BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF011F05

Length=574
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011094312.1|  PREDICTED: transcription factor MYC2               241   1e-73   Sesamum indicum [beniseed]
ref|XP_007051457.1|  Basic helix-loop-helix DNA-binding family pr...    238   4e-72   
ref|XP_009604694.1|  PREDICTED: transcription factor MYC3-like          234   1e-70   Nicotiana tomentosiformis
ref|XP_010100678.1|  hypothetical protein L484_023447                   234   2e-70   Morus notabilis
ref|XP_006362125.1|  PREDICTED: transcription factor MYC2-like          232   3e-70   Solanum tuberosum [potatoes]
gb|KDP28433.1|  hypothetical protein JCGZ_14204                         231   8e-70   Jatropha curcas
ref|XP_004248092.1|  PREDICTED: transcription factor MYC3-like          230   1e-69   Solanum lycopersicum
ref|XP_009776117.1|  PREDICTED: transcription factor MYC2-like          231   1e-69   Nicotiana sylvestris
ref|XP_010054972.1|  PREDICTED: transcription factor MYC2               231   2e-69   Eucalyptus grandis [rose gum]
ref|XP_011039030.1|  PREDICTED: transcription factor MYC2 isoform X2    228   2e-68   Populus euphratica
ref|XP_011039024.1|  PREDICTED: transcription factor MYC2 isoform X1    228   4e-68   Populus euphratica
ref|XP_004306627.1|  PREDICTED: transcription factor MYC2               227   5e-68   Fragaria vesca subsp. vesca
ref|XP_007219048.1|  hypothetical protein PRUPE_ppa004680mg             226   1e-67   Prunus persica
gb|KDO86574.1|  hypothetical protein CISIN_1g046178mg                   226   2e-67   Citrus sinensis [apfelsine]
ref|XP_006444764.1|  hypothetical protein CICLE_v10019749mg             226   2e-67   Citrus clementina [clementine]
gb|ABK94979.1|  unknown                                                 225   3e-67   Populus trichocarpa [western balsam poplar]
ref|XP_002301432.1|  basic helix-loop-helix family protein              225   3e-67   Populus trichocarpa [western balsam poplar]
ref|XP_002266775.1|  PREDICTED: transcription factor MYC2-like          223   2e-66   Vitis vinifera
gb|KJB41602.1|  hypothetical protein B456_007G111800                    221   5e-66   Gossypium raimondii
ref|XP_009375455.1|  PREDICTED: transcription factor MYC2-like          220   2e-65   Pyrus x bretschneideri [bai li]
ref|XP_008370350.1|  PREDICTED: transcription factor MYC2               219   4e-65   
gb|KJB24531.1|  hypothetical protein B456_004G149500                    218   1e-64   Gossypium raimondii
ref|XP_007135301.1|  hypothetical protein PHAVU_010G117900g             217   2e-64   Phaseolus vulgaris [French bean]
ref|XP_011023113.1|  PREDICTED: transcription factor MYC2-like          216   4e-64   Populus euphratica
gb|KHN15898.1|  Transcription factor bHLH14                             216   5e-64   Glycine soja [wild soybean]
ref|XP_003548195.1|  PREDICTED: transcription factor MYC2-like          216   5e-64   Glycine max [soybeans]
gb|KJB09595.1|  hypothetical protein B456_001G151700                    216   1e-63   Gossypium raimondii
ref|XP_002529968.1|  transcription factor, putative                     208   3e-63   
ref|XP_003528771.1|  PREDICTED: transcription factor MYC2-like          213   9e-63   Glycine max [soybeans]
ref|XP_009592442.1|  PREDICTED: transcription factor MYC2-like          211   3e-62   Nicotiana tomentosiformis
ref|XP_002529965.1|  DNA binding protein, putative                      210   9e-62   Ricinus communis
gb|KCW83845.1|  hypothetical protein EUGRSUZ_B00713                     211   9e-62   Eucalyptus grandis [rose gum]
ref|XP_010031905.1|  PREDICTED: transcription factor MYC2-like          210   9e-62   Eucalyptus grandis [rose gum]
ref|XP_010909816.1|  PREDICTED: transcription factor MYC4-like          209   1e-61   Elaeis guineensis
gb|KEH18600.1|  basic helix loop helix (bHLH) family transcriptio...    205   5e-60   Medicago truncatula
ref|XP_009766909.1|  PREDICTED: transcription factor MYC2               203   2e-59   Nicotiana sylvestris
gb|KJB49615.1|  hypothetical protein B456_008G128800                    202   1e-58   Gossypium raimondii
ref|XP_009623539.1|  PREDICTED: transcription factor MYC3-like is...    199   1e-57   Nicotiana tomentosiformis
ref|XP_008345582.1|  PREDICTED: transcription factor bHLH14-like        200   1e-57   
ref|XP_009623534.1|  PREDICTED: transcription factor MYC2-like is...    199   2e-57   
ref|XP_007039384.1|  Basic helix-loop-helix DNA-binding family pr...    197   6e-57   
emb|CDP08631.1|  unnamed protein product                                194   4e-56   Coffea canephora [robusta coffee]
ref|XP_004166899.1|  PREDICTED: transcription factor ATR2-like          193   1e-55   
ref|XP_004510627.1|  PREDICTED: transcription factor bHLH14-like        194   1e-55   Cicer arietinum [garbanzo]
ref|XP_004140617.1|  PREDICTED: transcription factor ATR2-like          192   2e-55   Cucumis sativus [cucumbers]
ref|XP_002320222.1|  basic helix-loop-helix family protein              190   1e-54   
gb|KJB52372.1|  hypothetical protein B456_008G259000                    191   1e-54   Gossypium raimondii
ref|XP_010267440.1|  PREDICTED: transcription factor MYC2               191   3e-54   Nelumbo nucifera [Indian lotus]
gb|ACF05947.1|  MYC1                                                    190   4e-54   Hevea brasiliensis [jebe]
ref|XP_004230022.1|  PREDICTED: transcription factor MYC2-like is...    189   5e-54   Solanum lycopersicum
ref|XP_004230021.1|  PREDICTED: transcription factor MYC2-like is...    189   6e-54   Solanum lycopersicum
ref|XP_006357552.1|  PREDICTED: transcription factor MYC2-like          189   7e-54   Solanum tuberosum [potatoes]
ref|XP_009412473.1|  PREDICTED: transcription factor MYC3-like          187   5e-53   Musa acuminata subsp. malaccensis [pisang utan]
emb|CBI34590.3|  unnamed protein product                                183   5e-53   Vitis vinifera
ref|XP_002518914.1|  DNA binding protein, putative                      186   1e-52   Ricinus communis
ref|XP_009775258.1|  PREDICTED: transcription factor MYC2-like          184   2e-52   Nicotiana sylvestris
ref|XP_006476285.1|  PREDICTED: transcription factor MYC2-like          186   2e-52   Citrus sinensis [apfelsine]
gb|KDO76730.1|  hypothetical protein CISIN_1g010053mg                   186   2e-52   Citrus sinensis [apfelsine]
ref|XP_006439218.1|  hypothetical protein CICLE_v10019730mg             186   2e-52   
gb|KEH18599.1|  basic helix loop helix (bHLH) family transcriptio...    184   3e-52   Medicago truncatula
gb|KJB24138.1|  hypothetical protein B456_004G129600                    184   4e-52   Gossypium raimondii
ref|XP_002279973.1|  PREDICTED: transcription factor MYC4               184   4e-52   Vitis vinifera
gb|ACF19982.1|  MYC2                                                    183   1e-51   Hevea brasiliensis [jebe]
ref|XP_011026782.1|  PREDICTED: transcription factor MYC2-like          183   1e-51   Populus euphratica
gb|AEG74015.1|  lMYC5                                                   182   3e-51   Hevea brasiliensis [jebe]
ref|XP_010531704.1|  PREDICTED: transcription factor MYC2-like          184   4e-51   Tarenaya hassleriana [spider flower]
ref|XP_006830285.1|  hypothetical protein AMTR_s00121p00026620          182   4e-51   Amborella trichopoda
gb|AGO03813.1|  JAMYC2                                                  177   5e-51   Taxus cuspidata [ichii]
ref|XP_006343781.1|  PREDICTED: transcription factor MYC2-like          179   2e-50   
gb|AEG74013.1|  lMYC3                                                   180   3e-50   Hevea brasiliensis [jebe]
ref|XP_008233076.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...    180   3e-50   Prunus mume [ume]
ref|XP_011022409.1|  PREDICTED: transcription factor MYC2-like          179   3e-50   Populus euphratica
gb|ADK91082.1|  LMYC2                                                   180   3e-50   Hevea brasiliensis [jebe]
gb|KJB21076.1|  hypothetical protein B456_003G182100                    181   4e-50   Gossypium raimondii
ref|XP_011082365.1|  PREDICTED: transcription factor MYC4-like          182   5e-50   Sesamum indicum [beniseed]
ref|XP_002299425.1|  hypothetical protein POPTR_0001s11400g             179   6e-50   Populus trichocarpa [western balsam poplar]
ref|XP_002893732.1|  ATMYC2                                             181   7e-50   Arabidopsis lyrata subsp. lyrata
ref|NP_174541.1|  transcription factor MYC2                             181   8e-50   Arabidopsis thaliana [mouse-ear cress]
gb|AAL55713.1|AF251691_1  putative transcription factor BHLH6           181   8e-50   Arabidopsis thaliana [mouse-ear cress]
gb|KDP25207.1|  hypothetical protein JCGZ_20363                         178   1e-49   Jatropha curcas
ref|XP_006415166.1|  hypothetical protein EUTSA_v10007075mg             180   1e-49   Eutrema salsugineum [saltwater cress]
ref|XP_006362123.1|  PREDICTED: transcription factor MYC4-like          176   1e-49   Solanum tuberosum [potatoes]
dbj|BAA25078.1|  RD22BP1                                                180   1e-49   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002303693.2|  hypothetical protein POPTR_0003s14710g             177   1e-49   Populus trichocarpa [western balsam poplar]
gb|ABS11038.1|  MYC                                                     180   2e-49   Brassica oleracea var. gemmifera
ref|XP_009151447.1|  PREDICTED: transcription factor MYC2               180   2e-49   Brassica rapa
gb|AEG74014.1|  lMYC4                                                   177   2e-49   Hevea brasiliensis [jebe]
gb|KHM99167.1|  Transcription factor MYC4                               171   3e-49   Glycine soja [wild soybean]
ref|XP_010478689.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...    179   3e-49   
ref|XP_010538366.1|  PREDICTED: transcription factor MYC2-like          179   3e-49   Tarenaya hassleriana [spider flower]
ref|XP_006361006.1|  PREDICTED: transcription factor MYC4-like          176   3e-49   Solanum tuberosum [potatoes]
emb|CDX84081.1|  BnaC08g07580D                                          178   3e-49   
ref|XP_010461111.1|  PREDICTED: transcription factor MYC2-like          179   4e-49   Camelina sativa [gold-of-pleasure]
gb|KDO44754.1|  hypothetical protein CISIN_1g005651mg                   179   5e-49   Citrus sinensis [apfelsine]
ref|XP_006428423.1|  hypothetical protein CICLE_v10011214mg             179   6e-49   Citrus clementina [clementine]
ref|XP_007158304.1|  hypothetical protein PHAVU_002G141500g             179   7e-49   Phaseolus vulgaris [French bean]
ref|XP_004246085.1|  PREDICTED: transcription factor bHLH14-like        174   8e-49   
gb|AAC28907.1|  phaseolin G-box binding protein PG2                     178   9e-49   Phaseolus vulgaris [French bean]
ref|XP_010691764.1|  PREDICTED: transcription factor MYC2-like          175   1e-48   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009131125.1|  PREDICTED: transcription factor MYC4-like          169   1e-48   
gb|AFZ93650.1|  transcription factor MYC2                               171   1e-48   Euphorbia lathyris
ref|XP_008780029.1|  PREDICTED: transcription factor MYC4-like          175   1e-48   
ref|XP_010100202.1|  hypothetical protein L484_015347                   176   1e-48   Morus notabilis
gb|AGZ94899.1|  MYC transcription factor 2                              177   1e-48   Solanum lycopersicum
ref|XP_007209110.1|  hypothetical protein PRUPE_ppa005343mg             175   2e-48   
ref|XP_004245895.2|  PREDICTED: transcription factor MYC2               177   2e-48   
ref|XP_006303928.1|  hypothetical protein CARUB_v10008586mg             177   2e-48   Capsella rubella
ref|XP_009590627.1|  PREDICTED: transcription factor bHLH14-like        174   2e-48   Nicotiana tomentosiformis
ref|XP_009609942.1|  PREDICTED: transcription factor MYC2-like          176   4e-48   Nicotiana tomentosiformis
gb|KHN18804.1|  Transcription factor MYC4                               169   6e-48   Glycine soja [wild soybean]
gb|AIO09733.1|  transcription factor MYC2                               176   6e-48   Salvia miltiorrhiza [Chinese salvia]
ref|XP_008245836.1|  PREDICTED: transcription factor bHLH14-like ...    174   6e-48   
ref|XP_008374122.1|  PREDICTED: transcription factor MYC2-like          173   6e-48   
ref|XP_009780487.1|  PREDICTED: transcription factor MYC2-like          176   7e-48   Nicotiana sylvestris
gb|ADH04268.1|  MYC1b transcription factor                              176   7e-48   Nicotiana tabacum [American tobacco]
gb|ADH04267.1|  MYC1a transcription factor                              176   7e-48   Nicotiana tabacum [American tobacco]
ref|XP_006352856.1|  PREDICTED: transcription factor MYC2-like          176   7e-48   Solanum tuberosum [potatoes]
ref|XP_009418327.1|  PREDICTED: transcription factor MYC4-like          172   8e-48   
ref|XP_008373574.1|  PREDICTED: transcription factor MYC2               176   9e-48   
gb|AAB00686.1|  phaseolin G-box binding protein PG1                     175   1e-47   Phaseolus vulgaris [French bean]
gb|ADL36595.1|  BHLH domain class transcription factor                  175   1e-47   Malus domestica [apple tree]
ref|NP_001288107.1|  uncharacterized protein LOC101261048               174   1e-47   Solanum lycopersicum
emb|CAF74711.1|  MYC transcription factor                               175   1e-47   Solanum tuberosum [potatoes]
ref|XP_006366244.1|  PREDICTED: transcription factor MYC2-like          174   2e-47   Solanum tuberosum [potatoes]
gb|ADK56287.1|  LMYC1                                                   172   2e-47   Hevea brasiliensis [jebe]
gb|EYU44086.1|  hypothetical protein MIMGU_mgv1a002808mg                174   2e-47   Erythranthe guttata [common monkey flower]
ref|XP_007210309.1|  hypothetical protein PRUPE_ppa002404mg             174   2e-47   
gb|AHN63211.1|  transcription factor MYC2                               174   2e-47   Salvia miltiorrhiza f. alba
emb|CDY58502.1|  BnaA06g40330D                                          172   2e-47   Brassica napus [oilseed rape]
emb|CDX77688.1|  BnaC07g19420D                                          172   2e-47   
ref|XP_010559309.1|  PREDICTED: transcription factor MYC4-like          174   2e-47   Tarenaya hassleriana [spider flower]
ref|XP_008238247.1|  PREDICTED: transcription factor MYC2               174   2e-47   Prunus mume [ume]
ref|XP_009114329.1|  PREDICTED: transcription factor MYC3-like          173   2e-47   Brassica rapa
emb|CDY35179.1|  BnaA09g18160D                                          173   2e-47   Brassica napus [oilseed rape]
ref|NP_199488.1|  JAZ-interacting transcription factor MYC3             174   2e-47   Arabidopsis thaliana [mouse-ear cress]
gb|AAL55712.1|AF251690_1  putative transcription factor BHLH5           174   2e-47   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008245834.1|  PREDICTED: transcription factor bHLH14-like ...    172   3e-47   Prunus mume [ume]
gb|EPS57820.1|  hypothetical protein M569_16997                         173   3e-47   Genlisea aurea
gb|AGL98101.1|  transcription factor MYC2-like protein                  174   3e-47   Nicotiana attenuata
emb|CDY03195.1|  BnaC09g19610D                                          173   3e-47   
gb|ABD65632.1|  basic helix-loop-helix (bHLH) family transcriptio...    173   3e-47   Brassica oleracea
gb|AGQ80897.1|  MYC1                                                    174   3e-47   Lithospermum erythrorhizon
gb|KHM99168.1|  Transcription factor MYC2                               171   4e-47   Glycine soja [wild soybean]
ref|XP_008658563.1|  PREDICTED: transcription factor MYC4               174   4e-47   
gb|AAD15818.1|  transcription factor MYC7E                              174   4e-47   Zea mays [maize]
ref|XP_006414178.1|  hypothetical protein EUTSA_v10024688mg             173   4e-47   Eutrema salsugineum [saltwater cress]
ref|XP_010540785.1|  PREDICTED: transcription factor MYC2-like is...    173   5e-47   Tarenaya hassleriana [spider flower]
ref|XP_008659898.1|  PREDICTED: transcription factor MYC4-like          173   6e-47   Zea mays [maize]
ref|XP_008374121.1|  PREDICTED: transcription factor MYC3-like          171   6e-47   
ref|XP_009360191.1|  PREDICTED: transcription factor MYC2-like          171   7e-47   Pyrus x bretschneideri [bai li]
ref|XP_009796881.1|  PREDICTED: transcription factor MYC2-like          170   7e-47   Nicotiana sylvestris
ref|XP_009344509.1|  PREDICTED: transcription factor MYC2-like          170   7e-47   Pyrus x bretschneideri [bai li]
ref|XP_007156435.1|  hypothetical protein PHAVU_003G285700g             172   1e-46   Phaseolus vulgaris [French bean]
ref|XP_008810069.1|  PREDICTED: transcription factor MYC4-like          169   2e-46   Phoenix dactylifera
ref|XP_002865164.1|  hypothetical protein ARALYDRAFT_916752             171   2e-46   Arabidopsis lyrata subsp. lyrata
ref|XP_009101493.1|  PREDICTED: transcription factor MYC3               171   2e-46   Brassica rapa
gb|KJB37703.1|  hypothetical protein B456_006G216700                    172   2e-46   Gossypium raimondii
ref|XP_003612909.1|  BHLH transcription factor                          172   2e-46   Medicago truncatula
gb|KJB51639.1|  hypothetical protein B456_008G226300                    171   2e-46   Gossypium raimondii
ref|XP_010445298.1|  PREDICTED: transcription factor MYC4-like          171   2e-46   Camelina sativa [gold-of-pleasure]
ref|XP_006283348.1|  hypothetical protein CARUB_v10004392mg             171   2e-46   Capsella rubella
ref|XP_006279855.1|  hypothetical protein CARUB_v10028441mg             171   2e-46   Capsella rubella
ref|XP_008346662.1|  PREDICTED: transcription factor MYC2-like          169   2e-46   
gb|EYU32289.1|  hypothetical protein MIMGU_mgv1a007575mg                168   2e-46   Erythranthe guttata [common monkey flower]
ref|XP_003516794.1|  PREDICTED: transcription factor MYC2-like          171   3e-46   Glycine max [soybeans]
emb|CAF74710.1|  MYC transcription factor                               171   3e-46   Solanum tuberosum [potatoes]
gb|ADH04263.1|  bHLH2 transcription factor                              171   3e-46   Nicotiana benthamiana
ref|XP_004512525.1|  PREDICTED: transcription factor MYC2-like          171   3e-46   Cicer arietinum [garbanzo]
ref|XP_009800420.1|  PREDICTED: transcription factor MYC2-like          171   3e-46   Nicotiana sylvestris
ref|XP_009587276.1|  PREDICTED: transcription factor MYC2-like          171   4e-46   Nicotiana tomentosiformis
ref|XP_010481417.1|  PREDICTED: transcription factor MYC3               171   4e-46   Camelina sativa [gold-of-pleasure]
ref|XP_009347383.1|  PREDICTED: transcription factor MYC2               171   4e-46   
ref|XP_006398371.1|  hypothetical protein EUTSA_v10000808mg             171   4e-46   
emb|CDY44507.1|  BnaC01g10420D                                          170   5e-46   Brassica napus [oilseed rape]
ref|XP_010441550.1|  PREDICTED: transcription factor MYC3-like          170   5e-46   Camelina sativa [gold-of-pleasure]
dbj|BAJ33793.1|  unnamed protein product                                170   6e-46   Eutrema halophilum
ref|XP_010494857.1|  PREDICTED: transcription factor MYC3-like          170   6e-46   
gb|AGL98100.1|  transcription factor MYC2                               170   6e-46   Nicotiana attenuata
gb|KJB25303.1|  hypothetical protein B456_004G184800                    170   7e-46   Gossypium raimondii
ref|NP_193522.1|  transcription factor MYC4                             169   7e-46   Arabidopsis thaliana [mouse-ear cress]
gb|AAL55711.1|AF251689_1  putative transcription factor BHLH4           169   7e-46   Arabidopsis thaliana [mouse-ear cress]
gb|KFK31432.1|  hypothetical protein AALP_AA6G111200                    169   7e-46   Arabis alpina [alpine rockcress]
ref|XP_010556617.1|  PREDICTED: transcription factor bHLH14             167   8e-46   Tarenaya hassleriana [spider flower]
ref|XP_004509726.1|  PREDICTED: transcription factor MYC2-like          170   8e-46   Cicer arietinum [garbanzo]
gb|ACO53628.1|  bHLH domain protein                                     170   8e-46   Gossypium hirsutum [American cotton]
ref|XP_003574381.1|  PREDICTED: transcription factor MYC4-like          170   1e-45   Brachypodium distachyon [annual false brome]
gb|ABD59338.1|  G-box element binding protein                           169   1e-45   Pisum sativum [garden pea]
gb|ADH04269.1|  MYC2a transcription factor                              169   1e-45   Nicotiana tabacum [American tobacco]
ref|XP_008341963.1|  PREDICTED: transcription factor MYC2-like          169   1e-45   
ref|XP_010434608.1|  PREDICTED: transcription factor MYC4-like          169   1e-45   Camelina sativa [gold-of-pleasure]
gb|KDP34321.1|  hypothetical protein JCGZ_12669                         169   1e-45   Jatropha curcas
ref|XP_002868032.1|  basic helix-loop-helix family protein              169   2e-45   
ref|XP_003531962.1|  PREDICTED: transcription factor MYC2               169   2e-45   Glycine max [soybeans]
ref|XP_010530031.1|  PREDICTED: transcription factor MYC4               169   2e-45   Tarenaya hassleriana [spider flower]
ref|XP_002280253.1|  PREDICTED: transcription factor MYC2-like          169   2e-45   
emb|CDX78808.1|  BnaA01g08750D                                          168   2e-45   
gb|AIT39751.1|  transcription factor MYC2                               168   3e-45   Chrysanthemum boreale
gb|EPS71023.1|  hypothetical protein M569_03732                         167   4e-45   Genlisea aurea
ref|XP_009360190.1|  PREDICTED: transcription factor MYC2-like          166   5e-45   Pyrus x bretschneideri [bai li]
emb|CDP13028.1|  unnamed protein product                                167   6e-45   Coffea canephora [robusta coffee]
ref|XP_010919958.1|  PREDICTED: transcription factor MYC4-like          167   7e-45   Elaeis guineensis
gb|AET03296.2|  basic helix loop helix (bHLH) family transcriptio...    167   8e-45   Medicago truncatula
ref|XP_010449546.1|  PREDICTED: transcription factor MYC4-like          167   8e-45   Camelina sativa [gold-of-pleasure]
gb|AAY90122.1|  basic helix-loop-helix transcription factor protein     167   8e-45   Rheum australe [Himalayan rhubarb]
ref|XP_004148475.1|  PREDICTED: transcription factor MYC2-like          167   9e-45   
ref|XP_009388411.1|  PREDICTED: transcription factor MYC2               167   9e-45   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHN38923.1|  Transcription factor MYC2                               165   9e-45   Glycine soja [wild soybean]
gb|KGN60384.1|  Transcription factor AtMYC2                             167   9e-45   Cucumis sativus [cucumbers]
ref|XP_010940945.1|  PREDICTED: transcription factor MYC4-like          164   1e-44   Elaeis guineensis
ref|XP_004248095.1|  PREDICTED: transcription factor MYC2-like          163   1e-44   Solanum lycopersicum
ref|XP_010104300.1|  hypothetical protein L484_023250                   167   1e-44   Morus notabilis
ref|XP_010058170.1|  PREDICTED: transcription factor MYC2               167   1e-44   
ref|XP_008465979.1|  PREDICTED: transcription factor MYC2-like          167   1e-44   Cucumis melo [Oriental melon]
dbj|BAJ91674.1|  predicted protein                                      167   1e-44   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ91022.1|  predicted protein                                      167   1e-44   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KCW71784.1|  hypothetical protein EUGRSUZ_E00277                     167   1e-44   Eucalyptus grandis [rose gum]
ref|XP_002467448.1|  hypothetical protein SORBIDRAFT_01g028230          167   1e-44   Sorghum bicolor [broomcorn]
ref|NP_001065478.1|  Os10g0575000                                       167   1e-44   
ref|XP_007210206.1|  hypothetical protein PRUPE_ppa016220mg             164   1e-44   
ref|XP_004300239.1|  PREDICTED: transcription factor MYC2-like          166   1e-44   Fragaria vesca subsp. vesca
ref|XP_004159750.1|  PREDICTED: transcription factor MYC4-like          164   2e-44   
ref|XP_008448683.1|  PREDICTED: transcription factor MYC2-like          166   2e-44   Cucumis melo [Oriental melon]
ref|XP_004166734.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...    166   2e-44   
ref|XP_009765330.1|  PREDICTED: transcription factor MYC2-like          163   2e-44   Nicotiana sylvestris
ref|XP_009359541.1|  PREDICTED: transcription factor MYC2-like          164   2e-44   Pyrus x bretschneideri [bai li]
ref|XP_010523833.1|  PREDICTED: transcription factor MYC3-like          163   2e-44   Tarenaya hassleriana [spider flower]
gb|AAK00453.1|AC060755_23  putative MYC transcription factor            166   2e-44   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010441529.1|  PREDICTED: transcription factor bHLH28-like        164   2e-44   Camelina sativa [gold-of-pleasure]
ref|XP_008370020.1|  PREDICTED: transcription factor MYC2-like          164   2e-44   
gb|KGN55667.1|  hypothetical protein Csa_3G002860                       163   2e-44   Cucumis sativus [cucumbers]
ref|XP_004146202.1|  PREDICTED: transcription factor MYC4-like          163   3e-44   
ref|XP_004148739.1|  PREDICTED: transcription factor MYC2-like          166   3e-44   Cucumis sativus [cucumbers]
ref|XP_007039493.1|  Basic helix-loop-helix DNA-binding family pr...    165   3e-44   
gb|KDP22548.1|  hypothetical protein JCGZ_26379                         163   4e-44   Jatropha curcas
dbj|BAJ86015.1|  predicted protein                                      165   5e-44   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002519814.1|  Transcription factor AtMYC2, putative              165   5e-44   Ricinus communis
ref|XP_009384727.1|  PREDICTED: transcription factor MYC3-like          165   5e-44   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003534274.2|  PREDICTED: transcription factor MYC2-like          165   5e-44   Glycine max [soybeans]
gb|EEC67493.1|  hypothetical protein OsI_34761                          165   5e-44   Oryza sativa Indica Group [Indian rice]
ref|XP_003628820.1|  Transcription factor MYC2                          164   6e-44   
ref|XP_008796257.1|  PREDICTED: transcription factor MYC4               165   6e-44   Phoenix dactylifera
ref|XP_009384126.1|  PREDICTED: transcription factor MYC4-like          164   7e-44   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009401251.1|  PREDICTED: transcription factor MYC4-like          164   7e-44   Musa acuminata subsp. malaccensis [pisang utan]
gb|AAQ14332.1|AF283507_1  MYC2                                          164   1e-43   Catharanthus roseus [chatas]
gb|KFK28472.1|  hypothetical protein AALP_AA7G000700                    163   1e-43   Arabis alpina [alpine rockcress]
gb|AEB35656.1|  MYC2                                                    154   1e-43   Helianthus annuus
ref|XP_011081344.1|  PREDICTED: transcription factor MYC2-like          162   1e-43   Sesamum indicum [beniseed]
gb|AEB35640.1|  MYC2                                                    154   1e-43   Helianthus annuus
gb|AEB35703.1|  MYC2                                                    154   1e-43   Helianthus annuus
gb|AEB35671.1|  MYC2                                                    154   1e-43   Helianthus annuus
gb|AEB35606.1|  MYC2                                                    154   1e-43   Helianthus annuus
ref|XP_009617148.1|  PREDICTED: transcription factor MYC4-like          159   1e-43   
gb|AEB35604.1|  MYC2                                                    154   1e-43   Helianthus argophyllus
gb|AEB35565.1|  MYC2                                                    154   1e-43   Helianthus petiolaris
gb|AEB35567.1|  MYC2                                                    154   1e-43   Helianthus petiolaris
gb|AEB35597.1|  MYC2                                                    154   1e-43   Helianthus argophyllus
gb|AEB35692.1|  MYC2                                                    154   1e-43   Helianthus annuus
gb|AEB35595.1|  MYC2                                                    154   2e-43   Helianthus tuberosus [Jerusalem artichoke]
gb|AEB35674.1|  MYC2                                                    154   2e-43   Helianthus annuus
ref|XP_008245390.1|  PREDICTED: transcription factor MYC2-like          162   2e-43   Prunus mume [ume]
gb|AEB35676.1|  MYC2                                                    154   2e-43   Helianthus annuus
gb|AEB35658.1|  MYC2                                                    153   2e-43   Helianthus annuus
ref|XP_009408104.1|  PREDICTED: transcription factor MYC4-like          163   2e-43   Musa acuminata subsp. malaccensis [pisang utan]
gb|AEB35596.1|  MYC2                                                    153   2e-43   Helianthus tuberosus [Jerusalem artichoke]
ref|XP_009420803.1|  PREDICTED: transcription factor MYC3-like          160   3e-43   Musa acuminata subsp. malaccensis [pisang utan]
gb|AEB35587.1|  MYC2                                                    153   3e-43   Helianthus tuberosus [Jerusalem artichoke]
ref|XP_011028179.1|  PREDICTED: transcription factor MYC2-like          162   3e-43   Populus euphratica
ref|XP_006385657.1|  phaseolin G-box binding protein PG2                162   3e-43   
gb|AEB35649.1|  MYC2                                                    153   3e-43   Helianthus annuus
gb|AEB35660.1|  MYC2                                                    152   4e-43   Helianthus annuus
ref|XP_010538501.1|  PREDICTED: transcription factor MYC4-like          162   4e-43   Tarenaya hassleriana [spider flower]
gb|AEB35592.1|  MYC2                                                    152   4e-43   Helianthus tuberosus [Jerusalem artichoke]
gb|AEB35694.1|  MYC2                                                    152   5e-43   Helianthus annuus
ref|XP_008448555.1|  PREDICTED: transcription factor MYC3-like          160   5e-43   Cucumis melo [Oriental melon]
gb|AEB35568.1|  MYC2                                                    152   6e-43   Helianthus petiolaris
ref|XP_010481407.1|  PREDICTED: transcription factor bHLH28-like        160   6e-43   Camelina sativa [gold-of-pleasure]
ref|XP_011018569.1|  PREDICTED: transcription factor MYC2-like          162   6e-43   Populus euphratica
gb|AEB35580.1|  MYC2                                                    152   7e-43   Helianthus exilis
gb|ACM48567.1|  JAMYC                                                   161   7e-43   Taxus cuspidata [ichii]
ref|XP_008799392.1|  PREDICTED: transcription factor MYC2-like          161   8e-43   
gb|AEB35601.1|  MYC2                                                    152   8e-43   
gb|ACN21638.1|  putative basic helix-loop-helix protein BHLH22          161   8e-43   
ref|XP_009413229.1|  PREDICTED: transcription factor MYC2-like          162   8e-43   
ref|XP_008238755.1|  PREDICTED: transcription factor bHLH14-like ...    160   9e-43   
ref|XP_008238754.1|  PREDICTED: transcription factor MYC4-like is...    160   9e-43   
emb|CDY26910.1|  BnaA05g18020D                                          159   1e-42   
gb|AEB35706.1|  MYC2                                                    151   1e-42   
ref|XP_010677236.1|  PREDICTED: transcription factor MYC2-like          161   1e-42   
gb|AEB35575.1|  MYC2                                                    151   1e-42   
ref|XP_009396848.1|  PREDICTED: transcription factor MYC4-like          161   2e-42   
emb|CDX73261.1|  BnaC05g28450D                                          158   2e-42   
gb|AEB35657.1|  MYC2                                                    151   2e-42   
gb|AEB35570.1|  MYC2                                                    151   2e-42   
gb|AEB35571.1|  MYC2                                                    150   2e-42   
ref|XP_010933462.1|  PREDICTED: transcription factor MYC4-like          160   2e-42   
ref|XP_008238769.1|  PREDICTED: transcription factor MYC2-like          159   2e-42   
ref|XP_006368399.1|  phaseolin G-box binding protein PG2                160   2e-42   
gb|AEB35678.1|  MYC2                                                    150   2e-42   
ref|XP_007151965.1|  hypothetical protein PHAVU_004G090300g             157   3e-42   
ref|XP_007210924.1|  hypothetical protein PRUPE_ppa027182mg             158   4e-42   
ref|XP_010275210.1|  PREDICTED: transcription factor MYC2-like          159   4e-42   
ref|XP_006398377.1|  hypothetical protein EUTSA_v10000853mg             159   4e-42   
ref|XP_008786336.1|  PREDICTED: transcription factor MYC2-like          159   4e-42   
gb|AEB35577.1|  MYC2                                                    150   4e-42   
gb|AEB35578.1|  MYC2                                                    150   4e-42   
ref|XP_010273162.1|  PREDICTED: transcription factor MYC2-like          159   8e-42   
gb|KHN04880.1|  Transcription factor MYC2                               157   8e-42   
gb|ADH04262.1|  bHLH1 transcription factor                              159   8e-42   
ref|XP_009385748.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...    158   9e-42   
ref|XP_007208833.1|  hypothetical protein PRUPE_ppa025417mg             156   2e-41   
ref|XP_007210117.1|  hypothetical protein PRUPE_ppa022165mg             155   2e-41   
ref|XP_006352213.1|  PREDICTED: transcription factor ATR2-like          155   3e-41   
ref|XP_008245386.1|  PREDICTED: transcription factor bHLH14-like        155   4e-41   
ref|XP_010941241.1|  PREDICTED: transcription factor MYC2-like          157   4e-41   
gb|KFK31426.1|  hypothetical protein AALP_AA6G110400                    155   5e-41   
ref|XP_008245388.1|  PREDICTED: transcription factor MYC2-like          155   5e-41   
gb|AEB35573.1|  MYC2                                                    147   7e-41   
ref|XP_010910582.1|  PREDICTED: transcription factor MYC4-like          154   8e-41   
ref|XP_004244656.1|  PREDICTED: transcription factor bHLH14-like        154   8e-41   
ref|XP_009393178.1|  PREDICTED: transcription factor MYC3-like          153   2e-40   
gb|KFK45000.1|  hypothetical protein AALP_AA1G331100                    154   3e-40   
gb|AGO03814.1|  JAMYC4                                                  150   5e-40   
ref|XP_009391048.1|  PREDICTED: transcription factor MYC2-like          152   1e-39   
ref|XP_009370919.1|  PREDICTED: transcription factor MYC2-like          151   2e-39   
ref|XP_010053608.1|  PREDICTED: transcription factor MYC2-like          151   3e-39   
ref|XP_009114324.1|  PREDICTED: transcription factor bHLH28-like        150   3e-39   
emb|CDY35183.1|  BnaA09g18200D                                          150   4e-39   
ref|XP_006279851.1|  hypothetical protein CARUB_v10028430mg             149   6e-39   
ref|XP_009101672.1|  PREDICTED: transcription factor bHLH28-like        145   7e-39   
ref|XP_006838603.1|  hypothetical protein AMTR_s00002p00225810          150   8e-39   
ref|XP_002865159.1|  predicted protein                                  149   9e-39   
ref|XP_010935028.1|  PREDICTED: transcription factor MYC4-like          150   9e-39   
emb|CDX77699.1|  BnaC07g19530D                                          144   1e-38   
ref|XP_009359542.1|  PREDICTED: transcription factor MYC2-like          149   1e-38   
gb|EPS60924.1|  hypothetical protein M569_13876                         149   2e-38   
ref|XP_008342536.1|  PREDICTED: transcription factor MYC2-like          148   2e-38   
ref|XP_010494874.1|  PREDICTED: transcription factor bHLH28-like        148   2e-38   
emb|CDY03185.1|  BnaC09g19710D                                          147   2e-38   
emb|CDY33482.1|  BnaA06g35910D                                          143   3e-38   
ref|XP_007210118.1|  hypothetical protein PRUPE_ppa022201mg             147   4e-38   
ref|XP_008356558.1|  PREDICTED: transcription factor MYC2-like          147   6e-38   
ref|XP_008245385.1|  PREDICTED: transcription factor bHLH14-like ...    146   7e-38   
ref|XP_008245384.1|  PREDICTED: transcription factor bHLH14-like ...    146   8e-38   
ref|XP_010056012.1|  PREDICTED: transcription factor MYC2-like          145   1e-37   
ref|XP_003520013.2|  PREDICTED: transcription factor MYC2-like          144   2e-37   
ref|XP_008342518.1|  PREDICTED: transcription factor MYC3-like is...    145   3e-37   
ref|XP_008342523.1|  PREDICTED: transcription factor MYC3-like is...    145   3e-37   
ref|XP_009358714.1|  PREDICTED: transcription factor MYC4-like          144   5e-37   
gb|KFK30669.1|  hypothetical protein AALP_AA6G012400                    142   6e-37   
gb|ABR16623.1|  unknown                                                 144   7e-37   
ref|XP_006287856.1|  hypothetical protein CARUB_v10001082mg             142   1e-36   
emb|CDP12229.1|  unnamed protein product                                142   1e-36   
gb|KGN61317.1|  hypothetical protein Csa_2G080170                       140   1e-36   
gb|AEB35693.1|  MYC2                                                    135   1e-36   
ref|NP_199495.1|  calcium-binding transcription factor NIG1             143   2e-36   
gb|EMS55891.1|  Transcription factor MYC4                               141   2e-36   
ref|XP_008803328.1|  PREDICTED: transcription factor MYC3-like          140   7e-36   
ref|XP_010058363.1|  PREDICTED: transcription factor MYC2-like          140   7e-36   
gb|KCW72574.1|  hypothetical protein EUGRSUZ_E01043                     140   2e-35   
emb|CDY59973.1|  BnaA09g53560D                                          139   2e-35   
ref|XP_008441948.1|  PREDICTED: transcription factor MYC4-like          137   3e-35   
emb|CDY03183.1|  BnaC09g19730D                                          139   3e-35   
gb|AEB35702.1|  MYC2                                                    131   5e-35   
gb|AEB35681.1|  MYC2                                                    131   6e-35   
gb|AAF04917.1|AF011557_1  jasmonic acid 3                               136   7e-35   
gb|AEB35699.1|  MYC2                                                    131   7e-35   
gb|AEB35566.1|  MYC2                                                    130   8e-35   
ref|XP_009114323.1|  PREDICTED: transcription factor bHLH28-like        138   9e-35   
ref|XP_008350027.1|  PREDICTED: transcription factor MYC2-like          137   1e-34   
ref|XP_010058361.1|  PREDICTED: transcription factor MYC2-like          137   1e-34   
ref|XP_010456176.1|  PREDICTED: transcription factor bHLH14-like ...    135   2e-34   
gb|AEB35704.1|  MYC2                                                    130   2e-34   
ref|XP_010456175.1|  PREDICTED: transcription factor bHLH14-like ...    136   3e-34   
ref|XP_002872924.1|  predicted protein                                  135   3e-34   
ref|XP_008386326.1|  PREDICTED: transcription factor MYC3-like          136   4e-34   
ref|XP_007210224.1|  hypothetical protein PRUPE_ppa015634mg             134   9e-34   
ref|XP_004152861.1|  PREDICTED: transcription factor bHLH14-like        132   1e-33   
ref|XP_010058362.1|  PREDICTED: transcription factor MYC2-like          134   1e-33   
gb|KCW72573.1|  hypothetical protein EUGRSUZ_E01042                     134   1e-33   
emb|CBI38690.3|  unnamed protein product                                132   1e-33   
ref|XP_010422737.1|  PREDICTED: transcription factor bHLH14-like        133   3e-33   
ref|XP_002320871.2|  hypothetical protein POPTR_0014s09520g             134   6e-33   
ref|XP_006852614.1|  hypothetical protein AMTR_s00021p00226670          132   9e-33   
ref|XP_008385225.1|  PREDICTED: transcription factor MYC2-like          132   1e-32   
ref|XP_010507550.1|  PREDICTED: transcription factor MYC2-like          131   1e-32   
ref|XP_010513049.1|  PREDICTED: transcription factor MYC2-like          130   3e-32   
gb|KHN16427.1|  Transcription factor bHLH13                             131   3e-32   
gb|AFB33094.1|  hypothetical protein 0_9408_01                          124   3e-32   
gb|AFB33098.1|  hypothetical protein 0_9408_01                          124   3e-32   
ref|XP_010058370.1|  PREDICTED: transcription factor MYC2-like          130   3e-32   
ref|XP_008385247.1|  PREDICTED: transcription factor MYC3-like          130   3e-32   
ref|XP_003520875.1|  PREDICTED: transcription factor bHLH13-like        131   3e-32   
ref|XP_011038317.1|  PREDICTED: transcription factor bHLH13-like        131   4e-32   
ref|XP_006294316.1|  hypothetical protein CARUB_v10023324mg             130   4e-32   
ref|NP_567195.1|  transcription factor bHLH14                           130   4e-32   
ref|XP_010412880.1|  PREDICTED: transcription factor MYC2-like          130   4e-32   
ref|XP_010242395.1|  PREDICTED: transcription factor bHLH13-like        131   4e-32   
ref|XP_008358724.1|  PREDICTED: transcription factor MYC3-like          130   5e-32   
gb|AEW07707.1|  hypothetical protein 0_9408_01                          123   7e-32   
ref|XP_007147321.1|  hypothetical protein PHAVU_006G114000g             130   7e-32   
gb|AEW07706.1|  hypothetical protein 0_9408_01                          123   8e-32   
gb|AFB33089.1|  hypothetical protein 0_9408_01                          123   9e-32   
ref|XP_010058366.1|  PREDICTED: transcription factor MYC4-like          129   1e-31   
gb|AHG95274.1|  mys transcription factor                                120   4e-31   
ref|XP_009354516.1|  PREDICTED: transcription factor MYC3-like          127   4e-31   
gb|AHG95269.1|  mys transcription factor                                119   1e-30   
ref|XP_010055004.1|  PREDICTED: transcription factor bHLH13             127   1e-30   
ref|XP_010506659.1|  PREDICTED: transcription factor ABA-INDUCIBL...    127   1e-30   
ref|XP_010428091.1|  PREDICTED: transcription factor bHLH14-like        125   1e-30   
ref|XP_010508006.1|  PREDICTED: transcription factor ABA-INDUCIBL...    126   1e-30   
gb|AHG95271.1|  mys transcription factor                                119   2e-30   
gb|AHG95270.1|  mys transcription factor                                119   2e-30   
ref|XP_002892077.1|  basic helix-loop-helix family protein              126   2e-30   
ref|XP_010518324.1|  PREDICTED: transcription factor ABA-INDUCIBL...    126   2e-30   
ref|XP_008670327.1|  PREDICTED: transcription factor MYC2-like          123   3e-30   
ref|XP_010677037.1|  PREDICTED: transcription factor bHLH14-like        123   3e-30   
ref|XP_006397843.1|  hypothetical protein EUTSA_v10001374mg             125   5e-30   
ref|XP_010554450.1|  PREDICTED: transcription factor bHLH3              124   5e-30   
ref|XP_002462680.1|  hypothetical protein SORBIDRAFT_02g030120          122   7e-30   
ref|XP_003553791.1|  PREDICTED: transcription factor bHLH13-like        125   1e-29   
gb|EMS62462.1|  Transcription factor MYC2                               120   1e-29   
gb|KFK37416.1|  hypothetical protein AALP_AA4G254100                    124   1e-29   
dbj|BAJ85584.1|  predicted protein                                      124   1e-29   
ref|XP_010696336.1|  PREDICTED: transcription factor bHLH13-like        125   1e-29   
ref|XP_001765254.1|  predicted protein                                  125   1e-29   
ref|NP_566078.1|  transcription factor ABA-INDUCIBLE bHLH-TYPE          124   1e-29   
ref|XP_002882073.1|  basic helix-loop-helix family protein              123   2e-29   
gb|EMT07783.1|  Transcription factor MYC2                               120   2e-29   
ref|XP_004229991.1|  PREDICTED: transcription factor bHLH13-like        124   2e-29   
ref|XP_001754025.1|  predicted protein                                  123   2e-29   
ref|XP_006361007.1|  PREDICTED: transcription factor bHLH14-like        116   3e-29   
ref|XP_008372794.1|  PREDICTED: transcription factor bHLH14-like        117   3e-29   
gb|ABR16436.1|  unknown                                                 123   3e-29   
ref|XP_008233131.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...    123   4e-29   
ref|XP_006307052.1|  hypothetical protein CARUB_v10008640mg             123   4e-29   
gb|AAM19778.1|  At2g46510/F13A10.4                                      122   6e-29   
emb|CDY70013.1|  BnaCnng66320D                                          118   7e-29   
ref|XP_001765161.1|  predicted protein                                  124   7e-29   
ref|XP_004306657.1|  PREDICTED: transcription factor bHLH13-like        122   8e-29   
ref|XP_009781532.1|  PREDICTED: transcription factor bHLH13-like        122   8e-29   
dbj|BAH20404.1|  AT1G01260                                              120   9e-29   
ref|XP_010451453.1|  PREDICTED: transcription factor bHLH3-like         119   1e-28   
ref|XP_004974089.1|  PREDICTED: transcription factor MYC2-like          118   1e-28   
ref|XP_009627739.1|  PREDICTED: transcription factor bHLH13-like        121   1e-28   
ref|XP_010058368.1|  PREDICTED: transcription factor MYC2-like          120   2e-28   
ref|XP_009608279.1|  PREDICTED: transcription factor bHLH13-like        121   2e-28   
gb|EMT04182.1|  Transcription factor bHLH13                             121   2e-28   
ref|XP_009401987.1|  PREDICTED: transcription factor bHLH13-like        121   2e-28   
emb|CDX90021.1|  BnaA10g00610D                                          120   3e-28   
gb|AEB35549.1|  MYC2                                                    118   3e-28   
gb|AEB35467.1|  MYC2                                                    118   3e-28   
tpg|DAA62295.1|  TPA: putative HLH DNA-binding domain superfamily...    117   3e-28   
gb|AEB35522.1|  MYC2                                                    118   3e-28   
gb|AEB35556.1|  MYC2                                                    118   3e-28   
ref|NP_171634.1|  transcription factor bHLH13                           120   3e-28   
ref|XP_010474717.1|  PREDICTED: transcription factor bHLH13-like        120   3e-28   
gb|AAM10932.1|AF488559_1  putative bHLH transcription factor            120   3e-28   
ref|XP_009119682.1|  PREDICTED: transcription factor bHLH13             120   4e-28   
ref|XP_010480459.1|  PREDICTED: transcription factor bHLH13-like        120   4e-28   
emb|CDY34468.1|  BnaC01g21650D                                          119   4e-28   
ref|XP_010457144.1|  PREDICTED: transcription factor bHLH13             120   4e-28   
gb|AEB35563.1|  MYC2                                                    117   5e-28   
ref|XP_010559123.1|  PREDICTED: transcription factor ABA-INDUCIBL...    120   5e-28   
gb|AEB35550.1|  MYC2                                                    117   5e-28   
ref|XP_011093944.1|  PREDICTED: transcription factor bHLH13-like        120   5e-28   
ref|XP_008652936.1|  PREDICTED: transcription factor bHLH14-like        117   6e-28   
ref|XP_009146001.1|  PREDICTED: transcription factor bHLH3              118   8e-28   
emb|CDY32242.1|  BnaA01g17420D                                          118   8e-28   
ref|XP_010434826.1|  PREDICTED: transcription factor bHLH3              118   9e-28   
ref|XP_001752627.1|  predicted protein                                  120   9e-28   
ref|XP_006418406.1|  hypothetical protein EUTSA_v10007139mg             119   9e-28   
ref|XP_010440158.1|  PREDICTED: transcription factor bHLH3-like i...    118   1e-27   
ref|XP_010440156.1|  PREDICTED: transcription factor bHLH3-like i...    118   1e-27   
ref|XP_006414350.1|  hypothetical protein EUTSA_v10025122mg             117   1e-27   
emb|CDX90525.1|  BnaA03g42560D                                          117   1e-27   
gb|EYU32259.1|  hypothetical protein MIMGU_mgv1a021930mg                117   1e-27   
ref|XP_010544844.1|  PREDICTED: transcription factor ABA-INDUCIBL...    118   1e-27   
ref|XP_010522910.1|  PREDICTED: transcription factor bHLH13-like        119   2e-27   
ref|NP_193376.1|  transcription factor bHLH3                            117   2e-27   
ref|XP_010058369.1|  PREDICTED: transcription factor MYC2-like          117   2e-27   
ref|XP_006282965.1|  hypothetical protein CARUB_v10007725mg             117   2e-27   
ref|XP_002870159.1|  basic helix-loop-helix family protein              117   2e-27   
ref|XP_002302637.2|  basic helix-loop-helix family protein              118   2e-27   
gb|AEJ88337.1|  putative MYC protein                                    117   2e-27   
ref|XP_004974086.1|  PREDICTED: transcription factor MYC2-like          114   3e-27   
gb|AGE32978.1|  hypothetical protein                                    113   3e-27   
gb|AGE32656.1|  hypothetical protein 751129                             113   3e-27   
gb|KFK26541.1|  hypothetical protein AALP_AA8G262400                    116   3e-27   
ref|XP_006339721.1|  PREDICTED: transcription factor bHLH13-like        117   3e-27   
ref|XP_004493757.1|  PREDICTED: transcription factor bHLH3-like         117   3e-27   
emb|CDP08667.1|  unnamed protein product                                117   4e-27   
gb|KDO68498.1|  hypothetical protein CISIN_1g010728mg                   116   4e-27   
ref|XP_006443887.1|  hypothetical protein CICLE_v10019816mg             116   4e-27   
ref|XP_008461882.1|  PREDICTED: transcription factor bHLH3              116   4e-27   
ref|XP_009770264.1|  PREDICTED: transcription factor bHLH13-like        117   4e-27   
ref|XP_010679205.1|  PREDICTED: transcription factor bHLH3-like         116   4e-27   
ref|XP_011083013.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...    116   4e-27   
ref|XP_011023168.1|  PREDICTED: transcription factor bHLH13-like        117   5e-27   
ref|XP_004151980.1|  PREDICTED: transcription factor bHLH3-like         116   5e-27   
gb|KDP26171.1|  hypothetical protein JCGZ_22265                         114   5e-27   



