BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF011C12

Length=806
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KDO75234.1|  hypothetical protein CISIN_1g015465mg                   364   1e-121   Citrus sinensis [apfelsine]
ref|XP_006468322.1|  PREDICTED: obg-like ATPase 1-like                  364   3e-121   Citrus sinensis [apfelsine]
ref|XP_006448884.1|  hypothetical protein CICLE_v10015175mg             364   3e-121   
ref|XP_006448885.1|  hypothetical protein CICLE_v10015175mg             365   1e-120   
gb|KDP34925.1|  hypothetical protein JCGZ_09213                         360   7e-120   Jatropha curcas
ref|XP_004293982.1|  PREDICTED: obg-like ATPase 1                       358   8e-119   Fragaria vesca subsp. vesca
gb|EYU43227.1|  hypothetical protein MIMGU_mgv1a007827mg                357   1e-118   Erythranthe guttata [common monkey flower]
ref|XP_003546267.1|  PREDICTED: obg-like ATPase 1-like                  357   2e-118   Glycine max [soybeans]
ref|NP_001242520.1|  uncharacterized protein LOC100793501               357   2e-118   Glycine max [soybeans]
ref|XP_010499597.1|  PREDICTED: obg-like ATPase 1                       356   3e-118   Camelina sativa [gold-of-pleasure]
ref|XP_010478480.1|  PREDICTED: obg-like ATPase 1                       356   3e-118   Camelina sativa [gold-of-pleasure]
emb|CDP17295.1|  unnamed protein product                                356   3e-118   Coffea canephora [robusta coffee]
ref|XP_007211399.1|  hypothetical protein PRUPE_ppa006821mg             356   3e-118   Prunus persica
ref|XP_010460862.1|  PREDICTED: obg-like ATPase 1                       356   4e-118   Camelina sativa [gold-of-pleasure]
ref|XP_008225608.1|  PREDICTED: obg-like ATPase 1                       355   6e-118   Prunus mume [ume]
ref|XP_002263885.1|  PREDICTED: obg-like ATPase 1                       355   8e-118   Vitis vinifera
ref|XP_002893634.1|  GTP binding protein                                355   1e-117   Arabidopsis lyrata subsp. lyrata
ref|XP_009362223.1|  PREDICTED: obg-like ATPase 1                       354   1e-117   Pyrus x bretschneideri [bai li]
ref|XP_011085197.1|  PREDICTED: obg-like ATPase 1                       354   2e-117   Sesamum indicum [beniseed]
ref|XP_008383389.1|  PREDICTED: obg-like ATPase 1                       354   2e-117   Malus domestica [apple tree]
ref|XP_010051911.1|  PREDICTED: obg-like ATPase 1                       353   4e-117   Eucalyptus grandis [rose gum]
ref|XP_004231561.1|  PREDICTED: obg-like ATPase 1                       353   4e-117   Solanum lycopersicum
ref|XP_002523184.1|  GTP-dependent nucleic acid-binding protein e...    353   5e-117   Ricinus communis
ref|XP_006305006.1|  hypothetical protein CARUB_v10009370mg             353   5e-117   Capsella rubella
ref|XP_010098556.1|  Obg-like ATPase 1                                  353   6e-117   Morus notabilis
ref|NP_174346.1|  GTP-binding protein                                   353   7e-117   Arabidopsis thaliana [mouse-ear cress]
gb|AAF65513.1|  GTP-binding protein                                     353   7e-117   Capsicum annuum
ref|XP_008372236.1|  PREDICTED: obg-like ATPase 1                       352   1e-116   Malus domestica [apple tree]
ref|XP_010245345.1|  PREDICTED: obg-like ATPase 1                       352   1e-116   Nelumbo nucifera [Indian lotus]
ref|XP_007147477.1|  hypothetical protein PHAVU_006G127800g             351   2e-116   Phaseolus vulgaris [French bean]
ref|XP_011037748.1|  PREDICTED: obg-like ATPase 1                       351   2e-116   Populus euphratica
gb|AAM63059.1|  putative GTP-binding protein                            351   4e-116   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006377958.1|  hypothetical protein POPTR_0011s16690g             350   6e-116   Populus trichocarpa [western balsam poplar]
gb|KJB69090.1|  hypothetical protein B456_011G005000                    349   6e-116   Gossypium raimondii
ref|XP_010926935.1|  PREDICTED: obg-like ATPase 1                       350   7e-116   Elaeis guineensis
ref|XP_006360314.1|  PREDICTED: obg-like ATPase 1-like                  350   7e-116   Solanum tuberosum [potatoes]
gb|KJB69089.1|  hypothetical protein B456_011G005000                    350   8e-116   Gossypium raimondii
gb|KFK44867.1|  hypothetical protein AALP_AA1G312800                    350   1e-115   Arabis alpina [alpine rockcress]
ref|XP_009803590.1|  PREDICTED: obg-like ATPase 1                       349   1e-115   Nicotiana sylvestris
gb|KHF97630.1|  Obg-like ATPase 1                                       349   2e-115   Gossypium arboreum [tree cotton]
ref|XP_009412029.1|  PREDICTED: obg-like ATPase 1                       349   2e-115   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011039799.1|  PREDICTED: obg-like ATPase 1                       349   2e-115   Populus euphratica
emb|CDY12460.1|  BnaC08g09490D                                          349   2e-115   Brassica napus [oilseed rape]
ref|XP_006415450.1|  hypothetical protein EUTSA_v10007733mg             349   3e-115   
ref|XP_002300568.1|  hypothetical protein POPTR_0001s47010g             348   3e-115   Populus trichocarpa [western balsam poplar]
ref|XP_009107765.1|  PREDICTED: obg-like ATPase 1                       348   4e-115   Brassica rapa
ref|XP_010519060.1|  PREDICTED: obg-like ATPase 1                       348   5e-115   Tarenaya hassleriana [spider flower]
ref|XP_009603694.1|  PREDICTED: obg-like ATPase 1 {ECO:0000255|HA...    348   5e-115   Nicotiana tomentosiformis
emb|CDX77584.1|  BnaA07g07220D                                          347   9e-115   
ref|XP_009144765.1|  PREDICTED: obg-like ATPase 1                       347   1e-114   Brassica rapa
emb|CDX98216.1|  BnaC07g08820D                                          347   1e-114   
ref|NP_001061206.2|  Os08g0199300                                       346   3e-114   
ref|XP_010538270.1|  PREDICTED: obg-like ATPase 1                       345   6e-114   Tarenaya hassleriana [spider flower]
ref|XP_008799072.1|  PREDICTED: obg-like ATPase 1                       345   8e-114   Phoenix dactylifera
gb|EEC83063.1|  hypothetical protein OsI_28170                          344   1e-113   Oryza sativa Indica Group [Indian rice]
ref|XP_007022926.1|  GTP binding                                        343   2e-113   Theobroma cacao [chocolate]
ref|XP_004486463.1|  PREDICTED: obg-like ATPase 1-like                  343   3e-113   Cicer arietinum [garbanzo]
gb|AFK48623.1|  unknown                                                 343   4e-113   Lotus japonicus
ref|XP_008445378.1|  PREDICTED: obg-like ATPase 1                       342   7e-113   Cucumis melo [Oriental melon]
ref|XP_006659204.1|  PREDICTED: obg-like ATPase 1-like                  342   1e-112   Oryza brachyantha
ref|XP_003573525.1|  PREDICTED: obg-like ATPase 1                       342   1e-112   Brachypodium distachyon [annual false brome]
gb|ACJ85184.1|  unknown                                                 342   1e-112   Medicago truncatula
ref|XP_003594539.1|  Obg-like ATPase                                    342   1e-112   Medicago truncatula
ref|XP_010687083.1|  PREDICTED: obg-like ATPase 1                       341   3e-112   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010941555.1|  PREDICTED: obg-like ATPase 1                       340   4e-112   
ref|XP_004135546.1|  PREDICTED: obg-like ATPase 1-like                  340   8e-112   Cucumis sativus [cucumbers]
gb|ABK25108.1|  unknown                                                 339   2e-111   Picea sitchensis
gb|AFK49195.1|  unknown                                                 338   3e-111   Medicago truncatula
ref|NP_001150211.1|  GTP-binding protein PTD004                         338   5e-111   Zea mays [maize]
ref|XP_002445191.1|  hypothetical protein SORBIDRAFT_07g005700          338   6e-111   Sorghum bicolor [broomcorn]
ref|XP_004972629.1|  PREDICTED: obg-like ATPase 1-like                  337   7e-111   Setaria italica
ref|XP_009115125.1|  PREDICTED: obg-like ATPase 1                       331   2e-108   Brassica rapa
emb|CDY02308.1|  BnaA09g25940D                                          330   5e-108   
emb|CDY09558.1|  BnaC05g23610D                                          330   8e-108   Brassica napus [oilseed rape]
emb|CDM85617.1|  unnamed protein product                                329   1e-107   Triticum aestivum [Canadian hard winter wheat]
gb|EMS48297.1|  Obg-like ATPase 1                                       324   1e-105   Triticum urartu
ref|XP_001776504.1|  predicted protein                                  323   3e-105   
gb|EMT28525.1|  Obg-like ATPase 1                                       323   4e-105   
gb|AFW56959.1|  hypothetical protein ZEAMMB73_810066                    303   7e-101   
ref|XP_011015196.1|  PREDICTED: obg-like ATPase 1                       305   2e-98    Populus euphratica
ref|XP_002985543.1|  hypothetical protein SELMODRAFT_234816             303   2e-97    Selaginella moellendorffii
gb|KDO75236.1|  hypothetical protein CISIN_1g015465mg                   303   3e-97    Citrus sinensis [apfelsine]
gb|AAP43929.1|  GTP-binding protein                                     280   1e-90    Triticum aestivum [Canadian hard winter wheat]
ref|XP_001699763.1|  flagellar associated protein                       284   6e-90    Chlamydomonas reinhardtii
ref|XP_006845996.1|  hypothetical protein AMTR_s00155p00052120          275   9e-90    
ref|XP_008812127.1|  PREDICTED: obg-like ATPase 1                       283   2e-89    
ref|XP_002953429.1|  hypothetical protein VOLCADRAFT_105955             282   3e-89    Volvox carteri f. nagariensis
gb|AFW56960.1|  hypothetical protein ZEAMMB73_810066                    275   5e-87    
gb|KDO75237.1|  hypothetical protein CISIN_1g015465mg                   273   2e-86    Citrus sinensis [apfelsine]
ref|XP_005847323.1|  hypothetical protein CHLNCDRAFT_56178              271   3e-85    Chlorella variabilis
ref|XP_005650863.1|  flagellar associated protein                       271   5e-85    Coccomyxa subellipsoidea C-169
ref|XP_003064009.1|  predicted protein                                  270   1e-84    Micromonas pusilla CCMP1545
ref|XP_001421839.1|  predicted protein                                  270   1e-84    Ostreococcus lucimarinus CCE9901
gb|KDD75506.1|  DUF933 hypothetical protein                             270   2e-84    Helicosporidium sp. ATCC 50920
ref|XP_011395756.1|  Obg-like ATPase 1                                  265   3e-83    Auxenochlorella protothecoides
gb|EPS62769.1|  hypothetical protein M569_12020                         255   5e-82    Genlisea aurea
gb|KJB69091.1|  hypothetical protein B456_011G005000                    260   4e-81    Gossypium raimondii
emb|CEG00523.1|  P-loop containing nucleoside triphosphate hydrolase    260   1e-80    Ostreococcus tauri
ref|XP_002502254.1|  predicted protein                                  257   1e-79    Micromonas commoda
gb|EMS48298.1|  Obg-like ATPase 1                                       250   3e-77    Triticum urartu
ref|XP_003083821.1|  GTP-binding protein (ISS)                          261   3e-77    
ref|XP_010736093.1|  PREDICTED: obg-like ATPase 1 isoform X2            245   8e-77    
ref|XP_003388006.1|  PREDICTED: obg-like ATPase 1                       251   9e-77    Amphimedon queenslandica
ref|XP_005703761.1|  GTP-binding protein                                250   9e-77    Galdieria sulphuraria
ref|XP_005452977.1|  PREDICTED: obg-like ATPase 1-like isoform X8       245   1e-76    Oreochromis niloticus
ref|XP_011488091.1|  PREDICTED: obg-like ATPase 1                       244   2e-76    
ref|XP_008116321.1|  PREDICTED: obg-like ATPase 1 isoform X3            243   3e-76    Anolis carolinensis [Carolina anole]
ref|XP_005452976.1|  PREDICTED: obg-like ATPase 1-like isoform X7       244   6e-76    Oreochromis niloticus
ref|XP_010192575.1|  PREDICTED: obg-like ATPase 1                       241   7e-76    Mesitornis unicolor
ref|XP_005019763.1|  PREDICTED: obg-like ATPase 1                       242   1e-75    
ref|XP_004601224.1|  PREDICTED: obg-like ATPase 1 isoform X3            241   1e-75    Sorex araneus [Eurasian shrew]
ref|XP_004703789.1|  PREDICTED: obg-like ATPase 1 isoform X3            241   2e-75    Echinops telfairi [lesser hedgehog tenrec]
ref|XP_009490257.1|  PREDICTED: obg-like ATPase 1                       241   2e-75    Pelecanus crispus
ref|XP_008533775.1|  PREDICTED: obg-like ATPase 1                       240   2e-75    Equus przewalskii [Przewalski horse]
gb|AAY14876.1|  unknown                                                 240   2e-75    Homo sapiens [man]
ref|XP_005452975.1|  PREDICTED: obg-like ATPase 1-like isoform X6       244   3e-75    
ref|XP_005519867.1|  PREDICTED: obg-like ATPase 1 isoform X4            242   3e-75    
ref|XP_004092018.1|  PREDICTED: obg-like ATPase 1 isoform 2             240   4e-75    Nomascus leucogenys [White-cheeked Gibbon]
ref|XP_009581765.1|  PREDICTED: obg-like ATPase 1                       241   4e-75    Fulmarus glacialis
ref|XP_010116935.1|  PREDICTED: obg-like ATPase 1                       241   4e-75    Chlamydotis macqueenii
ref|XP_009086253.1|  PREDICTED: obg-like ATPase 1 isoform X2            241   5e-75    
gb|EPY26360.1|  GTP binding protein                                     239   5e-75    Angomonas deanei
ref|XP_005442958.1|  PREDICTED: obg-like ATPase 1                       241   5e-75    
ref|XP_010162756.1|  PREDICTED: obg-like ATPase 1                       241   5e-75    Antrostomus carolinensis
ref|XP_008929287.1|  PREDICTED: obg-like ATPase 1                       241   5e-75    
ref|XP_010073941.1|  PREDICTED: obg-like ATPase 1                       241   6e-75    Pterocles gutturalis
ref|XP_004878683.1|  PREDICTED: obg-like ATPase 1-like                  240   6e-75    
ref|NP_001011708.1|  obg-like ATPase 1 isoform 2                        240   6e-75    Homo sapiens [man]
ref|XP_004426695.1|  PREDICTED: obg-like ATPase 1 isoform 3             240   6e-75    
gb|KFP49878.1|  Obg-like ATPase 1                                       241   6e-75    Cathartes aura
ref|XP_004220982.1|  GTP-binding protein                                245   6e-75    Plasmodium cynomolgi strain B
ref|XP_003961956.1|  PREDICTED: obg-like ATPase 1-like                  245   7e-75    Takifugu rubripes [tiger puffer]
emb|CAG09966.1|  unnamed protein product                                243   7e-75    Tetraodon nigroviridis
ref|XP_007938961.1|  PREDICTED: obg-like ATPase 1 isoform X2            240   7e-75    Orycteropus afer afer
gb|AAF71123.1|AF116721_103  PRO2455                                     240   7e-75    Homo sapiens [man]
ref|XP_009276861.1|  PREDICTED: obg-like ATPase 1                       241   8e-75    Aptenodytes forsteri
ref|XP_005921550.1|  PREDICTED: obg-like ATPase 1-like isoform X4       241   8e-75    Haplochromis burtoni
gb|KFV04274.1|  Obg-like ATPase 1                                       241   9e-75    Tauraco erythrolophus
ref|XP_007527278.1|  PREDICTED: obg-like ATPase 1 isoform X2            239   1e-74    Erinaceus europaeus [common hedgehog]
ref|XP_007431000.1|  PREDICTED: obg-like ATPase 1-like isoform X3       243   1e-74    
ref|XP_004267373.1|  PREDICTED: obg-like ATPase 1 isoform 2             239   1e-74    Orcinus orca [Orca]
ref|XP_009977093.1|  PREDICTED: obg-like ATPase 1                       241   1e-74    Tauraco erythrolophus
ref|XP_005452974.1|  PREDICTED: obg-like ATPase 1-like isoform X5       243   1e-74    Oreochromis niloticus
ref|XP_007451127.1|  PREDICTED: obg-like ATPase 1 isoform X2            239   2e-74    Lipotes vexillifer [baiji]
gb|EHA99193.1|  Obg-like ATPase 1                                       240   2e-74    Heterocephalus glaber [naked mole rat]
ref|XP_668381.1|  GTP-binding protein                                   244   2e-74    Cryptosporidium hominis TU502
ref|XP_628099.1|  yyaF/YCHF TRANSFAC/OBG family small GTpase plus...    244   3e-74    Cryptosporidium parvum Iowa II
gb|KFZ54967.1|  Obg-like ATPase 1                                       241   3e-74    Antrostomus carolinensis
ref|XP_008818190.1|  GTP-binding protein YchF                           243   3e-74    Plasmodium inui San Antonio 1
ref|XP_009236113.1|  PREDICTED: obg-like ATPase 1 isoform X2            238   3e-74    
ref|XP_008136766.1|  PREDICTED: obg-like ATPase 1 isoform X2            238   3e-74    Eptesicus fuscus
ref|XP_005484131.1|  PREDICTED: obg-like ATPase 1                       239   3e-74    
ref|XP_009932339.1|  PREDICTED: obg-like ATPase 1                       239   3e-74    Opisthocomus hoazin [hoatzin]
ref|XP_010605332.1|  PREDICTED: obg-like ATPase 1 isoform X2            240   4e-74    Fukomys damarensis [Damara mole rat]
gb|AEB61109.1|  obg-like ATPase 1-like protein                          239   4e-74    Equus caballus [domestic horse]
ref|XP_010736092.1|  PREDICTED: obg-like ATPase 1 isoform X1            243   5e-74    Larimichthys crocea [croceine croaker]
ref|XP_009330922.1|  PREDICTED: obg-like ATPase 1 isoform X1            239   6e-74    Pygoscelis adeliae
ref|XP_010878192.1|  PREDICTED: obg-like ATPase 1 isoform X4            243   6e-74    
ref|XP_006866714.1|  PREDICTED: obg-like ATPase 1 isoform X2            238   6e-74    Chrysochloris asiatica
ref|XP_007430999.1|  PREDICTED: obg-like ATPase 1-like isoform X2       243   6e-74    Python bivittatus
ref|XP_010878191.1|  PREDICTED: obg-like ATPase 1 isoform X3            243   6e-74    Esox lucius
ref|XP_004757606.1|  PREDICTED: obg-like ATPase 1-like                  237   7e-74    
ref|XP_003447358.1|  PREDICTED: obg-like ATPase 1-like isoform X1       242   7e-74    
ref|XP_010878190.1|  PREDICTED: obg-like ATPase 1 isoform X2            243   8e-74    Esox lucius
ref|XP_001515633.1|  PREDICTED: obg-like ATPase 1 isoform X1            242   8e-74    Ornithorhynchus anatinus [duck-billed platypus]
ref|XP_010878189.1|  PREDICTED: obg-like ATPase 1 isoform X1            243   8e-74    Esox lucius
ref|XP_001368232.1|  PREDICTED: Obg-like ATPase 1                       242   8e-74    Monodelphis domestica
ref|XP_007430998.1|  PREDICTED: obg-like ATPase 1-like isoform X1       242   9e-74    Python bivittatus
ref|XP_005452973.1|  PREDICTED: obg-like ATPase 1-like isoform X4       242   9e-74    Oreochromis niloticus
ref|XP_008116320.1|  PREDICTED: obg-like ATPase 1 isoform X2            242   1e-73    Anolis carolinensis [Carolina anole]
ref|XP_005723778.1|  PREDICTED: obg-like ATPase 1-like                  242   1e-73    Pundamilia nyererei
ref|XP_003442972.1|  PREDICTED: obg-like ATPase 1-like                  242   1e-73    Oreochromis niloticus
ref|XP_005510535.1|  PREDICTED: obg-like ATPase 1-like                  241   1e-73    
ref|XP_003764019.1|  PREDICTED: obg-like ATPase 1                       242   1e-73    Sarcophilus harrisii
ref|XP_006744648.1|  PREDICTED: obg-like ATPase 1 isoform X2            239   1e-73    Leptonychotes weddellii
ref|NP_001026425.1|  obg-like ATPase 1                                  241   1e-73    Gallus gallus [bantam]
ref|XP_009952424.1|  PREDICTED: obg-like ATPase 1                       238   2e-73    Leptosomus discolor
emb|CEG70465.1|  Putative Obg-like ATPase 1                             241   2e-73    Rhizopus microsporus
ref|XP_006798459.1|  PREDICTED: obg-like ATPase 1-like                  241   2e-73    Neolamprologus brichardi [lyretail cichlid]
ref|XP_005452972.1|  PREDICTED: obg-like ATPase 1-like isoform X3       242   2e-73    
gb|ETE71660.1|  Obg-like ATPase 1                                       240   2e-73    Ophiophagus hannah
ref|XP_006788528.1|  PREDICTED: obg-like ATPase 1-like                  241   3e-73    Neolamprologus brichardi [lyretail cichlid]
ref|XP_004557802.1|  PREDICTED: obg-like ATPase 1-like isoform X2       239   3e-73    Maylandia zebra
ref|XP_008297045.1|  PREDICTED: obg-like ATPase 1                       241   3e-73    Stegastes partitus
ref|XP_005723547.1|  PREDICTED: obg-like ATPase 1-like isoform X4       239   3e-73    
ref|XP_004786306.1|  PREDICTED: obg-like ATPase 1-like                  236   3e-73    
ref|XP_006003587.1|  PREDICTED: obg-like ATPase 1 isoform X1            241   3e-73    Latimeria chalumnae
gb|EDL27121.1|  RIKEN cDNA 2810409H07, isoform CRA_a                    238   3e-73    Mus musculus [mouse]
ref|XP_006003588.1|  PREDICTED: obg-like ATPase 1 isoform X2            241   3e-73    Latimeria chalumnae
gb|KFO14346.1|  Obg-like ATPase 1                                       239   3e-73    Balearica regulorum gibbericeps
ref|XP_005723546.1|  PREDICTED: obg-like ATPase 1-like isoform X3       239   3e-73    Pundamilia nyererei
ref|XP_003225685.1|  PREDICTED: obg-like ATPase 1 isoform X1            241   4e-73    Anolis carolinensis [Carolina anole]
gb|ETW37410.1|  GTP-binding protein YchF                                239   4e-73    Plasmodium falciparum Tanzania (2000708)
gb|EWC89308.1|  GTP-binding protein YchF                                239   4e-73    Plasmodium falciparum NF54
gb|ETW39419.1|  GTP-binding protein YchF                                239   4e-73    Plasmodium falciparum NF135/5.C10
emb|CDQ57167.1|  unnamed protein product                                241   4e-73    Oncorhynchus mykiss
gb|KFW10028.1|  Obg-like ATPase 1                                       239   4e-73    Fulmarus glacialis
gb|ETW50152.1|  GTP-binding protein YchF                                239   5e-73    Plasmodium falciparum MaliPS096_E11
ref|XP_005798398.1|  PREDICTED: obg-like ATPase 1-like                  240   5e-73    Xiphophorus maculatus
gb|KFM07037.1|  Obg-like ATPase 1                                       239   5e-73    Aptenodytes forsteri
ref|XP_006636567.1|  PREDICTED: obg-like ATPase 1-like isoform X2       239   5e-73    
gb|ETW28438.1|  GTP-binding protein YchF                                240   6e-73    Plasmodium falciparum FCH/4
gb|KFV08740.1|  Obg-like ATPase 1                                       239   6e-73    Pterocles gutturalis
gb|KFP41102.1|  Obg-like ATPase 1                                       239   6e-73    Chlamydotis macqueenii
ref|XP_005452971.1|  PREDICTED: obg-like ATPase 1-like isoform X2       242   6e-73    
gb|KFH07802.1|  putative GTP-binding protein                            233   7e-73    Toxoplasma gondii VAND
ref|XP_002261143.1|  GTP-binding protein                                240   7e-73    Plasmodium knowlesi strain H
gb|KFW86891.1|  Obg-like ATPase 1                                       239   8e-73    Manacus vitellinus
ref|XP_008275154.1|  PREDICTED: obg-like ATPase 1                       239   9e-73    Stegastes partitus
ref|XP_007576845.1|  PREDICTED: obg-like ATPase 1                       239   9e-73    Poecilia formosa
ref|XP_005237197.1|  PREDICTED: obg-like ATPase 1                       239   1e-72    
ref|XP_004774421.1|  PREDICTED: obg-like ATPase 1-like isoform X2       238   1e-72    Mustela putorius furo [black ferret]
ref|XP_008565607.1|  PREDICTED: obg-like ATPase 1                       238   1e-72    Galeopterus variegatus [Malayan flying lemur]
gb|EPY25232.1|  GTP binding protein                                     233   1e-72    Angomonas deanei
ref|XP_008397950.1|  PREDICTED: obg-like ATPase 1                       239   2e-72    Poecilia reticulata
ref|XP_002198993.1|  PREDICTED: obg-like ATPase 1 isoform 1             239   2e-72    Taeniopygia guttata
ref|XP_004703787.1|  PREDICTED: obg-like ATPase 1 isoform X1            239   2e-72    Echinops telfairi [lesser hedgehog tenrec]
ref|XP_005519864.1|  PREDICTED: obg-like ATPase 1 isoform X1            239   2e-72    
ref|XP_001349125.1|  conserved GTP-binding protein, putative            239   2e-72    Plasmodium falciparum 3D7
ref|XP_009070315.1|  PREDICTED: obg-like ATPase 1                       239   2e-72    Acanthisitta chloris
ref|XP_004601222.1|  PREDICTED: obg-like ATPase 1 isoform X1            239   2e-72    Sorex araneus [Eurasian shrew]
ref|XP_005049114.1|  PREDICTED: obg-like ATPase 1                       239   2e-72    Ficedula albicollis
ref|XP_005799467.1|  PREDICTED: obg-like ATPase 1-like                  239   2e-72    
ref|XP_005723544.1|  PREDICTED: obg-like ATPase 1-like isoform X1       239   2e-72    Pundamilia nyererei
ref|XP_005723545.1|  PREDICTED: obg-like ATPase 1-like isoform X2       239   2e-72    
ref|XP_004557801.1|  PREDICTED: obg-like ATPase 1-like isoform X1       239   2e-72    Maylandia zebra
gb|KFH16391.1|  putative GTP-binding protein                            233   2e-72    Toxoplasma gondii MAS
gb|EPY39657.1|  GTP binding protein                                     238   2e-72    Angomonas deanei
ref|XP_007546548.1|  PREDICTED: obg-like ATPase 1                       238   2e-72    Poecilia formosa
