243 bits (621),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 111/141 (79%), Positives = 125/141 (89%), Gaps = 0/141 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRI+DFTFIP E+GEGLQ+LHY+VGQKYEPHYDYFLD++NTKNGGQRIATV MYLSDV++
Sbjct  151  KRISDFTFIPVENGEGLQVLHYQVGQKYEPHYDYFLDEFNTKNGGQRIATVLMYLSDVDD  210

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGETVFP+AKGNISAVPW NEL +CGK GLSV PK  DALL W+M+PD SLDPSSLHGGC
Sbjct  211  GGETVFPAAKGNISAVPWWNELSKCGKEGLSVLPKKRDALLFWNMRPDASLDPSSLHGGC  270

Query  363  PVIKGNKWSXTKXMRVREYKA  301
            PV+KGNKWS TK   V E+K 
Sbjct  271  PVVKGNKWSSTKWFHVHEFKV  291



>ref|XP_009150771.1| PREDICTED: prolyl 4-hydroxylase 5 isoform X2 [Brassica rapa]
Length=292

 Score =   243 bits (621),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 111/141 (79%), Positives = 125/141 (89%), Gaps = 0/141 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRI+DFTFIP E+GEGLQ+LHY+VGQKYEPHYDYFLD++NTKNGGQRIATV MYLSDV++
Sbjct  152  KRISDFTFIPVENGEGLQVLHYQVGQKYEPHYDYFLDEFNTKNGGQRIATVLMYLSDVDD  211

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGETVFP+AKGNISAVPW NEL +CGK GLSV PK  DALL W+M+PD SLDPSSLHGGC
Sbjct  212  GGETVFPAAKGNISAVPWWNELSKCGKEGLSVLPKKRDALLFWNMRPDASLDPSSLHGGC  271

Query  363  PVIKGNKWSXTKXMRVREYKA  301
            PV+KGNKWS TK   V E+K 
Sbjct  272  PVVKGNKWSSTKWFHVHEFKV  292



>gb|AAM65040.1| putative prolyl 4-hydroxylase, alpha subunit [Arabidopsis thaliana]
Length=291

 Score =   243 bits (621),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 110/141 (78%), Positives = 125/141 (89%), Gaps = 0/141 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRI+DFTFIP E+GEGLQ+LHY+VGQKYEPHYDYFLD++NTKNGGQRIATV MYLSDV++
Sbjct  151  KRISDFTFIPVENGEGLQVLHYQVGQKYEPHYDYFLDEFNTKNGGQRIATVLMYLSDVDD  210

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGETVFP+A+GNISAVPW NEL +CGK GLSV PK  DALL W+M+PD SLDPSSLHGGC
Sbjct  211  GGETVFPAARGNISAVPWWNELSKCGKEGLSVLPKXRDALLFWNMRPDASLDPSSLHGGC  270

Query  363  PVIKGNKWSXTKXMRVREYKA  301
            PV+KGNKWS TK   V E+K 
Sbjct  271  PVVKGNKWSSTKWFHVHEFKV  291



>ref|XP_008778312.1| PREDICTED: probable prolyl 4-hydroxylase 3 isoform X1 [Phoenix 
dactylifera]
Length=308

 Score =   244 bits (622),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 112/138 (81%), Positives = 124/138 (90%), Gaps = 0/138 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRIAD+TFIP EHGEGLQ+LHYEVGQKYEPH+DYFLD++NTKNGGQR+AT+ MYLSDVEE
Sbjct  161  KRIADYTFIPVEHGEGLQVLHYEVGQKYEPHFDYFLDEFNTKNGGQRMATLLMYLSDVEE  220

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGET FPSAK N S++PW NEL ECGK GLSVKPKMGDALL WSMKPD +LDP SLHGGC
Sbjct  221  GGETGFPSAKVNSSSLPWFNELSECGKKGLSVKPKMGDALLFWSMKPDATLDPLSLHGGC  280

Query  363  PVIKGNKWSXTKXMRVRE  310
            P+IKGNKWS TK +RV E
Sbjct  281  PLIKGNKWSATKWIRVHE  298



>emb|CDY07826.1| BnaC03g47960D [Brassica napus]
Length=293

 Score =   243 bits (621),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 111/141 (79%), Positives = 125/141 (89%), Gaps = 0/141 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRI+DFTFIP E+GEGLQ+LHY+VGQKYEPHYDYFLD++NTKNGGQRIATV MYLSDV++
Sbjct  153  KRISDFTFIPVENGEGLQVLHYQVGQKYEPHYDYFLDEFNTKNGGQRIATVLMYLSDVDD  212

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGETVFP+AKGNISAVPW NEL +CGK GLSV PK  DALL W+M+PD SLDPSSLHGGC
Sbjct  213  GGETVFPAAKGNISAVPWWNELSKCGKEGLSVLPKKRDALLFWNMRPDASLDPSSLHGGC  272

Query  363  PVIKGNKWSXTKXMRVREYKA  301
            PV+KGNKWS TK   V E+K 
Sbjct  273  PVVKGNKWSSTKWFHVHEFKV  293



>emb|CDY29194.1| BnaA06g25630D [Brassica napus]
Length=293

 Score =   243 bits (621),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 111/141 (79%), Positives = 125/141 (89%), Gaps = 0/141 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRI+DFTFIP E+GEGLQ+LHY+VGQKYEPHYDYFLD++NTKNGGQRIATV MYLSDV++
Sbjct  153  KRISDFTFIPVENGEGLQVLHYQVGQKYEPHYDYFLDEFNTKNGGQRIATVLMYLSDVDD  212

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGETVFP+AKGNISAVPW NEL +CGK GLSV PK  DALL W+M+PD SLDPSSLHGGC
Sbjct  213  GGETVFPAAKGNISAVPWWNELSKCGKEGLSVLPKKRDALLFWNMRPDASLDPSSLHGGC  272

Query  363  PVIKGNKWSXTKXMRVREYKA  301
            PV+KGNKWS TK   V E+K 
Sbjct  273  PVVKGNKWSSTKWFHVHEFKV  293



>ref|XP_010514697.1| PREDICTED: prolyl 4-hydroxylase 5-like [Camelina sativa]
Length=291

 Score =   243 bits (621),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 111/141 (79%), Positives = 125/141 (89%), Gaps = 0/141 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRI+DFTFIP E+GEGLQ+LHY+VGQKYEPHYDYFLD++NTKNGGQRIATV MYLSDV++
Sbjct  151  KRISDFTFIPVENGEGLQVLHYQVGQKYEPHYDYFLDEFNTKNGGQRIATVLMYLSDVDD  210

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGETVFP+AKGNISAVPW NEL +CGK GLSV PK  DALL W+M+PD SLDPSSLHGGC
Sbjct  211  GGETVFPAAKGNISAVPWWNELSKCGKEGLSVLPKKRDALLFWNMRPDASLDPSSLHGGC  270

Query  363  PVIKGNKWSXTKXMRVREYKA  301
            PV+KGNKWS TK   V E+K 
Sbjct  271  PVVKGNKWSSTKWFHVHEFKV  291



>ref|XP_006409254.1| hypothetical protein EUTSA_v10022796mg [Eutrema salsugineum]
 gb|ESQ50707.1| hypothetical protein EUTSA_v10022796mg [Eutrema salsugineum]
Length=290

 Score =   243 bits (620),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 111/141 (79%), Positives = 125/141 (89%), Gaps = 0/141 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRI+DFTFIP E+GEGLQ+LHY+VGQKYEPHYDYFLD++NTKNGGQRIATV MYLSDV++
Sbjct  150  KRISDFTFIPVENGEGLQVLHYQVGQKYEPHYDYFLDEFNTKNGGQRIATVLMYLSDVDD  209

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGETVFP+AKGNISAVPW NEL +CGK GLSV PK  DALL W+M+PD SLDPSSLHGGC
Sbjct  210  GGETVFPAAKGNISAVPWWNELSKCGKEGLSVLPKKRDALLFWNMRPDASLDPSSLHGGC  269

Query  363  PVIKGNKWSXTKXMRVREYKA  301
            PV+KGNKWS TK   V E+K 
Sbjct  270  PVVKGNKWSSTKWFHVHEFKV  290



>ref|NP_179363.1| prolyl 4-hydroxylase 5 [Arabidopsis thaliana]
 sp|Q24JN5.1|P4H5_ARATH RecName: Full=Prolyl 4-hydroxylase 5; Flags: Precursor [Arabidopsis 
thaliana]
 pir||F84555 similar to prolyl 4-hydroxylase alpha subunit [imported] - Arabidopsis 
thaliana
 gb|ABD65585.1| At2g17720 [Arabidopsis thaliana]
 dbj|BAF01353.1| similar to prolyl 4-hydroxylase alpha subunit [Arabidopsis thaliana]
 gb|AEC06673.1| prolyl 4-hydroxylase 5 [Arabidopsis thaliana]
Length=291

 Score =   243 bits (620),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 110/141 (78%), Positives = 125/141 (89%), Gaps = 0/141 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRI+DFTFIP E+GEGLQ+LHY+VGQKYEPHYDYFLD++NTKNGGQRIATV MYLSDV++
Sbjct  151  KRISDFTFIPVENGEGLQVLHYQVGQKYEPHYDYFLDEFNTKNGGQRIATVLMYLSDVDD  210

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGETVFP+A+GNISAVPW NEL +CGK GLSV PK  DALL W+M+PD SLDPSSLHGGC
Sbjct  211  GGETVFPAARGNISAVPWWNELSKCGKEGLSVLPKKRDALLFWNMRPDASLDPSSLHGGC  270

Query  363  PVIKGNKWSXTKXMRVREYKA  301
            PV+KGNKWS TK   V E+K 
Sbjct  271  PVVKGNKWSSTKWFHVHEFKV  291



>ref|XP_006828848.1| hypothetical protein AMTR_s00001p00155640 [Amborella trichopoda]
 gb|ERM96264.1| hypothetical protein AMTR_s00001p00155640 [Amborella trichopoda]
Length=286

 Score =   243 bits (620),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 107/141 (76%), Positives = 125/141 (89%), Gaps = 0/141 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRIADFTFIP EHGEGLQ+LHYEVGQKYEPH+DYFLD++NTKNGGQRIATV MYL++VE+
Sbjct  146  KRIADFTFIPVEHGEGLQVLHYEVGQKYEPHFDYFLDEFNTKNGGQRIATVLMYLTNVEK  205

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGETVFPS+K N S+VPW +EL +C K G+SV+P+MGDALL WSM+PD +LDPSSLH GC
Sbjct  206  GGETVFPSSKVNSSSVPWWDELSDCAKTGVSVRPRMGDALLFWSMRPDATLDPSSLHAGC  265

Query  363  PVIKGNKWSXTKXMRVREYKA  301
            PVI+GNKWS TK + V EYK 
Sbjct  266  PVIQGNKWSSTKWLHVTEYKV  286



>ref|XP_009397948.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Musa acuminata subsp. 
malaccensis]
Length=288

 Score =   243 bits (620),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 111/141 (79%), Positives = 124/141 (88%), Gaps = 0/141 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRIAD+TFIP EHGEGLQ+LHYEVGQKY+PHYDYF D++NTKNGGQRIAT+ MYLSDVEE
Sbjct  148  KRIADYTFIPVEHGEGLQVLHYEVGQKYDPHYDYFNDEFNTKNGGQRIATLLMYLSDVEE  207

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGETVFPS K N S++PW NEL +C K  LSVKPKMGDALL WSM+PD + DPSSLHGGC
Sbjct  208  GGETVFPSVKVNSSSLPWYNELSDCAKQCLSVKPKMGDALLFWSMRPDATPDPSSLHGGC  267

Query  363  PVIKGNKWSXTKXMRVREYKA  301
            PVIKGNKWS TK MR+ EY+A
Sbjct  268  PVIKGNKWSSTKWMRMHEYRA  288



>ref|XP_003603828.1| Prolyl 4-hydroxylase alpha-2 subunit [Medicago truncatula]
Length=156

 Score =   238 bits (608),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 108/141 (77%), Positives = 123/141 (87%), Gaps = 0/141 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            +RIADFTFIP E+GEGLQ+LHY VG+KYEPHYDYFLD++NTKNGGQR+ATV MYLSDVEE
Sbjct  16   RRIADFTFIPVENGEGLQVLHYGVGEKYEPHYDYFLDEFNTKNGGQRVATVLMYLSDVEE  75

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGETVFP+AK N S+VPW N+L EC + GLS+KPKMGDALL WSM+PD +LD SSLHGGC
Sbjct  76   GGETVFPAAKANFSSVPWWNDLSECARKGLSLKPKMGDALLFWSMRPDATLDASSLHGGC  135

Query  363  PVIKGNKWSXTKXMRVREYKA  301
            PVI GNKWS TK M + EYK 
Sbjct  136  PVIVGNKWSSTKWMHLEEYKV  156



>ref|XP_002884079.1| oxidoreductase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH60338.1| oxidoreductase [Arabidopsis lyrata subsp. lyrata]
Length=291

 Score =   243 bits (620),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 110/141 (78%), Positives = 125/141 (89%), Gaps = 0/141 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRI+DFTFIP E+GEGLQ+LHY+VGQKYEPHYDYFLD++NTKNGGQRIATV MYLSDV++
Sbjct  151  KRISDFTFIPVENGEGLQVLHYQVGQKYEPHYDYFLDEFNTKNGGQRIATVLMYLSDVDD  210