>ref|XP_011094312.1| PREDICTED: transcription factor MYC2 [Sesamum indicum]
Length=473

 Score =   241 bits (615),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 133/190 (70%), Positives = 151/190 (79%), Gaps = 9/190 (5%)
 Frame = -2

Query  573  SYPEXEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRF  394
            SY + EHSDSDCQF   P  V+ ++  PKKRGRKP  GR  P+NHVEAERQRREKLNHRF
Sbjct  262  SYLDSEHSDSDCQFFL-PETVETKR-TPKKRGRKPNLGRDAPLNHVEAERQRREKLNHRF  319

Query  393  YALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKVKVEAVG---DNQ  223
            YALRSVVPNVSRMDKASLLSDAVSYI ELK KVEELE QLQ RESKKVK E      DNQ
Sbjct  320  YALRSVVPNVSRMDKASLLSDAVSYIKELKSKVEELETQLQ-RESKKVKTETTAETLDNQ  378

Query  222  stssaassv---aSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASIS  52
            ST+++   V    S ++VEVKIVG D MIRVQS+N NYP+A+LM+ +RELEL VHHAS+S
Sbjct  379  STTTSVDQVGPITSLLEVEVKIVGVDGMIRVQSDNGNYPAARLMDAIRELELQVHHASMS  438

Query  51   SVNDIMLQDI  22
             VND+MLQD+
Sbjct  439  CVNDLMLQDV  448



>ref|XP_007051457.1| Basic helix-loop-helix DNA-binding family protein [Theobroma 
cacao]
 gb|EOX95614.1| Basic helix-loop-helix DNA-binding family protein [Theobroma 
cacao]
Length=497

 Score =   238 bits (606),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 132/198 (67%), Positives = 149/198 (75%), Gaps = 18/198 (9%)
 Frame = -2

Query  573  SYPEXEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRF  394
            SY + EHSDSDC  L    I  R    PKKRGRKPG GR TP+NHVEAERQRREKLNHRF
Sbjct  280  SYVDSEHSDSDCPLLAMNNIEKR---TPKKRGRKPGLGRETPLNHVEAERQRREKLNHRF  336

Query  393  YALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKVKVEAVG--DNQs  220
            YALR+VVPNVSRMDKASLLSDAVSYINELK K+EELE QLQ RE KKVKVE V   DNQS
Sbjct  337  YALRAVVPNVSRMDKASLLSDAVSYINELKAKIEELESQLQ-RECKKVKVEMVDAMDNQS  395

Query  219  tssaassvaSP------------VDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELEL  76
            T+++    A P            ++ ++KI+G DAMIRVQSEN NYPSA+LM  LR+LE 
Sbjct  396  TTTSVDQAARPSNSSSGTAGSGGLEFDIKIMGNDAMIRVQSENVNYPSARLMIALRDLEF  455

Query  75   AVHHASISSVNDIMLQDI  22
             VHHAS+S VN++MLQDI
Sbjct  456  QVHHASMSCVNELMLQDI  473



>ref|XP_009604694.1| PREDICTED: transcription factor MYC3-like [Nicotiana tomentosiformis]
Length=489

 Score =   234 bits (596),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 128/206 (62%), Positives = 153/206 (74%), Gaps = 25/206 (12%)
 Frame = -2

Query  570  YPEXEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFY  391
            + + +HSDSDCQ L + PIV+++   PKKRGRKPGA R TP NHVEAERQRREKLNHRFY
Sbjct  262  FQDSDHSDSDCQVLVDKPIVEKK--TPKKRGRKPGATRETPSNHVEAERQRREKLNHRFY  319

Query  390  ALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLR--ESKKVKVEAVG----D  229
            ALRSVVP+V++MDKASLLSDAV YINELK KV++LE QL  +    KK+KVE++     D
Sbjct  320  ALRSVVPHVTKMDKASLLSDAVEYINELKAKVDDLELQLNNKSESKKKLKVESMDSTTLD  379

Query  228  NQs-----------------tssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLM  100
            NQS                 ++S+       V+VEVKI+GPDAMIRVQSEN NYPSA+LM
Sbjct  380  NQSTTTTTTTSVDQIRPNSNSTSSFGPNNLTVEVEVKILGPDAMIRVQSENVNYPSARLM  439

Query  99   NGLRELELAVHHASISSVNDIMLQDI  22
              L++LEL VHHASISSVND+MLQDI
Sbjct  440  RALQDLELHVHHASISSVNDLMLQDI  465



>ref|XP_010100678.1| hypothetical protein L484_023447 [Morus notabilis]
 gb|EXB83840.1| hypothetical protein L484_023447 [Morus notabilis]
Length=525

 Score =   234 bits (596),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 127/215 (59%), Positives = 152/215 (71%), Gaps = 31/215 (14%)
 Frame = -2

Query  573  SYPEXEHSDSDCQFLK-----EPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREK  409
            +Y + EHSDSDC  +         I   ++ APKKRGRKPG GR TP+NHVEAERQRREK
Sbjct  284  AYVDSEHSDSDCPLITVNNNNNNNISTGEKRAPKKRGRKPGLGRDTPLNHVEAERQRREK  343

Query  408  LNHRFYALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRES-KKVKVEAVG  232
            LNHRFYALR+VVPNVSRMDKASLLSDAVSYINELK K+++LE QLQ  +S KKVK+EA  
Sbjct  344  LNHRFYALRAVVPNVSRMDKASLLSDAVSYINELKAKIDDLESQLQRDQSNKKVKLEAAD  403

Query  231  ----DNQstssaassvaSP---------------------VDVEVKIVGPDAMIRVQSEN  127
                DNQST+++      P                     +++EVKI+G DAMIRVQSEN
Sbjct  404  TMSLDNQSTTTSVDQTKPPNSNSSSNKSNNINSVTGNINGLEIEVKIIGTDAMIRVQSEN  463

Query  126  ANYPSAKLMNGLRELELAVHHASISSVNDIMLQDI  22
             NYPSA+LM  LR+LE  VHHAS+SS+ND+MLQD+
Sbjct  464  VNYPSARLMGALRDLEFQVHHASVSSINDLMLQDV  498



>ref|XP_006362125.1| PREDICTED: transcription factor MYC2-like [Solanum tuberosum]
Length=457

 Score =   232 bits (591),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 128/200 (64%), Positives = 145/200 (73%), Gaps = 27/200 (14%)
 Frame = -2

Query  552  SDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYALRSVV  373
            SDSDCQ L E P+   ++  PKKRGRKPGA R TP+NHVEAERQRREKLNHRFYALRSVV
Sbjct  237  SDSDCQVLVEKPV---EKKTPKKRGRKPGATRETPLNHVEAERQRREKLNHRFYALRSVV  293

Query  372  PNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKVKVEAVG----DNQ------  223
            P+V++MDKASLLSDAVSYINELK KV ELE QL  R+SKK+K+E       DN       
Sbjct  294  PHVTKMDKASLLSDAVSYINELKSKVTELEGQLT-RKSKKLKIECTDSITIDNHSTATTT  352

Query  222  -------------stssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLREL  82
                         S +S        V+VEVKI+GPDAM+RVQSEN NYPSA+LM  L++L
Sbjct  353  TTNSVDQIRHNSSSAASFGVQNNLKVEVEVKILGPDAMVRVQSENVNYPSARLMRALQDL  412

Query  81   ELAVHHASISSVNDIMLQDI  22
            EL VHHASISSVNDIMLQDI
Sbjct  413  ELHVHHASISSVNDIMLQDI  432



>gb|KDP28433.1| hypothetical protein JCGZ_14204 [Jatropha curcas]
Length=482

 Score =   231 bits (590),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 121/191 (63%), Positives = 147/191 (77%), Gaps = 12/191 (6%)
 Frame = -2

Query  570  YPEXEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFY  391
            Y + EHSDSDC  +   P V+++   PKKRGRKP  GR TP+NHVEAERQRREKLNHRFY
Sbjct  272  YIDSEHSDSDCPLV--APTVEKR--TPKKRGRKPSLGRETPLNHVEAERQRREKLNHRFY  327

Query  390  ALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKVKVEAV--GDNQst  217
            ALR+VVPNVSRMDKASLLSDAV YINELK K++EL+ QLQ  +SK+VK+E     DNQST
Sbjct  328  ALRAVVPNVSRMDKASLLSDAVCYINELKAKIDELDSQLQRDQSKRVKLEVTDNTDNQST  387

Query  216  ssaass------vaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASI  55
             ++             +D+EVKI+G DAMIRVQSEN NYP+AKL+  LR+LE  VHHAS+
Sbjct  388  ITSVDQARPSPISGFTLDIEVKILGDDAMIRVQSENVNYPAAKLLTALRDLEFQVHHASM  447

Query  54   SSVNDIMLQDI  22
            S+VN++MLQD+
Sbjct  448  STVNELMLQDV  458



>ref|XP_004248092.1| PREDICTED: transcription factor MYC3-like [Solanum lycopersicum]
Length=451

 Score =   230 bits (586),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 127/198 (64%), Positives = 145/198 (73%), Gaps = 25/198 (13%)
 Frame = -2

Query  564  EXEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYAL  385
            E   SDSDCQ L E       +  PKKRGRKPGA R TP+NHVEAERQRREKLNHRFYAL
Sbjct  237  ECNDSDSDCQLLVE-------KKTPKKRGRKPGATRETPLNHVEAERQRREKLNHRFYAL  289

Query  384  RSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKVKVEAVG----DNQst  217
            RSVVP+V++MDKASLLSDAVSYINELK KV ELE QL  R+SKK+K+E       DN ST
Sbjct  290  RSVVPHVTKMDKASLLSDAVSYINELKSKVAELETQLT-RKSKKLKIECTDSFSIDNNST  348

Query  216  ssaassva-------------SPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELEL  76
            ++  ++                 V+VEVKI+GPDAM+RVQSEN NYPS +LM  L++LEL
Sbjct  349  ATTITNSVDQIRHNSFGVHSNLKVEVEVKILGPDAMVRVQSENVNYPSTRLMRALQDLEL  408

Query  75   AVHHASISSVNDIMLQDI  22
             VHHASISSVNDIMLQDI
Sbjct  409  HVHHASISSVNDIMLQDI  426



>ref|XP_009776117.1| PREDICTED: transcription factor MYC2-like [Nicotiana sylvestris]
Length=496

 Score =   231 bits (589),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 124/205 (60%), Positives = 148/205 (72%), Gaps = 24/205 (12%)
 Frame = -2

Query  570  YPEXEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFY  391
            + + +HSDSDCQ L + PIV+++   PKKRGRKPGA R TP+NHVEAERQRREKLNHRFY
Sbjct  270  FQDSDHSDSDCQVLVDKPIVEKK--TPKKRGRKPGATRETPLNHVEAERQRREKLNHRFY  327

Query  390  ALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQL---------------------  274
            ALRSVVP+V++MDKASLLSDAV YINELK KV+ELE QL                     
Sbjct  328  ALRSVVPHVTKMDKASLLSDAVEYINELKTKVDELELQLNKKSESKKKLKVESMDSTTLD  387

Query  273  -QLRESKKVKVEAVGDNQstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMN  97
             Q   +    V+ +  N ++SS+       V+VEVKI+GPDAMIRVQSEN NYPSA+LM 
Sbjct  388  NQTTTTTTTSVDQIRPNSNSSSSYGPNNLTVEVEVKILGPDAMIRVQSENVNYPSARLMR  447

Query  96   GLRELELAVHHASISSVNDIMLQDI  22
             L++LEL VHHASISSVND+MLQDI
Sbjct  448  ALQDLELHVHHASISSVNDLMLQDI  472



>ref|XP_010054972.1| PREDICTED: transcription factor MYC2 [Eucalyptus grandis]
 gb|KCW71457.1| hypothetical protein EUGRSUZ_E00019 [Eucalyptus grandis]
Length=495

 Score =   231 bits (588),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 124/189 (66%), Positives = 148/189 (78%), Gaps = 12/189 (6%)
 Frame = -2

Query  564  EXEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYAL  385
            E EHSDSD  F+     V  ++  PKKRGRKPG GR TP+NHVEAERQRREKLNHRFYAL
Sbjct  287  ESEHSDSDSPFMAA---VMTEKRTPKKRGRKPGLGRDTPLNHVEAERQRREKLNHRFYAL  343

Query  384  RSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKVKVEAV-GDNQstssa  208
            R+VVPNVSRMDKASLLSDAVSYINELK K+ +LE QLQ RESK+VK E     +  +++ 
Sbjct  344  RAVVPNVSRMDKASLLSDAVSYINELKSKIGDLESQLQ-RESKRVKQEVTDATDNLSTTT  402

Query  207  assvaSP-------VDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISS  49
            +   +SP       ++VEVKIVG DAMIRVQSENANYPSA+LM  +R+LEL +HHAS+S+
Sbjct  403  SVDHSSPSGCGGSLLEVEVKIVGCDAMIRVQSENANYPSARLMAAMRDLELHIHHASLST  462

Query  48   VNDIMLQDI  22
            VND+MLQD+
Sbjct  463  VNDLMLQDV  471



>ref|XP_011039030.1| PREDICTED: transcription factor MYC2 isoform X2 [Populus euphratica]
Length=500

 Score =   228 bits (582),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 124/197 (63%), Positives = 151/197 (77%), Gaps = 18/197 (9%)
 Frame = -2

Query  573  SYPEXEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRF  394
            SY + EHSDSD  F+     V+ ++  PKKRGRKPG GR  P+NHVEAERQRREKLNHRF
Sbjct  278  SYVDSEHSDSDFHFVA----VNIEKRIPKKRGRKPGLGRGAPLNHVEAERQRREKLNHRF  333

Query  393  YALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKVKVEAVG--DNQs  220
            YALR+VVPNVSRMDKASLLSDAVSYINE+K KV++LE QLQ RESKKVK+E     DNQS
Sbjct  334  YALRAVVPNVSRMDKASLLSDAVSYINEMKAKVDKLESQLQ-RESKKVKMEVADTMDNQS  392

Query  219  tssa-----------assvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELA  73
            T+++           +      ++VEVK VG DAMIRVQS+N NYP+++LM+ LR+LE  
Sbjct  393  TTTSVDQAACRPNSNSGGAGLALEVEVKFVGNDAMIRVQSDNVNYPASRLMSALRDLEFQ  452

Query  72   VHHASISSVNDIMLQDI  22
            VHHAS+SSVN++MLQD+
Sbjct  453  VHHASMSSVNELMLQDV  469



>ref|XP_011039024.1| PREDICTED: transcription factor MYC2 isoform X1 [Populus euphratica]
Length=525

 Score =   228 bits (581),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 125/197 (63%), Positives = 151/197 (77%), Gaps = 18/197 (9%)
 Frame = -2

Query  573  SYPEXEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRF  394
            SY + EHSDSD  F+     V+ ++  PKKRGRKPG GR  P+NHVEAERQRREKLNHRF
Sbjct  278  SYVDSEHSDSDFHFVA----VNIEKRIPKKRGRKPGLGRGAPLNHVEAERQRREKLNHRF  333

Query  393  YALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKVKVEAVG--DNQs  220
            YALR+VVPNVSRMDKASLLSDAVSYINE+K KV++LE QLQ RESKKVK+E     DNQS
Sbjct  334  YALRAVVPNVSRMDKASLLSDAVSYINEMKAKVDKLESQLQ-RESKKVKMEVADTMDNQS  392

Query  219  tssaassva-----------SPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELA  73
            T+++    A             ++VEVK VG DAMIRVQS+N NYP+++LM+ LR+LE  
Sbjct  393  TTTSVDQAACRPNSNSGGAGLALEVEVKFVGNDAMIRVQSDNVNYPASRLMSALRDLEFQ  452

Query  72   VHHASISSVNDIMLQDI  22
            VHHAS+SSVN++MLQD+
Sbjct  453  VHHASMSSVNELMLQDV  469



>ref|XP_004306627.1| PREDICTED: transcription factor MYC2 [Fragaria vesca subsp. vesca]
Length=491

 Score =   227 bits (578),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 126/196 (64%), Positives = 145/196 (74%), Gaps = 28/196 (14%)
 Frame = -2

Query  558  EHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYALRS  379
            + +DSD Q           +  PKKRGRKPG GR TP+NHVEAERQRREKLNHRFYALR+
Sbjct  281  DFADSDFQL----------KRTPKKRGRKPGMGRDTPLNHVEAERQRREKLNHRFYALRA  330

Query  378  VVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKVKVEAVG--DNQstssaa  205
            VVPNVSRMDKASLLSDAVSYINELK KV+ELE QLQ RESKKVKVE     DNQST++ A
Sbjct  331  VVPNVSRMDKASLLSDAVSYINELKAKVDELESQLQ-RESKKVKVEMADNLDNQSTTTTA  389

Query  204  ssvaS---------------PVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAV  70
            S   +                +++EVKIVG DAMIRVQSEN NYPSA+LM  +R+LE  +
Sbjct  390  SVEQTQTVTPDNNNNNNNGSGLEIEVKIVGTDAMIRVQSENVNYPSARLMTAMRDLEFQI  449

Query  69   HHASISSVNDIMLQDI  22
            HHAS+SS+ND+MLQDI
Sbjct  450  HHASLSSINDLMLQDI  465



>ref|XP_007219048.1| hypothetical protein PRUPE_ppa004680mg [Prunus persica]
 gb|EMJ20247.1| hypothetical protein PRUPE_ppa004680mg [Prunus persica]
Length=496

 Score =   226 bits (576),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 128/194 (66%), Positives = 149/194 (77%), Gaps = 25/194 (13%)
 Frame = -2

Query  567  PEXEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYA  388
            P+ ++SDSD             +  PKKRGRKPG GR TP+NHVEAERQRREKLNHRFYA
Sbjct  291  PKPDYSDSDGP-----------KRTPKKRGRKPGLGRDTPLNHVEAERQRREKLNHRFYA  339

Query  387  LRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKVKVEAVGDN---Qst  217
            LR+VVPNVSRMDKASLLSDAVSYINELK KV+ELE Q+Q RESKKVKVE  GDN   QST
Sbjct  340  LRAVVPNVSRMDKASLLSDAVSYINELKTKVDELESQVQ-RESKKVKVE-TGDNLDIQST  397

Query  216  ssaassvaSP---------VDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHH  64
            +++   +A P         ++VEVKIVG DAMIRVQSEN NYPSA+LM  LR+LEL +HH
Sbjct  398  TTSVEQIAKPPSSSANGSGLEVEVKIVGTDAMIRVQSENVNYPSARLMAALRDLELQIHH  457

Query  63   ASISSVNDIMLQDI  22
            AS+S +N++MLQDI
Sbjct  458  ASLSCINELMLQDI  471



>gb|KDO86574.1| hypothetical protein CISIN_1g046178mg [Citrus sinensis]
Length=515

 Score =   226 bits (576),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 123/194 (63%), Positives = 148/194 (76%), Gaps = 17/194 (9%)
 Frame = -2

Query  564  EXEHSDSDCQFLKEPPIVDR----QQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHR  397
            + EHSDSDC     PP V+     ++  PKKRGRKPG GR TP+NHVEAERQRREKLNHR
Sbjct  302  DSEHSDSDCPL---PPPVNNISAVEKRTPKKRGRKPGLGRETPLNHVEAERQRREKLNHR  358

Query  396  FYALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKVKVEAVGDNQst  217
            FYALR+VVPNVSRMDKASLLSDAVSYI ELK K+++LE QL  RESKKVK+E + DN ST
Sbjct  359  FYALRAVVPNVSRMDKASLLSDAVSYIRELKVKIDDLESQLLQRESKKVKLE-ISDNHST  417

Query  216  ssaassvaSP---------VDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHH  64
            +++                ++VE KI+G DAMIRVQSEN N+P+AKLM+ LR+L+L +HH
Sbjct  418  TTSVDQARPSSAGSGGGFNLEVETKIMGSDAMIRVQSENVNHPAAKLMSSLRDLDLQLHH  477

Query  63   ASISSVNDIMLQDI  22
            AS+S VND+MLQDI
Sbjct  478  ASMSCVNDLMLQDI  491



>ref|XP_006444764.1| hypothetical protein CICLE_v10019749mg [Citrus clementina]
 gb|ESR58004.1| hypothetical protein CICLE_v10019749mg [Citrus clementina]
Length=515

 Score =   226 bits (576),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 123/194 (63%), Positives = 148/194 (76%), Gaps = 17/194 (9%)
 Frame = -2

Query  564  EXEHSDSDCQFLKEPPIVDR----QQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHR  397
            + EHSDSDC     PP V+     ++  PKKRGRKPG GR TP+NHVEAERQRREKLNHR
Sbjct  302  DSEHSDSDCPL---PPPVNNISAVEKRTPKKRGRKPGLGRETPLNHVEAERQRREKLNHR  358

Query  396  FYALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKVKVEAVGDNQst  217
            FYALR+VVPNVSRMDKASLLSDAVSYI ELK K+++LE QL  RESKKVK+E + DN ST
Sbjct  359  FYALRAVVPNVSRMDKASLLSDAVSYIRELKVKIDDLESQLLQRESKKVKLE-ISDNHST  417

Query  216  ssaassvaSP---------VDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHH  64
            +++                ++VE KI+G DAMIRVQSEN N+P+AKLM+ LR+L+L +HH
Sbjct  418  TTSVDQARPSSAGSGGGFNLEVETKIMGSDAMIRVQSENVNHPAAKLMSSLRDLDLQLHH  477

Query  63   ASISSVNDIMLQDI  22
            AS+S VND+MLQDI
Sbjct  478  ASMSCVNDLMLQDI  491



>gb|ABK94979.1| unknown [Populus trichocarpa]
Length=491

 Score =   225 bits (573),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 125/196 (64%), Positives = 146/196 (74%), Gaps = 17/196 (9%)
 Frame = -2

Query  573  SYPEXEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRF  394
            SY   EHSDSD   L     +  ++  PKKRGRKPG GR  P+NHVEAERQRREKLNHRF
Sbjct  278  SYLNSEHSDSDFPLLA----MHMEKRIPKKRGRKPGLGRDAPLNHVEAERQRREKLNHRF  333

Query  393  YALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKVKVEAVG--DNQs  220
            YALR+VVPNVSRMDKASLLSDAVSYINELK KV+ELE QL+ RESKKVK+E     DNQS
Sbjct  334  YALRAVVPNVSRMDKASLLSDAVSYINELKAKVDELESQLE-RESKKVKLEVADNLDNQS  392

Query  219  tss----------aassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAV  70
            T++          +A      ++VE+K VG DAMIRVQSEN NYP+++LM  LRELE  V
Sbjct  393  TTTSVDQSACRPNSAGGAGLALEVEIKFVGNDAMIRVQSENVNYPASRLMCALRELEFQV  452

Query  69   HHASISSVNDIMLQDI  22
            HHAS+S VN++MLQD+
Sbjct  453  HHASMSCVNELMLQDV  468



>ref|XP_002301432.1| basic helix-loop-helix family protein [Populus trichocarpa]
 gb|EEE80705.1| basic helix-loop-helix family protein [Populus trichocarpa]
Length=491

 Score =   225 bits (573),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 125/196 (64%), Positives = 146/196 (74%), Gaps = 17/196 (9%)
 Frame = -2

Query  573  SYPEXEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRF  394
            SY   EHSDSD   L     +  ++  PKKRGRKPG GR  P+NHVEAERQRREKLNHRF
Sbjct  278  SYLNSEHSDSDFPLLA----MHMEKRIPKKRGRKPGLGRDAPLNHVEAERQRREKLNHRF  333

Query  393  YALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKVKVEAVG--DNQs  220
            YALR+VVPNVSRMDKASLLSDAVSYINELK KV+ELE QL+ RESKKVK+E     DNQS
Sbjct  334  YALRAVVPNVSRMDKASLLSDAVSYINELKAKVDELESQLE-RESKKVKLEVADNLDNQS  392

Query  219  tss----------aassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAV  70
            T++          +A      ++VE+K VG DAMIRVQSEN NYP+++LM  LRELE  V
Sbjct  393  TTTSVDQSACRPNSAGGAGLALEVEIKFVGNDAMIRVQSENVNYPASRLMCALRELEFQV  452

Query  69   HHASISSVNDIMLQDI  22
            HHAS+S VN++MLQD+
Sbjct  453  HHASMSCVNELMLQDV  468



>ref|XP_002266775.1| PREDICTED: transcription factor MYC2-like [Vitis vinifera]
Length=497

 Score =   223 bits (568),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 123/200 (62%), Positives = 148/200 (74%), Gaps = 24/200 (12%)
 Frame = -2

Query  564  EXEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYAL  385
            E EHSDSDC  +     V  ++  PKKRGRKP  GR  P+NHVEAERQRREKLNHRFYAL
Sbjct  279  ESEHSDSDCPLVA----VTVEKRVPKKRGRKPRLGRDAPLNHVEAERQRREKLNHRFYAL  334

Query  384  RSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKVKVEA--VGDNQstss  211
            R+VVPNVSRMDKASLL+DAVSYINELK KV+ELE Q+  +ESKKVK+E     DNQST++
Sbjct  335  RAVVPNVSRMDKASLLADAVSYINELKAKVDELESQVH-KESKKVKLEMADTTDNQSTTT  393

Query  210  -----------------aassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLREL  82
                             +A+     ++VE+KIVGPDAMIRVQS+N N+PSA+LM  LR+L
Sbjct  394  SVDQTGPTPPPPPPPPSSATGGGVALEVEIKIVGPDAMIRVQSDNHNHPSARLMGALRDL  453

Query  81   ELAVHHASISSVNDIMLQDI  22
            E  VHHAS+SS+ND+MLQD+
Sbjct  454  EFQVHHASMSSINDLMLQDV  473



>gb|KJB41602.1| hypothetical protein B456_007G111800 [Gossypium raimondii]
Length=495

 Score =   221 bits (564),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 127/201 (63%), Positives = 148/201 (74%), Gaps = 21/201 (10%)
 Frame = -2

Query  573  SYPEXEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRF  394
            SY + EHSDSD   L    +   ++  PKKRGRKPG GR TP+NHVEAERQRREKLNHRF
Sbjct  274  SYVDSEHSDSDFPLLAMNNV---EKRTPKKRGRKPGLGRETPLNHVEAERQRREKLNHRF  330

Query  393  YALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKVKVEAVG--DNQs  220
            YALR+VVPNVSRMDKASLLSDAVSYI +LK K++ELE QLQ RE KKVKVE V   DNQS
Sbjct  331  YALRAVVPNVSRMDKASLLSDAVSYITDLKAKIDELESQLQ-RERKKVKVEMVDTMDNQS  389

Query  219  tssaass---------------vaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRE  85
            T++  +S                 S +++EVKI+  DAMIRV SEN NYP+A+LM  LR+
Sbjct  390  TTTTTTSEEEQQATRPSYSSPGTGSGIELEVKIMVNDAMIRVHSENVNYPAARLMGALRD  449

Query  84   LELAVHHASISSVNDIMLQDI  22
            LE  VHHAS+SSVND+MLQDI
Sbjct  450  LEFQVHHASMSSVNDLMLQDI  470



>ref|XP_009375455.1| PREDICTED: transcription factor MYC2-like [Pyrus x bretschneideri]
Length=496

 Score =   220 bits (561),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 124/190 (65%), Positives = 143/190 (75%), Gaps = 23/190 (12%)
 Frame = -2

Query  558  EHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYALRS  379
            EHSDS  +F K           PKKRGRKPG GR TP+NHVEAERQRREKLNHRFYALR+
Sbjct  294  EHSDS--EFPKR---------TPKKRGRKPGLGRDTPLNHVEAERQRREKLNHRFYALRA  342

Query  378  VVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKVKVEAVG--DNQstssaa  205
            VVPNVSRMDKASLLSDAVSYINELK KV+ELE Q+Q RESKKVKVE     DNQST+++ 
Sbjct  343  VVPNVSRMDKASLLSDAVSYINELKSKVDELESQVQ-RESKKVKVETGDNLDNQSTTTSV  401

Query  204  ssvaSP---------VDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASIS  52
                 P         +++EVKIVG DAMIRVQS N NYPSA+LM  LR+LE  +HHAS+S
Sbjct  402  EQTRPPNSSASGSTGLEMEVKIVGSDAMIRVQSANVNYPSARLMAALRDLEFEIHHASLS  461

Query  51   SVNDIMLQDI  22
             +N++MLQD+
Sbjct  462  CMNELMLQDV  471



>ref|XP_008370350.1| PREDICTED: transcription factor MYC2 [Malus domestica]
Length=496

 Score =   219 bits (558),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 124/190 (65%), Positives = 141/190 (74%), Gaps = 23/190 (12%)
 Frame = -2

Query  558  EHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYALRS  379
            EHSDS  +F K           PKKRGRKPG GR TP+NHVEAERQRREKLNHRFYALR+
Sbjct  294  EHSDS--EFPKR---------TPKKRGRKPGLGRDTPLNHVEAERQRREKLNHRFYALRA  342

Query  378  VVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKVKVEAVG--DNQstssaa  205
            VVPNVSRMDKASLLSDAVSYINELK KV+ELE Q+Q RESKKVKVE     DNQST+++ 
Sbjct  343  VVPNVSRMDKASLLSDAVSYINELKXKVDELESQVQ-RESKKVKVETGDNLDNQSTTTSV  401

Query  204  ssvaSP---------VDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASIS  52
                 P          + EVKIVG DAMIRVQS N NYPSA+LM  LR+LE  +HHAS+S
Sbjct  402  EQTRPPNSSASGSTGFETEVKIVGSDAMIRVQSANVNYPSARLMAALRDLEFEIHHASLS  461

Query  51   SVNDIMLQDI  22
             +N++MLQD+
Sbjct  462  CMNELMLQDV  471



>gb|KJB24531.1| hypothetical protein B456_004G149500 [Gossypium raimondii]
Length=476

 Score =   218 bits (554),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 116/202 (57%), Positives = 150/202 (74%), Gaps = 19/202 (9%)
 Frame = -2

Query  573  SYPEXEHSDSDCQF---LKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLN  403
            S+   +HSDS+C+F    +     + ++  PKKRGRKPG+GR T +NHVEAERQRREKLN
Sbjct  250  SFVNSDHSDSECRFRAATESNSNSNTEKRIPKKRGRKPGSGRETLLNHVEAERQRREKLN  309

Query  402  HRFYALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKVKVEAVG--D  229
            HRFYALR+VVPNVSRMDKASLLSDAV+YINELK K+E+L+ +L  R+ KKVK+E V   D
Sbjct  310  HRFYALRAVVPNVSRMDKASLLSDAVAYINELKSKIEDLQSELG-RDRKKVKIETVDGMD  368

Query  228  NQstssaassvaSP-------------VDVEVKIVGPDAMIRVQSENANYPSAKLMNGLR  88
            NQST+++    A P              ++++KI+G DAMIRVQSEN N+P+A+LM+ LR
Sbjct  369  NQSTTTSVEQAAKPSSNSSSGNAGSNGFELDIKIIGNDAMIRVQSENVNHPAARLMDALR  428

Query  87   ELELAVHHASISSVNDIMLQDI  22
             LE  VHHAS+S VND+M+QD+
Sbjct  429  NLEFRVHHASMSCVNDLMIQDV  450



>ref|XP_007135301.1| hypothetical protein PHAVU_010G117900g [Phaseolus vulgaris]
 gb|ESW07295.1| hypothetical protein PHAVU_010G117900g [Phaseolus vulgaris]
Length=464

 Score =   217 bits (552),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 119/198 (60%), Positives = 143/198 (72%), Gaps = 17/198 (9%)
 Frame = -2

Query  570  YPEXEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFY  391
            Y + EHSDSDC  L          + PKKRGRKP  GR TP+NHVEAERQRREKLNHRFY
Sbjct  245  YVDSEHSDSDCPMLPT--TTTPTASEPKKRGRKPVIGRETPMNHVEAERQRREKLNHRFY  302

Query  390  ALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKVKVEAVG--DNQst  217
            ALR+VVPNVSRMDKASLLSDAV+YINELK K+E LE Q Q   +K+VK E +   DNQST
Sbjct  303  ALRAVVPNVSRMDKASLLSDAVTYINELKAKIEYLESQQQREGNKRVKTEMMDTMDNQST  362

Query  216  ssaassva-------------SPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELEL  76
            ++  +S                 ++++VKI+GPDAM+RVQSENAN+P A+LM  LR+LE 
Sbjct  363  TTTTTSTIVDQSRPGAGGPCPFGLEIDVKIMGPDAMVRVQSENANHPGARLMGALRDLEF  422

Query  75   AVHHASISSVNDIMLQDI  22
             VHHAS+S VND+MLQD+
Sbjct  423  QVHHASMSCVNDLMLQDV  440



>ref|XP_011023113.1| PREDICTED: transcription factor MYC2-like [Populus euphratica]
Length=491

 Score =   216 bits (551),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 123/195 (63%), Positives = 143/195 (73%), Gaps = 17/195 (9%)
 Frame = -2

Query  570  YPEXEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFY  391
            Y   E SDSD   L     +  ++  PKKRGRKPG GR  P+NHVEAERQRREKLNHRFY
Sbjct  279  YLNSEPSDSDFPLLA----MHMEKRIPKKRGRKPGLGRDAPLNHVEAERQRREKLNHRFY  334

Query  390  ALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKVKVEAVG--DNQst  217
            ALR+VVPNVSRMDKASLLSDAVSYINELK KV+ELE QL+ RE KKVK+E     DNQST
Sbjct  335  ALRAVVPNVSRMDKASLLSDAVSYINELKAKVDELESQLE-REFKKVKLEVADNLDNQST  393

Query  216  ss----------aassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVH  67
            ++          +A      ++VEVK VG DAMIRVQSEN NYP+++LM  LRELE  VH
Sbjct  394  TTSVDQSACRPNSAGGAGHALEVEVKFVGNDAMIRVQSENVNYPASRLMCALRELEFQVH  453

Query  66   HASISSVNDIMLQDI  22
            HAS+S VN++MLQD+
Sbjct  454  HASMSCVNELMLQDV  468



>gb|KHN15898.1| Transcription factor bHLH14 [Glycine soja]
Length=465

 Score =   216 bits (549),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 117/198 (59%), Positives = 142/198 (72%), Gaps = 16/198 (8%)
 Frame = -2

Query  573  SYPEXEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRF  394
            +Y + EHSDSDC  L         +  PKKRGRKP  GR TP+NHVEAERQRREKLNHRF
Sbjct  246  NYVDSEHSDSDCPTLPTATTPTASE--PKKRGRKPVLGRETPINHVEAERQRREKLNHRF  303

Query  393  YALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKVKVEAVG--DNQs  220
            YALR+VVPNVSRMDKASLLSDAV+YINELK K+E+LE Q     +KK+K E     DNQS
Sbjct  304  YALRAVVPNVSRMDKASLLSDAVAYINELKAKIEDLESQQPRDSNKKMKTEMTDTLDNQS  363

Query  219  tssaassvaSP------------VDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELEL  76
             ++ ++ V               ++V+V+IVGPDAM+RVQSEN N+P A+LM  LR+LE 
Sbjct  364  ATTTSTVVDQSGSGSRLGLGPLGLEVDVRIVGPDAMVRVQSENVNHPGARLMGALRDLEF  423

Query  75   AVHHASISSVNDIMLQDI  22
             VHHAS+S VND+MLQD+
Sbjct  424  QVHHASMSCVNDLMLQDV  441



>ref|XP_003548195.1| PREDICTED: transcription factor MYC2-like [Glycine max]
Length=466

 Score =   216 bits (549),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 117/198 (59%), Positives = 142/198 (72%), Gaps = 16/198 (8%)
 Frame = -2

Query  573  SYPEXEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRF  394
            +Y + EHSDSDC  L         +  PKKRGRKP  GR TP+NHVEAERQRREKLNHRF
Sbjct  247  NYVDSEHSDSDCPTLPTATTPTASE--PKKRGRKPVLGRETPINHVEAERQRREKLNHRF  304

Query  393  YALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKVKVEAVG--DNQs  220
            YALR+VVPNVSRMDKASLLSDAV+YINELK K+E+LE Q     +KK+K E     DNQS
Sbjct  305  YALRAVVPNVSRMDKASLLSDAVAYINELKAKIEDLESQQPRDSNKKMKTEMTDTLDNQS  364

Query  219  tssaassvaSP------------VDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELEL  76
             ++ ++ V               ++V+V+IVGPDAM+RVQSEN N+P A+LM  LR+LE 
Sbjct  365  ATTTSTVVDQSGSGSRLGLGPLGLEVDVRIVGPDAMVRVQSENVNHPGARLMGALRDLEF  424

Query  75   AVHHASISSVNDIMLQDI  22
             VHHAS+S VND+MLQD+
Sbjct  425  QVHHASMSCVNDLMLQDV  442



>gb|KJB09595.1| hypothetical protein B456_001G151700 [Gossypium raimondii]
Length=502

 Score =   216 bits (549),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 123/197 (62%), Positives = 142/197 (72%), Gaps = 20/197 (10%)
 Frame = -2

Query  564  EXEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYAL  385
            + EHSDSD   L    +   +Q  P+KRGRKPG GR TP+NHVEAERQRREKLNHRFYAL
Sbjct  285  DSEHSDSDRPSLA---MSHLEQKTPQKRGRKPGLGRETPLNHVEAERQRREKLNHRFYAL  341

Query  384  RSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKVKVEA--VGDNQstss  211
            R+VVPNVSRMDKASLLSDAVSYINELK K+EELE QLQ RE KK KVE   V DN ST++
Sbjct  342  RAVVPNVSRMDKASLLSDAVSYINELKAKIEELESQLQ-RECKKPKVEMVDVTDNHSTTT  400

Query  210  aassvaSPVD--------------VEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELA  73
            +    A+  D               ++KI+G DAMIRVQSENANYP  +LM  LR+LE  
Sbjct  401  SVEQEAAKPDNSPSPATAGCVGLEFDIKIMGNDAMIRVQSENANYPVTRLMVALRDLEFP  460

Query  72   VHHASISSVNDIMLQDI  22
            +HHAS+S VN+ MLQDI
Sbjct  461  IHHASMSCVNETMLQDI  477



>ref|XP_002529968.1| transcription factor, putative [Ricinus communis]
 gb|EEF32411.1| transcription factor, putative [Ricinus communis]
Length=288

 Score =   208 bits (530),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 111/196 (57%), Positives = 139/196 (71%), Gaps = 18/196 (9%)
 Frame = -2

Query  564  EXEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYAL  385
            + EHSDSD        +   ++ +PKKRGRKP  G    + HVEAERQRREKLNHRFYAL
Sbjct  72   DSEHSDSDFSLFAAASL---EKKSPKKRGRKPALGGDKALKHVEAERQRREKLNHRFYAL  128

Query  384  RSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKVKVEA--VGDNQstss  211
            R+VVPNVSRMDKASLLSDAVSYIN+LK K++ELE QL +  SK VK+E     DNQST++
Sbjct  129  RAVVPNVSRMDKASLLSDAVSYINDLKAKIDELESQLHIDSSKTVKLEVADTKDNQSTTT  188

Query  210  a-------------assvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAV  70
                          +++   P++VEVK +G DAMIRVQSEN NYP+A+LM  LRELE  V
Sbjct  189  TSDDQAASRPISSVSTTNGFPLEVEVKSLGNDAMIRVQSENVNYPAARLMTALRELEFQV  248

Query  69   HHASISSVNDIMLQDI  22
            H  ++S+VN++MLQD+
Sbjct  249  HRVTMSTVNELMLQDV  264



>ref|XP_003528771.1| PREDICTED: transcription factor MYC2-like [Glycine max]
 gb|KHN06348.1| Transcription factor bHLH14 [Glycine soja]
Length=464

 Score =   213 bits (541),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 120/198 (61%), Positives = 140/198 (71%), Gaps = 16/198 (8%)
 Frame = -2

Query  573  SYPEXEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRF  394
            +Y   EHSDSDC  L          + PKKRGRKP  GR TPVNHVEAERQRREKLNHRF
Sbjct  245  NYVNSEHSDSDCPTLPT--ATTPTTSEPKKRGRKPILGRETPVNHVEAERQRREKLNHRF  302

Query  393  YALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKVKVEAVG--DNQs  220
            YALR+VVPNVSRMDKASLLSDAV+YI+ELK K+E LE Q     SKKVK E     DN S
Sbjct  303  YALRAVVPNVSRMDKASLLSDAVAYISELKAKIEYLESQQPRDSSKKVKTEMTDTLDNHS  362

Query  219  tssaassvaSP------------VDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELEL  76
            T++ ++ V               ++V+VKIVGPDAM+RVQSEN N+P A+LM  LR+LE 
Sbjct  363  TTTISTVVDQSGPEPRLGPSPLGLEVDVKIVGPDAMVRVQSENVNHPGARLMGALRDLEF  422

Query  75   AVHHASISSVNDIMLQDI  22
             VHHAS+S VND+MLQD+
Sbjct  423  QVHHASMSCVNDLMLQDV  440



>ref|XP_009592442.1| PREDICTED: transcription factor MYC2-like [Nicotiana tomentosiformis]
Length=439

 Score =   211 bits (536),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 118/191 (62%), Positives = 145/191 (76%), Gaps = 10/191 (5%)
 Frame = -2

Query  573  SYPEXEHSDSDCQFLKEP---PIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLN  403
            S+P+ E S SDCQ L+ P     V  ++   KKRGRKPG      +NHVE ERQRREKLN
Sbjct  224  SFPDSELSASDCQLLEHPVQKSRVGSKKRTYKKRGRKPGEDCDKQMNHVEVERQRREKLN  283

Query  402  HRFYALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQ--LRESKKVKVEA--V  235
            HRFYALRSVVP V+RMDKASLLSDAV+YINELK KV++LE +L   L   KK+++E+   
Sbjct  284  HRFYALRSVVPQVTRMDKASLLSDAVAYINELKAKVDKLESKLHRNLELKKKLQMESNDA  343

Query  234  GDNQstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASI  55
             DNQ   S+ +SV   ++VEVK+VGP+AMIRVQSENANYPS +LM  L++LEL VHHASI
Sbjct  344  VDNQ---SSTNSVDLTLEVEVKMVGPNAMIRVQSENANYPSTRLMCALQDLELHVHHASI  400

Query  54   SSVNDIMLQDI  22
            SSVN+I+LQ+I
Sbjct  401  SSVNNILLQNI  411



>ref|XP_002529965.1| DNA binding protein, putative [Ricinus communis]
 gb|EEF32408.1| DNA binding protein, putative [Ricinus communis]
Length=486

 Score =   210 bits (535),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 109/172 (63%), Positives = 131/172 (76%), Gaps = 14/172 (8%)
 Frame = -2

Query  495  APKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYI  316
             PKKRGRKP  GR TP+NHVEAER RREKLNHRFYALR+VVPNVSRMDKASLLSDAV YI
Sbjct  291  TPKKRGRKPALGRDTPLNHVEAERLRREKLNHRFYALRAVVPNVSRMDKASLLSDAVCYI  350

Query  315  NELKGKVEELECQLQLRESKKVKVEAV--GDNQstssaa------------ssvaSPVDV  178
            NELK K+EELE QL  + SK+VK+E     DNQST+++             ++   P ++
Sbjct  351  NELKAKIEELESQLHRKSSKRVKLEVADNTDNQSTTTSEDQAASKPISTVCTTTGFPPEI  410

Query  177  EVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQDI  22
            EVKI+  DAMIRVQSEN NYP+A+LM  LR+LE  VHH S+S+VN++MLQD+
Sbjct  411  EVKILANDAMIRVQSENVNYPAARLMTALRDLEFQVHHVSMSTVNELMLQDV  462



>gb|KCW83845.1| hypothetical protein EUGRSUZ_B00713 [Eucalyptus grandis]
Length=490

 Score =   211 bits (536),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 116/189 (61%), Positives = 145/189 (77%), Gaps = 12/189 (6%)
 Frame = -2

Query  564  EXEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYAL  385
            E EHSDS   F+    +V  ++  PKKRGRKPG G   P+NHVEAERQRREKLNHRFYAL
Sbjct  282  ESEHSDSGSPFMA---VVMTEKRTPKKRGRKPGLGLDPPLNHVEAERQRREKLNHRFYAL  338

Query  384  RSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKVKVEAV-GDNQstssa  208
            R+VVPNVS+MDK+SLLSDAVSYINELK K+ +LE Q+Q RESKK K E     +  +S++
Sbjct  339  RAVVPNVSKMDKSSLLSDAVSYINELKSKISDLESQMQ-RESKKFKQEVTDATDNLSSTS  397

Query  207  assvaSP-------VDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISS  49
            +   +SP       ++VEVKIVG DAMIRVQS+NANY SA+LM  +R+LEL +HHAS+S+
Sbjct  398  SVDHSSPSGCGGSLLEVEVKIVGCDAMIRVQSQNANYMSARLMAVMRDLELHIHHASLSA  457

Query  48   VNDIMLQDI  22
            VND++LQD+
Sbjct  458  VNDLLLQDV  466



>ref|XP_010031905.1| PREDICTED: transcription factor MYC2-like [Eucalyptus grandis]
Length=490

 Score =   210 bits (535),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 116/189 (61%), Positives = 145/189 (77%), Gaps = 12/189 (6%)
 Frame = -2

Query  564  EXEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYAL  385
            E EHSDS   F+    +V  ++  PKKRGRKPG G   P+NHVEAERQRREKLNHRFYAL
Sbjct  282  ESEHSDSGSPFMA---VVMTEKRTPKKRGRKPGLGLDPPLNHVEAERQRREKLNHRFYAL  338