ref|XP_009680050.1|  PREDICTED: obg-like ATPase 1                       238   3e-72    Struthio camelus australis
ref|XP_009639084.1|  PREDICTED: obg-like ATPase 1                       238   3e-72    Egretta garzetta
ref|XP_005152654.1|  PREDICTED: obg-like ATPase 1                       238   3e-72    Melopsittacus undulatus
ref|XP_010564826.1|  PREDICTED: obg-like ATPase 1                       238   3e-72    Haliaeetus leucocephalus
ref|XP_008933239.1|  PREDICTED: obg-like ATPase 1                       238   3e-72    Merops nubicus
ref|XP_001612801.1|  GTP-binding protein                                238   3e-72    Plasmodium vivax
gb|KFR10255.1|  Obg-like ATPase 1                                       237   4e-72    Opisthocomus hoazin [hoatzin]
ref|NP_001268915.1|  obg-like ATPase 1 isoform 2                        236   4e-72    Danio rerio [leopard danio]
ref|XP_006878885.1|  PREDICTED: obg-like ATPase 1-like                  238   4e-72    Elephantulus edwardii [Cape long-eared elephant shrew]
emb|CEI96573.1|  Putative Obg-like ATPase 1                             238   4e-72    Rhizopus microsporus
emb|CDO63681.1|  GTP-binding protein, putative                          238   5e-72    Plasmodium reichenowi
ref|XP_006636566.1|  PREDICTED: obg-like ATPase 1-like isoform X1       238   5e-72    Lepisosteus oculatus
ref|XP_010988428.1|  PREDICTED: obg-like ATPase 1                       238   5e-72    Camelus dromedarius [camel]
gb|AIC56285.1|  OLA1                                                    238   6e-72    synthetic construct
gb|EPY23726.1|  GTP binding protein                                     233   6e-72    Strigomonas culicis
ref|XP_004476856.1|  PREDICTED: obg-like ATPase 1 isoform 2             238   6e-72    Dasypus novemcinctus
ref|XP_003253776.1|  PREDICTED: obg-like ATPase 1 isoform 1             238   6e-72    Nomascus leucogenys [White-cheeked Gibbon]
ref|XP_004476855.1|  PREDICTED: obg-like ATPase 1 isoform 1             238   6e-72    
ref|XP_010605331.1|  PREDICTED: obg-like ATPase 1 isoform X1            238   6e-72    Fukomys damarensis [Damara mole rat]
ref|XP_005573571.1|  PREDICTED: uncharacterized LOC101926459 isof...    238   6e-72    Macaca fascicularis [crab eating macaque]
ref|XP_004674578.1|  PREDICTED: obg-like ATPase 1 isoform X1            237   6e-72    Condylura cristata
ref|XP_008685352.1|  PREDICTED: obg-like ATPase 1                       237   6e-72    Ursus maritimus [white bear]
ref|XP_006972493.1|  PREDICTED: obg-like ATPase 1                       237   6e-72    Peromyscus maniculatus bairdii
ref|XP_010356768.1|  PREDICTED: obg-like ATPase 1 isoform X1            237   7e-72    Rhinopithecus roxellana
gb|KFO22378.1|  Obg-like ATPase 1                                       237   7e-72    Fukomys damarensis [Damara mole rat]
ref|XP_004857751.1|  PREDICTED: obg-like ATPase 1-like                  237   7e-72    Heterocephalus glaber [naked mole rat]
ref|XP_001499403.1|  PREDICTED: Obg-like ATPase 1 isoformX1             237   7e-72    Equus caballus [domestic horse]
ref|XP_008996931.1|  PREDICTED: obg-like ATPase 1 isoform X1            237   7e-72    
ref|XP_008853504.1|  PREDICTED: obg-like ATPase 1                       237   7e-72    Nannospalax galili
ref|XP_011355667.1|  PREDICTED: obg-like ATPase 1 isoform X1            237   7e-72    Pteropus vampyrus
ref|XP_005907299.1|  PREDICTED: obg-like ATPase 1                       237   7e-72    Bos mutus
ref|XP_004426693.1|  PREDICTED: obg-like ATPase 1 isoform 1             237   7e-72    Ceratotherium simum simum [southern square-lipped rhinoceros]
ref|XP_004092019.1|  PREDICTED: obg-like ATPase 1 isoform 3             238   7e-72    Nomascus leucogenys [White-cheeked Gibbon]
ref|NP_037473.3|  obg-like ATPase 1 isoform 1                           237   7e-72    Homo sapiens [man]
gb|KFH65596.1|  GTP-binding protein YchF                                237   8e-72    Mortierella verticillata NRRL 6337
gb|EPQ02313.1|  Obg-like ATPase 1                                       236   8e-72    Myotis brandtii
ref|XP_005300474.1|  PREDICTED: obg-like ATPase 1 isoform X1            238   8e-72    Chrysemys picta bellii
ref|XP_003406265.1|  PREDICTED: obg-like ATPase 1                       237   8e-72    Loxodonta africana [African bush elephant]
gb|AAD44500.1|  homologous yeast-44.2 protein                           237   8e-72    Homo sapiens [man]
dbj|BAB55174.1|  unnamed protein product                                237   8e-72    Homo sapiens [man]
ref|NP_001039510.1|  obg-like ATPase 1                                  237   9e-72    Bos taurus [bovine]
ref|XP_004634805.1|  PREDICTED: obg-like ATPase 1 isoform X1            237   9e-72    Octodon degus
ref|XP_004032861.1|  PREDICTED: obg-like ATPase 1-like isoform 1        237   9e-72    Gorilla gorilla gorilla [lowland gorilla]
ref|XP_007527277.1|  PREDICTED: obg-like ATPase 1 isoform X1            237   9e-72    Erinaceus europaeus [common hedgehog]
ref|XP_004267372.1|  PREDICTED: obg-like ATPase 1 isoform 1             237   9e-72    Orcinus orca [Orca]
ref|XP_006275602.1|  PREDICTED: obg-like ATPase 1-like isoform X2       237   1e-71    Alligator mississippiensis
ref|XP_005676004.1|  PREDICTED: obg-like ATPase 1                       237   1e-71    
ref|XP_007060593.1|  PREDICTED: obg-like ATPase 1                       237   1e-71    
ref|XP_006275601.1|  PREDICTED: obg-like ATPase 1-like isoform X1       238   1e-71    
ref|XP_005300475.1|  PREDICTED: obg-like ATPase 1 isoform X2            237   1e-71    Chrysemys picta bellii
ref|XP_004004627.1|  PREDICTED: obg-like ATPase 1                       238   1e-71    
ref|XP_005300476.1|  PREDICTED: obg-like ATPase 1 isoform X3            237   1e-71    
ref|XP_007183357.1|  PREDICTED: obg-like ATPase 1                       237   1e-71    
ref|XP_007963584.1|  PREDICTED: obg-like ATPase 1 isoform X1            238   1e-71    
ref|XP_003478641.1|  PREDICTED: obg-like ATPase 1                       237   1e-71    
ref|XP_007451126.1|  PREDICTED: obg-like ATPase 1 isoform X1            237   1e-71    
ref|XP_004032863.1|  PREDICTED: obg-like ATPase 1-like isoform 3        237   1e-71    
ref|XP_008326509.1|  PREDICTED: obg-like ATPase 1 isoform X1            237   1e-71    
ref|XP_010747153.1|  PREDICTED: obg-like ATPase 1                       237   1e-71    
ref|XP_003474516.1|  PREDICTED: obg-like ATPase 1-like                  236   1e-71    
gb|EHH54959.1|  hypothetical protein EGM_04072                          237   2e-71    
ref|XP_008326510.1|  PREDICTED: obg-like ATPase 1 isoform X2            236   2e-71    
ref|NP_999865.1|  obg-like ATPase 1 isoform 1                           236   2e-71    
ref|XP_005346631.1|  PREDICTED: obg-like ATPase 1                       236   2e-71    
ref|NP_080218.1|  obg-like ATPase 1 isoform a                           236   2e-71    
dbj|BAE39543.1|  unnamed protein product                                236   2e-71    
ref|XP_008503320.1|  PREDICTED: obg-like ATPase 1                       236   2e-71    
dbj|BAE35446.1|  unnamed protein product                                236   2e-71    
ref|XP_006116547.1|  PREDICTED: obg-like ATPase 1 isoform X2            237   2e-71    
gb|EDL79133.1|  similar to RIKEN cDNA 2810409H07, isoform CRA_a         236   3e-71    
ref|NP_001029099.1|  obg-like ATPase 1                                  236   3e-71    
ref|XP_005857658.1|  PREDICTED: obg-like ATPase 1                       236   3e-71    
ref|XP_010884736.1|  PREDICTED: obg-like ATPase 1                       236   3e-71    
ref|XP_004375552.1|  PREDICTED: obg-like ATPase 1                       236   3e-71    
ref|XP_008136765.1|  PREDICTED: obg-like ATPase 1 isoform X1            236   3e-71    
gb|ELW64153.1|  Obg-like ATPase 1                                       238   3e-71    
ref|XP_006866713.1|  PREDICTED: obg-like ATPase 1 isoform X1            236   3e-71    
gb|KFQ13404.1|  Obg-like ATPase 1                                       231   3e-71    
gb|ELK32737.1|  Obg-like ATPase 1                                       236   3e-71    
emb|CAB66481.1|  hypothetical protein                                   235   3e-71    
ref|XP_007248906.1|  PREDICTED: obg-like ATPase 1-like                  235   4e-71    
ref|XP_001466463.1|  putative GTP binding protein                       235   4e-71    
ref|NP_001127505.1|  obg-like ATPase 1                                  235   4e-71    
tpg|DAA13236.1|  TPA: Obg-like ATPase 1-like                            235   6e-71    
ref|XP_008397269.1|  PREDICTED: obg-like ATPase 1 isoform X1            235   6e-71    
gb|AAY18927.1|  DKFZp761C10121                                          236   6e-71    
ref|XP_515918.2|  PREDICTED: obg-like ATPase 1 isoform X1               237   7e-71    
ref|XP_003824289.1|  PREDICTED: obg-like ATPase 1 isoform X1            237   7e-71    
emb|CCC89543.1|  putative GTP binding protein                           234   7e-71    
ref|XP_850320.2|  PREDICTED: LOW QUALITY PROTEIN: Obg-like ATPase...    234   1e-70    
ref|NP_001158828.1|  obg-like ATPase 1                                  234   1e-70    
ref|XP_008310339.1|  PREDICTED: obg-like ATPase 1                       234   1e-70    
ref|XP_002646525.1|  C. briggsae CBR-TAG-210 protein                    234   2e-70    
ref|XP_003722043.1|  putative GTP binding protein                       233   2e-70    
dbj|BAB27201.1|  unnamed protein product                                234   2e-70    
gb|EFN78354.1|  Obg-like ATPase 1                                       231   2e-70    
gb|ADD38665.1|  GTP-binding protein CG1354                              233   2e-70    
gb|ACO09273.1|  GTP-binding protein PTD004                              233   2e-70    
gb|ACO12256.1|  Obg-like ATPase 1                                       233   2e-70    
ref|XP_010831175.1|  PREDICTED: obg-like ATPase 1                       233   2e-70    
ref|XP_002163078.2|  PREDICTED: obg-like ATPase 1-like                  233   3e-70    
gb|ESL11226.1|  GTP-binding protein                                     229   3e-70    
ref|XP_003876812.1|  putative GTP binding protein                       233   3e-70    
emb|CDS09858.1|  Putative GTP-binding protein YchF                      233   3e-70    
emb|CDH52754.1|  gtp-binding protein                                    233   3e-70    
gb|ETN73871.1|  GTP-binding protein YchF                                233   3e-70    
ref|XP_003884761.1|  putative GTP binding protein                       233   3e-70    
gb|EFN60681.1|  Obg-like ATPase 1                                       231   3e-70    
ref|XP_009236111.1|  PREDICTED: obg-like ATPase 1 isoform X1            235   3e-70    
emb|CDU17077.1|  GTP-binding protein, putative                          232   5e-70    
emb|CDJ43406.1|  GTP binding protein, putative                          232   5e-70    
emb|CDQ81805.1|  unnamed protein product                                234   5e-70    
ref|XP_004341541.1|  GTP binding protein                                233   5e-70    
emb|CDJ65501.1|  GTP binding protein, putative                          231   6e-70    
ref|XP_011498533.1|  PREDICTED: obg-like ATPase 1                       232   6e-70    
ref|NP_001270427.1|  uncharacterized protein LOC101926459               233   6e-70    
ref|NP_001079680.1|  obg-like ATPase 1                                  232   8e-70    
ref|XP_003695060.1|  PREDICTED: GTP-binding protein CG1354-like         232   9e-70    
gb|EYC24730.1|  hypothetical protein Y032_0013g2079                     232   9e-70    
gb|KFW61884.1|  Obg-like ATPase 1                                       231   9e-70    
gb|EPY37092.1|  GTP binding protein                                     231   1e-69    
gb|ERG79748.1|  gtp-binding protein                                     232   1e-69    
ref|XP_002370768.1|  GTP binding protein, putative                      232   1e-69    
gb|ETB58464.1|  GTP-binding protein YchF                                231   1e-69    
ref|XP_009553897.1|  PREDICTED: obg-like ATPase 1                       231   1e-69    
emb|CDR11783.1|  GTP-binding protein, putative                          231   1e-69    
gb|EGT58351.1|  hypothetical protein CAEBREN_10889                      231   1e-69    
ref|XP_008625563.1|  GTP-binding protein YchF                           231   1e-69    
gb|EUD71003.1|  GTP-binding protein YchF                                231   1e-69    
gb|EPY30421.1|  GTP binding protein                                     231   1e-69    
ref|XP_010350251.1|  PREDICTED: LOW QUALITY PROTEIN: obg-like ATP...    233   1e-69    
ref|XP_009311370.1|  GTP-binding protein                                231   2e-69    
ref|XP_008216612.1|  PREDICTED: obg-like ATPase 1                       231   2e-69    
ref|NP_001254006.1|  Protein OLA-1, isoform a                           231   2e-69    
ref|XP_007888200.1|  PREDICTED: obg-like ATPase 1                       231   2e-69    
ref|XP_396711.3|  PREDICTED: obg-like ATPase 1-like isoformX1           231   2e-69    
emb|CAJ83205.1|  novel protein similar to GTP-binding protein PTD004    231   2e-69    
emb|CCW63611.1|  unnamed protein product                                231   2e-69    
ref|XP_008885365.1|  GTP-binding protein, putative                      231   3e-69    
ref|XP_003400207.1|  PREDICTED: GTP-binding protein CG1354-like         231   3e-69    
gb|EGI59771.1|  GTP-binding protein                                     229   3e-69    
ref|XP_003704224.1|  PREDICTED: GTP-binding protein CG1354-like         230   3e-69    
ref|XP_006174828.1|  PREDICTED: obg-like ATPase 1 isoform X1            230   4e-69    
ref|XP_743834.1|  GTP-binding protein                                   229   4e-69    
ref|XP_676964.1|  GTP-binding protein                                   230   4e-69    
ref|XP_730137.1|  hypothetical protein                                  231   4e-69    
emb|CBK21211.2|  unnamed protein product                                230   6e-69    
emb|CBH09562.1|  GTP binding protein, putative                          229   6e-69    
gb|ESL05473.1|  GTP-binding protein                                     228   8e-69    
ref|XP_951682.1|  GTP binding protein                                   229   8e-69    
gb|ELR47977.1|  Obg-like ATPase 1                                       229   9e-69    
ref|XP_001635003.1|  predicted protein                                  229   1e-68    
ref|XP_003115069.1|  CRE-TAG-210 protein                                229   1e-68    
ref|XP_002142230.1|  GTP-binding protein                                229   1e-68    
ref|XP_003494408.1|  PREDICTED: GTP-binding protein CG1354-like         229   1e-68    
gb|EIE82570.1|  GTP-binding protein YchF                                229   1e-68    
ref|XP_001748154.1|  hypothetical protein                               229   1e-68    
gb|KHN83895.1|  Obg-like ATPase 1                                       230   2e-68    
ref|NP_001008044.1|  obg-like ATPase 1                                  228   2e-68    
ref|XP_011329428.1|  PREDICTED: obg-like ATPase 1                       228   2e-68    
ref|XP_010793747.1|  PREDICTED: LOW QUALITY PROTEIN: obg-like ATP...    228   2e-68    
ref|XP_011267424.1|  PREDICTED: obg-like ATPase 1                       228   2e-68    
ref|XP_008549165.1|  PREDICTED: obg-like ATPase 1                       226   2e-68    
gb|ERE71973.1|  obg-like ATPase 1-like protein                          238   2e-68    
ref|XP_011148752.1|  PREDICTED: obg-like ATPase 1                       228   2e-68    
ref|XP_007512524.1|  predicted protein                                  228   3e-68    
gb|EFX64851.1|  hypothetical protein DAPPUDRAFT_333762                  228   3e-68    
ref|XP_006020859.1|  PREDICTED: obg-like ATPase 1                       228   3e-68    
ref|XP_002407922.1|  GTP-binding protein, putative                      228   3e-68    
emb|CCW70456.1|  unnamed protein product                                228   4e-68    
gb|AGG11697.1|  hypothetical protein                                    227   4e-68    
ref|XP_011063638.1|  PREDICTED: obg-like ATPase 1 isoform X1            227   5e-68    
ref|XP_011063639.1|  PREDICTED: obg-like ATPase 1 isoform X2            227   6e-68    
ref|XP_008472916.1|  PREDICTED: obg-like ATPase 1                       221   6e-68    
ref|XP_010793340.1|  PREDICTED: obg-like ATPase 1                       227   7e-68    
ref|XP_011162955.1|  PREDICTED: obg-like ATPase 1                       227   7e-68    
ref|XP_003745114.1|  PREDICTED: GTP-binding protein CG1354-like         226   1e-67    
ref|XP_010700320.1|  GTP binding protein, putative                      225   3e-67    
ref|XP_001566005.1|  putative GTP binding protein                       225   4e-67    
ref|XP_009351070.1|  PREDICTED: obg-like ATPase 1                       225   4e-67    
ref|XP_010959009.1|  PREDICTED: obg-like ATPase 1                       225   4e-67    
gb|EFA09583.1|  hypothetical protein TcasGA2_TC011700                   223   5e-67    
gb|EFX64850.1|  hypothetical protein DAPPUDRAFT_219469                  224   6e-67    
gb|EKF26595.1|  GTP-binding protein, putative                           224   6e-67    
gb|AGG11505.1|  hypothetical protein                                    224   7e-67    
ref|XP_011307687.1|  PREDICTED: obg-like ATPase 1                       224   8e-67    
ref|XP_817773.1|  GTP-binding protein                                   224   1e-66    
ref|XP_004521628.1|  PREDICTED: obg-like ATPase 1-like isoform X1       223   2e-66    
ref|XP_003962811.1|  PREDICTED: obg-like ATPase 1-like                  223   2e-66    
gb|ETN66120.1|  GTP-binding protein                                     221   2e-66    
ref|NP_001040339.1|  GTP binding protein                                223   3e-66    
gb|ESS62262.1|  GTP-binding protein                                     222   4e-66    
gb|AAO26205.1|  GTP-binding protein                                     222   4e-66    
emb|CDJ59407.1|  GTP binding protein, putative                          224   4e-66    
ref|XP_002116391.1|  hypothetical protein TRIADDRAFT_30808              222   5e-66    
ref|XP_007370743.1|  cytoplasmic protein                                222   6e-66    
ref|XP_005416153.1|  PREDICTED: obg-like ATPase 1                       229   6e-66    
ref|XP_797209.1|  PREDICTED: obg-like ATPase 1-like                     222   7e-66    
ref|XP_813495.1|  GTP-binding protein                                   222   7e-66    
emb|CCD81858.1|  GTP-binding protein-related                            221   9e-66    
ref|XP_005716907.1|  GTP-binding protein of Obg family                  221   1e-65    
emb|CCC46753.1|  putative GTP binding protein                           221   1e-65    
ref|XP_011213430.1|  PREDICTED: obg-like ATPase 1                       221   2e-65    
gb|AEH16630.1|  GTPase                                                  221   2e-65    
ref|XP_969865.2|  PREDICTED: obg-like ATPase 1                          221   2e-65    
gb|KGB37524.1|  Obg-like ATPase 1                                       221   2e-65    
gb|EKG08395.1|  hypothetical protein TCSYLVIO_000468                    220   2e-65    
ref|XP_002010541.1|  GI15984                                            220   3e-65    
ref|XP_011185359.1|  PREDICTED: obg-like ATPase 1                       220   3e-65    
ref|XP_311198.2|  AGAP000672-PA                                         220   3e-65    
ref|XP_010858116.1|  PREDICTED: obg-like ATPase 1 isoform X2            219   5e-65    
ref|XP_001991915.1|  GH11803                                            219   6e-65    
gb|EZA60180.1|  GTP-binding protein                                     228   6e-65    
ref|XP_001654823.1|  AAEL002160-PA                                      219   8e-65    
gb|KFB40079.1|  AGAP000672-PA-like protein                              219   1e-64    
ref|XP_008472914.1|  PREDICTED: obg-like ATPase 1 isoform X3            219   1e-64    
ref|XP_002772113.1|  GTP-binding protein, putative                      218   2e-64    
ref|XP_008472912.1|  PREDICTED: obg-like ATPase 1 isoform X1            219   2e-64    
dbj|BAH70818.1|  hypothetical protein                                   211   2e-64    
gb|EPB88277.1|  obg-like ATPase 1                                       218   2e-64    
dbj|BAM19435.1|  GTP-binding protein                                    218   2e-64    
ref|XP_008472913.1|  PREDICTED: obg-like ATPase 1 isoform X2            219   2e-64    
gb|EPY89073.1|  hypothetical protein CB1_000138041                      211   2e-64    
ref|XP_002774229.1|  GTP-binding protein, putative                      218   2e-64    
ref|XP_008397279.1|  PREDICTED: obg-like ATPase 1 isoform X2            217   3e-64    
ref|XP_007393236.1|  hypothetical protein PHACADRAFT_251809             217   3e-64    
emb|CDW82130.1|  gtp-binding protein                                    217   3e-64    
ref|XP_002787114.1|  GTP-binding protein, putative                      217   4e-64    
ref|XP_001836147.2|  cytoplasmic protein                                217   4e-64    
gb|EHJ68331.1|  GTP binding protein                                     229   4e-64    
ref|XP_001454300.1|  hypothetical protein                               217   4e-64    
dbj|GAN04407.1|  GTP-binding protein                                    217   4e-64    
ref|XP_002767889.1|  GTP-binding protein, putative                      217   5e-64    
ref|XP_009024324.1|  hypothetical protein HELRODRAFT_187336             217   6e-64    
ref|XP_004347436.1|  GTP-binding protein                                216   6e-64    
ref|XP_001462345.1|  hypothetical protein                               216   6e-64    
ref|XP_001846950.1|  GTP-binding protein                                215   7e-64    
ref|XP_002071025.1|  GK25358                                            216   7e-64    
ref|XP_006683298.1|  hypothetical protein BATDEDRAFT_33861              217   7e-64    
ref|XP_002055571.1|  GJ18714                                            216   8e-64    
emb|CEF67024.1|  Obg-like ATPase 1                                      216   1e-63    
emb|CDR96464.1|  GTP-binding protein YchF domain containing prote...    216   1e-63    
gb|KFO72251.1|  Obg-like ATPase 1                                       216   1e-63    
emb|CDW53501.1|  GTP binding protein CG1354                             216   2e-63    
gb|EPS96720.1|  hypothetical protein FOMPIDRAFT_1167253                 216   2e-63    
ref|XP_005535678.1|  GTP-binding protein of Obg family                  215   3e-63    
emb|CCF75311.1|  unnamed protein product                                215   3e-63    
ref|NP_727364.1|  CG1354, isoform B                                     214   3e-63    
gb|ACX32983.1|  SD24341p                                                214   3e-63    
dbj|BAN66077.1|  GTP-binding protein YchF domain containing protein     214   3e-63    
ref|XP_001611354.1|  GTP-binding protein YchF domain containing p...    214   3e-63    
ref|XP_005182762.2|  PREDICTED: obg-like ATPase 1                       215   4e-63    
gb|ESA10852.1|  hypothetical protein GLOINDRAFT_348023                  214   4e-63    
ref|XP_001846949.1|  ras-related protein Rab-10                         214   4e-63    
ref|XP_003137166.1|  GTP-binding protein                                214   4e-63    
gb|EUB60715.1|  GTP-binding protein                                     214   4e-63    
gb|EJY78341.1|  putative GTPase, probable translation factor            214   5e-63    
ref|XP_011128728.1|  putative GTP-binding protein                       214   6e-63    
gb|EPY31725.1|  GTP binding protein                                     214   6e-63    
ref|XP_001956259.1|  GF25119                                            214   6e-63    
ref|XP_006616484.1|  PREDICTED: LOW QUALITY PROTEIN: obg-like ATP...    214   7e-63    
ref|XP_001977300.1|  GG18324                                            214   9e-63    
gb|ELU09460.1|  hypothetical protein CAPTEDRAFT_174827                  213   1e-62    
emb|CDS18927.1|  GTP binding protein CG1354                             214   1e-62    
gb|AET50562.1|  hypothetical protein                                    206   1e-62    
ref|XP_010213077.1|  PREDICTED: obg-like ATPase 1                       206   2e-62    
ref|NP_572580.1|  CG1354, isoform A                                     213   2e-62    
ref|XP_002041803.1|  GM11387                                            213   2e-62    
gb|KFD67365.1|  hypothetical protein M514_20401                         214   2e-62    
ref|NP_001153863.1|  Obg-like ATPase 1                                  213   2e-62    
ref|XP_002124995.1|  PREDICTED: obg-like ATPase 1                       213   2e-62    