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGETVFP+A+GNISAVPW NEL +CGK GLSV PK  DALL W+M+PD SLDPSSLHGGC
Sbjct  211  GGETVFPAARGNISAVPWWNELSKCGKEGLSVLPKKRDALLFWNMRPDASLDPSSLHGGC  270

Query  363  PVIKGNKWSXTKXMRVREYKA  301
            PV+KGNKWS TK   V E+K 
Sbjct  271  PVVKGNKWSSTKWFHVHEFKV  291



>dbj|BAK01841.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=315

 Score =   244 bits (622),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 109/141 (77%), Positives = 125/141 (89%), Gaps = 0/141 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            +RIAD+TFIPAEHGEGLQ+LHYEVGQKYEPH+DYFLD++NTKNGGQR+AT+ MYLSD+EE
Sbjct  175  RRIADYTFIPAEHGEGLQVLHYEVGQKYEPHFDYFLDEFNTKNGGQRMATILMYLSDIEE  234

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGET+FP A  N S++PW NEL EC + GL+VKPKMGDALL WSMKPD +LDP SLHGGC
Sbjct  235  GGETIFPDANVNSSSLPWYNELSECARKGLAVKPKMGDALLFWSMKPDATLDPLSLHGGC  294

Query  363  PVIKGNKWSXTKXMRVREYKA  301
            PVIKGNKWS TK + V EYKA
Sbjct  295  PVIKGNKWSSTKWLHVGEYKA  315



>ref|XP_009121088.1| PREDICTED: prolyl 4-hydroxylase 5-like [Brassica rapa]
Length=293

 Score =   243 bits (620),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 110/141 (78%), Positives = 125/141 (89%), Gaps = 0/141 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            +RI+DFTFIP E+GEGLQ+LHY+VGQKYEPHYDYFLD++NTKNGGQRIATV MYLSDV++
Sbjct  153  QRISDFTFIPVENGEGLQVLHYQVGQKYEPHYDYFLDEFNTKNGGQRIATVLMYLSDVDD  212

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGETVFP+AKGNISAVPW N+L ECGK GLSV PK  DALL W+M+PD SLDPSSLHGGC
Sbjct  213  GGETVFPAAKGNISAVPWWNQLSECGKEGLSVLPKKRDALLFWNMRPDASLDPSSLHGGC  272

Query  363  PVIKGNKWSXTKXMRVREYKA  301
            PV+KGNKWS TK   V E+K 
Sbjct  273  PVVKGNKWSSTKWFHVHEFKV  293



>ref|XP_010467565.1| PREDICTED: prolyl 4-hydroxylase 5 [Camelina sativa]
Length=291

 Score =   243 bits (619),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 111/141 (79%), Positives = 125/141 (89%), Gaps = 0/141 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRI+DFTFIP E+GEGLQ+LHY+VGQKYEPHYDYFLD++NTKNGGQRIATV MYLSDV++
Sbjct  151  KRISDFTFIPVENGEGLQVLHYQVGQKYEPHYDYFLDEFNTKNGGQRIATVLMYLSDVDD  210

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGETVFP+AKGNISAVPW NEL +CGK GLSV PK  DALL W+M+PD SLDPSSLHGGC
Sbjct  211  GGETVFPAAKGNISAVPWWNELSKCGKEGLSVLPKKRDALLFWNMRPDASLDPSSLHGGC  270

Query  363  PVIKGNKWSXTKXMRVREYKA  301
            PV+KGNKWS TK   V E+K 
Sbjct  271  PVVKGNKWSSTKWYHVHEFKV  291



>ref|XP_002467008.1| hypothetical protein SORBIDRAFT_01g018200 [Sorghum bicolor]
 gb|EER94006.1| hypothetical protein SORBIDRAFT_01g018200 [Sorghum bicolor]
Length=307

 Score =   243 bits (620),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 117/141 (83%), Positives = 126/141 (89%), Gaps = 0/141 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRIADFTFIP EHGEGLQ+LHYEVGQKYEPH+DYF DDYNTKNGGQRIAT+ MYLSDVE+
Sbjct  167  KRIADFTFIPVEHGEGLQVLHYEVGQKYEPHFDYFHDDYNTKNGGQRIATLLMYLSDVED  226

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGETVFPS+  N S+ P+ NEL EC KGGLSVKPKMGDALL WSMKPDGS+D +SLHGGC
Sbjct  227  GGETVFPSSTTNSSSSPFYNELSECAKGGLSVKPKMGDALLFWSMKPDGSMDSTSLHGGC  286

Query  363  PVIKGNKWSXTKXMRVREYKA  301
            PVIKGNKWS TK MRV EYKA
Sbjct  287  PVIKGNKWSSTKWMRVHEYKA  307



>emb|CDY20811.1| BnaC07g06600D [Brassica napus]
Length=293

 Score =   243 bits (619),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 110/141 (78%), Positives = 125/141 (89%), Gaps = 0/141 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            +RI+DFTFIP E+GEGLQ+LHY+VGQKYEPHYDYFLD++NTKNGGQRIATV MYLSDV++
Sbjct  153  QRISDFTFIPVENGEGLQVLHYQVGQKYEPHYDYFLDEFNTKNGGQRIATVLMYLSDVDD  212

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGETVFP+AKGNISAVPW N+L ECGK GLSV PK  DALL W+M+PD SLDPSSLHGGC
Sbjct  213  GGETVFPAAKGNISAVPWWNQLSECGKEGLSVLPKKRDALLFWNMRPDASLDPSSLHGGC  272

Query  363  PVIKGNKWSXTKXMRVREYKA  301
            PV+KGNKWS TK   V E+K 
Sbjct  273  PVVKGNKWSSTKWFHVHEFKV  293



>emb|CDY24364.1| BnaA07g02890D [Brassica napus]
Length=293

 Score =   243 bits (619),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 110/141 (78%), Positives = 125/141 (89%), Gaps = 0/141 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            +RI+DFTFIP E+GEGLQ+LHY+VGQKYEPHYDYFLD++NTKNGGQRIATV MYLSDV++
Sbjct  153  QRISDFTFIPVENGEGLQVLHYQVGQKYEPHYDYFLDEFNTKNGGQRIATVLMYLSDVDD  212

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGETVFP+AKGNISAVPW N+L ECGK GLSV PK  DALL W+M+PD SLDPSSLHGGC
Sbjct  213  GGETVFPAAKGNISAVPWWNQLSECGKEGLSVLPKKRDALLFWNMRPDASLDPSSLHGGC  272

Query  363  PVIKGNKWSXTKXMRVREYKA  301
            PV+KGNKWS TK   V E+K 
Sbjct  273  PVVKGNKWSSTKWFHVHEFKV  293



>ref|XP_010683036.1| PREDICTED: probable prolyl 4-hydroxylase 10 [Beta vulgaris subsp. 
vulgaris]
Length=291

 Score =   243 bits (619),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 111/139 (80%), Positives = 125/139 (90%), Gaps = 0/139 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            +RIADFTF+P EHGEGLQ+LHYEVGQKYEPH+DYFL+DY+T  GGQRIATV MYLSDVEE
Sbjct  151  QRIADFTFLPVEHGEGLQVLHYEVGQKYEPHFDYFLEDYSTVTGGQRIATVLMYLSDVEE  210

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGETVFPSAKGNIS VP+ NEL +CG+ GL+VKPKMGDALL WS+KPD SLDPSSLH GC
Sbjct  211  GGETVFPSAKGNISDVPYWNELSKCGQEGLAVKPKMGDALLFWSLKPDASLDPSSLHAGC  270

Query  363  PVIKGNKWSXTKXMRVREY  307
            PVI+G+KWS TK +RV EY
Sbjct  271  PVIRGDKWSATKWIRVNEY  289



>ref|XP_003603827.1| Prolyl 4-hydroxylase alpha-2 subunit [Medicago truncatula]
 gb|AES74078.1| prolyl 4-hydroxylase alpha-like protein [Medicago truncatula]
Length=280

 Score =   242 bits (617),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 108/141 (77%), Positives = 123/141 (87%), Gaps = 0/141 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            +RIADFTFIP E+GEGLQ+LHY VG+KYEPHYDYFLD++NTKNGGQR+ATV MYLSDVEE
Sbjct  140  RRIADFTFIPVENGEGLQVLHYGVGEKYEPHYDYFLDEFNTKNGGQRVATVLMYLSDVEE  199

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGETVFP+AK N S+VPW N+L EC + GLS+KPKMGDALL WSM+PD +LD SSLHGGC
Sbjct  200  GGETVFPAAKANFSSVPWWNDLSECARKGLSLKPKMGDALLFWSMRPDATLDASSLHGGC  259

Query  363  PVIKGNKWSXTKXMRVREYKA  301
            PVI GNKWS TK M + EYK 
Sbjct  260  PVIVGNKWSSTKWMHLEEYKV  280



>ref|XP_004954469.1| PREDICTED: prolyl 4-hydroxylase subunit alpha-1-like [Setaria 
italica]
Length=311

 Score =   243 bits (619),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 110/141 (78%), Positives = 123/141 (87%), Gaps = 0/141 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRIADFTFIP EHGEGLQ+LHYEVGQKYEPH+DYFLD++NTKNGGQR+AT+ MYLSDVEE
Sbjct  171  KRIADFTFIPVEHGEGLQVLHYEVGQKYEPHFDYFLDEFNTKNGGQRMATLLMYLSDVEE  230

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGET+FP A  N S++PW NEL EC + GLS+KPKMGDALL +SMKPD +LDP SLHGGC
Sbjct  231  GGETIFPDANVNSSSLPWYNELSECARRGLSIKPKMGDALLFYSMKPDATLDPLSLHGGC  290

Query  363  PVIKGNKWSXTKXMRVREYKA  301
            PVI GNKWS TK M V EYKA
Sbjct  291  PVINGNKWSSTKWMHVHEYKA  311



>ref|XP_010667434.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010667435.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010667436.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Beta vulgaris subsp. 
vulgaris]
Length=285

 Score =   242 bits (617),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 113/141 (80%), Positives = 122/141 (87%), Gaps = 0/141 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRIADFTFIP EHGEGLQILHYE GQKYEPHYDYFLD++N KNGGQRIATV MYLSDVEE
Sbjct  145  KRIADFTFIPVEHGEGLQILHYEEGQKYEPHYDYFLDEFNKKNGGQRIATVLMYLSDVEE  204

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGETVFP+A GN S++P  NE  ECGK GLSV+PKMGDALL WSM+PD +LD SSLHGGC
Sbjct  205  GGETVFPAAPGNFSSLPGWNERSECGKRGLSVRPKMGDALLFWSMRPDATLDSSSLHGGC  264

Query  363  PVIKGNKWSXTKXMRVREYKA  301
            PVIKGNKWS TK M V EY+ 
Sbjct  265  PVIKGNKWSSTKWMHVEEYRV  285



>gb|ABK24739.1| unknown [Picea sitchensis]
Length=303

 Score =   242 bits (618),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 109/141 (77%), Positives = 125/141 (89%), Gaps = 0/141 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRIADFTFIPAEHGEGLQ+LHYEVGQKYEPH+DYFLD++NTKNGGQRIATV MYLSDVE+
Sbjct  163  KRIADFTFIPAEHGEGLQVLHYEVGQKYEPHFDYFLDEFNTKNGGQRIATVLMYLSDVEK  222

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGETVFP++K N S+VPW +EL EC K G+SV+P+MGDALL WSM+PD  LDPSSLH GC
Sbjct  223  GGETVFPASKVNSSSVPWWDELSECAKAGISVRPRMGDALLFWSMRPDAELDPSSLHAGC  282

Query  363  PVIKGNKWSXTKXMRVREYKA  301
            PVI+G+KWS TK + V EYK 
Sbjct  283  PVIQGDKWSATKWIHVGEYKV  303



>ref|XP_010446875.1| PREDICTED: prolyl 4-hydroxylase 5-like [Camelina sativa]
Length=293

 Score =   241 bits (616),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 112/140 (80%), Positives = 122/140 (87%), Gaps = 0/140 (0%)
 Frame = -2

Query  720  RIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEEG  541
            RI+DFTFIP E+GEGLQ+LHYEVGQKYEPH+DYF D++NT+ GGQRIATV MYLSDVEEG
Sbjct  154  RISDFTFIPIENGEGLQVLHYEVGQKYEPHHDYFFDEFNTRKGGQRIATVLMYLSDVEEG  213

Query  540  GETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGCP  361
            GETVFPSAKGN+S VPW NEL +CGK GLSV PK  DALL WS+KPD SLDPSSLHGGCP
Sbjct  214  GETVFPSAKGNVSDVPWWNELSQCGKTGLSVLPKKRDALLFWSIKPDASLDPSSLHGGCP  273

Query  360  VIKGNKWSXTKXMRVREYKA  301
            VIKGNKWS TK   V EYKA
Sbjct  274  VIKGNKWSSTKWFHVHEYKA  293



>ref|XP_003570489.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Brachypodium distachyon]
Length=318

 Score =   242 bits (618),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 108/140 (77%), Positives = 123/140 (88%), Gaps = 0/140 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            +RIAD+TFIPAEHGEGLQ+LHYEVGQKYEPH+DYFLD++NTKNGGQR+AT+ MYLSDVEE
Sbjct  178  RRIADYTFIPAEHGEGLQVLHYEVGQKYEPHFDYFLDEFNTKNGGQRMATILMYLSDVEE  237