Query  384  RSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKVKVEAV-GDNQstssa  208
            R+VVPNVS+MDK+SLLSDAVSYINELK K+ +LE Q+Q RESKK K E     +  +S++
Sbjct  339  RAVVPNVSKMDKSSLLSDAVSYINELKSKISDLESQMQ-RESKKFKQEVTDATDNLSSTS  397

Query  207  assvaSP-------VDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISS  49
            +   +SP       ++VEVKIVG DAMIRVQS+NANY SA+LM  +R+LEL +HHAS+S+
Sbjct  398  SVDHSSPSGCGGSLLEVEVKIVGCDAMIRVQSQNANYMSARLMAVMRDLELHIHHASLSA  457

Query  48   VNDIMLQDI  22
            VND++LQD+
Sbjct  458  VNDLLLQDV  466



>ref|XP_010909816.1| PREDICTED: transcription factor MYC4-like [Elaeis guineensis]
Length=437

 Score =   209 bits (532),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 111/188 (59%), Positives = 139/188 (74%), Gaps = 19/188 (10%)
 Frame = -2

Query  564  EXEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYAL  385
            + EHSDS+   + E       Q  PKKRGRKPG GR TPVNHVEAERQRREKLNHRFYAL
Sbjct  237  DSEHSDSEGALMME-------QRRPKKRGRKPGTGRETPVNHVEAERQRREKLNHRFYAL  289

Query  384  RSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKVKVEAVGDNQstssaa  205
            RSVVPNVSRMDKASLL+DAVSYI  L+ KVEELE      E+K++K E +GD     +A 
Sbjct  290  RSVVPNVSRMDKASLLADAVSYIKVLRAKVEELEA-----EAKRIKKEVIGDQGVGGAAT  344

Query  204  ssvaS-------PVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSV  46
            +S  +        +++EVK++GPDA+IRV S+N N+P+AKLM  LR+LE+ VHHAS+S+V
Sbjct  345  TSTTTTVSSGPLTMELEVKMLGPDALIRVHSDNLNHPTAKLMGALRDLEVNVHHASVSTV  404

Query  45   NDIMLQDI  22
             ++MLQD+
Sbjct  405  KEVMLQDV  412



>gb|KEH18600.1| basic helix loop helix (bHLH) family transcription factor [Medicago 
truncatula]
Length=464

 Score =   205 bits (522),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 111/196 (57%), Positives = 147/196 (75%), Gaps = 16/196 (8%)
 Frame = -2

Query  564  EXEHSDSD-CQFLKEPPIVDRQQNA-----PKKRGRKPGAGRVTPVNHVEAERQRREKLN  403
            + E+SDS+ C  L  P     ++++     PKKRGRKP +G  TP+NHVEAERQRREKLN
Sbjct  245  DSENSDSEYCPPLATPTKTRTEKDSFEKREPKKRGRKPLSGTQTPMNHVEAERQRREKLN  304

Query  402  HRFYALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKVKVEA--VGD  229
            HRFYALRSVVPNVS+MDKASLLSDAV YINELK K+E+LE  +Q +ESKKVK+E   + D
Sbjct  305  HRFYALRSVVPNVSKMDKASLLSDAVDYINELKSKIEDLES-VQQKESKKVKMETMEIVD  363

Query  228  NQstssaass-------vaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAV  70
            N S ++ ++          +  +++VKI+G DAM+RVQSEN N+P A+LM+ L++LE  V
Sbjct  364  NNSATTTSTVVDQKRPCNVNAFEIDVKIIGNDAMVRVQSENVNHPGARLMSVLKDLEFQV  423

Query  69   HHASISSVNDIMLQDI  22
            HHASIS+VN++M+QD+
Sbjct  424  HHASISTVNEVMVQDV  439



>ref|XP_009766909.1| PREDICTED: transcription factor MYC2 [Nicotiana sylvestris]
 ref|XP_009766910.1| PREDICTED: transcription factor MYC2 [Nicotiana sylvestris]
Length=444

 Score =   203 bits (516),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 112/165 (68%), Positives = 128/165 (78%), Gaps = 9/165 (5%)
 Frame = -2

Query  489  KKRGRKPGAG----RVTPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVS  322
            KKRGRKP  G     +  +NHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVS
Sbjct  254  KKRGRKPKGGDSNINMVALNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVS  313

Query  321  YINELKGKVEELECQL--QLRESKKVKVEAVGDNQstssaassvaSP---VDVEVKIVGP  157
            YIN+LK KV+ELE QL      +KK K    G+NQST+++      P    +VEVKIVGP
Sbjct  314  YINQLKTKVDELESQLIDHSNSNKKQKSNESGENQSTNTSVDQELRPNSSSEVEVKIVGP  373

Query  156  DAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQDI  22
            DAMIRVQSEN N+PSAKLM+ LR L+L VHHASISSVN++ML D+
Sbjct  374  DAMIRVQSENVNHPSAKLMSALRHLQLQVHHASISSVNNLMLHDV  418



>gb|KJB49615.1| hypothetical protein B456_008G128800 [Gossypium raimondii]
Length=487

 Score =   202 bits (514),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 118/203 (58%), Positives = 145/203 (71%), Gaps = 23/203 (11%)
 Frame = -2

Query  573  SYPEXEHSDSDCQFLKEPPIVDRQQN--APKKRGRKPGAGRVTPVNHVEAERQRREKLNH  400
            SY + E+SD DC  L     V+  +N   PKKRGRKP   R TPVNHVEAERQRREKLNH
Sbjct  265  SYVDSENSDFDCPLLA----VNNTENIRTPKKRGRKPCLRRDTPVNHVEAERQRREKLNH  320

Query  399  RFYALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKVKVEAVG--DN  226
            RFYALR+ VPNVSRMDKASLLSDAV+YI ELK K+++LE QL+   ++KVKVE +   DN
Sbjct  321  RFYALRAAVPNVSRMDKASLLSDAVTYITELKSKIKDLESQLRKVCNEKVKVETIDAMDN  380

Query  225  Qstssaassva--------------SPVDVEVKIVG-PDAMIRVQSENANYPSAKLMNGL  91
            QST+++    A              S + ++VK+ G  DA+IRVQSEN NYPSA+LM+ L
Sbjct  381  QSTTTSEEQAAARPSNSSSAATGRFSDLQLDVKVKGNDDAIIRVQSENVNYPSARLMSAL  440

Query  90   RELELAVHHASISSVNDIMLQDI  22
            R+LE  VHHAS+S VN++MLQDI
Sbjct  441  RDLEFQVHHASMSCVNELMLQDI  463



>ref|XP_009623539.1| PREDICTED: transcription factor MYC3-like isoform X2 [Nicotiana 
tomentosiformis]
Length=448

 Score =   199 bits (505),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 112/166 (67%), Positives = 128/166 (77%), Gaps = 10/166 (6%)
 Frame = -2

Query  489  KKRGRKPGAG----RVTPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVS  322
            KKRGRKP  G     +  +NHVEAERQRREKLNHRFYALRS VPNVSRMDKASLLSDAVS
Sbjct  257  KKRGRKPKGGDNNINMAALNHVEAERQRREKLNHRFYALRSAVPNVSRMDKASLLSDAVS  316

Query  321  YINELKGKVEELECQL---QLRESKKVKVEAVGDNQstssaassvaSP---VDVEVKIVG  160
            YIN+LK KV+ELE QL       +KK K    G+NQST+++      P   ++VEVKIVG
Sbjct  317  YINQLKAKVDELELQLIDHSSSSNKKQKSNESGENQSTNTSVDQELRPNSSLEVEVKIVG  376

Query  159  PDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQDI  22
            PDAMIRVQSEN NYPSAKLM+ LR L+L VHHASISSVN++ML D+
Sbjct  377  PDAMIRVQSENVNYPSAKLMSALRHLQLQVHHASISSVNNLMLHDV  422



>ref|XP_008345582.1| PREDICTED: transcription factor bHLH14-like [Malus domestica]
Length=492

 Score =   200 bits (508),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 110/179 (61%), Positives = 135/179 (75%), Gaps = 12/179 (7%)
 Frame = -2

Query  525  EPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKA  346
            EP   +  +  PKKRGRKPG G  T ++HVEAERQRREKLNHRF ALR+VVPNVSRMDKA
Sbjct  290  EPSDSEFPKRTPKKRGRKPGLGXDTTLDHVEAERQRREKLNHRFCALRAVVPNVSRMDKA  349

Query  345  SLLSDAVSYINELKGKVEELECQLQLRESKKVKVEAVG--DNQstssaassvaSP-----  187
            SLLSDAVSYI ELK KV+E+E Q+Q RESKKVK E V   DNQS++++      P     
Sbjct  350  SLLSDAVSYIIELKSKVDEMESQVQ-RESKKVKAETVDNLDNQSSTTSVDQTRPPNSLVS  408

Query  186  ----VDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQDI  22
                ++VEVKIV  DAMIRV+SEN NYPSA+LM  LR+L+  ++HAS+S +N++MLQD+
Sbjct  409  GSTGLEVEVKIVCSDAMIRVRSENVNYPSARLMAALRDLDFEMYHASLSCMNELMLQDV  467



>ref|XP_009623534.1| PREDICTED: transcription factor MYC2-like isoform X1 [Nicotiana 
tomentosiformis]
Length=487

 Score =   199 bits (506),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 112/166 (67%), Positives = 128/166 (77%), Gaps = 10/166 (6%)
 Frame = -2

Query  489  KKRGRKPGAG----RVTPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVS  322
            KKRGRKP  G     +  +NHVEAERQRREKLNHRFYALRS VPNVSRMDKASLLSDAVS
Sbjct  296  KKRGRKPKGGDNNINMAALNHVEAERQRREKLNHRFYALRSAVPNVSRMDKASLLSDAVS  355

Query  321  YINELKGKVEELECQL---QLRESKKVKVEAVGDNQstssaassvaSP---VDVEVKIVG  160
            YIN+LK KV+ELE QL       +KK K    G+NQST+++      P   ++VEVKIVG
Sbjct  356  YINQLKAKVDELELQLIDHSSSSNKKQKSNESGENQSTNTSVDQELRPNSSLEVEVKIVG  415

Query  159  PDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQDI  22
            PDAMIRVQSEN NYPSAKLM+ LR L+L VHHASISSVN++ML D+
Sbjct  416  PDAMIRVQSENVNYPSAKLMSALRHLQLQVHHASISSVNNLMLHDV  461



>ref|XP_007039384.1| Basic helix-loop-helix DNA-binding family protein, putative [Theobroma 
cacao]
 gb|EOY23885.1| Basic helix-loop-helix DNA-binding family protein, putative [Theobroma 
cacao]
Length=473

 Score =   197 bits (502),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 103/172 (60%), Positives = 136/172 (79%), Gaps = 10/172 (6%)
 Frame = -2

Query  510  DRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSD  331
            D++ N   KRGRKPG+G+ +P+NHVEAERQRRE+LNHRFYALRSVVPNVS+MDKASLLSD
Sbjct  278  DKEFNVRSKRGRKPGSGKDSPLNHVEAERQRRERLNHRFYALRSVVPNVSKMDKASLLSD  337

Query  330  AVSYINELKGKVEELECQLQLRESKKVKVEAVG--DNQstssaassva-------SPVDV  178
            AV+YI EL+ KVEELE +L++ +S+K K+ A+   DNQ T+S   +           ++V
Sbjct  338  AVAYIKELRSKVEELEAKLRV-QSQKSKLNAINVFDNQITTSTFENTRPSPSYGPKTIEV  396

Query  177  EVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQDI  22
            +VKIVG +AMIRVQ  + NYP+A+LM+ LR+LEL VHHASIS+V +++LQD+
Sbjct  397  DVKIVGSEAMIRVQCPDVNYPAARLMDALRDLELHVHHASISNVKELVLQDV  448



>emb|CDP08631.1| unnamed protein product [Coffea canephora]
Length=419

 Score =   194 bits (492),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 117/199 (59%), Positives = 140/199 (70%), Gaps = 20/199 (10%)
 Frame = -2

Query  558  EHSDSDCQFLKEPPIVDRQ-----QNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRF  394
            E SDSDC  + E      Q         KKRGRK G GR TP+NHVEAERQRREKLNHRF
Sbjct  191  ESSDSDCVVVVETTTRSHQVERKGGVGGKKRGRKAGTGRETPLNHVEAERQRREKLNHRF  250

Query  393  YALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRES--KKVKVEAVGDNQs  220
            YALRSVVPNVSRMDKASLLSDAV+YI ELKGKV+ELE QL+  E   K VK+E    N +
Sbjct  251  YALRSVVPNVSRMDKASLLSDAVAYIKELKGKVDELESQLKRIEGNKKSVKIEVADSNGN  310

Query  219  ts-------------saassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELE  79
            T+             S    ++S V VEVK+VG DAM+RVQS+++ YP+A+LM+ +R+LE
Sbjct  311  TTDNHSTTTASSSSCSGGGGMSSNVQVEVKMVGTDAMVRVQSDSSGYPTARLMDAIRDLE  370

Query  78   LAVHHASISSVNDIMLQDI  22
            L VHHAS+S VND+MLQD+
Sbjct  371  LRVHHASMSHVNDLMLQDV  389



>ref|XP_004166899.1| PREDICTED: transcription factor ATR2-like [Cucumis sativus]
Length=431

 Score =   193 bits (491),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 113/201 (56%), Positives = 136/201 (68%), Gaps = 27/201 (13%)
 Frame = -2

Query  564  EXEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYAL  385
            E E SDSD   LK   +    +   +KRGRKP   +   +NHVEAERQRREKLN+RFYAL
Sbjct  215  EWELSDSDSPVLKTGVM----KKTGQKRGRKPNMSKENAMNHVEAERQRREKLNNRFYAL  270

Query  384  RSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKVKVEAVGDNQstssaa  205
            RSVVPNVSRMDKASLLSDAVSYIN LK KVEE+E  LQLRESKK + E  GDNQST++ +
Sbjct  271  RSVVPNVSRMDKASLLSDAVSYINALKAKVEEME--LQLRESKKSRDEG-GDNQSTTTTS  327

Query  204  ssvaSP--------------------VDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRE  85
              +                        DVEVKI+G DAM+RVQS+N N+PSA +M   R+
Sbjct  328  EELMKGNSGGGVTTPTITTTTTTMTRFDVEVKIIGRDAMVRVQSQNLNFPSAIVMGVFRD  387

Query  84   LELAVHHASISSVNDIMLQDI  22
            +E  + HASI++VNDIMLQD+
Sbjct  388  MEFEIQHASITNVNDIMLQDV  408



>ref|XP_004510627.1| PREDICTED: transcription factor bHLH14-like [Cicer arietinum]
Length=472

 Score =   194 bits (492),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 109/197 (55%), Positives = 145/197 (74%), Gaps = 21/197 (11%)
 Frame = -2

Query  570  YPEXEHSDSDCQFLKEPPIVDRQQN------APKKRGRKPGAGRVTPVNHVEAERQRREK  409
            Y + E+SDS+       P ++ ++N       PKKRGRKP  G  TP++HVEAERQRREK
Sbjct  258  YVDSEYSDSEYY-----PQLETKKNDSFEKREPKKRGRKPLLGNPTPMSHVEAERQRREK  312

Query  408  LNHRFYALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKVKVEAVGD  229
            +NHRFYALR+VVPNVSRMDKASLLSDAV +INELK K+ ELE + Q +E KK+K+E + D
Sbjct  313  INHRFYALRAVVPNVSRMDKASLLSDAVDFINELKSKIVELELE-QQKELKKLKIENM-D  370

Query  228  NQstssaassvaS--------PVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELA  73
            NQST++ ++ V           ++++VKI+G DAM+RVQ EN N+P A+LM+ L++LE  
Sbjct  371  NQSTATTSTVVDQKRISCNNISLEIDVKIIGGDAMVRVQCENVNHPGARLMSVLKDLEFQ  430

Query  72   VHHASISSVNDIMLQDI  22
            VHHASIS VN+IM+QD+
Sbjct  431  VHHASISCVNEIMVQDV  447



>ref|XP_004140617.1| PREDICTED: transcription factor ATR2-like [Cucumis sativus]
 gb|KGN46541.1| hypothetical protein Csa_6G107910 [Cucumis sativus]
Length=431

 Score =   192 bits (488),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 113/201 (56%), Positives = 135/201 (67%), Gaps = 27/201 (13%)
 Frame = -2

Query  564  EXEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYAL  385
            E E SDSD   LK   +    +   +KRGRKP   +   +NHVEAERQRREKLN+RFYAL
Sbjct  215  EWELSDSDSPVLKTGVM----KKTGQKRGRKPNMSKENAMNHVEAERQRREKLNNRFYAL  270

Query  384  RSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKVKVEAVGDNQstssaa  205
            RSVVPNVSRMDKASLLSDAVSYIN LK KVEE+E  LQLRESKK + E  GDNQST++ +
Sbjct  271  RSVVPNVSRMDKASLLSDAVSYINALKAKVEEME--LQLRESKKSRDEG-GDNQSTTTTS  327

Query  204  ssvaSP--------------------VDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRE  85
              +                        DVEVKI+G DAM+RVQS N N+PSA +M   R+
Sbjct  328  EELMKGNSGGGVTTPTITTTTTTMTRFDVEVKIIGRDAMVRVQSHNLNFPSAIVMGVFRD  387

Query  84   LELAVHHASISSVNDIMLQDI  22
            +E  + HASI++VNDIMLQD+
Sbjct  388  MEFEIQHASITNVNDIMLQDV  408



>ref|XP_002320222.1| basic helix-loop-helix family protein [Populus trichocarpa]
 gb|EEE98537.1| basic helix-loop-helix family protein [Populus trichocarpa]
Length=430

 Score =   190 bits (483),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 102/156 (65%), Positives = 124/156 (79%), Gaps = 14/156 (9%)
 Frame = -2

Query  450  PVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQ  271
            P+NHVEAERQRREKLNHRFYALR+VVPNVSRMDKASLLSDAVSYINE+K KV++LE +LQ
Sbjct  252  PLNHVEAERQRREKLNHRFYALRAVVPNVSRMDKASLLSDAVSYINEMKAKVDKLESKLQ  311

Query  270  LRESKKVKVEAVG--DNQstssa-----------assvaSPVDVEVKIVGPDAMIRVQSE  130
             RESKKVK+E     DNQST+++           +      ++VEVK VG DAMIRVQS+
Sbjct  312  -RESKKVKLEVADTMDNQSTTTSVDQAACRPNSNSGGAGLALEVEVKFVGNDAMIRVQSD  370

Query  129  NANYPSAKLMNGLRELELAVHHASISSVNDIMLQDI  22
            N NYP ++LM+ LR+LE  VHHAS+SSVN++MLQD+
Sbjct  371  NVNYPGSRLMSALRDLEFQVHHASMSSVNELMLQDV  406



>gb|KJB52372.1| hypothetical protein B456_008G259000 [Gossypium raimondii]
Length=475

 Score =   191 bits (485),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 108/190 (57%), Positives = 142/190 (75%), Gaps = 18/190 (9%)
 Frame = -2

Query  552  SDSDCQFLKEPPIVDRQQNA---PKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYALR  382
            S+SD  F       D + NA    KKRGRKPG G+ +P+NHVEAERQRRE+LNHRFYALR
Sbjct  265  SESDGDFAS----ADTEFNAGGRSKKRGRKPGNGKESPINHVEAERQRRERLNHRFYALR  320

Query  381  SVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKVKVEAVG--DNQstssa  208
            SVVPNVS+MDKASLLSDAV+YI EL+ K+++LE QL L +S+K K+  +   +NQ+T SA
Sbjct  321  SVVPNVSKMDKASLLSDAVAYIKELRSKIDKLEAQL-LVQSEKSKLNPINVFENQTTKSA  379

Query  207  assva--------SPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASIS  52
              +            V+V+VKIVG +AMIRV+S + ++P+A+LM+ LR+LEL VHHAS+S
Sbjct  380  FDNTMKQSSTYWPKTVEVDVKIVGSEAMIRVRSPDIDHPAARLMDALRDLELPVHHASVS  439

Query  51   SVNDIMLQDI  22
            +VND+MLQD+
Sbjct  440  NVNDLMLQDV  449



>ref|XP_010267440.1| PREDICTED: transcription factor MYC2 [Nelumbo nucifera]
Length=522

 Score =   191 bits (486),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 124/199 (62%), Positives = 149/199 (75%), Gaps = 22/199 (11%)
 Frame = -2

Query  564  EXEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYAL  385
            E EH DSD   +      D ++  PKKRGRKPG GR  P+NHVEAERQRREKLNHRFYAL
Sbjct  303  ESEHFDSDALLITS---ADMEKRRPKKRGRKPGKGRDMPLNHVEAERQRREKLNHRFYAL  359

Query  384  RSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQL-RESKKVKVEAVGDNQstssa  208
            RSVVPNVSRMDKASLL+DAVSYINELKGK+E+LE +L L R SKKVK+E + D+QST + 
Sbjct  360  RSVVPNVSRMDKASLLADAVSYINELKGKIEDLEGRLGLGRHSKKVKME-MDDHQSTITT  418

Query  207  assva-----------------SPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELE  79
            A++V                  + +DVEVKI+G DA+IRVQSEN NYPSA+LM+ LR L+
Sbjct  419  ATTVFDYGQTRSSSIYGSGGLITSMDVEVKILGTDALIRVQSENVNYPSARLMDALRGLK  478

Query  78   LAVHHASISSVNDIMLQDI  22
            L VHHAS+SSV ++MLQD+
Sbjct  479  LQVHHASVSSVKELMLQDV  497



>gb|ACF05947.1| MYC1 [Hevea brasiliensis]
Length=476

 Score =   190 bits (482),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 103/170 (61%), Positives = 131/170 (77%), Gaps = 9/170 (5%)
 Frame = -2

Query  489  KKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYINE  310
            KKRGRK   G + P+NHVEAERQRRE+LNHRFYALRSVVPNVS+MDKASLL+DAV+YI E
Sbjct  291  KKRGRKQLNGELLPINHVEAERQRRERLNHRFYALRSVVPNVSKMDKASLLADAVTYIKE  350

Query  309  LKGKVEELECQLQLRESKKVKVEAVGDNQst-------ssaassvaSPVDVEVKIVGPDA  151
            LK KV+ELE +LQ   SKK K+ +V DNQST        S+++  A  +++EVKIVG +A
Sbjct  351  LKAKVDELESKLQ-AVSKKSKITSVTDNQSTDSMIDHIRSSSAYKAKAMELEVKIVGSEA  409

Query  150  MIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQDIRG*RXPD  1
            MIR  S + NYP+A+LM+ LRE+E  VHHAS+SS+ +++LQD+   R PD
Sbjct  410  MIRFLSPDVNYPAARLMDALREVEFKVHHASMSSIKEMVLQDVVA-RVPD  458



>ref|XP_004230022.1| PREDICTED: transcription factor MYC2-like isoform X2 [Solanum 
lycopersicum]
Length=450

 Score =   189 bits (480),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 106/170 (62%), Positives = 126/170 (74%), Gaps = 15/170 (9%)
 Frame = -2

Query  489  KKRGRKPGAG----RVTPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVS  322
            KKRGRKP  G     +  +NHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVS
Sbjct  258  KKRGRKPKGGEEDAHMAALNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVS  317

Query  321  YINELKGKVEELECQLQLRESKKVKV---EAVGDNQstssaassvaSPV-------DVEV  172
            YIN+LK KV+ELE QL +  +KK K+    +  DNQS ++++              +VEV
Sbjct  318  YINQLKAKVDELELQL-IDHTKKPKIVTESSSADNQSATTSSDDQVIKAANPTAAPEVEV  376

Query  171  KIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQDI  22
            KIVG DAMIRVQSEN +YPSAKLM  L+ L++ VHHASISSVN ++L D+
Sbjct  377  KIVGTDAMIRVQSENVDYPSAKLMIALQNLQMQVHHASISSVNHLVLHDV  426



>ref|XP_004230021.1| PREDICTED: transcription factor MYC2-like isoform X1 [Solanum 
lycopersicum]
Length=451

 Score =   189 bits (480),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 107/169 (63%), Positives = 127/169 (75%), Gaps = 13/169 (8%)
 Frame = -2

Query  489  KKRGRKPGAG----RVTPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVS  322
            KKRGRKP  G     +  +NHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVS
Sbjct  258  KKRGRKPKGGEEDAHMAALNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVS  317

Query  321  YINELKGKVEELECQL--QLRESKKVKVEAVGDNQstssaa----ssvaSPV---DVEVK  169
            YIN+LK KV+ELE QL    ++ K V   +  DNQS ++++       A+P    +VEVK
Sbjct  318  YINQLKAKVDELELQLIDHTKKPKIVTESSSADNQSATTSSDDQVIKAANPTAAPEVEVK  377

Query  168  IVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQDI  22
            IVG DAMIRVQSEN +YPSAKLM  L+ L++ VHHASISSVN ++L D+
Sbjct  378  IVGTDAMIRVQSENVDYPSAKLMIALQNLQMQVHHASISSVNHLVLHDV  426



>ref|XP_006357552.1| PREDICTED: transcription factor MYC2-like [Solanum tuberosum]
Length=452

 Score =   189 bits (480),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 109/179 (61%), Positives = 134/179 (75%), Gaps = 15/179 (8%)
 Frame = -2

Query  528  KEP-PIVDRQQNAPKKRGRKPGA-GRVTPVNHVEAERQRREKLNHRFYALRSVVPNVSRM  355
            K+P P+V     A KKRGRKP     +  +NHVEAERQRREKLNHRFYALRSVVPNVSRM
Sbjct  254  KQPQPVV-----AKKKRGRKPKEDANMAALNHVEAERQRREKLNHRFYALRSVVPNVSRM  308

Query  354  DKASLLSDAVSYINELKGKVEELECQL--QLRESKKVKVEAVGDNQstssaa------ss  199
            DKASLLSDAVSYIN+LK KV+ELE QL    ++ K V   +  DNQST++++      ++
Sbjct  309  DKASLLSDAVSYINQLKAKVDELELQLIDHTKKPKNVTESSSADNQSTTTSSDDQVIKAN  368

Query  198  vaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQDI  22
              +  +VEVKI+G DAMIRVQSEN +YPSAKLM  L+ L++ VHHASISSVN ++L D+
Sbjct  369  STAAPEVEVKIIGTDAMIRVQSENVDYPSAKLMIALQNLQMQVHHASISSVNHLVLHDV  427



>ref|XP_009412473.1| PREDICTED: transcription factor MYC3-like [Musa acuminata subsp. 
malaccensis]
Length=467

 Score =   187 bits (474),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 103/168 (61%), Positives = 127/168 (76%), Gaps = 13/168 (8%)
 Frame = -2

Query  489  KKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYINE  310
            KKRGRKPG+ R TPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLL+DAVSYI E
Sbjct  276  KKRGRKPGSRRETPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLADAVSYIKE  335

Query  309  LKGKVEELECQLQLRESKKVKVEAVGDN------------QstssaassvaSPVDVEVKI  166
            LK K+E+LE   + R  K++ V    +              ++SS  ++  + ++VEVK 
Sbjct  336  LKSKLEDLEADSK-RAKKEINVVDASNRPCGAMASSTGTATTSSSVVTAGPATMEVEVKS  394

Query  165  VGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQDI  22
            +GPDAMIRVQ+EN ++P+AKLM  LRELEL VHHAS+SSV ++ML D+
Sbjct  395  LGPDAMIRVQTENVSHPTAKLMEVLRELELQVHHASVSSVKEVMLHDV  442



>emb|CBI34590.3| unnamed protein product [Vitis vinifera]
Length=306

 Score =   183 bits (464),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 97/157 (62%), Positives = 121/157 (77%), Gaps = 15/157 (10%)
 Frame = -2

Query  492  PKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYIN  313
            PKKRGRKP  GR  P+NHVEAERQRREKLNHRFYALR+VVPNVSRMDKASLL+DAVSYI+
Sbjct  142  PKKRGRKPATGREMPLNHVEAERQRREKLNHRFYALRAVVPNVSRMDKASLLADAVSYIH  201

Query  312  ELKGKVEELECQLQLRESKKVKVEAVGDNQstssaassvaSPVDVEVKIVGPDAMIRVQS  133
            ELK K+++LE   +LRE  + K +A G  +            ++V+VKI+G +AMIRVQ 
Sbjct  202  ELKTKIDDLET--KLREEVR-KPKAYGAIR------------MEVDVKIIGSEAMIRVQC  246

Query  132  ENANYPSAKLMNGLRELELAVHHASISSVNDIMLQDI  22
             + NYPSA LM+ LR+L+L V HAS+SSV ++MLQD+
Sbjct  247  PDLNYPSAILMDALRDLDLRVLHASVSSVKELMLQDV  283



>ref|XP_002518914.1| DNA binding protein, putative [Ricinus communis]
 gb|EEF43447.1| DNA binding protein, putative [Ricinus communis]
Length=479

 Score =   186 bits (472),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 109/186 (59%), Positives = 137/186 (74%), Gaps = 17/186 (9%)
 Frame = -2

Query  549  DSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYALRSVVP  370
            DSD  F  E    DR     KKRGRKP  G+  P+NHVEAERQRRE+LN+RFYALRSVVP
Sbjct  276  DSDGNFAVES--TDR----IKKRGRKPVKGKELPLNHVEAERQRRERLNNRFYALRSVVP  329

Query  369  NVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKVKVEA--VGDNQsts------  214
            NVS+MDKASLL+DAV+YI ELK KV+EL+ Q+QL  SKK K+    V DN STS      
Sbjct  330  NVSKMDKASLLADAVTYIQELKAKVDELKTQVQL-VSKKSKISGNNVFDNNSTSSMIDRH  388

Query  213  --saassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVND  40
              +++   A  ++V+V+IVG +AMIRV+S + +YP+A+LMN +RELE  VHHASISS+ D
Sbjct  389  LMTSSIYRAKEMEVDVRIVGSEAMIRVRSPDIDYPAARLMNAIRELEFQVHHASISSIKD  448

Query  39   IMLQDI  22
            ++LQDI
Sbjct  449  VVLQDI  454



>ref|XP_009775258.1| PREDICTED: transcription factor MYC2-like [Nicotiana sylvestris]
Length=425

 Score =   184 bits (468),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 108/193 (56%), Positives = 137/193 (71%), Gaps = 16/193 (8%)
 Frame = -2

Query  573  SYPEXEHSDSDCQFLKEPP----IVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKL  406
            S+ + E S+SDCQ L+ P     +  + +   +KRGRK G      +NHVEAERQRREKL
Sbjct  210  SFLDSELSNSDCQLLEYPVQKSRVGSKIRRTYRKRGRKHGVDCDKQMNHVEAERQRREKL  269

Query  405  NHRFYALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQ--LRESKKVKVEAVG  232
            NHRFY LRSVVP V+ +DKASLLSDAV+YINELK KV++LE +L   L   KK ++E   
Sbjct  270  NHRFYMLRSVVPQVTGIDKASLLSDAVAYINELKAKVDKLESKLHTNLELKKKPEMEHND  329

Query  231  --DNQstssaassvaSPVD-VEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHA  61
              DNQ       S  + VD VEVK++GPDAMIRVQSE+ NYPS +LM  L++LEL V+HA
Sbjct  330  DVDNQ-------SSTNSVDHVEVKMIGPDAMIRVQSEDVNYPSTRLMCALQDLELHVYHA  382

Query  60   SISSVNDIMLQDI  22
            +ISSVN+I++QDI
Sbjct  383  NISSVNNIVVQDI  395



>ref|XP_006476285.1| PREDICTED: transcription factor MYC2-like [Citrus sinensis]
Length=519

 Score =   186 bits (473),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 98/169 (58%), Positives = 125/169 (74%), Gaps = 13/169 (8%)
 Frame = -2

Query  489  KKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYINE  310
            KKRGRKP +GR +P+NHVEAERQRRE+LNHRFYALRSVVPNVS+MDKASLL+DAV+YI E
Sbjct  327  KKRGRKPTSGRESPLNHVEAERQRRERLNHRFYALRSVVPNVSKMDKASLLADAVAYIKE  386

Query  309  LKGKVEELECQLQLRESKKVKVEAVGDNQstssaassvaSP-------------VDVEVK  169
            L+ KV+ELE +L+ +  K   V  V DN  ++ +   + +              +DV+VK
Sbjct  387  LRAKVDELEAKLREQARKSKVVYNVYDNNQSTGSTIMMPTSSSTTHHLGININIMDVDVK  446

Query  168  IVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQDI  22
            IVG +AMIRVQ  + NYP+AKLM+ LR+LE  VHHAS+SSV + MLQD+
Sbjct  447  IVGSEAMIRVQCPDINYPAAKLMDVLRDLEFHVHHASVSSVRETMLQDV  495



>gb|KDO76730.1| hypothetical protein CISIN_1g010053mg [Citrus sinensis]
Length=519

 Score =   186 bits (473),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 98/169 (58%), Positives = 125/169 (74%), Gaps = 13/169 (8%)
 Frame = -2

Query  489  KKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYINE  310
            KKRGRKP +GR +P+NHVEAERQRRE+LNHRFYALRSVVPNVS+MDKASLL+DAV+YI E
Sbjct  327  KKRGRKPTSGRESPLNHVEAERQRRERLNHRFYALRSVVPNVSKMDKASLLADAVAYIKE  386

Query  309  LKGKVEELECQLQLRESKKVKVEAVGDNQstssaassvaSP-------------VDVEVK  169
            L+ KV+ELE +L+ +  K   V  V DN  ++ +   + +              +DV+VK
Sbjct  387  LRAKVDELEAKLREQARKSKVVYNVYDNNQSTGSTIMMPTSSSTTHHLGININIMDVDVK  446

Query  168  IVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQDI  22
            IVG +AMIRVQ  + NYP+AKLM+ LR+LE  VHHAS+SSV + MLQD+
Sbjct  447  IVGSEAMIRVQCPDINYPAAKLMDVLRDLEFHVHHASVSSVRETMLQDV  495



>ref|XP_006439218.1| hypothetical protein CICLE_v10019730mg [Citrus clementina]
 gb|ESR52458.1| hypothetical protein CICLE_v10019730mg [Citrus clementina]
Length=519

 Score =   186 bits (472),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 98/169 (58%), Positives = 125/169 (74%), Gaps = 13/169 (8%)
 Frame = -2

Query  489  KKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYINE  310
            KKRGRKP +GR +P+NHVEAERQRRE+LNHRFYALRSVVPNVS+MDKASLL+DAV+YI E
Sbjct  327  KKRGRKPTSGRESPLNHVEAERQRRERLNHRFYALRSVVPNVSKMDKASLLADAVAYIKE  386

Query  309  LKGKVEELECQLQLRESKKVKVEAVGDNQstssaassvaSP-------------VDVEVK  169
            L+ KV+ELE +L+ +  K   V  V DN  ++ +   + +              +DV+VK
Sbjct  387  LRAKVDELEAKLREQARKSKVVYNVYDNNQSTGSTIMMPTSSSTTHHLGININIMDVDVK  446

Query  168  IVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQDI  22
            IVG +AMIRVQ  + NYP+AKLM+ LR+LE  VHHAS+SSV + MLQD+
Sbjct  447  IVGSEAMIRVQCPDINYPAAKLMDVLRDLEFHVHHASVSSVRETMLQDV  495



>gb|KEH18599.1| basic helix loop helix (bHLH) family transcription factor [Medicago 
truncatula]
Length=454

 Score =   184 bits (468),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 107/199 (54%), Positives = 138/199 (69%), Gaps = 19/199 (10%)
 Frame = -2

Query  564  EXEHSDSD-CQFLKEPPIVDR----QQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNH  400
            + E SDS+ C  L       +    ++  PKKRGRKP  G  TP+NHVEAERQRREKLNH
Sbjct  234  DSEDSDSEYCPLLATKTTTAKNDSFEKREPKKRGRKPLTGTQTPMNHVEAERQRREKLNH  293

Query  399  RFYALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKK--VKVEAVGDN  226
            RFYALRSVVPNVS+MDKASLLSDAV YINELK K+E+L+   Q +ESKK  +K   + DN
Sbjct  294  RFYALRSVVPNVSKMDKASLLSDAVDYINELKAKIEDLKLG-QQKESKKAMMKTMKIVDN  352

Query  225  Qstssaa----------ssvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELEL  76
             S ++ +          S     ++++VKI+G DAM+RVQS N N+PSA+LM+ L++LE 
Sbjct  353  NSATTTSIVVDQNKPSCSKNLIALEIDVKIIGHDAMVRVQSLNVNHPSARLMSVLKDLEY  412

Query  75   AVHHASISSVND-IMLQDI  22
             VH ASIS+VN  +M+QD+
Sbjct  413  QVHQASISTVNKVVMVQDV  431



>gb|KJB24138.1| hypothetical protein B456_004G129600 [Gossypium raimondii]
Length=463

 Score =   184 bits (468),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 96/167 (57%), Positives = 127/167 (76%), Gaps = 10/167 (6%)
 Frame = -2

Query  495  APKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYI  316
              KKRGRK G G+ TP NHVEAER RREKLNHRFYALRSVVP VS+MDKASLLSDAV+YI
Sbjct  275  GSKKRGRKSGTGKTTPSNHVEAERLRREKLNHRFYALRSVVPTVSKMDKASLLSDAVAYI  334

Query  315  NELKGKVEELECQLQLRESKKVKVEA--VGDNQstssaassvaSPVD-------VEVKIV  163
             EL+ ++++L+ +L++ +S+K K+ A  V +NQ  +S   S     D       V+VKI+
Sbjct  335  KELRSQIDKLDVKLKV-QSQKAKLNAINVSNNQRNASTFDSTRPTYDYGPNTMEVDVKII  393

Query  162  GPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQDI  22
            G +AMIRVQ  + NYP+A+LM+ LR+LEL VHHAS+S+VN+++LQD+
Sbjct  394  GSEAMIRVQCPDVNYPAARLMDALRDLELHVHHASVSTVNELVLQDV  440



>ref|XP_002279973.1| PREDICTED: transcription factor MYC4 [Vitis vinifera]
Length=468

 Score =   184 bits (468),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 102/168 (61%), Positives = 129/168 (77%), Gaps = 12/168 (7%)
 Frame = -2

Query  492  PKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYIN  313
            PKKRGRKP  GR  P+NHVEAERQRREKLNHRFYALR+VVPNVSRMDKASLL+DAVSYI+
Sbjct  279  PKKRGRKPATGREMPLNHVEAERQRREKLNHRFYALRAVVPNVSRMDKASLLADAVSYIH  338

Query  312  ELKGKVEELECQL--QLRESKKVKVEAVGDNQstssa---------assvaSPVDVEVKI  166
            ELK K+++LE +L  ++R+ K    E   DNQST++          +S  A  ++V+VKI
Sbjct  339  ELKTKIDDLETKLREEVRKPKACLAEMY-DNQSTTTTSIVDHGRSSSSYGAIRMEVDVKI  397

Query  165  VGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQDI  22
            +G +AMIRVQ  + NYPSA LM+ LR+L+L V HAS+SSV ++MLQD+
Sbjct  398  IGSEAMIRVQCPDLNYPSAILMDALRDLDLRVLHASVSSVKELMLQDV  445



>gb|ACF19982.1| MYC2 [Hevea brasiliensis]
Length=476

 Score =   183 bits (465),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 101/170 (59%), Positives = 129/170 (76%), Gaps = 9/170 (5%)
 Frame = -2

Query  489  KKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYINE  310
            KKRGR    G+   +NHVEAERQRRE+LNHRFYALRSVVPNVS+MDKASLL+DAV+YI E
Sbjct  291  KKRGRTQLNGKELTLNHVEAERQRRERLNHRFYALRSVVPNVSKMDKASLLADAVTYIKE  350

Query  309  LKGKVEELECQLQLRESKKVKVEAVGDNQst-------ssaassvaSPVDVEVKIVGPDA  151
            LK KV+ELE +LQ   SKK K+ +V DNQST        S+++  A  +++EVKIVG +A
Sbjct  351  LKAKVDELESKLQ-AVSKKSKITSVTDNQSTDSMIDHIRSSSAYKAKAMELEVKIVGSEA  409

Query  150  MIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQDIRG*RXPD  1
            MIR  S + NYP+A+LM+ LRE+E  VHHAS+SS+ +++LQD+   R PD
Sbjct  410  MIRFLSPDVNYPAARLMDALREVEFKVHHASMSSIKEMVLQDVVA-RVPD  458



>ref|XP_011026782.1| PREDICTED: transcription factor MYC2-like [Populus euphratica]
Length=471

 Score =   183 bits (465),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 100/169 (59%), Positives = 129/169 (76%), Gaps = 15/169 (9%)
 Frame = -2

Query  489  KKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYINE  310
            KKRGRKPG G+  P+NHVEAERQRRE+LNHRFYALRSVVPNVS+MDKASLL+DA +YI E
Sbjct  281  KKRGRKPG-GKELPLNHVEAERQRRERLNHRFYALRSVVPNVSKMDKASLLADAATYIKE  339

Query  309  LKGKVEELECQLQLRESKKVKVEA---VGDNQstssaass----------vaSPVDVEVK  169
            LK KV ELE +L+   SKK K+     + DNQSTS++  +            + ++V+VK
Sbjct  340  LKSKVNELEGKLRA-VSKKSKISGNANIYDNQSTSTSTMTNHIRPTPNYMSNNAMEVDVK  398

Query  168  IVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQDI  22
            I+G +A+IRVQS + NYP+A+LM+ LRELE +VHHAS+S V D++LQD+
Sbjct  399  ILGSEALIRVQSPDVNYPAARLMDALRELEFSVHHASVSKVKDLVLQDV  447



>gb|AEG74015.1| lMYC5 [Hevea brasiliensis]
Length=475

 Score =   182 bits (462),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 96/164 (59%), Positives = 127/164 (77%), Gaps = 9/164 (5%)
 Frame = -2

Query  489  KKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYINE  310
            KKRGRKP  G+  P+NHVEAERQRR++LNHRFYALRSVVPNVS+MDKASLL+DAV+YI E
Sbjct  289  KKRGRKPN-GKELPLNHVEAERQRRKRLNHRFYALRSVVPNVSKMDKASLLADAVTYIEE  347

Query  309  LKGKVEELECQLQ-LRESKKVKVEAVGDNQstss-------aassvaSPVDVEVKIVGPD  154
            LK KV+ELE +LQ + +  K+    + DNQST+        ++S     ++V+VKIVG +
Sbjct  348  LKAKVDELEAKLQAVSKQSKITSTIIYDNQSTNYMVNHLRPSSSYRDKAMEVDVKIVGSE  407

Query  153  AMIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQDI  22
            AM+RV S + NYP+ +LM+ LRELE  VHHAS+SS+N+++LQD+
Sbjct  408  AMVRVHSPDVNYPAVRLMDALRELEFQVHHASVSSINEMVLQDV  451



>ref|XP_010531704.1| PREDICTED: transcription factor MYC2-like [Tarenaya hassleriana]
Length=615

 Score =   184 bits (468),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 99/186 (53%), Positives = 135/186 (73%), Gaps = 13/186 (7%)
 Frame = -2

Query  558  EHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYALRS  379
            +HSD +   +KE     R    P+KRGRKP  GR  P+NHVEAERQRREKLN RFYALR+
Sbjct  410  DHSDLEASVVKEAAPEKR----PRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRA  465

Query  378  VVPNVSRMDKASLLSDAVSYINELKGKVE-------ELECQLQLRESKKVKVEAVGDNQs  220
            VVPNVS+MDKASLL DA+SYINELK K++       ++ECQL+  +S+     A   N+ 
Sbjct  466  VVPNVSKMDKASLLGDAISYINELKSKLQRTESEKTQIECQLENLKSELAGRNANAGNRD  525

Query  219  tssaassvaSPV--DVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSV  46
               ++S+V+ P+  ++EVKI+G DAMIR++S   N+P+A+LM+ L++LEL V+HAS+S V
Sbjct  526  CGDSSSAVSKPIGMEIEVKIIGWDAMIRIESSKRNHPAARLMSALKDLELEVNHASMSVV  585

Query  45   NDIMLQ  28
            ND+M+Q
Sbjct  586  NDLMIQ  591



>ref|XP_006830285.1| hypothetical protein AMTR_s00121p00026620 [Amborella trichopoda]
 gb|ERM97701.1| hypothetical protein AMTR_s00121p00026620 [Amborella trichopoda]
Length=459

 Score =   182 bits (461),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 95/161 (59%), Positives = 120/161 (75%), Gaps = 4/161 (2%)
 Frame = -2

Query  492  PKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYIN  313
            PKKRGRKPG GRV P+NHVEAERQRREKLN RFYALR+VVP+VS+MDKASLL+DAVSYIN
Sbjct  267  PKKRGRKPGNGRVVPLNHVEAERQRREKLNRRFYALRAVVPHVSKMDKASLLADAVSYIN  326

Query  312  ELKGKVEELECQLQLRESKKVKVEAVGDNQ----stssaassvaSPVDVEVKIVGPDAMI  145
            +LK KV+ LE  LQ   S +   +   D +    ++ S  +      ++EVKI+G DA+I
Sbjct  327  QLKAKVQHLESALQKLGSDEKTTQKDSDGKLMPDTSGSEGAEWNGIAELEVKIMGQDAII  386

Query  144  RVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQDI  22
            RVQSE+  +P+AKLM  L EL L VHHAS+S+V  +M+QD+
Sbjct  387  RVQSESTGHPAAKLMRALEELGLPVHHASVSNVKGLMVQDV  427



>gb|AGO03813.1| JAMYC2 [Taxus cuspidata]
Length=304

 Score =   177 bits (450),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 101/208 (49%), Positives = 136/208 (65%), Gaps = 27/208 (13%)
 Frame = -2

Query  573  SYPEXEHSDSDCQFLKE--PPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNH  400
            S  E EHSD +    KE    +V+++   P+KRGRKP  GR  P+NHVEAERQRREKLN 
Sbjct  72   SGAESEHSDVEAASFKEMEEAVVEKK---PRKRGRKPANGREEPLNHVEAERQRREKLNQ  128

Query  399  RFYALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRES--KKVKVEAVGDN  226
            RFYALR+VVPNVS+MDKASLL DAVSYINEL+ KV+ELE + +  ES  +  K E +  +
Sbjct  129  RFYALRAVVPNVSKMDKASLLGDAVSYINELRSKVQELETERKELESHVEATKKELLSSH  188

Query  225  QstssaassvaS--------------------PVDVEVKIVGPDAMIRVQSENANYPSAK  106
               S A    A                      +D++V+++G +AM+R+QS   N+P+A+
Sbjct  189  SGFSGANFGFAKDLSSSSRVPDSKGFGTKQCPGLDLDVRVLGAEAMVRIQSGKKNHPAAR  248

Query  105  LMNGLRELELAVHHASISSVNDIMLQDI  22
            LM   +ELEL VHHAS+S+VN++MLQ++
Sbjct  249  LMTAFQELELEVHHASVSTVNELMLQNV  276



>ref|XP_006343781.1| PREDICTED: transcription factor MYC2-like [Solanum tuberosum]
Length=388

 Score =   179 bits (453),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 99/181 (55%), Positives = 121/181 (67%), Gaps = 33/181 (18%)
 Frame = -2

Query  552  SDS-DCQFLKEPPIVDRQQNAPKKRGRKPGAG---RVTPVNHVEAERQRREKLNHRFYAL  385
            SDS +  +  E   +++  N+PKKRGRK  +    R T  NHVEAERQRREKLNHRFYAL
Sbjct  210  SDSGNSDYDNESSAINKDANSPKKRGRKSSSSTIERATAKNHVEAERQRREKLNHRFYAL  269

Query  384  RSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKVKVEAVGDNQstssaa  205
            RSVVPNVS+MDKASLL+DAV+YINELK KVEE               +A G         
Sbjct  270  RSVVPNVSKMDKASLLADAVTYINELKAKVEEF--------------KAYG---------  306

Query  204  ssvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQD  25
                  ++VEVKI+G +AMIRV+S N NYP A+LMN LRELE  +HHAS+SSV ++M QD
Sbjct  307  ------MEVEVKIIGVEAMIRVRSPNVNYPCARLMNVLRELEFQIHHASVSSVKEMMQQD  360

Query  24   I  22
            +
Sbjct  361  V  361



>gb|AEG74013.1| lMYC3 [Hevea brasiliensis]
Length=475

 Score =   180 bits (456),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 100/170 (59%), Positives = 126/170 (74%), Gaps = 9/170 (5%)
 Frame = -2