>gb|KDO75234.1| hypothetical protein CISIN_1g015465mg [Citrus sinensis]
Length=374

 Score =   364 bits (934),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 173/183 (95%), Positives = 178/183 (97%), Gaps = 0/183 (0%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHGGELIIPFSAALERSLA  616
            EI NTFQ+LTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHGGE IIPFS ALER+LA
Sbjct  192  EILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHGGEQIIPFSCALERNLA  251

Query  615  DMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAG  436
            DMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAG
Sbjct  252  DMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAG  311

Query  435  AIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGG  256
             IHTDFERGFICAEVMKF+DLKELGSEPAVKA GKY+QEGKTYVVQDGD+IFFKFNVSGG
Sbjct  312  TIHTDFERGFICAEVMKFDDLKELGSEPAVKAAGKYKQEGKTYVVQDGDIIFFKFNVSGG  371

Query  255  GKK  247
            GKK
Sbjct  372  GKK  374



>ref|XP_006468322.1| PREDICTED: obg-like ATPase 1-like [Citrus sinensis]
 gb|KDO75235.1| hypothetical protein CISIN_1g015465mg [Citrus sinensis]
Length=394

 Score =   364 bits (934),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 173/183 (95%), Positives = 178/183 (97%), Gaps = 0/183 (0%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHGGELIIPFSAALERSLA  616
            EI NTFQ+LTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHGGE IIPFS ALER+LA
Sbjct  212  EILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHGGEQIIPFSCALERNLA  271

Query  615  DMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAG  436
            DMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAG
Sbjct  272  DMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAG  331

Query  435  AIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGG  256
             IHTDFERGFICAEVMKF+DLKELGSEPAVKA GKY+QEGKTYVVQDGD+IFFKFNVSGG
Sbjct  332  TIHTDFERGFICAEVMKFDDLKELGSEPAVKAAGKYKQEGKTYVVQDGDIIFFKFNVSGG  391

Query  255  GKK  247
            GKK
Sbjct  392  GKK  394



>ref|XP_006448884.1| hypothetical protein CICLE_v10015175mg [Citrus clementina]
 gb|ESR62124.1| hypothetical protein CICLE_v10015175mg [Citrus clementina]
Length=394

 Score =   364 bits (934),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 173/183 (95%), Positives = 178/183 (97%), Gaps = 0/183 (0%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHGGELIIPFSAALERSLA  616
            EI NTFQ+LTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHGGE IIPFS ALER+LA
Sbjct  212  EILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHGGEQIIPFSCALERNLA  271

Query  615  DMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAG  436
            DMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAG
Sbjct  272  DMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAG  331

Query  435  AIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGG  256
             IHTDFERGFICAEVMKF+DLKELGSEPAVKA GKY+QEGKTYVVQDGD+IFFKFNVSGG
Sbjct  332  TIHTDFERGFICAEVMKFDDLKELGSEPAVKAAGKYKQEGKTYVVQDGDIIFFKFNVSGG  391

Query  255  GKK  247
            GKK
Sbjct  392  GKK  394



>ref|XP_006448885.1| hypothetical protein CICLE_v10015175mg [Citrus clementina]
 gb|ESR62125.1| hypothetical protein CICLE_v10015175mg [Citrus clementina]
Length=460

 Score =   365 bits (936),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 173/183 (95%), Positives = 178/183 (97%), Gaps = 0/183 (0%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHGGELIIPFSAALERSLA  616
            EI NTFQ+LTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHGGE IIPFS ALER+LA
Sbjct  278  EILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHGGEQIIPFSCALERNLA  337

Query  615  DMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAG  436
            DMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAG
Sbjct  338  DMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAG  397

Query  435  AIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGG  256
             IHTDFERGFICAEVMKF+DLKELGSEPAVKA GKY+QEGKTYVVQDGD+IFFKFNVSGG
Sbjct  398  TIHTDFERGFICAEVMKFDDLKELGSEPAVKAAGKYKQEGKTYVVQDGDIIFFKFNVSGG  457

Query  255  GKK  247
            GKK
Sbjct  458  GKK  460



>gb|KDP34925.1| hypothetical protein JCGZ_09213 [Jatropha curcas]
Length=394

 Score =   360 bits (925),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 171/183 (93%), Positives = 177/183 (97%), Gaps = 0/183 (0%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHGGELIIPFSAALERSLA  616
            EI NTFQ+LTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHGGE IIPFSAA ER+LA
Sbjct  212  EILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHGGETIIPFSAAFERNLA  271

Query  615  DMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAG  436
            DM PDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQ+KAPQAAG
Sbjct  272  DMTPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQSKAPQAAG  331

Query  435  AIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGG  256
             IH+DFERGFICAEVMKFEDLKELGSE AVKAGG+YRQEGKTYVVQDGD+IFFKFNVSGG
Sbjct  332  TIHSDFERGFICAEVMKFEDLKELGSESAVKAGGRYRQEGKTYVVQDGDIIFFKFNVSGG  391

Query  255  GKK  247
            GKK
Sbjct  392  GKK  394



>ref|XP_004293982.1| PREDICTED: obg-like ATPase 1 [Fragaria vesca subsp. vesca]
Length=394

 Score =   358 bits (918),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 169/183 (92%), Positives = 177/183 (97%), Gaps = 0/183 (0%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHGGELIIPFSAALERSLA  616
            EI NTFQ+LTAKPVVYLVNMNE+DYQRKKNKFLPKIHAWVQEHGGE IIPFS ALER+LA
Sbjct  212  EILNTFQLLTAKPVVYLVNMNERDYQRKKNKFLPKIHAWVQEHGGEKIIPFSCALERNLA  271

Query  615  DMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAG  436
            D+PPDEAAKYCEENKV+SALPKIIKTGF+AINLIYFFTAGPDEVKCWQIRR +KAPQAAG
Sbjct  272  DLPPDEAAKYCEENKVESALPKIIKTGFAAINLIYFFTAGPDEVKCWQIRRLSKAPQAAG  331

Query  435  AIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGG  256
             IHTDFERGFICAEVMKFEDLKELGSEPAVKA GKYRQEGKTYVVQDGD+IFFKFNVSGG
Sbjct  332  TIHTDFERGFICAEVMKFEDLKELGSEPAVKAAGKYRQEGKTYVVQDGDIIFFKFNVSGG  391

Query  255  GKK  247
            GKK
Sbjct  392  GKK  394



>gb|EYU43227.1| hypothetical protein MIMGU_mgv1a007827mg [Erythranthe guttata]
Length=394

 Score =   357 bits (917),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 168/183 (92%), Positives = 176/183 (96%), Gaps = 0/183 (0%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHGGELIIPFSAALERSLA  616
            EI NTFQ+LTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHGGE +IPFS +LER+L 
Sbjct  212  EILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHGGETMIPFSCSLERNLT  271

Query  615  DMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAG  436
            D+ PDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRR TKAPQAAG
Sbjct  272  DLSPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRLTKAPQAAG  331

Query  435  AIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGG  256
            AIHTDFE+GFICAEVMKFEDLKELGSEPAVKA GKYRQEGKTY+VQDGD+IFFKFNVSGG
Sbjct  332  AIHTDFEKGFICAEVMKFEDLKELGSEPAVKASGKYRQEGKTYIVQDGDIIFFKFNVSGG  391

Query  255  GKK  247
            GKK
Sbjct  392  GKK  394



>ref|XP_003546267.1| PREDICTED: obg-like ATPase 1-like [Glycine max]
 gb|KHN14324.1| Obg-like ATPase 1 [Glycine soja]
Length=394

 Score =   357 bits (915),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 170/183 (93%), Positives = 175/183 (96%), Gaps = 0/183 (0%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHGGELIIPFSAALERSLA  616
            EI N+FQ+LTAKPVVYLVNM EKDYQRKKNKFLPKIHAWVQEHGGE IIPFS ALER+LA
Sbjct  212  EILNSFQLLTAKPVVYLVNMTEKDYQRKKNKFLPKIHAWVQEHGGETIIPFSCALERNLA  271

Query  615  DMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAG  436
            DMPPDEAAKYCEENK QSAL KIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAG
Sbjct  272  DMPPDEAAKYCEENKTQSALTKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAG  331

Query  435  AIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGG  256
            AIHTDFERGFICAEVMKFEDLKELGSE AVKA GKY+QEGKTYVVQDGD+IFFKFNVSGG
Sbjct  332  AIHTDFERGFICAEVMKFEDLKELGSESAVKAAGKYKQEGKTYVVQDGDIIFFKFNVSGG  391

Query  255  GKK  247
            GKK
Sbjct  392  GKK  394



>ref|NP_001242520.1| uncharacterized protein LOC100793501 [Glycine max]
 gb|ACU21485.1| unknown [Glycine max]
Length=394

 Score =   357 bits (915),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 170/183 (93%), Positives = 175/183 (96%), Gaps = 0/183 (0%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHGGELIIPFSAALERSLA  616
            EI N+FQ+LTAKPVVYLVNM EKDYQRKKNKFLPKIHAWVQEHGGE IIPFS ALER+LA
Sbjct  212  EILNSFQLLTAKPVVYLVNMTEKDYQRKKNKFLPKIHAWVQEHGGETIIPFSCALERNLA  271

Query  615  DMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAG  436
            DMPPDEAAKYCEENK QSAL KIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAG
Sbjct  272  DMPPDEAAKYCEENKTQSALTKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAG  331

Query  435  AIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGG  256
            AIHTDFERGFICAEVMKFEDLKELGSE AVKA GKY+QEGKTYVVQDGD+IFFKFNVSGG
Sbjct  332  AIHTDFERGFICAEVMKFEDLKELGSESAVKAAGKYKQEGKTYVVQDGDIIFFKFNVSGG  391

Query  255  GKK  247
            GKK
Sbjct  392  GKK  394



>ref|XP_010499597.1| PREDICTED: obg-like ATPase 1 [Camelina sativa]
Length=394

 Score =   356 bits (914),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 165/183 (90%), Positives = 177/183 (97%), Gaps = 0/183 (0%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHGGELIIPFSAALERSLA  616
            EI NTFQ+L+AKPVVYL+NMNE+DYQRKKNKFLPKIHAWVQEHGG+ +IPFS   ER+LA
Sbjct  212  EILNTFQLLSAKPVVYLINMNERDYQRKKNKFLPKIHAWVQEHGGDTMIPFSGVFERTLA  271

Query  615  DMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAG  436
            DMPPDEAAKYCEENK+QSALP+IIKTGFSAINLIYFFTAGPDEVKCWQIRRQ+KAPQAAG
Sbjct  272  DMPPDEAAKYCEENKLQSALPRIIKTGFSAINLIYFFTAGPDEVKCWQIRRQSKAPQAAG  331

Query  435  AIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGG  256
            AIHTDFERGFICAEVMKFEDLKELG+EPAVKA GKYRQEGKTYVVQDGD+IFFKFNVSGG
Sbjct  332  AIHTDFERGFICAEVMKFEDLKELGNEPAVKAAGKYRQEGKTYVVQDGDIIFFKFNVSGG  391

Query  255  GKK  247
            GKK
Sbjct  392  GKK  394



>ref|XP_010478480.1| PREDICTED: obg-like ATPase 1 [Camelina sativa]
Length=394

 Score =   356 bits (914),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 165/183 (90%), Positives = 177/183 (97%), Gaps = 0/183 (0%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHGGELIIPFSAALERSLA  616
            EI NTFQ+L+AKPVVYL+NMNE+DYQRKKNKFLPKIHAWVQEHGG+ +IPFS   ER+LA
Sbjct  212  EILNTFQLLSAKPVVYLINMNERDYQRKKNKFLPKIHAWVQEHGGDTMIPFSGVFERTLA  271

Query  615  DMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAG  436
            DMPPDEAAKYCEENK+QSALP+IIKTGFSAINLIYFFTAGPDEVKCWQIRRQ+KAPQAAG
Sbjct  272  DMPPDEAAKYCEENKLQSALPRIIKTGFSAINLIYFFTAGPDEVKCWQIRRQSKAPQAAG  331

Query  435  AIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGG  256
            AIHTDFERGFICAEVMKFEDLKELG+EPAVKA GKYRQEGKTYVVQDGD+IFFKFNVSGG
Sbjct  332  AIHTDFERGFICAEVMKFEDLKELGNEPAVKAAGKYRQEGKTYVVQDGDIIFFKFNVSGG  391

Query  255  GKK  247
            GKK
Sbjct  392  GKK  394



>emb|CDP17295.1| unnamed protein product [Coffea canephora]
Length=394

 Score =   356 bits (914),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 170/183 (93%), Positives = 173/183 (95%), Gaps = 0/183 (0%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHGGELIIPFSAALERSLA  616
            EI NT Q+LTAKPVVYLVNM EKDYQRKKNKFLPKIHAWVQEHGGE IIPFS ALER L 
Sbjct  212  EILNTLQLLTAKPVVYLVNMTEKDYQRKKNKFLPKIHAWVQEHGGETIIPFSGALERDLT  271

Query  615  DMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAG  436
            D+PP+EAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAG
Sbjct  272  DLPPEEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAG  331

Query  435  AIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGG  256
             IHTDFERGFICAEVMKFEDLKELGSE AVKA GKYRQEGKTYVVQDGDVIFFKFNVSGG
Sbjct  332  TIHTDFERGFICAEVMKFEDLKELGSESAVKAAGKYRQEGKTYVVQDGDVIFFKFNVSGG  391

Query  255  GKK  247
            GKK
Sbjct  392  GKK  394



>ref|XP_007211399.1| hypothetical protein PRUPE_ppa006821mg [Prunus persica]
 gb|EMJ12598.1| hypothetical protein PRUPE_ppa006821mg [Prunus persica]
Length=394

 Score =   356 bits (914),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 170/183 (93%), Positives = 176/183 (96%), Gaps = 0/183 (0%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHGGELIIPFSAALERSLA  616
            EI NTFQ+LTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHGGE IIPFS ALER+LA
Sbjct  212  EILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHGGEPIIPFSCALERNLA  271

Query  615  DMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAG  436
            D+PP+EAAKYCE+N VQSAL KIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAG
Sbjct  272  DLPPEEAAKYCEQNNVQSALTKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAG  331

Query  435  AIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGG  256
            AIHTDFE+GFICAEVMKFEDLKELGSEPAVKA GKYRQEGKTYVVQD DVIFFKFNVSGG
Sbjct  332  AIHTDFEKGFICAEVMKFEDLKELGSEPAVKAAGKYRQEGKTYVVQDADVIFFKFNVSGG  391

Query  255  GKK  247
            GKK
Sbjct  392  GKK  394



>ref|XP_010460862.1| PREDICTED: obg-like ATPase 1 [Camelina sativa]
Length=394

 Score =   356 bits (913),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 165/183 (90%), Positives = 177/183 (97%), Gaps = 0/183 (0%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHGGELIIPFSAALERSLA  616
            EI NTFQ+L+AKPVVYL+NMNE+DYQRKKNKFLPKIHAWVQEHGG+ +IPFS   ER+LA
Sbjct  212  EILNTFQLLSAKPVVYLINMNERDYQRKKNKFLPKIHAWVQEHGGDTMIPFSGVFERTLA  271

Query  615  DMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAG  436
            DMPPDEAAKYCEENK+QSALP+IIKTGFSAINLIYFFTAGPDEVKCWQIRRQ+KAPQAAG
Sbjct  272  DMPPDEAAKYCEENKLQSALPRIIKTGFSAINLIYFFTAGPDEVKCWQIRRQSKAPQAAG  331

Query  435  AIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGG  256
            AIHTDFERGFICAEVMKFEDLKELG+EPAVKA GKYRQEGKTYVVQDGD+IFFKFNVSGG
Sbjct  332  AIHTDFERGFICAEVMKFEDLKELGNEPAVKAAGKYRQEGKTYVVQDGDIIFFKFNVSGG  391

Query  255  GKK  247
            GKK
Sbjct  392  GKK  394



>ref|XP_008225608.1| PREDICTED: obg-like ATPase 1 [Prunus mume]
Length=394

 Score =   355 bits (912),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 169/183 (92%), Positives = 176/183 (96%), Gaps = 0/183 (0%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHGGELIIPFSAALERSLA  616
            EI NTFQ+LTAKPVVYLVNMNE+DYQRKKNKFLPKIHAWVQEHGGE IIPFS ALER+LA
Sbjct  212  EILNTFQLLTAKPVVYLVNMNERDYQRKKNKFLPKIHAWVQEHGGEPIIPFSCALERNLA  271

Query  615  DMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAG  436
            D+PP+EAAKYCE+N VQSAL KIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAG
Sbjct  272  DLPPEEAAKYCEQNNVQSALTKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAG  331

Query  435  AIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGG  256
            AIHTDFE+GFICAEVMKFEDLKELGSEPAVKA GKYRQEGKTYVVQD DVIFFKFNVSGG
Sbjct  332  AIHTDFEKGFICAEVMKFEDLKELGSEPAVKAAGKYRQEGKTYVVQDADVIFFKFNVSGG  391

Query  255  GKK  247
            GKK
Sbjct  392  GKK  394



>ref|XP_002263885.1| PREDICTED: obg-like ATPase 1 [Vitis vinifera]
 emb|CBI31027.3| unnamed protein product [Vitis vinifera]
Length=394

 Score =   355 bits (911),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 169/183 (92%), Positives = 175/183 (96%), Gaps = 0/183 (0%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHGGELIIPFSAALERSLA  616
            EI NTFQ+LTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQ+HGGE IIPFS ALER+LA
Sbjct  212  EILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQDHGGETIIPFSCALERNLA  271

Query  615  DMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAG  436
            DMP DEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAG
Sbjct  272  DMPEDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAG  331

Query  435  AIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGG  256
             IH+DFERGFICAEVMKF+DLKELGSE AVKA GKYRQEGKTYVVQD D+IFFKFNVSGG
Sbjct  332  TIHSDFERGFICAEVMKFDDLKELGSEGAVKAAGKYRQEGKTYVVQDADIIFFKFNVSGG  391

Query  255  GKK  247
            GKK
Sbjct  392  GKK  394



>ref|XP_002893634.1| GTP binding protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69893.1| GTP binding protein [Arabidopsis lyrata subsp. lyrata]
Length=394

 Score =   355 bits (910),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 165/183 (90%), Positives = 176/183 (96%), Gaps = 0/183 (0%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHGGELIIPFSAALERSLA  616
            EI NTFQ+L+AKPVVYL+NMNE+DYQRKKNKFLPKIHAWVQEHGG+ +IPFS   ERSLA
Sbjct  212  EILNTFQLLSAKPVVYLINMNERDYQRKKNKFLPKIHAWVQEHGGDTMIPFSGVFERSLA  271

Query  615  DMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAG  436
            DM PDEAAKYCEENK+QSALP+IIKTGFSAINLIYFFTAGPDEVKCWQIRRQ+KAPQAAG
Sbjct  272  DMAPDEAAKYCEENKLQSALPRIIKTGFSAINLIYFFTAGPDEVKCWQIRRQSKAPQAAG  331

Query  435  AIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGG  256
            AIHTDFERGFICAEVMKFEDLKELG+EPAVKA GKYRQEGKTYVVQDGD+IFFKFNVSGG
Sbjct  332  AIHTDFERGFICAEVMKFEDLKELGNEPAVKAAGKYRQEGKTYVVQDGDIIFFKFNVSGG  391

Query  255  GKK  247
            GKK
Sbjct  392  GKK  394



>ref|XP_009362223.1| PREDICTED: obg-like ATPase 1 [Pyrus x bretschneideri]
Length=394

 Score =   354 bits (909),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 169/183 (92%), Positives = 175/183 (96%), Gaps = 0/183 (0%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHGGELIIPFSAALERSLA  616
            EI NTFQ+LTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHG E IIPFS ALER+LA
Sbjct  212  EILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHGAEPIIPFSCALERNLA  271

Query  615  DMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAG  436
            D+PP+EAAKYCE+N VQSAL KIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAG
Sbjct  272  DLPPEEAAKYCEQNNVQSALTKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAG  331

Query  435  AIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGG  256
            AIHTDFERGFICAEVMKF+DLKELGSEPAVKA GKYRQEGKTYVVQD DVIFFKFNVSGG
Sbjct  332  AIHTDFERGFICAEVMKFDDLKELGSEPAVKAAGKYRQEGKTYVVQDADVIFFKFNVSGG  391

Query  255  GKK  247
            GKK
Sbjct  392  GKK  394



>ref|XP_011085197.1| PREDICTED: obg-like ATPase 1 [Sesamum indicum]
Length=394

 Score =   354 bits (909),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 168/183 (92%), Positives = 174/183 (95%), Gaps = 0/183 (0%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHGGELIIPFSAALERSLA  616
            EI NTFQ+LTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHGGE IIPFS  LER+LA
Sbjct  212  EILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHGGETIIPFSCVLERNLA  271

Query  615  DMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAG  436
            D+ PDEAAKYCEENKVQSALPKIIKTGF+AINLIYFFTAGPDEVKCWQIRRQTKAPQAAG
Sbjct  272  DISPDEAAKYCEENKVQSALPKIIKTGFAAINLIYFFTAGPDEVKCWQIRRQTKAPQAAG  331

Query  435  AIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGG  256
             IHTDFE+GFICAEVMKFEDLKELGSE AVKA GKYRQEGKTYVVQDGD+IFFKFNVS G
Sbjct  332  TIHTDFEKGFICAEVMKFEDLKELGSESAVKAAGKYRQEGKTYVVQDGDIIFFKFNVSSG  391

Query  255  GKK  247
            GKK
Sbjct  392  GKK  394



>ref|XP_008383389.1| PREDICTED: obg-like ATPase 1 [Malus domestica]
Length=394

 Score =   354 bits (908),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 169/183 (92%), Positives = 175/183 (96%), Gaps = 0/183 (0%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHGGELIIPFSAALERSLA  616
            EI NTFQ+LTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHG E IIPFS ALER+LA
Sbjct  212  EILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHGAEPIIPFSCALERNLA  271

Query  615  DMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAG  436
            D+PP+EAAKYCE+N VQSAL KIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAG
Sbjct  272  DLPPEEAAKYCEQNNVQSALTKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAG  331