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGET+FP A  N S++PW NEL EC + GL+VKPKMGDALL WSM PD +LDP SLHGGC
Sbjct  238  GGETIFPDANVNSSSLPWHNELSECARKGLAVKPKMGDALLFWSMNPDATLDPLSLHGGC  297

Query  363  PVIKGNKWSXTKXMRVREYK  304
            PVI+GNKWS TK M V EYK
Sbjct  298  PVIRGNKWSSTKWMHVGEYK  317



>ref|XP_002307750.2| oxidoreductase family protein [Populus trichocarpa]
 gb|EEE94746.2| oxidoreductase family protein [Populus trichocarpa]
Length=288

 Score =   241 bits (615),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 109/140 (78%), Positives = 122/140 (87%), Gaps = 0/140 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRIADF+FIP EHGEGLQ+LHYEVGQKYE H+DYFLD++NTKNGGQR AT+ MYLSDVEE
Sbjct  148  KRIADFSFIPVEHGEGLQVLHYEVGQKYEAHFDYFLDEFNTKNGGQRTATLLMYLSDVEE  207

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGETVFP+A  NISAVPW NEL EC K GLS+KPKMG+ALL WS +PD +LDPSSLHG C
Sbjct  208  GGETVFPAANMNISAVPWWNELSECAKQGLSLKPKMGNALLFWSTRPDATLDPSSLHGSC  267

Query  363  PVIKGNKWSXTKXMRVREYK  304
            PVI+GNKWS TK M + EYK
Sbjct  268  PVIRGNKWSATKWMHLGEYK  287



>gb|EPS63604.1| iron ion binding / oxidoreductase/ oxidoreductase protein, partial 
[Genlisea aurea]
Length=283

 Score =   241 bits (615),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 112/139 (81%), Positives = 121/139 (87%), Gaps = 0/139 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRIAD TFIP EHGEGLQILHYE GQKYEPHYDYF+D++NTKNGGQRIAT  MYLSDVEE
Sbjct  145  KRIADATFIPVEHGEGLQILHYEEGQKYEPHYDYFMDEFNTKNGGQRIATFLMYLSDVEE  204

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGETVFP+AKGN S VPW NEL ECGKGGLSVKPK GDA+L WSMKPD +LDP+SLHG C
Sbjct  205  GGETVFPAAKGNSSGVPWWNELSECGKGGLSVKPKTGDAVLFWSMKPDATLDPTSLHGSC  264

Query  363  PVIKGNKWSXTKXMRVREY  307
            PVIKG+KWS  K + V EY
Sbjct  265  PVIKGSKWSAPKWIHVHEY  283



>ref|NP_001241695.1| prolyl 4-hydroxylase 8-5 [Zea mays]
 gb|AEP37762.1| prolyl 4-hydroxylase 8-5 [Zea mays]
Length=307

 Score =   241 bits (616),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 110/141 (78%), Positives = 123/141 (87%), Gaps = 0/141 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRIAD+TFIP +HGEGLQ+LHYEVGQKYEPH+DYFLD++NTKNGGQRIAT+ MYLSDVEE
Sbjct  167  KRIADYTFIPVDHGEGLQVLHYEVGQKYEPHFDYFLDEFNTKNGGQRIATLLMYLSDVEE  226

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGET+FP A  N S++PW NEL +C K GLSVKPKMGDALL WSMKP  +LDP SLHGGC
Sbjct  227  GGETIFPDANVNASSLPWYNELSDCAKRGLSVKPKMGDALLFWSMKPGATLDPLSLHGGC  286

Query  363  PVIKGNKWSXTKXMRVREYKA  301
            PVIKGNKWS TK M + EYKA
Sbjct  287  PVIKGNKWSSTKWMHIHEYKA  307



>ref|XP_010437420.1| PREDICTED: prolyl 4-hydroxylase 5-like isoform X2 [Camelina sativa]
Length=289

 Score =   240 bits (612),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 112/140 (80%), Positives = 121/140 (86%), Gaps = 0/140 (0%)
 Frame = -2

Query  720  RIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEEG  541
            RI+DFTFIP E+GEGL +LHYEVGQKYEPH+DYF D++NT+ GGQRIATV MYLSDVEEG
Sbjct  150  RISDFTFIPIENGEGLHVLHYEVGQKYEPHHDYFFDEFNTRKGGQRIATVLMYLSDVEEG  209

Query  540  GETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGCP  361
            GETVFPSAKGN+S VPW +EL ECGK GLSV PK  DALL WSMKPD SLDPSSLHGGCP
Sbjct  210  GETVFPSAKGNVSDVPWWDELSECGKTGLSVLPKKRDALLFWSMKPDASLDPSSLHGGCP  269

Query  360  VIKGNKWSXTKXMRVREYKA  301
            VIKGNKWS TK   V EYKA
Sbjct  270  VIKGNKWSSTKWFHVHEYKA  289



>ref|XP_010437419.1| PREDICTED: prolyl 4-hydroxylase 5-like isoform X1 [Camelina sativa]
Length=290

 Score =   240 bits (612),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 112/140 (80%), Positives = 121/140 (86%), Gaps = 0/140 (0%)
 Frame = -2

Query  720  RIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEEG  541
            RI+DFTFIP E+GEGL +LHYEVGQKYEPH+DYF D++NT+ GGQRIATV MYLSDVEEG
Sbjct  151  RISDFTFIPIENGEGLHVLHYEVGQKYEPHHDYFFDEFNTRKGGQRIATVLMYLSDVEEG  210

Query  540  GETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGCP  361
            GETVFPSAKGN+S VPW +EL ECGK GLSV PK  DALL WSMKPD SLDPSSLHGGCP
Sbjct  211  GETVFPSAKGNVSDVPWWDELSECGKTGLSVLPKKRDALLFWSMKPDASLDPSSLHGGCP  270

Query  360  VIKGNKWSXTKXMRVREYKA  301
            VIKGNKWS TK   V EYKA
Sbjct  271  VIKGNKWSSTKWFHVHEYKA  290



>ref|NP_001131953.1| uncharacterized protein LOC100193348 [Zea mays]
 gb|ACF80592.1| unknown [Zea mays]
 gb|AEP37741.1| prolyl 4-hydroxylase 1 [Zea mays]
 tpg|DAA49455.1| TPA: hypothetical protein ZEAMMB73_536273 [Zea mays]
Length=307

 Score =   240 bits (612),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 116/141 (82%), Positives = 125/141 (89%), Gaps = 0/141 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRIAD+TFIP E GEGLQ+LHYEVGQKYEPH+DYF DDYNTKNGGQRIAT+ MYLSDVE+
Sbjct  167  KRIADYTFIPVEQGEGLQVLHYEVGQKYEPHFDYFHDDYNTKNGGQRIATLLMYLSDVED  226

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGETVFPS+  N S+ P+ NEL EC KGGLSVKPKMGDALL WSMKPDGSLDP+SLHGGC
Sbjct  227  GGETVFPSSTTNSSSSPFYNELSECAKGGLSVKPKMGDALLFWSMKPDGSLDPTSLHGGC  286

Query  363  PVIKGNKWSXTKXMRVREYKA  301
            PVIKGNKWS TK MRV EYK 
Sbjct  287  PVIKGNKWSSTKWMRVHEYKV  307



>ref|XP_010432225.1| PREDICTED: prolyl 4-hydroxylase 5-like isoform X3 [Camelina sativa]
Length=294

 Score =   239 bits (610),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 110/140 (79%), Positives = 122/140 (87%), Gaps = 0/140 (0%)
 Frame = -2

Query  720  RIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEEG  541
            RI+DFTFIP E+GEGLQ+LHYEVGQKYEPH+DYF D++NT+ GGQRIAT+ MYLSDVEEG
Sbjct  155  RISDFTFIPIENGEGLQVLHYEVGQKYEPHHDYFFDEFNTRKGGQRIATLLMYLSDVEEG  214

Query  540  GETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGCP  361
            GETVFPSAKGN+S VPW +EL +CGK GLSV PK  DALL WSMKPD +LDPSSLHGGCP
Sbjct  215  GETVFPSAKGNVSDVPWWDELSQCGKTGLSVLPKKRDALLFWSMKPDAALDPSSLHGGCP  274

Query  360  VIKGNKWSXTKXMRVREYKA  301
            VIKGNKWS TK   V EYKA
Sbjct  275  VIKGNKWSSTKWFHVHEYKA  294



>ref|XP_010432226.1| PREDICTED: prolyl 4-hydroxylase 5-like isoform X4 [Camelina sativa]
Length=293

 Score =   239 bits (610),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 110/140 (79%), Positives = 122/140 (87%), Gaps = 0/140 (0%)
 Frame = -2

Query  720  RIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEEG  541
            RI+DFTFIP E+GEGLQ+LHYEVGQKYEPH+DYF D++NT+ GGQRIAT+ MYLSDVEEG
Sbjct  154  RISDFTFIPIENGEGLQVLHYEVGQKYEPHHDYFFDEFNTRKGGQRIATLLMYLSDVEEG  213

Query  540  GETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGCP  361
            GETVFPSAKGN+S VPW +EL +CGK GLSV PK  DALL WSMKPD +LDPSSLHGGCP
Sbjct  214  GETVFPSAKGNVSDVPWWDELSQCGKTGLSVLPKKRDALLFWSMKPDAALDPSSLHGGCP  273

Query  360  VIKGNKWSXTKXMRVREYKA  301
            VIKGNKWS TK   V EYKA
Sbjct  274  VIKGNKWSSTKWFHVHEYKA  293



>tpg|DAA49456.1| TPA: hypothetical protein ZEAMMB73_536273 [Zea mays]
Length=364

 Score =   241 bits (615),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 116/140 (83%), Positives = 125/140 (89%), Gaps = 0/140 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRIAD+TFIP E GEGLQ+LHYEVGQKYEPH+DYF DDYNTKNGGQRIAT+ MYLSDVE+
Sbjct  224  KRIADYTFIPVEQGEGLQVLHYEVGQKYEPHFDYFHDDYNTKNGGQRIATLLMYLSDVED  283

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGETVFPS+  N S+ P+ NEL EC KGGLSVKPKMGDALL WSMKPDGSLDP+SLHGGC
Sbjct  284  GGETVFPSSTTNSSSSPFYNELSECAKGGLSVKPKMGDALLFWSMKPDGSLDPTSLHGGC  343

Query  363  PVIKGNKWSXTKXMRVREYK  304
            PVIKGNKWS TK MRV EYK
Sbjct  344  PVIKGNKWSSTKWMRVHEYK  363



>ref|XP_011003088.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Populus euphratica]
 ref|XP_011003089.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Populus euphratica]
Length=288

 Score =   238 bits (608),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 108/140 (77%), Positives = 121/140 (86%), Gaps = 0/140 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRIADF+FIP EHGEGLQ+LHYEVGQKYE H+DYFLD++NTKNGGQR AT+ MYLSDVEE
Sbjct  148  KRIADFSFIPVEHGEGLQVLHYEVGQKYEAHFDYFLDEFNTKNGGQRTATLLMYLSDVEE  207

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGETVFP+A  NISAVPW NEL EC K GLS+KPK G+ALL WS +PD +LDPSSLHG C
Sbjct  208  GGETVFPAANVNISAVPWWNELSECAKQGLSLKPKRGNALLFWSTRPDATLDPSSLHGSC  267

Query  363  PVIKGNKWSXTKXMRVREYK  304
            PVI+GNKWS TK M + EYK
Sbjct  268  PVIRGNKWSATKWMHLGEYK  287



>ref|XP_010266056.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Nelumbo nucifera]
Length=309

 Score =   239 bits (609),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 110/141 (78%), Positives = 120/141 (85%), Gaps = 0/141 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRIADF+FIP EHGEGLQIL YE+GQKYEPH+DYF+D+ NTKNGG R+AT+ MYLSDVEE
Sbjct  169  KRIADFSFIPVEHGEGLQILRYELGQKYEPHFDYFVDELNTKNGGNRMATLLMYLSDVEE  228

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGETVFP+ KGNISAVPW NEL  CGK GLSVKPKMGDA+L WSMKPD +LDP SLHG C
Sbjct  229  GGETVFPNVKGNISAVPWWNELSACGKRGLSVKPKMGDAILFWSMKPDATLDPLSLHGAC  288

Query  363  PVIKGNKWSXTKXMRVREYKA  301
            PVIKG KWS  K M V EYK 
Sbjct  289  PVIKGTKWSCAKWMHVNEYKV  309



>ref|XP_009418644.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Musa acuminata subsp. 
malaccensis]
Length=301

 Score =   238 bits (607),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 109/141 (77%), Positives = 122/141 (87%), Gaps = 0/141 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRIA++TFIP EHGEGLQ+LHYEVGQKYEPH+DYFLD+YN KNGGQRIAT+ MYLSDVEE
Sbjct  161  KRIAEYTFIPIEHGEGLQVLHYEVGQKYEPHFDYFLDEYNAKNGGQRIATLLMYLSDVEE  220

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGET+FP AK +  ++ W NEL +CG+ GLS+KPKMGDALL WSMKPD SLDP SLHGGC
Sbjct  221  GGETIFPDAKISSRSLSWSNELSKCGEKGLSIKPKMGDALLFWSMKPDASLDPLSLHGGC  280