Query  489  KKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYINE  310
            KKR +K   G+  P+NHVEAERQRRE+LNHRFYALRSVVPNVS+MDKASLL+DAV+YI E
Sbjct  285  KKRAKKLQNGKELPLNHVEAERQRRERLNHRFYALRSVVPNVSKMDKASLLADAVTYIKE  344

Query  309  LKGKVEELECQLQLRESKKVKVEAVGDNQstssaassvaSP-------VDVEVKIVGPDA  151
            LK KV+ELE +LQ   +KK K   V DNQST S    +  P       +++EVKIVG +A
Sbjct  345  LKAKVDELESKLQ-AVTKKSKNTNVTDNQSTDSLIDQIRDPSIYKTKAMELEVKIVGSEA  403

Query  150  MIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQDIRG*RXPD  1
            MIR  S + NYP+A+LM+ LRE+E  VHHAS+SS+ +++LQD+   R PD
Sbjct  404  MIRFLSPDINYPAARLMDVLREIEFKVHHASMSSIKEMVLQDVVA-RVPD  452



>ref|XP_008233076.1| PREDICTED: LOW QUALITY PROTEIN: transcription factor MYC2 [Prunus 
mume]
Length=483

 Score =   180 bits (456),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 111/194 (57%), Positives = 132/194 (68%), Gaps = 36/194 (19%)
 Frame = -2

Query  567  PEXEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYA  388
            P+ ++SDSD             +  PKKRGRKPG GR TP+NHVEAERQRR K+ H    
Sbjct  289  PKPDYSDSDGP-----------KRTPKKRGRKPGLGRDTPLNHVEAERQRRGKIKHPVSG  337

Query  387  LRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKVKVEAVGDN---Qst  217
                       DKASLLSDAVSYINELK KV+ELE Q+Q RESKKVKVE  GDN   QST
Sbjct  338  -----------DKASLLSDAVSYINELKTKVDELESQVQ-RESKKVKVE-TGDNLDIQST  384

Query  216  ssaassvaSP---------VDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHH  64
            +++   +A P         ++VEVKIVG DAMIRVQSEN NYPSA+LM  LR+LEL +HH
Sbjct  385  TTSVEQIAKPPSSSANGSGLEVEVKIVGTDAMIRVQSENVNYPSARLMAALRDLELQIHH  444

Query  63   ASISSVNDIMLQDI  22
            AS+S +N++MLQDI
Sbjct  445  ASLSCINELMLQDI  458



>ref|XP_011022409.1| PREDICTED: transcription factor MYC2-like [Populus euphratica]
Length=463

 Score =   179 bits (455),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 98/166 (59%), Positives = 128/166 (77%), Gaps = 13/166 (8%)
 Frame = -2

Query  489  KKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYINE  310
            KKRGRKPG G+ +P+NHVEAERQRRE+LNHRFYALRSVVPNVS+MD+ASLL+DAV+YI E
Sbjct  275  KKRGRKPG-GKESPLNHVEAERQRRERLNHRFYALRSVVPNVSKMDRASLLADAVTYIKE  333

Query  309  LKGKVEELECQLQLRESKKVKVEA---VGDNQstssaassvaSP--------VDVEVKIV  163
            LK +V ELE  LQ+  SKK K+ +   + DNQSTS+  + +  P        V+V+VKI+
Sbjct  334  LKRRVNELEANLQV-VSKKSKISSCANIYDNQSTSTMVNHIRPPPNYMSNNAVEVDVKIL  392

Query  162  GPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQD  25
            G D +IRVQS + NYP+A+LM+ LRELE  +HH S++ V +++LQD
Sbjct  393  GSDGLIRVQSPDINYPAARLMDTLRELEFPIHHLSVTRVKELVLQD  438



>gb|ADK91082.1| LMYC2 [Hevea brasiliensis]
Length=475

 Score =   180 bits (456),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 99/170 (58%), Positives = 129/170 (76%), Gaps = 9/170 (5%)
 Frame = -2

Query  489  KKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYINE  310
            KKRGR    G+   +N+VEAERQRRE+LNHRFYALRSVVPNVS+MDKASLL+DAV+YI E
Sbjct  290  KKRGRAQLNGKELTLNYVEAERQRRERLNHRFYALRSVVPNVSKMDKASLLADAVTYIKE  349

Query  309  LKGKVEELECQLQLRESKKVKVEAVGDNQst-------ssaassvaSPVDVEVKIVGPDA  151
            LK KV+ELE +LQ   SKK K+ +V DNQST        S+++  A  +++EVKIVG +A
Sbjct  350  LKAKVDELESKLQ-AVSKKSKITSVTDNQSTDSMIDHIRSSSAYKAKAMELEVKIVGSEA  408

Query  150  MIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQDIRG*RXPD  1
            MI+  S + NYP+A+LM+ LRE+E  VHHAS+SS+ +++LQD+   R PD
Sbjct  409  MIQFLSPDVNYPAARLMDALREVEFKVHHASMSSIKEVVLQDVVA-RVPD  457



>gb|KJB21076.1| hypothetical protein B456_003G182100 [Gossypium raimondii]
Length=549

 Score =   181 bits (458),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 98/191 (51%), Positives = 126/191 (66%), Gaps = 17/191 (9%)
 Frame = -2

Query  564  EXEHSDSDCQFLKEP-----PIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNH  400
            + +HSD +   +KE       I    +  P+KRGRKP  GR  P+NHVEAERQRREKLN 
Sbjct  340  DSDHSDLEVSVIKEADSARVTITAEPEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQ  399

Query  399  RFYALRSVVPNVSRMDKASLLSDAVSYINELKGKVEEL-----ECQLQLRESKKVKVEAV  235
            RFYALR+VVPNVS+MDKASLL DA+SYINELK K++       E   QL E+KK      
Sbjct  400  RFYALRAVVPNVSKMDKASLLGDAISYINELKIKLQNADSKKEELHKQLEETKK------  453

Query  234  GDNQstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASI  55
             + Q      S     +D++VK +G DAMIR+QS   N+P+A+LM  L+EL+L VHHAS+
Sbjct  454  -EGQRGGLTTSHKLLELDIDVKTIGLDAMIRIQSNKKNHPAARLMAALQELDLDVHHASV  512

Query  54   SSVNDIMLQDI  22
            S VND+M+Q +
Sbjct  513  SVVNDLMIQQV  523



>ref|XP_011082365.1| PREDICTED: transcription factor MYC4-like [Sesamum indicum]
Length=670

 Score =   182 bits (461),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 104/191 (54%), Positives = 133/191 (70%), Gaps = 13/191 (7%)
 Frame = -2

Query  564  EXEHSDSDCQFLKE---PPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRF  394
            E +HSD +   +KE     +VD ++  P+KRGRKP  GR  P+NHVEAERQRREKLN RF
Sbjct  453  ESDHSDLEASVVKEVESSRVVDPEKR-PRKRGRKPANGREEPLNHVEAERQRREKLNQRF  511

Query  393  YALRSVVPNVSRMDKASLLSDAVSYINELKGKV-------EELECQLQL--RESKKVKVE  241
            YALR+VVPNVS+MDKASLL DA++YINELK KV       EEL  QL+L  +E     + 
Sbjct  512  YALRAVVPNVSKMDKASLLGDAIAYINELKSKVQSVESDKEELRSQLELVKKELGTKDMR  571

Query  240  AVGDNQstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHA  61
            +        + +S+V   +D++VKI+G DAMIRVQ    N+P+AKLM  LREL+L VHHA
Sbjct  572  SAPPPAHDLNMSSNVKVDMDIDVKIIGWDAMIRVQCSKKNHPAAKLMLALRELDLDVHHA  631

Query  60   SISSVNDIMLQ  28
            S+S VND+M+Q
Sbjct  632  SVSVVNDLMIQ  642



>ref|XP_002299425.1| hypothetical protein POPTR_0001s11400g [Populus trichocarpa]
 gb|EEE84230.1| hypothetical protein POPTR_0001s11400g [Populus trichocarpa]
Length=471

 Score =   179 bits (454),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 98/169 (58%), Positives = 129/169 (76%), Gaps = 15/169 (9%)
 Frame = -2

Query  489  KKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYINE  310
            KKRGRKP +G+  P+NHVEAERQRRE+LNHRFYALRSVVPNVS+MDKASLL+DA +YI E
Sbjct  281  KKRGRKP-SGKELPLNHVEAERQRRERLNHRFYALRSVVPNVSKMDKASLLADAATYIKE  339

Query  309  LKGKVEELECQLQLRESKKVKVEA---VGDNQstssaass----------vaSPVDVEVK  169
            LK KV ELE +L+   SKK K+     + DNQSTS++  +            + ++V+VK
Sbjct  340  LKSKVNELEGKLRA-VSKKSKISGNANIYDNQSTSTSTMTNHIRPTPNYMSNNAMEVDVK  398

Query  168  IVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQDI  22
            I+G +A+IRVQS + NYP+A+LM+ LRELE +VHHAS+S V +++LQD+
Sbjct  399  ILGSEALIRVQSPDVNYPAARLMDALRELEFSVHHASVSKVKELVLQDV  447



>ref|XP_002893732.1| ATMYC2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69991.1| ATMYC2 [Arabidopsis lyrata subsp. lyrata]
Length=625

 Score =   181 bits (459),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 106/190 (56%), Positives = 133/190 (70%), Gaps = 18/190 (9%)
 Frame = -2

Query  564  EXEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYAL  385
            E +HSD +   +KE  +  R    PKKRGRKP  GR  P+NHVEAERQRREKLN RFYAL
Sbjct  418  ESDHSDLEASVVKEVAVEKR----PKKRGRKPANGREEPLNHVEAERQRREKLNQRFYAL  473

Query  384  RSVVPNVSRMDKASLLSDAVSYINELKGKV-----EELECQLQLRESKKVKVEAVGDNQs  220
            R+VVPNVS+MDKASLL DA+SYINELK KV     E+++ + QL E   VK+E  G   S
Sbjct  474  RAVVPNVSKMDKASLLGDAISYINELKSKVVKTESEKIQIKNQLEE---VKLELAGRKAS  530

Query  219  tssaassva----SPV--DVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHAS  58
             S    S +     PV  ++EVKI+G DAMIRV+S   N+P+A+LM+ L +LEL V+HAS
Sbjct  531  ASGGDMSSSCSSIKPVGMEIEVKIIGWDAMIRVESSKRNHPAARLMSALMDLELEVNHAS  590

Query  57   ISSVNDIMLQ  28
            +S VND+M+Q
Sbjct  591  MSVVNDLMIQ  600



>ref|NP_174541.1| transcription factor MYC2 [Arabidopsis thaliana]
 sp|Q39204.2|MYC2_ARATH RecName: Full=Transcription factor MYC2; Short=AtMYC2; AltName: 
Full=Basic helix-loop-helix protein 6; Short=AtbHLH6; Short=bHLH 
6; AltName: Full=Protein JASMONATE INSENSITIVE 1; AltName: 
Full=R-homologous Arabidopsis protein 1; Short=RAP-1; 
AltName: Full=Transcription factor EN 38; AltName: Full=Z-box 
binding factor 1 protein; AltName: Full=bHLH transcription 
factor bHLH006; AltName: Full=rd22BP1 [Arabidopsis thaliana]
 gb|AAF25980.1|AC017118_17 F6N18.4 [Arabidopsis thaliana]
 gb|AAK59788.1| At1g32640/F6N18_4 [Arabidopsis thaliana]
 gb|AAO23607.1| At1g32640/F6N18_4 [Arabidopsis thaliana]
 emb|CAH58735.1| Z-box binding factor 1 protein [Arabidopsis thaliana]
 emb|CAA67885.2| bHLH protein [Arabidopsis thaliana]
 gb|AEE31513.1| transcription factor MYC2 [Arabidopsis thaliana]
Length=623

 Score =   181 bits (459),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 106/190 (56%), Positives = 133/190 (70%), Gaps = 18/190 (9%)
 Frame = -2

Query  564  EXEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYAL  385
            E +HSD +   +KE  +  R    PKKRGRKP  GR  P+NHVEAERQRREKLN RFYAL
Sbjct  416  ESDHSDLEASVVKEVAVEKR----PKKRGRKPANGREEPLNHVEAERQRREKLNQRFYAL  471

Query  384  RSVVPNVSRMDKASLLSDAVSYINELKGKV-----EELECQLQLRESKKVKVEAVGDNQs  220
            R+VVPNVS+MDKASLL DA++YINELK KV     E+L+ + QL E   VK+E  G   S
Sbjct  472  RAVVPNVSKMDKASLLGDAIAYINELKSKVVKTESEKLQIKNQLEE---VKLELAGRKAS  528

Query  219  tssaassva----SPV--DVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHAS  58
             S    S +     PV  ++EVKI+G DAMIRV+S   N+P+A+LM+ L +LEL V+HAS
Sbjct  529  ASGGDMSSSCSSIKPVGMEIEVKIIGWDAMIRVESSKRNHPAARLMSALMDLELEVNHAS  588

Query  57   ISSVNDIMLQ  28
            +S VND+M+Q
Sbjct  589  MSVVNDLMIQ  598



>gb|AAL55713.1|AF251691_1 putative transcription factor BHLH6 [Arabidopsis thaliana]
Length=623

 Score =   181 bits (459),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 105/190 (55%), Positives = 134/190 (71%), Gaps = 18/190 (9%)
 Frame = -2

Query  564  EXEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYAL  385
            E +HSD +   +KE  +  R    PKKRGRKP  GR  P+NHVEAERQRREKLN RFYAL
Sbjct  416  ESDHSDLEASVVKEVAVEKR----PKKRGRKPANGREEPLNHVEAERQRREKLNQRFYAL  471

Query  384  RSVVPNVSRMDKASLLSDAVSYINELKGKV-----EELECQLQLRESKKVKVEAVG----  232
            R+VVPNVS+MDKASLL DA++YINELK KV     E+L+ + QL E   VK+E  G    
Sbjct  472  RAVVPNVSKMDKASLLGDAIAYINELKSKVVKTESEKLQIKNQLEE---VKLELAGRRAS  528

Query  231  DNQstssaassvaSPV--DVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHAS  58
             +    S++ S   PV  ++EVKI+G DAMIRV+S   N+P+A+LM+ L +LEL V+HAS
Sbjct  529  ASGGDMSSSCSSIKPVGMEIEVKIIGWDAMIRVESSKRNHPAARLMSALMDLELEVNHAS  588

Query  57   ISSVNDIMLQ  28
            +S VND+M+Q
Sbjct  589  MSVVNDLMIQ  598



>gb|KDP25207.1| hypothetical protein JCGZ_20363 [Jatropha curcas]
Length=482

 Score =   178 bits (452),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 99/182 (54%), Positives = 126/182 (69%), Gaps = 11/182 (6%)
 Frame = -2

Query  549  DSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYALRSVVP  370
            DSD +F      VDR     KKRGRKP  G+  P+NHVEAERQRRE+LNHRFYALRSVVP
Sbjct  284  DSDGKF-APGSTVDRF----KKRGRKPINGKELPLNHVEAERQRRERLNHRFYALRSVVP  338

Query  369  NVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKVKVEAVGDNQsts------sa  208
            NVS+MDKASLL DAV+YI +LK KV ELE +LQ    K   V  +  N +          
Sbjct  339  NVSKMDKASLLEDAVTYIKDLKAKVNELETKLQAVRKKSKNVTNINANTNNYVVIGPEVM  398

Query  207  assvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQ  28
            + +    ++V+VKIVG +AMIRVQS + NYP+A+LM+ LRELE+ VHHAS+S + +++L 
Sbjct  399  SHNKVMTMEVDVKIVGSEAMIRVQSLDVNYPAARLMDALRELEIKVHHASVSRIKEMVLL  458

Query  27   DI  22
            D+
Sbjct  459  DV  460



>ref|XP_006415166.1| hypothetical protein EUTSA_v10007075mg [Eutrema salsugineum]
 gb|ESQ33519.1| hypothetical protein EUTSA_v10007075mg [Eutrema salsugineum]
Length=624

 Score =   180 bits (457),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 103/192 (54%), Positives = 130/192 (68%), Gaps = 21/192 (11%)
 Frame = -2

Query  564  EXEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYAL  385
            E +HSD +   +KE P     +  PKKRGRKP  GR  P+NHVEAERQRREKLN RFYAL
Sbjct  416  ESDHSDLEASVVKEVP-----EKRPKKRGRKPANGREEPLNHVEAERQRREKLNQRFYAL  470

Query  384  RSVVPNVSRMDKASLLSDAVSYINELKGKV-----EELECQLQLRESKKVKVEAVGDNQs  220
            R+VVPNVS+MDKASLL DA++YINELK KV     E+ + + QL E   VK E  G   S
Sbjct  471  RAVVPNVSKMDKASLLGDAIAYINELKSKVTKTESEKTQIKTQLEE---VKHELAGRKAS  527

Query  219  tssaassvaSP--------VDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHH  64
                  + +SP        +++EVKI+G DAMIRV+S   N+P+A+LM  L +LEL V+H
Sbjct  528  AGGGDLASSSPMMGIKPVGMEIEVKIIGWDAMIRVESSKRNHPAARLMTALMDLELEVNH  587

Query  63   ASISSVNDIMLQ  28
            AS+S VND+M+Q
Sbjct  588  ASMSVVNDLMIQ  599



>ref|XP_006362123.1| PREDICTED: transcription factor MYC4-like [Solanum tuberosum]
Length=402

 Score =   176 bits (447),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 98/171 (57%), Positives = 124/171 (73%), Gaps = 10/171 (6%)
 Frame = -2

Query  513  VDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLS  334
            V  +    KKRGRK      T  NHVEAERQRREKLN RFYALR VVPNV++MDKA+LLS
Sbjct  208  VGFKSKTSKKRGRKGREICETQGNHVEAERQRREKLNSRFYALREVVPNVTKMDKATLLS  267

Query  333  DAVSYINELKGKVEELECQL-------QLRESKKVKVEAVGDNQstssaassvaSPVDVE  175
            DAV+YI +LK KV+ELE +L       + ++  K++ + V DNQ   S+ +S    +++E
Sbjct  268  DAVTYITQLKAKVDELESKLHNNYYYSEHKKKHKMENDNVVDNQ---SSTTSWDHTMEIE  324

Query  174  VKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQDI  22
            VK+VG DAMIRVQSEN NYPS +LM  L+E+EL V+HA+ISSVND+ML DI
Sbjct  325  VKMVGQDAMIRVQSENVNYPSTRLMCALQEVELHVYHANISSVNDLMLHDI  375



>dbj|BAA25078.1| RD22BP1 [Arabidopsis thaliana]
Length=623

 Score =   180 bits (457),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 105/190 (55%), Positives = 134/190 (71%), Gaps = 18/190 (9%)
 Frame = -2

Query  564  EXEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYAL  385
            E +HSD +   +KE  +  R    PKKRGRKP  GR  P+NHVEAERQRREKLN RFYAL
Sbjct  416  ESDHSDLEASVVKEVAVEKR----PKKRGRKPANGREEPLNHVEAERQRREKLNQRFYAL  471

Query  384  RSVVPNVSRMDKASLLSDAVSYINELKGKV-----EELECQLQLRESKKVKVEAVG----  232
            R+VVPNVS+MDKASLL DA++YINELK KV     E+L+ + QL E   VK+E  G    
Sbjct  472  RAVVPNVSKMDKASLLGDAIAYINELKSKVVKTESEKLQIKNQLEE---VKLELAGRKAS  528

Query  231  DNQstssaassvaSPV--DVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHAS  58
             +    S++ S   PV  ++EVKI+G DAMIRV+S   N+P+A+LM+ L +LEL V+HAS
Sbjct  529  PSGGDMSSSCSSIKPVGMEIEVKIIGWDAMIRVESSKRNHPAARLMSALMDLELEVNHAS  588

Query  57   ISSVNDIMLQ  28
            +S VND+M+Q
Sbjct  589  MSVVNDLMIQ  598



>ref|XP_002303693.2| hypothetical protein POPTR_0003s14710g [Populus trichocarpa]
 gb|EEE78672.2| hypothetical protein POPTR_0003s14710g [Populus trichocarpa]
Length=465

 Score =   177 bits (450),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 98/169 (58%), Positives = 128/169 (76%), Gaps = 15/169 (9%)
 Frame = -2

Query  489  KKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYINE  310
            KKRGRKPG G+ +P+NHVEAERQRRE+LNHRFYALRSVVPNVS+MD+ASLL+DAV+YI E
Sbjct  275  KKRGRKPG-GKESPLNHVEAERQRRERLNHRFYALRSVVPNVSKMDRASLLADAVNYIKE  333

Query  309  LKGKVEELECQLQLRESKKVKVEA---VGDNQstssaas----------svaSPVDVEVK  169
            LK KV ELE  LQ+  SKK K+ +   + DNQSTS++               + V+V+VK
Sbjct  334  LKRKVNELEANLQV-VSKKSKISSCANIYDNQSTSTSTMVNHIRPPPNYMSNNAVEVDVK  392

Query  168  IVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQDI  22
            I+G + +IRVQS + NYP+A+LM+ LRELE  VHH S++ V +++LQD+
Sbjct  393  ILGSEGLIRVQSPDINYPAARLMDALRELEFPVHHLSVTRVKELVLQDV  441



>gb|ABS11038.1| MYC [Brassica oleracea var. gemmifera]
Length=610

 Score =   180 bits (456),  Expect = 2e-49, Method: Composition-based stats.
 Identities = 103/188 (55%), Positives = 131/188 (70%), Gaps = 14/188 (7%)
 Frame = -2

Query  564  EXEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYAL  385
            E +HSD +   +KE P     +  PKKRGRKP  GR  P+NHVEAERQRREKLN RFYAL
Sbjct  403  ESDHSDLEASVVKEIP-----EKRPKKRGRKPANGREEPLNHVEAERQRREKLNQRFYAL  457

Query  384  RSVVPNVSRMDKASLLSDAVSYINELKGKV-----EELECQLQLRESKKV----KVEAVG  232
            R+VVPNVS+MDKASLL DA++YINELK KV     E+ + + QL E K      K  A G
Sbjct  458  RAVVPNVSKMDKASLLGDAIAYINELKSKVTKTESEKTQIKTQLEEVKMELAGRKASAGG  517

Query  231  DNQstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASIS  52
            D  S+ S  +     +++EVKI+G DAMIRV+S   N+P+A+LM+ L +LEL V+HAS+S
Sbjct  518  DLSSSCSLTAIKPVGMEIEVKIIGWDAMIRVESSKRNHPAARLMSALMDLELEVNHASMS  577

Query  51   SVNDIMLQ  28
             VND+M+Q
Sbjct  578  VVNDLMIQ  585



>ref|XP_009151447.1| PREDICTED: transcription factor MYC2 [Brassica rapa]
Length=605

 Score =   180 bits (456),  Expect = 2e-49, Method: Composition-based stats.
 Identities = 103/188 (55%), Positives = 131/188 (70%), Gaps = 14/188 (7%)
 Frame = -2

Query  564  EXEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYAL  385
            E +HSD +   +KE P     +  PKKRGRKP  GR  P+NHVEAERQRREKLN RFYAL
Sbjct  398  ESDHSDLEASVVKEIP-----EKRPKKRGRKPANGREEPLNHVEAERQRREKLNQRFYAL  452

Query  384  RSVVPNVSRMDKASLLSDAVSYINELKGKV-----EELECQLQLRESKKV----KVEAVG  232
            R+VVPNVS+MDKASLL DA++YINELK KV     E+ + + QL E K      K  A G
Sbjct  453  RAVVPNVSKMDKASLLGDAIAYINELKSKVTKTESEKTQIKTQLEEVKMELAGRKASAGG  512

Query  231  DNQstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASIS  52
            D  S+ S  +     +++EVKI+G DAMIRV+S   N+P+A+LM+ L +LEL V+HAS+S
Sbjct  513  DLSSSCSMTAIKPVGMEIEVKIIGWDAMIRVESSKRNHPAARLMSALMDLELEVNHASMS  572

Query  51   SVNDIMLQ  28
             VND+M+Q
Sbjct  573  VVNDLMIQ  580



>gb|AEG74014.1| lMYC4 [Hevea brasiliensis]
Length=470

 Score =   177 bits (449),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 100/170 (59%), Positives = 126/170 (74%), Gaps = 9/170 (5%)
 Frame = -2

Query  489  KKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYINE  310
            KK+GRK   G+  P+NHVEAERQRRE+LNHRFYALRSVVPNVS+MDKASLL+DAV+YI E
Sbjct  285  KKKGRKQLNGKELPLNHVEAERQRRERLNHRFYALRSVVPNVSKMDKASLLADAVTYIEE  344

Query  309  LKGKVEELECQLQLRESKKVKVEAVGDNQstss-------aassvaSPVDVEVKIVGPDA  151
            LK KV+ELE +LQ   SKK K   V DNQST S       ++S     ++++VKIVG +A
Sbjct  345  LKAKVDELESKLQAV-SKKCKSINVTDNQSTDSMIDHTRCSSSYKVKSMELDVKIVGSEA  403

Query  150  MIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQDIRG*RXPD  1
            MIR  S + NYP A+LM  L+E+E  VHHAS+SS+ +++LQD+   R PD
Sbjct  404  MIRFLSPDVNYPGARLMEVLKEVEFKVHHASMSSIKEMVLQDVVA-RVPD  452



>gb|KHM99167.1| Transcription factor MYC4 [Glycine soja]
Length=218

 Score =   171 bits (432),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 90/174 (52%), Positives = 116/174 (67%), Gaps = 19/174 (11%)
 Frame = -2

Query  492  PKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYIN  313
            P+KRGRKP  GR  P+NHVEAERQRREKLN RFYALR+VVPNVS+MDKASLL DA+SYIN
Sbjct  16   PRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYIN  75

Query  312  ELKGKVEEL-----ECQLQLRESKK--------------VKVEAVGDNQstssaassvaS  190
            ELK K+  L     E + QL  +KK                      N   +   ++  +
Sbjct  76   ELKLKLNGLDSEKGELEKQLDSAKKELELATKNPPPPPPPPPGLPPSNNEEAKKTTTKLA  135

Query  189  PVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQ  28
             +++EVKI+G DAMIR+Q    N+P+A+LM  L++L+L VHHAS+S VND+M+Q
Sbjct  136  DLEIEVKIIGWDAMIRIQCSKKNHPAARLMAALKDLDLEVHHASVSVVNDLMIQ  189



>ref|XP_010478689.1| PREDICTED: LOW QUALITY PROTEIN: transcription factor MYC2-like 
[Camelina sativa]
Length=626

 Score =   179 bits (455),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 104/191 (54%), Positives = 134/191 (70%), Gaps = 19/191 (10%)
 Frame = -2

Query  564  EXEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYAL  385
            E +HSD +   +KE  +  R    PKKRGRKP  GR  P+NHVEAERQRREKLN RFYAL
Sbjct  418  ESDHSDLEASVVKEVAVEKR----PKKRGRKPANGREEPLNHVEAERQRREKLNQRFYAL  473

Query  384  RSVVPNVSRMDKASLLSDAVSYINELKGKV-----EELECQLQLRESKKVKVEAVG----  232
            R+VVPNVS+MDKASLL DA++YINELK KV     E+L+ + QL E   VK+E  G    
Sbjct  474  RAVVPNVSKMDKASLLGDAIAYINELKSKVVKTESEKLQIKNQLEE---VKLELAGRKAS  530

Query  231  ---DNQstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHA  61
                + S+S+ +S     +++EVKI+G DAMIRV+S   N+P+A+LM  L +LEL V+HA
Sbjct  531  AGCGDMSSSTCSSIKPVGMEIEVKIIGWDAMIRVESSKRNHPAARLMAALMDLELEVNHA  590

Query  60   SISSVNDIMLQ  28
            S+S VND+M+Q
Sbjct  591  SMSVVNDLMIQ  601



>ref|XP_010538366.1| PREDICTED: transcription factor MYC2-like [Tarenaya hassleriana]
Length=613

 Score =   179 bits (454),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 100/194 (52%), Positives = 134/194 (69%), Gaps = 24/194 (12%)
 Frame = -2

Query  564  EXEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYAL  385
            + +HSD +   +KE     R    P+KRGRKP  GR  P+NHVEAERQRREKLN RFYAL
Sbjct  404  DSDHSDLEASVVKEAVPEKR----PRKRGRKPANGREEPLNHVEAERQRREKLNQRFYAL  459

Query  384  RSVVPNVSRMDKASLLSDAVSYINELKGKVE-------ELECQLQLRESKKVKVEAVGDN  226
            R+VVPNVS+MDKASLL DA++YINELK K++       ++ECQ++      +K E  G N
Sbjct  460  RAVVPNVSKMDKASLLGDAIAYINELKSKLQKVESEKTQVECQVE-----SLKGELAGQN  514

Query  225  Qst--------ssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAV  70
             +         S ++ S  + V++EVKI+G DAMIR++S   NYP+A+LM+ LR+LEL V
Sbjct  515  ANAGVVGDVGDSYSSVSKRTGVEIEVKIIGWDAMIRIESSKRNYPAARLMSALRDLELEV  574

Query  69   HHASISSVNDIMLQ  28
            +HAS+S VND+M+Q
Sbjct  575  NHASMSVVNDLMVQ  588



>ref|XP_006361006.1| PREDICTED: transcription factor MYC4-like [Solanum tuberosum]
Length=407

 Score =   176 bits (445),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 97/171 (57%), Positives = 123/171 (72%), Gaps = 10/171 (6%)
 Frame = -2

Query  513  VDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLS  334
            V  +    KKRGRK      T  NHVEAERQRREKLN RFYALR VVPNV++MDKA+LLS
Sbjct  213  VGFKSKTSKKRGRKGREICETQGNHVEAERQRREKLNSRFYALREVVPNVTKMDKATLLS  272

Query  333  DAVSYINELKGKVEELECQLQ-------LRESKKVKVEAVGDNQstssaassvaSPVDVE  175
            DAV+YI +LK KV+ELE +L        + +  K++ + V DNQ   S+ +S    +++E
Sbjct  273  DAVTYITQLKAKVDELESKLHNNYYYSVMEKKHKMENDNVVDNQ---SSTTSWDHTMEIE  329

Query  174  VKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQDI  22
            VK+VG DAM+RVQSEN NYPS +LM  L+E+EL V+HA+ISSVND+ML DI
Sbjct  330  VKMVGQDAMLRVQSENMNYPSTRLMCALQEVELHVYHANISSVNDLMLHDI  380



>emb|CDX84081.1| BnaC08g07580D [Brassica napus]
Length=529

 Score =   178 bits (451),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 105/190 (55%), Positives = 135/190 (71%), Gaps = 16/190 (8%)
 Frame = -2

Query  564  EXEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYAL  385
            E +HSD +   +KE P     +  PKKRGRKP  GR  P+NHVEAERQRREKLN RFYAL
Sbjct  320  ESDHSDLEAFIVKEIP-----EKRPKKRGRKPANGREEPLNHVEAERQRREKLNQRFYAL  374

Query  384  RSVVPNVSRMDKASLLSDAVSYINELKGKV-----EELECQLQLRESK----KVKVEAVG  232
            R+VVPNVS+MDKASLL DA++YINELK KV     E++  + QL E K      K    G
Sbjct  375  RAVVPNVSKMDKASLLGDAIAYINELKLKVNKTESEKIHIKNQLEEVKIELAGRKSSTCG  434

Query  231  DNQstssaassvaSPV--DVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHAS  58
            D  S+SS+A+++  PV  ++EVK++G DAMIRV+S   N+P+A+LM+ L +LEL V HAS
Sbjct  435  DLSSSSSSATAMIKPVGMEIEVKVIGWDAMIRVESSKRNHPAARLMSALMDLELEVSHAS  494

Query  57   ISSVNDIMLQ  28
            +S VND+M+Q
Sbjct  495  MSVVNDLMIQ  504



>ref|XP_010461111.1| PREDICTED: transcription factor MYC2-like [Camelina sativa]
Length=623

 Score =   179 bits (453),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 107/191 (56%), Positives = 133/191 (70%), Gaps = 19/191 (10%)
 Frame = -2

Query  564  EXEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYAL  385
            E +HSD +   +KE  +  R    PKKRGRKP  GR  P+NHVEAERQRREKLN RFYAL
Sbjct  415  ESDHSDLEASVVKEVAMEKR----PKKRGRKPANGREEPLNHVEAERQRREKLNQRFYAL  470

Query  384  RSVVPNVSRMDKASLLSDAVSYINELKGKV-----EELECQLQLRESKKVKVEAVGDNQs  220
            R+VVPNVS+MDKASLL DA++YINELK KV     E+L+ + QL E   VK+E  G   S
Sbjct  471  RAVVPNVSKMDKASLLGDAIAYINELKSKVVKTESEKLQIKNQLEE---VKLELAGRKAS  527

Query  219  t-----ssaassvaSPV--DVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHA  61
                  SS+  S   PV  ++EVKI+G DAMIRV+S   N+P+A+LM  L +LEL V+HA
Sbjct  528  AGCGDVSSSTCSSIKPVGMEIEVKIIGWDAMIRVESSKRNHPAARLMAALMDLELEVNHA  587

Query  60   SISSVNDIMLQ  28
            S+S VND+M+Q
Sbjct  588  SMSVVNDLMIQ  598



>gb|KDO44754.1| hypothetical protein CISIN_1g005651mg [Citrus sinensis]
Length=685

 Score =   179 bits (454),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 101/195 (52%), Positives = 130/195 (67%), Gaps = 17/195 (9%)
 Frame = -2

Query  564  EXEHSDSDCQFLKEPPIVDRQ-QNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYA  388
            + +HSD +   +K+P     + +  P+KRGRKP  GR  P+NHVEAERQRREKLN RFYA
Sbjct  464  DSDHSDLEASVVKDPDSSRVEPEKKPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYA  523

Query  387  LRSVVPNVSRMDKASLLSDAVSYINELKGKVEELEC---QLQLRESKKVKVEAVG-----  232
            LR+VVPNVS+MDKASLL DA+SYINEL+ K++  E     LQ +E   VK E  G     
Sbjct  524  LRAVVPNVSKMDKASLLGDAISYINELRTKLQSAESDKEDLQ-KELASVKKELAGGGKDS  582

Query  231  -------DNQstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELA  73
                   D     S  +S    +D+EVKI+G DAMIR+QS   N+P+AKLM  L+EL+L 
Sbjct  583  HSGPSTSDQDLKMSNHASKLIDLDIEVKIIGWDAMIRIQSSKKNHPAAKLMQALKELDLE  642

Query  72   VHHASISSVNDIMLQ  28
            V+HAS+S VND+M+Q
Sbjct  643  VNHASMSVVNDLMIQ  657



>ref|XP_006428423.1| hypothetical protein CICLE_v10011214mg [Citrus clementina]
 ref|XP_006491734.1| PREDICTED: transcription factor MYC2-like [Citrus sinensis]
 gb|ESR41663.1| hypothetical protein CICLE_v10011214mg [Citrus clementina]
Length=685

 Score =   179 bits (453),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 101/195 (52%), Positives = 130/195 (67%), Gaps = 17/195 (9%)
 Frame = -2

Query  564  EXEHSDSDCQFLKEPPIVDRQ-QNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYA  388
            + +HSD +   +K+P     + +  P+KRGRKP  GR  P+NHVEAERQRREKLN RFYA
Sbjct  464  DSDHSDLEASVVKDPDSSRVEPEKKPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYA  523

Query  387  LRSVVPNVSRMDKASLLSDAVSYINELKGKVEELEC---QLQLRESKKVKVEAVG-----  232
            LR+VVPNVS+MDKASLL DA+SYINEL+ K++  E     LQ +E   VK E  G     
Sbjct  524  LRAVVPNVSKMDKASLLGDAISYINELRTKLQSAESDKEDLQ-KELASVKKELAGGGKDS  582

Query  231  -------DNQstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELA  73
                   D     S  +S    +D+EVKI+G DAMIR+QS   N+P+AKLM  L+EL+L 
Sbjct  583  HSGPSTSDQDLKMSNHASKLIDLDIEVKIIGWDAMIRIQSSKKNHPAAKLMEALKELDLE  642

Query  72   VHHASISSVNDIMLQ  28
            V+HAS+S VND+M+Q
Sbjct  643  VNHASMSVVNDLMIQ  657



>ref|XP_007158304.1| hypothetical protein PHAVU_002G141500g [Phaseolus vulgaris]
 gb|ESW30298.1| hypothetical protein PHAVU_002G141500g [Phaseolus vulgaris]
Length=728

 Score =   179 bits (453),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 100/194 (52%), Positives = 130/194 (67%), Gaps = 18/194 (9%)
 Frame = -2

Query  564  EXEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYAL  385
            + +HSD +   +K+P  V   +  P+KRGRKP  GR  P+NHVEAERQRREKLN RFYAL
Sbjct  510  DSDHSDLEASVVKDP--VVEPEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYAL  567

Query  384  RSVVPNVSRMDKASLLSDAVSYINELKGKVEELEC-----QLQLRESKKVKVEAVGDN--  226
            R+VVPNVS+MDKASLL DA+SYI ELK K++ LE      Q QL   KK ++E   DN  
Sbjct  568  RAVVPNVSKMDKASLLGDAISYITELKSKLQNLESDKDGLQKQLEGVKK-ELEKSSDNVS  626

Query  225  --------QstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAV  70
                     S   +++     +D++VKI+G DAMIR+Q    N+P+A+LM  L EL+L V
Sbjct  627  SNHTKHGGNSNIKSSNQALIDLDIDVKIIGWDAMIRIQCSKKNHPAARLMAALMELDLDV  686

Query  69   HHASISSVNDIMLQ  28
            HHAS+S VND+M+Q
Sbjct  687  HHASVSVVNDLMIQ  700



>ref|XP_004246085.1| PREDICTED: transcription factor bHLH14-like [Solanum lycopersicum]
Length=387

 Score =   174 bits (441),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 93/167 (56%), Positives = 120/167 (72%), Gaps = 11/167 (7%)
 Frame = -2

Query  501  QNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVS  322
            +++PKKR RK      T  NHVEAERQRREKLNHRFYALRSVVPNVS+MDKASLL+DAV+
Sbjct  200  KDSPKKRARKS----TTAKNHVEAERQRREKLNHRFYALRSVVPNVSKMDKASLLADAVT  255

Query  321  YINELKGKVEELECQLQLRESKKVK-------VEAVGDNQstssaassvaSPVDVEVKIV  163
            YINELK KVEEL+ ++++   K ++          V       +  SS    ++VEVKI+
Sbjct  256  YINELKAKVEELKAKIEVSTKKLIQKRNCVSSSAVVDGTNINININSSFVDGMEVEVKII  315

Query  162  GPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQDI  22
            G +AMIRV+S N NYP A+LMN LRELE  +HHA++SS+ ++M QD+
Sbjct  316  GVEAMIRVRSPNVNYPCARLMNVLRELEFQIHHATVSSMKEMMQQDV  362



>gb|AAC28907.1| phaseolin G-box binding protein PG2, partial [Phaseolus vulgaris]
Length=614

 Score =   178 bits (451),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 100/194 (52%), Positives = 130/194 (67%), Gaps = 18/194 (9%)
 Frame = -2

Query  564  EXEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYAL  385
            + +HSD +   +K+P  V   +  P+KRGRKP  GR  P+NHVEAERQRREKLN RFYAL
Sbjct  396  DSDHSDLEASVVKDP--VVEPEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYAL  453

Query  384  RSVVPNVSRMDKASLLSDAVSYINELKGKVEELEC-----QLQLRESKKVKVEAVGDN--  226
            R+VVPNVS+MDKASLL DA+SYI ELK K++ LE      Q QL   KK ++E   DN  
Sbjct  454  RAVVPNVSKMDKASLLGDAISYITELKSKLQNLESDKDGLQKQLEGVKK-ELEKSSDNVS  512

Query  225  --------QstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAV  70
                     S   +++     +D++VKI+G DAMIR+Q    N+P+A+LM  L EL+L V
Sbjct  513  SNHTKHGGNSNIKSSNQALIDLDIDVKIIGWDAMIRIQCSKKNHPAARLMAALMELDLDV  572

Query  69   HHASISSVNDIMLQ  28
            HHAS+S VND+M+Q
Sbjct  573  HHASVSVVNDLMIQ  586



>ref|XP_010691764.1| PREDICTED: transcription factor MYC2-like [Beta vulgaris subsp. 
vulgaris]
Length=457

 Score =   175 bits (444),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 89/167 (53%), Positives = 121/167 (72%), Gaps = 6/167 (4%)
 Frame = -2

Query  504  QQNAPKKRGRKPGA---GRVTPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLS  334
            +Q   +KRGR+P     G+V  +NHVEAERQRREK+N RFYALRSVVP V+RMDKASLL+
Sbjct  266  RQRVVRKRGRRPITSREGQVVTMNHVEAERQRREKMNSRFYALRSVVPTVTRMDKASLLA  325

Query  333  DAVSYINELKGKVEELECQLQLRESKKVKVEAVG---DNQstssaassvaSPVDVEVKIV  163
            DAV+YIN+LK K+  LE Q Q+  + +  + +      N +  +   +   P+DVEV+++
Sbjct  326  DAVAYINDLKNKISSLELQFQVTNNDRNTLMSSSSGISNTNIHNNVVNSRIPLDVEVRVL  385

Query  162  GPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQDI  22
            G +AMIRVQSEN N+PSA+LMN  ++L L VHHAS+S+V  +MLQD+
Sbjct  386  GNEAMIRVQSENVNHPSARLMNVFKQLNLQVHHASVSTVEQMMLQDV  432



>ref|XP_009131125.1| PREDICTED: transcription factor MYC4-like [Brassica rapa]
Length=230

 Score =   169 bits (428),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 95/187 (51%), Positives = 125/187 (67%), Gaps = 12/187 (6%)
 Frame = -2

Query  552  SDSDCQFLKEPP---IVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYALR  382
            SD +   +KE     I    +  P+KRGRKP  GR  P+NHVEAERQRREKLN RFY+LR
Sbjct  20   SDLEASVVKEAESGRIAAEPEKKPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYSLR  79

Query  381  SVVPNVSRMDKASLLSDAVSYINELKGKVEELEC-QLQLRESKKVKVEAVGD--------  229
            +VVPNVS+MDKASLL DA+SYINELK K+++ E  + +L++      + VGD        
Sbjct  80   AVVPNVSKMDKASLLGDAISYINELKAKLQKAEADKEELQKQIDGMSKEVGDGNVKSSVK  139

Query  228  NQstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISS  49
            +Q      S V+  V+++VKI+G DAMIR+Q    N+P AK M  L+ELEL V+HAS+S 
Sbjct  140  DQKCLEQDSGVSIEVEIDVKIIGWDAMIRIQCGKKNHPGAKFMEALKELELEVNHASLSV  199

Query  48   VNDIMLQ  28
            VN+ M+Q
Sbjct  200  VNEFMIQ  206



>gb|AFZ93650.1| transcription factor MYC2, partial [Euphorbia lathyris]
Length=272

 Score =   171 bits (432),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 96/191 (50%), Positives = 129/191 (68%), Gaps = 13/191 (7%)
 Frame = -2

Query  564  EXEHSDSDCQFLKEPP---IVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRF  394
            + +HSD +   ++E     IV+ ++  P+KRGRKP  GR  P+NHVEAERQRREKLN RF
Sbjct  56   DSDHSDLEASVVRETESSRIVEPEKK-PRKRGRKPANGREEPLNHVEAERQRREKLNQRF  114

Query  393  YALRSVVPNVSRMDKASLLSDAVSYINELKGKV-------EELECQLQL--RESKKVKVE  241
            YALR+VVPNVS+MDKASLL DA+SYI ELK K+       EELE Q++   +E  K    
Sbjct  115  YALRAVVPNVSKMDKASLLGDAISYIKELKSKLQNTESDKEELEKQVESMKKEFSKKDTR  174

Query  240  AVGDNQstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHA  61
            +           S+ +  +D++VKI+G D MIR+Q    N+P+A+LM  L+EL+L VHHA
Sbjct  175  SGTPPPDQELKMSNKSIEMDIDVKIIGWDVMIRIQCSKKNHPAARLMAALKELDLDVHHA  234

Query  60   SISSVNDIMLQ  28
            S+S VND+M+Q
Sbjct  235  SVSVVNDLMIQ  245



>ref|XP_008780029.1| PREDICTED: transcription factor MYC4-like [Phoenix dactylifera]
Length=440

 Score =   175 bits (443),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 97/154 (63%), Positives = 119/154 (77%), Gaps = 12/154 (8%)
 Frame = -2

Query  462  GRVTPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELE  283
            GR TPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLL+DAVSYI EL+ KVEELE
Sbjct  266  GRETPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLADAVSYIKELRAKVEELE  325

Query  282  CQLQLRESKKVKVEAVGDNQstssaa-------ssvaSPVDVEVKIVGPDAMIRVQSENA  124
                  E K+VK E V D+  + +AA        S    +++EVK +GPDA+IRV SEN 
Sbjct  326  A-----EGKRVKKETVVDHGVSGAAATSTTTTELSGRVTMELEVKKLGPDALIRVHSENL  380

Query  123  NYPSAKLMNGLRELELAVHHASISSVNDIMLQDI  22
            N+P+AKLM  LR+LE+ V+HAS+S++ ++MLQD+
Sbjct  381  NHPAAKLMGVLRDLEVHVNHASVSTLKEVMLQDV  414



>ref|XP_010100202.1| hypothetical protein L484_015347 [Morus notabilis]
 gb|EXB81873.1| hypothetical protein L484_015347 [Morus notabilis]
Length=506

 Score =   176 bits (445),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 100/182 (55%), Positives = 123/182 (68%), Gaps = 17/182 (9%)
 Frame = -2

Query  498  NAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSY  319
            N  KKRGRKP  G   PVNHVEAERQRREKLNHRFYALRSVVPNVS+MDKASLL+DAV Y
Sbjct  308  NRIKKRGRKPVIGNSLPVNHVEAERQRREKLNHRFYALRSVVPNVSKMDKASLLADAVVY  367

Query  318  INELKGKVEELECQLQLRESKK-VKVEAVGDNQstssaassvaSPV--------------  184
            INELK K+ ELE Q+ L +S + +K+     N +    + S  + V              
Sbjct  368  INELKSKINELETQVHLSQSNRPLKMGITMCNSTPKFESQSTYNIVEHKRKYSSYGSVGA  427

Query  183  -DVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQDIRG*RX  7
             +V+VKIVG +AMIRVQ  + NYP A+LMN LR+LE  + H S+SSV +++LQD+   R 
Sbjct  428  MEVDVKIVGTEAMIRVQCPDVNYPPARLMNALRDLEFQILHVSVSSVKELVLQDVVV-RV  486

Query  6    PD  1
            PD
Sbjct  487  PD  488



>gb|AGZ94899.1| MYC transcription factor 2 [Solanum lycopersicum]
Length=689

 Score =   177 bits (450),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 98/191 (51%), Positives = 129/191 (68%), Gaps = 12/191 (6%)
 Frame = -2

Query  564  EXEHSDSDCQFLKEPPI--VDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFY  391
            + EHSD +   +KE     V   +  P+KRGRKP  GR  P+NHVEAERQRREKLN RFY
Sbjct  471  DSEHSDLEASVVKEADSSRVVEPEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFY  530

Query  390  ALRSVVPNVSRMDKASLLSDAVSYINELKGKV-------EELECQLQ-LRESKKVKVEAV  235
            ALR+VVPNVS+MDKASLL DA+SYINELK K+       E+L+ Q++ L++  +      
Sbjct  531  ALRAVVPNVSKMDKASLLGDAISYINELKSKLQNTESDKEDLKSQIEDLKKESRRPGPPP  590

Query  234  GDNQstssaassvaS--PVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHA  61
              NQ    ++ +      VD++VKI+G DAMIR+Q    N+P+A+LM  L EL+L VHHA
Sbjct  591  PPNQDLKMSSHTGGKIVDVDIDVKIIGWDAMIRIQCNKKNHPAARLMAALMELDLDVHHA  650

Query  60   SISSVNDIMLQ  28
            S+S VND+M+Q
Sbjct  651  SVSVVNDLMIQ  661



>ref|XP_007209110.1| hypothetical protein PRUPE_ppa005343mg [Prunus persica]
 gb|EMJ10309.1| hypothetical protein PRUPE_ppa005343mg [Prunus persica]
Length=466