Query  435  AIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGG  256
            AIHTDFERGFICAEVMKF+DLKELGSEPAVKA GKYRQEGKTYVVQD DVIFFKFNVSGG
Sbjct  332  AIHTDFERGFICAEVMKFDDLKELGSEPAVKAAGKYRQEGKTYVVQDADVIFFKFNVSGG  391

Query  255  GKK  247
            GKK
Sbjct  392  GKK  394



>ref|XP_010051911.1| PREDICTED: obg-like ATPase 1 [Eucalyptus grandis]
 gb|KCW75746.1| hypothetical protein EUGRSUZ_D00127 [Eucalyptus grandis]
Length=394

 Score =   353 bits (907),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 169/183 (92%), Positives = 174/183 (95%), Gaps = 0/183 (0%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHGGELIIPFSAALERSLA  616
            EI NTFQ+LTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHGGE IIPFS ALER+LA
Sbjct  212  EILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHGGETIIPFSCALERNLA  271

Query  615  DMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAG  436
            D+  DEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRR TKAPQAAG
Sbjct  272  DISADEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRHTKAPQAAG  331

Query  435  AIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGG  256
             IHTDFERGFICAEVMKFEDLKELGSE AVKA GKY+QEGKTYVVQDGD+IFFKFNVSGG
Sbjct  332  TIHTDFERGFICAEVMKFEDLKELGSESAVKAAGKYKQEGKTYVVQDGDIIFFKFNVSGG  391

Query  255  GKK  247
            GKK
Sbjct  392  GKK  394



>ref|XP_004231561.1| PREDICTED: obg-like ATPase 1 [Solanum lycopersicum]
Length=394

 Score =   353 bits (907),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 166/183 (91%), Positives = 175/183 (96%), Gaps = 0/183 (0%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHGGELIIPFSAALERSLA  616
            E  NTFQ+LTAKP+VYLVNMNEKDYQRKKNKFLPKIHAWVQEHGGE+IIPFSAA+ER+LA
Sbjct  212  EFLNTFQLLTAKPIVYLVNMNEKDYQRKKNKFLPKIHAWVQEHGGEIIIPFSAAVERNLA  271

Query  615  DMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAG  436
            DMPPDEAAKYCEENK+QS LPKIIKTGF+AINLIYFFTAGPDEVKCWQIRR  KAPQAAG
Sbjct  272  DMPPDEAAKYCEENKLQSCLPKIIKTGFAAINLIYFFTAGPDEVKCWQIRRLMKAPQAAG  331

Query  435  AIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGG  256
             IHTDFERGFICAEVMKFEDLKELGSE AVKA GKY+QEGKTYVVQDGD+IFFKFNVSGG
Sbjct  332  TIHTDFERGFICAEVMKFEDLKELGSESAVKAAGKYKQEGKTYVVQDGDIIFFKFNVSGG  391

Query  255  GKK  247
            GKK
Sbjct  392  GKK  394



>ref|XP_002523184.1| GTP-dependent nucleic acid-binding protein engD, putative [Ricinus 
communis]
 gb|EEF39215.1| GTP-dependent nucleic acid-binding protein engD, putative [Ricinus 
communis]
Length=394

 Score =   353 bits (906),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 167/183 (91%), Positives = 175/183 (96%), Gaps = 0/183 (0%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHGGELIIPFSAALERSLA  616
            EI NTFQ+LTAKPVVYLVNMNE+DYQRKKNKFLPKIHAW+QEHGGE IIPFS  LE++LA
Sbjct  212  EIMNTFQLLTAKPVVYLVNMNERDYQRKKNKFLPKIHAWLQEHGGETIIPFSCVLEQNLA  271

Query  615  DMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAG  436
            D+ PDEA KYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAG
Sbjct  272  DISPDEATKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAG  331

Query  435  AIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGG  256
            AIHTDFE+GFICAEVMKFEDLKELGSE AVKA GKYRQEGKTYVVQDGD+IFFKFNVSGG
Sbjct  332  AIHTDFEKGFICAEVMKFEDLKELGSEAAVKAAGKYRQEGKTYVVQDGDIIFFKFNVSGG  391

Query  255  GKK  247
            GKK
Sbjct  392  GKK  394



>ref|XP_006305006.1| hypothetical protein CARUB_v10009370mg [Capsella rubella]
 gb|EOA37904.1| hypothetical protein CARUB_v10009370mg [Capsella rubella]
Length=394

 Score =   353 bits (906),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 164/183 (90%), Positives = 176/183 (96%), Gaps = 0/183 (0%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHGGELIIPFSAALERSLA  616
            EI NTFQ+L+AKPVVYL+NMNE+DYQRKKNKFLPKIHAWVQEHGG+ +IPFS   ER+LA
Sbjct  212  EILNTFQLLSAKPVVYLINMNERDYQRKKNKFLPKIHAWVQEHGGDTMIPFSGVFERTLA  271

Query  615  DMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAG  436
            DM PDEAAKYCEENK+QSALP+IIKTGFSAINLIYFFTAGPDEVKCWQIRRQ+KAPQAAG
Sbjct  272  DMAPDEAAKYCEENKLQSALPRIIKTGFSAINLIYFFTAGPDEVKCWQIRRQSKAPQAAG  331

Query  435  AIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGG  256
            AIHTDFERGFICAEVMKFEDLKELG+EPAVKA GKYRQEGKTYVVQDGD+IFFKFNVSGG
Sbjct  332  AIHTDFERGFICAEVMKFEDLKELGNEPAVKAAGKYRQEGKTYVVQDGDIIFFKFNVSGG  391

Query  255  GKK  247
            GKK
Sbjct  392  GKK  394



>ref|XP_010098556.1| Obg-like ATPase 1 [Morus notabilis]
 gb|EXB75216.1| Obg-like ATPase 1 [Morus notabilis]
Length=394

 Score =   353 bits (905),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 168/183 (92%), Positives = 173/183 (95%), Gaps = 0/183 (0%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHGGELIIPFSAALERSLA  616
            EI N FQ+LTAKPVVYLVNMNE+DYQRKKNKFLPKIHAWVQEHGGE IIPFS  LER+LA
Sbjct  212  EILNAFQLLTAKPVVYLVNMNERDYQRKKNKFLPKIHAWVQEHGGEQIIPFSCVLERNLA  271

Query  615  DMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAG  436
            DMPPDEAA YCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAG
Sbjct  272  DMPPDEAANYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAG  331

Query  435  AIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGG  256
             IHTDFERGFICAEVMKFEDLKE GSE AVKA GKY+QEGKTYVVQDGD+IFFKFNVSGG
Sbjct  332  TIHTDFERGFICAEVMKFEDLKEHGSEAAVKAAGKYKQEGKTYVVQDGDIIFFKFNVSGG  391

Query  255  GKK  247
            GKK
Sbjct  392  GKK  394



>ref|NP_174346.1| GTP-binding protein [Arabidopsis thaliana]
 gb|AAD25745.1|AC007060_3 Similar to WO8E3.3 gi|3880615 putative GTP-binding protein from 
C. elegans cosmid gb|Z92773. EST gb|AA597331 comes from this 
gene [Arabidopsis thaliana]
 gb|ABG25054.1| At1g30580 [Arabidopsis thaliana]
 gb|AEE31246.1| GTP-binding protein [Arabidopsis thaliana]
Length=394

 Score =   353 bits (905),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 164/183 (90%), Positives = 176/183 (96%), Gaps = 0/183 (0%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHGGELIIPFSAALERSLA  616
            EI NTFQ+L+AKPVVYL+N+NE+DYQRKKNKFLPKIHAWVQEHGG+ +IPFS   ERSLA
Sbjct  212  EILNTFQLLSAKPVVYLINLNERDYQRKKNKFLPKIHAWVQEHGGDTMIPFSGVFERSLA  271

Query  615  DMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAG  436
            DM PDEAAKYCEENK+QSALP+IIKTGFSAINLIYFFTAGPDEVKCWQIRRQ+KAPQAAG
Sbjct  272  DMAPDEAAKYCEENKLQSALPRIIKTGFSAINLIYFFTAGPDEVKCWQIRRQSKAPQAAG  331

Query  435  AIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGG  256
            AIHTDFERGFICAEVMKFEDLKELG+EPAVKA GKYRQEGKTYVVQDGD+IFFKFNVSGG
Sbjct  332  AIHTDFERGFICAEVMKFEDLKELGNEPAVKAAGKYRQEGKTYVVQDGDIIFFKFNVSGG  391

Query  255  GKK  247
            GKK
Sbjct  392  GKK  394



>gb|AAF65513.1| GTP-binding protein [Capsicum annuum]
Length=394

 Score =   353 bits (905),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 165/183 (90%), Positives = 176/183 (96%), Gaps = 0/183 (0%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHGGELIIPFSAALERSLA  616
            E+ NTFQ+LTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHGG++IIPFSAA+ER+LA
Sbjct  212  ELLNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHGGDIIIPFSAAVERNLA  271

Query  615  DMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAG  436
            DMPPDEA+KYCEENK+QS LPKIIKTGFSAINLIYFFTAGPDEVKCWQIRR  KAPQAAG
Sbjct  272  DMPPDEASKYCEENKLQSCLPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRLMKAPQAAG  331

Query  435  AIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGG  256
             IHTDFERGFICAEVMKF+DLKELGSE AVKA GKY+QEGKTYVVQDGD+IFFKFNVSGG
Sbjct  332  TIHTDFERGFICAEVMKFDDLKELGSEAAVKAAGKYKQEGKTYVVQDGDIIFFKFNVSGG  391

Query  255  GKK  247
            GKK
Sbjct  392  GKK  394



>ref|XP_008372236.1| PREDICTED: obg-like ATPase 1 [Malus domestica]
Length=394

 Score =   352 bits (903),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 168/183 (92%), Positives = 174/183 (95%), Gaps = 0/183 (0%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHGGELIIPFSAALERSLA  616
            EI N FQ+LTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHG E IIPFS ALER+LA
Sbjct  212  EILNPFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHGAEPIIPFSCALERNLA  271

Query  615  DMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAG  436
            D+PP+EAAKYCE+N VQSAL KIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAG
Sbjct  272  DLPPEEAAKYCEQNNVQSALTKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAG  331

Query  435  AIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGG  256
            AIHTDFERGFICAEVMKF+DLKELGSEPAVKA GKYRQEGKTYVVQD DVIFFKFNVSGG
Sbjct  332  AIHTDFERGFICAEVMKFDDLKELGSEPAVKAAGKYRQEGKTYVVQDADVIFFKFNVSGG  391

Query  255  GKK  247
            GKK
Sbjct  392  GKK  394



>ref|XP_010245345.1| PREDICTED: obg-like ATPase 1 [Nelumbo nucifera]
Length=394

 Score =   352 bits (903),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 168/183 (92%), Positives = 172/183 (94%), Gaps = 0/183 (0%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHGGELIIPFSAALERSLA  616
            EI NT Q+LTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHGGE IIPFSA LE++L 
Sbjct  212  EIMNTLQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHGGETIIPFSAVLEKNLT  271

Query  615  DMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAG  436
            DMP DEAAKYC ENKVQSALPKIIK GFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAG
Sbjct  272  DMPEDEAAKYCAENKVQSALPKIIKIGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAG  331

Query  435  AIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGG  256
             IHTDFERGFICAEVMKFEDLKELGSE AVKA GKYRQEGKTYVVQDGD+IFFKFNVSGG
Sbjct  332  VIHTDFERGFICAEVMKFEDLKELGSESAVKAAGKYRQEGKTYVVQDGDIIFFKFNVSGG  391

Query  255  GKK  247
            GKK
Sbjct  392  GKK  394



>ref|XP_007147477.1| hypothetical protein PHAVU_006G127800g [Phaseolus vulgaris]
 gb|ESW19471.1| hypothetical protein PHAVU_006G127800g [Phaseolus vulgaris]
Length=394

 Score =   351 bits (901),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 166/183 (91%), Positives = 174/183 (95%), Gaps = 0/183 (0%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHGGELIIPFSAALERSLA  616
            EI N+FQ+LTAKPVVYLVNM EKDYQRKKNKFLPKIHAWVQEHGGE IIPFS A ER+L+
Sbjct  212  EILNSFQLLTAKPVVYLVNMTEKDYQRKKNKFLPKIHAWVQEHGGEQIIPFSCAFERNLS  271

Query  615  DMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAG  436
            D+PPDEAAKYCEENK+QSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAG
Sbjct  272  DLPPDEAAKYCEENKIQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAG  331

Query  435  AIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGG  256
            AIHTDFERGFICAEVMKFEDLKE  SE AVKA GKY+QEGKTYVVQDGD+IFFKFNVSGG
Sbjct  332  AIHTDFERGFICAEVMKFEDLKEHSSESAVKAAGKYKQEGKTYVVQDGDIIFFKFNVSGG  391

Query  255  GKK  247
            GKK
Sbjct  392  GKK  394



>ref|XP_011037748.1| PREDICTED: obg-like ATPase 1 [Populus euphratica]
Length=394

 Score =   351 bits (901),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 166/183 (91%), Positives = 173/183 (95%), Gaps = 0/183 (0%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHGGELIIPFSAALERSLA  616
            EI NTFQ+LTAKPVVYL+NMNEKDYQRKKNKFLPKIHAWVQEHGGE IIPFS  LER+LA
Sbjct  212  EILNTFQLLTAKPVVYLINMNEKDYQRKKNKFLPKIHAWVQEHGGETIIPFSCILERTLA  271

Query  615  DMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAG  436
            DM PDEAAKYCEENK+QS LPKIIK GFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAG
Sbjct  272  DMLPDEAAKYCEENKLQSCLPKIIKIGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAG  331

Query  435  AIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGG  256
             IHTDFERGFICAEVMKF+DLKELGSE AVKA GKY+QEGKTYVVQDGD+IFFKFNVSGG
Sbjct  332  TIHTDFERGFICAEVMKFDDLKELGSESAVKAAGKYKQEGKTYVVQDGDIIFFKFNVSGG  391

Query  255  GKK  247
            GKK
Sbjct  392  GKK  394



>gb|AAM63059.1| putative GTP-binding protein [Arabidopsis thaliana]
Length=394

 Score =   351 bits (900),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 163/183 (89%), Positives = 175/183 (96%), Gaps = 0/183 (0%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHGGELIIPFSAALERSLA  616
            EI NTFQ+L+AKPVVYL+N+NE+DYQRKKNKFLPKIHAWVQEHGG+ +IPFS   ERSLA
Sbjct  212  EILNTFQLLSAKPVVYLINLNERDYQRKKNKFLPKIHAWVQEHGGDTMIPFSGVFERSLA  271

Query  615  DMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAG  436
            DM PDEAAKYCEENK+QSALP+IIKTGFSAINLIYFFTAGPDEVKCWQIRRQ+KAPQAAG
Sbjct  272  DMAPDEAAKYCEENKLQSALPRIIKTGFSAINLIYFFTAGPDEVKCWQIRRQSKAPQAAG  331

Query  435  AIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGG  256
            AIHTDFERGFICAEVMKFEDLKELG+EPAVKA GKYRQEGKTY VQDGD+IFFKFNVSGG
Sbjct  332  AIHTDFERGFICAEVMKFEDLKELGNEPAVKAAGKYRQEGKTYFVQDGDIIFFKFNVSGG  391

Query  255  GKK  247
            GKK
Sbjct  392  GKK  394



>ref|XP_006377958.1| hypothetical protein POPTR_0011s16690g [Populus trichocarpa]
 gb|ERP55755.1| hypothetical protein POPTR_0011s16690g [Populus trichocarpa]
Length=394

 Score =   350 bits (899),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 165/183 (90%), Positives = 173/183 (95%), Gaps = 0/183 (0%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHGGELIIPFSAALERSLA  616
            EI NTFQ+LTAKPVVYL+NMNEKDYQRKKNKFLPKIHAWVQEHGGE IIPFS  LER+LA
Sbjct  212  EILNTFQLLTAKPVVYLINMNEKDYQRKKNKFLPKIHAWVQEHGGETIIPFSCILERTLA  271

Query  615  DMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAG  436
            DM PDEAAKYCEENK+QS LPKI+K GFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAG
Sbjct  272  DMLPDEAAKYCEENKLQSCLPKILKIGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAG  331

Query  435  AIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGG  256
             IHTDFERGFICAEVMKF+DLKELGSE AVKA GKY+QEGKTYVVQDGD+IFFKFNVSGG
Sbjct  332  TIHTDFERGFICAEVMKFDDLKELGSESAVKAAGKYKQEGKTYVVQDGDIIFFKFNVSGG  391

Query  255  GKK  247
            GKK
Sbjct  392  GKK  394



>gb|KJB69090.1| hypothetical protein B456_011G005000 [Gossypium raimondii]
Length=361

 Score =   349 bits (895),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 167/183 (91%), Positives = 173/183 (95%), Gaps = 0/183 (0%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHGGELIIPFSAALERSLA  616
            EI NTFQ+L+AKPVVYLVNM EKDYQRKKNKFLPKIHAWVQEHGGE IIPFS   ER+LA
Sbjct  179  EILNTFQLLSAKPVVYLVNMTEKDYQRKKNKFLPKIHAWVQEHGGEPIIPFSGVFERNLA  238

Query  615  DMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAG  436
            DM P +AAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQ+KAPQAAG
Sbjct  239  DMEPADAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQSKAPQAAG  298

Query  435  AIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGG  256
            AIHTDFERGFICAEVMKFEDLKELGSE AVKA GKYRQEGKTYVVQDGD+IFFKFNVSGG
Sbjct  299  AIHTDFERGFICAEVMKFEDLKELGSESAVKAAGKYRQEGKTYVVQDGDIIFFKFNVSGG  358

Query  255  GKK  247
            GKK
Sbjct  359  GKK  361



>ref|XP_010926935.1| PREDICTED: obg-like ATPase 1 [Elaeis guineensis]
 ref|XP_010926936.1| PREDICTED: obg-like ATPase 1 [Elaeis guineensis]
 ref|XP_010926937.1| PREDICTED: obg-like ATPase 1 [Elaeis guineensis]
Length=394

 Score =   350 bits (898),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 166/183 (91%), Positives = 175/183 (96%), Gaps = 0/183 (0%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHGGELIIPFSAALERSLA  616
            EI NTFQ+LTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQ+HGGE IIPFS  LE++L 
Sbjct  212  EILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQDHGGEPIIPFSCVLEKNLV  271

Query  615  DMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAG  436
            DMP DEAAKYCEENKVQSA+PKIIKTGF+AINLIYFFTAGPDEVKCWQIRRQTKAPQAAG
Sbjct  272  DMPEDEAAKYCEENKVQSAIPKIIKTGFAAINLIYFFTAGPDEVKCWQIRRQTKAPQAAG  331

Query  435  AIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGG  256
            AIHTDFE+GFICAEVMKFE+LKELGSE AVKA GKYRQEGKTYVVQDGD+IFFKFNVSGG
Sbjct  332  AIHTDFEKGFICAEVMKFEELKELGSEAAVKAAGKYRQEGKTYVVQDGDIIFFKFNVSGG  391

Query  255  GKK  247
            GKK
Sbjct  392  GKK  394



>ref|XP_006360314.1| PREDICTED: obg-like ATPase 1-like [Solanum tuberosum]
Length=394

 Score =   350 bits (898),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 165/183 (90%), Positives = 174/183 (95%), Gaps = 0/183 (0%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHGGELIIPFSAALERSLA  616
            E  NTFQ+LTAKP+VYLVNMNEKDYQRKKNKFLPKIHAWVQEHGGE+IIPFSAA+ER+LA
Sbjct  212  EFLNTFQLLTAKPIVYLVNMNEKDYQRKKNKFLPKIHAWVQEHGGEIIIPFSAAVERNLA  271

Query  615  DMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAG  436
            DMPPDEAAKYCEENK+ S LPKIIKTGF+AINLIYFFTAGPDEVKCWQIRR  KAPQAAG
Sbjct  272  DMPPDEAAKYCEENKLISCLPKIIKTGFAAINLIYFFTAGPDEVKCWQIRRLMKAPQAAG  331

Query  435  AIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGG  256
             IHTDFERGFICAEVMKFEDLKELGSE AVKA GKY+QEGKTYVVQDGD+IFFKFNVSGG
Sbjct  332  TIHTDFERGFICAEVMKFEDLKELGSESAVKAAGKYKQEGKTYVVQDGDIIFFKFNVSGG  391

Query  255  GKK  247
            GKK
Sbjct  392  GKK  394



>gb|KJB69089.1| hypothetical protein B456_011G005000 [Gossypium raimondii]
Length=394

 Score =   350 bits (898),  Expect = 8e-116, Method: Compositional matrix adjust.
 Identities = 167/183 (91%), Positives = 173/183 (95%), Gaps = 0/183 (0%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHGGELIIPFSAALERSLA  616
            EI NTFQ+L+AKPVVYLVNM EKDYQRKKNKFLPKIHAWVQEHGGE IIPFS   ER+LA
Sbjct  212  EILNTFQLLSAKPVVYLVNMTEKDYQRKKNKFLPKIHAWVQEHGGEPIIPFSGVFERNLA  271

Query  615  DMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAG  436
            DM P +AAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQ+KAPQAAG
Sbjct  272  DMEPADAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQSKAPQAAG  331

Query  435  AIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGG  256
            AIHTDFERGFICAEVMKFEDLKELGSE AVKA GKYRQEGKTYVVQDGD+IFFKFNVSGG
Sbjct  332  AIHTDFERGFICAEVMKFEDLKELGSESAVKAAGKYRQEGKTYVVQDGDIIFFKFNVSGG  391

Query  255  GKK  247
            GKK
Sbjct  392  GKK  394



>gb|KFK44867.1| hypothetical protein AALP_AA1G312800 [Arabis alpina]
Length=394

 Score =   350 bits (897),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 162/183 (89%), Positives = 175/183 (96%), Gaps = 0/183 (0%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHGGELIIPFSAALERSLA  616
            EI NTFQ+L+AKPVVYL+NMNE+DYQRKKNKFLPKIHAWVQEHGG+ +IPFS   ER++A
Sbjct  212  EILNTFQLLSAKPVVYLINMNERDYQRKKNKFLPKIHAWVQEHGGDTMIPFSGVFERTIA  271

Query  615  DMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAG  436
            DM PDEAAKYCEENK+QSALP+IIKTGFSAINLIYFFTAGPDEVKCWQIRRQ+KAPQAAG
Sbjct  272  DMAPDEAAKYCEENKLQSALPRIIKTGFSAINLIYFFTAGPDEVKCWQIRRQSKAPQAAG  331

Query  435  AIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGG  256
            AIHTDFERGFICAEVMKFEDLKELG+E AVKA GKYRQEGKTYVVQDGD+IFFKFNVSGG
Sbjct  332  AIHTDFERGFICAEVMKFEDLKELGNETAVKAAGKYRQEGKTYVVQDGDIIFFKFNVSGG  391

Query  255  GKK  247
            GKK
Sbjct  392  GKK  394



>ref|XP_009803590.1| PREDICTED: obg-like ATPase 1 [Nicotiana sylvestris]
Length=394

 Score =   349 bits (896),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 164/183 (90%), Positives = 174/183 (95%), Gaps = 0/183 (0%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHGGELIIPFSAALERSLA  616
            E  NTFQ+LTAKPVVYLVNMNEKDY RKKNKFLPKIHAWVQEHGGE+IIPFSAA+ER+LA
Sbjct  212  EFLNTFQLLTAKPVVYLVNMNEKDYARKKNKFLPKIHAWVQEHGGEIIIPFSAAVERNLA  271

Query  615  DMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAG  436
            DMPPDEA+KYCEENK+QS LPKIIKTGF+AINLIYFFTAGPDEVKCWQIRR  KAPQAAG
Sbjct  272  DMPPDEASKYCEENKLQSCLPKIIKTGFAAINLIYFFTAGPDEVKCWQIRRLMKAPQAAG  331

Query  435  AIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGG  256
             IHTDFERGFICAEVMKF+DLKELGSE AVKA GKY+QEGKTYVVQDGD+IFFKFNVSGG
Sbjct  332  TIHTDFERGFICAEVMKFDDLKELGSEAAVKAAGKYKQEGKTYVVQDGDIIFFKFNVSGG  391

Query  255  GKK  247
            GKK
Sbjct  392  GKK  394



>gb|KHF97630.1| Obg-like ATPase 1 [Gossypium arboreum]
Length=394

 Score =   349 bits (896),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 166/183 (91%), Positives = 173/183 (95%), Gaps = 0/183 (0%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHGGELIIPFSAALERSLA  616
            EI NTFQ+L+AKPVVYLVNM E+DYQRKKNKFLPKIHAWVQEHGGE IIPFS   ER+LA
Sbjct  212  EILNTFQLLSAKPVVYLVNMTERDYQRKKNKFLPKIHAWVQEHGGEPIIPFSGVFERNLA  271

Query  615  DMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAG  436
            DM P +AAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQ+KAPQAAG
Sbjct  272  DMEPADAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQSKAPQAAG  331

Query  435  AIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGG  256
            AIHTDFERGFICAEVMKFEDLKELGSE AVKA GKYRQEGKTYVVQDGD+IFFKFNVSGG
Sbjct  332  AIHTDFERGFICAEVMKFEDLKELGSESAVKAAGKYRQEGKTYVVQDGDIIFFKFNVSGG  391