Query  363  PVIKGNKWSXTKXMRVREYKA  301
            PVIKGNKWS TK M V EYK 
Sbjct  281  PVIKGNKWSCTKWMHVHEYKV  301



>ref|XP_011083428.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Sesamum indicum]
 ref|XP_011083429.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Sesamum indicum]
 ref|XP_011083430.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Sesamum indicum]
 ref|XP_011083431.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Sesamum indicum]
Length=292

 Score =   238 bits (606),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 109/139 (78%), Positives = 122/139 (88%), Gaps = 0/139 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRIADFTFIP EHGEGLQ+LHYEVGQKYEPH+DYFLD++NT+NGGQR+ATV MYLSDVEE
Sbjct  152  KRIADFTFIPVEHGEGLQVLHYEVGQKYEPHFDYFLDEFNTRNGGQRVATVLMYLSDVEE  211

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGETVFP+A+GN S++P  NE  EC K GLS+KPKMGDALL WSM PD +LDPSSLHG C
Sbjct  212  GGETVFPAARGNYSSLPGWNERSECAKRGLSLKPKMGDALLFWSMHPDATLDPSSLHGSC  271

Query  363  PVIKGNKWSXTKXMRVREY  307
            PVI+GNKWS TK M V EY
Sbjct  272  PVIRGNKWSSTKWMHVGEY  290



>ref|XP_004982729.1| PREDICTED: prolyl 4-hydroxylase subunit alpha-1-like [Setaria 
italica]
Length=308

 Score =   238 bits (607),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 112/137 (82%), Positives = 121/137 (88%), Gaps = 0/137 (0%)
 Frame = -2

Query  714  ADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEEGGE  535
            AD+TFIP EHGEGLQ+LHYEVGQKYEPH+DYF DDYNTKNGGQRIAT+ MYLSDVE+GGE
Sbjct  171  ADYTFIPVEHGEGLQVLHYEVGQKYEPHFDYFHDDYNTKNGGQRIATLLMYLSDVEDGGE  230

Query  534  TVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGCPVI  355
            TVFPSA  N S+ P+ +EL  C K GLSVKPKMGDALL WSMKPDGSLDP+SLHGGCPVI
Sbjct  231  TVFPSATVNSSSSPFYSELSACAKRGLSVKPKMGDALLFWSMKPDGSLDPTSLHGGCPVI  290

Query  354  KGNKWSXTKXMRVREYK  304
            KGNKWS TK MRV EYK
Sbjct  291  KGNKWSSTKWMRVHEYK  307



>ref|XP_003629237.1| Prolyl 4-hydroxylase alpha-2 subunit [Medicago truncatula]
 gb|AET03713.1| prolyl 4-hydroxylase alpha-like protein [Medicago truncatula]
 gb|AFK44766.1| unknown [Medicago truncatula]
 gb|AFK46234.1| unknown [Medicago truncatula]
Length=275

 Score =   237 bits (604),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 106/139 (76%), Positives = 120/139 (86%), Gaps = 0/139 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRIADFTFIP EHGE   +LHYEVGQKYEPHYDYFLD ++T++ GQRIAT+ MYLSDVEE
Sbjct  137  KRIADFTFIPVEHGESFNVLHYEVGQKYEPHYDYFLDTFSTRHAGQRIATMLMYLSDVEE  196

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGETVFP+AKGN S+VPW NEL +CGKGGLS+KPKMG+A+L WSMKPD +LDPSSLHG C
Sbjct  197  GGETVFPNAKGNFSSVPWWNELSDCGKGGLSIKPKMGNAILFWSMKPDATLDPSSLHGAC  256

Query  363  PVIKGNKWSXTKXMRVREY  307
            PVIKG+KWS  K M   EY
Sbjct  257  PVIKGDKWSCAKWMHADEY  275



>ref|XP_009394475.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Musa acuminata subsp. 
malaccensis]
Length=293

 Score =   237 bits (605),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 109/141 (77%), Positives = 122/141 (87%), Gaps = 0/141 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRIAD+TFIP EHGEGLQ+LHYEVGQKYEPH DYF D++NTKNGGQRIAT  MYLSDVEE
Sbjct  153  KRIADYTFIPVEHGEGLQVLHYEVGQKYEPHLDYFADEFNTKNGGQRIATFLMYLSDVEE  212

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGETVFP+AK N S++P  NEL +CGK GL++KPKMGDALL WSMKPD ++DP SLHG C
Sbjct  213  GGETVFPNAKVNSSSLPGYNELSDCGKAGLALKPKMGDALLFWSMKPDATMDPLSLHGAC  272

Query  363  PVIKGNKWSXTKXMRVREYKA  301
            PVIKGNKWS  K MR+ EYKA
Sbjct  273  PVIKGNKWSAPKWMRLHEYKA  293



>ref|XP_010266057.1| PREDICTED: probable prolyl 4-hydroxylase 10 [Nelumbo nucifera]
Length=311

 Score =   238 bits (606),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 109/141 (77%), Positives = 119/141 (84%), Gaps = 0/141 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            +RIA  TFIP EHGEGL +L YE+GQ YEPH+DYFLD++N KNGGQR+ATV MYLSDVEE
Sbjct  171  ERIAKSTFIPVEHGEGLHVLRYELGQMYEPHFDYFLDEFNPKNGGQRMATVLMYLSDVEE  230

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGETVFP AKGNISAVPW NEL EC K GLSVKPKMGDA+L WSMKPD +LDPSSLHG C
Sbjct  231  GGETVFPDAKGNISAVPWWNELSECAKKGLSVKPKMGDAILFWSMKPDATLDPSSLHGAC  290

Query  363  PVIKGNKWSXTKXMRVREYKA  301
            PVIKG KWS  K MRV EY+ 
Sbjct  291  PVIKGTKWSCAKWMRVNEYQV  311



>ref|XP_009392830.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Musa acuminata subsp. 
malaccensis]
 ref|XP_009392831.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Musa acuminata subsp. 
malaccensis]
Length=301

 Score =   236 bits (603),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 107/141 (76%), Positives = 124/141 (88%), Gaps = 0/141 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRI+D+TFIP E+GEGLQ+LHYEVGQKYEPH+DYFLD++NT NGGQR+AT+ MYLSDVEE
Sbjct  161  KRISDYTFIPVENGEGLQVLHYEVGQKYEPHFDYFLDEFNTMNGGQRMATLLMYLSDVEE  220

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGET+FP+AK N S++P  NEL ECGK G+SV+PKMGDALL WSMKPD +LDP SLHGGC
Sbjct  221  GGETIFPNAKINSSSLPLYNELSECGKKGISVRPKMGDALLFWSMKPDATLDPLSLHGGC  280

Query  363  PVIKGNKWSXTKXMRVREYKA  301
            PVI+GNKWS TK M V EYK 
Sbjct  281  PVIRGNKWSSTKWMHVHEYKV  301



>ref|XP_002510597.1| prolyl 4-hydroxylase alpha subunit, putative [Ricinus communis]
 gb|EEF52784.1| prolyl 4-hydroxylase alpha subunit, putative [Ricinus communis]
Length=289

 Score =   235 bits (600),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 107/139 (77%), Positives = 120/139 (86%), Gaps = 0/139 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRIADF+FIP EHGEGLQ+LHYEVGQKYE HYDYFLD++NTKNGGQR AT+ MYLSDVEE
Sbjct  149  KRIADFSFIPIEHGEGLQVLHYEVGQKYEAHYDYFLDEFNTKNGGQRTATLLMYLSDVEE  208

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGETVFP+AK NIS VP  NEL EC + GLSVKPKMG+ALL WS +PD +LDP+SLHG C
Sbjct  209  GGETVFPAAKANISNVPSWNELSECARQGLSVKPKMGNALLFWSTRPDATLDPASLHGSC  268

Query  363  PVIKGNKWSXTKXMRVREY  307
            PVI+GNKWS TK M + EY
Sbjct  269  PVIRGNKWSATKWMHLGEY  287



>ref|XP_010935631.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Elaeis guineensis]
Length=297

 Score =   235 bits (600),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 109/141 (77%), Positives = 122/141 (87%), Gaps = 0/141 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRIAD+TFIP EHGEGLQ+LHY VGQKYEPH+DYFLD++NTKNGGQR+AT+ MYLSDVEE
Sbjct  157  KRIADYTFIPVEHGEGLQVLHYGVGQKYEPHFDYFLDEFNTKNGGQRMATLLMYLSDVEE  216

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGETVFPS K N S++P  NEL ECGK GLSVKPKMGDALL WSMKPD  +DP SLHG C
Sbjct  217  GGETVFPSVKVNSSSLPSYNELSECGKKGLSVKPKMGDALLFWSMKPDAVVDPLSLHGAC  276

Query  363  PVIKGNKWSXTKXMRVREYKA  301
            PVIKGNKWS TK M + +Y+A
Sbjct  277  PVIKGNKWSCTKWMHIHKYEA  297



>gb|KHG08442.1| Prolyl 4-hydroxylase subunit alpha-1 [Gossypium arboreum]
Length=296

 Score =   235 bits (600),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 107/138 (78%), Positives = 125/138 (91%), Gaps = 2/138 (1%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRIA+++FIP EHGEGLQ+LHYEVGQKYEPH+DYF+D+YNT++GGQR+AT  M +SDVEE
Sbjct  146  KRIAEYSFIPIEHGEGLQVLHYEVGQKYEPHFDYFVDEYNTRHGGQRMAT--MLMSDVEE  203

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGET+FP+AKGNISAVPW +EL ECGKGGL+VKPKMGDALL WSMKPD ++DPSSLHGGC
Sbjct  204  GGETIFPNAKGNISAVPWWDELSECGKGGLAVKPKMGDALLFWSMKPDATVDPSSLHGGC  263

Query  363  PVIKGNKWSXTKXMRVRE  310
            PVI G+KWS TK M V E
Sbjct  264  PVIVGDKWSSTKWMHVNE  281



>ref|XP_008456352.1| PREDICTED: prolyl 4-hydroxylase subunit alpha-1-like [Cucumis 
melo]
 ref|XP_008456362.1| PREDICTED: prolyl 4-hydroxylase subunit alpha-1-like [Cucumis 
melo]
 ref|XP_008456370.1| PREDICTED: prolyl 4-hydroxylase subunit alpha-1-like [Cucumis 
melo]
Length=284

 Score =   234 bits (597),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 105/139 (76%), Positives = 121/139 (87%), Gaps = 0/139 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRIADFTFIP EHGE +QILHY VGQKY+ HYD+F+D+YN K+ GQR+AT+ MYLSDVEE
Sbjct  145  KRIADFTFIPIEHGEDIQILHYAVGQKYDAHYDFFVDEYNLKSVGQRMATLLMYLSDVEE  204

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGETVFP+AKGN S+VPW NEL ECGK GLS+KPKMGDALL WSMKPD +LDP+SLHG C
Sbjct  205  GGETVFPAAKGNFSSVPWWNELSECGKSGLSIKPKMGDALLFWSMKPDTTLDPTSLHGAC  264

Query  363  PVIKGNKWSXTKXMRVREY  307
            PVI+GNKWS TK + V +Y
Sbjct  265  PVIRGNKWSCTKWIHVNKY  283



>ref|XP_004167095.1| PREDICTED: prolyl 4-hydroxylase subunit alpha-1-like [Cucumis 
sativus]
Length=249

 Score =   233 bits (594),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 107/138 (78%), Positives = 121/138 (88%), Gaps = 0/138 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRIADFTFIP EHGEGLQILHYEVGQKY+ HYD+F D++N K  GQR+AT+ MYLSDVEE
Sbjct  110  KRIADFTFIPIEHGEGLQILHYEVGQKYDAHYDFFDDEFNLKEIGQRMATLLMYLSDVEE  169

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGETVFP+AKGN S+VPW NEL +CGKGGLSVKPKMGDALL WSMKPD +LDP+SLHG C
Sbjct  170  GGETVFPAAKGNFSSVPWWNELSKCGKGGLSVKPKMGDALLFWSMKPDTTLDPTSLHGAC  229

Query  363  PVIKGNKWSXTKXMRVRE  310
            PVI+GNKWS TK + V +
Sbjct  230  PVIRGNKWSCTKWIHVNQ  247



>gb|EYU17561.1| hypothetical protein MIMGU_mgv1a0210091mg, partial [Erythranthe 
guttata]
Length=193

 Score =   231 bits (588),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 105/139 (76%), Positives = 121/139 (87%), Gaps = 0/139 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRIAD++ IP EHGEG+Q+LHYEVGQKYEPHYDYFLD+++TKNG QR+AT+ MYLSDVEE
Sbjct  55   KRIADYSQIPLEHGEGIQVLHYEVGQKYEPHYDYFLDEFHTKNGDQRVATLLMYLSDVEE  114

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGETVFP AKGN S++P  NE+ EC K GLSVKPKMGDALL WS+KPD +LDPSSLHG C
Sbjct  115  GGETVFPVAKGNFSSLPGWNEMSECAKKGLSVKPKMGDALLFWSLKPDATLDPSSLHGAC  174

Query  363  PVIKGNKWSXTKXMRVREY  307
            PVI+GNKWS TK M + EY
Sbjct  175  PVIRGNKWSATKWMHLHEY  193



>ref|XP_008802391.1| PREDICTED: probable prolyl 4-hydroxylase 3 isoform X2 [Phoenix 
dactylifera]
Length=303