 Score =   175 bits (443),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 98/183 (54%), Positives = 120/183 (66%), Gaps = 27/183 (15%)
 Frame = -2

Query  489  KKRGRKP--GAGRVTPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYI  316
            KKRGR    G  R +P+NHVEAERQRREKLNHRFYALRSVVPNVS+MDKASLLSDAV YI
Sbjct  260  KKRGRSSNHGTDRESPINHVEAERQRREKLNHRFYALRSVVPNVSKMDKASLLSDAVVYI  319

Query  315  NELKGKVEELECQLQ-------------LRESKKVKVEAVGDNQstssaassvaSP----  187
            N+LK KVEELE ++Q             L         ++ D+        +   P    
Sbjct  320  NKLKAKVEELEAKIQQPPQKPKLGILSNLEHQSNQSASSIVDHHRHHHHHQARPRPASSY  379

Query  186  --------VDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIML  31
                    ++V+VKIVG +AMIRVQS + NYP A+LMN L++LEL V+HASISSV ++ML
Sbjct  380  TNSEVAGAIEVDVKIVGSEAMIRVQSPDQNYPYARLMNALKDLELQVYHASISSVKEMML  439

Query  30   QDI  22
            QD+
Sbjct  440  QDV  442



>ref|XP_004245895.2| PREDICTED: transcription factor MYC2 [Solanum lycopersicum]
Length=689

 Score =   177 bits (450),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 98/191 (51%), Positives = 129/191 (68%), Gaps = 12/191 (6%)
 Frame = -2

Query  564  EXEHSDSDCQFLKEPPI--VDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFY  391
            + EHSD +   +KE     V   +  P+KRGRKP  GR  P+NHVEAERQRREKLN RFY
Sbjct  471  DSEHSDLEASVVKEADSSRVVEPEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFY  530

Query  390  ALRSVVPNVSRMDKASLLSDAVSYINELKGKV-------EELECQLQ-LRESKKVKVEAV  235
            ALR+VVPNVS+MDKASLL DA+SYINELK K+       E+L+ Q++ L++  +      
Sbjct  531  ALRAVVPNVSKMDKASLLGDAISYINELKSKLQNTESDKEDLKSQIEDLKKESRRPGPPP  590

Query  234  GDNQstssaassvaS--PVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHA  61
              NQ    ++ +      VD++VKI+G DAMIR+Q    N+P+A+LM  L EL+L VHHA
Sbjct  591  PPNQDLKMSSHTGGKIVDVDIDVKIIGWDAMIRIQCNKKNHPAARLMAALMELDLDVHHA  650

Query  60   SISSVNDIMLQ  28
            S+S VND+M+Q
Sbjct  651  SVSVVNDLMIQ  661



>ref|XP_006303928.1| hypothetical protein CARUB_v10008586mg [Capsella rubella]
 gb|EOA36826.1| hypothetical protein CARUB_v10008586mg [Capsella rubella]
Length=624

 Score =   177 bits (449),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 101/188 (54%), Positives = 135/188 (72%), Gaps = 13/188 (7%)
 Frame = -2

Query  564  EXEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYAL  385
            E +HSD +   +KE  +  R    PKKRGRKP  GR  P+NHVEAERQRREKLN RFYAL
Sbjct  416  ESDHSDVEASVVKEVAVEKR----PKKRGRKPANGREEPLNHVEAERQRREKLNQRFYAL  471

Query  384  RSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESK--KVKVEAVG-------  232
            R+VVPNVS+MDKASLL DA++YINELK KV + E +  + +++  +VK+E  G       
Sbjct  472  RAVVPNVSKMDKASLLGDAIAYINELKAKVVKTESEKVMIKNQLEEVKMELAGRKASAGC  531

Query  231  DNQstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASIS  52
             + S+SS +S     +++EVKI+G DAMIRV+S   N+P+A+LM+ L +LEL V+HAS+S
Sbjct  532  GDMSSSSCSSIKPVGMEIEVKIIGWDAMIRVESSKRNHPAARLMSALMDLELEVNHASMS  591

Query  51   SVNDIMLQ  28
             VND+M+Q
Sbjct  592  VVNDLMIQ  599



>ref|XP_009590627.1| PREDICTED: transcription factor bHLH14-like [Nicotiana tomentosiformis]
Length=425

 Score =   174 bits (440),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 98/174 (56%), Positives = 124/174 (71%), Gaps = 6/174 (3%)
 Frame = -2

Query  525  EPPIVDRQQNAPKKRGRKPGAGRVTPV----NHVEAERQRREKLNHRFYALRSVVPNVSR  358
            E   ++   N P KR RK G+ R T      NHVEAERQRREKLN+RFYALRSVVPNVS+
Sbjct  226  ESSTINNIINRPIKRERKAGSSRTTGTEMAKNHVEAERQRREKLNNRFYALRSVVPNVSK  285

Query  357  MDKASLLSDAVSYINELKGKVEELECQLQLRESKK--VKVEAVGDNQstssaassvaSPV  184
            MD+ASLL+DAV+YINELK KVEELE    L +  K      +V    ST    ++ +  +
Sbjct  286  MDRASLLADAVTYINELKAKVEELESYKILSQKPKGQCATTSVQSVPSTVVNRANNSFEM  345

Query  183  DVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQDI  22
            +VEVKI+G +AM+RV+S + NYP A+LMN LRELEL V+HAS+SSV ++MLQD+
Sbjct  346  EVEVKIIGLEAMVRVRSPDMNYPCARLMNVLRELELQVNHASVSSVKNLMLQDV  399



>ref|XP_009609942.1| PREDICTED: transcription factor MYC2-like [Nicotiana tomentosiformis]
Length=679

 Score =   176 bits (447),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 99/195 (51%), Positives = 129/195 (66%), Gaps = 16/195 (8%)
 Frame = -2

Query  564  EXEHSDSDCQFLKEPPI--VDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFY  391
            + +HSD +   +KE     V   +  PKKRGRKP  GR  P+NHVEAERQRREKLN RFY
Sbjct  457  DSDHSDLEASVVKEAESSRVVEPEKRPKKRGRKPANGREEPLNHVEAERQRREKLNQRFY  516

Query  390  ALRSVVPNVSRMDKASLLSDAVSYINELKGK--------------VEELECQLQLRESKK  253
            ALR+VVPNVS+MDKASLL DA+SYINELK K              +E+L+ +L  ++S++
Sbjct  517  ALRAVVPNVSKMDKASLLGDAISYINELKLKLQNTETDREELKSQIEDLKKELASKDSRR  576

Query  252  VKVEAVGDNQstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELA  73
                    +   SS   S    VD++VKI+G DAMIR+Q    N+P+A+LM  L+EL+L 
Sbjct  577  PGPPPSNHDHKMSSHTGSKIVDVDIDVKIIGWDAMIRIQCNKKNHPAARLMVALKELDLD  636

Query  72   VHHASISSVNDIMLQ  28
            VHHAS+S VND+M+Q
Sbjct  637  VHHASVSVVNDLMIQ  651



>gb|KHN18804.1| Transcription factor MYC4 [Glycine soja]
Length=280

 Score =   169 bits (428),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 94/200 (47%), Positives = 125/200 (63%), Gaps = 24/200 (12%)
 Frame = -2

Query  564  EXEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYAL  385
            + +HSD +    K+   V   +  P+KRGRKP  GR  P+NHVEAERQRREKLN RFYAL
Sbjct  55   DSDHSDLEASVAKQ---VVEPEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYAL  111

Query  384  RSVVPNVSRMDKASLLSDAVSYINELKGKV-----EELECQLQLRESKK-----------  253
            R+VVPNVS+MDKASLL DA+ YINELK K+     E+ E + QL  +KK           
Sbjct  112  RAVVPNVSKMDKASLLGDAILYINELKSKLNVLDSEKTELEKQLDSTKKELELATKNPPP  171

Query  252  -----VKVEAVGDNQstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLR  88
                         N       +S  + +++EVKI+G DAM+R+Q    N+P+A+LM  L+
Sbjct  172  PPPPPPPPGPPPSNSVEPKKTTSKLADLELEVKIIGWDAMVRIQCSKKNHPAARLMAALK  231

Query  87   ELELAVHHASISSVNDIMLQ  28
            +L+L VHHAS+S VND+M+Q
Sbjct  232  DLDLEVHHASVSVVNDLMIQ  251



>gb|AIO09733.1| transcription factor MYC2 [Salvia miltiorrhiza]
Length=602

 Score =   176 bits (445),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 96/181 (53%), Positives = 123/181 (68%), Gaps = 2/181 (1%)
 Frame = -2

Query  564  EXEHSDSDCQFLKEPPI--VDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFY  391
            E +HSD +   +KE     V   +  P+KRGRKP  GR  P+NHVEAERQRREKLN RFY
Sbjct  394  ESDHSDLEASVVKEADSSRVVNPEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFY  453

Query  390  ALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKVKVEAVGDNQstss  211
            ALR+VVPNVS+MDKASLL DA++YINELK KV+  E       S+   ++      + + 
Sbjct  454  ALRAVVPNVSKMDKASLLGDAIAYINELKSKVQNAESDKDELRSELESLKRATPAPAPAP  513

Query  210  aassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIML  31
            A +     +D++VKI+G DAMIRVQ    N+P+AKLM  LREL+L VHHAS+S V D+M+
Sbjct  514  APAPAKIDMDMDVKIIGWDAMIRVQCSKKNHPAAKLMVALRELDLDVHHASVSVVKDLMI  573

Query  30   Q  28
            Q
Sbjct  574  Q  574



>ref|XP_008245836.1| PREDICTED: transcription factor bHLH14-like isoform X2 [Prunus 
mume]
Length=492

 Score =   174 bits (441),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 97/183 (53%), Positives = 123/183 (67%), Gaps = 27/183 (15%)
 Frame = -2

Query  489  KKRGRKP--GAGRVTPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYI  316
            KKRGR    G  R +P+NHVEAERQRREKLNHRFYALRSVVPNVS+MDKASLLSDAV YI
Sbjct  286  KKRGRSSNHGTDRESPINHVEAERQRREKLNHRFYALRSVVPNVSKMDKASLLSDAVVYI  345

Query  315  NELKGKVEELECQLQLRESKKVKV-------------EAVGDNQstssaassvaSP----  187
            N+LK +VEELE ++Q  +  K+ +              ++ D+        +   P    
Sbjct  346  NKLKARVEELEAKIQQPQKPKLGILSNLEHHQSNQSASSIVDHHRHHHHHQARPRPASSY  405

Query  186  --------VDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIML  31
                    ++V+VKIVG +AMIRVQS + NYP A+LMN L++LEL V+HASISSV ++ML
Sbjct  406  TNCEVAGAIEVDVKIVGSEAMIRVQSPDQNYPYARLMNALKDLELQVYHASISSVKEMML  465

Query  30   QDI  22
            QD+
Sbjct  466  QDV  468



>ref|XP_008374122.1| PREDICTED: transcription factor MYC2-like [Malus domestica]
Length=467

 Score =   173 bits (439),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 99/171 (58%), Positives = 124/171 (73%), Gaps = 16/171 (9%)
 Frame = -2

Query  489  KKRGRKPGA--GRV-TPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSY  319
            KKRGR   +  GR  TP+NHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAV+Y
Sbjct  274  KKRGRSSNSETGRSETPINHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVAY  333

Query  318  INELKGKVEELECQLQLRESKKVKVEAVGDN------------QstssaassvaSPVDVE  175
            INELK +V +LE ++Q +  K V V+  G              + +SS  +  A  + ++
Sbjct  334  INELKARVVQLEAKIQAQPGKPV-VDIGGQTTCSIVDHHQTRPRQSSSYNNRAAGAMKID  392

Query  174  VKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQDI  22
            VKIVG +AMIRVQ  + +YP+A+LMN L+ LEL V+HASISSV ++MLQD+
Sbjct  393  VKIVGSEAMIRVQCPDCDYPNARLMNALKSLELQVYHASISSVKELMLQDV  443



>ref|XP_009780487.1| PREDICTED: transcription factor MYC2-like [Nicotiana sylvestris]
Length=681

 Score =   176 bits (446),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 99/193 (51%), Positives = 128/193 (66%), Gaps = 16/193 (8%)
 Frame = -2

Query  558  EHSDSDCQFLKEPPI--VDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYAL  385
            +HSD +   +KE     V   +  PKKRGRKP  GR  P+NHVEAERQRREKLN RFYAL
Sbjct  461  DHSDLEASVVKEAESSRVVEPEKRPKKRGRKPANGREEPLNHVEAERQRREKLNQRFYAL  520

Query  384  RSVVPNVSRMDKASLLSDAVSYINELKGK--------------VEELECQLQLRESKKVK  247
            R+VVPNVS+MDKASLL DA+SYINELK K              +E+L+ +L  ++S++  
Sbjct  521  RAVVPNVSKMDKASLLGDAISYINELKLKLQTTETDREDLKSQIEDLKKELDSKDSRRPG  580

Query  246  VEAVGDNQstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVH  67
                  +   SS   S    VD++VKI+G DAMIR+Q    N+P+A+LM  L+EL+L VH
Sbjct  581  PPPPNQDHKMSSHTGSKIVDVDIDVKIIGWDAMIRIQCNKKNHPAARLMVALKELDLDVH  640

Query  66   HASISSVNDIMLQ  28
            HAS+S VND+M+Q
Sbjct  641  HASVSVVNDLMIQ  653



>gb|ADH04268.1| MYC1b transcription factor [Nicotiana tabacum]
 gb|ADU60100.1| MYC2a transcription factor [Nicotiana tabacum]
Length=679

 Score =   176 bits (445),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 99/195 (51%), Positives = 129/195 (66%), Gaps = 16/195 (8%)
 Frame = -2

Query  564  EXEHSDSDCQFLKEPPI--VDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFY  391
            + +HSD +   +KE     V   +  PKKRGRKP  GR  P+NHVEAERQRREKLN RFY
Sbjct  457  DSDHSDLEASVVKEAESSRVVEPEKRPKKRGRKPANGREEPLNHVEAERQRREKLNQRFY  516

Query  390  ALRSVVPNVSRMDKASLLSDAVSYINELKGK--------------VEELECQLQLRESKK  253
            ALR+VVPNVS+MDKASLL DA+SYINELK K              +E+L+ +L  ++S++
Sbjct  517  ALRAVVPNVSKMDKASLLGDAISYINELKLKLQNTETDREELKSQIEDLKKELVSKDSRR  576

Query  252  VKVEAVGDNQstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELA  73
                    +   SS   S    VD++VKI+G DAMIR+Q    N+P+A+LM  L+EL+L 
Sbjct  577  PGPPPSNHDHKMSSHTGSKIVDVDIDVKIIGWDAMIRIQCNKKNHPAARLMVALKELDLD  636

Query  72   VHHASISSVNDIMLQ  28
            VHHAS+S VND+M+Q
Sbjct  637  VHHASVSVVNDLMIQ  651



>gb|ADH04267.1| MYC1a transcription factor [Nicotiana tabacum]
 gb|ADU60101.1| MYC2b transcription factor [Nicotiana tabacum]
 gb|ADU60102.1| MYC2c transcription factor [Nicotiana tabacum]
Length=681

 Score =   176 bits (445),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 99/193 (51%), Positives = 128/193 (66%), Gaps = 16/193 (8%)
 Frame = -2

Query  558  EHSDSDCQFLKEPPI--VDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYAL  385
            +HSD +   +KE     V   +  PKKRGRKP  GR  P+NHVEAERQRREKLN RFYAL
Sbjct  461  DHSDLEASVVKEAESSRVVEPEKRPKKRGRKPANGREEPLNHVEAERQRREKLNQRFYAL  520

Query  384  RSVVPNVSRMDKASLLSDAVSYINELKGK--------------VEELECQLQLRESKKVK  247
            R+VVPNVS+MDKASLL DA+SYINELK K              +E+L+ +L  ++S++  
Sbjct  521  RAVVPNVSKMDKASLLGDAISYINELKLKLQTTETDREDLKSQIEDLKKELDSKDSRRPG  580

Query  246  VEAVGDNQstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVH  67
                  +   SS   S    VD++VKI+G DAMIR+Q    N+P+A+LM  L+EL+L VH
Sbjct  581  PPPPNQDHKMSSHTGSKIVDVDIDVKIIGWDAMIRIQCNKKNHPAARLMVALKELDLDVH  640

Query  66   HASISSVNDIMLQ  28
            HAS+S VND+M+Q
Sbjct  641  HASVSVVNDLMIQ  653



>ref|XP_006352856.1| PREDICTED: transcription factor MYC2-like [Solanum tuberosum]
Length=702

 Score =   176 bits (445),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 99/190 (52%), Positives = 128/190 (67%), Gaps = 11/190 (6%)
 Frame = -2

Query  564  EXEHSDSDCQFLKEPPI--VDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFY  391
            + EHSD +   +KE     V   +  P+KRGRKP  GR  P+NHVEAERQRREKLN RFY
Sbjct  481  DSEHSDLEASVVKEADSSRVVEPEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFY  540

Query  390  ALRSVVPNVSRMDKASLLSDAVSYINELKGKV-------EELECQLQ--LRESKKVKVEA  238
            ALR+VVPNVS+MDKASLL DA+SYINELK K+       E+L+ Q++   +ES++     
Sbjct  541  ALRAVVPNVSKMDKASLLGDAISYINELKSKLQNTESDKEDLKSQIEDLKKESRRPGPPP  600

Query  237  VGDNQstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHAS  58
               +   SS        VD++VKI+G DAMIR+Q    N+P+A+LM  L EL+L VHHAS
Sbjct  601  PNQDLKMSSHTGGKIVDVDIDVKIIGWDAMIRIQCNKKNHPAARLMAALMELDLDVHHAS  660

Query  57   ISSVNDIMLQ  28
            +S VND+M+Q
Sbjct  661  VSVVNDLMIQ  670



>ref|XP_009418327.1| PREDICTED: transcription factor MYC4-like [Musa acuminata subsp. 
malaccensis]
Length=417

 Score =   172 bits (436),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 101/188 (54%), Positives = 131/188 (70%), Gaps = 18/188 (10%)
 Frame = -2

Query  555  HSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAG-RVTPVNHVEAERQRREKLNHRFYALRS  379
            HSDSD     E          PKKRGRK  +G R  P +HVEAERQRREKLNHRFYALRS
Sbjct  213  HSDSDGGLTVE-------HRRPKKRGRKTVSGTREAPASHVEAERQRREKLNHRFYALRS  265

Query  378  VVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKVKVEAVGDNQs-------  220
            VVPNVSRMDKASLL+DAV+YI ELK KV++LE + +    K++ VE    + +       
Sbjct  266  VVPNVSRMDKASLLADAVAYIQELKAKVDKLEAEGK-PAMKEITVEQTAGHSADAGAATS  324

Query  219  --tssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSV  46
              T+SA +   + ++VEVK++G +A+IRVQSE+  +PSA+LM  LR+LEL VHHAS+SS+
Sbjct  325  STTTSATTLTKAAMEVEVKLLGAEALIRVQSEDRGHPSARLMAALRDLELRVHHASVSSL  384

Query  45   NDIMLQDI  22
              ++LQD+
Sbjct  385  EQVVLQDV  392



>ref|XP_008373574.1| PREDICTED: transcription factor MYC2 [Malus domestica]
Length=689

 Score =   176 bits (445),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 99/193 (51%), Positives = 131/193 (68%), Gaps = 15/193 (8%)
 Frame = -2

Query  564  EXEHSDSDCQFLKEPP---IVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRF  394
            + +HSD +   ++E     +VD ++  P+KRGRKP  GR  P+NHVEAERQRREKLN RF
Sbjct  468  DSDHSDLEASVVREADSSRVVDPEKR-PRKRGRKPANGREEPLNHVEAERQRREKLNQRF  526

Query  393  YALRSVVPNVSRMDKASLLSDAVSYINELKGKV-------EELECQLQLRE----SKKVK  247
            YALR+VVPNVS+MDKASLL DA+SYINELK K+       EEL+ QL+       SK  +
Sbjct  527  YALRAVVPNVSKMDKASLLGDAISYINELKXKLQTVETDKEELQKQLESMNKDLPSKDSR  586

Query  246  VEAVGDNQstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVH  67
                   +     +SS    +D++VKI+G DAMIR+Q    N+P+A+LM  L+EL+L VH
Sbjct  587  SSGSTVXEHEMKGSSSKLLDMDIDVKIIGRDAMIRIQCCKKNHPAARLMAALKELDLEVH  646

Query  66   HASISSVNDIMLQ  28
            HAS+S VND+M+Q
Sbjct  647  HASVSVVNDLMIQ  659



>gb|AAB00686.1| phaseolin G-box binding protein PG1 [Phaseolus vulgaris]
Length=642

 Score =   175 bits (443),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 96/193 (50%), Positives = 128/193 (66%), Gaps = 17/193 (9%)
 Frame = -2

Query  558  EHSDSDCQFLKEPP--IVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYAL  385
            E+SD +   +KE    +V+ ++  P+KRGRKPG GR  P+NHVEAERQRREKLN RFYAL
Sbjct  423  ENSDLEASVVKEADSRVVEPEKR-PRKRGRKPGNGREEPLNHVEAERQRREKLNQRFYAL  481

Query  384  RSVVPNVSRMDKASLLSDAVSYINELKGKVEELEC--------------QLQLRESKKVK  247
            R+VVPNVS+MDKASLL DA+SYINELK K+ ELE               +L+L       
Sbjct  482  RAVVPNVSKMDKASLLGDAISYINELKSKLSELESEKGELEKQLELVKKELELATKSPSP  541

Query  246  VEAVGDNQstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVH  67
                  +   +   +S    +++EVKI+G DAMIR+Q    N+P+A+LM  L+EL+L V+
Sbjct  542  PPGPPPSNKEAKETTSKLIDLELEVKIIGWDAMIRIQCSKKNHPAARLMAALKELDLDVN  601

Query  66   HASISSVNDIMLQ  28
            HAS+S VND+M+Q
Sbjct  602  HASVSVVNDLMIQ  614



>gb|ADL36595.1| BHLH domain class transcription factor [Malus domestica]
Length=691

 Score =   175 bits (444),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 99/193 (51%), Positives = 132/193 (68%), Gaps = 15/193 (8%)
 Frame = -2

Query  564  EXEHSDSDCQFLKEPP---IVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRF  394
            + +HSD +   ++E     +VD ++  P+KRGRKP  GR  P+NHVEAERQRREKLN RF
Sbjct  470  DSDHSDLEASVVREADSSRVVDPEKR-PRKRGRKPANGREEPLNHVEAERQRREKLNQRF  528

Query  393  YALRSVVPNVSRMDKASLLSDAVSYINELKGKV-------EELECQLQLRE----SKKVK  247
            YALR+VVPNVS+MDKASLL DA+SYINELK K+       EEL+ QL+       SK  +
Sbjct  529  YALRAVVPNVSKMDKASLLGDAISYINELKLKLQTVETDKEELQKQLESMNKDLPSKDSR  588

Query  246  VEAVGDNQstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVH  67
                  ++     +SS    +D++VKI+G DAMIR+Q    N+P+A+LM  L+EL+L VH
Sbjct  589  SSGSTMSEHEMKGSSSKLLDMDIDVKIIGRDAMIRIQCCKKNHPAARLMAALKELDLEVH  648

Query  66   HASISSVNDIMLQ  28
            HAS+S VND+M+Q
Sbjct  649  HASVSVVNDLMIQ  661



>ref|NP_001288107.1| uncharacterized protein LOC101261048 [Solanum lycopersicum]
 gb|AIC63945.1| MYC1 [Solanum lycopersicum]
Length=630

 Score =   174 bits (442),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 92/186 (49%), Positives = 124/186 (67%), Gaps = 9/186 (5%)
 Frame = -2

Query  564  EXEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYAL  385
            + +HSD +   +KE  +    +  P+KRGRKP  GR  P+NHVEAERQRREKLN RFYAL
Sbjct  419  DSDHSDLEASVVKEAVV--EPEKKPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYAL  476

Query  384  RSVVPNVSRMDKASLLSDAVSYINELKGKV-------EELECQLQLRESKKVKVEAVGDN  226
            R+VVPNVS+MDKASLL DA++YINELK KV       EEL  Q++    +     +   +
Sbjct  477  RAVVPNVSKMDKASLLGDAIAYINELKSKVQNSDLDKEELRSQIECLRKELTNKGSSNYS  536

Query  225  QstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSV  46
             S           +D++VK++G DAMIR+Q    N+P+A+LM  L++L+L VHHAS+S V
Sbjct  537  ASPPLNQDVKIVDMDIDVKVIGWDAMIRIQCSKKNHPAARLMAALKDLDLDVHHASVSVV  596

Query  45   NDIMLQ  28
            ND+M+Q
Sbjct  597  NDLMIQ  602



>emb|CAF74711.1| MYC transcription factor [Solanum tuberosum]
Length=646

 Score =   175 bits (443),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 95/184 (52%), Positives = 127/184 (69%), Gaps = 9/184 (5%)
 Frame = -2

Query  558  EHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYALRS  379
            +HSD +   +KE  IV+ ++  P+KRGRKP  GR  P+NHVEAERQRREKLN RFYALR+
Sbjct  437  DHSDLEASVVKEA-IVEPERK-PRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRA  494

Query  378  VVPNVSRMDKASLLSDAVSYINELKGKV-------EELECQLQLRESKKVKVEAVGDNQs  220
            VVPNVS+MDKASLL DA++YINELK KV       EEL  Q++    +     +   + S
Sbjct  495  VVPNVSKMDKASLLGDAIAYINELKSKVQNSDLDKEELRSQIESLRKELANKGSSNYSSS  554

Query  219  tssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVND  40
              S        +D++VK++G DAMIR+Q    N+P+A+LM  L++L+L VHHAS+S VND
Sbjct  555  PPSNQDLKIVDMDIDVKVIGWDAMIRIQCSKKNHPAARLMAALKDLDLDVHHASVSVVND  614

Query  39   IMLQ  28
            +M+Q
Sbjct  615  LMIQ  618



>ref|XP_006366244.1| PREDICTED: transcription factor MYC2-like [Solanum tuberosum]
Length=650

 Score =   174 bits (442),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 95/183 (52%), Positives = 126/183 (69%), Gaps = 9/183 (5%)
 Frame = -2

Query  555  HSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYALRSV  376
            HSD +   +KE  IV+ ++  P+KRGRKP  GR  P+NHVEAERQRREKLN RFYALR+V
Sbjct  442  HSDLEASVVKEA-IVEPEKK-PRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAV  499

Query  375  VPNVSRMDKASLLSDAVSYINELKGKV-------EELECQLQLRESKKVKVEAVGDNQst  217
            VPNVS+MDKASLL DA++YINELK KV       EEL  Q++    +     +   + S 
Sbjct  500  VPNVSKMDKASLLGDAIAYINELKSKVQNSDLDKEELRSQIESLRKELANKGSSNYSSSP  559

Query  216  ssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDI  37
             S        +D++VK++G DAMIR+Q    N+P+A+LM  L++L+L VHHAS+S VND+
Sbjct  560  PSNQDLKIVDMDIDVKVIGWDAMIRIQCSKKNHPAARLMAALKDLDLDVHHASVSVVNDL  619

Query  36   MLQ  28
            M+Q
Sbjct  620  MIQ  622



>gb|ADK56287.1| LMYC1 [Hevea brasiliensis]
Length=476

 Score =   172 bits (437),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 95/163 (58%), Positives = 122/163 (75%), Gaps = 8/163 (5%)
 Frame = -2

Query  489  KKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYINE  310
            KKRGRK   G   P+NHVEAERQRRE+LNHRFYALRS VPNVS+MDKASLL+DAV+YI E
Sbjct  291  KKRGRKQLNGEELPINHVEAERQRRERLNHRFYALRSAVPNVSKMDKASLLADAVTYIKE  350

Query  309  LKGKVEELECQLQLRESKKVKVEAVGDNQst-------ssaassvaSPVDVEVKIVGPDA  151
            LK  V+EL+ +L+   SKK K   V DNQST        S++S  A  ++++V IVG +A
Sbjct  351  LKATVDELQSKLEAV-SKKSKSTNVTDNQSTDSMIDHMRSSSSYKAKGMELDVTIVGSEA  409

Query  150  MIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQDI  22
            MIR  S + NYP+A+LM+ LRE+E  VHHAS+SS+ +++LQD+
Sbjct  410  MIRFLSPDVNYPAARLMDVLREVEFKVHHASMSSIKEMVLQDV  452



>gb|EYU44086.1| hypothetical protein MIMGU_mgv1a002808mg [Erythranthe guttata]
Length=635

 Score =   174 bits (442),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 95/161 (59%), Positives = 120/161 (75%), Gaps = 6/161 (4%)
 Frame = -2

Query  492  PKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYIN  313
            P+KRGRKP  GR  P+NHVEAERQRREKLN RFYALR+VVPNVS+MDKASLL DA++YIN
Sbjct  449  PRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYIN  508

Query  312  ELKGKVEELEC-QLQLR---ESKKVKVEAVGDNQstssaassvaSPVDVE--VKIVGPDA  151
            ELK K++ +E  + +LR   ES    ++   D + +S+   S    VD+E  VKI+G DA
Sbjct  509  ELKSKLQNVELDKDELRRQLESSSSSMQKKKDKEYSSAKEESSKGIVDMEIDVKIIGWDA  568

Query  150  MIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQ  28
            MIRVQ    N+P+AK+M  LREL+L VHHAS+S VND+M+Q
Sbjct  569  MIRVQCSKKNHPAAKMMVALRELDLDVHHASVSVVNDLMIQ  609



>ref|XP_007210309.1| hypothetical protein PRUPE_ppa002404mg [Prunus persica]
 gb|EMJ11508.1| hypothetical protein PRUPE_ppa002404mg [Prunus persica]
Length=676

 Score =   174 bits (442),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 100/192 (52%), Positives = 131/192 (68%), Gaps = 14/192 (7%)
 Frame = -2

Query  564  EXEHSDSDCQFLKEPP---IVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRF  394
            + +HSD +   ++E     +VD ++  P+KRGRKP  GR  P+NHVEAERQRREKLN RF
Sbjct  458  DSDHSDLEASVVRETDSSRVVDPEKR-PRKRGRKPANGREEPLNHVEAERQRREKLNQRF  516

Query  393  YALRSVVPNVSRMDKASLLSDAVSYINELKGKV-------EELECQLQLRESK---KVKV  244
            YALR+VVPNVS+MDKASLL DA+SYINELK K+       E+L+ QL+        K   
Sbjct  517  YALRAVVPNVSKMDKASLLGDAISYINELKAKLQTTESDKEDLQKQLESMNQDLGCKDSS  576

Query  243  EAVGDNQstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHH  64
                D + +   ASS    +D++VKI+G DAMIR+Q    N+P+A+LM  L+EL+L VHH
Sbjct  577  SLSDDLKMSKHQASSKLIDLDIDVKIIGWDAMIRIQCCKKNHPAARLMASLKELDLDVHH  636

Query  63   ASISSVNDIMLQ  28
            ASIS VND+M+Q
Sbjct  637  ASISVVNDLMIQ  648



>gb|AHN63211.1| transcription factor MYC2 [Salvia miltiorrhiza f. alba]
Length=592

 Score =   174 bits (441),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 96/183 (52%), Positives = 130/183 (71%), Gaps = 8/183 (4%)
 Frame = -2

Query  564  EXEHSDSDCQFLKEPP---IVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRF  394
            E +HSD +   +KE     +V+ ++  P+KRGRKP  GR  P+NHVEAERQRREKLN RF
Sbjct  386  ESDHSDLEASVVKEADSSRVVNPEKR-PRKRGRKPANGREEPLNHVEAERQRREKLNQRF  444

Query  393  YALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKVKVEAVG-DNQst  217
            YALR+VVPNVS+MDKASLL DA++YINELK KV+  E     ++  + ++E++     + 
Sbjct  445  YALRAVVPNVSKMDKASLLGDAIAYINELKSKVQNAESD---KDELRSELESLKRATPAP  501

Query  216  ssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDI  37
            + A +     +D++VKI+G DAMIRVQ    N+P+AKLM  LREL+L VHHAS+S V D+
Sbjct  502  APAPAPAKIDMDMDVKIIGWDAMIRVQCSKKNHPAAKLMVALRELDLDVHHASVSVVKDL  561

Query  36   MLQ  28
            M+Q
Sbjct  562  MIQ  564



>emb|CDY58502.1| BnaA06g40330D [Brassica napus]
Length=449

 Score =   172 bits (435),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 94/189 (50%), Positives = 131/189 (69%), Gaps = 11/189 (6%)
 Frame = -2

Query  564  EXEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYAL  385
            E +HSD +   +KE  +V+ ++  P+KRGRKP  GR  P+NHVEAERQRREKLN RFY+L
Sbjct  234  ESDHSDLEASVVKEAIVVEPEKK-PRKRGRKPANGREEPLNHVEAERQRREKLNQRFYSL  292

Query  384  RSVVPNVSRMDKASLLSDAVSYINELKGKVEELEC-----QLQLRESKKVKVEAVGDNQs  220
            R+VVPNVS+MDKASLL DA+SYINELK K+++ E      Q QL    K      G +++
Sbjct  293  RAVVPNVSKMDKASLLGDAISYINELKSKLQQAESEKEEIQKQLDGMSKEGNGKSGASRA  352

Query  219  -----tssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASI  55
                 +S   S+ +  ++++VKI+G D MIRVQ    N+P ++ M+ L+EL+L V+HAS+
Sbjct  353  VKERRSSYQDSASSVEMEIDVKIIGWDVMIRVQCSKKNHPGSRFMDALKELDLEVNHASL  412

Query  54   SSVNDIMLQ  28
            S VND+M+Q
Sbjct  413  SVVNDLMIQ  421



>emb|CDX77688.1| BnaC07g19420D [Brassica napus]
Length=452

 Score =   172 bits (435),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 94/189 (50%), Positives = 131/189 (69%), Gaps = 11/189 (6%)
 Frame = -2

Query  564  EXEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYAL  385
            E +HSD +   +KE  +V+ ++  P+KRGRKP  GR  P+NHVEAERQRREKLN RFY+L
Sbjct  237  ESDHSDLEASVVKEAIVVEPEKK-PRKRGRKPANGREEPLNHVEAERQRREKLNQRFYSL  295

Query  384  RSVVPNVSRMDKASLLSDAVSYINELKGKVEELEC-----QLQLRESKKVKVEAVGDNQs  220
            R+VVPNVS+MDKASLL DA+SYINELK K+++ E      Q QL    K      G +++
Sbjct  296  RAVVPNVSKMDKASLLGDAISYINELKSKLQQAESDKEEIQKQLDGMSKEGNGKSGASRA  355

Query  219  -----tssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASI  55
                 +S   S+ +  ++++VKI+G D MIRVQ    N+P ++ M+ L+EL+L V+HAS+
Sbjct  356  VRERKSSYQDSASSVEMEIDVKIIGWDVMIRVQCSKKNHPGSRFMDALKELDLEVNHASL  415

Query  54   SSVNDIMLQ  28
            S VND+M+Q
Sbjct  416  SVVNDLMIQ  424



>ref|XP_010559309.1| PREDICTED: transcription factor MYC4-like [Tarenaya hassleriana]
Length=635

 Score =   174 bits (441),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 95/186 (51%), Positives = 124/186 (67%), Gaps = 10/186 (5%)
 Frame = -2

Query  564  EXEHSDSDCQFLKEPPI--VDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFY  391
            + +HSD +    KE     V   +  P+KRGRKP  GR  P+NHVEAERQRREKLN RFY
Sbjct  428  DSDHSDVEASVYKEADSGRVVEPEKKPRKRGRKPANGREEPLNHVEAERQRREKLNQRFY  487

Query  390  ALRSVVPNVSRMDKASLLSDAVSYINELKGKVEEL-----ECQLQLRESKKVKVEAVGDN  226
            +LR++VPNVS+MDKASLL DA+SYINELK KV++      E Q QLRE +K      G +
Sbjct  488  SLRALVPNVSKMDKASLLGDAISYINELKSKVQKAEFDKGELQKQLRELRK---GVSGKD  544

Query  225  QstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSV  46
            Q   +  S  +   +++VKI+G D MIR+Q    N+P AK M  L+EL+L V+HAS+S V
Sbjct  545  QKGLNQDSGPSVETEIDVKIIGWDVMIRIQCSKKNHPGAKFMEALKELDLEVNHASLSVV  604

Query  45   NDIMLQ  28
            ND M++
Sbjct  605  NDFMIE  610



>ref|XP_008238247.1| PREDICTED: transcription factor MYC2 [Prunus mume]
Length=685

 Score =   174 bits (442),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 98/196 (50%), Positives = 134/196 (68%), Gaps = 21/196 (11%)
 Frame = -2

Query  564  EXEHSDSDCQFLKEPP---IVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRF  394
            + +HSD +   ++E     +VD ++  P+KRGRKP  GR  P+NHVEAERQRREKLN RF
Sbjct  466  DSDHSDLEASVVRETDSSRVVDPEKR-PRKRGRKPANGREEPLNHVEAERQRREKLNQRF  524

Query  393  YALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKVKVEAVG------  232
            YALR+VVPNVS+MDKASLL DA+SYINELK K++ +E     +E  + ++E++       
Sbjct  525  YALRAVVPNVSKMDKASLLGDAISYINELKAKLQTVESD---KEDLQKQLESMNQDLGCK  581

Query  231  --------DNQstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELEL  76
                    D + +   ASS    +D++VKI+G DAMIR+Q    N+P+A+LM  L+EL+L
Sbjct  582  DSSSLSDQDLKMSKHQASSKLIDLDIDVKIIGWDAMIRIQCCKKNHPAARLMASLKELDL  641

Query  75   AVHHASISSVNDIMLQ  28
             VHHASIS VND+M+Q
Sbjct  642  DVHHASISVVNDLMIQ  657



>ref|XP_009114329.1| PREDICTED: transcription factor MYC3-like [Brassica rapa]
Length=563

 Score =   173 bits (439),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 94/184 (51%), Positives = 128/184 (70%), Gaps = 6/184 (3%)
 Frame = -2

Query  564  EXEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYAL  385
            + +HSD +   +KE  IV+ ++  P+KRGRKP  GR  P+NHVEAERQRREKLN RFY+L
Sbjct  353  DSDHSDIEASVVKEAIIVEPEKK-PRKRGRKPANGREEPLNHVEAERQRREKLNQRFYSL  411

Query  384  RSVVPNVSRMDKASLLSDAVSYINELKGKVEELEC-----QLQLRESKKVKVEAVGDNQs  220
            R+VVPNVS+MDKASLL DA+SYINELK K+++ E      Q QL    K    +    + 
Sbjct  412  RAVVPNVSKMDKASLLGDAISYINELKTKLQQAETDKEEVQKQLDRMSKEGGGSRRAKER  471

Query  219  tssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVND  40
             S+  S+ +  ++++VKI+G D MIRVQ    N+P A+ M  L+EL+L V+HAS+S VND
Sbjct  472  KSNLDSASSVEMEIDVKIIGWDVMIRVQCGKKNHPGARFMEALKELDLEVNHASLSMVND  531

Query  39   IMLQ  28
            +M+Q
Sbjct  532  LMIQ  535



>emb|CDY35179.1| BnaA09g18160D [Brassica napus]
Length=562

 Score =   173 bits (439),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 94/184 (51%), Positives = 128/184 (70%), Gaps = 6/184 (3%)
 Frame = -2

Query  564  EXEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYAL  385
            + +HSD +   +KE  IV+ ++  P+KRGRKP  GR  P+NHVEAERQRREKLN RFY+L
Sbjct  352  DSDHSDIEASVVKEAIIVEPEKK-PRKRGRKPANGREEPLNHVEAERQRREKLNQRFYSL  410

Query  384  RSVVPNVSRMDKASLLSDAVSYINELKGKVEELEC-----QLQLRESKKVKVEAVGDNQs  220
            R+VVPNVS+MDKASLL DA+SYINELK K+++ E      Q QL    K    +    + 
Sbjct  411  RAVVPNVSKMDKASLLGDAISYINELKTKLQQAETDKEEVQKQLDRMSKEGGGSRRAKER  470

Query  219  tssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVND  40
             S+  S+ +  ++++VKI+G D MIRVQ    N+P A+ M  L+EL+L V+HAS+S VND
Sbjct  471  KSNLDSASSVEMEIDVKIIGWDVMIRVQCGKKNHPGARFMEALKELDLEVNHASLSMVND  530

Query  39   IMLQ  28
            +M+Q
Sbjct  531  LMIQ  534



>ref|NP_199488.1| JAZ-interacting transcription factor MYC3 [Arabidopsis thaliana]
 sp|Q9FIP9.1|MYC3_ARATH RecName: Full=Transcription factor MYC3; AltName: Full=Basic 
helix-loop-helix protein 5; Short=AtbHLH5; Short=bHLH 5; AltName: 
Full=Protein ALTERED TRYPTOPHAN REGULATION 2; AltName: 
Full=Transcription factor ATR2; AltName: Full=Transcription 
factor EN 36; AltName: Full=bHLH transcription factor bHLH005 
[Arabidopsis thaliana]
 dbj|BAB08920.1| bHLH protein-like [Arabidopsis thaliana]
 gb|AED95422.1| JAZ-interacting transcription factor MYC3 [Arabidopsis thaliana]
Length=592

 Score =   174 bits (440),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 90/190 (47%), Positives = 131/190 (69%), Gaps = 11/190 (6%)
 Frame = -2

Query  564  EXEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYAL  385
            + +HSD +   +KE  +V+  +  P+KRGRKP  GR  P+NHVEAERQRREKLN RFY+L
Sbjct  375  DSDHSDLEASVVKEAIVVEPPEKKPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYSL  434

Query  384  RSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKVKVEAVGDN-------  226
            R+VVPNVS+MDKASLL DA+SYINELK K+++ E   +  + K   +   G+N       
Sbjct  435  RAVVPNVSKMDKASLLGDAISYINELKSKLQQAESDKEEIQKKLDGMSKEGNNGKGCGSR  494

Query  225  ----QstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHAS  58
                +S++  +++ +  ++++VKI+G D MIRVQ    ++P A+ M  L+EL+L V+HAS
Sbjct  495  AKERKSSNQDSTASSIEMEIDVKIIGWDVMIRVQCGKKDHPGARFMEALKELDLEVNHAS  554

Query  57   ISSVNDIMLQ  28
            +S VND+M+Q
Sbjct  555  LSVVNDLMIQ  564



>gb|AAL55712.1|AF251690_1 putative transcription factor BHLH5 [Arabidopsis thaliana]
Length=592

 Score =   174 bits (440),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 90/190 (47%), Positives = 131/190 (69%), Gaps = 11/190 (6%)
 Frame = -2

Query  564  EXEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYAL  385
            + +HSD +   +KE  +V+  +  P+KRGRKP  GR  P+NHVEAERQRREKLN RFY+L
Sbjct  375  DSDHSDLEASVVKEAIVVEPPEKKPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYSL  434

Query  384  RSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKVKVEAVGDN-------  226
            R+VVPNVS+MDKASLL DA+SYINELK K+++ E   +  + K   +   G+N       
Sbjct  435  RAVVPNVSKMDKASLLGDAISYINELKSKLQQAESDKEEIQKKLDGMSKEGNNGKGCGSR  494

Query  225  ----QstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHAS  58
                +S++  +++ +  ++++VKI+G D MIRVQ    ++P A+ M  L+EL+L V+HAS
Sbjct  495  AKERKSSNQDSTASSIEMEIDVKIIGWDVMIRVQCGKKDHPGARFMEALKELDLEVNHAS  554

Query  57   ISSVNDIMLQ  28
            +S VND+M+Q
Sbjct  555  LSVVNDLMIQ  564



>ref|XP_008245834.1| PREDICTED: transcription factor bHLH14-like isoform X1 [Prunus 
mume]
Length=493

 Score =   172 bits (436),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 98/184 (53%), Positives = 124/184 (67%), Gaps = 28/184 (15%)
 Frame = -2

Query  489  KKRGRKP--GAGRVTPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYI  316
            KKRGR    G  R +P+NHVEAERQRREKLNHRFYALRSVVPNVS+MDKASLLSDAV YI
Sbjct  286  KKRGRSSNHGTDRESPINHVEAERQRREKLNHRFYALRSVVPNVSKMDKASLLSDAVVYI  345

Query  315  NELKGKVEELECQLQLRESK-KVKV-------------EAVGDNQstssaassvaSP---  187
            N+LK +VEELE ++Q +  K K+ +              ++ D+        +   P   
Sbjct  346  NKLKARVEELEAKIQQQPQKPKLGILSNLEHHQSNQSASSIVDHHRHHHHHQARPRPASS  405

Query  186  ---------VDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIM  34
                     ++V+VKIVG +AMIRVQS + NYP A+LMN L++LEL V+HASISSV ++M
Sbjct  406  YTNCEVAGAIEVDVKIVGSEAMIRVQSPDQNYPYARLMNALKDLELQVYHASISSVKEMM  465

Query  33   LQDI  22
            LQD+
Sbjct  466  LQDV  469



>gb|EPS57820.1| hypothetical protein M569_16997, partial [Genlisea aurea]
Length=562

 Score =   173 bits (439),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 94/162 (58%), Positives = 117/162 (72%), Gaps = 10/162 (6%)
 Frame = -2

Query  492  PKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYIN  313
            P+KRGRKP  GR  P+NHVEAERQRREKLN RFYALR+VVPNVS+MDKASLL DA+SYIN
Sbjct  379  PRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYIN  438

Query  312  ELKGK-------VEELECQLQLRESKKVKVEAVGDNQstssaassvaSPVDVEVKIVGPD  154
            ELK K       V+EL  QL   ES K +          ++A+++    VD+EVKI+G D
Sbjct  439  ELKSKLQNSEMDVDELRSQL---ESLKKEHNDSDPPTGYTTASATNNVSVDIEVKIIGRD  495

Query  153  AMIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQ  28
            AMI+VQ    N+P+A+LM   REL+L VHHAS+S VN++M+Q
Sbjct  496  AMIQVQCGKRNHPAAQLMTAFRELDLDVHHASVSVVNELMIQ  537



>gb|AGL98101.1| transcription factor MYC2-like protein [Nicotiana attenuata]
Length=666

 Score =   174 bits (441),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 99/195 (51%), Positives = 126/195 (65%), Gaps = 21/195 (11%)
 Frame = -2

Query  558  EHSDSDCQFLKEPPI--VDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYAL  385
            +HSD +   +KE     V   +  PKKRGRKP  GR  P+NHVEAERQRREKLN RFYAL
Sbjct  447  DHSDLEASVVKEAESSRVVEPEKRPKKRGRKPANGREEPLNHVEAERQRREKLNQRFYAL  506

Query  384  RSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKVKVEAV----------  235
            R+VVPNVS+MDKASLL DA+SYINELK K++  E     RE  K ++E +          
Sbjct  507  RAVVPNVSKMDKASLLGDAISYINELKLKLQNTETD---REDLKSQIEDLKKELASEDSW  563

Query  234  ------GDNQstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELA  73
                    +   SS   S    VD++VKI+G DAM+R+Q    N+P+A+LM  L+EL+L 
Sbjct  564  RPGPPPNQDHKMSSHTGSKIVDVDIDVKIIGWDAMVRIQCNKKNHPAARLMVALKELDLE  623

Query  72   VHHASISSVNDIMLQ  28
            VHHAS+S VND+M+Q
Sbjct  624  VHHASVSVVNDLMIQ  638



>emb|CDY03195.1| BnaC09g19610D [Brassica napus]
Length=545

 Score =   173 bits (438),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 95/179 (53%), Positives = 124/179 (69%), Gaps = 11/179 (6%)
 Frame = -2

Query  564  EXEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYAL  385
            + +HSD +   +KE  IV+ ++  P+KRGRKP  GR  P+NHVEAERQRREKLN RFY+L
Sbjct  350  DSDHSDIEASVVKEAIIVEPEKK-PRKRGRKPANGREEPLNHVEAERQRREKLNQRFYSL  408

Query  384  RSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKVKVEAVGDNQstssaa  205
            R+VVPNVS+MDKASLL DA+SYINELK K       LQ  E+ K +V+   D  S     
Sbjct  409  RAVVPNVSKMDKASLLGDAISYINELKTK-------LQQAETDKEEVQKQLDGMSKEGGG  461