Query  255  GKK  247
            GKK
Sbjct  392  GKK  394



>ref|XP_009412029.1| PREDICTED: obg-like ATPase 1 [Musa acuminata subsp. malaccensis]
Length=394

 Score =   349 bits (895),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 166/183 (91%), Positives = 172/183 (94%), Gaps = 0/183 (0%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHGGELIIPFSAALERSLA  616
            EI N+FQ+LTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHGGE IIP S  LE+ L 
Sbjct  212  EILNSFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHGGEPIIPVSCVLEKKLV  271

Query  615  DMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAG  436
            DMP DEAAKYCEENKVQS LPKIIKTGF+AINLIYFFTAGPDEVKCWQIRRQTKAPQAAG
Sbjct  272  DMPEDEAAKYCEENKVQSVLPKIIKTGFAAINLIYFFTAGPDEVKCWQIRRQTKAPQAAG  331

Query  435  AIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGG  256
            AIHTDFERGFICAEVMKF+DLKELGSE AVKA GKYRQEGKTYVVQDGD+IFFKFNVSGG
Sbjct  332  AIHTDFERGFICAEVMKFDDLKELGSESAVKAAGKYRQEGKTYVVQDGDIIFFKFNVSGG  391

Query  255  GKK  247
            GKK
Sbjct  392  GKK  394



>ref|XP_011039799.1| PREDICTED: obg-like ATPase 1 [Populus euphratica]
Length=394

 Score =   349 bits (895),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 165/183 (90%), Positives = 171/183 (93%), Gaps = 0/183 (0%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHGGELIIPFSAALERSLA  616
            EI NTFQ+LTAKPVVYLVNMNE+DYQRKKNKFLPKIH WVQEHGGE IIPFS  LER+LA
Sbjct  212  EILNTFQLLTAKPVVYLVNMNERDYQRKKNKFLPKIHTWVQEHGGETIIPFSCVLERNLA  271

Query  615  DMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAG  436
            DM P E AKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTK PQAAG
Sbjct  272  DMLPHEGAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKTPQAAG  331

Query  435  AIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGG  256
             IHTDFERGFICAEVMKF+DLKELGSE AVKA GKY+QEGKTYVVQDGD+IFFKFNVSGG
Sbjct  332  TIHTDFERGFICAEVMKFDDLKELGSESAVKAAGKYKQEGKTYVVQDGDIIFFKFNVSGG  391

Query  255  GKK  247
            GKK
Sbjct  392  GKK  394



>emb|CDY12460.1| BnaC08g09490D [Brassica napus]
Length=394

 Score =   349 bits (895),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 163/183 (89%), Positives = 174/183 (95%), Gaps = 0/183 (0%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHGGELIIPFSAALERSLA  616
            EI NTFQ+L+AKPVVYL+NMNE+DYQRKKNKFLPKIHAWVQEHGG+ +IPFS   ERSLA
Sbjct  212  EILNTFQLLSAKPVVYLINMNERDYQRKKNKFLPKIHAWVQEHGGDTMIPFSGVFERSLA  271

Query  615  DMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAG  436
            DM PDEAAKYCEENK+QSALP+IIKTGFSAINLIYFFTAGPDEVKCWQIRRQ+KAPQAAG
Sbjct  272  DMLPDEAAKYCEENKLQSALPRIIKTGFSAINLIYFFTAGPDEVKCWQIRRQSKAPQAAG  331

Query  435  AIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGG  256
            AIHTDFERGFICAEVMKFEDLKELG+E AVK  GKYRQEGKTYVVQDGD+IFFKFNVSGG
Sbjct  332  AIHTDFERGFICAEVMKFEDLKELGNETAVKGAGKYRQEGKTYVVQDGDIIFFKFNVSGG  391

Query  255  GKK  247
            GKK
Sbjct  392  GKK  394



>ref|XP_006415450.1| hypothetical protein EUTSA_v10007733mg [Eutrema salsugineum]
 gb|ESQ33803.1| hypothetical protein EUTSA_v10007733mg [Eutrema salsugineum]
Length=419

 Score =   349 bits (896),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 162/183 (89%), Positives = 174/183 (95%), Gaps = 0/183 (0%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHGGELIIPFSAALERSLA  616
            EI NTFQ+L+AKPVVYL+NMNE+DYQRKKNKFLPKIHAWVQEHGG+ +IPFS   ERSLA
Sbjct  237  EILNTFQLLSAKPVVYLINMNERDYQRKKNKFLPKIHAWVQEHGGDTMIPFSGVFERSLA  296

Query  615  DMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAG  436
            DMPPDEAAKYCEENK+QSALP+IIKTGFSAINLIYFFTAGPDEVKCWQIRR +KAPQAAG
Sbjct  297  DMPPDEAAKYCEENKLQSALPRIIKTGFSAINLIYFFTAGPDEVKCWQIRRLSKAPQAAG  356

Query  435  AIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGG  256
            AIHTDFERGFICAEVMKFEDLKELG+E AVK  GKYRQEGKTY+VQDGD+IFFKFNVSGG
Sbjct  357  AIHTDFERGFICAEVMKFEDLKELGNETAVKGAGKYRQEGKTYIVQDGDIIFFKFNVSGG  416

Query  255  GKK  247
            GKK
Sbjct  417  GKK  419



>ref|XP_002300568.1| hypothetical protein POPTR_0001s47010g [Populus trichocarpa]
 gb|EEE85373.1| hypothetical protein POPTR_0001s47010g [Populus trichocarpa]
Length=394

 Score =   348 bits (894),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 166/183 (91%), Positives = 172/183 (94%), Gaps = 0/183 (0%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHGGELIIPFSAALERSLA  616
            EI NTFQ+LTAKPVVYLVNMNE+DYQRKKNKFLPKIH WVQEHGGE IIPFS  LER+LA
Sbjct  212  EILNTFQLLTAKPVVYLVNMNERDYQRKKNKFLPKIHTWVQEHGGETIIPFSCILERNLA  271

Query  615  DMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAG  436
            DM P EA KYCEENKVQSAL KIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAG
Sbjct  272  DMLPHEADKYCEENKVQSALSKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAG  331

Query  435  AIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGG  256
             IHTDFERGFICAEVMKF+DLKELGSE AVKAGGKY+QEGKTYVVQDGD+IFFKFNVSGG
Sbjct  332  TIHTDFERGFICAEVMKFDDLKELGSESAVKAGGKYKQEGKTYVVQDGDIIFFKFNVSGG  391

Query  255  GKK  247
            GKK
Sbjct  392  GKK  394



>ref|XP_009107765.1| PREDICTED: obg-like ATPase 1 [Brassica rapa]
 emb|CDY47157.1| BnaA08g05260D [Brassica napus]
Length=394

 Score =   348 bits (893),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 163/183 (89%), Positives = 174/183 (95%), Gaps = 0/183 (0%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHGGELIIPFSAALERSLA  616
            EI NTFQ+L+AKPVVYL+NMNE+DYQRKKNKFLPKIHAWVQEHGG+ +IPFS   ERSLA
Sbjct  212  EILNTFQLLSAKPVVYLINMNERDYQRKKNKFLPKIHAWVQEHGGDTMIPFSGVFERSLA  271

Query  615  DMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAG  436
            DM PDEAAKYCEENK+QSALP+IIKTGFSAINLIYFFTAGPDEVKCWQIRRQ+KAPQAAG
Sbjct  272  DMLPDEAAKYCEENKLQSALPRIIKTGFSAINLIYFFTAGPDEVKCWQIRRQSKAPQAAG  331

Query  435  AIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGG  256
            AIHTDFERGFICAEVMKFEDLKELG+E AVK  GKYRQEGKTYVVQDGD+IFFKFNVSGG
Sbjct  332  AIHTDFERGFICAEVMKFEDLKELGNETAVKGAGKYRQEGKTYVVQDGDIIFFKFNVSGG  391

Query  255  GKK  247
            GKK
Sbjct  392  GKK  394



>ref|XP_010519060.1| PREDICTED: obg-like ATPase 1 [Tarenaya hassleriana]
Length=395

 Score =   348 bits (893),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 166/183 (91%), Positives = 173/183 (95%), Gaps = 0/183 (0%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHGGELIIPFSAALERSLA  616
            EI NTFQ+L+AKPVVYLVNM E+DYQRKKNKFLPKIHAWVQEHGGE IIPFS  LER+LA
Sbjct  213  EILNTFQLLSAKPVVYLVNMTERDYQRKKNKFLPKIHAWVQEHGGEQIIPFSGVLERNLA  272

Query  615  DMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAG  436
            DM PDEAAKYCEENKVQSAL KIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAG
Sbjct  273  DMLPDEAAKYCEENKVQSALSKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAG  332

Query  435  AIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGG  256
             IHTDFE+GFICAEVMKFEDLKELG+E AVKA GKYRQEGKTYVVQDGD+IFFKFNVSGG
Sbjct  333  TIHTDFEKGFICAEVMKFEDLKELGNEGAVKAAGKYRQEGKTYVVQDGDIIFFKFNVSGG  392

Query  255  GKK  247
            GKK
Sbjct  393  GKK  395



>ref|XP_009603694.1| PREDICTED: obg-like ATPase 1 {ECO:0000255|HAMAP-Rule:MF_03167} 
[Nicotiana tomentosiformis]
Length=394

 Score =   348 bits (892),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 163/183 (89%), Positives = 174/183 (95%), Gaps = 0/183 (0%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHGGELIIPFSAALERSLA  616
            E  NTFQ+LTAKPVVYLVNMNEKDY RKKNKFLPKIHAWVQEHGGE+IIPFSAA+ER+LA
Sbjct  212  EFLNTFQLLTAKPVVYLVNMNEKDYARKKNKFLPKIHAWVQEHGGEIIIPFSAAVERNLA  271

Query  615  DMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAG  436
            DMPPDEA++YCEENK+QS LPKIIKTGF+AINLIYFFTAGPDEVKCWQIRR  KAPQAAG
Sbjct  272  DMPPDEASQYCEENKLQSCLPKIIKTGFAAINLIYFFTAGPDEVKCWQIRRLMKAPQAAG  331

Query  435  AIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGG  256
             IHTDFERGFICAEVMKF+DLKELGSE AVKA GKY+QEGKTYVVQDGD+IFFKFNVSGG
Sbjct  332  TIHTDFERGFICAEVMKFDDLKELGSEAAVKAAGKYKQEGKTYVVQDGDIIFFKFNVSGG  391

Query  255  GKK  247
            GKK
Sbjct  392  GKK  394



>emb|CDX77584.1| BnaA07g07220D [Brassica napus]
Length=394

 Score =   347 bits (891),  Expect = 9e-115, Method: Compositional matrix adjust.
 Identities = 162/183 (89%), Positives = 174/183 (95%), Gaps = 0/183 (0%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHGGELIIPFSAALERSLA  616
            EI NTFQ+L+AKPVVYL+NMNE+DYQRKKNKFLPKIHAWVQEHGG+ +IPFS   ER+LA
Sbjct  212  EILNTFQLLSAKPVVYLINMNERDYQRKKNKFLPKIHAWVQEHGGDTMIPFSGVFERTLA  271

Query  615  DMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAG  436
            DM PDEAAKYCEENK+QSALP+IIKTGFSAINLIYFFTAGPDEVKCWQIRRQ+KAPQAAG
Sbjct  272  DMLPDEAAKYCEENKLQSALPRIIKTGFSAINLIYFFTAGPDEVKCWQIRRQSKAPQAAG  331

Query  435  AIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGG  256
            AIHTDFERGFICAEVMKFEDLKELG+E AVK  GKYRQEGKTYVVQDGD+IFFKFNVSGG
Sbjct  332  AIHTDFERGFICAEVMKFEDLKELGNETAVKGAGKYRQEGKTYVVQDGDIIFFKFNVSGG  391

Query  255  GKK  247
            GKK
Sbjct  392  GKK  394



>ref|XP_009144765.1| PREDICTED: obg-like ATPase 1 [Brassica rapa]
Length=394

 Score =   347 bits (891),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 162/183 (89%), Positives = 174/183 (95%), Gaps = 0/183 (0%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHGGELIIPFSAALERSLA  616
            EI NTFQ+L+AKPVVYL+NMNE+DYQRKKNKFLPKIHAWVQEHGG+ +IPFS   ER+LA
Sbjct  212  EILNTFQLLSAKPVVYLINMNERDYQRKKNKFLPKIHAWVQEHGGDTMIPFSGVFERTLA  271

Query  615  DMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAG  436
            DM PDEAAKYCEENK+QSALP+IIKTGFSAINLIYFFTAGPDEVKCWQIRRQ+KAPQAAG
Sbjct  272  DMLPDEAAKYCEENKLQSALPRIIKTGFSAINLIYFFTAGPDEVKCWQIRRQSKAPQAAG  331

Query  435  AIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGG  256
            AIHTDFERGFICAEVMKFEDLKELG+E AVK  GKYRQEGKTYVVQDGD+IFFKFNVSGG
Sbjct  332  AIHTDFERGFICAEVMKFEDLKELGNETAVKGAGKYRQEGKTYVVQDGDIIFFKFNVSGG  391

Query  255  GKK  247
            GKK
Sbjct  392  GKK  394



>emb|CDX98216.1| BnaC07g08820D [Brassica napus]
Length=394

 Score =   347 bits (891),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 162/183 (89%), Positives = 174/183 (95%), Gaps = 0/183 (0%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHGGELIIPFSAALERSLA  616
            EI NTFQ+L+AKPVVYL+NMNE+DYQRKKNKFLPKIHAWVQEHGG+ +IPFS   ER+LA
Sbjct  212  EILNTFQLLSAKPVVYLINMNERDYQRKKNKFLPKIHAWVQEHGGDTMIPFSGVFERTLA  271

Query  615  DMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAG  436
            DM PDEAAKYCEENK+QSALP+IIKTGFSAINLIYFFTAGPDEVKCWQIRRQ+KAPQAAG
Sbjct  272  DMLPDEAAKYCEENKLQSALPRIIKTGFSAINLIYFFTAGPDEVKCWQIRRQSKAPQAAG  331

Query  435  AIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGG  256
            AIHTDFERGFICAEVMKFEDLKELG+E AVK  GKYRQEGKTYVVQDGD+IFFKFNVSGG
Sbjct  332  AIHTDFERGFICAEVMKFEDLKELGNETAVKGAGKYRQEGKTYVVQDGDIIFFKFNVSGG  391

Query  255  GKK  247
            GKK
Sbjct  392  GKK  394



>ref|NP_001061206.2| Os08g0199300 [Oryza sativa Japonica Group]
 dbj|BAD03576.1| putative GTP-binding protein [Oryza sativa Japonica Group]
 dbj|BAG88257.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG93810.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE68206.1| hypothetical protein OsJ_26368 [Oryza sativa Japonica Group]
 dbj|BAF23120.2| Os08g0199300 [Oryza sativa Japonica Group]
Length=394

 Score =   346 bits (888),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 163/183 (89%), Positives = 172/183 (94%), Gaps = 0/183 (0%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHGGELIIPFSAALERSLA  616
            EI NTFQ+LTAKPVVYLVNM+EKDYQRKKNKFLPKIHAWVQEHGGE IIPFS A ER LA
Sbjct  212  EILNTFQLLTAKPVVYLVNMSEKDYQRKKNKFLPKIHAWVQEHGGETIIPFSCAFERLLA  271

Query  615  DMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAG  436
            DMPPDEAAKYC EN++ S +PKIIKTGF+AI+LIYFFTAGPDEVKCWQIRRQTKAPQAAG
Sbjct  272  DMPPDEAAKYCAENQIASVIPKIIKTGFAAIHLIYFFTAGPDEVKCWQIRRQTKAPQAAG  331

Query  435  AIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGG  256
             IHTDFERGFICAEVMKF+DLKELGSE AVKA GKYRQEGKTYVVQDGD+IFFKFNVSGG
Sbjct  332  TIHTDFERGFICAEVMKFDDLKELGSESAVKAAGKYRQEGKTYVVQDGDIIFFKFNVSGG  391

Query  255  GKK  247
            GKK
Sbjct  392  GKK  394



>ref|XP_010538270.1| PREDICTED: obg-like ATPase 1 [Tarenaya hassleriana]
Length=395

 Score =   345 bits (885),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 165/183 (90%), Positives = 171/183 (93%), Gaps = 0/183 (0%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHGGELIIPFSAALERSLA  616
            EI NTFQ+LTAKPVVYLVNM E+DYQRKKNKFLPKIHAWVQEHGGE IIPFS ALER+LA
Sbjct  213  EIMNTFQLLTAKPVVYLVNMTERDYQRKKNKFLPKIHAWVQEHGGEPIIPFSGALERNLA  272

Query  615  DMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAG  436
            DM PDEAAKYCEEN VQS LPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAG
Sbjct  273  DMLPDEAAKYCEENTVQSVLPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAG  332

Query  435  AIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGG  256
             IH+DFE+GFICAEVMKFEDL ELGSE AVKA GKY+QEGKTYVV DGDVIFFKFNVSGG
Sbjct  333  TIHSDFEKGFICAEVMKFEDLMELGSEGAVKAAGKYKQEGKTYVVHDGDVIFFKFNVSGG  392

Query  255  GKK  247
            GKK
Sbjct  393  GKK  395



>ref|XP_008799072.1| PREDICTED: obg-like ATPase 1 [Phoenix dactylifera]
 ref|XP_008799073.1| PREDICTED: obg-like ATPase 1 [Phoenix dactylifera]
 ref|XP_008799075.1| PREDICTED: obg-like ATPase 1 [Phoenix dactylifera]
 ref|XP_008799076.1| PREDICTED: obg-like ATPase 1 [Phoenix dactylifera]
 ref|XP_008799077.1| PREDICTED: obg-like ATPase 1 [Phoenix dactylifera]
Length=394

 Score =   345 bits (884),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 163/183 (89%), Positives = 173/183 (95%), Gaps = 0/183 (0%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHGGELIIPFSAALERSLA  616
            EI NT Q+LTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQ+HGGE IIPFS  LE++L 
Sbjct  212  EILNTLQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQDHGGEPIIPFSCVLEKNLV  271

Query  615  DMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAG  436
            DMP DEAAKYCEENKVQSA+PKIIKTGF+AINLIYFFTAGPDEVKCWQIRRQTKAPQAAG
Sbjct  272  DMPEDEAAKYCEENKVQSAIPKIIKTGFAAINLIYFFTAGPDEVKCWQIRRQTKAPQAAG  331

Query  435  AIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGG  256
             IH+DFE+GFICAEVMKFE+LKELGSE AVKA GKYRQEGKTYVVQDGD+IFFKFNVSGG
Sbjct  332  TIHSDFEKGFICAEVMKFEELKELGSEAAVKAAGKYRQEGKTYVVQDGDIIFFKFNVSGG  391

Query  255  GKK  247
            GKK
Sbjct  392  GKK  394



>gb|EEC83063.1| hypothetical protein OsI_28170 [Oryza sativa Indica Group]
Length=394

 Score =   344 bits (883),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 162/183 (89%), Positives = 171/183 (93%), Gaps = 0/183 (0%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHGGELIIPFSAALERSLA  616
            EI NTFQ+LTAKPVVYLVNM+EKDYQRKKNKFLPKIHAWVQEHGGE IIPFS A ER LA
Sbjct  212  EILNTFQLLTAKPVVYLVNMSEKDYQRKKNKFLPKIHAWVQEHGGETIIPFSCAFERLLA  271

Query  615  DMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAG  436
            DMPPDEAAKYC EN++ S +PKIIKTGF+AI+LIYFFTAGPDEVKCWQIRRQTKAPQAAG
Sbjct  272  DMPPDEAAKYCAENQIASVIPKIIKTGFAAIHLIYFFTAGPDEVKCWQIRRQTKAPQAAG  331

Query  435  AIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGG  256
             IHTDFERGFICAEVMKF+DLKELGSE AVKA GKYRQEGKTYVVQD D+IFFKFNVSGG
Sbjct  332  TIHTDFERGFICAEVMKFDDLKELGSESAVKAAGKYRQEGKTYVVQDADIIFFKFNVSGG  391

Query  255  GKK  247
            GKK
Sbjct  392  GKK  394



>ref|XP_007022926.1| GTP binding [Theobroma cacao]
 gb|EOY25548.1| GTP binding [Theobroma cacao]
Length=394

 Score =   343 bits (881),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 164/183 (90%), Positives = 171/183 (93%), Gaps = 0/183 (0%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHGGELIIPFSAALERSLA  616
            EI NTFQ+L+AKPVVYLVNM EKDYQRKKNKFLPKIHAWVQEHGGE IIPFS   ER+L 
Sbjct  212  EILNTFQLLSAKPVVYLVNMTEKDYQRKKNKFLPKIHAWVQEHGGEPIIPFSGVFERNLV  271

Query  615  DMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAG  436
            DM  +EAAKYCEENK+QSALPKIIKTGFSAINLIYFFTAG DEVKCWQIRRQTKAPQAAG
Sbjct  272  DMESEEAAKYCEENKLQSALPKIIKTGFSAINLIYFFTAGADEVKCWQIRRQTKAPQAAG  331

Query  435  AIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGG  256
            AIHTDFERGFICAEVMKFEDLKELG+E AVKA GKYRQEGKTYVVQDGD+IFFKFNVSGG
Sbjct  332  AIHTDFERGFICAEVMKFEDLKELGNESAVKAAGKYRQEGKTYVVQDGDIIFFKFNVSGG  391

Query  255  GKK  247
            GKK
Sbjct  392  GKK  394



>ref|XP_004486463.1| PREDICTED: obg-like ATPase 1-like [Cicer arietinum]
Length=394

 Score =   343 bits (880),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 162/183 (89%), Positives = 172/183 (94%), Gaps = 0/183 (0%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHGGELIIPFSAALERSLA  616
            EI N+FQ+LTAKPVVYLVNM EKDYQRKKNKFLPKIHAWVQEHGG  +IPFS  LE++L+
Sbjct  212  EILNSFQLLTAKPVVYLVNMTEKDYQRKKNKFLPKIHAWVQEHGGGQMIPFSCVLEKNLS  271

Query  615  DMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAG  436
            DMPPDEAAKYCE N VQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRR TKAPQAAG
Sbjct  272  DMPPDEAAKYCEANNVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRLTKAPQAAG  331

Query  435  AIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGG  256
            AIHTDFE+GFICAEVMKFEDLKELG+E AVKA GKY+QEGKTYVVQDGD+IFFKFNVSGG
Sbjct  332  AIHTDFEKGFICAEVMKFEDLKELGTESAVKAAGKYKQEGKTYVVQDGDIIFFKFNVSGG  391

Query  255  GKK  247
            GKK
Sbjct  392  GKK  394



>gb|AFK48623.1| unknown [Lotus japonicus]
Length=394

 Score =   343 bits (880),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 161/183 (88%), Positives = 172/183 (94%), Gaps = 0/183 (0%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHGGELIIPFSAALERSLA  616
            +I N+FQ+LTAKPVVYLVNM EKDYQRKKNKFLPKIHAWVQEHGG  IIPFS  LER+LA
Sbjct  212  DILNSFQLLTAKPVVYLVNMTEKDYQRKKNKFLPKIHAWVQEHGGGSIIPFSGVLERNLA  271

Query  615  DMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAG  436
            D+P DE AKYCEENKVQSALP+IIKTGF+AINLIYFFTAGPDEVKCWQIRRQTKAPQAAG
Sbjct  272  DLPSDEVAKYCEENKVQSALPEIIKTGFAAINLIYFFTAGPDEVKCWQIRRQTKAPQAAG  331

Query  435  AIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGG  256
             IHTDFERGFICAEVMKF+DLKELG+E AVKA GKY+QEGKTYVVQDGD+IFFKFNVSGG
Sbjct  332  TIHTDFERGFICAEVMKFDDLKELGTESAVKAAGKYKQEGKTYVVQDGDIIFFKFNVSGG  391

Query  255  GKK  247
            GKK
Sbjct  392  GKK  394



>ref|XP_008445378.1| PREDICTED: obg-like ATPase 1 [Cucumis melo]
Length=395

 Score =   342 bits (878),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 164/184 (89%), Positives = 171/184 (93%), Gaps = 1/184 (1%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHGGELIIPFSAALERSLA  616
            EI NTFQ+LTAKPVVYLVNM EKDYQRKKNKFLPKIHAWVQEHGGE IIPFS  LER+LA
Sbjct  212  EILNTFQLLTAKPVVYLVNMTEKDYQRKKNKFLPKIHAWVQEHGGETIIPFSGVLERNLA  271

Query  615  DMP-PDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAA  439
            DM  P +  KYCEENK+QSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAA
Sbjct  272  DMSSPADVEKYCEENKIQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAA  331

Query  438  GAIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSG  259
            G IHTDFE+GFICAEVMKFEDLKELGSE AVKA GKY+QEGKTYVVQDGD+IFFKFNVSG
Sbjct  332  GTIHTDFEKGFICAEVMKFEDLKELGSETAVKAAGKYKQEGKTYVVQDGDIIFFKFNVSG  391