 Score =   234 bits (598),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 108/141 (77%), Positives = 121/141 (86%), Gaps = 0/141 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRIAD+TFIP EHGEGLQ+LHY VGQKYEPH+DYFLD++NTKNGGQR+AT+ MYLSDVEE
Sbjct  163  KRIADYTFIPVEHGEGLQVLHYGVGQKYEPHFDYFLDEFNTKNGGQRMATLLMYLSDVEE  222

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGET+FPS K N S++P  NEL ECGK GLSVKPKMGDALL WSMKPD  +DP SLHG C
Sbjct  223  GGETIFPSVKVNSSSLPSYNELSECGKKGLSVKPKMGDALLFWSMKPDAIVDPLSLHGAC  282

Query  363  PVIKGNKWSXTKXMRVREYKA  301
            PVIKGNKWS TK M + EY+ 
Sbjct  283  PVIKGNKWSCTKWMHIHEYEV  303



>ref|XP_008802369.1| PREDICTED: probable prolyl 4-hydroxylase 3 isoform X1 [Phoenix 
dactylifera]
 ref|XP_008802377.1| PREDICTED: probable prolyl 4-hydroxylase 3 isoform X1 [Phoenix 
dactylifera]
 ref|XP_008802385.1| PREDICTED: probable prolyl 4-hydroxylase 3 isoform X1 [Phoenix 
dactylifera]
Length=306

 Score =   234 bits (598),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 108/141 (77%), Positives = 121/141 (86%), Gaps = 0/141 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRIAD+TFIP EHGEGLQ+LHY VGQKYEPH+DYFLD++NTKNGGQR+AT+ MYLSDVEE
Sbjct  166  KRIADYTFIPVEHGEGLQVLHYGVGQKYEPHFDYFLDEFNTKNGGQRMATLLMYLSDVEE  225

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGET+FPS K N S++P  NEL ECGK GLSVKPKMGDALL WSMKPD  +DP SLHG C
Sbjct  226  GGETIFPSVKVNSSSLPSYNELSECGKKGLSVKPKMGDALLFWSMKPDAIVDPLSLHGAC  285

Query  363  PVIKGNKWSXTKXMRVREYKA  301
            PVIKGNKWS TK M + EY+ 
Sbjct  286  PVIKGNKWSCTKWMHIHEYEV  306



>ref|XP_002869059.1| oxidoreductase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH45318.1| oxidoreductase [Arabidopsis lyrata subsp. lyrata]
Length=290

 Score =   233 bits (595),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 108/138 (78%), Positives = 119/138 (86%), Gaps = 0/138 (0%)
 Frame = -2

Query  720  RIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEEG  541
            RI+DFTFIP E+GEGLQ+LHYEVGQKYEPH+DYF D++N + GGQRIATV MYLSDV+EG
Sbjct  152  RISDFTFIPIENGEGLQVLHYEVGQKYEPHHDYFFDEFNVRKGGQRIATVLMYLSDVDEG  211

Query  540  GETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGCP  361
            GETVFP+AKGNIS VPW +EL +CGK GLSV PK  DALL WSMKPD SLDPSSLHGGCP
Sbjct  212  GETVFPAAKGNISDVPWWDELSQCGKEGLSVLPKKRDALLFWSMKPDASLDPSSLHGGCP  271

Query  360  VIKGNKWSXTKXMRVREY  307
            VIKGNKWS TK   V EY
Sbjct  272  VIKGNKWSSTKWFHVHEY  289



>ref|XP_010432223.1| PREDICTED: prolyl 4-hydroxylase 5-like isoform X1 [Camelina sativa]
Length=299

 Score =   233 bits (594),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 110/145 (76%), Positives = 122/145 (84%), Gaps = 5/145 (3%)
 Frame = -2

Query  720  RIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEEG  541
            RI+DFTFIP E+GEGLQ+LHYEVGQKYEPH+DYF D++NT+ GGQRIAT+ MYLSDVEEG
Sbjct  155  RISDFTFIPIENGEGLQVLHYEVGQKYEPHHDYFFDEFNTRKGGQRIATLLMYLSDVEEG  214

Query  540  GETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLH----  373
            GETVFPSAKGN+S VPW +EL +CGK GLSV PK  DALL WSMKPD +LDPSSLH    
Sbjct  215  GETVFPSAKGNVSDVPWWDELSQCGKTGLSVLPKKRDALLFWSMKPDAALDPSSLHGERE  274

Query  372  -GGCPVIKGNKWSXTKXMRVREYKA  301
             GGCPVIKGNKWS TK   V EYKA
Sbjct  275  RGGCPVIKGNKWSSTKWFHVHEYKA  299



>ref|XP_010432224.1| PREDICTED: prolyl 4-hydroxylase 5-like isoform X2 [Camelina sativa]
Length=298

 Score =   233 bits (593),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 110/145 (76%), Positives = 122/145 (84%), Gaps = 5/145 (3%)
 Frame = -2

Query  720  RIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEEG  541
            RI+DFTFIP E+GEGLQ+LHYEVGQKYEPH+DYF D++NT+ GGQRIAT+ MYLSDVEEG
Sbjct  154  RISDFTFIPIENGEGLQVLHYEVGQKYEPHHDYFFDEFNTRKGGQRIATLLMYLSDVEEG  213

Query  540  GETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLH----  373
            GETVFPSAKGN+S VPW +EL +CGK GLSV PK  DALL WSMKPD +LDPSSLH    
Sbjct  214  GETVFPSAKGNVSDVPWWDELSQCGKTGLSVLPKKRDALLFWSMKPDAALDPSSLHGERE  273

Query  372  -GGCPVIKGNKWSXTKXMRVREYKA  301
             GGCPVIKGNKWS TK   V EYKA
Sbjct  274  RGGCPVIKGNKWSSTKWFHVHEYKA  298



>gb|EEE51215.1| hypothetical protein OsJ_32038 [Oryza sativa Japonica Group]
Length=222

 Score =   229 bits (585),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 110/140 (79%), Positives = 125/140 (89%), Gaps = 0/140 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRI+D+TFIP E+GEGLQ+LHYEVGQKYEPH+DYF D++NTKNGGQRIAT+ MYLSDVEE
Sbjct  82   KRISDYTFIPVENGEGLQVLHYEVGQKYEPHFDYFHDEFNTKNGGQRIATLLMYLSDVEE  141

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGET+FPS+K N S+ P+ NEL EC K GL+VKPKMGDALL WSM+PDGSLD +SLHGGC
Sbjct  142  GGETIFPSSKANSSSSPFYNELSECAKKGLAVKPKMGDALLFWSMRPDGSLDATSLHGGC  201

Query  363  PVIKGNKWSXTKXMRVREYK  304
            PVIKGNKWS TK MRV EYK
Sbjct  202  PVIKGNKWSSTKWMRVHEYK  221



>ref|XP_009109263.1| PREDICTED: prolyl 4-hydroxylase 5-like [Brassica rapa]
Length=292

 Score =   232 bits (591),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 108/140 (77%), Positives = 117/140 (84%), Gaps = 0/140 (0%)
 Frame = -2

Query  720  RIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEEG  541
            RI+DFTFIP E+GEGLQ+LHYEVGQKYEPH+DYF D+YN K GG RIATV MYLSDVEEG
Sbjct  153  RISDFTFIPVENGEGLQVLHYEVGQKYEPHHDYFSDEYNVKRGGNRIATVLMYLSDVEEG  212

Query  540  GETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGCP  361
            GETVFP+AKGNIS VPW NEL +CG+ GLSV PK  DALL WS +PD SLDPSSLHGGCP
Sbjct  213  GETVFPAAKGNISDVPWWNELSQCGREGLSVLPKKRDALLFWSARPDASLDPSSLHGGCP  272

Query  360  VIKGNKWSXTKXMRVREYKA  301
            VIKGNKWS TK     EY A
Sbjct  273  VIKGNKWSSTKWFHFNEYTA  292



>emb|CDY24822.1| BnaA08g14880D [Brassica napus]
Length=293

 Score =   232 bits (591),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 108/140 (77%), Positives = 117/140 (84%), Gaps = 0/140 (0%)
 Frame = -2

Query  720  RIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEEG  541
            RI+DFTFIP E+GEGLQ+LHYEVGQKYEPH+DYF D+YN K GG RIATV MYLSDVEEG
Sbjct  154  RISDFTFIPVENGEGLQVLHYEVGQKYEPHHDYFSDEYNVKRGGNRIATVLMYLSDVEEG  213

Query  540  GETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGCP  361
            GETVFP+AKGNIS VPW NEL +CG+ GLSV PK  DALL WS +PD SLDPSSLHGGCP
Sbjct  214  GETVFPAAKGNISDVPWWNELSQCGREGLSVLPKKRDALLFWSARPDASLDPSSLHGGCP  273

Query  360  VIKGNKWSXTKXMRVREYKA  301
            VIKGNKWS TK     EY A
Sbjct  274  VIKGNKWSSTKWFHFNEYTA  293



>ref|NP_195306.2| oxidoreductase, 2OG-Fe(II) oxygenase family protein [Arabidopsis 
thaliana]
 gb|AEE86574.1| oxidoreductase, 2OG-Fe(II) oxygenase family protein [Arabidopsis 
thaliana]
Length=290

 Score =   231 bits (590),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 106/138 (77%), Positives = 119/138 (86%), Gaps = 0/138 (0%)
 Frame = -2

Query  720  RIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEEG  541
            RI+DFTFIP E+GEGLQ+LHYEVGQ+YEPH+DYF D++N + GGQRIATV MYLSDV+EG
Sbjct  152  RISDFTFIPPENGEGLQVLHYEVGQRYEPHHDYFFDEFNVRKGGQRIATVLMYLSDVDEG  211

Query  540  GETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGCP  361
            GETVFP+AKGN+S VPW +EL +CGK GLSV PK  DALL WSMKPD SLDPSSLHGGCP
Sbjct  212  GETVFPAAKGNVSDVPWWDELSQCGKEGLSVLPKKRDALLFWSMKPDASLDPSSLHGGCP  271

Query  360  VIKGNKWSXTKXMRVREY  307
            VIKGNKWS TK   V EY
Sbjct  272  VIKGNKWSSTKWFHVHEY  289



>ref|XP_007017903.1| 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily 
protein isoform 2 [Theobroma cacao]
 gb|EOY15128.1| 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily 
protein isoform 2 [Theobroma cacao]
Length=260

 Score =   230 bits (587),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 104/131 (79%), Positives = 117/131 (89%), Gaps = 0/131 (0%)
 Frame = -2

Query  693  AEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEEGGETVFPSAK  514
            +EHGEGLQ+LHYEVGQKY+ H+DYFLD++NTKNGGQR+AT+ MYLSDVEEGGET+FP+AK
Sbjct  130  SEHGEGLQVLHYEVGQKYDAHFDYFLDEFNTKNGGQRMATMLMYLSDVEEGGETIFPAAK  189

Query  513  GNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGCPVIKGNKWSX  334
            GN SAVPW NEL ECGK GLSVKPKMGDALL WSM+PD +LDPSSLHGGCPVI GNKWS 
Sbjct  190  GNFSAVPWWNELSECGKQGLSVKPKMGDALLFWSMRPDATLDPSSLHGGCPVIMGNKWSS  249

Query  333  TKXMRVREYKA  301
            TK + V EYK 
Sbjct  250  TKWIHVEEYKV  260



>ref|XP_002978409.1| hypothetical protein SELMODRAFT_418273 [Selaginella moellendorffii]
 gb|EFJ20395.1| hypothetical protein SELMODRAFT_418273 [Selaginella moellendorffii]
Length=256

 Score =   230 bits (587),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 108/139 (78%), Positives = 118/139 (85%), Gaps = 0/139 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            +RIA FTFIP EHGEGLQ+LHYEVGQKY+ H+DYF D  NTKNGGQR+ATV MYLSDVEE
Sbjct  117  ERIAKFTFIPKEHGEGLQVLHYEVGQKYDAHHDYFHDKVNTKNGGQRVATVLMYLSDVEE  176

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGETVFPSAK N S+VPW +EL ECGK G+SVKP+ GDALL WSM PD  LDP SLHGGC
Sbjct  177  GGETVFPSAKVNSSSVPWWDELSECGKKGVSVKPRKGDALLFWSMSPDAELDPFSLHGGC  236

Query  363  PVIKGNKWSXTKXMRVREY  307
            PVIKGNKWS TK M +REY
Sbjct  237  PVIKGNKWSATKWMHLREY  255



>emb|CDX69169.1| BnaC01g02840D [Brassica napus]
Length=292

 Score =   231 bits (590),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 106/139 (76%), Positives = 119/139 (86%), Gaps = 0/139 (0%)
 Frame = -2

Query  720  RIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEEG  541
            +I+DFTFIP E+GE LQ+LHYEVGQKYEPH+DYF D+ N K GGQR+ATV MYLSD++EG
Sbjct  153  KISDFTFIPVENGESLQVLHYEVGQKYEPHHDYFTDELNVKRGGQRVATVLMYLSDIDEG  212

Query  540  GETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGCP  361
            GETVFP AKGNIS VPW NEL +CGK GLSV PK  DALL WSM+PDGSLDPSSLHGGCP
Sbjct  213  GETVFPLAKGNISDVPWWNELSQCGKEGLSVLPKKRDALLFWSMRPDGSLDPSSLHGGCP  272