Query  204  ssvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQ  28
            S     ++++VKI+G D MIRVQ    N+P A+ M  L+EL+L V+HAS+S VND+M+Q
Sbjct  462  SVE---MEIDVKIIGWDVMIRVQCGKKNHPGARFMEALKELDLEVNHASLSVVNDLMIQ  517



>gb|ABD65632.1| basic helix-loop-helix (bHLH) family transcription factor [Brassica 
oleracea]
Length=586

 Score =   173 bits (439),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 97/187 (52%), Positives = 126/187 (67%), Gaps = 12/187 (6%)
 Frame = -2

Query  552  SDSDCQFLKEPP---IVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYALR  382
            SD +   +KE     IV   +  P+KRGRKP  GR  P+NHVEAERQRREKLN RFY+LR
Sbjct  376  SDLEASVVKEAESGRIVAETEKKPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYSLR  435

Query  381  SVVPNVSRMDKASLLSDAVSYINELKGKV-------EELECQL--QLRESKKVKVEAVGD  229
            +VVPNVS+MDKASLL DA+SYINELK K+       EEL+ Q+    +E     V+++  
Sbjct  436  AVVPNVSKMDKASLLGDAISYINELKAKLQKAEADKEELQKQIDGMSKEVGDGNVKSLVK  495

Query  228  NQstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISS  49
            +Q      S V+  V+++VKI+G DAMIR+Q    N+P AK M  L+ELEL V+HAS+S 
Sbjct  496  DQKCLDQDSGVSIEVEIDVKIIGWDAMIRIQCAKKNHPGAKFMEALKELELEVNHASLSV  555

Query  48   VNDIMLQ  28
            VN+ M+Q
Sbjct  556  VNEFMIQ  562



>gb|AGQ80897.1| MYC1 [Lithospermum erythrorhizon]
Length=636

 Score =   174 bits (440),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 93/169 (55%), Positives = 122/169 (72%), Gaps = 17/169 (10%)
 Frame = -2

Query  492  PKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYIN  313
            P+KRGRKP  GR+ P+NHVEAERQRREKLN RFYALR+VVPNVS+MDKASLL+DA+SYI 
Sbjct  443  PRKRGRKPANGRLEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLADAISYIT  502

Query  312  ELKGKVEELECQLQLRESKKVKVEAV-GDNQstssaassvaSP-------------VDVE  175
            ELK K+++ E     RE  K +VE +  D  S++  +   ++P             +D++
Sbjct  503  ELKSKLQKSESA---REDLKSQVEFLKKDLSSSTKESRKGSAPPTSRGTKNTKIVDIDID  559

Query  174  VKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQ  28
            VKI+G DAMIR+QS   N+P+AKLM  L+E +L VHHAS+S VND+M+Q
Sbjct  560  VKIIGWDAMIRIQSSKRNHPAAKLMAALQEHDLEVHHASVSVVNDLMIQ  608



>gb|KHM99168.1| Transcription factor MYC2 [Glycine soja]
Length=426

 Score =   171 bits (432),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 95/195 (49%), Positives = 124/195 (64%), Gaps = 22/195 (11%)
 Frame = -2

Query  555  HSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYALRSV  376
            HSD +    K+   V   +  P+KRGRKP  GR  P+NHVEAERQRREKLN RFYALR+V
Sbjct  206  HSDLEASVAKQ---VVEPEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAV  262

Query  375  VPNVSRMDKASLLSDAVSYINELKGKVEEL-----ECQLQLRESKK--------------  253
            VPNVS+MDKASLL DA+SYINELK K+  L     E + QL  +KK              
Sbjct  263  VPNVSKMDKASLLGDAISYINELKLKLNGLDSEKGELEKQLDSAKKELELATKNPPPPPP  322

Query  252  VKVEAVGDNQstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELA  73
                    N   +   ++  + +++EVKI+G DAMIR+Q    N+P+A+LM  L++L+L 
Sbjct  323  PPPGLPPSNNEEAKKTTTKLADLEIEVKIIGWDAMIRIQCSKKNHPAARLMAALKDLDLE  382

Query  72   VHHASISSVNDIMLQ  28
            VHHAS+S VND+M+Q
Sbjct  383  VHHASVSVVNDLMIQ  397



>ref|XP_008658563.1| PREDICTED: transcription factor MYC4 [Zea mays]
 tpg|DAA46409.1| TPA: putative HLH DNA-binding domain superfamily protein [Zea 
mays]
Length=705

 Score =   174 bits (440),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 97/199 (49%), Positives = 130/199 (65%), Gaps = 24/199 (12%)
 Frame = -2

Query  564  EXEHSDSDC--------QFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREK  409
            E +HSD D         + +  PP  +++   P+KRGRKP  GR  P+NHVEAERQRREK
Sbjct  482  ESDHSDLDASVREVESSRVVAPPPEAEKR---PRKRGRKPANGREEPLNHVEAERQRREK  538

Query  408  LNHRFYALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKVKVEAVGD  229
            LN RFYALR+VVPNVS+MDKASLL DA+SYINEL+GK+  LE     +E+ + +VEA+  
Sbjct  539  LNQRFYALRAVVPNVSKMDKASLLGDAISYINELRGKLTSLETD---KETLQTQVEALKK  595

Query  228  NQstssaassvaS----------PVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELE  79
             +     + S              V+++ KI+G +AMIRVQ    N+PSA+LM  LREL+
Sbjct  596  ERDARPPSHSAGLGGHDGGPRCHAVEIDAKILGLEAMIRVQCHKRNHPSARLMTALRELD  655

Query  78   LAVHHASISSVNDIMLQDI  22
            L V+HAS+S V D+M+Q +
Sbjct  656  LDVYHASVSVVKDLMIQQV  674



>gb|AAD15818.1| transcription factor MYC7E [Zea mays]
Length=702

 Score =   174 bits (440),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 97/199 (49%), Positives = 130/199 (65%), Gaps = 24/199 (12%)
 Frame = -2

Query  564  EXEHSDSDC--------QFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREK  409
            E +HSD D         + +  PP  +++   P+KRGRKP  GR  P+NHVEAERQRREK
Sbjct  479  ESDHSDLDASVREVESSRVVAPPPEAEKR---PRKRGRKPANGREEPLNHVEAERQRREK  535

Query  408  LNHRFYALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKVKVEAVGD  229
            LN RFYALR+VVPNVS+MDKASLL DA+SYINEL+GK+  LE     +E+ + +VEA+  
Sbjct  536  LNQRFYALRAVVPNVSKMDKASLLGDAISYINELRGKLTSLETD---KETLQTQVEALKK  592

Query  228  NQstssaassva----------SPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELE  79
             +     + S              V+++ KI+G +AMIRVQ    N+PSA+LM  LREL+
Sbjct  593  ERDARPPSHSAGLGGHDGGPRCHAVEIDAKILGLEAMIRVQCHKRNHPSARLMTALRELD  652

Query  78   LAVHHASISSVNDIMLQDI  22
            L V+HAS+S V D+M+Q +
Sbjct  653  LDVYHASVSVVKDLMIQQV  671



>ref|XP_006414178.1| hypothetical protein EUTSA_v10024688mg [Eutrema salsugineum]
 gb|ESQ55631.1| hypothetical protein EUTSA_v10024688mg [Eutrema salsugineum]
Length=621

 Score =   173 bits (439),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 95/186 (51%), Positives = 126/186 (68%), Gaps = 12/186 (6%)
 Frame = -2

Query  555  HSDSDCQFLKEPP---IVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYAL  385
            HSD D   +KE      V   +  P+KRGRKP  GR  P+NHVEAERQRREKLN RFY+L
Sbjct  410  HSDLDASVVKEAESNRTVVEPEKKPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYSL  469

Query  384  RSVVPNVSRMDKASLLSDAVSYINELKGKV-------EELECQLQLRESKKVKVEAVGDN  226
            R+VVPNVS+MDKASLL DA+SYINELK K+       EEL+ Q+ +  ++  K    G +
Sbjct  470  RAVVPNVSKMDKASLLGDAISYINELKSKLQKVESDKEELQKQIDVMSNENGKCS--GGD  527

Query  225  QstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSV  46
            +   +  S V+  ++++VKI+G DAMIR+Q    N+P AK M  L++L+L V+HAS+S V
Sbjct  528  RKYLNQDSGVSIEMEIDVKIIGWDAMIRIQCSKRNHPGAKFMEALKDLDLEVNHASLSVV  587

Query  45   NDIMLQ  28
            ND M+Q
Sbjct  588  NDFMIQ  593



>ref|XP_010540785.1| PREDICTED: transcription factor MYC2-like isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010540787.1| PREDICTED: transcription factor MYC2-like isoform X2 [Tarenaya 
hassleriana]
Length=603

 Score =   173 bits (438),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 99/192 (52%), Positives = 132/192 (69%), Gaps = 15/192 (8%)
 Frame = -2

Query  570  YPEXEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFY  391
            + + +HSD +   +KE     R    P+KRGRKP  GR  P+NHVEAERQRREKLN RFY
Sbjct  391  FGDSDHSDLEASVVKEAAPEKR----PRKRGRKPANGREEPLNHVEAERQRREKLNQRFY  446

Query  390  ALRSVVPNVSRMDKASLLSDAVSYINELKGKVE-------ELECQLQ--LRESKKVKVEA  238
            ALR+VVPNVS+MDKASLL DA+SYINELK K++       + +CQL+   RE       A
Sbjct  447  ALRAVVPNVSKMDKASLLGDAISYINELKSKLQRAESDKTQFQCQLENLKRELAGRHANA  506

Query  237  VGDNQstssaassvaSPV--DVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHH  64
                   S ++S+V+ P+  ++EVKI+  DAMIR++S   N+P+A+LM  L+ELEL V+H
Sbjct  507  NAGILDASDSSSAVSKPIGMEIEVKIIEWDAMIRIESSKRNHPAARLMTALKELELEVNH  566

Query  63   ASISSVNDIMLQ  28
            AS+S VND+M+Q
Sbjct  567  ASVSVVNDLMIQ  578



>ref|XP_008659898.1| PREDICTED: transcription factor MYC4-like [Zea mays]
 gb|AFW87749.1| putative HLH DNA-binding domain superfamily protein [Zea mays]
Length=703

 Score =   173 bits (439),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 98/201 (49%), Positives = 129/201 (64%), Gaps = 26/201 (13%)
 Frame = -2

Query  564  EXEHSDSDC--------QFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREK  409
            E +HSD D         + +  PP  +++   P+KRGRKP  GR  P+NHVEAERQRREK
Sbjct  478  ESDHSDLDASVREVESSRVVAPPPEAEKR---PRKRGRKPANGREEPLNHVEAERQRREK  534

Query  408  LNHRFYALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKVKVEAVGD  229
            LN RFYALR+VVPNVS+MDKASLL DA+SYINEL+GK+  LE     RE+ + +VEA+  
Sbjct  535  LNQRFYALRAVVPNVSKMDKASLLGDAISYINELRGKLTSLESD---RETLQAQVEALKK  591

Query  228  NQstssaassvaS------------PVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRE  85
             +         A              V+++ KI+G +AMIRVQ    N+PSA+LM  LRE
Sbjct  592  ERDARPHPHPAAGLGGHDAGGPRCHAVEIDAKILGLEAMIRVQCHKRNHPSARLMTALRE  651

Query  84   LELAVHHASISSVNDIMLQDI  22
            L+L V+HAS+S V D+M+Q +
Sbjct  652  LDLDVYHASVSVVKDLMIQQV  672



>ref|XP_008374121.1| PREDICTED: transcription factor MYC3-like [Malus domestica]
Length=500

 Score =   171 bits (434),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 98/170 (58%), Positives = 124/170 (73%), Gaps = 15/170 (9%)
 Frame = -2

Query  489  KKRGRKPG--AGRV-TPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSY  319
            KKRGR      GR  +P+NHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAV Y
Sbjct  308  KKRGRSSNRETGRTESPINHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVVY  367

Query  318  INELKGKVEELECQLQLRESKKVKVEAVGDNQs-----------tssaassvaSPVDVEV  172
            IN+LK ++ +LE ++   + +K  V+  G   S           +SS  +S A  V+++V
Sbjct  368  INDLKARIGQLEAKIHA-QPQKPGVDIGGQTSSXVDHHQTRPRLSSSYNNSAAGAVEIDV  426

Query  171  KIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQDI  22
            KIVG +AMIRVQ  + NYP+A+LMN L++LEL V+HASISSV ++MLQD+
Sbjct  427  KIVGSEAMIRVQCPDCNYPNARLMNALKDLELQVYHASISSVKELMLQDV  476



>ref|XP_009360191.1| PREDICTED: transcription factor MYC2-like [Pyrus x bretschneideri]
Length=476

 Score =   171 bits (433),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 96/172 (56%), Positives = 120/172 (70%), Gaps = 18/172 (10%)
 Frame = -2

Query  489  KKRGRKPG--AGRV-TPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSY  319
            KKRGR      GR  TP+NHVEAERQRREKLN RFYALR+VVPNVSRMDKASLLSDAV Y
Sbjct  283  KKRGRSSNRETGRSETPINHVEAERQRREKLNRRFYALRAVVPNVSRMDKASLLSDAVVY  342

Query  318  INELKGKVEELECQLQLRESKKVKVEAVGDNQstssaassvaSP-------------VDV  178
            INELK +VE+LE ++Q +  K V    +G   ++S        P             +++
Sbjct  343  INELKARVEQLEAKIQAQHLKPVV--DIGGQTTSSIIDHHQTRPRLSSSYDNKAAGVMEI  400

Query  177  EVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQDI  22
            +VKIVG +AMIRVQ  + +YP+A+LMN L++LEL V+HASISSV  +MLQD+
Sbjct  401  DVKIVGSEAMIRVQCPDCDYPNARLMNALKDLELQVYHASISSVKGLMLQDV  452



>ref|XP_009796881.1| PREDICTED: transcription factor MYC2-like [Nicotiana sylvestris]
Length=424

 Score =   170 bits (430),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 94/165 (57%), Positives = 120/165 (73%), Gaps = 6/165 (4%)
 Frame = -2

Query  498  NAPKKRGRKPGAGRVTPV----NHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSD  331
            N P KRGRK  +   T       HVEAERQRREKLN+RFYALRSVVPNVS+MD+ASLL+D
Sbjct  234  NRPIKRGRKSSSSNATGTEMAKKHVEAERQRREKLNNRFYALRSVVPNVSKMDRASLLAD  293

Query  330  AVSYINELKGKVEELECQ--LQLRESKKVKVEAVGDNQstssaassvaSPVDVEVKIVGP  157
            AV+YINELK KVEELE    L  +  ++    +V    ST    ++ +  ++VEVKI+G 
Sbjct  294  AVTYINELKAKVEELESYKILSQKPKRQCATNSVQTVPSTVLNRANNSFGMEVEVKIIGL  353

Query  156  DAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQDI  22
            +AM+RV+S + NYP A+LMN LRELEL V+HAS+SSV ++MLQD+
Sbjct  354  EAMVRVRSPDVNYPCARLMNVLRELELQVNHASVSSVKNLMLQDV  398



>ref|XP_009344509.1| PREDICTED: transcription factor MYC2-like, partial [Pyrus x bretschneideri]
Length=461

 Score =   170 bits (431),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 97/193 (50%), Positives = 131/193 (68%), Gaps = 15/193 (8%)
 Frame = -2

Query  564  EXEHSDSDCQFLKEPP---IVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRF  394
            + +HSD +   ++E     +VD ++  P+KRGRKP  GR  P+NHVEAERQRREKLN RF
Sbjct  240  DSDHSDLEASVVREADSSRVVDPEKR-PRKRGRKPANGREEPLNHVEAERQRREKLNQRF  298

Query  393  YALRSVVPNVSRMDKASLLSDAVSYINELKGKV-------EELECQLQLRES----KKVK  247
            YALR+VVPNVS+MDKASLL DA+SYINELK K+       EEL+ QL+   +    K  +
Sbjct  299  YALRAVVPNVSKMDKASLLGDAISYINELKLKLQTVETDKEELQKQLESMNNHLPCKDSR  358

Query  246  VEAVGDNQstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVH  67
                  ++      SS    +D++VKI+G DAMIR+Q    N+P+A+LM  L+EL++ VH
Sbjct  359  SSGSIMSEEELKGCSSKLLDMDIDVKIIGRDAMIRIQCCKKNHPAARLMAALKELDMDVH  418

Query  66   HASISSVNDIMLQ  28
            HAS+S VND+M+Q
Sbjct  419  HASVSVVNDLMIQ  431



>ref|XP_007156435.1| hypothetical protein PHAVU_003G285700g [Phaseolus vulgaris]
 gb|ESW28429.1| hypothetical protein PHAVU_003G285700g [Phaseolus vulgaris]
Length=642

 Score =   172 bits (437),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 95/193 (49%), Positives = 127/193 (66%), Gaps = 17/193 (9%)
 Frame = -2

Query  558  EHSDSDCQFLKEPP--IVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYAL  385
            E+SD +   +KE    +V+ ++  P+KRGRKP  GR  P+NHVEAERQRREKLN RFYAL
Sbjct  423  ENSDLEASVVKEADSRVVEPEKR-PRKRGRKPANGREEPLNHVEAERQRREKLNQRFYAL  481

Query  384  RSVVPNVSRMDKASLLSDAVSYINELKGKVEELEC--------------QLQLRESKKVK  247
            R+VVPNVS+MDKASLL DA+SYINELK K+ ELE               +L+L       
Sbjct  482  RAVVPNVSKMDKASLLGDAISYINELKSKLSELESEKGELEKQLELVKKELELATKSPSP  541

Query  246  VEAVGDNQstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVH  67
                  +   +   +S    +++EVKI+G DAMIR+Q    N+P+A+LM  L+EL+L V+
Sbjct  542  PPGPPPSNKEAKETTSKLIDLELEVKIIGWDAMIRIQCSKKNHPAARLMAALKELDLDVN  601

Query  66   HASISSVNDIMLQ  28
            HAS+S VND+M+Q
Sbjct  602  HASVSVVNDLMIQ  614



>ref|XP_008810069.1| PREDICTED: transcription factor MYC4-like [Phoenix dactylifera]
Length=434

 Score =   169 bits (428),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 99/188 (53%), Positives = 124/188 (66%), Gaps = 25/188 (13%)
 Frame = -2

Query  564  EXEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYAL  385
            + EHSDS+   + E     ++   P         GR TPVNHVEAERQRREKLNHRFYAL
Sbjct  228  DSEHSDSEGLLMVERRRPKKRGRKPGT-------GRETPVNHVEAERQRREKLNHRFYAL  280

Query  384  RSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKVKVEAVGDNQstssa-  208
            RSVVPNVSRMDKASLL+DAVSYI EL+ KVEELE      E+K+VK E + D     +A 
Sbjct  281  RSVVPNVSRMDKASLLADAVSYIKELRTKVEELEA-----EAKRVKKEIIVDQGVGGAAT  335

Query  207  ------------assvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHH  64
                             + +++EVK++GPDA+IRV SEN ++P+AKLM  LRELE+ VHH
Sbjct  336  TTSTTVSSVVSCGGGGLATMELEVKMLGPDALIRVHSENLSHPTAKLMGALRELEVHVHH  395

Query  63   ASISSVND  40
            AS+S+V +
Sbjct  396  ASVSTVKE  403



>ref|XP_002865164.1| hypothetical protein ARALYDRAFT_916752 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41423.1| hypothetical protein ARALYDRAFT_916752 [Arabidopsis lyrata subsp. 
lyrata]
Length=610

 Score =   171 bits (434),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 89/193 (46%), Positives = 132/193 (68%), Gaps = 17/193 (9%)
 Frame = -2

Query  564  EXEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYAL  385
            + +HSD +   +KE  +V+  +  P+KRGRKP  GR  P+NHVEAERQRREKLN RFY+L
Sbjct  393  DSDHSDLEASVVKEAIVVEPPEKKPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYSL  452

Query  384  RSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKVKVEAVG---------  232
            R+VVPNVS+MDKASLL DA+SYINELK K+++ E     +E  + K++ +          
Sbjct  453  RAVVPNVSKMDKASLLGDAISYINELKSKLQQAESD---KEEIQKKLDGMSKEGNNGKGG  509

Query  231  -----DNQstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVH  67
                 + +S++  +++ +  ++++VKI+G D MIRVQ    ++P A+ M  L+EL+L V+
Sbjct  510  GSRAKERKSSNQDSTASSIEMEIDVKIIGWDVMIRVQCSKKDHPGARFMEALKELDLEVN  569

Query  66   HASISSVNDIMLQ  28
            HAS+S VND+M+Q
Sbjct  570  HASLSVVNDLMIQ  582



>ref|XP_009101493.1| PREDICTED: transcription factor MYC3 [Brassica rapa]
Length=580

 Score =   171 bits (434),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 94/189 (50%), Positives = 131/189 (69%), Gaps = 11/189 (6%)
 Frame = -2

Query  564  EXEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYAL  385
            E +HSD +   +KE  +V+ ++  P+KRGRKP  GR  P+NHVEAERQRREKLN RFY+L
Sbjct  365  ESDHSDLEASVVKEAIVVEPEKK-PRKRGRKPANGREEPLNHVEAERQRREKLNQRFYSL  423

Query  384  RSVVPNVSRMDKASLLSDAVSYINELKGKVEELEC-----QLQLRESKKVKVEAVGDNQs  220
            R+VVPNVS+MDKASLL DA+SYINELK K+++ E      Q QL    K      G +++
Sbjct  424  RAVVPNVSKMDKASLLGDAISYINELKSKLQQAESEKEEIQKQLDGMSKEGNGKSGASRA  483

Query  219  -----tssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASI  55
                 +S   S+ +  ++++VKI+G D MIRVQ    N+P ++ M+ L+EL+L V+HAS+
Sbjct  484  VKERRSSYQDSASSVEMEIDVKIIGWDVMIRVQCSKKNHPGSRFMDALKELDLEVNHASL  543

Query  54   SSVNDIMLQ  28
            S VND+M+Q
Sbjct  544  SVVNDLMIQ  552



>gb|KJB37703.1| hypothetical protein B456_006G216700 [Gossypium raimondii]
Length=656

 Score =   172 bits (435),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 94/174 (54%), Positives = 117/174 (67%), Gaps = 28/174 (16%)
 Frame = -2

Query  492  PKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYIN  313
            P+KRGRKP  GR  P+NHVEAERQRREKLN +FYALR+VVPNVS+MDKASLL DA+SYIN
Sbjct  464  PRKRGRKPANGREEPLNHVEAERQRREKLNQKFYALRAVVPNVSKMDKASLLGDAISYIN  523

Query  312  ELKGKVEEL-----ECQLQLRESKKVKVEAVGDNQstssaassvaSP-------------  187
            EL+ KV++      E Q QL E KK         Q  S  +   A P             
Sbjct  524  ELRTKVQDADSEKEELQKQLDEMKK---------QLASKESCWTAPPPPDEDRNMSNKLI  574

Query  186  -VDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQ  28
             +D++VKI+G DAMIR+Q    N+P+A+LM  L+EL+L VHHAS+S VND+M+Q
Sbjct  575  ELDIDVKIIGLDAMIRIQCSKKNHPAARLMTALKELDLDVHHASVSVVNDLMIQ  628



>ref|XP_003612909.1| BHLH transcription factor [Medicago truncatula]
 gb|AES95867.1| basic helix loop helix (bHLH) family transcription factor [Medicago 
truncatula]
Length=677

 Score =   172 bits (435),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 99/205 (48%), Positives = 132/205 (64%), Gaps = 32/205 (16%)
 Frame = -2

Query  564  EXEHSDSDCQFLKEPPIVDRQ-----QNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNH  400
            + +HSD +   +KE   VD       +  P+KRGRKP  GR  P+NHVEAERQRREKLN 
Sbjct  451  DSDHSDLEASVVKE---VDSSRVVEPEKKPRKRGRKPANGREEPLNHVEAERQRREKLNQ  507

Query  399  RFYALRSVVPNVSRMDKASLLSDAVSYINELKGKVEE-------LECQLQLRESKKVKVE  241
            RFYALR+VVPNVS+MDKASLL DA+SYI ELK K+++       LE QL   +  K +++
Sbjct  508  RFYALRAVVPNVSKMDKASLLGDAISYITELKTKLQKTESDKDGLEKQL---DGMKNEIQ  564

Query  240  AVGDNQstss--------------aassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKL  103
             + +NQS                 +++     +D++VKI+G DAMIRVQ    N+P+A+L
Sbjct  565  KINENQSHQPPQQQQQQQPIPNKPSSNQALIDLDIDVKIIGWDAMIRVQCSKKNHPAARL  624

Query  102  MNGLRELELAVHHASISSVNDIMLQ  28
            M  L EL+L VHHAS+S VND+M+Q
Sbjct  625  MAALMELDLEVHHASVSVVNDLMIQ  649



>gb|KJB51639.1| hypothetical protein B456_008G226300 [Gossypium raimondii]
Length=646

 Score =   171 bits (434),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 94/188 (50%), Positives = 128/188 (68%), Gaps = 9/188 (5%)
 Frame = -2

Query  564  EXEHSDSDCQFLKEPPIVD--RQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFY  391
            + ++SD +   +KE   V     +  P+KRGRKP  GR  P+NHVEAERQRREKLN RFY
Sbjct  431  DSDNSDIEASVVKEAECVKPLEPEKKPRKRGRKPANGREEPLNHVEAERQRREKLNQRFY  490

Query  390  ALRSVVPNVSRMDKASLLSDAVSYINELKGKV-------EELECQLQLRESKKVKVEAVG  232
            ALR+VVPNVS+MDKASLL DA+SYINEL  KV       +EL+ QL+  + +  K ++  
Sbjct  491  ALRAVVPNVSKMDKASLLGDAISYINELSTKVQDAESEKQELQKQLEAMKKELAKKDSSP  550

Query  231  DNQstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASIS  52
             N  TS+   +    ++ EVK++G DAMIR+Q +  N+P+A+LM  L+EL L V HAS++
Sbjct  551  QNPKTSNHLGNRLIELETEVKVIGWDAMIRIQCKRKNHPAARLMAALKELNLDVQHASVT  610

Query  51   SVNDIMLQ  28
             VND+M+Q
Sbjct  611  VVNDLMIQ  618



>ref|XP_010445298.1| PREDICTED: transcription factor MYC4-like [Camelina sativa]
Length=612

 Score =   171 bits (434),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 93/179 (52%), Positives = 122/179 (68%), Gaps = 11/179 (6%)
 Frame = -2

Query  555  HSDSDCQFLKEPP---IVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYAL  385
            HSD +   +KE      V   +  P+KRGRKP  GR  P+NHVEAERQRREKLN RFY+L
Sbjct  414  HSDLEASVVKEAESNRTVVEPEKKPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYSL  473

Query  384  RSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKVKVEAVGDNQstssaa  205
            R+VVPNVS+MDKASLL DA+SYINELK K+ + E     +E  + +++ +  NQ    + 
Sbjct  474  RAVVPNVSKMDKASLLGDAISYINELKSKLLKAESD---KEELQKQIDGMKRNQEPGVSV  530

Query  204  ssvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQ  28
                  ++V+VKI+G DAMIRVQ    N+P AK M  L+EL+L V+HAS+S VND+M+Q
Sbjct  531  E-----MEVDVKIIGWDAMIRVQCSKRNHPGAKFMEALKELDLEVNHASLSVVNDLMIQ  584



>ref|XP_006283348.1| hypothetical protein CARUB_v10004392mg [Capsella rubella]
 gb|EOA16246.1| hypothetical protein CARUB_v10004392mg [Capsella rubella]
Length=614

 Score =   171 bits (433),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 94/186 (51%), Positives = 125/186 (67%), Gaps = 10/186 (5%)
 Frame = -2

Query  555  HSDSDCQFLKEPP---IVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYAL  385
            HSD +   +KE      V   +  P+KRGRKP  GR  P+NHVEAERQRREKLN RFY+L
Sbjct  401  HSDLEASVVKEAESNRTVVEPEKKPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYSL  460

Query  384  RSVVPNVSRMDKASLLSDAVSYINELKGKV-------EELECQLQLRESKKVKVEAVGDN  226
            R+VVPN+S+MDKASLL DA+SYINELK K+       EEL+ Q++    +    ++    
Sbjct  461  RAVVPNISKMDKASLLGDAISYINELKSKLQKVESDKEELQKQIEGMSKEAANEKSYVKE  520

Query  225  QstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSV  46
            +  ++  S V   ++V+VKI+G DAMIRVQ    N+P AK M  L+EL+L V+HAS+S V
Sbjct  521  RKCANQESGVTIEMEVDVKIIGWDAMIRVQCSKRNHPGAKFMEALKELDLEVNHASLSVV  580

Query  45   NDIMLQ  28
            ND+M+Q
Sbjct  581  NDLMIQ  586



>ref|XP_006279855.1| hypothetical protein CARUB_v10028441mg [Capsella rubella]
 gb|EOA12753.1| hypothetical protein CARUB_v10028441mg [Capsella rubella]
Length=602

 Score =   171 bits (433),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 91/188 (48%), Positives = 127/188 (68%), Gaps = 9/188 (5%)
 Frame = -2

Query  564  EXEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYAL  385
            + +HSD +   +KE  +V+  +  P+KRGRKP  GR  P+NHVEAERQRREKLN RFY+L
Sbjct  387  DSDHSDLEASVVKEAIVVEPPEKKPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYSL  446

Query  384  RSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKVKVEAVGDNQstssaa  205
            R+VVPNVS+MDKASLL DA+SYINELK K+++ E   +  + +   V   G+ +  S A 
Sbjct  447  RAVVPNVSKMDKASLLGDAISYINELKSKLQQAEIDKEEIQKRLDGVNKEGNGKGGSRAK  506

Query  204  ssvaSP---------VDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASIS  52
               +S          ++++VKI+G D MIRVQ    ++P A+ M  L+EL+L V+HAS+S
Sbjct  507  ERKSSNQDSSGSSIEMEIDVKIIGWDVMIRVQCSKKDHPGARFMEALKELDLEVNHASLS  566

Query  51   SVNDIMLQ  28
             VND+M+Q
Sbjct  567  VVNDLMIQ  574



>ref|XP_008346662.1| PREDICTED: transcription factor MYC2-like [Malus domestica]
Length=475

 Score =   169 bits (429),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 98/171 (57%), Positives = 122/171 (71%), Gaps = 16/171 (9%)
 Frame = -2

Query  489  KKRGRKPG--AGRV-TPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSY  319
            KKRGR      GR  TP+NHVEAERQRREKLN RFYALR+VVPNVSRMDKASLLSDAV Y
Sbjct  282  KKRGRSSNREXGRSETPINHVEAERQRREKLNRRFYALRAVVPNVSRMDKASLLSDAVVY  341

Query  318  INELKGKVEELECQLQLRESKKVKVEAVGDN------------QstssaassvaSPVDVE  175
            INELK +VE+LE ++Q +  K V V+  G              + +SS  +  A  +++E
Sbjct  342  INELKARVEQLEAKIQAQHLKPV-VDIGGQTTSSIIDPHQTRPRLSSSYNNRAAGAMEIE  400

Query  174  VKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQDI  22
             KIVG +AMIRVQ  + +YP+A+LMN L++LEL V+HASISSV  +MLQD+
Sbjct  401  XKIVGSEAMIRVQCPDCDYPNARLMNALKDLELQVYHASISSVKGLMLQDV  451



>gb|EYU32289.1| hypothetical protein MIMGU_mgv1a007575mg [Erythranthe guttata]
Length=403

 Score =   168 bits (425),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 97/164 (59%), Positives = 120/164 (73%), Gaps = 14/164 (9%)
 Frame = -2

Query  489  KKRGRKPGAGR----VTPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVS  322
            KKRGRKP   R    +  +NHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVS
Sbjct  222  KKRGRKPAGPRGPDALPTMNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVS  281

Query  321  YINELKGKVEELECQ----LQLRESKKVKVEAVGDNQstssaassvaSPVDVEVKIVGPD  154
            YI ELK ++++L+      L    S  VK E   D++   S++S       VEVK+VG D
Sbjct  282  YIKELKSRLDDLQTNNVNKLLSSSSSVVKTETDDDDEPIISSSSL------VEVKMVGVD  335

Query  153  AMIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQDI  22
             MIRVQSE +NYPSA+LM+ +R+L+L + HAS+S VN+IM+QD+
Sbjct  336  GMIRVQSEKSNYPSARLMDAIRDLKLEIQHASMSCVNNIMIQDV  379



>ref|XP_003516794.1| PREDICTED: transcription factor MYC2-like [Glycine max]
Length=637

 Score =   171 bits (433),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 95/196 (48%), Positives = 125/196 (64%), Gaps = 20/196 (10%)
 Frame = -2

Query  555  HSDSDCQFLKEPPI-VDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYALRS  379
            HSD +   +K+    V   +  P+KRGRKP  GR  P+NHVEAERQRREKLN RFYALR+
Sbjct  413  HSDLEASMVKQADSRVMEPEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRA  472

Query  378  VVPNVSRMDKASLLSDAVSYINELKGKVEEL-----ECQLQLRESKK-------------  253
            VVPNVS+MDKASLL DA+SYINELK K+  L     E + QL  +KK             
Sbjct  473  VVPNVSKMDKASLLGDAISYINELKLKLNGLDSEKGELEKQLDSAKKELELATKNPPPPP  532

Query  252  -VKVEAVGDNQstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELEL  76
                     N   +   ++  + +++EVKI+G DAMIR+Q    N+P+A+LM  L++L+L
Sbjct  533  PPPPGLPPSNNEEAKKTTTKLADLEIEVKIIGWDAMIRIQCSKKNHPAARLMAALKDLDL  592

Query  75   AVHHASISSVNDIMLQ  28
             VHHAS+S VND+M+Q
Sbjct  593  EVHHASVSVVNDLMIQ  608



>emb|CAF74710.1| MYC transcription factor [Solanum tuberosum]
Length=692

 Score =   171 bits (434),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 95/189 (50%), Positives = 122/189 (65%), Gaps = 13/189 (7%)
 Frame = -2

Query  564  EXEHSDSDCQFLKEPPI--VDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFY  391
            + EHSD +   +KE     V   +  P+KRGRKP  GR  P+NHVEAERQRREKLN RFY
Sbjct  475  DSEHSDLEASVVKEADSSRVVEPEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFY  534

Query  390  ALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKVKVEAVGDNQ----  223
            ALR+VVPNVS+MDKASLL DA+SYINELK K++  E     +E  K ++E +        
Sbjct  535  ALRAVVPNVSKMDKASLLGDAISYINELKSKLQNTESD---KEDLKSQIEDLKKESRRPG  591

Query  222  ----stssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASI  55
                +           VD++VKI+G DAMI +Q    N+P+A+LM  L EL+L VHHAS+
Sbjct  592  PPPPNQDLKIGGKIVDVDIDVKIIGWDAMIGIQCNKKNHPAARLMAALMELDLDVHHASV  651

Query  54   SSVNDIMLQ  28
            S VND+M+Q
Sbjct  652  SVVNDLMIQ  660



>gb|ADH04263.1| bHLH2 transcription factor [Nicotiana benthamiana]
Length=657

 Score =   171 bits (433),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 92/164 (56%), Positives = 117/164 (71%), Gaps = 12/164 (7%)
 Frame = -2

Query  492  PKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYIN  313
            P+KRGRKP  GR  P+NHVEAERQRREKLN RFYALR+VVPNVS+MDKASLL DA+++IN
Sbjct  469  PRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAFIN  528

Query  312  ELKGKV-------EELECQLQLRESKKVKVEAVGDNQstssaassvaSPV--DVEVKIVG  160
            ELK KV       EEL  Q+   ES + ++   G N +     +     V  D++VK++G
Sbjct  529  ELKSKVQNSDSDKEELRNQI---ESLRNELANKGSNYTGPPPLNQELKIVDMDIDVKVIG  585

Query  159  PDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQ  28
             DAMIR+QS   N+P+AKLM  L EL+L VHHAS+S VN++M+Q
Sbjct  586  WDAMIRIQSNKKNHPAAKLMAALMELDLDVHHASVSVVNELMIQ  629



>ref|XP_004512525.1| PREDICTED: transcription factor MYC2-like [Cicer arietinum]
Length=664

 Score =   171 bits (433),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 96/197 (49%), Positives = 131/197 (66%), Gaps = 21/197 (11%)
 Frame = -2

Query  564  EXEHSDSDCQFLKEPPIVDRQ-----QNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNH  400
            + +HSD +   +KE   VD       +  P+KRGRKP  GR  P+NHVEAERQRREKLN 
Sbjct  443  DSDHSDLEASVVKE---VDSSRMVEPEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQ  499

Query  399  RFYALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESK----KVKVEAVG  232
            RFYALR+VVPNVS+MDKASLL DA+SYI ELK K+++ E    + E +    K +++ + 
Sbjct  500  RFYALRAVVPNVSKMDKASLLGDAISYITELKTKLQKTESDKDVLEKEIDEVKKELQKIN  559

Query  231  DNQstss---------aassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELE  79
            +N S  S         +++     +D++VKI+G DAMIR+Q    N+P+A+LM  L EL+
Sbjct  560  ENSSNPSQPQPLHNKPSSNKALINLDIDVKIIGWDAMIRIQCSKKNHPAARLMAALMELD  619

Query  78   LAVHHASISSVNDIMLQ  28
            L VHHAS+S VND+M+Q
Sbjct  620  LEVHHASVSVVNDLMIQ  636



>ref|XP_009800420.1| PREDICTED: transcription factor MYC2-like [Nicotiana sylvestris]
Length=659

 Score =   171 bits (433),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 91/164 (55%), Positives = 118/164 (72%), Gaps = 12/164 (7%)
 Frame = -2

Query  492  PKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYIN  313
            P+KRGRKP  GR  P+NHVEAERQRREKLN RFYALR+VVPNVS+MDKASLL DA+++IN
Sbjct  471  PRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAFIN  530

Query  312  ELKGKV-------EELECQLQLRESKKVKVEAVGDNQstssaassvaSPV--DVEVKIVG  160
            ELK KV       EEL  Q+   ES + ++   G N +    ++     V  D++VK++G
Sbjct  531  ELKSKVQNSDSDKEELRNQI---ESLRNELANKGSNYTGPPPSNQELKIVDMDIDVKVIG  587

Query  159  PDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQ  28
             DAMIR+QS   N+P+A+LM  L EL+L VHHAS+S VN++M+Q
Sbjct  588  WDAMIRIQSNKKNHPAARLMTALMELDLDVHHASVSVVNELMIQ  631



>ref|XP_009587276.1| PREDICTED: transcription factor MYC2-like [Nicotiana tomentosiformis]
 gb|ADH04270.1| MYC2b transcription factor [Nicotiana tabacum]
Length=658

 Score =   171 bits (433),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 97/188 (52%), Positives = 129/188 (69%), Gaps = 16/188 (9%)
 Frame = -2

Query  555  HSDSDCQFLKEPP---IVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYAL  385
            HSD +   +KE     +VD ++  P+KRGRKP  GR  P+NHVEAERQRREKLN RFYAL
Sbjct  447  HSDLEASVVKEADSSRVVDPEKR-PRKRGRKPANGREEPLNHVEAERQRREKLNQRFYAL  505

Query  384  RSVVPNVSRMDKASLLSDAVSYINELKGKV-------EELECQLQLRESKKVKVEAVGDN  226
            R+VVPNVS+MDKASLL DA+++INELK KV       +EL  Q+   ES + ++   G N
Sbjct  506  RAVVPNVSKMDKASLLGDAIAFINELKSKVQNSDSDKDELRNQI---ESLRNELANKGSN  562

Query  225  QstssaassvaSPV--DVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASIS  52
             +     +     V  D++VK++G DAMIR+QS   N+P+A+LM  L EL+L VHHAS+S
Sbjct  563  YTGPPPPNQDLKIVDMDIDVKVIGWDAMIRIQSNKKNHPAARLMAALMELDLDVHHASVS  622

Query  51   SVNDIMLQ  28
             VN++M+Q
Sbjct  623  VVNELMIQ  630



>ref|XP_010481417.1| PREDICTED: transcription factor MYC3 [Camelina sativa]
Length=610

 Score =   171 bits (432),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 88/186 (47%), Positives = 125/186 (67%), Gaps = 7/186 (4%)
 Frame = -2

Query  564  EXEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYAL  385
            + +HSD +   +KE  +V+  +  P+KRGRKP  GR  P+NHVEAERQRREKLN RFY+L
Sbjct  397  DSDHSDLEASVVKEAIVVEPPEKKPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYSL  456

Query  384  RSVVPNVSRMDKASLLSDAVSYINELKGKV-------EELECQLQLRESKKVKVEAVGDN  226
            R+VVPNVS+MDKASLL+DA+SYINELK K+       EE++ +L     +          
Sbjct  457  RAVVPNVSKMDKASLLADAISYINELKSKLQQAEIDKEEIQKRLDGVNKEGKGGGGGSRG  516

Query  225  QstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSV  46
            +  + +    +  ++++VKI+G D MIRVQ    ++P A+ M  L+EL+L V+HAS+S V
Sbjct  517  RERNCSNQDASIEMEIDVKIIGWDVMIRVQCSKKDHPGARFMEALKELDLEVNHASLSVV  576

Query  45   NDIMLQ  28
            ND+M+Q
Sbjct  577  NDLMIQ  582



>ref|XP_009347383.1| PREDICTED: transcription factor MYC2 [Pyrus x bretschneideri]
Length=687

 Score =   171 bits (433),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 97/193 (50%), Positives = 131/193 (68%), Gaps = 15/193 (8%)
 Frame = -2

Query  564  EXEHSDSDCQFLKEPP---IVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRF  394
            + +HSD +   ++E     +VD ++  P+KRGRKP  GR  P+NHVEAERQRREKLN RF
Sbjct  466  DSDHSDLEASVVREADSSRVVDPEKR-PRKRGRKPANGREEPLNHVEAERQRREKLNQRF  524

Query  393  YALRSVVPNVSRMDKASLLSDAVSYINELKGKV-------EELECQLQLRES----KKVK  247
            YALR+VVPNVS+MDKASLL DA+SYINELK K+       EEL+ QL+   +    K  +
Sbjct  525  YALRAVVPNVSKMDKASLLGDAISYINELKLKLQTVETDKEELQKQLESMNNHLPCKDSR  584

Query  246  VEAVGDNQstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVH  67
                  ++      SS    +D++VKI+G DAMIR+Q    N+P+A+LM  L+EL++ VH
Sbjct  585  SSGSIMSEEELKGCSSKLLDMDIDVKIIGRDAMIRIQCCKKNHPAARLMAALKELDMDVH  644

Query  66   HASISSVNDIMLQ  28
            HAS+S VND+M+Q
Sbjct  645  HASVSVVNDLMIQ  657



>ref|XP_006398371.1| hypothetical protein EUTSA_v10000808mg [Eutrema salsugineum]
 gb|ESQ39824.1| hypothetical protein EUTSA_v10000808mg [Eutrema salsugineum]
Length=665

 Score =   171 bits (432),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 94/188 (50%), Positives = 129/188 (69%), Gaps = 10/188 (5%)
 Frame = -2

Query  564  EXEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYAL  385
            + +HSD +   +KE  +V+ ++  P+KRGRKP  GR  P+NHVEAERQRREKLN RFY+L
Sbjct  451  DSDHSDLEASVVKEAIVVEPEKK-PRKRGRKPANGREEPLNHVEAERQRREKLNQRFYSL  509

Query  384  RSVVPNVSRMDKASLLSDAVSYINELKGKVEELEC-----QLQLRESKKVKVEAVGDNQs  220
            R+VVPNVS+MDKASLL DA+SYINELK K+++ E      Q QL    K      G ++ 
Sbjct  510  RAVVPNVSKMDKASLLGDAISYINELKSKLQQAESDKEEIQKQLDGMSKEGNGKSGGSRV  569

Query  219  t----ssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASIS  52
                 S+  S+ +  ++++VKI+G D MIRVQ    N+P A+ M  L+EL+L V+HAS+S
Sbjct  570  KERKCSNQDSASSIEMEIDVKIIGWDVMIRVQCSKKNHPGARFMEALKELDLEVNHASLS  629

Query  51   SVNDIMLQ  28
             VND+M+Q
Sbjct  630  VVNDLMIQ  637



>emb|CDY44507.1| BnaC01g10420D [Brassica napus]
Length=586

 Score =   170 bits (431),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 96/187 (51%), Positives = 126/187 (67%), Gaps = 12/187 (6%)
 Frame = -2

Query  552  SDSDCQFLKEPP---IVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYALR  382
            SD +   +KE     IV   +  P+KRGRKP  GR  P+NHVEAERQRREKLN RFY+LR
Sbjct  376  SDLEASVVKEAESGRIVAEPEKKPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYSLR  435

Query  381  SVVPNVSRMDKASLLSDAVSYINELKGKVEELEC-QLQLRESKKVKVEAVGD--------  229
            +VVPNVS+MDKASLL DA+SYINELK K+++ E  + +L++      + VGD        
Sbjct  436  AVVPNVSKMDKASLLGDAISYINELKAKLQKAEADKEELQKQIGGMSKEVGDGNVKSSVK  495

Query  228  NQstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISS  49
            +Q      S V+  V+++VKI+G DAMIR+Q    N+P AK M  L+ELEL V+HAS+S 
Sbjct  496  DQKCLDQDSGVSIEVEIDVKIIGWDAMIRIQCGKNNHPGAKFMEALKELELEVNHASLSV  555

Query  48   VNDIMLQ  28
            VN+ M+Q
Sbjct  556  VNEFMIQ  562



>ref|XP_010441550.1| PREDICTED: transcription factor MYC3-like [Camelina sativa]
Length=607

 Score =   170 bits (431),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 88/186 (47%), Positives = 123/186 (66%), Gaps = 7/186 (4%)
 Frame = -2

Query  564  EXEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYAL  385
            + +HSD +   +KE  +V+  +  P+KRGRKP  GR  P+NHVEAERQRREKLN RFY+L
Sbjct  394  DSDHSDLEASVVKEAIVVEPPEKKPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYSL  453

Query  384  RSVVPNVSRMDKASLLSDAVSYINELKGKV-------EELECQLQLRESKKVKVEAVGDN  226
            R+VVPNVS+MDKASLL DA+SYINELK K+       EE++ +L     +          
Sbjct  454  RAVVPNVSKMDKASLLGDAISYINELKSKLQQAEVDKEEIQKRLDGVNKEGKGGGGGSRA  513

Query  225  QstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSV  46
            +    +    +  ++++VKI+G D MIRVQ    ++P A+ M  L+EL+L V+HAS+S V
Sbjct  514  RERKCSNQDTSIEMEIDVKIIGWDVMIRVQCSKKDHPGARFMEALKELDLEVNHASLSVV  573

Query  45   NDIMLQ  28
            ND+M+Q
Sbjct  574  NDLMIQ  579



>dbj|BAJ33793.1| unnamed protein product [Thellungiella halophila]
Length=606

 Score =   170 bits (430),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 94/188 (50%), Positives = 128/188 (68%), Gaps = 10/188 (5%)
 Frame = -2

Query  564  EXEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYAL  385
            + +HSD +   +KE  +V+ ++  P+KRGRKP  GR  P+NHVEAERQRREKLN RFY+L
Sbjct  392  DSDHSDLEASVVKEAIVVEPEK-KPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYSL  450

Query  384  RSVVPNVSRMDKASLLSDAVSYINELKGKVEELEC-----QLQLRESKKVKVEAVGDNQs  220
            R+VVPNVS MDKASLL DA+SYINELK K+++ E      Q QL    K      G ++ 
Sbjct  451  RAVVPNVSEMDKASLLGDAISYINELKSKLQQAESDKEEIQKQLDGMSKEGNGKSGGSRV  510

Query  219  t----ssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASIS  52
                 S+  S+ +  ++++VKI+G D MIRVQ    N+P A+ M  L+EL+L V+HAS+S
Sbjct  511  KERKCSNQDSASSIEMEIDVKIIGWDVMIRVQCSKKNHPGARFMEALKELDLEVNHASLS  570

Query  51   SVNDIMLQ  28
             VND+M+Q
Sbjct  571  VVNDLMIQ  578



>ref|XP_010494857.1| PREDICTED: transcription factor MYC3-like [Camelina sativa]
Length=607

 Score =   170 bits (430),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 88/190 (46%), Positives = 125/190 (66%), Gaps = 14/190 (7%)
 Frame = -2