Query  258  GGKK  247
            GGKK
Sbjct  392  GGKK  395



>ref|XP_006659204.1| PREDICTED: obg-like ATPase 1-like [Oryza brachyantha]
Length=394

 Score =   342 bits (877),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 161/183 (88%), Positives = 171/183 (93%), Gaps = 0/183 (0%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHGGELIIPFSAALERSLA  616
            EI NTFQ+LTAKPVVYLVNM+EKDYQRKKNKFLPKIHAWVQEHGGE IIPFS A ER+LA
Sbjct  212  EILNTFQLLTAKPVVYLVNMSEKDYQRKKNKFLPKIHAWVQEHGGETIIPFSCAFERNLA  271

Query  615  DMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAG  436
            DMP DEAAKYC EN++ S + KIIKTGF+AI+LIYFFTAGPDEV+CWQIRRQTKAPQAAG
Sbjct  272  DMPQDEAAKYCAENQITSVISKIIKTGFAAIHLIYFFTAGPDEVRCWQIRRQTKAPQAAG  331

Query  435  AIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGG  256
             IHTDFERGFICAEVMKFEDLKELGSE AVKA GKYRQEGKTYVVQDGD+IFFKFNVSGG
Sbjct  332  TIHTDFERGFICAEVMKFEDLKELGSESAVKAAGKYRQEGKTYVVQDGDIIFFKFNVSGG  391

Query  255  GKK  247
            GKK
Sbjct  392  GKK  394



>ref|XP_003573525.1| PREDICTED: obg-like ATPase 1 [Brachypodium distachyon]
Length=394

 Score =   342 bits (877),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 161/183 (88%), Positives = 170/183 (93%), Gaps = 0/183 (0%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHGGELIIPFSAALERSLA  616
            EI NTFQ+LTAKPVVYLVNM+EKDYQRKKNKFLPKIHAWVQEHGGE IIPFS A E+ L 
Sbjct  212  EILNTFQLLTAKPVVYLVNMSEKDYQRKKNKFLPKIHAWVQEHGGETIIPFSCAFEQKLV  271

Query  615  DMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAG  436
            DMP DEAAKYC EN++ S +PKIIKTGF+AI+LIYFFTAGPDEVKCWQIRRQTKAPQAAG
Sbjct  272  DMPADEAAKYCAENQITSLIPKIIKTGFAAIHLIYFFTAGPDEVKCWQIRRQTKAPQAAG  331

Query  435  AIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGG  256
             IHTDFERGFICAEVMKFEDLKELGSE AVKA GKYRQEGKTYVVQDGD+IFFKFNVSGG
Sbjct  332  TIHTDFERGFICAEVMKFEDLKELGSESAVKAAGKYRQEGKTYVVQDGDIIFFKFNVSGG  391

Query  255  GKK  247
            GKK
Sbjct  392  GKK  394



>gb|ACJ85184.1| unknown [Medicago truncatula]
Length=394

 Score =   342 bits (876),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 160/183 (87%), Positives = 171/183 (93%), Gaps = 0/183 (0%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHGGELIIPFSAALERSLA  616
            EI N+FQ+LTAKPVVYL+NM E+DYQRKKNKFLPKIH WVQEHGG  +IPFS  LE++L+
Sbjct  212  EILNSFQLLTAKPVVYLINMTERDYQRKKNKFLPKIHTWVQEHGGGQMIPFSCVLEKNLS  271

Query  615  DMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAG  436
            DMPPDEAAKYCE N VQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRR TKAPQAAG
Sbjct  272  DMPPDEAAKYCEANNVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRLTKAPQAAG  331

Query  435  AIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGG  256
            AIHTDFERGFICAEVMKF+DLKELGSE AVKA GKY+QEGKTYVVQDGD+IFFKFNVSGG
Sbjct  332  AIHTDFERGFICAEVMKFDDLKELGSESAVKAAGKYKQEGKTYVVQDGDIIFFKFNVSGG  391

Query  255  GKK  247
            GKK
Sbjct  392  GKK  394



>ref|XP_003594539.1| Obg-like ATPase [Medicago truncatula]
 gb|AES64790.1| GTP-binding protein [Medicago truncatula]
Length=394

 Score =   342 bits (876),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 160/183 (87%), Positives = 171/183 (93%), Gaps = 0/183 (0%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHGGELIIPFSAALERSLA  616
            EI N+FQ+LTAKPVVYL+NM E+DYQRKKNKFLPKIH WVQEHGG  +IPFS  LE++L+
Sbjct  212  EILNSFQLLTAKPVVYLINMTERDYQRKKNKFLPKIHTWVQEHGGGQMIPFSCVLEKNLS  271

Query  615  DMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAG  436
            DMPPDEAAKYCE N VQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRR TKAPQAAG
Sbjct  272  DMPPDEAAKYCEANNVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRLTKAPQAAG  331

Query  435  AIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGG  256
            AIHTDFERGFICAEVMKF+DLKELGSE AVKA GKY+QEGKTYVVQDGD+IFFKFNVSGG
Sbjct  332  AIHTDFERGFICAEVMKFDDLKELGSESAVKAAGKYKQEGKTYVVQDGDIIFFKFNVSGG  391

Query  255  GKK  247
            GKK
Sbjct  392  GKK  394



>ref|XP_010687083.1| PREDICTED: obg-like ATPase 1 [Beta vulgaris subsp. vulgaris]
Length=394

 Score =   341 bits (874),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 161/183 (88%), Positives = 170/183 (93%), Gaps = 0/183 (0%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHGGELIIPFSAALERSLA  616
            E+ NTFQ+LTAKPVVYLVNM E+DYQRKKNKFLPKIHAWVQEHG E IIPFS   ER+ A
Sbjct  212  EVLNTFQLLTAKPVVYLVNMTERDYQRKKNKFLPKIHAWVQEHGAEPIIPFSGVFERNYA  271

Query  615  DMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAG  436
            DMP DEAAKYC+ENKVQSA+PKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAG
Sbjct  272  DMPEDEAAKYCDENKVQSAIPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAG  331

Query  435  AIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGG  256
             IHTDFERGFICAEVMK+EDLKE G+E AVKA GKYRQEGKTYVVQDGD+IFFKFNVSGG
Sbjct  332  TIHTDFERGFICAEVMKYEDLKEHGNEGAVKAAGKYRQEGKTYVVQDGDIIFFKFNVSGG  391

Query  255  GKK  247
            GKK
Sbjct  392  GKK  394



>ref|XP_010941555.1| PREDICTED: obg-like ATPase 1 [Elaeis guineensis]
Length=394

 Score =   340 bits (873),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 161/183 (88%), Positives = 171/183 (93%), Gaps = 0/183 (0%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHGGELIIPFSAALERSLA  616
            EI NTFQ+LTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQ+HGGE IIPFS   E++L 
Sbjct  212  EILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQDHGGEPIIPFSCVFEKNLV  271

Query  615  DMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAG  436
            DMP  EA KYCE NK+QSA+PKIIKTGF+AINLIYFFTAGPDEVKCWQIRRQTKAPQAAG
Sbjct  272  DMPEGEAPKYCEANKIQSAIPKIIKTGFAAINLIYFFTAGPDEVKCWQIRRQTKAPQAAG  331

Query  435  AIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGG  256
            AIH+DFE+GFICAEVMKFEDLKELGSE AVKA GKYRQEGKTYVVQDGD+IFFKFNVSGG
Sbjct  332  AIHSDFEKGFICAEVMKFEDLKELGSEAAVKAAGKYRQEGKTYVVQDGDIIFFKFNVSGG  391

Query  255  GKK  247
            GKK
Sbjct  392  GKK  394



>ref|XP_004135546.1| PREDICTED: obg-like ATPase 1-like [Cucumis sativus]
 ref|XP_004158075.1| PREDICTED: obg-like ATPase 1-like [Cucumis sativus]
 gb|KGN65918.1| hypothetical protein Csa_1G538160 [Cucumis sativus]
Length=395

 Score =   340 bits (871),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 163/184 (89%), Positives = 170/184 (92%), Gaps = 1/184 (1%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHGGELIIPFSAALERSLA  616
            EI NTFQ+LTAKPVVYLVNM EKDYQRKKNKFLPKIHAWVQEHGGE IIPFS  LER+LA
Sbjct  212  EILNTFQLLTAKPVVYLVNMTEKDYQRKKNKFLPKIHAWVQEHGGETIIPFSGVLERNLA  271

Query  615  DMP-PDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAA  439
            DM  P +  KYCEENK+QSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAA
Sbjct  272  DMSSPADVEKYCEENKIQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAA  331

Query  438  GAIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSG  259
            G IHTDFE+GFICAEVMKFEDLKE GSE AVKA GKY+QEGKTYVVQDGD+IFFKFNVSG
Sbjct  332  GTIHTDFEKGFICAEVMKFEDLKEHGSETAVKAAGKYKQEGKTYVVQDGDIIFFKFNVSG  391

Query  258  GGKK  247
            GGKK
Sbjct  392  GGKK  395



>gb|ABK25108.1| unknown [Picea sitchensis]
Length=392

 Score =   339 bits (869),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 161/182 (88%), Positives = 169/182 (93%), Gaps = 0/182 (0%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHGGELIIPFSAALERSLA  616
            EI NTFQ+L+AKPVVYLVNM EKDYQRKKNK+LPKIH+WVQ HGGE IIPFS ALE+ LA
Sbjct  211  EILNTFQLLSAKPVVYLVNMTEKDYQRKKNKYLPKIHSWVQGHGGEPIIPFSGALEQKLA  270

Query  615  DMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAG  436
            DMPPDEAAKYCEENK QSAL KIIKTGFSAINLIYFFTAGPDEVKCWQ+R+Q KAPQAAG
Sbjct  271  DMPPDEAAKYCEENKTQSALTKIIKTGFSAINLIYFFTAGPDEVKCWQVRKQIKAPQAAG  330

Query  435  AIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGG  256
            AIHTDFERGFICAEVMK EDLKELGSE AVKAGGKYRQEGKTYVVQDGD+I FKFNVSGG
Sbjct  331  AIHTDFERGFICAEVMKVEDLKELGSESAVKAGGKYRQEGKTYVVQDGDIILFKFNVSGG  390

Query  255  GK  250
             K
Sbjct  391  KK  392



>gb|AFK49195.1| unknown [Medicago truncatula]
Length=401

 Score =   338 bits (868),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 158/183 (86%), Positives = 171/183 (93%), Gaps = 0/183 (0%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHGGELIIPFSAALERSLA  616
            EI N+FQ+LTAKPVVYL+NM E+DYQRKKNKFLPKIH WVQEHGG  +IPFS  LE++L+
Sbjct  212  EILNSFQLLTAKPVVYLINMTERDYQRKKNKFLPKIHTWVQEHGGGQMIPFSCVLEKNLS  271

Query  615  DMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAG  436
            DMPPDEAAKYCE N VQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRR TKAPQAAG
Sbjct  272  DMPPDEAAKYCEANNVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRLTKAPQAAG  331

Query  435  AIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGG  256
            AIHTDFERGFICAEVMKF+DLKELGSE AVKA GKY+QEGKTYVVQDGD+IFFKFNVSGG
Sbjct  332  AIHTDFERGFICAEVMKFDDLKELGSESAVKAAGKYKQEGKTYVVQDGDIIFFKFNVSGG  391

Query  255  GKK  247
            G++
Sbjct  392  GEE  394



>ref|NP_001150211.1| GTP-binding protein PTD004 [Zea mays]
 gb|ACF85733.1| unknown [Zea mays]
 gb|ACG38260.1| GTP-binding protein PTD004 [Zea mays]
 gb|AFW56961.1| GTP-binding protein PTD004 [Zea mays]
Length=393

 Score =   338 bits (866),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 158/183 (86%), Positives = 171/183 (93%), Gaps = 0/183 (0%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHGGELIIPFSAALERSLA  616
            EI NTFQ+L+AKPVVYLVNM+EKD+QRKKNKFLPKIHAWVQEHGGE I+PFS A E+ L 
Sbjct  211  EILNTFQLLSAKPVVYLVNMSEKDFQRKKNKFLPKIHAWVQEHGGETILPFSCAFEQKLV  270

Query  615  DMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAG  436
            DMP DEAAKYC EN++ S +PKIIKTGF+AI+LIYFFTAGPDEVKCWQIRRQTKAPQAAG
Sbjct  271  DMPEDEAAKYCAENQITSMIPKIIKTGFAAIHLIYFFTAGPDEVKCWQIRRQTKAPQAAG  330

Query  435  AIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGG  256
            AIHTDFERGFICAEVMKFEDLKELGSE AVKA GKY+QEGKTYVVQDGD+IFFKFNVSGG
Sbjct  331  AIHTDFERGFICAEVMKFEDLKELGSESAVKAAGKYKQEGKTYVVQDGDIIFFKFNVSGG  390

Query  255  GKK  247
            GKK
Sbjct  391  GKK  393



>ref|XP_002445191.1| hypothetical protein SORBIDRAFT_07g005700 [Sorghum bicolor]
 gb|EES14686.1| hypothetical protein SORBIDRAFT_07g005700 [Sorghum bicolor]
Length=393

 Score =   338 bits (866),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 158/183 (86%), Positives = 171/183 (93%), Gaps = 0/183 (0%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHGGELIIPFSAALERSLA  616
            EI NTFQ+L+AKPVVYLVNM+EKD+QRKKNKFLPKIHAWVQEHGGE I+PFS A E+ L 
Sbjct  211  EILNTFQLLSAKPVVYLVNMSEKDFQRKKNKFLPKIHAWVQEHGGETILPFSCAFEQKLV  270

Query  615  DMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAG  436
            DMP DEAAKYC EN++ S +PKIIKTGF+AI+LIYFFTAGPDEVKCWQIRRQTKAPQAAG
Sbjct  271  DMPEDEAAKYCAENQITSMIPKIIKTGFAAIHLIYFFTAGPDEVKCWQIRRQTKAPQAAG  330

Query  435  AIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGG  256
            AIHTDFERGFICAEVMKFEDLKELGSE AVKA GKY+QEGKTYVVQDGD+IFFKFNVSGG
Sbjct  331  AIHTDFERGFICAEVMKFEDLKELGSESAVKAAGKYKQEGKTYVVQDGDIIFFKFNVSGG  390

Query  255  GKK  247
            GKK
Sbjct  391  GKK  393



>ref|XP_004972629.1| PREDICTED: obg-like ATPase 1-like [Setaria italica]
Length=393

 Score =   337 bits (865),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 158/183 (86%), Positives = 171/183 (93%), Gaps = 0/183 (0%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHGGELIIPFSAALERSLA  616
            EI NTFQ+LTAKPVVYLVNM+EKD+QRKKNKFLPKIHAWVQEHGGE I+PFS A E+ L 
Sbjct  211  EILNTFQLLTAKPVVYLVNMSEKDFQRKKNKFLPKIHAWVQEHGGETILPFSCAFEQKLV  270

Query  615  DMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAG  436
            DMP DEAAKYC EN++ S +PKIIKTGF+AI+LIYFFTAGPDEVKCWQIRRQTKAPQAAG
Sbjct  271  DMPEDEAAKYCAENQITSMIPKIIKTGFAAIHLIYFFTAGPDEVKCWQIRRQTKAPQAAG  330

Query  435  AIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGG  256
            AIHTDFERGFICAEVMKF++LKELGSE AVKA GKYRQEGKTYVVQDGD+IFFKFNVSGG
Sbjct  331  AIHTDFERGFICAEVMKFDELKELGSESAVKAAGKYRQEGKTYVVQDGDIIFFKFNVSGG  390

Query  255  GKK  247
            GKK
Sbjct  391  GKK  393



>ref|XP_009115125.1| PREDICTED: obg-like ATPase 1 [Brassica rapa]
Length=395

 Score =   331 bits (849),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 154/183 (84%), Positives = 169/183 (92%), Gaps = 0/183 (0%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHGGELIIPFSAALERSLA  616
            EI NTFQ+L+AKPVVYL+NMNE+DYQRKKNKFLPKIHAWVQEHGG+ +IPFS   ERSLA
Sbjct  213  EILNTFQLLSAKPVVYLINMNERDYQRKKNKFLPKIHAWVQEHGGDTMIPFSGVFERSLA  272

Query  615  DMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAG  436
            DM PDEAAKYCEENK+QSALP+IIKTGFSAINLIYFFT G  EV+CWQIRRQ+KAPQAAG
Sbjct  273  DMLPDEAAKYCEENKLQSALPRIIKTGFSAINLIYFFTVGHGEVRCWQIRRQSKAPQAAG  332

Query  435  AIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGG  256
            AIH+DFERGFICAEVMKFED+KE G+E AVK  GKYRQEGKTYVV DGD+I+FKFNVSGG
Sbjct  333  AIHSDFERGFICAEVMKFEDIKEYGNETAVKGAGKYRQEGKTYVVLDGDIIYFKFNVSGG  392

Query  255  GKK  247
            GKK
Sbjct  393  GKK  395



>emb|CDY02308.1| BnaA09g25940D [Brassica napus]
Length=394

 Score =   330 bits (846),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 154/183 (84%), Positives = 168/183 (92%), Gaps = 0/183 (0%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHGGELIIPFSAALERSLA  616
            EI NTFQ+L+AKPVVYL+NMNE+DYQRKKNKFLPKIHAWVQEHGG+ +IPFS   ERSLA
Sbjct  212  EILNTFQLLSAKPVVYLINMNERDYQRKKNKFLPKIHAWVQEHGGDTMIPFSGVFERSLA  271

Query  615  DMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAG  436
            DM PDEAAKYCEENK+QSALP+IIKTGFSAINLIYFFT G  EV+CWQIRRQ+KAPQAAG
Sbjct  272  DMLPDEAAKYCEENKLQSALPRIIKTGFSAINLIYFFTVGHGEVRCWQIRRQSKAPQAAG  331

Query  435  AIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGG  256
            AIH+DFERGFICAEVMKFED+KE G+E AVK  GKYRQEGKTYVV DGD+I FKFNVSGG
Sbjct  332  AIHSDFERGFICAEVMKFEDIKEYGNETAVKGAGKYRQEGKTYVVLDGDIIHFKFNVSGG  391

Query  255  GKK  247
            GKK
Sbjct  392  GKK  394



>emb|CDY09558.1| BnaC05g23610D [Brassica napus]
Length=397

 Score =   330 bits (845),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 153/183 (84%), Positives = 169/183 (92%), Gaps = 0/183 (0%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHGGELIIPFSAALERSLA  616
            EI NTFQ+L+AKPVVYL+NMNE+DYQRKKNKFLPKIHAWVQEHGG+ +IPFS   ERSLA
Sbjct  215  EILNTFQLLSAKPVVYLINMNERDYQRKKNKFLPKIHAWVQEHGGDTMIPFSGVFERSLA  274

Query  615  DMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAG  436
            D+ PDEAAKYCEENK+QSALP+IIKTGFSAINLIYFFT G  EV+CWQIRRQ+KAPQAAG
Sbjct  275  DILPDEAAKYCEENKLQSALPRIIKTGFSAINLIYFFTVGHGEVRCWQIRRQSKAPQAAG  334

Query  435  AIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGG  256
            AIH+DFERGFICAEVMKFED+KE G+E AVK  GKYRQEGKTYVV DGD+I+FKFNVSGG
Sbjct  335  AIHSDFERGFICAEVMKFEDIKEFGNETAVKGAGKYRQEGKTYVVLDGDIIYFKFNVSGG  394

Query  255  GKK  247
            GKK
Sbjct  395  GKK  397



>emb|CDM85617.1| unnamed protein product [Triticum aestivum]
Length=394

 Score =   329 bits (844),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 156/183 (85%), Positives = 167/183 (91%), Gaps = 0/183 (0%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHGGELIIPFSAALERSLA  616
            EI N FQ+LTAKPVVYLVNM++KDY RKKNKFLPKIHAWV+EHGGE IIPFS A E+ L 
Sbjct  212  EILNAFQLLTAKPVVYLVNMSKKDYLRKKNKFLPKIHAWVKEHGGETIIPFSCAFEQKLV  271

Query  615  DMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAG  436
            DMP DEAAKYC EN+  S +PKIIKTGF+AI+LIYFFTAG DEVKCWQIRRQ+KAPQAAG
Sbjct  272  DMPEDEAAKYCAENQTASLIPKIIKTGFAAIHLIYFFTAGHDEVKCWQIRRQSKAPQAAG  331

Query  435  AIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGG  256
            AIHTDFERGFICAEVMKFEDLKELGSE AVKA GKYRQEGKTYVVQDGD+IFFKFNVSGG
Sbjct  332  AIHTDFERGFICAEVMKFEDLKELGSESAVKAAGKYRQEGKTYVVQDGDIIFFKFNVSGG  391

Query  255  GKK  247
            GKK
Sbjct  392  GKK  394



>gb|EMS48297.1| Obg-like ATPase 1 [Triticum urartu]
Length=397

 Score =   324 bits (831),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 156/186 (84%), Positives = 166/186 (89%), Gaps = 3/186 (2%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHGGELIIPFSAALERSLA  616
            EI N FQ+LTAKPVVYLVNM+EKDY RKKNKFLPKIHAWV+EHGGE IIPFS A E+ L 
Sbjct  212  EILNAFQLLTAKPVVYLVNMSEKDYLRKKNKFLPKIHAWVKEHGGETIIPFSCAFEQKLV  271

Query  615  DMPPDEAAKYCEENKVQS---ALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQ  445
            DMP DEAAKYC EN+       +PKIIKTGF+AI+LIYFFTAG DEVKCWQIRRQ+KAPQ
Sbjct  272  DMPEDEAAKYCAENQTARQVILIPKIIKTGFAAIHLIYFFTAGHDEVKCWQIRRQSKAPQ  331

Query  444  AAGAIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNV  265
            AAGAIHTDFERGFICAEVMKFEDLKELGSE AVKA GKYRQEGKTYVVQDGD+IFFKFNV
Sbjct  332  AAGAIHTDFERGFICAEVMKFEDLKELGSESAVKAAGKYRQEGKTYVVQDGDIIFFKFNV  391

Query  264  SGGGKK  247
            SGGGKK
Sbjct  392  SGGGKK  397



>ref|XP_001776504.1| predicted protein [Physcomitrella patens]
 gb|EDQ58637.1| predicted protein [Physcomitrella patens]
Length=394

 Score =   323 bits (827),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 151/183 (83%), Positives = 167/183 (91%), Gaps = 0/183 (0%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHGGELIIPFSAALERSLA  616
            EI NTFQ+L+AKPVVYL+NM EKDYQRKKNK+L KIHAWVQEHGG ++IPFS  LE+ LA
Sbjct  212  EILNTFQLLSAKPVVYLINMTEKDYQRKKNKWLAKIHAWVQEHGGGVLIPFSGVLEQKLA  271

Query  615  DMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAG  436
            DMP DEAA YC+EN + SALPKIIKTGF+AINLIYFFTAGPDEVKCWQIR+Q+KAPQAAG
Sbjct  272  DMPADEAAVYCKENDLVSALPKIIKTGFAAINLIYFFTAGPDEVKCWQIRKQSKAPQAAG  331

Query  435  AIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGG  256
            AIHTDFERGFICAEVMKF+DLKELGSE AVKA GKY+QEGK YVVQDGD+IFFKFNV+  
Sbjct  332  AIHTDFERGFICAEVMKFDDLKELGSESAVKAAGKYKQEGKNYVVQDGDIIFFKFNVTAS  391

Query  255  GKK  247
            GKK
Sbjct  392  GKK  394



>gb|EMT28525.1| Obg-like ATPase 1 [Aegilops tauschii]
Length=397

 Score =   323 bits (827),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 155/186 (83%), Positives = 166/186 (89%), Gaps = 3/186 (2%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHGGELIIPFSAALERSLA  616
            EI N FQ+LTAKPVVYLVNM+EKDY RKKNKFLPKIHAWV++HGGE IIPFS A E+ L 
Sbjct  212  EILNAFQLLTAKPVVYLVNMSEKDYLRKKNKFLPKIHAWVKDHGGETIIPFSCAFEQKLV  271

Query  615  DMPPDEAAKYCEENKVQS---ALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQ  445
            DMP DEAAKYC EN+       +PKIIKTGF+AI+LIYFFTAG DEVKCWQIRRQ+KAPQ
Sbjct  272  DMPEDEAAKYCAENQTARQVILIPKIIKTGFAAIHLIYFFTAGHDEVKCWQIRRQSKAPQ  331

Query  444  AAGAIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNV  265
            AAGAIHTDFERGFICAEVMKFEDLKELGSE AVKA GKYRQEGKTYVVQDGD+IFFKFNV
Sbjct  332  AAGAIHTDFERGFICAEVMKFEDLKELGSESAVKAAGKYRQEGKTYVVQDGDIIFFKFNV  391

Query  264  SGGGKK  247
            SGGGKK
Sbjct  392  SGGGKK  397



>gb|AFW56959.1| hypothetical protein ZEAMMB73_810066 [Zea mays]
Length=164

 Score =   303 bits (777),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 142/164 (87%), Positives = 153/164 (93%), Gaps = 0/164 (0%)
 Frame = -3