Query  360  VIKGNKWSXTKXMRVREYK  304
            VIKGNKWS TK + V EY+
Sbjct  273  VIKGNKWSSTKWLHVHEYR  291



>gb|KCW70504.1| hypothetical protein EUGRSUZ_F03711 [Eucalyptus grandis]
Length=284

 Score =   230 bits (587),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 106/141 (75%), Positives = 119/141 (84%), Gaps = 0/141 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRIADFT IP EHGEGLQIL Y  GQKY+ H+DYF D +NT+NGGQR+AT+ MYLSDVEE
Sbjct  144  KRIADFTHIPVEHGEGLQILQYGHGQKYDAHHDYFSDSFNTRNGGQRMATMLMYLSDVEE  203

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGETVFP+AK N SAVPW NEL ECGK GLSVKPKMG+A+L WSMKPDG+LDP+SLHG C
Sbjct  204  GGETVFPAAKANFSAVPWWNELSECGKRGLSVKPKMGNAVLFWSMKPDGTLDPTSLHGAC  263

Query  363  PVIKGNKWSXTKXMRVREYKA  301
            PVIKG KWS  K MRV+ Y+ 
Sbjct  264  PVIKGTKWSAPKWMRVQNYRV  284



>ref|NP_001064962.1| Os10g0497800 [Oryza sativa Japonica Group]
 gb|ABB47828.1| prolyl 4-hydroxylase alpha subunit, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF26876.1| Os10g0497800 [Oryza sativa Japonica Group]
 dbj|BAH00081.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC67248.1| hypothetical protein OsI_34188 [Oryza sativa Indica Group]
Length=321

 Score =   231 bits (589),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 110/140 (79%), Positives = 125/140 (89%), Gaps = 0/140 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRI+D+TFIP E+GEGLQ+LHYEVGQKYEPH+DYF D++NTKNGGQRIAT+ MYLSDVEE
Sbjct  181  KRISDYTFIPVENGEGLQVLHYEVGQKYEPHFDYFHDEFNTKNGGQRIATLLMYLSDVEE  240

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGET+FPS+K N S+ P+ NEL EC K GL+VKPKMGDALL WSM+PDGSLD +SLHGGC
Sbjct  241  GGETIFPSSKANSSSSPFYNELSECAKKGLAVKPKMGDALLFWSMRPDGSLDATSLHGGC  300

Query  363  PVIKGNKWSXTKXMRVREYK  304
            PVIKGNKWS TK MRV EYK
Sbjct  301  PVIKGNKWSSTKWMRVHEYK  320



>ref|XP_002970251.1| hypothetical protein SELMODRAFT_411114 [Selaginella moellendorffii]
 gb|EFJ28381.1| hypothetical protein SELMODRAFT_411114 [Selaginella moellendorffii]
Length=256

 Score =   229 bits (583),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 107/139 (77%), Positives = 117/139 (84%), Gaps = 0/139 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            +RIA FTFIP EHGEGLQ+LHYEVGQKY+ H+DYF D  NTKNGGQR+ATV MYLSDVEE
Sbjct  117  ERIAKFTFIPKEHGEGLQVLHYEVGQKYDAHHDYFHDKVNTKNGGQRVATVLMYLSDVEE  176

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGETVFPSAK N S+VPW +EL EC K G+SVKP+ GDALL WSM PD  LDP SLHGGC
Sbjct  177  GGETVFPSAKVNSSSVPWWDELSECAKKGVSVKPRKGDALLFWSMSPDAELDPFSLHGGC  236

Query  363  PVIKGNKWSXTKXMRVREY  307
            PVIKGNKWS TK M +REY
Sbjct  237  PVIKGNKWSATKWMHLREY  255



>gb|KJB43228.1| hypothetical protein B456_007G190600 [Gossypium raimondii]
Length=266

 Score =   229 bits (584),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 105/118 (89%), Positives = 112/118 (95%), Gaps = 0/118 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            +RIADFTFIP EHGEGLQ+LHYEVGQKYEPH+DYF+D++NTKNGGQRIATV MYLSDVEE
Sbjct  149  QRIADFTFIPVEHGEGLQVLHYEVGQKYEPHFDYFMDEFNTKNGGQRIATVLMYLSDVEE  208

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHG  370
            GGETVFPSAKGNISAVPW NEL ECGKGGLSVKPKMGDALL WSMKPD +LDPSSLHG
Sbjct  209  GGETVFPSAKGNISAVPWWNELSECGKGGLSVKPKMGDALLFWSMKPDATLDPSSLHG  266



>emb|CDX75528.1| BnaA01g01740D [Brassica napus]
Length=292

 Score =   229 bits (585),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 105/138 (76%), Positives = 118/138 (86%), Gaps = 0/138 (0%)
 Frame = -2

Query  720  RIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEEG  541
            +I+DFTFIP E+GE LQ+LHYEVGQKYEPH+DYF D++N K GGQR+ATV MYLS+VEEG
Sbjct  153  KISDFTFIPVENGESLQVLHYEVGQKYEPHHDYFTDEFNVKRGGQRVATVLMYLSEVEEG  212

Query  540  GETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGCP  361
            GETVFP AKGNIS VPW NEL +CGK GLSV PK  DALL WSM+PDGSLDPSSLHGGCP
Sbjct  213  GETVFPLAKGNISDVPWWNELSQCGKEGLSVLPKKRDALLFWSMRPDGSLDPSSLHGGCP  272

Query  360  VIKGNKWSXTKXMRVREY  307
            VI+GNKWS TK +   EY
Sbjct  273  VIRGNKWSSTKWLHAHEY  290



>ref|XP_003629236.1| Prolyl 4-hydroxylase alpha-2 subunit [Medicago truncatula]
 gb|AET03712.1| prolyl 4-hydroxylase alpha-like protein [Medicago truncatula]
Length=326

 Score =   230 bits (587),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 104/140 (74%), Positives = 119/140 (85%), Gaps = 0/140 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            +RIADFTFIP EHGE   +LHYEVGQKYEPHYDYF+D ++T   GQRIAT+ MYLSDVEE
Sbjct  186  RRIADFTFIPVEHGENFNVLHYEVGQKYEPHYDYFMDTFSTTYAGQRIATMLMYLSDVEE  245

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGETVFP+AKGN S+VPW NEL +CGKGGLS+KPKMG+A+L WSMKPD +LDPSSLHG C
Sbjct  246  GGETVFPNAKGNFSSVPWWNELSDCGKGGLSIKPKMGNAILFWSMKPDATLDPSSLHGAC  305

Query  363  PVIKGNKWSXTKXMRVREYK  304
            PVIKG+KW   K M V E+K
Sbjct  306  PVIKGDKWLCAKWMHVGEFK  325



>ref|XP_002866777.1| oxidoreductase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH43036.1| oxidoreductase [Arabidopsis lyrata subsp. lyrata]
Length=266

 Score =   226 bits (577),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 102/118 (86%), Positives = 110/118 (93%), Gaps = 0/118 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRI+DFTFIP EHGEGLQ+LHYE+GQKYEPHYDYF+D+YNT+NGGQRIATV MYLSDVEE
Sbjct  148  KRISDFTFIPVEHGEGLQVLHYEIGQKYEPHYDYFMDEYNTRNGGQRIATVLMYLSDVEE  207

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHG  370
            GGETVFP+AKGN SAVPW NEL ECGKGGLSVKPKMGDALL WSM PD +LDPSSLHG
Sbjct  208  GGETVFPAAKGNYSAVPWWNELSECGKGGLSVKPKMGDALLFWSMTPDATLDPSSLHG  265



>dbj|BAB10411.1| prolyl 4-hydroxylase, alpha subunit-like protein [Arabidopsis 
thaliana]
Length=267

 Score =   226 bits (577),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 102/118 (86%), Positives = 110/118 (93%), Gaps = 0/118 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRI+DFTFIP EHGEGLQ+LHYE+GQKYEPHYDYF+D+YNT+NGGQRIATV MYLSDVEE
Sbjct  149  KRISDFTFIPVEHGEGLQVLHYEIGQKYEPHYDYFMDEYNTRNGGQRIATVLMYLSDVEE  208

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHG  370
            GGETVFP+AKGN SAVPW NEL ECGKGGLSVKPKMGDALL WSM PD +LDPSSLHG
Sbjct  209  GGETVFPAAKGNYSAVPWWNELSECGKGGLSVKPKMGDALLFWSMTPDATLDPSSLHG  266



>ref|XP_009149485.1| PREDICTED: prolyl 4-hydroxylase 5-like isoform X1 [Brassica rapa]
 ref|XP_009149555.1| PREDICTED: prolyl 4-hydroxylase 5-like isoform X1 [Brassica rapa]
Length=292

 Score =   224 bits (571),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 103/138 (75%), Positives = 116/138 (84%), Gaps = 0/138 (0%)
 Frame = -2

Query  720  RIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEEG  541
            +I+DFTFIP E+GE LQ+LHYEVGQKYEPH+DYF D++N K GGQR+ATV MYLS+VEEG
Sbjct  153  KISDFTFIPVENGESLQVLHYEVGQKYEPHHDYFTDEFNVKRGGQRVATVLMYLSEVEEG  212

Query  540  GETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGCP  361
            GETVFP AKGNIS VPW NEL +CGK GLSV PK  DALL WS +P GSLDPSSLHGGCP
Sbjct  213  GETVFPLAKGNISDVPWWNELSQCGKEGLSVLPKKRDALLFWSRRPHGSLDPSSLHGGCP  272

Query  360  VIKGNKWSXTKXMRVREY  307
            VI+GNKWS TK +   EY
Sbjct  273  VIRGNKWSSTKWLHAHEY  290



>ref|XP_009400627.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Musa acuminata subsp. 
malaccensis]
Length=131

 Score =   218 bits (556),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 99/130 (76%), Positives = 115/130 (88%), Gaps = 0/130 (0%)
 Frame = -2

Query  690  EHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEEGGETVFPSAKG  511
            EHGEGLQ+LHYEVGQKYEPHYDYF+D++NT+NGGQR+AT+ MYLSDVEEGGETVFPSAK 
Sbjct  2    EHGEGLQVLHYEVGQKYEPHYDYFVDEFNTRNGGQRLATLLMYLSDVEEGGETVFPSAKV  61

Query  510  NISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGCPVIKGNKWSXT  331
              S++P   EL ECGK GLS+KPKMGDALL WS +PD +LDPSSLHGGCPVI+GNKWS T
Sbjct  62   FSSSLPRYTELSECGKKGLSIKPKMGDALLFWSTRPDATLDPSSLHGGCPVIRGNKWSST  121

Query  330  KXMRVREYKA  301
            K M +RE++A
Sbjct  122  KWMHIREFRA  131



>gb|KJB48236.1| hypothetical protein B456_008G061800 [Gossypium raimondii]
Length=266

 Score =   222 bits (566),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 104/118 (88%), Positives = 109/118 (92%), Gaps = 0/118 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRIADFTFIP EHGEGLQ+LHYEVGQKYEPHYDYF D+ NT+NGGQRIATV MYLSDVEE
Sbjct  149  KRIADFTFIPVEHGEGLQVLHYEVGQKYEPHYDYFKDEVNTRNGGQRIATVLMYLSDVEE  208

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHG  370
            GGETVFPSAKGNISAVPW NEL ECGKGGLSV+PKMGDALL WSMKPD +LD SSLHG
Sbjct  209  GGETVFPSAKGNISAVPWWNELSECGKGGLSVRPKMGDALLFWSMKPDATLDLSSLHG  266



>dbj|BAE92293.1| putative prolyl 4-hydroxylase, alpha subunit [Cryptomeria japonica]
Length=302

 Score =   222 bits (565),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 102/139 (73%), Positives = 116/139 (83%), Gaps = 0/139 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRIADF+ IP EHGEGL +LHYEV QKY+ HYDYF D  N KNGGQR AT+ MYLSDVE+
Sbjct  162  KRIADFSHIPVEHGEGLHVLHYEVEQKYDAHYDYFSDTINVKNGGQRGATMLMYLSDVEK  221

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGETVFP +K N S+VPW +EL ECG+ GLSV+PKMGDALL WS+KPD SLDPSSLHG C
Sbjct  222  GGETVFPQSKVNSSSVPWWDELSECGRSGLSVRPKMGDALLFWSVKPDASLDPSSLHGSC  281

Query  363  PVIKGNKWSXTKXMRVREY  307
            PVI+GNKWS TK MR+ +Y
Sbjct  282  PVIQGNKWSATKWMRLNKY  300



>ref|XP_003629231.1| Prolyl 4-hydroxylase alpha-2 subunit [Medicago truncatula]
 gb|AET03707.1| prolyl 4-hydroxylase alpha-like protein [Medicago truncatula]
Length=279

 Score =   221 bits (562),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 102/136 (75%), Positives = 117/136 (86%), Gaps = 0/136 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRIADFTFIP EHGE + ILHYEVGQKY+ H DYF D+ NTK+GG+RIAT+ MYLSDVEE
Sbjct  141  KRIADFTFIPVEHGEDVNILHYEVGQKYDFHTDYFEDEVNTKHGGERIATMLMYLSDVEE  200

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGETVFPSAKGN S+VPW NEL +CGK GLS+KPKMG+A+L W MKPD ++DP S+HG C
Sbjct  201  GGETVFPSAKGNFSSVPWWNELSDCGKKGLSIKPKMGNAILFWGMKPDATVDPLSVHGAC  260