Query  564  EXEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYAL  385
            + +HSD +   +KE  +V+  +  P+KRGRKP  GR  P+NHVEAERQRREKLN RFY+L
Sbjct  393  DSDHSDLEASVVKEAIVVEPPEKKPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYSL  452

Query  384  RSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKVKVEAVGDNQstss--  211
            R+VVPNVS+MDKASLL DA+SYINELK K+++ E     +E  + +++ V          
Sbjct  453  RAVVPNVSKMDKASLLGDAISYINELKSKLQQAEID---KEEIQKRLDGVNKEGKGGGGG  509

Query  210  ---------aassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHAS  58
                     +    +  ++++VKI+G D MIRVQ    ++P A+ M  L+EL+L V+HAS
Sbjct  510  GSRARERKCSNQDTSIEMEIDVKIIGWDVMIRVQCSKKDHPGARFMEALKELDLEVNHAS  569

Query  57   ISSVNDIMLQ  28
            +S VND+M+Q
Sbjct  570  LSVVNDLMIQ  579



>gb|AGL98100.1| transcription factor MYC2 [Nicotiana attenuata]
Length=656

 Score =   170 bits (431),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 91/164 (55%), Positives = 117/164 (71%), Gaps = 12/164 (7%)
 Frame = -2

Query  492  PKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYIN  313
            P+KRGRKP  GR  P+NHVEAERQRREKLN RFYALR+VVPNVS+MDKASLL DA+++IN
Sbjct  468  PRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAFIN  527

Query  312  ELKGKV-------EELECQLQLRESKKVKVEAVGDNQst--ssaassvaSPVDVEVKIVG  160
            ELK KV       EEL  Q+   ES + ++   G N +    S        +D++VK++G
Sbjct  528  ELKSKVQNSDSDKEELRNQI---ESLRKELANKGSNYTGPPPSNQDLKILDMDIDVKVIG  584

Query  159  PDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQ  28
             DAMIR+QS   N+P+A+LM  L EL+L VHHAS+S VN++M+Q
Sbjct  585  WDAMIRIQSNKKNHPAARLMAALMELDLDVHHASVSVVNELMIQ  628



>gb|KJB25303.1| hypothetical protein B456_004G184800 [Gossypium raimondii]
Length=676

 Score =   170 bits (431),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 96/190 (51%), Positives = 127/190 (67%), Gaps = 11/190 (6%)
 Frame = -2

Query  564  EXEHSDSDCQFLKEPPI--VDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFY  391
            + +HSD +   +KE     V   +  P+KRGRKP  GR  P+NHVEAERQRREKLN +FY
Sbjct  459  DSDHSDLEASVVKEADSSRVVEPEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQKFY  518

Query  390  ALRSVVPNVSRMDKASLLSDAVSYINELKGKV-------EELECQLQ-LRESKKVKVEAV  235
            ALR+VVPNVS+MDKASLL DA+SYINELK K+       EE++ QL+ L+++   K    
Sbjct  519  ALRAVVPNVSKMDKASLLGDAISYINELKSKLQSADSEKEEMQSQLEALKKNLSSKAPPP  578

Query  234  GDNQstssa-assvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHAS  58
             D     S         +++EVKI+G DAMI++Q    N+P+AKLM  L+EL+L VHHAS
Sbjct  579  HDQDLKISNHTGDKLIDLEIEVKIIGWDAMIQIQCSKKNHPAAKLMAALKELDLDVHHAS  638

Query  57   ISSVNDIMLQ  28
            +S V D+M+Q
Sbjct  639  VSVVKDLMIQ  648



>ref|NP_193522.1| transcription factor MYC4 [Arabidopsis thaliana]
 sp|O49687.1|MYC4_ARATH RecName: Full=Transcription factor MYC4; Short=AtMYC4; AltName: 
Full=Basic helix-loop-helix protein 4; Short=AtbHLH4; Short=bHLH 
4; AltName: Full=Transcription factor EN 37; AltName: 
Full=bHLH transcription factor bHLH004 [Arabidopsis thaliana]
 emb|CAA17131.1| bHLH protein-like [Arabidopsis thaliana]
 emb|CAB78790.1| bHLH protein-like [Arabidopsis thaliana]
 dbj|BAD94748.1| putative transcription factor BHLH4 [Arabidopsis thaliana]
 gb|AEE83960.1| transcription factor MYC4 [Arabidopsis thaliana]
Length=589

 Score =   169 bits (429),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 94/186 (51%), Positives = 126/186 (68%), Gaps = 10/186 (5%)
 Frame = -2

Query  555  HSDSDCQFLKEPP---IVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYAL  385
            HSD +    KE     +V   +  P+KRGRKP  GR  P+NHVEAERQRREKLN RFY+L
Sbjct  376  HSDLEASVAKEAESNRVVVEPEKKPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYSL  435

Query  384  RSVVPNVSRMDKASLLSDAVSYINELKGKV-------EELECQLQLRESKKVKVEAVGDN  226
            R+VVPNVS+MDKASLL DA+SYI+ELK K+       EEL+ Q+ +   +    ++   +
Sbjct  436  RAVVPNVSKMDKASLLGDAISYISELKSKLQKAESDKEELQKQIDVMNKEAGNAKSSVKD  495

Query  225  QstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSV  46
            +   +  SSV   ++V+VKI+G DAMIR+Q    N+P AK M  L+EL+L V+HAS+S V
Sbjct  496  RKCLNQESSVLIEMEVDVKIIGWDAMIRIQCSKRNHPGAKFMEALKELDLEVNHASLSVV  555

Query  45   NDIMLQ  28
            ND+M+Q
Sbjct  556  NDLMIQ  561



>gb|AAL55711.1|AF251689_1 putative transcription factor BHLH4 [Arabidopsis thaliana]
Length=589

 Score =   169 bits (429),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 94/186 (51%), Positives = 126/186 (68%), Gaps = 10/186 (5%)
 Frame = -2

Query  555  HSDSDCQFLKEPP---IVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYAL  385
            HSD +    KE     +V   +  P+KRGRKP  GR  P+NHVEAERQRREKLN RFY+L
Sbjct  376  HSDLEASVAKEAESNRVVVEPEKKPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYSL  435

Query  384  RSVVPNVSRMDKASLLSDAVSYINELKGKV-------EELECQLQLRESKKVKVEAVGDN  226
            R+VVPNVS+MDKASLL DA+SYI+ELK K+       EEL+ Q+ +   +    ++   +
Sbjct  436  RAVVPNVSKMDKASLLGDAISYISELKSKLQKAESDKEELQKQIDVMNKEAGNAKSSVKD  495

Query  225  QstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSV  46
            +   +  SSV   ++V+VKI+G DAMIR+Q    N+P AK M  L+EL+L V+HAS+S V
Sbjct  496  RKCLNQESSVLIEMEVDVKIIGWDAMIRIQCSKRNHPGAKFMEALKELDLEVNHASLSVV  555

Query  45   NDIMLQ  28
            ND+M+Q
Sbjct  556  NDLMIQ  561



>gb|KFK31432.1| hypothetical protein AALP_AA6G111200 [Arabis alpina]
Length=585

 Score =   169 bits (429),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 89/188 (47%), Positives = 131/188 (70%), Gaps = 12/188 (6%)
 Frame = -2

Query  564  EXEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYAL  385
            + +HSD +   +KE  +V+  +  P+KRGRKP  GR  P+NHVEAERQRREKLN +FY+L
Sbjct  376  DSDHSDLEASVVKEAIVVEPPEKKPRKRGRKPANGREEPLNHVEAERQRREKLNQKFYSL  435

Query  384  RSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKVKVEAVG---------  232
            R+VVPNVS+MDKASLL DA+SYINELK K+++ E     +E  +  ++ +G         
Sbjct  436  RAVVPNVSKMDKASLLGDAISYINELKTKLQQAEND---KEEIQKLLDGMGKEGNGTRGR  492

Query  231  DNQstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASIS  52
            + +  S+  S+ +  ++++VKI+G D MIRVQ    N+P A+ M+ L+EL+L V+HAS+S
Sbjct  493  ERKRGSNQDSASSIEMEIDVKIIGWDVMIRVQCSKKNHPGARFMDALKELDLEVNHASLS  552

Query  51   SVNDIMLQ  28
             VN++M+Q
Sbjct  553  VVNELMIQ  560



>ref|XP_010556617.1| PREDICTED: transcription factor bHLH14 [Tarenaya hassleriana]
Length=439

 Score =   167 bits (423),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 100/182 (55%), Positives = 124/182 (68%), Gaps = 14/182 (8%)
 Frame = -2

Query  564  EXEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYAL  385
            + E+SD D  F         Q N   KR +K G     PVNHVEAERQRR KLNHRFYAL
Sbjct  245  DSEYSDFDGIF---------QGN---KRRKKLGTPAAVPVNHVEAERQRRVKLNHRFYAL  292

Query  384  RSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKVKVEAVGDNQstssaa  205
            R+VVPNVSRMDKASLLSDAVSYINELK ++EELE QLQ +           +NQS ++++
Sbjct  293  RAVVPNVSRMDKASLLSDAVSYINELKARIEELETQLQTQTQSPSCSNNNNNNQSNTTSS  352

Query  204  ssvaS--PVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIML  31
             +       +V+VK+VG +A++RVQSEN N+P+A LM  LRE+E  V HAS S VND+M+
Sbjct  353  EAGGVIPGAEVQVKMVGDEAVVRVQSENVNHPTAALMGALREMECRVIHASASRVNDLMV  412

Query  30   QD  25
            QD
Sbjct  413  QD  414



>ref|XP_004509726.1| PREDICTED: transcription factor MYC2-like [Cicer arietinum]
Length=657

 Score =   170 bits (430),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 91/165 (55%), Positives = 115/165 (70%), Gaps = 10/165 (6%)
 Frame = -2

Query  492  PKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYIN  313
            P+KRGRKP  GR  P+NHVEAERQRREKLN RFY+LR+VVPNVS+MDKASLL DA+SYIN
Sbjct  465  PRKRGRKPANGREEPLNHVEAERQRREKLNQRFYSLRAVVPNVSKMDKASLLGDAISYIN  524

Query  312  ELKGKVEELEC-----QLQLRESKKVKVEAVGDN-----QstssaassvaSPVDVEVKIV  163
            ELK K++ LE      + QL  +KK    A   N            +     +D+EVK++
Sbjct  525  ELKEKLQGLESSKGELEKQLDTTKKELELASNKNPLLPLDKEKLKTNCKLIDLDIEVKVI  584

Query  162  GPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQ  28
            G DAMIRVQ    N+P+AKLM  L+EL++ V+HAS+S VND+M+Q
Sbjct  585  GWDAMIRVQCSKKNHPAAKLMVALKELDVEVNHASVSVVNDLMIQ  629



>gb|ACO53628.1| bHLH domain protein [Gossypium hirsutum]
Length=674

 Score =   170 bits (430),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 96/190 (51%), Positives = 128/190 (67%), Gaps = 11/190 (6%)
 Frame = -2

Query  564  EXEHSDSDCQFLKEPPI--VDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFY  391
            + +HSD +   +KE     V   +  P+KRGRKP  GR  P+NHVEAERQRREKLN +FY
Sbjct  457  DSDHSDLEASVVKEADSSRVVEPEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQKFY  516

Query  390  ALRSVVPNVSRMDKASLLSDAVSYINELKGKV-------EELECQLQ-LRESKKVKVEAV  235
            ALR+VVPNVS+MDKASLL DA+SYINELK K+       EE++ QL+ L+++   K    
Sbjct  517  ALRAVVPNVSKMDKASLLGDAISYINELKSKLQSADLEKEEMQSQLEALKKNLSSKAPPP  576

Query  234  GDNQstssa-assvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHAS  58
             D     S    +    +++EVKI+G DAMI++Q    N+P+AKLM  L+EL+L VHHAS
Sbjct  577  HDQDLKISNHTGNKLIDLEIEVKIIGWDAMIQIQCSKKNHPAAKLMVALKELDLDVHHAS  636

Query  57   ISSVNDIMLQ  28
            +S V D+M+Q
Sbjct  637  VSVVKDLMIQ  646



>ref|XP_003574381.1| PREDICTED: transcription factor MYC4-like [Brachypodium distachyon]
Length=706

 Score =   170 bits (430),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 90/165 (55%), Positives = 115/165 (70%), Gaps = 11/165 (7%)
 Frame = -2

Query  492  PKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYIN  313
            P+KRGRKP  GR  P+NHVEAERQRREKLN RFYALR+VVPNVS+MDKASLL DA+SYIN
Sbjct  513  PRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYIN  572

Query  312  ELKGKVEELECQLQLRESKKVKVEAVGDNQstssaassva--------SPVDVEVKIVGP  157
            EL+GK+  LE     +++   ++EA+   +     A              V++E KI+G 
Sbjct  573  ELRGKMTALESD---KDTLHSQIEALKKERDARPVAPLSGVHDSGPRCHAVEIEAKILGL  629

Query  156  DAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQDI  22
            +AMIRVQ    N+P+AKLM  LREL+L V+HAS+S V DIM+Q +
Sbjct  630  EAMIRVQCHKRNHPAAKLMTALRELDLDVYHASVSVVKDIMIQQV  674



>gb|ABD59338.1| G-box element binding protein [Pisum sativum]
Length=646

 Score =   169 bits (429),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 89/169 (53%), Positives = 118/169 (70%), Gaps = 17/169 (10%)
 Frame = -2

Query  492  PKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYIN  313
            P+KRGRKP  GR  P+NHVEAERQRREKLN RFYALR+VVPNVS+MDKASLL DA+SYIN
Sbjct  453  PRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYIN  512

Query  312  ELKGKVEELEC--------------QLQLRESKKVKVEAVGDNQstssaassvaSPVDVE  175
            ELK K++ LE               +L++   K V++      +  +++       +D++
Sbjct  513  ELKLKLQGLESSKDELEKELDTTRKELEIATKKPVRLNEEEKEKPENNSKLID---LDID  569

Query  174  VKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQ  28
            VKI+G DAMIR+Q    N+P+AKLM  L+EL+L V+HAS+S VND+M+Q
Sbjct  570  VKIMGWDAMIRIQCSKKNHPAAKLMAALKELDLDVNHASVSVVNDLMIQ  618



>gb|ADH04269.1| MYC2a transcription factor [Nicotiana tabacum]
Length=659

 Score =   169 bits (429),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 90/164 (55%), Positives = 118/164 (72%), Gaps = 12/164 (7%)
 Frame = -2

Query  492  PKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYIN  313
            P+KRGRKP  GR  P+NHVEAERQRREKLN RFYALR+VVPNVS+MDKASLL DA+++IN
Sbjct  471  PRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAFIN  530

Query  312  ELKGKV-------EELECQLQLRESKKVKVEAVGDNQstssaassvaSPV--DVEVKIVG  160
            ELK KV       E+L  Q+   ES + ++   G N +    ++     V  D++VK++G
Sbjct  531  ELKSKVQNSDSDKEDLRNQI---ESLRNELANKGSNYTGPPPSNQELKIVDMDIDVKVIG  587

Query  159  PDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQ  28
             DAMIR+QS   N+P+A+LM  L EL+L VHHAS+S VN++M+Q
Sbjct  588  WDAMIRIQSNKKNHPAARLMTALMELDLDVHHASVSVVNELMIQ  631



>ref|XP_008341963.1| PREDICTED: transcription factor MYC2-like [Malus domestica]
Length=688

 Score =   169 bits (429),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 96/193 (50%), Positives = 130/193 (67%), Gaps = 15/193 (8%)
 Frame = -2

Query  564  EXEHSDSDCQFLKEPP---IVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRF  394
            + +HSD +   ++E     +VD Q+  P+KRGRKP  GR  P+NHVEAERQRREKLN RF
Sbjct  467  DSDHSDLEASVVREADSSRVVD-QEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRF  525

Query  393  YALRSVVPNVSRMDKASLLSDAVSYINELKGKV-------EELECQLQLRE----SKKVK  247
            YALR+VVPNVS+MDKASLL DA++YINELK K+       EEL+ QL+        K  +
Sbjct  526  YALRAVVPNVSKMDKASLLGDAIAYINELKLKLQTVETDKEELQNQLESMNKDLPCKDSR  585

Query  246  VEAVGDNQstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVH  67
                  ++      SS    +D++VKI+G DAMIR+Q    N+P+A+LM  L+EL++ VH
Sbjct  586  SSGSIMSEDELKGCSSKLLDMDIDVKIIGRDAMIRIQCCKKNHPAARLMAALKELDMDVH  645

Query  66   HASISSVNDIMLQ  28
            +AS+S VND+M+Q
Sbjct  646  YASVSVVNDLMIQ  658



>ref|XP_010434608.1| PREDICTED: transcription factor MYC4-like [Camelina sativa]
Length=623

 Score =   169 bits (428),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 97/188 (52%), Positives = 123/188 (65%), Gaps = 17/188 (9%)
 Frame = -2

Query  555  HSDSDCQFLKEPP---IVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYAL  385
            HSD +   +KE      V   +  P+KRGRKP  GR  P+NHVEAERQRREKLN RFY+L
Sbjct  413  HSDLEASVVKEAESNRTVVEPEKKPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYSL  472

Query  384  RSVVPNVSRMDKASLLSDAVSYINELKGKV-------EELECQL--QLRESKKVKVEAVG  232
            R+VVPNVS+MDKASLL DA+SYINELK K+       EEL+ Q+    +E+   K     
Sbjct  473  RAVVPNVSKMDKASLLGDAISYINELKSKLLKAESDKEELQKQIDGMSKEAANGKSSVKE  532

Query  231  DNQstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASIS  52
             NQ    +       ++V+VKI+G DAMIRVQ    N+P AK M  L+EL+L V+HAS+S
Sbjct  533  RNQEPGVSVE-----MEVDVKIIGWDAMIRVQCSKRNHPGAKFMEALKELDLEVNHASLS  587

Query  51   SVNDIMLQ  28
             VND+M+Q
Sbjct  588  VVNDLMIQ  595



>gb|KDP34321.1| hypothetical protein JCGZ_12669 [Jatropha curcas]
Length=674

 Score =   169 bits (429),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 97/193 (50%), Positives = 130/193 (67%), Gaps = 14/193 (7%)
 Frame = -2

Query  564  EXEHSDSDCQFLKEPPI--VDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFY  391
            + +HSD +   ++E     V   +  P+KRGRKP  GR  P+NHVEAERQRREKLN RFY
Sbjct  455  DSDHSDLEASVVRETDSSRVIEPEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFY  514

Query  390  ALRSVVPNVSRMDKASLLSDAVSYINELKGKV-------EELECQLQ-LRESKKVKVEAV  235
            ALR+VVPNVS+MDKASLL DA+SYI EL+ K+       EELE Q++ +++    K    
Sbjct  515  ALRAVVPNVSKMDKASLLGDAISYIKELRTKLQTAESEKEELEKQVESIKKEFASKDSRP  574

Query  234  G----DNQstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVH  67
            G    D +   S+  S    +D++VKI+G DAMIR+Q    N+P+A+LM  L+EL+L VH
Sbjct  575  GPPPPDQELKMSSGGSKLIEMDIDVKIIGWDAMIRIQCCKKNHPAARLMAALKELDLDVH  634

Query  66   HASISSVNDIMLQ  28
            HAS+S VND+M+Q
Sbjct  635  HASVSVVNDLMIQ  647



>ref|XP_002868032.1| basic helix-loop-helix family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44291.1| basic helix-loop-helix family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=598

 Score =   169 bits (427),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 95/189 (50%), Positives = 129/189 (68%), Gaps = 10/189 (5%)
 Frame = -2

Query  564  EXEHSDSDCQFLKEPP---IVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRF  394
            +  HSD +    KE      V   +  P+KRGRKP  GR  P+NHVEAERQRREKLN RF
Sbjct  382  DSNHSDLEASVAKEAESNRFVVEPEKKPRKRGRKPANGREEPLNHVEAERQRREKLNQRF  441

Query  393  YALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELEC-QLQLRESKKVKVEAVGDNQst  217
            Y+LR+VVPNVS+MDKASLL DA+SYINELK K+++ E  + +L++     ++  G+++S+
Sbjct  442  YSLRAVVPNVSKMDKASLLGDAISYINELKSKLQKAESDKEELQKQFDGMIKEAGNSKSS  501

Query  216  ss------aassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASI  55
                      SSV   ++V+VKI+G DAMIR+Q    N+P AK M  L+EL+L V+HAS+
Sbjct  502  VKDRRCLNQESSVLIEMEVDVKIIGWDAMIRIQCSKRNHPGAKFMEALKELDLEVNHASL  561

Query  54   SSVNDIMLQ  28
            S VND+M+Q
Sbjct  562  SVVNDLMIQ  570



>ref|XP_003531962.1| PREDICTED: transcription factor MYC2 [Glycine max]
Length=654

 Score =   169 bits (428),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 94/200 (47%), Positives = 125/200 (63%), Gaps = 24/200 (12%)
 Frame = -2

Query  564  EXEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYAL  385
            + +HSD +    K+   V   +  P+KRGRKP  GR  P+NHVEAERQRREKLN RFYAL
Sbjct  429  DSDHSDLEASVAKQ---VVEPEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYAL  485

Query  384  RSVVPNVSRMDKASLLSDAVSYINELKGKV-----EELECQLQLRESKK-----------  253
            R+VVPNVS+MDKASLL DA+ YINELK K+     E+ E + QL  +KK           
Sbjct  486  RAVVPNVSKMDKASLLGDAILYINELKSKLNVLDSEKTELEKQLDSTKKELELATKNPPP  545

Query  252  -----VKVEAVGDNQstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLR  88
                         N       +S  + +++EVKI+G DAM+R+Q    N+P+A+LM  L+
Sbjct  546  PPPPPPPPGPPPSNSVEPKKTTSKLADLELEVKIIGWDAMVRIQCSKKNHPAARLMAALK  605

Query  87   ELELAVHHASISSVNDIMLQ  28
            +L+L VHHAS+S VND+M+Q
Sbjct  606  DLDLEVHHASVSVVNDLMIQ  625



>ref|XP_010530031.1| PREDICTED: transcription factor MYC4 [Tarenaya hassleriana]
Length=653

 Score =   169 bits (427),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 97/192 (51%), Positives = 127/192 (66%), Gaps = 14/192 (7%)
 Frame = -2

Query  564  EXEHSDSDCQFLKEPP---IVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRF  394
            + +HSD +    KE     IV+ ++  P+KRGRKP  GR  P+NHVEAERQRREKLN RF
Sbjct  435  DSDHSDVEASVAKEADSSRIVEPEKK-PRKRGRKPANGREEPLNHVEAERQRREKLNQRF  493

Query  393  YALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELEC-----QLQLRE-----SKKVKV  244
            Y+LR+VVPNVS+MDKASLL DA+SYINELK K++E E      Q QL E     S K   
Sbjct  494  YSLRAVVPNVSKMDKASLLGDAISYINELKSKLQEAESDKEDLQKQLNELNKEGSGKDSR  553

Query  243  EAVGDNQstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHH  64
                 ++   +  S  A  ++++VKI+G D MIR+Q    N+P AK M  L+EL+L V+H
Sbjct  554  PQSSKDRKGLNQDSGPAMEMEIDVKIIGWDVMIRIQCSKKNHPGAKFMEALKELDLEVNH  613

Query  63   ASISSVNDIMLQ  28
            AS+S VND+M+Q
Sbjct  614  ASLSVVNDLMIQ  625



>ref|XP_002280253.1| PREDICTED: transcription factor MYC2-like [Vitis vinifera]
Length=663

 Score =   169 bits (427),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 97/197 (49%), Positives = 128/197 (65%), Gaps = 18/197 (9%)
 Frame = -2

Query  564  EXEHSDSDCQFLKEPPI--VDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFY  391
            + +HSD +   ++E     V   +  P+KRGRKP  GR  P+NHVEAERQRREKLN RFY
Sbjct  439  DSDHSDLEASVVREADSSRVVEPEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFY  498

Query  390  ALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELEC---QLQLRESKKVKVEAVGDNQs  220
            ALR+VVPNVS+MDKASLL DA+SYINEL+ K++  E     LQ   +   K  A  D+Q 
Sbjct  499  ALRAVVPNVSKMDKASLLGDAISYINELRTKLQSAESDKEDLQKEVNSMKKELASKDSQY  558

Query  219  tssaa-------------ssvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELE  79
            + S+               S    +D++VKI+G DAMIR+Q    N+P+AKLM  L+EL+
Sbjct  559  SGSSRPPPDQDLKMSNHHGSKLVEMDIDVKIIGWDAMIRIQCSKKNHPAAKLMGALKELD  618

Query  78   LAVHHASISSVNDIMLQ  28
            L V+HAS+S VND+M+Q
Sbjct  619  LDVNHASVSVVNDLMIQ  635



>emb|CDX78808.1| BnaA01g08750D [Brassica napus]
Length=579

 Score =   168 bits (425),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 89/164 (54%), Positives = 117/164 (71%), Gaps = 9/164 (5%)
 Frame = -2

Query  492  PKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYIN  313
            P+KRGRKP  GR  P+NHVEAERQRREKLN RFY+LR+VVPNVS+MDKASLL DA+SYIN
Sbjct  392  PRKRGRKPANGREEPLNHVEAERQRREKLNQRFYSLRAVVPNVSKMDKASLLGDAISYIN  451

Query  312  ELKGKVEELEC-QLQLRESKKVKVEAVGD--------NQstssaassvaSPVDVEVKIVG  160
            ELK K+++ E  + +L++      + VGD        +Q      S V+  V+++VKI+G
Sbjct  452  ELKAKLQKAEADKEELQKQIDGMSKEVGDGNVKSSVKDQKCLEQDSGVSVEVEIDVKIIG  511

Query  159  PDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQ  28
             DAMIR+Q    ++P AK M  L+ELEL V+HAS+S VN+ M+Q
Sbjct  512  WDAMIRIQCGKKDHPGAKFMEALKELELEVNHASLSVVNEFMIQ  555



>gb|AIT39751.1| transcription factor MYC2, partial [Chrysanthemum boreale]
Length=648

 Score =   168 bits (426),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 92/200 (46%), Positives = 127/200 (64%), Gaps = 24/200 (12%)
 Frame = -2

Query  564  EXEHSDSDCQFLKEPPIVD--RQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFY  391
            + +HSD D   +KE   +     +  P+KRGRKP  GR  P+NHVEAERQRREKLN RFY
Sbjct  424  DSDHSDLDASMIKEVESIRVVEPEKKPRKRGRKPANGREEPLNHVEAERQRREKLNQRFY  483

Query  390  ALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKVKVEAVG-------  232
            ALR+VVPNVS+MDKASLL DA+ YINELK KV+  +C    +E  + ++EA+        
Sbjct  484  ALRAVVPNVSKMDKASLLGDAILYINELKSKVDNTQCD---KEELRNQLEALKKELLTKD  540

Query  231  ------------DNQstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLR  88
                        D+    +   S  + +D++VK++G DAMIR+Q    N+P+A+LM   +
Sbjct  541  SRQSSSSAISLPDDMKMPTGVHSAIADLDIDVKVMGWDAMIRIQCNKKNHPAARLMAVFK  600

Query  87   ELELAVHHASISSVNDIMLQ  28
            EL+  V+HAS+S VND+M+Q
Sbjct  601  ELDFEVNHASVSIVNDLMIQ  620



>gb|EPS71023.1| hypothetical protein M569_03732, partial [Genlisea aurea]
Length=549

 Score =   167 bits (423),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 98/201 (49%), Positives = 124/201 (62%), Gaps = 32/201 (16%)
 Frame = -2

Query  555  HSDSDCQFLKEPP---IVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYAL  385
            HSD +    K+     +VD Q+  PKKRGRKP  GR  P+NHVEAERQRREKLN RFYAL
Sbjct  332  HSDIEASVAKDAGSSKVVDPQKR-PKKRGRKPANGREEPLNHVEAERQRREKLNQRFYAL  390

Query  384  RSVVPNVSRMDKASLLSDAVSYINELKGKV-------EELECQLQ---------------  271
            R+VVP VS+MDK+SLL DA+SYINELK K+       EE+  QL+               
Sbjct  391  RAVVPTVSKMDKSSLLGDAISYINELKSKLQNSELDMEEMRAQLESLKKKKKKKEEEEEG  450

Query  270  LRESKKVKVEAVGDNQstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGL  91
            L    + K  A  +N+     A       D+EVKI+G DAMIR+Q    N+P+AKLM   
Sbjct  451  LPPHNETKYSAPSENKYGGGGA------TDIEVKIIGSDAMIRIQCSRKNHPAAKLMAAF  504

Query  90   RELELAVHHASISSVNDIMLQ  28
            +EL+L +HHASIS +N+ M+Q
Sbjct  505  KELDLDLHHASISVMNESMIQ  525



>ref|XP_009360190.1| PREDICTED: transcription factor MYC2-like [Pyrus x bretschneideri]
Length=468

 Score =   166 bits (419),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 96/176 (55%), Positives = 126/176 (72%), Gaps = 15/176 (9%)
 Frame = -2

Query  489  KKRGRKPGA--GRV-TPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSY  319
            KKRGR   +  GR  TP+NHVEAERQRR+KLN RFYALR+VVPNVSRMDKASLLSDAV Y
Sbjct  275  KKRGRSSNSETGRSETPINHVEAERQRRDKLNRRFYALRAVVPNVSRMDKASLLSDAVIY  334

Query  318  INELKGKVEELECQLQLRESKKV------KVEAVGDN-----QstssaassvaSPVDVEV  172
            INELK +V +LE ++Q +  K V         ++ D+     Q +S+  +  A  + ++V
Sbjct  335  INELKARVVQLEAKIQAQPGKPVVDIGGQTTTSIVDHHQTRPQQSSNYNNKAAGAMKIDV  394

Query  171  KIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQDIRG*RXP  4
            KI+G +AMIRVQ  + +YP+A+LMN L++LEL V+HAS+SSV + MLQD+ G R P
Sbjct  395  KILGSEAMIRVQCPDCDYPNARLMNVLKDLELQVYHASLSSVKEWMLQDVVG-RVP  449



>emb|CDP13028.1| unnamed protein product [Coffea canephora]
Length=693

 Score =   167 bits (424),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 93/196 (47%), Positives = 129/196 (66%), Gaps = 18/196 (9%)
 Frame = -2

Query  564  EXEHSDSDCQFLKEPP---IVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRF  394
            + +HSD +    KE     +VD ++  P+KRGRKP  GR  P+NHVEAERQRREKLN RF
Sbjct  471  DSDHSDLEASVAKEADSSRVVDPEKK-PRKRGRKPANGREEPLNHVEAERQRREKLNQRF  529

Query  393  YALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELEC--------------QLQLRESK  256
            YALR+VVPNVS+MDKASLL DA+SYINELK K+  +E               +L  +E++
Sbjct  530  YALRAVVPNVSKMDKASLLGDAISYINELKSKLHNMESDKEELRNQIDSLKKELTSKEAR  589

Query  255  KVKVEAVGDNQstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELEL  76
                     +   +S   S +  +D++VKI+G +AMIRVQS   N+P+A++M  L++L+L
Sbjct  590  NFAPPPPDKDLKLASHQGSKSLDMDIDVKIIGWEAMIRVQSSKNNHPAARIMGALKDLDL  649

Query  75   AVHHASISSVNDIMLQ  28
             + HAS+S VND+M+Q
Sbjct  650  ELLHASVSVVNDLMIQ  665



>ref|XP_010919958.1| PREDICTED: transcription factor MYC4-like [Elaeis guineensis]
Length=691

 Score =   167 bits (424),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 92/194 (47%), Positives = 129/194 (66%), Gaps = 19/194 (10%)
 Frame = -2

Query  564  EXEHSDSDCQF--LKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFY  391
            + +HSD +     ++  P+V+ ++  P+KRGRKP  GR  P+NHVEAERQRREKLN RFY
Sbjct  471  DSDHSDLEASVREVESSPVVEPEKR-PRKRGRKPANGREEPLNHVEAERQRREKLNQRFY  529

Query  390  ALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKVKVEAVG-------  232
            ALR+VVPNVS+MDKASLL DA+SYINEL+ K++ LE     +E  + ++EA+        
Sbjct  530  ALRAVVPNVSKMDKASLLGDAISYINELRSKLQSLESD---KEGLQTQIEALKRERDSNP  586

Query  231  ------DNQstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAV  70
                   +Q            V++EVKI+G +AMIRVQ    N+P+A+LM  L+EL+L V
Sbjct  587  ARPLQLPDQDMKMMNGGRCHGVEIEVKILGVEAMIRVQCHKRNHPAARLMAALKELDLDV  646

Query  69   HHASISSVNDIMLQ  28
            ++AS+S V D+M+Q
Sbjct  647  YYASVSVVKDLMIQ  660



>gb|AET03296.2| basic helix loop helix (bHLH) family transcription factor [Medicago 
truncatula]
Length=648

 Score =   167 bits (423),  Expect = 8e-45, Method: Composition-based stats.
 Identities = 103/196 (53%), Positives = 128/196 (65%), Gaps = 20/196 (10%)
 Frame = -2

Query  555  HSDSDCQFLKE--PPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYALR  382
            HSD D   +KE     V      PKKRGRKP  GR  P+NHVEAERQRREKLN +FYALR
Sbjct  423  HSDLDVSAVKEGESSRVVEPGKRPKKRGRKPANGREEPLNHVEAERQRREKLNQKFYALR  482

Query  381  SVVPNVSRMDKASLLSDAVSYINELKGKVEELEC-----QLQLRESKKVKVEAVGDNQst  217
            +VVPNVS+MDKASLL DA+SYINELK K++ LE      + QL  +KK        NQS 
Sbjct  483  AVVPNVSKMDKASLLGDAISYINELKSKLQGLESSKGELEKQLGATKKELELVASKNQSQ  542

Query  216  s-------------saassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELEL  76
            +             S +SS    +D++VKI+G DAMIR+Q    N+P+AKLM  L+EL+L
Sbjct  543  NPIPLDKEKEKTTSSTSSSKLIDLDIDVKIMGWDAMIRIQCSKKNHPAAKLMAALKELDL  602

Query  75   AVHHASISSVNDIMLQ  28
             V+HAS+S VND+M+Q
Sbjct  603  DVNHASVSVVNDLMIQ  618



>ref|XP_010449546.1| PREDICTED: transcription factor MYC4-like [Camelina sativa]
Length=622

 Score =   167 bits (422),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 91/164 (55%), Positives = 110/164 (67%), Gaps = 14/164 (9%)
 Frame = -2

Query  492  PKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYIN  313
            P+KRGRKP  GR  P+NHVEAERQRREKLN RFY+LR+VVPNVS+MDKASLL DA+SYIN
Sbjct  436  PRKRGRKPANGREEPLNHVEAERQRREKLNQRFYSLRAVVPNVSKMDKASLLGDAISYIN  495

Query  312  ELKGKV-------EELECQLQLRESKKVKVEAVGDNQstssaassvaSPVDVE--VKIVG  160
            ELK K+       EEL+ Q+       +  EA                 VD+E  VKI+G
Sbjct  496  ELKSKLLKAESDKEELQKQID-----GMSKEAANGKSLVKERNQEPGVSVDMEVDVKIIG  550

Query  159  PDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQ  28
             DAMIRVQ    N+P AK M  L+EL+L V+HAS+S VND+M+Q
Sbjct  551  WDAMIRVQCSKRNHPGAKFMEALKELDLEVNHASLSVVNDLMIQ  594



>gb|AAY90122.1| basic helix-loop-helix transcription factor protein [Rheum australe]
Length=720

 Score =   167 bits (423),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 101/207 (49%), Positives = 133/207 (64%), Gaps = 29/207 (14%)
 Frame = -2

Query  564  EXEHSDSDCQFLKEPP---IVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRF  394
            + +HSD +   +KE     +VD ++  P+KRGRKP  GR  P+NHVEAERQRREKLN RF
Sbjct  486  DSDHSDLEASVVKEADSSRVVDPEKR-PRKRGRKPANGREEPLNHVEAERQRREKLNQRF  544

Query  393  YALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQ----LQLRESKKVKVEAVGDN  226
            YALR+VVPNVS+MDKASLL DA+S+INELK K++ +E +    L   E  K +V A  D+
Sbjct  545  YALRAVVPNVSKMDKASLLGDAISFINELKSKLQNVESEKETLLSQVECLKTEVLASRDH  604

Query  225  Qstssaass---------------------vaSPVDVEVKIVGPDAMIRVQSENANYPSA  109
            QS SS                           S +DV+VKI+G DAM+RV    +N+P+A
Sbjct  605  QSRSSNGGGGVQNHHHPSLEQDMNMLNGSCKQSDLDVDVKIIGRDAMVRVNCSKSNHPAA  664

Query  108  KLMNGLRELELAVHHASISSVNDIMLQ  28
            +LM  L+EL+L V HAS+S VND+M+Q
Sbjct  665  RLMVALKELDLEVTHASVSVVNDLMIQ  691



>ref|XP_004148475.1| PREDICTED: transcription factor MYC2-like [Cucumis sativus]
Length=688

 Score =   167 bits (423),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 95/199 (48%), Positives = 126/199 (63%), Gaps = 20/199 (10%)
 Frame = -2

Query  564  EXEHSDSDCQFLKEPPI--VDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFY  391
            + +HSD +   ++E     V   +  P+KRGRKP  GR  P+NHVEAERQRREKLN RFY
Sbjct  461  DSDHSDLEASVIREAESSRVVEPEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFY  520

Query  390  ALRSVVPNVSRMDKASLLSDAVSYINELKGKV-------EELECQLQLRESKKVKVEAVG  232
            ALR+VVPNVS+MDKASLL DA+SYINEL+GK+       E+L+ QL   +   +   +  
Sbjct  521  ALRAVVPNVSKMDKASLLGDAISYINELRGKLQTAESDKEDLQKQLDSVKKMMMSSSSKD  580

Query  231  -----------DNQstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRE  85
                       D    SS  +      D++VKI+  DAMIR+QS   N+P+A+LM  L E
Sbjct  581  SCMSSSNQPPPDQDIKSSNINHNDIETDIDVKIISWDAMIRIQSSKKNHPAARLMAALEE  640

Query  84   LELAVHHASISSVNDIMLQ  28
            L+L ++HASIS VND+M+Q
Sbjct  641  LDLDINHASISVVNDLMIQ  659



>ref|XP_009388411.1| PREDICTED: transcription factor MYC2 [Musa acuminata subsp. malaccensis]
Length=705

 Score =   167 bits (423),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 91/172 (53%), Positives = 117/172 (68%), Gaps = 20/172 (12%)
 Frame = -2

Query  492  PKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYIN  313
            PKKRGRKP  GR  P+NHVEAERQRREKLN RFYALR+VVPNVS+MDKASLL DAVSYIN
Sbjct  504  PKKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAVSYIN  563

Query  312  ELKGKVEELECQLQLRESKKVKVEAVGDNQstssaassvaSP-----------------V  184
            EL+ K+E LE     +E  + +VEA+   + ++        P                 V
Sbjct  564  ELRSKLETLEID---KEELRAQVEALEKERESNPTRPVQPPPDHDLRMMNGSGGDRCHGV  620

Query  183  DVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQ  28
            ++EVKI+G +AMIR+Q    N+P+AKLM  +R+L+L VH+AS+S V D+M+Q
Sbjct  621  ELEVKILGSEAMIRLQCLKRNHPAAKLMAAIRDLDLDVHYASVSVVEDLMIQ  672



>gb|KHN38923.1| Transcription factor MYC2 [Glycine soja]
Length=471

 Score =   165 bits (417),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 93/195 (48%), Positives = 126/195 (65%), Gaps = 18/195 (9%)
 Frame = -2

Query  564  EXEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYAL  385
            + +HSD +   +K+P  V   +  P+KRGRKP  GR  P+NHVEAERQRREKLN RFYAL
Sbjct  251  DSDHSDLEASVVKDP--VVEPEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYAL  308

Query  384  RSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQL----RESKKVKVEAVGDN---  226
            R+VVPNVS+MDKASLL DA+SYI ELK K++ LE    +     E  K ++E   DN   
Sbjct  309  RAVVPNVSKMDKASLLGDAISYITELKSKLQTLESDKDVLHKQLEGVKKELEKTTDNVSS  368

Query  225  ----QstssaassvaSP-----VDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELA  73
                 + ++   S   P     V+++VKI+G DAMI +     N+P+A LM  L EL+L 
Sbjct  369  NHACNNNNNNKLSSNQPALIDLVEMDVKIIGWDAMITITCSKKNHPAATLMTALMELDLD  428

Query  72   VHHASISSVNDIMLQ  28
            VH+A+++ VND+M+Q
Sbjct  429  VHYATVTLVNDLMIQ  443



>gb|KGN60384.1| Transcription factor AtMYC2 [Cucumis sativus]
Length=679

 Score =   167 bits (422),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 95/199 (48%), Positives = 126/199 (63%), Gaps = 20/199 (10%)
 Frame = -2

Query  564  EXEHSDSDCQFLKEPPI--VDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFY  391
            + +HSD +   ++E     V   +  P+KRGRKP  GR  P+NHVEAERQRREKLN RFY
Sbjct  452  DSDHSDLEASVIREAESSRVVEPEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFY  511

Query  390  ALRSVVPNVSRMDKASLLSDAVSYINELKGKV-------EELECQLQLRESKKVKVEAVG  232
            ALR+VVPNVS+MDKASLL DA+SYINEL+GK+       E+L+ QL   +   +   +  
Sbjct  512  ALRAVVPNVSKMDKASLLGDAISYINELRGKLQTAESDKEDLQKQLDSVKKMMMSSSSKD  571

Query  231  -----------DNQstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRE  85
                       D    SS  +      D++VKI+  DAMIR+QS   N+P+A+LM  L E
Sbjct  572  SCMSSSNQPPPDQDIKSSNINHNDIETDIDVKIISWDAMIRIQSSKKNHPAARLMAALEE  631

Query  84   LELAVHHASISSVNDIMLQ  28
            L+L ++HASIS VND+M+Q
Sbjct  632  LDLDINHASISVVNDLMIQ  650



>ref|XP_010940945.1| PREDICTED: transcription factor MYC4-like [Elaeis guineensis]
Length=448

 Score =   164 bits (416),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 97/193 (50%), Positives = 127/193 (66%), Gaps = 30/193 (16%)
 Frame = -2

Query  564  EXEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYAL  385
            + EHSDS+   + E     ++   P         GR TPVNHVEAERQRREKLNHRFYAL
Sbjct  237  DSEHSDSEGLLMMERRRPKKRGRKPGT-------GRETPVNHVEAERQRREKLNHRFYAL  289

Query  384  RSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKVKVEAVGDNQstssaa  205
            RSVVPNVSRMDKASLL+DAV+YI EL+ KV+ELE      E+K+VK E + D     +A 
Sbjct  290  RSVVPNVSRMDKASLLADAVAYIKELRAKVDELET-----EAKRVKKEVIVDQGVGGAAT  344

Query  204  ssva------------------SPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELE  79
            ++                    + +++EVK++GPDA+IRV SEN ++P+AKLM+ LR+LE
Sbjct  345  TTTTTTTTTTMSSVVSCGGGGPATMELEVKMLGPDALIRVHSENLSHPTAKLMSALRDLE  404

Query  78   LAVHHASISSVND  40
            + VHHAS+SSV +
Sbjct  405  VHVHHASVSSVKE  417



>ref|XP_004248095.1| PREDICTED: transcription factor MYC2-like [Solanum lycopersicum]
Length=393

 Score =   163 bits (413),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 98/170 (58%), Positives = 117/170 (69%), Gaps = 17/170 (10%)
 Frame = -2

Query  495  APKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYI  316
              KKR R+      T  NHVEAERQRREKLN RFYALR VVPNV++MDKA+LLSDAV+YI
Sbjct  201  TSKKRRREICE---TQGNHVEAERQRREKLNSRFYALREVVPNVTKMDKATLLSDAVTYI  257

Query  315  NELKGKVEELECQLQLRESK--------KVKVE----AVGDNQstssaassvaSPVDVEV  172
             +LK KV+ELE +L              K K+E     V DNQ  SS  +S    +++EV
Sbjct  258  TQLKAKVDELESKLHSNNYHYYYPEMKIKHKMENHDINVVDNQ--SSITTSRDHTMEIEV  315

Query  171  KIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQDI  22
            K+VG DAMIRVQSEN NYPS +LM  L+E+EL V+HA+ISSVND ML DI
Sbjct  316  KMVGQDAMIRVQSENVNYPSTRLMCALQEVELHVYHANISSVNDFMLHDI  365



>ref|XP_010104300.1| hypothetical protein L484_023250 [Morus notabilis]
 gb|EXB99720.1| hypothetical protein L484_023250 [Morus notabilis]
Length=683

 Score =   167 bits (422),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 89/166 (54%), Positives = 117/166 (70%), Gaps = 11/166 (7%)
 Frame = -2

Query  492  PKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYIN  313
            P+KRGRKP  GR  P+NHVEAERQRREKLN RFYALR+VVPNVS+MDKASLL DA+SYIN
Sbjct  490  PRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYIN  549

Query  312  ELKGKVEELEC-----QLQLRESKKVKVEAVG------DNQstssaassvaSPVDVEVKI  166
            ELK K++  E      Q Q+   K++  +         D   ++   SS    +D++VKI
Sbjct  550  ELKSKLQGAESDKEDLQKQIDSVKELAGKDSSRPPTDPDLSMSNHHGSSKLIDLDIDVKI  609

Query  165  VGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQ  28
            +G DAMIR+Q    N+P+A+ M+ L+EL+L V+HAS+S VND+M+Q
Sbjct  610  IGWDAMIRMQCSKKNHPAARFMSALKELDLDVNHASVSVVNDLMIQ  655



>ref|XP_010058170.1| PREDICTED: transcription factor MYC2 [Eucalyptus grandis]
Length=699

 Score =   167 bits (422),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 97/195 (50%), Positives = 127/195 (65%), Gaps = 17/195 (9%)
 Frame = -2

Query  564  EXEHSDSDCQFLKEPPI--VDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFY  391
            + +HSD +   +KE     V   +  P+KRGRKP  GR  P+NHVEAERQRREKLN RFY
Sbjct  481  DSDHSDLEASVVKEADSSRVIEPEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFY  540

Query  390  ALRSVVPNVSRMDKASLLSDAVSYINELKGKV--------------EELECQLQLRESKK  253
            ALR+VVPNVS+MDKASLL DA++YI EL  K+              E L+ +L  ++S+ 
Sbjct  541  ALRAVVPNVSKMDKASLLGDAIAYIKELNSKLQTTESDKENLQKQMESLKKELTNKDSRS  600

Query  252  VKVEAVGDNQstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELA  73
               ++  D  S SS   +    +DV+VKI+G D MIR+QS   N+P+AKLM  L EL+L 
Sbjct  601  ALPQSDKD-LSISSNHGAKLIELDVDVKIIGWDVMIRIQSSKKNHPAAKLMQALMELDLD  659

Query  72   VHHASISSVNDIMLQ  28
            VHHAS+S VND+M+Q
Sbjct  660  VHHASVSVVNDLMIQ  674



>ref|XP_008465979.1| PREDICTED: transcription factor MYC2-like [Cucumis melo]
Length=689

 Score =   167 bits (422),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 95/199 (48%), Positives = 126/199 (63%), Gaps = 20/199 (10%)
 Frame = -2

Query  564  EXEHSDSDCQFLKE--PPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFY  391
            + +HSD +   ++E     V   +  P+KRGRKP  GR  P+NHVEAERQRREKLN RFY
Sbjct  463  DSDHSDLEASVIREVESSRVVEPEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFY  522

Query  390  ALRSVVPNVSRMDKASLLSDAVSYINELKGKV-------EELECQLQLRESKKVKVEAVG  232
            ALR+VVPNVS+MDKASLL DA+SYINEL+GK+       E+L+ QL   +   +   +  
Sbjct  523  ALRAVVPNVSKMDKASLLGDAISYINELRGKLQTAESDKEDLQKQLDSVKKMMMSSSSKD  582

Query  231  -----------DNQstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRE  85
                       D    SS  +      D++VKI+  DAMIR+QS   N+P+A+LM  L E
Sbjct  583  SCVSSSNQPPPDQDIKSSNINHNDIETDIDVKIISWDAMIRIQSSKKNHPAARLMAALEE  642