Query  738  MNEKDYQRKKNKFLPKIHAWVQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSA  559
            M+EKD+QRKKNKFLPKIHAWVQEHGGE I+PFS A E+ L DMP DEAAKYC EN++ S 
Sbjct  1    MSEKDFQRKKNKFLPKIHAWVQEHGGETILPFSCAFEQKLVDMPEDEAAKYCAENQITSM  60

Query  558  LPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDFERGFICAEVMKFE  379
            +PKIIKTGF+AI+LIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDFERGFICAEVMKFE
Sbjct  61   IPKIIKTGFAAIHLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDFERGFICAEVMKFE  120

Query  378  DLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  247
            DLKELGSE AVKA GKY+QEGKTYVVQDGD+IFFKFNVSGGGKK
Sbjct  121  DLKELGSESAVKAAGKYKQEGKTYVVQDGDIIFFKFNVSGGGKK  164



>ref|XP_011015196.1| PREDICTED: obg-like ATPase 1 [Populus euphratica]
Length=392

 Score =   305 bits (782),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 146/183 (80%), Positives = 160/183 (87%), Gaps = 2/183 (1%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHGGELIIPFSAALERSLA  616
            EI NTFQ+LTAKPVVYL+NMNEKDYQRKKNKFLPKIHAWVQEHGGE IIPFS  LER+LA
Sbjct  212  EILNTFQLLTAKPVVYLINMNEKDYQRKKNKFLPKIHAWVQEHGGETIIPFSCILERTLA  271

Query  615  DMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAG  436
            DM PDEAAKYCEENK+Q  + +        I+ ++FF +  D+VKCWQIRRQTKAPQAAG
Sbjct  272  DMLPDEAAKYCEENKLQRLVLR--SQWLVNISQVFFFFSFEDQVKCWQIRRQTKAPQAAG  329

Query  435  AIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGG  256
             IHTDFERGFICAEVMKF+DLKELGSE AVKA GKY+QEGKTYVVQDGD+IFFKFNVSGG
Sbjct  330  TIHTDFERGFICAEVMKFDDLKELGSESAVKAAGKYKQEGKTYVVQDGDIIFFKFNVSGG  389

Query  255  GKK  247
            GKK
Sbjct  390  GKK  392



>ref|XP_002985543.1| hypothetical protein SELMODRAFT_234816 [Selaginella moellendorffii]
 ref|XP_002987026.1| hypothetical protein SELMODRAFT_158442 [Selaginella moellendorffii]
 gb|EFJ11869.1| hypothetical protein SELMODRAFT_158442 [Selaginella moellendorffii]
 gb|EFJ13417.1| hypothetical protein SELMODRAFT_234816 [Selaginella moellendorffii]
Length=389

 Score =   303 bits (776),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 146/182 (80%), Positives = 158/182 (87%), Gaps = 7/182 (4%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHGGELIIPFSAALERSLA  616
            E  NTFQ+L+AKPVVYLVNM EKDY RKKNK+LPKIHAWVQEHGG+ +IPFS  LE+ LA
Sbjct  215  EFLNTFQLLSAKPVVYLVNMTEKDYLRKKNKWLPKIHAWVQEHGGDPLIPFSGVLEQRLA  274

Query  615  DMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAG  436
            D P DEAA       VQSALPKIIKTGF+AINLIYFFTAGPDEVKCWQIR+ +KAPQAAG
Sbjct  275  DAPSDEAA-------VQSALPKIIKTGFAAINLIYFFTAGPDEVKCWQIRKHSKAPQAAG  327

Query  435  AIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGG  256
            AIHTDFERGFICAEVMKFEDLKELGSE AVKA GKY+QEGK YVVQDGD+IFFKFNV+  
Sbjct  328  AIHTDFERGFICAEVMKFEDLKELGSEAAVKAAGKYKQEGKNYVVQDGDIIFFKFNVTAA  387

Query  255  GK  250
             K
Sbjct  388  KK  389



>gb|KDO75236.1| hypothetical protein CISIN_1g015465mg [Citrus sinensis]
Length=406

 Score =   303 bits (775),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 144/153 (94%), Positives = 147/153 (96%), Gaps = 0/153 (0%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHGGELIIPFSAALERSLA  616
            EI NTFQ+LTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHGGE IIPFS ALER+LA
Sbjct  212  EILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHGGEQIIPFSCALERNLA  271

Query  615  DMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAG  436
            DMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAG
Sbjct  272  DMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAG  331

Query  435  AIHTDFERGFICAEVMKFEDLKELGSEPAVKAG  337
             IHTDFERGFICAEVMKF+DLKELGSEPAVK  
Sbjct  332  TIHTDFERGFICAEVMKFDDLKELGSEPAVKVN  364



>gb|AAP43929.1| GTP-binding protein [Triticum aestivum]
Length=232

 Score =   280 bits (715),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 132/157 (84%), Positives = 141/157 (90%), Gaps = 0/157 (0%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHGGELIIPFSAALERSLA  616
            EI N FQ+LTAKPVVYLVNM+EKDY RKKNKFLPKIHAWV+EHGGE IIPFS A E+ L 
Sbjct  40   EILNAFQLLTAKPVVYLVNMSEKDYLRKKNKFLPKIHAWVKEHGGETIIPFSCAFEQKLV  99

Query  615  DMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAG  436
            DMP DEAAKYC EN+  S +PKIIKTGF+AI+LIYFFTAG DEVKCWQIRRQ+KAPQAAG
Sbjct  100  DMPEDEAAKYCAENQTASLIPKIIKTGFAAIHLIYFFTAGHDEVKCWQIRRQSKAPQAAG  159

Query  435  AIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYR  325
            AIHTDFERGFICAEVMKFEDLKELGSE AVKA GKYR
Sbjct  160  AIHTDFERGFICAEVMKFEDLKELGSESAVKAAGKYR  196



>ref|XP_001699763.1| flagellar associated protein [Chlamydomonas reinhardtii]
 gb|EDP07459.1| flagellar associated protein [Chlamydomonas reinhardtii]
Length=391

 Score =   284 bits (726),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 136/183 (74%), Positives = 150/183 (82%), Gaps = 0/183 (0%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHGGELIIPFSAALERSLA  616
            E  N +Q+LTAKP VYLVNM+E D+ RKKNKFLPKIH WVQ HGGE IIPFSA+ E  + 
Sbjct  209  EWLNEYQLLTAKPAVYLVNMSENDFARKKNKFLPKIHEWVQAHGGEPIIPFSASFENKIN  268

Query  615  DMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAG  436
            DMP DE  KYC+E  V   LPKII TGF AI+LIYFFTAG DEVKCWQIR+  KAPQAAG
Sbjct  269  DMPDDEKDKYCKELGVVCQLPKIITTGFRAIHLIYFFTAGEDEVKCWQIRQGAKAPQAAG  328

Query  435  AIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGG  256
             IHTDFERGFICAEVMKFE+LKELG+E AVKA GKYRQ+GK YVV DGD+IFFKFNV+  
Sbjct  329  TIHTDFERGFICAEVMKFEELKELGTESAVKAAGKYRQQGKEYVVTDGDIIFFKFNVTSS  388

Query  255  GKK  247
            GKK
Sbjct  389  GKK  391



>ref|XP_006845996.1| hypothetical protein AMTR_s00155p00052120 [Amborella trichopoda]
 gb|ERN07671.1| hypothetical protein AMTR_s00155p00052120 [Amborella trichopoda]
Length=146

 Score =   275 bits (702),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 131/144 (91%), Positives = 137/144 (95%), Gaps = 0/144 (0%)
 Frame = -3

Query  678  VQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTA  499
            VQEHGGE IIPFS  LE+SL DMP DEAAKYC+ENK+QSA+PKIIKTGFSAINLIYFFTA
Sbjct  3    VQEHGGEPIIPFSCVLEKSLVDMPEDEAAKYCDENKIQSAIPKIIKTGFSAINLIYFFTA  62

Query  498  GPDEVKCWQIRRQTKAPQAAGAIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQE  319
            GPDEVKCWQIRRQTKAPQAAGAIHTDFERGFICAEVMKFEDLKELGSE A+KA GKYRQE
Sbjct  63   GPDEVKCWQIRRQTKAPQAAGAIHTDFERGFICAEVMKFEDLKELGSEAALKAAGKYRQE  122

Query  318  GKTYVVQDGDVIFFKFNVSGGGKK  247
            GKTYVVQDGD+IFFKFNVSGGGKK
Sbjct  123  GKTYVVQDGDIIFFKFNVSGGGKK  146



>ref|XP_008812127.1| PREDICTED: obg-like ATPase 1 [Phoenix dactylifera]
Length=412

 Score =   283 bits (725),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 142/201 (71%), Positives = 157/201 (78%), Gaps = 18/201 (9%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHGGELIIPFSAALERSLA  616
            EI NTFQ+LTAKPVVYLVNMNE+DYQRKKNKFLPKIHAWVQ HGGE IIPFS  LE++L 
Sbjct  212  EILNTFQLLTAKPVVYLVNMNERDYQRKKNKFLPKIHAWVQNHGGETIIPFSCVLEKNLV  271

Query  615  DMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQ-----IRRQTKA  451
            DMP DEAAKYCEENKVQSA+PKIIKTGF+AINL+YFFTAGPDEVKC        R +  A
Sbjct  272  DMPEDEAAKYCEENKVQSAIPKIIKTGFAAINLVYFFTAGPDEVKCCYNSFVLHRIRCLA  331

Query  450  PQAAGAIHTDFERGFI-------------CAEVMKFEDLKELGSEPAVKAGGKYRQEGKT  310
                 + + +  R ++             C +VMKFEDLKELGSE AVKA GKYRQEGKT
Sbjct  332  DMLLESKYLEISRSYVFAFHEMVFYLELYCLQVMKFEDLKELGSEAAVKAAGKYRQEGKT  391

Query  309  YVVQDGDVIFFKFNVSGGGKK  247
            YVVQDGD+IFFKFNVSGGGKK
Sbjct  392  YVVQDGDIIFFKFNVSGGGKK  412



>ref|XP_002953429.1| hypothetical protein VOLCADRAFT_105955 [Volvox carteri f. nagariensis]
 gb|EFJ45402.1| hypothetical protein VOLCADRAFT_105955 [Volvox carteri f. nagariensis]
Length=391

 Score =   282 bits (721),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 135/183 (74%), Positives = 151/183 (83%), Gaps = 0/183 (0%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHGGELIIPFSAALERSLA  616
            E  N +Q+LTAKP VYLVNM+E D+ RKKNKFLPKIH WVQ HGGE IIPFSAA E  + 
Sbjct  209  EWLNEYQLLTAKPAVYLVNMSETDFARKKNKFLPKIHEWVQAHGGEPIIPFSAAFENKIF  268

Query  615  DMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAG  436
            +MP DE  KYC+E  V S LPKII TGF AI+LIYFFTAG DEVKCWQIR+ TKAPQAAG
Sbjct  269  EMPDDEKDKYCKEAGVISMLPKIITTGFKAIHLIYFFTAGDDEVKCWQIRQGTKAPQAAG  328

Query  435  AIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGG  256
             IHTDFERGFICAEVMK+++LKELGSE AVKA GKYRQ+GK YVV DGD+I+FKFNV+  
Sbjct  329  TIHTDFERGFICAEVMKYDELKELGSEGAVKAAGKYRQQGKEYVVTDGDIIYFKFNVTSS  388

Query  255  GKK  247
             KK
Sbjct  389  AKK  391



>gb|AFW56960.1| hypothetical protein ZEAMMB73_810066 [Zea mays]
Length=369

 Score =   275 bits (704),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 136/183 (74%), Positives = 147/183 (80%), Gaps = 24/183 (13%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHGGELIIPFSAALERSLA  616
            EI NTFQ+L+AKPVVYL                        EHGGE I+PFS A E+ L 
Sbjct  211  EILNTFQLLSAKPVVYL------------------------EHGGETILPFSCAFEQKLV  246

Query  615  DMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAG  436
            DMP DEAAKYC EN++ S +PKIIKTGF+AI+LIYFFTAGPDEVKCWQIRRQTKAPQAAG
Sbjct  247  DMPEDEAAKYCAENQITSMIPKIIKTGFAAIHLIYFFTAGPDEVKCWQIRRQTKAPQAAG  306

Query  435  AIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGG  256
            AIHTDFERGFICAEVMKFEDLKELGSE AVKA GKY+QEGKTYVVQDGD+IFFKFNVSGG
Sbjct  307  AIHTDFERGFICAEVMKFEDLKELGSESAVKAAGKYKQEGKTYVVQDGDIIFFKFNVSGG  366

Query  255  GKK  247
            GKK
Sbjct  367  GKK  369



>gb|KDO75237.1| hypothetical protein CISIN_1g015465mg [Citrus sinensis]
Length=350

 Score =   273 bits (699),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 129/136 (95%), Positives = 132/136 (97%), Gaps = 0/136 (0%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHGGELIIPFSAALERSLA  616
            EI NTFQ+LTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHGGE IIPFS ALER+LA
Sbjct  212  EILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHGGEQIIPFSCALERNLA  271

Query  615  DMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAG  436
            DMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAG
Sbjct  272  DMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAG  331

Query  435  AIHTDFERGFICAEVM  388
             IHTDFERGFICAEV+
Sbjct  332  TIHTDFERGFICAEVV  347



>ref|XP_005847323.1| hypothetical protein CHLNCDRAFT_56178 [Chlorella variabilis]
 gb|EFN55221.1| hypothetical protein CHLNCDRAFT_56178 [Chlorella variabilis]
Length=390

 Score =   271 bits (694),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 127/180 (71%), Positives = 148/180 (82%), Gaps = 0/180 (0%)
 Frame = -3

Query  786  NTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHGGELIIPFSAALERSLADMP  607
            NT Q LTAKPVVYLVN++E+DYQRKKNK+L K+  WV+ HGG+ IIPFS ALE  L DMP
Sbjct  211  NTVQFLTAKPVVYLVNLSERDYQRKKNKWLVKLFEWVKAHGGDPIIPFSGALEAKLLDMP  270

Query  606  PDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIH  427
             DE   YC+E++VQSALPKI+  GF A+ LIY+FTAG  EV+CWQIR  TKAPQAAGAIH
Sbjct  271  EDEREVYCQEHEVQSALPKIVTAGFKAVRLIYYFTAGVQEVRCWQIREHTKAPQAAGAIH  330

Query  426  TDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  247
            +DFERGFICAEVM F D+KE GSE AVK+ G +RQEGKTY VQDGD+I +KFNV+ GGKK
Sbjct  331  SDFERGFICAEVMAFADMKEHGSEAAVKSAGNWRQEGKTYEVQDGDIIHWKFNVTSGGKK  390



>ref|XP_005650863.1| flagellar associated protein [Coccomyxa subellipsoidea C-169]
 gb|EIE26319.1| flagellar associated protein [Coccomyxa subellipsoidea C-169]
Length=392

 Score =   271 bits (693),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 129/183 (70%), Positives = 148/183 (81%), Gaps = 0/183 (0%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHGGELIIPFSAALERSLA  616
            +  NT Q++TAKPVVYLVN+ EK Y +KK+K+LPKI  WV+EHGGE IIPFS  LE  L 
Sbjct  210  DFLNTVQLITAKPVVYLVNLTEKAYIKKKSKWLPKIFEWVKEHGGEPIIPFSGVLESKLF  269

Query  615  DMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAG  436
            DMP DE A Y +EN+   ALPKII TGF +I LIYFFTAG DEVKCWQIR+ TKAPQAAG
Sbjct  270  DMPDDEKATYLKENEAMCALPKIITTGFKSIQLIYFFTAGEDEVKCWQIRKGTKAPQAAG  329

Query  435  AIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGG  256
            AIHTDFERGFICAEVM +++L ELG+E A +A GKYRQEGK YVV DGDVI+FKFNV+  
Sbjct  330  AIHTDFERGFICAEVMHYDELHELGTESAARAAGKYRQEGKNYVVLDGDVIYFKFNVTAS  389

Query  255  GKK  247
            GKK
Sbjct  390  GKK  392



>ref|XP_003064009.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH51631.1| predicted protein [Micromonas pusilla CCMP1545]
Length=400

 Score =   270 bits (691),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 130/183 (71%), Positives = 150/183 (82%), Gaps = 0/183 (0%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHGGELIIPFSAALERSLA  616
            +  NT+Q+LT+KPV+YLVN+ EKDY RKKNK+L KIHAWV EHGG  IIPFS A E  L 
Sbjct  218  DFLNTYQLLTSKPVIYLVNLTEKDYARKKNKWLAKIHAWVMEHGGGTIIPFSGAFECELQ  277

Query  615  DMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAG  436
            D+P DE A++ ++ ++ + LPKIIKT FS I+LIYFFTAGPDEVK W IR+  KAPQAAG
Sbjct  278  DVPEDEKAQFQKDKEMTTILPKIIKTAFSTIHLIYFFTAGPDEVKAWCIRKGFKAPQAAG  337

Query  435  AIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGG  256
            AIHTDFERGFICAEVM FE LKELGSE  VKA GKY+QEGKTY+V DGDVIFFKFNV+  
Sbjct  338  AIHTDFERGFICAEVMAFETLKELGSEQEVKAKGKYKQEGKTYLVNDGDVIFFKFNVTAK  397

Query  255  GKK  247
            GKK
Sbjct  398  GKK  400



>ref|XP_001421839.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABP00133.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=400

 Score =   270 bits (691),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 127/180 (71%), Positives = 147/180 (82%), Gaps = 0/180 (0%)
 Frame = -3

Query  786  NTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHGGELIIPFSAALERSLADMP  607
            N +Q+LTAKPV+YLVN++ KD++RKKNKFL KIH WVQ HGG  IIPFSA +E  L  + 
Sbjct  220  NKYQLLTAKPVIYLVNLSRKDFERKKNKFLVKIHEWVQAHGGGTIIPFSAEVESELQHVA  279

Query  606  PDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIH  427
             ++ A++C++  VQ+ LPKII T FS ++LIYFFTAGPDEVK W IR+  KAPQAAGAIH
Sbjct  280  EEDKAQWCKDRGVQTMLPKIITTAFSTVHLIYFFTAGPDEVKAWCIRKGYKAPQAAGAIH  339

Query  426  TDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  247
            TDFERGFICAEVM F+DLKELGSE AVK  GKYRQEGKTY VQD DVIFFKFNVSG  KK
Sbjct  340  TDFERGFICAEVMAFDDLKELGSEQAVKTAGKYRQEGKTYTVQDADVIFFKFNVSGAAKK  399



>gb|KDD75506.1| DUF933 hypothetical protein [Helicosporidium sp. ATCC 50920]
Length=398

 Score =   270 bits (689),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 124/183 (68%), Positives = 150/183 (82%), Gaps = 0/183 (0%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHGGELIIPFSAALERSLA  616
            E  N  Q +TAKPV+YL N++EKDY RKKNK+L K+HAWV+ HGG  IIPFS  LE  L 
Sbjct  216  EFLNANQFITAKPVIYLANLSEKDYIRKKNKWLVKLHAWVEAHGGGQIIPFSGQLEGKLL  275

Query  615  DMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAG  436
            DMP DE A YC+EN+  SA+PKII +GF A+NLIYFFT GP+EV+CWQIR+ +KAPQAAG
Sbjct  276  DMPEDERAVYCKENECVSAIPKIITSGFRAVNLIYFFTCGPEEVRCWQIRKYSKAPQAAG  335

Query  435  AIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGG  256
            AIH+DFERGFICAEVM++ DL E+G+E AVKA GKY+QEGK YVV+DGD+I+FKFNV+  
Sbjct  336  AIHSDFERGFICAEVMRYSDLHEIGNEQAVKAAGKYKQEGKNYVVEDGDIIYFKFNVTAD  395

Query  255  GKK  247
             KK
Sbjct  396  KKK  398



>ref|XP_011395756.1| Obg-like ATPase 1 [Auxenochlorella protothecoides]
 gb|KFM22890.1| Obg-like ATPase 1 [Auxenochlorella protothecoides]
Length=348

 Score =   265 bits (677),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 123/183 (67%), Positives = 147/183 (80%), Gaps = 0/183 (0%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHGGELIIPFSAALERSLA  616
            E  N  Q ++AKPV+YLVN++EKDY RKKNK+LPK+  W+Q HGG  +IPFS ALE  L 
Sbjct  166  EFLNNHQFISAKPVIYLVNLSEKDYIRKKNKWLPKLFEWIQAHGGAQLIPFSGALEAKLF  225

Query  615  DMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAG  436
            DMP DE   YC+E+   SALPKII  GF A++LIYFFT GP EV+CWQIR+ +KAPQAAG
Sbjct  226  DMPDDEKEAYCKEHGCTSALPKIIVAGFKAVHLIYFFTCGPGEVRCWQIRKNSKAPQAAG  285

Query  435  AIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGG  256
            AIH+DFERGFICAEVM +++LKELG+E AVKA GKYRQEGKTYV+QDGD+  FKFNV+  
Sbjct  286  AIHSDFERGFICAEVMHYDELKELGNENAVKAAGKYRQEGKTYVMQDGDICHFKFNVTAE  345

Query  255  GKK  247
             KK
Sbjct  346  KKK  348



>gb|EPS62769.1| hypothetical protein M569_12020, partial [Genlisea aurea]
Length=146

 Score =   255 bits (651),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 124/146 (85%), Positives = 131/146 (90%), Gaps = 2/146 (1%)
 Frame = -3

Query  678  VQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTA  499
            VQEHGGE IIP S ALE  LADM P+EAAKYCEEN+VQSAL K+IKTGFSAINLIYFFTA
Sbjct  1    VQEHGGETIIPVSCALENKLADMSPEEAAKYCEENQVQSALSKVIKTGFSAINLIYFFTA  60

Query  498  GPDEVKCWQIRRQTKAPQAAGAIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQE  319
            GPDEVKCWQIRR +KAPQAAG IH+DFERGFICAEVMKFEDLKELGSE AVKA GKY+QE
Sbjct  61   GPDEVKCWQIRRLSKAPQAAGTIHSDFERGFICAEVMKFEDLKELGSEAAVKACGKYKQE  120

Query  318  GKTYVVQDGDVIFFKFNV--SGGGKK  247
            GK YVVQDGD+IFFKFNV  SGG KK
Sbjct  121  GKGYVVQDGDIIFFKFNVSSSGGAKK  146



>gb|KJB69091.1| hypothetical protein B456_011G005000 [Gossypium raimondii]
Length=357

 Score =   260 bits (664),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 122/135 (90%), Positives = 127/135 (94%), Gaps = 0/135 (0%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHGGELIIPFSAALERSLA  616
            EI NTFQ+L+AKPVVYLVNM EKDYQRKKNKFLPKIHAWVQEHGGE IIPFS   ER+LA
Sbjct  212  EILNTFQLLSAKPVVYLVNMTEKDYQRKKNKFLPKIHAWVQEHGGEPIIPFSGVFERNLA  271

Query  615  DMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAG  436
            DM P +AAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQ+KAPQAAG
Sbjct  272  DMEPADAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQSKAPQAAG  331

Query  435  AIHTDFERGFICAEV  391
            AIHTDFERGFICAEV
Sbjct  332  AIHTDFERGFICAEV  346



>emb|CEG00523.1| P-loop containing nucleoside triphosphate hydrolase [Ostreococcus 
tauri]
Length=398

 Score =   260 bits (664),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 122/179 (68%), Positives = 144/179 (80%), Gaps = 0/179 (0%)
 Frame = -3

Query  786  NTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHGGELIIPFSAALERSLADMP  607
            N +Q+LTAKPV+YLVN++ KD++RKKNKFL KIH WV+ HGG  IIP SA +E  L  +P
Sbjct  220  NKYQLLTAKPVIYLVNLSRKDFERKKNKFLVKIHEWVKSHGGGTIIPVSAEVEGELQHVP  279

Query  606  PDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIH  427
             +E  ++C++  V S LPKIIKT FS I+LIYFFTAGPDEVK W IR+  KAPQAAGAIH
Sbjct  280  AEEKEQWCKDQGVTSCLPKIIKTAFSTIHLIYFFTAGPDEVKAWCIRKGFKAPQAAGAIH  339

Query  426  TDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGK  250
            TDFERGFICAEVM F+DLKELG+E AVK  GKYRQEGK Y+VQDGD+ FFKFNV+   K
Sbjct  340  TDFERGFICAEVMAFDDLKELGTESAVKTAGKYRQEGKNYLVQDGDICFFKFNVTSSKK  398



>ref|XP_002502254.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO63512.1| predicted protein [Micromonas sp. RCC299]
Length=400

 Score =   257 bits (657),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 124/183 (68%), Positives = 145/183 (79%), Gaps = 0/183 (0%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHGGELIIPFSAALERSLA  616
            +  N +Q+LTAKPV+Y+VN+ +KDY RK NK+L KIH WV  HGG +IIPFS A E  L 
Sbjct  218  DFLNKYQLLTAKPVIYVVNLTKKDYARKANKWLKKIHEWVMGHGGGVIIPFSGAFEAELQ  277