Query  363  PVIKGNKWSXTKXMRV  316
            PVIKG+KWS TK MRV
Sbjct  261  PVIKGDKWSCTKWMRV  276



>ref|XP_006425362.1| hypothetical protein CICLE_v10026208mg [Citrus clementina]
 gb|ESR38602.1| hypothetical protein CICLE_v10026208mg [Citrus clementina]
Length=265

 Score =   220 bits (561),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 99/118 (84%), Positives = 110/118 (93%), Gaps = 0/118 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRIADFTF+P E+GEGLQ+LHYE GQKYEPH+DYF+D++NTKNGGQR+ATV MYLSDVEE
Sbjct  148  KRIADFTFLPLENGEGLQVLHYEAGQKYEPHFDYFMDEFNTKNGGQRMATVLMYLSDVEE  207

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHG  370
            GGETVFP+A+GNISAVPW NEL ECGK GLS+KPKMGDALL WSMKPD SLDPSSLHG
Sbjct  208  GGETVFPNAQGNISAVPWWNELSECGKTGLSIKPKMGDALLFWSMKPDASLDPSSLHG  265



>gb|KDO71356.1| hypothetical protein CISIN_1g023009mg [Citrus sinensis]
Length=265

 Score =   219 bits (558),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 99/118 (84%), Positives = 109/118 (92%), Gaps = 0/118 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRIADFTF P E+GEGLQ+LHYE GQKYEPH+DYF+D++NTKNGGQR+ATV MYLSDVEE
Sbjct  148  KRIADFTFFPLENGEGLQVLHYEAGQKYEPHFDYFMDEFNTKNGGQRMATVLMYLSDVEE  207

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHG  370
            GGETVFP+A+GNISAVPW NEL ECGK GLS+KPKMGDALL WSMKPD SLDPSSLHG
Sbjct  208  GGETVFPNAQGNISAVPWWNELSECGKTGLSIKPKMGDALLFWSMKPDASLDPSSLHG  265



>ref|XP_001754091.1| predicted protein [Physcomitrella patens]
 gb|EDQ80992.1| predicted protein, partial [Physcomitrella patens]
Length=214

 Score =   216 bits (551),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 101/141 (72%), Positives = 116/141 (82%), Gaps = 0/141 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRIADFTFIPAE GEGLQ+L Y+  +KYEPHYDYF D YNTKNGGQRIATV MYLS+VEE
Sbjct  74   KRIADFTFIPAEQGEGLQVLQYKESEKYEPHYDYFHDAYNTKNGGQRIATVLMYLSNVEE  133

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGETVFP+A+ N + VP  ++L EC + GLSV+P+MGDALL WSMKPD +LD +SLHGGC
Sbjct  134  GGETVFPAAQVNKTEVPDWDKLSECAQKGLSVRPRMGDALLFWSMKPDATLDSTSLHGGC  193

Query  363  PVIKGNKWSXTKXMRVREYKA  301
            PVIKG KWS TK + V  Y A
Sbjct  194  PVIKGTKWSATKWLHVENYAA  214



>ref|XP_003520111.1| PREDICTED: prolyl 4-hydroxylase subunit alpha-1-like [Glycine 
max]
Length=286

 Score =   218 bits (556),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 98/140 (70%), Positives = 115/140 (82%), Gaps = 0/140 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRIAD TFIP E+GE + ++HYEVGQ Y+PHYDYF+DD+N +NGGQRIAT+ MYLS+VEE
Sbjct  145  KRIADVTFIPIENGEPIYVIHYEVGQYYDPHYDYFIDDFNIENGGQRIATMLMYLSNVEE  204

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGET+FP AK N S+VPW NEL  CGK GLS+KPKMGDALL WSMKP+ +LD  +LH  C
Sbjct  205  GGETMFPRAKANFSSVPWWNELSNCGKMGLSIKPKMGDALLFWSMKPNATLDALTLHSAC  264

Query  363  PVIKGNKWSXTKXMRVREYK  304
            PVIKGNKWS TK M   E+K
Sbjct  265  PVIKGNKWSCTKWMHPTEFK  284



>gb|AGP04974.1| prolyl-4-hydroxylase 5 [Physcomitrella patens]
Length=280

 Score =   216 bits (551),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 101/141 (72%), Positives = 116/141 (82%), Gaps = 0/141 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRIADFTFIPAE GEGLQ+L Y+  +KYEPHYDYF D YNTKNGGQRIATV MYLS+VEE
Sbjct  140  KRIADFTFIPAEQGEGLQVLQYKESEKYEPHYDYFHDAYNTKNGGQRIATVLMYLSNVEE  199

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGETVFP+A+ N + VP  ++L EC + GLSV+P+MGDALL WSMKPD +LD +SLHGGC
Sbjct  200  GGETVFPAAQVNKTEVPDWDKLSECAQKGLSVRPRMGDALLFWSMKPDATLDSTSLHGGC  259

Query  363  PVIKGNKWSXTKXMRVREYKA  301
            PVIKG KWS TK + V  Y A
Sbjct  260  PVIKGTKWSATKWLHVENYAA  280



>gb|KJB59734.1| hypothetical protein B456_009G269000 [Gossypium raimondii]
Length=294

 Score =   217 bits (552),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 96/121 (79%), Positives = 111/121 (92%), Gaps = 0/121 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRIAD++FIP EHGEGLQ+LHYEVGQKY+ H+DYFLD++NTKNGGQR+AT+ MYLSDVEE
Sbjct  147  KRIADYSFIPVEHGEGLQVLHYEVGQKYDAHFDYFLDEFNTKNGGQRMATMLMYLSDVEE  206

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGET+FP+AKGNIS+VPW NEL ECGK GL+VKPKMGDALL WSM+PD +LDPSSLHG  
Sbjct  207  GGETIFPAAKGNISSVPWWNELSECGKQGLAVKPKMGDALLFWSMRPDATLDPSSLHGLL  266

Query  363  P  361
            P
Sbjct  267  P  267



>ref|XP_002989495.1| hypothetical protein SELMODRAFT_129912, partial [Selaginella 
moellendorffii]
 gb|EFJ09371.1| hypothetical protein SELMODRAFT_129912, partial [Selaginella 
moellendorffii]
Length=213

 Score =   214 bits (545),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 96/139 (69%), Positives = 114/139 (82%), Gaps = 0/139 (0%)
 Frame = -2

Query  720  RIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEEG  541
            +IA  TFIP +HGEG+Q+LHYE GQKY+ H+D+F D  NT+NGGQRIAT+ MYL+DVEEG
Sbjct  74   KIAKLTFIPKDHGEGIQVLHYEPGQKYDAHHDFFYDTVNTRNGGQRIATLLMYLTDVEEG  133

Query  540  GETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGCP  361
            GETVFP +  N S++PW N+L ECG+ G+SV+PK GDALL WSM PD  LD SSLHGGCP
Sbjct  134  GETVFPKSAKNSSSLPWHNQLSECGRRGVSVRPKRGDALLFWSMSPDAQLDHSSLHGGCP  193

Query  360  VIKGNKWSXTKXMRVREYK  304
            VIKG+KWS TK MRV EYK
Sbjct  194  VIKGDKWSATKWMRVSEYK  212



>ref|XP_008809399.1| PREDICTED: probable prolyl 4-hydroxylase 3 isoform X3 [Phoenix 
dactylifera]
Length=267

 Score =   216 bits (550),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 98/118 (83%), Positives = 108/118 (92%), Gaps = 0/118 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRIADFTFIP EHGEGLQILHYEVGQKYEPH+DYFLD++N KNGGQRIAT+ MYLSDVEE
Sbjct  150  KRIADFTFIPVEHGEGLQILHYEVGQKYEPHFDYFLDEFNIKNGGQRIATLLMYLSDVEE  209

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHG  370
            GGETVFP+A+ N S++PW NEL ECGK GLSVKPKMGDALL WSM+PD +LDPSSLHG
Sbjct  210  GGETVFPAARVNSSSLPWYNELSECGKKGLSVKPKMGDALLFWSMRPDATLDPSSLHG  267



>ref|XP_008456383.1| PREDICTED: prolyl 4-hydroxylase subunit alpha-1-like isoform 
X1 [Cucumis melo]
Length=290

 Score =   216 bits (551),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 99/118 (84%), Positives = 108/118 (92%), Gaps = 0/118 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRIADFTFIP EHGEGLQILHYEVGQKY+ HYDYF+D+YN K GGQR+AT+ MYLSDVEE
Sbjct  145  KRIADFTFIPIEHGEGLQILHYEVGQKYDAHYDYFVDEYNIKKGGQRMATLLMYLSDVEE  204

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHG  370
            GGETVFP+AKGN S+VPW NEL ECGKGGLSVKPKMGDALL WSMKPD +LDP+SLHG
Sbjct  205  GGETVFPAAKGNFSSVPWWNELSECGKGGLSVKPKMGDALLFWSMKPDATLDPTSLHG  262



>ref|XP_007017904.1| 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily 
protein isoform 3 [Theobroma cacao]
 gb|EOY15129.1| 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily 
protein isoform 3 [Theobroma cacao]
Length=284

 Score =   216 bits (550),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 97/118 (82%), Positives = 109/118 (92%), Gaps = 0/118 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRIAD+TFIP EHGEGLQ+LHYEVGQKY+ H+DYFLD++NTKNGGQR+AT+ MYLSDVEE
Sbjct  147  KRIADYTFIPVEHGEGLQVLHYEVGQKYDAHFDYFLDEFNTKNGGQRMATMLMYLSDVEE  206

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHG  370
            GGET+FP+AKGN SAVPW NEL ECGK GLSVKPKMGDALL WSM+PD +LDPSSLHG
Sbjct  207  GGETIFPAAKGNFSAVPWWNELSECGKQGLSVKPKMGDALLFWSMRPDATLDPSSLHG  264



>ref|XP_002964648.1| hypothetical protein SELMODRAFT_82355, partial [Selaginella moellendorffii]
 gb|EFJ34981.1| hypothetical protein SELMODRAFT_82355, partial [Selaginella moellendorffii]
Length=225

 Score =   214 bits (544),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 96/139 (69%), Positives = 114/139 (82%), Gaps = 0/139 (0%)
 Frame = -2

Query  720  RIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEEG  541
            +IA  TFIP +HGEG+Q+LHYE GQKY+ H+D+F D  NT+NGGQRIAT+ MYL+DVEEG
Sbjct  86   KIAKLTFIPKDHGEGIQVLHYEPGQKYDAHHDFFYDTVNTRNGGQRIATLLMYLTDVEEG  145

Query  540  GETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGCP  361
            GETVFP +  N S++PW N+L ECG+ G+SV+PK GDALL WSM PD  LD SSLHGGCP
Sbjct  146  GETVFPKSAKNSSSLPWHNQLSECGRRGVSVRPKRGDALLFWSMSPDAQLDHSSLHGGCP  205

Query  360  VIKGNKWSXTKXMRVREYK  304
            VIKG+KWS TK MRV EYK
Sbjct  206  VIKGDKWSATKWMRVSEYK  224



>emb|CDY41627.1| BnaC03g62570D [Brassica napus]
Length=284

 Score =   215 bits (548),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 103/140 (74%), Positives = 113/140 (81%), Gaps = 4/140 (3%)
 Frame = -2

Query  720  RIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEEG  541
            RI+DFTFIP E+GEGLQ+LHYEVGQKYEPH+DYF D+YN K GG RIATV MYLSDVEEG
Sbjct  149  RISDFTFIPVENGEGLQVLHYEVGQKYEPHHDYFSDEYNVKRGGNRIATVLMYLSDVEEG  208

Query  540  GETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGCP  361
            GETVFP+AKGNIS VPW NEL +CG+ GLSV PK  DALL WS +PD +LDPSSLH    
Sbjct  209  GETVFPAAKGNISDVPWWNELSQCGREGLSVLPKKRDALLFWSARPDATLDPSSLH----  264

Query  360  VIKGNKWSXTKXMRVREYKA  301
            VIKGNKWS TK     EY A
Sbjct  265  VIKGNKWSSTKWFHFNEYTA  284



>ref|XP_001782374.1| predicted protein [Physcomitrella patens]
 gb|EDQ52828.1| predicted protein, partial [Physcomitrella patens]
Length=211

 Score =   213 bits (542),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 98/139 (71%), Positives = 112/139 (81%), Gaps = 0/139 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRIADFTFIP E GEGLQ+L Y   +KYEPHYDYF D +NTKNGGQRIATV MYLSDVE+
Sbjct  73   KRIADFTFIPVEQGEGLQVLQYRESEKYEPHYDYFHDAFNTKNGGQRIATVLMYLSDVEK  132

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGETVFP++K N S VP  ++  EC K GLSV+P+MGDALL WSMKPD  LDP+SLHG C
Sbjct  133  GGETVFPASKVNASEVPDWDQRSECAKRGLSVRPRMGDALLFWSMKPDAKLDPTSLHGAC  192

Query  363  PVIKGNKWSXTKXMRVREY  307
            PVI+G KWS TK + V +Y
Sbjct  193  PVIQGTKWSATKWLHVEKY  211



>gb|AGP04976.1| prolyl-4-hydroxylase 6_b [Physcomitrella patens]
Length=283

 Score =   215 bits (547),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 99/141 (70%), Positives = 113/141 (80%), Gaps = 0/141 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRIADFTFIP E GEGLQ+L Y   +KYEPHYDYF D +NTKNGGQRIATV MYLSDVE+
Sbjct  142  KRIADFTFIPVEQGEGLQVLQYRESEKYEPHYDYFHDAFNTKNGGQRIATVLMYLSDVEK  201