Query  84   LELAVHHASISSVNDIMLQ  28
            L+L ++HASIS VND+M+Q
Sbjct  643  LDLDINHASISVVNDLMIQ  661



>dbj|BAJ91674.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ89030.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=684

 Score =   167 bits (422),  Expect = 1e-44, Method: Composition-based stats.
 Identities = 99/197 (50%), Positives = 129/197 (65%), Gaps = 23/197 (12%)
 Frame = -2

Query  564  EXEHSDSDCQFLK-------EPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKL  406
            E +HSD +    +        PP    ++  P+KRGRKP  GR  P+NHVEAERQRREKL
Sbjct  463  ESDHSDLEASVREVESSRVVPPP----EEKRPRKRGRKPANGREEPLNHVEAERQRREKL  518

Query  405  NHRFYALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKVKVEAVGDN  226
            N RFYALR+VVPNVS+MDKASLL DA+SYINEL+GK+  LE     +E+   ++EA+   
Sbjct  519  NQRFYALRAVVPNVSKMDKASLLGDAISYINELRGKMTALESD---KETLHSQIEALKKE  575

Query  225  Qstssaassva---------SPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELA  73
            +    AA S +           V++E KI+G +AMIRVQ    N+P+AKLM  LREL+L 
Sbjct  576  RDARPAAPSSSGMHDNGARCHAVEIEAKILGLEAMIRVQCHKRNHPAAKLMTALRELDLD  635

Query  72   VHHASISSVNDIMLQDI  22
            V+HAS+S V DIM+Q +
Sbjct  636  VYHASVSVVKDIMIQQV  652



>dbj|BAJ91022.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=684

 Score =   167 bits (422),  Expect = 1e-44, Method: Composition-based stats.
 Identities = 99/197 (50%), Positives = 129/197 (65%), Gaps = 23/197 (12%)
 Frame = -2

Query  564  EXEHSDSDCQFLK-------EPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKL  406
            E +HSD +    +        PP    ++  P+KRGRKP  GR  P+NHVEAERQRREKL
Sbjct  463  ESDHSDLEASVREVESSRVVPPP----EEKRPRKRGRKPANGREEPLNHVEAERQRREKL  518

Query  405  NHRFYALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKVKVEAVGDN  226
            N RFYALR+VVPNVS+MDKASLL DA+SYINEL+GK+  LE     +E+   ++EA+   
Sbjct  519  NQRFYALRAVVPNVSKMDKASLLGDAISYINELRGKMTALESD---KETLHSQIEALKKE  575

Query  225  Qstssaassva---------SPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELA  73
            +    AA S +           V++E KI+G +AMIRVQ    N+P+AKLM  LREL+L 
Sbjct  576  RDARPAAPSSSGMHDNGARCHAVEIEAKILGLEAMIRVQCHKRNHPAAKLMTALRELDLD  635

Query  72   VHHASISSVNDIMLQDI  22
            V+HAS+S V DIM+Q +
Sbjct  636  VYHASVSVVKDIMIQQV  652



>gb|KCW71784.1| hypothetical protein EUGRSUZ_E00277 [Eucalyptus grandis]
Length=713

 Score =   167 bits (422),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 97/195 (50%), Positives = 127/195 (65%), Gaps = 17/195 (9%)
 Frame = -2

Query  564  EXEHSDSDCQFLKEPPI--VDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFY  391
            + +HSD +   +KE     V   +  P+KRGRKP  GR  P+NHVEAERQRREKLN RFY
Sbjct  495  DSDHSDLEASVVKEADSSRVIEPEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFY  554

Query  390  ALRSVVPNVSRMDKASLLSDAVSYINELKGKV--------------EELECQLQLRESKK  253
            ALR+VVPNVS+MDKASLL DA++YI EL  K+              E L+ +L  ++S+ 
Sbjct  555  ALRAVVPNVSKMDKASLLGDAIAYIKELNSKLQTTESDKENLQKQMESLKKELTNKDSRS  614

Query  252  VKVEAVGDNQstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELA  73
               ++  D  S SS   +    +DV+VKI+G D MIR+QS   N+P+AKLM  L EL+L 
Sbjct  615  ALPQSDKD-LSISSNHGAKLIELDVDVKIIGWDVMIRIQSSKKNHPAAKLMQALMELDLD  673

Query  72   VHHASISSVNDIMLQ  28
            VHHAS+S VND+M+Q
Sbjct  674  VHHASVSVVNDLMIQ  688



>ref|XP_002467448.1| hypothetical protein SORBIDRAFT_01g028230 [Sorghum bicolor]
 gb|EER94446.1| hypothetical protein SORBIDRAFT_01g028230 [Sorghum bicolor]
Length=709

 Score =   167 bits (422),  Expect = 1e-44, Method: Composition-based stats.
 Identities = 95/199 (48%), Positives = 130/199 (65%), Gaps = 24/199 (12%)
 Frame = -2

Query  564  EXEHSDSDC--------QFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREK  409
            E +HSD D         + +  PP  +++   P+KRGRKP  GR  P+NHVEAERQRREK
Sbjct  486  ESDHSDLDASVREVESSRVVAPPPEAEKR---PRKRGRKPANGREEPLNHVEAERQRREK  542

Query  408  LNHRFYALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKVKVEAVGD  229
            LN RFYALR+VVPNVS+MDKASLL DA+SYINEL+GK+  LE     +++ + ++EA+  
Sbjct  543  LNQRFYALRAVVPNVSKMDKASLLGDAISYINELRGKLTSLESD---KDTLQAQIEALKK  599

Query  228  NQstssaassva----------SPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELE  79
             +     A +              V+++ KI+G +AMIRVQ    N+PSA+LM  LREL+
Sbjct  600  ERDARPPAHAAGLGGHDGGPRCHAVEIDAKILGLEAMIRVQCHKRNHPSARLMTALRELD  659

Query  78   LAVHHASISSVNDIMLQDI  22
            L V+HAS+S V D+M+Q +
Sbjct  660  LDVYHASVSVVKDLMIQQV  678



>ref|NP_001065478.1| Os10g0575000 [Oryza sativa Japonica Group]
 gb|AAS66204.1| MYC protein [Oryza sativa]
 gb|ABB48017.1| transcription factor MYC7E, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF27315.1| Os10g0575000 [Oryza sativa Japonica Group]
Length=699

 Score =   167 bits (422),  Expect = 1e-44, Method: Composition-based stats.
 Identities = 95/194 (49%), Positives = 124/194 (64%), Gaps = 16/194 (8%)
 Frame = -2

Query  564  EXEHSD--------SDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREK  409
            E +HSD           + +  PP  +++   P+KRGRKP  GR  P+NHVEAERQRREK
Sbjct  479  ESDHSDLEASVREVESSRVVAPPPEAEKR---PRKRGRKPANGREEPLNHVEAERQRREK  535

Query  408  LNHRFYALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELEC-----QLQLRESKKVKV  244
            LN RFYALR+VVPNVS+MDKASLL DA+SYINEL+GK+  LE      Q Q+   KK + 
Sbjct  536  LNQRFYALRAVVPNVSKMDKASLLGDAISYINELRGKLTALETDKETLQSQMESLKKERD  595

Query  243  EAVGDNQstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHH  64
                          +    V++E KI+G +AMIRVQ    N+P+A+LM  LREL+L V+H
Sbjct  596  ARPPAPSGGGGDGGARCHAVEIEAKILGLEAMIRVQCHKRNHPAARLMTALRELDLDVYH  655

Query  63   ASISSVNDIMLQDI  22
            AS+S V D+M+Q +
Sbjct  656  ASVSVVKDLMIQQV  669



>ref|XP_007210206.1| hypothetical protein PRUPE_ppa016220mg [Prunus persica]
 gb|EMJ11405.1| hypothetical protein PRUPE_ppa016220mg [Prunus persica]
Length=459

 Score =   164 bits (416),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 93/169 (55%), Positives = 123/169 (73%), Gaps = 14/169 (8%)
 Frame = -2

Query  489  KKRGRKPGAGRVTPV-NHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYIN  313
            ++R    GA R + + NHVEAERQRREKLNHRFY LRSVVPNVS+MD++SLL+DAV+YIN
Sbjct  268  RRRSSNNGASRESSLLNHVEAERQRREKLNHRFYLLRSVVPNVSKMDRSSLLADAVAYIN  327

Query  312  ELKGKVEELE--CQLQLRESKKVKVEAVGDNQstssaas----------svaSPVDVEVK  169
            +LK KVEELE   Q Q +  KKV V  + DNQ + S +S          +   PV+V+VK
Sbjct  328  QLKAKVEELELKTQAQPQNPKKVSVNNL-DNQCSQSTSSIVDHHSSYNNTKVVPVEVDVK  386

Query  168  IVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQDI  22
            I+G +A+IRVQ ++ +YP A+LMN L+ L L V+HASISSV ++M+QD+
Sbjct  387  IMGSEAIIRVQCQDQDYPYARLMNALKGLGLQVYHASISSVKELMIQDV  435



>ref|XP_004300239.1| PREDICTED: transcription factor MYC2-like [Fragaria vesca subsp. 
vesca]
Length=682

 Score =   166 bits (421),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 94/188 (50%), Positives = 125/188 (66%), Gaps = 10/188 (5%)
 Frame = -2

Query  564  EXEHSDSDCQFLKEPP---IVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRF  394
            + +HSD +    KE     +VD ++  P+KRGRKP  GR  P+NHVEAERQRREKLN RF
Sbjct  468  DSDHSDLEASVAKEADSSRVVDPEKR-PRKRGRKPANGREEPLNHVEAERQRREKLNQRF  526

Query  393  YALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELEC-----QLQLRE-SKKVKVEAVG  232
            YALR+VVPNVS+MDKASLL DA+SYI ELK K++  E      Q Q+   SK+++     
Sbjct  527  YALRAVVPNVSKMDKASLLGDAISYITELKTKLQTTESDKEDMQKQVETLSKELQESRSC  586

Query  231  DNQstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASIS  52
                     S+    +D++VKI+G DA I++Q    N+P+A+LM  L EL+L VHHAS+S
Sbjct  587  SGLDQELKGSTKLIDLDIDVKILGWDARIQIQCSKKNHPAARLMAALMELDLDVHHASVS  646

Query  51   SVNDIMLQ  28
             VND+M+Q
Sbjct  647  VVNDLMIQ  654



>ref|XP_004159750.1| PREDICTED: transcription factor MYC4-like [Cucumis sativus]
Length=443

 Score =   164 bits (415),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 91/169 (54%), Positives = 118/169 (70%), Gaps = 12/169 (7%)
 Frame = -2

Query  498  NAPKKRGRKPGAGRVT-----PVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLS  334
            N  KKRG++      T     PVNHVEAERQRR+KLN RFYALRSVVPNVS+MDKASLL+
Sbjct  252  NVGKKRGKRSAKNNKTELSSLPVNHVEAERQRRQKLNQRFYALRSVVPNVSKMDKASLLA  311

Query  333  DAVSYINELKGKVEELECQL-----QLRESKKVKVEAVGDNQstssaassvaSPVDVEVK  169
            DA  YI ELK KV++LE +L     Q   S    VE    +   +S  ++  +  +VEV+
Sbjct  312  DAAEYIKELKSKVQKLESKLKQSQHQTSSSTISTVEQTISS--ITSYTNNNNNNNNVEVQ  369

Query  168  IVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQDI  22
            ++G +AM+RVQ  + NYPSA+L+N L+EL L VHHAS+SSVN++MLQD+
Sbjct  370  LIGSEAMVRVQCRDENYPSARLLNVLKELGLQVHHASLSSVNEMMLQDV  418



>ref|XP_008448683.1| PREDICTED: transcription factor MYC2-like [Cucumis melo]
Length=662

 Score =   166 bits (420),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 92/193 (48%), Positives = 127/193 (66%), Gaps = 15/193 (8%)
 Frame = -2

Query  564  EXEHSDSDCQFLKEPPIVDRQ---QNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRF  394
            + +HSD +   ++E     +    +  P+KRGRKP  GR  P+NHVEAERQRREKLN +F
Sbjct  434  DSDHSDLEASVIREVDSCTKSLEPEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQKF  493

Query  393  YALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQ-------LQLRESKKVKVEAV  235
            YALR+VVPNVS+MDKASLL DAVSYINELK K++  E +       L+L + K++  + V
Sbjct  494  YALRAVVPNVSKMDKASLLGDAVSYINELKSKLQMAESEKTDMGKHLELLK-KEMGGKDV  552

Query  234  G----DNQstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVH  67
            G     N             +++EVKI+G DAMIR+QS   N+P+A+LM   ++L+L + 
Sbjct  553  GCYTNPNDEDLKIGKRKVMDMEIEVKIMGWDAMIRIQSNKKNHPAARLMTAFKDLDLEML  612

Query  66   HASISSVNDIMLQ  28
            HAS+S VND+M+Q
Sbjct  613  HASVSVVNDLMIQ  625



>ref|XP_004166734.1| PREDICTED: LOW QUALITY PROTEIN: transcription factor MYC4-like 
[Cucumis sativus]
Length=686

 Score =   166 bits (421),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 95/199 (48%), Positives = 126/199 (63%), Gaps = 20/199 (10%)
 Frame = -2

Query  564  EXEHSDSDCQFLKEPPI--VDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFY  391
            + +HSD +   ++E     V   +  P+KRGRKP  GR  P+NHVEAERQRREKLN RFY
Sbjct  459  DSDHSDLEASVIREAESSRVVEPEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFY  518

Query  390  ALRSVVPNVSRMDKASLLSDAVSYINELKGKV-------EELECQLQLRESKKVKVEAVG  232
            ALR+VVPNVS+MDKASLL DA+SYINEL+GK+       E+L+ QL   +   +   +  
Sbjct  519  ALRAVVPNVSKMDKASLLGDAISYINELRGKLQTAESDKEDLQKQLDSVKKMMMSSSSKD  578

Query  231  -----------DNQstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRE  85
                       D    SS  +      D++VKI+  DAMIR+QS   N+P+A+LM  L E
Sbjct  579  SCMSSSNQPPPDQDIKSSNINHNDIETDIDVKIISWDAMIRIQSSKKNHPAARLMAALEE  638

Query  84   LELAVHHASISSVNDIMLQ  28
            L+L ++HASIS VND+M+Q
Sbjct  639  LDLDINHASISVVNDLMIQ  657



>ref|XP_009765330.1| PREDICTED: transcription factor MYC2-like [Nicotiana sylvestris]
Length=423

 Score =   163 bits (413),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 91/176 (52%), Positives = 121/176 (69%), Gaps = 17/176 (10%)
 Frame = -2

Query  498  NAPKKRGRKPGAGRVTP------VNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLL  337
            N  + R RK  +  +        +NHVEAER RREKLNHRFYALRSVVP VS+MDKASLL
Sbjct  221  NINRSRKRKADSSSIITGRSEMAMNHVEAERIRREKLNHRFYALRSVVPYVSKMDKASLL  280

Query  336  SDAVSYINELKGKVEELECQLQLRESKKVKVE---------AVGD--NQstssaassvaS  190
            +DAV+YI ELK KVE+LE ++Q ++ K   +E         AV D  N  + S+++   +
Sbjct  281  ADAVTYIKELKAKVEDLESKIQSQKPKNNLMEQHDSHSASSAVFDPANNKSFSSSNGGRN  340

Query  189  PVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQDI  22
             +++EVKI+G +AMIRVQS + NYP A+LMN  RE+E  ++HAS+SS  D+MLQDI
Sbjct  341  GMEIEVKIIGTEAMIRVQSLDVNYPCARLMNVFREMEFQIYHASVSSFKDLMLQDI  396



>ref|XP_009359541.1| PREDICTED: transcription factor MYC2-like [Pyrus x bretschneideri]
Length=481

 Score =   164 bits (415),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 94/169 (56%), Positives = 122/169 (72%), Gaps = 13/169 (8%)
 Frame = -2

Query  489  KKRGRKPG--AGR-VTPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSY  319
            KKRGR      GR  +P+NHVEAERQRREKLN RFYALRSVVPNVSRMDKASLLSDAV Y
Sbjct  289  KKRGRSSNRETGRPESPINHVEAERQRREKLNCRFYALRSVVPNVSRMDKASLLSDAVVY  348

Query  318  INELKGKVEELECQLQLRESK-----KVKVEAVGDNQst-----ssaassvaSPVDVEVK  169
            INELK +V +LE ++Q +  K       +  ++ D+  T     SS  +     ++++VK
Sbjct  349  INELKARVGQLESKIQAQLQKPGVDIGGQTSSIVDHHQTRPRLSSSYNNRAVGDMEMDVK  408

Query  168  IVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQDI  22
            IVG +AM+RVQ  + NYP+A+LMN L++LEL V+HASISSV ++M+QD+
Sbjct  409  IVGSEAMLRVQCPDCNYPNARLMNALKDLELQVYHASISSVKELMIQDV  457



>ref|XP_010523833.1| PREDICTED: transcription factor MYC3-like [Tarenaya hassleriana]
Length=418

 Score =   163 bits (412),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 92/167 (55%), Positives = 121/167 (72%), Gaps = 11/167 (7%)
 Frame = -2

Query  492  PKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYIN  313
            P++R RK  +    P+NH+EAERQRREKLNHRFYALRSVVP VSRMDKASLLSDAVSYIN
Sbjct  229  PERRRRKANSTGEQPLNHIEAERQRREKLNHRFYALRSVVPRVSRMDKASLLSDAVSYIN  288

Query  312  ELKGKVEELECQLQLRESKKVKVEAVGD----------NQstssaassvaSPVDVEVKIV  163
            ELK K++ELE +L+  ++K+VK+E +            N S +  +    S V+V+VKIV
Sbjct  289  ELKRKIDELESKLK-PDNKRVKLEEMTTGLSNDQSGIKNASEALVSKRGYSKVEVDVKIV  347

Query  162  GPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQDI  22
            G +A+IRVQ+EN +YP A L   LREL+L + H S+SSV ++M+Q +
Sbjct  348  GDEAVIRVQTENLSYPVAALTAALRELKLKIRHGSMSSVEELMVQQM  394



>gb|AAK00453.1|AC060755_23 putative MYC transcription factor [Oryza sativa Japonica Group]
Length=688

 Score =   166 bits (420),  Expect = 2e-44, Method: Composition-based stats.
 Identities = 95/194 (49%), Positives = 124/194 (64%), Gaps = 16/194 (8%)
 Frame = -2

Query  564  EXEHSD--------SDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREK  409
            E +HSD           + +  PP  +++   P+KRGRKP  GR  P+NHVEAERQRREK
Sbjct  468  ESDHSDLEASVREVESSRVVAPPPEAEKR---PRKRGRKPANGREEPLNHVEAERQRREK  524

Query  408  LNHRFYALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELEC-----QLQLRESKKVKV  244
            LN RFYALR+VVPNVS+MDKASLL DA+SYINEL+GK+  LE      Q Q+   KK + 
Sbjct  525  LNQRFYALRAVVPNVSKMDKASLLGDAISYINELRGKLTALETDKETLQSQMESLKKERD  584

Query  243  EAVGDNQstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHH  64
                          +    V++E KI+G +AMIRVQ    N+P+A+LM  LREL+L V+H
Sbjct  585  ARPPAPSGGGGDGGARCHAVEIEAKILGLEAMIRVQCHKRNHPAARLMTALRELDLDVYH  644

Query  63   ASISSVNDIMLQDI  22
            AS+S V D+M+Q +
Sbjct  645  ASVSVVKDLMIQQV  658



>ref|XP_010441529.1| PREDICTED: transcription factor bHLH28-like [Camelina sativa]
Length=461

 Score =   164 bits (414),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 90/159 (57%), Positives = 106/159 (67%), Gaps = 5/159 (3%)
 Frame = -2

Query  489  KKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYINE  310
            KKRGRKP  GR  P+NHVEAER RREKLNHRFYALR+VVPNVS+MDK SLL DAV YINE
Sbjct  278  KKRGRKPMHGREKPLNHVEAERMRREKLNHRFYALRAVVPNVSKMDKTSLLEDAVRYINE  337

Query  309  LKGKVEELE-----CQLQLRESKKVKVEAVGDNQstssaassvaSPVDVEVKIVGPDAMI  145
            LK   E  E      Q QL E KK+       +    +      S + +EVK +G D MI
Sbjct  338  LKSTAENAESERNAVQNQLNELKKITGRQNATSSVVCNDDKENVSELKIEVKAMGSDVMI  397

Query  144  RVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQ  28
            RV+S   N+P A+LMN L +LEL V HASIS +ND+M+Q
Sbjct  398  RVESGKRNHPGARLMNALMDLELEVSHASISVMNDLMIQ  436



>ref|XP_008370020.1| PREDICTED: transcription factor MYC2-like [Malus domestica]
Length=481

 Score =   164 bits (415),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 94/169 (56%), Positives = 122/169 (72%), Gaps = 13/169 (8%)
 Frame = -2

Query  489  KKRGRKPG--AGR-VTPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSY  319
            KKRGR      GR  +P+NHVEAERQRREKLN RFYALRSVVPNVSRMDKASLLSDAV Y
Sbjct  289  KKRGRSSNRETGRPESPINHVEAERQRREKLNCRFYALRSVVPNVSRMDKASLLSDAVVY  348

Query  318  INELKGKVEELECQLQLRESK-----KVKVEAVGDNQst-----ssaassvaSPVDVEVK  169
            INELK +V +LE ++Q +  K       +  ++ D+  T     SS  +     ++++VK
Sbjct  349  INELKARVGQLESKIQAQLQKPGVDIGGQTSSIVDHHQTRPRLSSSYNNRAGGALEMDVK  408

Query  168  IVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQDI  22
            IVG +AM+RVQ  + +YP+A+LMN L++LEL V+HASISSV ++MLQD+
Sbjct  409  IVGSEAMLRVQCPDCDYPNARLMNALKDLELQVYHASISSVKELMLQDV  457



>gb|KGN55667.1| hypothetical protein Csa_3G002860 [Cucumis sativus]
Length=447

 Score =   163 bits (413),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 92/169 (54%), Positives = 118/169 (70%), Gaps = 11/169 (7%)
 Frame = -2

Query  498  NAPKKRGRKPGAGRVT-----PVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLS  334
            N  KKRG++      T     PVNHVEAERQRR+KLN RFYALRSVVPNVS+MDKASLL+
Sbjct  255  NVGKKRGKRSAKNIKTELSSLPVNHVEAERQRRQKLNQRFYALRSVVPNVSKMDKASLLA  314

Query  333  DAVSYINELKGKVEELECQL-----QLRESKKVKVEAVGDNQstssaassvaSPVDVEVK  169
            DA  YI ELK KV++LE +L     Q   S    VE    +  TS   ++  +  +VEV+
Sbjct  315  DAAEYIKELKSKVQKLESKLKQSQHQTSSSTISTVEQT-ISSITSFTNNNNNNNNNVEVQ  373

Query  168  IVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQDI  22
            ++G +AM+RVQ  + NYPSA+L+N L+EL L VHHAS+SSVN++MLQD+
Sbjct  374  LIGSEAMVRVQCRDENYPSARLLNVLKELGLQVHHASLSSVNEMMLQDV  422



>ref|XP_004146202.1| PREDICTED: transcription factor MYC4-like [Cucumis sativus]
Length=443

 Score =   163 bits (413),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 91/169 (54%), Positives = 118/169 (70%), Gaps = 12/169 (7%)
 Frame = -2

Query  498  NAPKKRGRKPGAGRVT-----PVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLS  334
            N  KKRG++      T     PVNHVEAERQRR+KLN RFYALRSVVPNVS+MDKASLL+
Sbjct  252  NVGKKRGKRSAKNIKTELSSLPVNHVEAERQRRQKLNQRFYALRSVVPNVSKMDKASLLA  311

Query  333  DAVSYINELKGKVEELECQL-----QLRESKKVKVEAVGDNQstssaassvaSPVDVEVK  169
            DA  YI ELK KV++LE +L     Q   S    VE    +   +S  ++  +  +VEV+
Sbjct  312  DAAEYIKELKSKVQKLESKLKQSQHQTSSSTISTVEQTISS--ITSYTNNNNNNNNVEVQ  369

Query  168  IVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQDI  22
            ++G +AM+RVQ  + NYPSA+L+N L+EL L VHHAS+SSVN++MLQD+
Sbjct  370  LIGSEAMVRVQCRDENYPSARLLNVLKELGLQVHHASLSSVNEMMLQDV  418



>ref|XP_004148739.1| PREDICTED: transcription factor MYC2-like [Cucumis sativus]
 ref|XP_004164415.1| PREDICTED: transcription factor MYC2-like [Cucumis sativus]
 gb|KGN55759.1| Transcription factor AtMYC2 [Cucumis sativus]
Length=661

 Score =   166 bits (419),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 94/199 (47%), Positives = 124/199 (62%), Gaps = 27/199 (14%)
 Frame = -2

Query  564  EXEHSDSDCQFLKEPPIVDRQ---QNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRF  394
            + +HSD +   ++E     +    +  P+KRGRKP  GR  P+NHVEAERQRREKLN +F
Sbjct  434  DSDHSDLEASAIREVDSCTKSLEPEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQKF  493

Query  393  YALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKK---------VKVE  241
            YALR+VVPNVS+MDKASLL DAVSYINELK K       LQ+ ES+K         +K E
Sbjct  494  YALRAVVPNVSKMDKASLLGDAVSYINELKSK-------LQMAESEKTDMGKHLELLKKE  546

Query  240  AVGD--------NQstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRE  85
              G         N             +++EVKI+G DAMIR+QS   N+P+A+LM   ++
Sbjct  547  MGGKDLGCYSNPNDEDLKTGKRKVMDMEIEVKIMGWDAMIRIQSNKKNHPAARLMTAFKD  606

Query  84   LELAVHHASISSVNDIMLQ  28
            L+L + HAS+S VND+M+Q
Sbjct  607  LDLEMLHASVSVVNDLMIQ  625



>ref|XP_007039493.1| Basic helix-loop-helix DNA-binding family protein [Theobroma 
cacao]
 gb|EOY23994.1| Basic helix-loop-helix DNA-binding family protein [Theobroma 
cacao]
Length=669

 Score =   165 bits (418),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 92/195 (47%), Positives = 127/195 (65%), Gaps = 17/195 (9%)
 Frame = -2

Query  564  EXEHSDSDCQFLKEPPI--VDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFY  391
            + +HSD +   +KE     V   +  P+KRGRKP  GR  P+NHVEAERQRREKLN RFY
Sbjct  448  DSDHSDLEASVVKEADSSRVVEPEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFY  507

Query  390  ALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELEC--------------QLQLRESKK  253
            ALR+VVPNVS+MDKASLL DA+SYINEL+ K++  +               +L  ++S+ 
Sbjct  508  ALRAVVPNVSKMDKASLLGDAISYINELRTKLQNADSEKEELQKELEAMKKELSSKDSRS  567

Query  252  VKVEAVGDNQstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELA  73
                A   +   S+   +    ++++VKI+G DAMIR+Q    N+P+A+LM  L+EL+L 
Sbjct  568  AP-PAPDQDLKMSNHLGNKLVELEIDVKIIGWDAMIRIQCNKKNHPAARLMAALKELDLD  626

Query  72   VHHASISSVNDIMLQ  28
            VHHAS+S VND+M+Q
Sbjct  627  VHHASVSVVNDLMIQ  641



>gb|KDP22548.1| hypothetical protein JCGZ_26379 [Jatropha curcas]
Length=469

 Score =   163 bits (413),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 92/167 (55%), Positives = 120/167 (72%), Gaps = 5/167 (3%)
 Frame = -2

Query  489  KKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYINE  310
            KKR RK  AG+ T +NHVEAERQRRE+LNHRFY+LRSVVP VS+MDKASLL+DAV+YI E
Sbjct  286  KKRSRKQSAGKETHLNHVEAERQRRERLNHRFYSLRSVVPTVSKMDKASLLADAVTYIKE  345

Query  309  LKGKVEELECQLQ---LRESKKVKVEAVGDNQstssaassvaSPVDVEVKIVG-PDAMIR  142
            LK KV+ELE + Q   + ++     +    N    S +S  A  ++V+VKI+G  +AMIR
Sbjct  346  LKAKVDELETKQQAIIMSKNNNNHNKLNNGNDIFRSFSSHRAKVIEVDVKILGSSEAMIR  405

Query  141  VQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQDIRG*RXPD  1
            V S N N+P+A+LM+ LRE E  VHH S+SS+ D++LQD+   R PD
Sbjct  406  VLSPNVNHPAARLMDALREAECQVHHGSVSSIKDMLLQDVMV-RVPD  451



>dbj|BAJ86015.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=684

 Score =   165 bits (417),  Expect = 5e-44, Method: Composition-based stats.
 Identities = 98/197 (50%), Positives = 128/197 (65%), Gaps = 23/197 (12%)
 Frame = -2

Query  564  EXEHSDSDCQFLK-------EPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKL  406
            E +HSD +    +        PP    ++  P+KRGRKP  GR  P+NHVEAERQRREKL
Sbjct  463  ESDHSDLEASVREVESSRVVPPP----EEKRPRKRGRKPANGREEPLNHVEAERQRREKL  518

Query  405  NHRFYALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKVKVEAVGDN  226
            N RFY LR+VVPNVS+MDKASLL DA+SYINEL+GK+  LE     +E+   ++EA+   
Sbjct  519  NQRFYTLRAVVPNVSKMDKASLLGDAISYINELRGKMTALESD---KETLHSQIEALKKE  575

Query  225  Qstssaassva---------SPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELA  73
            +    AA S +           V++E KI+G +AMIRVQ    N+P+AKLM  LREL+L 
Sbjct  576  RDARPAAPSSSGMHDNGARCHAVEIEAKILGLEAMIRVQCHKRNHPAAKLMTALRELDLD  635

Query  72   VHHASISSVNDIMLQDI  22
            V+HAS+S V DIM+Q +
Sbjct  636  VYHASVSVVKDIMIQQV  652



>ref|XP_002519814.1| Transcription factor AtMYC2, putative [Ricinus communis]
 gb|EEF42418.1| Transcription factor AtMYC2, putative [Ricinus communis]
Length=663

 Score =   165 bits (417),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 93/194 (48%), Positives = 128/194 (66%), Gaps = 15/194 (8%)
 Frame = -2

Query  564  EXEHSDSDCQFLKEPPI--VDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFY  391
            + +HSD +   ++E     V   +  P+KRGRKP  GR  P+NHVEAERQRREKLN RFY
Sbjct  443  DSDHSDLEASVVRETESSRVVEPEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFY  502

Query  390  ALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQ--LRESKKVKVEAVGDNQ--  223
            ALR+VVPNVS+MDKASLL DA+SYI EL+ K++  E   +   +E + +K E +  +   
Sbjct  503  ALRAVVPNVSKMDKASLLGDAISYIKELRTKLQTAESDKEELEKEVESMKKEFLSKDSRP  562

Query  222  ---------stssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAV  70
                       S+   S A  +D++VKI+G DAMIR+Q    N+P+A+LM  L++L+L V
Sbjct  563  GSPPPDKELKMSNNHGSKAIDMDIDVKIIGWDAMIRIQCSKKNHPAARLMAALKDLDLDV  622

Query  69   HHASISSVNDIMLQ  28
            HHAS+S VND+M+Q
Sbjct  623  HHASVSVVNDLMIQ  636



>ref|XP_009384727.1| PREDICTED: transcription factor MYC3-like [Musa acuminata subsp. 
malaccensis]
Length=696

 Score =   165 bits (417),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 87/163 (53%), Positives = 117/163 (72%), Gaps = 8/163 (5%)
 Frame = -2

Query  492  PKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYIN  313
            P+KRGRKP  GR  P+NHVEAERQRREKLN RFYALR+VVPNVS+MDKASLL DAVSYIN
Sbjct  502  PRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAVSYIN  561

Query  312  ELKGKVEELEC-----QLQLRESKKVKVEAVG---DNQstssaassvaSPVDVEVKIVGP  157
            EL+ K++ LE      Q Q++  KK +  A     ++   +         V++EVK++G 
Sbjct  562  ELRSKLQALEANKEDLQAQIQGLKKERESAPTQRPESNLKTMNGGGRCHGVEIEVKLLGS  621

Query  156  DAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQ  28
            +A+IR+QS+  N+P+A LM  L++L+L VH+AS+S V D+M+Q
Sbjct  622  EALIRLQSQKRNHPAAVLMAALQDLDLEVHYASVSVVKDLMIQ  664



>ref|XP_003534274.2| PREDICTED: transcription factor MYC2-like [Glycine max]
Length=731

 Score =   165 bits (418),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 93/195 (48%), Positives = 126/195 (65%), Gaps = 18/195 (9%)
 Frame = -2

Query  564  EXEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYAL  385
            + +HSD +   +K+P  V   +  P+KRGRKP  GR  P+NHVEAERQRREKLN RFYAL
Sbjct  511  DSDHSDLEASVVKDP--VVEPEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYAL  568

Query  384  RSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQL----RESKKVKVEAVGDN---  226
            R+VVPNVS+MDKASLL DA+SYI ELK K++ LE    +     E  K ++E   DN   
Sbjct  569  RAVVPNVSKMDKASLLGDAISYITELKSKLQTLESDKDVLHKQLEGVKKELEKTTDNVSS  628

Query  225  ----QstssaassvaSP-----VDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELA  73
                 + ++   S   P     V+++VKI+G DAMI +     N+P+A LM  L EL+L 
Sbjct  629  NHACNNNNNNKLSSNQPALIDLVEMDVKIIGWDAMITITCSKKNHPAATLMTALMELDLD  688

Query  72   VHHASISSVNDIMLQ  28
            VH+A+++ VND+M+Q
Sbjct  689  VHYATVTLVNDLMIQ  703



>gb|EEC67493.1| hypothetical protein OsI_34761 [Oryza sativa Indica Group]
Length=664

 Score =   165 bits (417),  Expect = 5e-44, Method: Composition-based stats.
 Identities = 95/194 (49%), Positives = 124/194 (64%), Gaps = 16/194 (8%)
 Frame = -2

Query  564  EXEHSD--------SDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREK  409
            E +HSD           + +  PP  +++   P+KRGRKP  GR  P+NHVEAERQRREK
Sbjct  444  ESDHSDLEASVREVESSRVVAPPPEAEKR---PRKRGRKPANGREEPLNHVEAERQRREK  500

Query  408  LNHRFYALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELEC-----QLQLRESKKVKV  244
            LN RFYALR+VVPNVS+MDKASLL DA+SYINEL+GK+  LE      Q Q+   KK + 
Sbjct  501  LNQRFYALRAVVPNVSKMDKASLLGDAISYINELRGKLTALETDKETLQSQMESLKKERD  560

Query  243  EAVGDNQstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHH  64
                          +    V++E KI+G +AMIRVQ    N+P+A+LM  LREL+L V+H
Sbjct  561  ARPPAPSGGGGDGGARCHAVEIEAKILGLEAMIRVQCHKRNHPAARLMTALRELDLDVYH  620

Query  63   ASISSVNDIMLQDI  22
            AS+S V D+M+Q +
Sbjct  621  ASVSVVKDLMIQQV  634



>ref|XP_003628820.1| Transcription factor MYC2 [Medicago truncatula]
Length=648

 Score =   164 bits (416),  Expect = 6e-44, Method: Composition-based stats.
 Identities = 102/196 (52%), Positives = 127/196 (65%), Gaps = 20/196 (10%)
 Frame = -2

Query  555  HSDSDCQFLKE--PPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYALR  382
            HSD D   +KE     V      PKKRGRKP  GR  P+NHVEAERQRREKLN +FYALR
Sbjct  423  HSDLDVSAVKEGESSRVVEPGKRPKKRGRKPANGREEPLNHVEAERQRREKLNQKFYALR  482

Query  381  SVVPNVSRMDKASLLSDAVSYINELKGKVEELEC-----QLQLRESKKVKVEAVGDNQst  217
            +VVPN S+MDKASLL DA+SYINELK K++ LE      + QL  +KK        NQS 
Sbjct  483  AVVPNGSKMDKASLLGDAISYINELKSKLQGLESSKGELEKQLGATKKELELVASKNQSQ  542

Query  216  s-------------saassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELEL  76
            +             S +SS    +D++VKI+G DAMIR+Q    N+P+AKLM  L+EL+L
Sbjct  543  NPIPLDKEKEKTTSSTSSSKLIDLDIDVKIMGWDAMIRIQCSKKNHPAAKLMAALKELDL  602

Query  75   AVHHASISSVNDIMLQ  28
             V+HAS+S VND+M+Q
Sbjct  603  DVNHASVSVVNDLMIQ  618



>ref|XP_008796257.1| PREDICTED: transcription factor MYC4 [Phoenix dactylifera]
Length=687

 Score =   165 bits (417),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 93/192 (48%), Positives = 129/192 (67%), Gaps = 15/192 (8%)
 Frame = -2

Query  564  EXEHSDSDCQF--LKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFY  391
            + +HSD +     ++  P+V+ ++  P+KRGRKP  GR  P+NHVEAERQRREKLN RFY
Sbjct  467  DSDHSDLEASVREVESSPVVEPEKR-PRKRGRKPANGREEPLNHVEAERQRREKLNQRFY  525

Query  390  ALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELEC-----QLQL------RESKKVKV  244
            ALR+VVPNVS+MDKASLL DA+SYINEL+ K++ LE      Q Q+      R+S   + 
Sbjct  526  ALRAVVPNVSKMDKASLLGDAISYINELRSKLQSLESDKEGLQAQIDSLKRDRDSSPARP  585

Query  243  EAVGDNQstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHH  64
              + D Q            V++EVKI+G +AMIRVQ    N+P+A+LM  L++L+L V++
Sbjct  586  LQLPD-QDAKMMNGGRCHGVEIEVKILGLEAMIRVQCHKKNHPAARLMAALKDLDLDVYY  644

Query  63   ASISSVNDIMLQ  28
            AS+S V D+M+Q
Sbjct  645  ASVSVVKDLMIQ  656



>ref|XP_009384126.1| PREDICTED: transcription factor MYC4-like [Musa acuminata subsp. 
malaccensis]
Length=676

 Score =   164 bits (416),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 87/163 (53%), Positives = 119/163 (73%), Gaps = 7/163 (4%)
 Frame = -2

Query  492  PKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYIN  313
            P+KRGRKP  GR  P+NHVEAERQRREKLN RFYALR+VVPNVS+MDKASLL DAVSYIN
Sbjct  481  PRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAVSYIN  540

Query  312  ELKGKVEELEC-QLQLRE-----SKKVKVEAVGDNQstssaassvaSPVDVEVKIVGPDA  151
            EL+  ++ LE  + +LR+      KK+ V+   D+   ++        V++EVKI+G +A
Sbjct  541  ELRSNLQTLEADKEELRDRVEALEKKLPVQPPPDHNLRTTTNGRCHG-VEMEVKILGSEA  599

Query  150  MIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQDI  22
            MIR+Q +  N+P+A LM  L++L+L +H+AS+S V D+M+Q +
Sbjct  600  MIRLQCQKRNHPAASLMAALKDLDLELHYASVSVVKDLMIQQV  642



>ref|XP_009401251.1| PREDICTED: transcription factor MYC4-like [Musa acuminata subsp. 
malaccensis]
Length=690

 Score =   164 bits (416),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 84/163 (52%), Positives = 116/163 (71%), Gaps = 8/163 (5%)
 Frame = -2

Query  492  PKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYIN  313
            P+KRGRKP  GR  P+NHVEAERQRREKLN RFYALR+VVPNVS+MDKASLL DAVSYIN
Sbjct  495  PRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAVSYIN  554

Query  312  ELKGKV-------EELECQLQ-LRESKKVKVEAVGDNQstssaassvaSPVDVEVKIVGP  157
            EL+ K+       EEL+ Q++ +++ ++                      V+++VK++G 
Sbjct  555  ELRSKLQASEADKEELQSQMEIIKKERESAPARPAPPPRYDVKMMKGCHGVEIDVKLLGS  614

Query  156  DAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQ  28
            +AMIR+QS+  N+P+A+LM  L++L+L VH+AS+S V D+M+Q
Sbjct  615  EAMIRLQSQKRNHPAARLMAALQDLDLEVHYASVSVVKDLMIQ  657



>gb|AAQ14332.1|AF283507_1 MYC2 [Catharanthus roseus]
Length=699

 Score =   164 bits (415),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 91/167 (54%), Positives = 124/167 (74%), Gaps = 12/167 (7%)
 Frame = -2

Query  492  PKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYIN  313
            P+KRGRKP  GR  P+NHVEAERQRREKLN RFYALR+VVPNVS+MDKASLL DA+SYIN
Sbjct  500  PRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYIN  559

Query  312  ELKGKVE-------ELECQL-QLRE---SKKVKVEAVGD-NQstssaassvaSPVDVEVK  169
            ELK K++       EL+ QL  L++   SK+ ++ +  D +  +S+  S     +D++VK
Sbjct  560  ELKAKLQTTETDKDELKNQLDSLKKELASKESRLLSSPDQDLKSSNKQSVGNLDMDIDVK  619

Query  168  IVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQ  28
            I+G +AMIRVQS   N+P+A++M  L++L+L + HAS+S VND+M+Q
Sbjct  620  IIGREAMIRVQSSKNNHPAARVMGALKDLDLELLHASVSVVNDLMIQ  666



>gb|KFK28472.1| hypothetical protein AALP_AA7G000700 [Arabis alpina]
Length=543

 Score =   163 bits (413),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 90/179 (50%), Positives = 126/179 (70%), Gaps = 18/179 (10%)
 Frame = -2

Query  516  IVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLL  337
            +V+  +  P+KRGRKP  GR  P+NHVEAERQRREKLN +FYALR+VVPNVS+MDKASLL
Sbjct  339  VVEPGEKKPRKRGRKPANGREEPLNHVEAERQRREKLNQKFYALRAVVPNVSKMDKASLL  398

Query  336  SDAVSYINELKGKV-------EELECQL-QLRESKKVKVEAVGD--------NQstssaa  205
             DA+SYINELK  +       EELE Q+ ++R  K+VK +A+          ++   +  
Sbjct  399  GDAISYINELKSNLEKAESDKEELEKQIDEMR--KEVKAKAMASENGKCSVKDRKCLNQD  456

Query  204  ssvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQ  28
            SSVA  ++++VKI+G D M+R+Q    N+P A+ M  L+EL++ V+HAS+S +ND+M+Q
Sbjct  457  SSVAIEMEIDVKIIGWDVMVRIQCSKKNHPGARFMEALKELDMEVNHASLSVMNDLMIQ  515



>gb|AEB35656.1| MYC2, partial [Helianthus annuus]
Length=155

 Score =   154 bits (389),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 84/155 (54%), Positives = 109/155 (70%), Gaps = 8/155 (5%)
 Frame = -2

Query  477  RKPGAGRVTPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYINELKGK  298
            RKP  GR  P+NHVEAERQRREKLN RFYALR+VVPNVS+MDKASLL DA+ YINELK K
Sbjct  1    RKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAILYINELKAK  60

Query  297  VE-------ELECQLQ-LRESKKVKVEAVGDNQstssaassvaSPVDVEVKIVGPDAMIR  142
            +E       EL  Q+  L++    KV A  + + +S       + +DV+VK++G DAMIR
Sbjct  61   LENNEANKDELRNQIDALKKELSNKVSAQENMKMSSITTRGPPADLDVDVKVIGWDAMIR  120

Query  141  VQSENANYPSAKLMNGLRELELAVHHASISSVNDI  37
            VQ    ++P+A+LM  + EL+L VHHAS+S VN++
Sbjct  121  VQCNKMSHPAARLMTAMMELDLEVHHASVSVVNEL  155



>ref|XP_011081344.1| PREDICTED: transcription factor MYC2-like [Sesamum indicum]
Length=469

 Score =   162 bits (410),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 93/168 (55%), Positives = 118/168 (70%), Gaps = 12/168 (7%)
 Frame = -2

Query  489  KKRGRKP-GAGR---VTPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVS  322
            +KR R     GR   +TP NHVEAERQRREKLN RFYALRS+VPNVSRMDKASLL+DAV+
Sbjct  278  RKRARNSENVGRNQLMTPANHVEAERQRREKLNQRFYALRSIVPNVSRMDKASLLADAVT  337

Query  321  YINELKGKVEELE--CQLQ-LRESKKVKVEAVGDNQstssaassvaSP-----VDVEVKI  166
            YI ELK K+  LE  C+++ L++  +  +  + D +ST S      S      +DVEVKI
Sbjct  338  YIKELKAKISGLEAKCRVESLKQEPRTGLLEMYDTKSTFSTVDFTRSASGCVIMDVEVKI  397

Query  165  VGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQDI  22
            +G +AMIRVQS + NYP A+LMN L +LE  + HAS+SSV D+M QD+
Sbjct  398  LGSEAMIRVQSPDVNYPCARLMNVLGDLEFQISHASVSSVRDVMFQDV  445



>gb|AEB35640.1| MYC2, partial [Helianthus annuus]
 gb|AEB35654.1| MYC2, partial [Helianthus annuus]
 gb|AEB35662.1| MYC2, partial [Helianthus annuus]
Length=155

 Score =   154 bits (389),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 84/155 (54%), Positives = 109/155 (70%), Gaps = 8/155 (5%)
 Frame = -2

Query  477  RKPGAGRVTPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYINELKGK  298
            RKP  GR  P+NHVEAERQRREKLN RFYALR+VVPNVS+MDKASLL DA+ YINELK K
Sbjct  1    RKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAILYINELKAK  60

Query  297  VE-------ELECQLQ-LRESKKVKVEAVGDNQstssaassvaSPVDVEVKIVGPDAMIR  142
            +E       EL  Q+  L++    KV A  + + +S       + +DV+VK++G DAMIR
Sbjct  61   LENNEGNKDELRNQIDALKKELSNKVSAQENMKMSSXTTRGPPADLDVDVKVIGWDAMIR  120

Query  141  VQSENANYPSAKLMNGLRELELAVHHASISSVNDI  37
            VQ    ++P+A+LM  + EL+L VHHAS+S VN++
Sbjct  121  VQCNKXSHPAARLMTAMMELDLEVHHASVSVVNEL  155



>gb|AEB35703.1| MYC2, partial [Helianthus annuus]
Length=155

 Score =   154 bits (389),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 84/155 (54%), Positives = 109/155 (70%), Gaps = 8/155 (5%)
 Frame = -2

Query  477  RKPGAGRVTPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYINELKGK  298
            RKP  GR  P+NHVEAERQRREKLN RFYALR+VVPNVS+MDKASLL DA+ YINELK K
Sbjct  1    RKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAILYINELKAK  60

Query  297  VE-------ELECQLQ-LRESKKVKVEAVGDNQstssaassvaSPVDVEVKIVGPDAMIR  142
            +E       EL  Q+  L++    KV A  + + +S       + +DV+VK++G DAMIR
Sbjct  61   LENNEGNKDELRNQIDALKKELSNKVSAQENMKMSSVTTRGPPADLDVDVKVIGWDAMIR  120

Query  141  VQSENANYPSAKLMNGLRELELAVHHASISSVNDI  37
            VQ    ++P+A+LM  + EL+L VHHAS+S VN++
Sbjct  121  VQCNKXSHPAARLMTAMMELDLEVHHASVSVVNEL  155



>gb|AEB35671.1| MYC2, partial [Helianthus annuus]
Length=155

 Score =   154 bits (389),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 84/155 (54%), Positives = 109/155 (70%), Gaps = 8/155 (5%)
 Frame = -2

Query  477  RKPGAGRVTPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYINELKGK  298
            RKP  GR  P+NHVEAERQRREKLN RFYALR+VVPNVS+MDKASLL DA+ YINELK K
Sbjct  1    RKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAILYINELKAK  60

Query  297  VE-------ELECQLQ-LRESKKVKVEAVGDNQstssaassvaSPVDVEVKIVGPDAMIR  142
            +E       EL  Q+  L++    KV A  + + +S       + +DV+VK++G DAMIR
Sbjct  61   LENNEXNKDELRNQIDALKKELSNKVSAQENMKMSSVTTRGPPADLDVDVKVIGWDAMIR  120

Query  141  VQSENANYPSAKLMNGLRELELAVHHASISSVNDI  37
            VQ    ++P+A+LM  + EL+L VHHAS+S VN++
Sbjct  121  VQCNKKSHPAARLMTAMMELDLEVHHASVSVVNEL  155



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 682974011750