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGETVFP++K N S VP  ++  EC K GLSV+P+MGDALL WSMKPD  LDP+SLHG C
Sbjct  202  GGETVFPASKVNASEVPDWDQRSECAKRGLSVRPRMGDALLFWSMKPDAKLDPTSLHGAC  261

Query  363  PVIKGNKWSXTKXMRVREYKA  301
            PVI+G KWS TK + V +Y A
Sbjct  262  PVIQGTKWSATKWLHVEKYAA  282



>ref|XP_003520105.1| PREDICTED: prolyl 4-hydroxylase subunit alpha-1-like [Glycine 
max]
Length=296

 Score =   215 bits (548),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 99/139 (71%), Positives = 116/139 (83%), Gaps = 0/139 (0%)
 Frame = -2

Query  720  RIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEEG  541
            RIADFTFIP ++GE LQ+LHY+VG+KY PH+DYF+DD NT NGG RIAT+ MYLSDVEEG
Sbjct  157  RIADFTFIPVDNGEELQVLHYQVGEKYVPHHDYFMDDINTANGGDRIATMLMYLSDVEEG  216

Query  540  GETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGCP  361
            GETVFP AKGN S++P  NEL  CGK GLS+KPKM +ALL WS+KPD + DP SLHG CP
Sbjct  217  GETVFPDAKGNFSSMPGWNELSVCGKKGLSIKPKMRNALLFWSIKPDATYDPLSLHGSCP  276

Query  360  VIKGNKWSXTKXMRVREYK  304
            VIKGNKWS TK +R+ E+K
Sbjct  277  VIKGNKWSSTKWIRIGEHK  295



>ref|XP_010480555.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Camelina sativa]
Length=272

 Score =   212 bits (540),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 94/117 (80%), Positives = 106/117 (91%), Gaps = 0/117 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRIAD+TFIPA+HGEGLQ+LHYE GQKYEPHYDYF+D +NTKNGGQR+AT+ MYLSDVEE
Sbjct  151  KRIADYTFIPADHGEGLQVLHYEAGQKYEPHYDYFVDTFNTKNGGQRMATMLMYLSDVEE  210

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLH  373
            GGETVFPSA  N S+VPW NEL ECGK GLSVKP+MGDALL WSM+PD +LDP+SLH
Sbjct  211  GGETVFPSANMNFSSVPWYNELSECGKKGLSVKPRMGDALLFWSMRPDATLDPTSLH  267



>gb|AGP04975.1| prolyl-4-hydroxylase 6_a [Physcomitrella patens]
Length=343

 Score =   213 bits (543),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 99/141 (70%), Positives = 113/141 (80%), Gaps = 0/141 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRIADFTFIP E GEGLQ+L Y   +KYEPHYDYF D +NTKNGGQRIATV MYLSDVE+
Sbjct  202  KRIADFTFIPVEQGEGLQVLQYRESEKYEPHYDYFHDAFNTKNGGQRIATVLMYLSDVEK  261

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGETVFP++K N S VP  ++  EC K GLSV+P+MGDALL WSMKPD  LDP+SLHG C
Sbjct  262  GGETVFPASKVNASEVPDWDQRSECAKRGLSVRPRMGDALLFWSMKPDAKLDPTSLHGAC  321

Query  363  PVIKGNKWSXTKXMRVREYKA  301
            PVI+G KWS TK + V +Y A
Sbjct  322  PVIQGTKWSATKWLHVEKYAA  342



>ref|XP_006598732.1| PREDICTED: uncharacterized protein LOC100782154 isoform X1 [Glycine 
max]
 ref|XP_006598733.1| PREDICTED: uncharacterized protein LOC100782154 isoform X2 [Glycine 
max]
 gb|KHN35553.1| Prolyl 4-hydroxylase subunit alpha-1 [Glycine soja]
Length=295

 Score =   209 bits (533),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 96/141 (68%), Positives = 110/141 (78%), Gaps = 0/141 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRIAD TFIP EHGE L ++ Y VGQ YEPH DYF ++++  NGGQRIAT+ MYLS+VE 
Sbjct  155  KRIADVTFIPIEHGEPLHVIRYAVGQYYEPHVDYFEEEFSLVNGGQRIATMLMYLSNVEG  214

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGETVFP A  N S+VPW NEL ECG+ GLS+KPKMGDALL WSMKPD +LDP +LH  C
Sbjct  215  GGETVFPIANANFSSVPWWNELSECGQTGLSIKPKMGDALLFWSMKPDATLDPLTLHRAC  274

Query  363  PVIKGNKWSXTKXMRVREYKA  301
            PVIKGNKWS TK M   EY+ 
Sbjct  275  PVIKGNKWSCTKWMHANEYET  295



>gb|KDO75954.1| hypothetical protein CISIN_1g0230532mg [Citrus sinensis]
Length=266

 Score =   208 bits (530),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 93/118 (79%), Positives = 105/118 (89%), Gaps = 0/118 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRIADFTFIP EHGEG+Q+LHYEVGQKY+ HYDYFLD++NTKNGGQR+AT+ MYLSDVEE
Sbjct  148  KRIADFTFIPMEHGEGIQVLHYEVGQKYDAHYDYFLDEFNTKNGGQRMATLLMYLSDVEE  207

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHG  370
            GGETVFP+A  N ++V W NEL ECGK GLSVKPK GDALL WSM+PD +LDPSSLHG
Sbjct  208  GGETVFPAANANFTSVRWWNELSECGKQGLSVKPKRGDALLFWSMRPDATLDPSSLHG  265



>emb|CDY48941.1| BnaA08g04730D [Brassica napus]
Length=436

 Score =   211 bits (538),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 92/121 (76%), Positives = 108/121 (89%), Gaps = 0/121 (0%)
 Frame = -2

Query  690  EHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEEGGETVFPSAKG  511
            +HGEGLQ+LHYE GQKYEPHYDYF+D++NTKN GQR+AT+ MYL+DVEEGGETVFP+A  
Sbjct  51   DHGEGLQVLHYEEGQKYEPHYDYFVDEFNTKNEGQRMATMLMYLADVEEGGETVFPAANM  110

Query  510  NISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGCPVIKGNKWSXT  331
            N S+VPW NEL  CGK GLSVKP+MGDALL WSM+PD +LDPS+LHGGCPVI+GNKWS T
Sbjct  111  NFSSVPWYNELSACGKKGLSVKPRMGDALLFWSMRPDATLDPSNLHGGCPVIRGNKWSST  170

Query  330  K  328
            +
Sbjct  171  R  171



>ref|NP_001242181.1| uncharacterized protein LOC100782154 [Glycine max]
 gb|ACU22735.1| unknown [Glycine max]
Length=285

 Score =   203 bits (517),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 93/132 (70%), Positives = 106/132 (80%), Gaps = 0/132 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRIAD TFIP EHGE L ++ Y VGQ YEPH DYF ++++  NGGQRIAT+ MYLS+VE 
Sbjct  154  KRIADVTFIPIEHGEPLHVIRYAVGQYYEPHVDYFEEEFSLVNGGQRIATMLMYLSNVEG  213

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGETVFP A  N S+VPW NEL ECG+ GLS+KPKMGDALL WSMKPD +LDP +LH  C
Sbjct  214  GGETVFPIANANFSSVPWWNELSECGQTGLSIKPKMGDALLFWSMKPDATLDPLTLHRAC  273

Query  363  PVIKGNKWSXTK  328
            PVIKGNKWS TK
Sbjct  274  PVIKGNKWSCTK  285



>gb|EEC74283.1| hypothetical protein OsI_09531 [Oryza sativa Indica Group]
Length=376

 Score =   205 bits (522),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 92/117 (79%), Positives = 104/117 (89%), Gaps = 0/117 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRIAD+TFIP EHGEGLQ+LHYEVGQKYEPH+DYFLD+YNTKNGGQR+AT+ MYLSDVEE
Sbjct  170  KRIADYTFIPMEHGEGLQVLHYEVGQKYEPHFDYFLDEYNTKNGGQRMATLLMYLSDVEE  229

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLH  373
            GGET+FP A  N S++PW NEL EC + GL+VKPKMGDALL WSMKPD +LDP SLH
Sbjct  230  GGETIFPDANVNSSSLPWYNELSECARKGLAVKPKMGDALLFWSMKPDATLDPLSLH  286



>gb|EEE58093.1| hypothetical protein OsJ_08962 [Oryza sativa Japonica Group]
Length=387

 Score =   206 bits (523),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 92/117 (79%), Positives = 104/117 (89%), Gaps = 0/117 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRIAD+TFIP EHGEGLQ+LHYEVGQKYEPH+DYFLD+YNTKNGGQR+AT+ MYLSDVEE
Sbjct  170  KRIADYTFIPMEHGEGLQVLHYEVGQKYEPHFDYFLDEYNTKNGGQRMATLLMYLSDVEE  229

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLH  373
            GGET+FP A  N S++PW NEL EC + GL+VKPKMGDALL WSMKPD +LDP SLH
Sbjct  230  GGETIFPDANVNSSSLPWYNELSECARKGLAVKPKMGDALLFWSMKPDATLDPLSLH  286



>ref|XP_004487245.1| PREDICTED: prolyl 4-hydroxylase subunit alpha-1-like [Cicer arietinum]
Length=282

 Score =   202 bits (513),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 90/134 (67%), Positives = 110/134 (82%), Gaps = 0/134 (0%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            KRIA  + IP EHGEGLQ+LHY+VGQKY+ H D+F+D+++ ++GGQRIAT+ MYLSDVEE
Sbjct  142  KRIAQVSLIPIEHGEGLQVLHYKVGQKYDTHGDFFMDNFSVRHGGQRIATMLMYLSDVEE  201

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGET+FP A  N S+VPW N+L +CGK GLS+KPKMGDALL WSM P+ +LD SS HG C
Sbjct  202  GGETMFPYANRNFSSVPWWNQLSDCGKLGLSIKPKMGDALLFWSMNPNATLDLSSAHGSC  261

Query  363  PVIKGNKWSXTKXM  322
            PVIKG+KWS  K M
Sbjct  262  PVIKGDKWSCAKWM  275



>ref|XP_003629235.1| Prolyl 4-hydroxylase alpha-2 subunit [Medicago truncatula]
Length=196

 Score =   197 bits (500),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 94/139 (68%), Positives = 109/139 (78%), Gaps = 13/139 (9%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            +RIADFTFIP E+GE + ILHYEVGQKYEPH D+F D+ NTKNGG             E+
Sbjct  67   QRIADFTFIPVENGESVNILHYEVGQKYEPHPDFFTDEINTKNGG-------------EQ  113

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGETVFP A+GN S+VPW NEL +CGK GLS+KPKMGDALL WSMKPDG+LDP S+HG C
Sbjct  114  GGETVFPFAEGNFSSVPWWNELSDCGKKGLSIKPKMGDALLFWSMKPDGTLDPLSMHGAC  173

Query  363  PVIKGNKWSXTKXMRVREY  307
            PVIKG+KWS TK MRV ++
Sbjct  174  PVIKGDKWSCTKWMRVGKW  192



>gb|AET03711.2| prolyl 4-hydroxylase alpha subunit, putative [Medicago truncatula]
Length=227

 Score =   197 bits (500),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 94/139 (68%), Positives = 109/139 (78%), Gaps = 13/139 (9%)
 Frame = -2

Query  723  KRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEE  544
            +RIADFTFIP E+GE + ILHYEVGQKYEPH D+F D+ NTKNGG             E+
Sbjct  98   QRIADFTFIPVENGESVNILHYEVGQKYEPHPDFFTDEINTKNGG-------------EQ  144

Query  543  GGETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGC  364
            GGETVFP A+GN S+VPW NEL +CGK GLS+KPKMGDALL WSMKPDG+LDP S+HG C
Sbjct  145  GGETVFPFAEGNFSSVPWWNELSDCGKKGLSIKPKMGDALLFWSMKPDGTLDPLSMHGAC  204

Query  363  PVIKGNKWSXTKXMRVREY  307
            PVIKG+KWS TK MRV ++
Sbjct  205  PVIKGDKWSCTKWMRVGKW  223



>emb|CAA21467.1| putative protein [Arabidopsis thaliana]
 emb|CAB81490.1| putative protein [Arabidopsis thaliana]
Length=307

 Score =   199 bits (505),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 90/117 (77%), Positives = 103/117 (88%), Gaps = 0/117 (0%)
 Frame = -2

Query  720  RIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEEG  541
            RI+DFTFIP E+GEGLQ+LHYEVGQ+YEPH+DYF D++N + GGQRIATV MYLSDV+EG
Sbjct  183  RISDFTFIPPENGEGLQVLHYEVGQRYEPHHDYFFDEFNVRKGGQRIATVLMYLSDVDEG  242

Query  540  GETVFPSAKGNISAVPWXNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHG  370
            GETVFP+AKGN+S VPW +EL +CGK GLSV PK  DALL WSMKPD SLDPSSLHG
Sbjct  243  GETVFPAAKGNVSDVPWWDELSQCGKEGLSVLPKKRDALLFWSMKPDASLDPSSLHG  299



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1300407706455