Query  615  DMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAG  436
            D+P +  A+Y +E  + S LPKIIKTGFS I+LIYFFTAGPDEVK W IR+  KAPQAAG
Sbjct  278  DVPEEGKAEYEKEQGMTSVLPKIIKTGFSTIHLIYFFTAGPDEVKAWCIRKGFKAPQAAG  337

Query  435  AIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGG  256
            AIHTDFERGFICAEVM F+ LKELG+E  VKA GKYRQEGKTY V+DGD+IFFKFNV+  
Sbjct  338  AIHTDFERGFICAEVMGFDTLKELGTEAEVKAKGKYRQEGKTYTVEDGDIIFFKFNVTAA  397

Query  255  GKK  247
             KK
Sbjct  398  KKK  400



>gb|EMS48298.1| Obg-like ATPase 1 [Triticum urartu]
Length=347

 Score =   250 bits (638),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 129/183 (70%), Positives = 137/183 (75%), Gaps = 39/183 (21%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHGGELIIPFSAALERSLA  616
            EI NTFQ+LTAKPVVYLVNM+EKDY RKKNKFLPKIHA +                    
Sbjct  204  EILNTFQLLTAKPVVYLVNMSEKDYLRKKNKFLPKIHACL--------------------  243

Query  615  DMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAG  436
                               +PKIIKTGF+AI+LIYFFTAG  EVKCWQIRRQ+KAPQAAG
Sbjct  244  -------------------IPKIIKTGFAAIHLIYFFTAGHGEVKCWQIRRQSKAPQAAG  284

Query  435  AIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGG  256
            AIHTDFERGFICAEVMKFEDLKELGSE AVKA GKYRQEGKTYVVQDGD+IFFKFNVSGG
Sbjct  285  AIHTDFERGFICAEVMKFEDLKELGSESAVKAAGKYRQEGKTYVVQDGDIIFFKFNVSGG  344

Query  255  GKK  247
            GKK
Sbjct  345  GKK  347



>ref|XP_003083821.1| GTP-binding protein (ISS) [Ostreococcus tauri]
Length=817

 Score =   261 bits (667),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 122/179 (68%), Positives = 144/179 (80%), Gaps = 0/179 (0%)
 Frame = -3

Query  786  NTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHGGELIIPFSAALERSLADMP  607
            N +Q+LTAKPV+YLVN++ KD++RKKNKFL KIH WV+ HGG  IIP SA +E  L  +P
Sbjct  639  NKYQLLTAKPVIYLVNLSRKDFERKKNKFLVKIHEWVKSHGGGTIIPVSAEVEGELQHVP  698

Query  606  PDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIH  427
             +E  ++C++  V S LPKIIKT FS I+LIYFFTAGPDEVK W IR+  KAPQAAGAIH
Sbjct  699  AEEKEQWCKDQGVTSCLPKIIKTAFSTIHLIYFFTAGPDEVKAWCIRKGFKAPQAAGAIH  758

Query  426  TDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGK  250
            TDFERGFICAEVM F+DLKELG+E AVK  GKYRQEGK Y+VQDGD+ FFKFNV+   K
Sbjct  759  TDFERGFICAEVMAFDDLKELGTESAVKTAGKYRQEGKNYLVQDGDICFFKFNVTSSKK  817



>ref|XP_010736093.1| PREDICTED: obg-like ATPase 1 isoform X2 [Larimichthys crocea]
Length=238

 Score =   245 bits (625),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 116/184 (63%), Positives = 141/184 (77%), Gaps = 1/184 (1%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHG-GELIIPFSAALERSL  619
            E+ N +  LT+KP++YL+N++EKDY R+KNK+L KI  WV  H  G L+IPFS  LE  L
Sbjct  54   EVLNKYLFLTSKPMIYLINLSEKDYIRRKNKWLVKIKEWVDSHDPGALVIPFSGGLENKL  113

Query  618  ADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAA  439
             D   +E  KYC E+K QSAL KIIKTG++A+ L YFFTAGPDEV+ W IR+ TKAPQAA
Sbjct  114  QDKSEEETQKYCTEHKTQSALSKIIKTGYAALQLEYFFTAGPDEVRAWTIRKGTKAPQAA  173

Query  438  GAIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSG  259
            G IHTDFE+GFI AEVMKF+D KE GSE AVKA GKYRQ+G+ Y+V+DGD+IFFKFN   
Sbjct  174  GKIHTDFEKGFIMAEVMKFQDFKEEGSENAVKAAGKYRQQGRNYIVEDGDIIFFKFNAPN  233

Query  258  GGKK  247
              KK
Sbjct  234  APKK  237



>ref|XP_003388006.1| PREDICTED: obg-like ATPase 1 [Amphimedon queenslandica]
Length=434

 Score =   251 bits (641),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 119/187 (64%), Positives = 144/187 (77%), Gaps = 4/187 (2%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEH-GGELIIPFSAALERSL  619
            E+ N    LTAKPVVYL+N++EKDY RKKNK+L  I  W+  H  G ++IPFS   E+ L
Sbjct  247  ELLNKHLFLTAKPVVYLINLSEKDYTRKKNKWLKDIKEWIDAHDAGAIVIPFSGVFEQKL  306

Query  618  ADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAA  439
             DMP DEAA+YC ENKV S+LPKII  G+ A+NL YFFT+GPDEV+ W +++ TKAPQAA
Sbjct  307  LDMPEDEAARYCTENKVTSSLPKIIVNGYKALNLQYFFTSGPDEVRAWTVQKGTKAPQAA  366

Query  438  GAIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSG  259
            G IHTDFE+GFI AEVMK+ED KELGSE AVKA GKYRQ+G+ Y+V+DGD+I FKFN   
Sbjct  367  GRIHTDFEKGFIMAEVMKYEDYKELGSESAVKAAGKYRQQGRNYIVEDGDIILFKFNAGA  426

Query  258  G---GKK  247
            G   GKK
Sbjct  427  GLTAGKK  433



>ref|XP_005703761.1| GTP-binding protein [Galdieria sulphuraria]
 gb|EME27241.1| GTP-binding protein [Galdieria sulphuraria]
Length=398

 Score =   250 bits (638),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 120/186 (65%), Positives = 145/186 (78%), Gaps = 3/186 (2%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHGGELIIPFSAALERSLA  616
            E+ N    LTAKP V+LVN++EKDY RKKNK+LPKI  WV    GE+IIPFSA LE  L 
Sbjct  213  EVLNRHLFLTAKPQVFLVNLSEKDYIRKKNKWLPKIKEWVDSRTGEMIIPFSADLESKLL  272

Query  615  DMP---PDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQ  445
            D+    P+ A +Y EENK  SALPKIIK G+ A++LIYFFTAG DEVKCW I++ T APQ
Sbjct  273  DLESQGPELAQQYLEENKTTSALPKIIKAGYQALHLIYFFTAGEDEVKCWTIQKGTLAPQ  332

Query  444  AAGAIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNV  265
            AAG IH+DFE+GFICAEVMK+++LKE GSE A+KA GKYRQ+GK Y+V+DGD+I FKFNV
Sbjct  333  AAGTIHSDFEKGFICAEVMKYDELKEYGSESALKAAGKYRQQGKNYMVEDGDIILFKFNV  392

Query  264  SGGGKK  247
            +   KK
Sbjct  393  TSSKKK  398



>ref|XP_005452977.1| PREDICTED: obg-like ATPase 1-like isoform X8 [Oreochromis niloticus]
Length=252

 Score =   245 bits (625),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 117/184 (64%), Positives = 140/184 (76%), Gaps = 1/184 (1%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHG-GELIIPFSAALERSL  619
            E+ N +  LT+KP++YLVN++EKDY R+KNK+L KI  WV  H  G L+IPFS  LE  L
Sbjct  68   EVLNKYLFLTSKPMIYLVNLSEKDYIRRKNKWLVKIKEWVDSHDPGALVIPFSGGLESLL  127

Query  618  ADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAA  439
             D   +E  KYC E+K QSAL KIIK G++A+ L YFFTAGPDEV+ W IR+ TKAPQAA
Sbjct  128  QDKSEEERQKYCTEHKTQSALSKIIKAGYAALQLEYFFTAGPDEVRAWTIRKGTKAPQAA  187

Query  438  GAIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSG  259
            G IHTDFERGFI AEVMKF+D KE GSE AVKA GKYRQ+G+ Y+V+DGD+IFFKFN   
Sbjct  188  GKIHTDFERGFIMAEVMKFQDFKEEGSESAVKAAGKYRQQGRNYIVEDGDIIFFKFNAPN  247

Query  258  GGKK  247
              KK
Sbjct  248  APKK  251



>ref|XP_011488091.1| PREDICTED: obg-like ATPase 1 [Oryzias latipes]
Length=245

 Score =   244 bits (622),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 117/184 (64%), Positives = 140/184 (76%), Gaps = 1/184 (1%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHG-GELIIPFSAALERSL  619
            E+ N F  LT+KP++YLVN++E+DY R+KNK+L KI  WV  H  G L+IPFS  LE  L
Sbjct  61   EVLNKFLFLTSKPMIYLVNLSERDYIRRKNKWLVKIKEWVDSHDPGALVIPFSGNLESKL  120

Query  618  ADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAA  439
             DM  +E  KYC E K QSAL KIIKTG++A+ L YFFT GPDEV+ W IR+ TKAPQAA
Sbjct  121  QDMSEEERHKYCTEQKTQSALNKIIKTGYAALQLEYFFTTGPDEVRAWTIRKGTKAPQAA  180

Query  438  GAIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSG  259
            G IHTDFE+GFI AEVMKF+D KE GSE AVKA GKYRQ+G+ Y+V+DGD+IFFKFN   
Sbjct  181  GKIHTDFEKGFIMAEVMKFQDFKEEGSESAVKAAGKYRQQGRNYIVEDGDIIFFKFNAPN  240

Query  258  GGKK  247
              KK
Sbjct  241  APKK  244



>ref|XP_008116321.1| PREDICTED: obg-like ATPase 1 isoform X3 [Anolis carolinensis]
Length=238

 Score =   243 bits (620),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 116/184 (63%), Positives = 143/184 (78%), Gaps = 1/184 (1%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHG-GELIIPFSAALERSL  619
            ++ N +  LT+KP++YLVN++EKDY RKKN++L KI  WV +H  G L+IPFS ALE  L
Sbjct  54   DVLNKYLFLTSKPMIYLVNLSEKDYIRKKNRWLIKIKEWVDKHDPGALVIPFSGALELKL  113

Query  618  ADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAA  439
             +M  +E  KY EEN  QSALPKIIK G++A+ L YFFTAGPDEV+ W IR+ TKAPQAA
Sbjct  114  QEMSAEEKQKYLEENMTQSALPKIIKAGYAALQLEYFFTAGPDEVRAWTIRKGTKAPQAA  173

Query  438  GAIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSG  259
            G IH+DFE+GFI AEVMKFED KE G+E AVKA GKYRQ+G+ Y+V+DGD+IFFKFN   
Sbjct  174  GKIHSDFEKGFIMAEVMKFEDFKEGGTEAAVKAAGKYRQQGRNYIVEDGDIIFFKFNTPQ  233

Query  258  GGKK  247
              KK
Sbjct  234  QPKK  237



>ref|XP_005452976.1| PREDICTED: obg-like ATPase 1-like isoform X7 [Oreochromis niloticus]
Length=283

 Score =   244 bits (623),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 117/184 (64%), Positives = 140/184 (76%), Gaps = 1/184 (1%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHG-GELIIPFSAALERSL  619
            E+ N +  LT+KP++YLVN++EKDY R+KNK+L KI  WV  H  G L+IPFS  LE  L
Sbjct  99   EVLNKYLFLTSKPMIYLVNLSEKDYIRRKNKWLVKIKEWVDSHDPGALVIPFSGGLESLL  158

Query  618  ADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAA  439
             D   +E  KYC E+K QSAL KIIK G++A+ L YFFTAGPDEV+ W IR+ TKAPQAA
Sbjct  159  QDKSEEERQKYCTEHKTQSALSKIIKAGYAALQLEYFFTAGPDEVRAWTIRKGTKAPQAA  218

Query  438  GAIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSG  259
            G IHTDFERGFI AEVMKF+D KE GSE AVKA GKYRQ+G+ Y+V+DGD+IFFKFN   
Sbjct  219  GKIHTDFERGFIMAEVMKFQDFKEEGSESAVKAAGKYRQQGRNYIVEDGDIIFFKFNAPN  278

Query  258  GGKK  247
              KK
Sbjct  279  APKK  282



>ref|XP_010192575.1| PREDICTED: obg-like ATPase 1, partial [Mesitornis unicolor]
 gb|KFQ29053.1| Obg-like ATPase 1, partial [Mesitornis unicolor]
 gb|KFZ56885.1| Obg-like ATPase 1, partial [Podiceps cristatus]
Length=213

 Score =   241 bits (616),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 117/184 (64%), Positives = 140/184 (76%), Gaps = 1/184 (1%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHG-GELIIPFSAALERSL  619
            ++ N     T+KP++YLVN++EKDY RKKNK+L KI  WV +H  G L+IPFS ALE  L
Sbjct  29   DVLNKHLFFTSKPMIYLVNLSEKDYIRKKNKWLIKIKEWVDKHDPGALVIPFSGALELKL  88

Query  618  ADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAA  439
             DM  +E  KY EEN  QSAL KIIK G++A+ L YFFTAGPDEV+ W IR+ TKAPQAA
Sbjct  89   QDMSAEEKQKYLEENMTQSALAKIIKAGYAALQLEYFFTAGPDEVRAWTIRKGTKAPQAA  148

Query  438  GAIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSG  259
            G IHTDFE+GFI AEVMK+ED KE GSE AVKA GKYRQ+G+ Y+V+DGD+IFFKFN   
Sbjct  149  GKIHTDFEKGFIMAEVMKYEDFKEGGSEAAVKAAGKYRQQGRNYIVEDGDIIFFKFNTPQ  208

Query  258  GGKK  247
              KK
Sbjct  209  QPKK  212



>ref|XP_005019763.1| PREDICTED: obg-like ATPase 1 [Anas platyrhynchos]
Length=236

 Score =   242 bits (617),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 118/184 (64%), Positives = 140/184 (76%), Gaps = 1/184 (1%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHG-GELIIPFSAALERSL  619
            ++ N     T+KP++YLVN++EKDY RKKNK+L KI  WV +H  G L+IPFS ALE  L
Sbjct  52   DVLNKHLFFTSKPMIYLVNLSEKDYIRKKNKWLIKIKEWVDKHDPGALVIPFSGALELKL  111

Query  618  ADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAA  439
             DM  +E  KY EEN  QSAL KIIK G++A+ L YFFTAGPDEV+ W IR+ TKAPQAA
Sbjct  112  QDMSAEEKQKYLEENMTQSALAKIIKAGYAALQLEYFFTAGPDEVRAWTIRKGTKAPQAA  171

Query  438  GAIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSG  259
            G IHTDFE+GFI AEVMK+ED KE GSE AVKA GKYRQ+G+ YVV+DGD+IFFKFN   
Sbjct  172  GKIHTDFEKGFIMAEVMKYEDFKEGGSEAAVKAAGKYRQQGRNYVVEDGDIIFFKFNTPQ  231

Query  258  GGKK  247
              KK
Sbjct  232  QPKK  235



>ref|XP_004601224.1| PREDICTED: obg-like ATPase 1 isoform X3 [Sorex araneus]
 ref|XP_007105933.1| PREDICTED: obg-like ATPase 1-like [Physeter catodon]
Length=238

 Score =   241 bits (616),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 118/184 (64%), Positives = 142/184 (77%), Gaps = 1/184 (1%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHG-GELIIPFSAALERSL  619
            E+ N +  LT+KP+VYLVN++EKDY RKKNK+L KI  WV ++  G L+IPFS ALE  L
Sbjct  54   EVLNKYLFLTSKPMVYLVNLSEKDYIRKKNKWLIKIKEWVDKYDPGALVIPFSGALELKL  113

Query  618  ADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAA  439
             ++  +E  KY E N  QSALPKIIK GF+A+ L YFFTAGPDEV+ W IR+ TKAPQAA
Sbjct  114  QELSAEERQKYLEANMTQSALPKIIKAGFAALQLEYFFTAGPDEVRAWTIRKGTKAPQAA  173

Query  438  GAIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSG  259
            G IHTDFE+GFI AEVMK+ED KE GSE AVKA GKYRQ+G+ Y+V+DGD+IFFKFN   
Sbjct  174  GKIHTDFEKGFIMAEVMKYEDFKEEGSENAVKAAGKYRQQGRNYIVEDGDIIFFKFNTPQ  233

Query  258  GGKK  247
              KK
Sbjct  234  QPKK  237



>ref|XP_004703789.1| PREDICTED: obg-like ATPase 1 isoform X3 [Echinops telfairi]
Length=238

 Score =   241 bits (616),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 120/184 (65%), Positives = 141/184 (77%), Gaps = 1/184 (1%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHG-GELIIPFSAALERSL  619
            E+ N    LT+KP+VYLVN++EKDY RKKNK+L KI  WV ++  G L+IPFS ALE  L
Sbjct  54   EVLNKHLFLTSKPMVYLVNLSEKDYIRKKNKWLIKIKEWVDKYDPGALVIPFSGALELKL  113

Query  618  ADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAA  439
             ++  +E  KY E N  QSALPKIIK GFSA+ L YFFTAGPDEV+ W +R+ TKAPQAA
Sbjct  114  QELSAEERQKYLEANMTQSALPKIIKAGFSALQLEYFFTAGPDEVRAWTVRKGTKAPQAA  173

Query  438  GAIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSG  259
            G IHTDFE+GFI AEVMK+ED KE GSE AVKA GKYRQ+G+ YVV+DGDVIFFKFN   
Sbjct  174  GKIHTDFEKGFIMAEVMKYEDFKEEGSENAVKAAGKYRQQGRNYVVEDGDVIFFKFNTPQ  233

Query  258  GGKK  247
              KK
Sbjct  234  QPKK  237



>ref|XP_009490257.1| PREDICTED: obg-like ATPase 1 [Pelecanus crispus]
 ref|XP_009966012.1| PREDICTED: obg-like ATPase 1 [Tyto alba]
Length=236

 Score =   241 bits (615),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 117/184 (64%), Positives = 140/184 (76%), Gaps = 1/184 (1%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHG-GELIIPFSAALERSL  619
            ++ N     T+KP++YLVN++EKDY RKKNK+L KI  WV +H  G L+IPFS ALE  L
Sbjct  52   DVLNKHLFFTSKPMIYLVNLSEKDYIRKKNKWLIKIKEWVDKHDPGALVIPFSGALELKL  111

Query  618  ADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAA  439
             DM  +E  KY EEN  QSAL KIIK G++A+ L YFFTAGPDEV+ W IR+ TKAPQAA
Sbjct  112  QDMSAEEKQKYLEENMTQSALAKIIKAGYAALQLEYFFTAGPDEVRAWTIRKGTKAPQAA  171

Query  438  GAIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSG  259
            G IHTDFE+GFI AEVMK+ED KE GSE AVKA GKYRQ+G+ Y+V+DGD+IFFKFN   
Sbjct  172  GKIHTDFEKGFIMAEVMKYEDFKEGGSEAAVKAAGKYRQQGRNYIVEDGDIIFFKFNTPQ  231

Query  258  GGKK  247
              KK
Sbjct  232  QPKK  235



>ref|XP_008533775.1| PREDICTED: obg-like ATPase 1, partial [Equus przewalskii]
Length=213

 Score =   240 bits (613),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 118/184 (64%), Positives = 141/184 (77%), Gaps = 1/184 (1%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHG-GELIIPFSAALERSL  619
            E+ N    LT+KP+VYLVN++EKDY RKKNK+L KI  WV ++  G L+IPFS ALE  L
Sbjct  29   EVLNKHLFLTSKPMVYLVNLSEKDYIRKKNKWLIKIKEWVDKYDPGALVIPFSGALELKL  88

Query  618  ADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAA  439
             ++  +E  KY E N  QSALPKIIK GF+A+ L YFFTAGPDEV+ W IR+ TKAPQAA
Sbjct  89   QELSAEERQKYLEANMTQSALPKIIKAGFAALQLEYFFTAGPDEVRAWTIRKGTKAPQAA  148

Query  438  GAIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSG  259
            G IHTDFE+GFI AEVMK+ED KE GSE AVKA GKYRQ+G+ Y+V+DGD+IFFKFN   
Sbjct  149  GKIHTDFEKGFIMAEVMKYEDFKEEGSENAVKAAGKYRQQGRNYIVEDGDIIFFKFNTPQ  208

Query  258  GGKK  247
              KK
Sbjct  209  QPKK  212



>gb|AAY14876.1| unknown [Homo sapiens]
Length=213

 Score =   240 bits (613),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 118/184 (64%), Positives = 141/184 (77%), Gaps = 1/184 (1%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHG-GELIIPFSAALERSL  619
            E+ N    LT+KP+VYLVN++EKDY RKKNK+L KI  WV ++  G L+IPFS ALE  L
Sbjct  29   EVLNKHLFLTSKPMVYLVNLSEKDYIRKKNKWLIKIKEWVDKYDPGALVIPFSGALELKL  88

Query  618  ADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAA  439
             ++  +E  KY E N  QSALPKIIK GF+A+ L YFFTAGPDEV+ W IR+ TKAPQAA
Sbjct  89   QELSAEERQKYLEANMTQSALPKIIKAGFAALQLEYFFTAGPDEVRAWTIRKGTKAPQAA  148

Query  438  GAIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSG  259
            G IHTDFE+GFI AEVMK+ED KE GSE AVKA GKYRQ+G+ Y+V+DGD+IFFKFN   
Sbjct  149  GKIHTDFEKGFIMAEVMKYEDFKEEGSENAVKAAGKYRQQGRNYIVEDGDIIFFKFNTPQ  208

Query  258  GGKK  247
              KK
Sbjct  209  QPKK  212



>ref|XP_005452975.1| PREDICTED: obg-like ATPase 1-like isoform X6 [Oreochromis niloticus]
Length=332

 Score =   244 bits (623),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 117/184 (64%), Positives = 140/184 (76%), Gaps = 1/184 (1%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHG-GELIIPFSAALERSL  619
            E+ N +  LT+KP++YLVN++EKDY R+KNK+L KI  WV  H  G L+IPFS  LE  L
Sbjct  148  EVLNKYLFLTSKPMIYLVNLSEKDYIRRKNKWLVKIKEWVDSHDPGALVIPFSGGLESLL  207

Query  618  ADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAA  439
             D   +E  KYC E+K QSAL KIIK G++A+ L YFFTAGPDEV+ W IR+ TKAPQAA
Sbjct  208  QDKSEEERQKYCTEHKTQSALSKIIKAGYAALQLEYFFTAGPDEVRAWTIRKGTKAPQAA  267

Query  438  GAIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSG  259
            G IHTDFERGFI AEVMKF+D KE GSE AVKA GKYRQ+G+ Y+V+DGD+IFFKFN   
Sbjct  268  GKIHTDFERGFIMAEVMKFQDFKEEGSESAVKAAGKYRQQGRNYIVEDGDIIFFKFNAPN  327

Query  258  GGKK  247
              KK
Sbjct  328  APKK  331



>ref|XP_005519867.1| PREDICTED: obg-like ATPase 1 isoform X4 [Pseudopodoces humilis]
 ref|XP_008632972.1| PREDICTED: obg-like ATPase 1 isoform X2 [Corvus brachyrhynchos]
 ref|XP_010307801.1| PREDICTED: obg-like ATPase 1 [Balearica regulorum gibbericeps]
 ref|XP_010405059.1| PREDICTED: obg-like ATPase 1 [Corvus cornix cornix]
Length=273

 Score =   242 bits (617),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 118/184 (64%), Positives = 140/184 (76%), Gaps = 1/184 (1%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHG-GELIIPFSAALERSL  619
            ++ N     T+KP++YLVN++EKDY RKKNK+L KI  WV +H  G L+IPFS ALE  L
Sbjct  89   DVLNKHLFFTSKPMIYLVNLSEKDYIRKKNKWLIKIKEWVDKHDPGALVIPFSGALELKL  148

Query  618  ADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAA  439
             DM  +E  KY EEN  QSAL KIIK G++A+ L YFFTAGPDEV+ W IR+ TKAPQAA
Sbjct  149  QDMSAEEKQKYLEENMTQSALAKIIKAGYAALQLEYFFTAGPDEVRAWTIRKGTKAPQAA  208

Query  438  GAIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSG  259
            G IHTDFE+GFI AEVMK+ED KE GSE AVKA GKYRQ+G+ YVV+DGD+IFFKFN   
Sbjct  209  GKIHTDFEKGFIMAEVMKYEDFKEGGSEAAVKAAGKYRQQGRNYVVEDGDIIFFKFNTPQ  268

Query  258  GGKK  247
              KK
Sbjct  269  QPKK  272



>ref|XP_004092018.1| PREDICTED: obg-like ATPase 1 isoform 2 [Nomascus leucogenys]
Length=238

 Score =   240 bits (613),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 119/184 (65%), Positives = 141/184 (77%), Gaps = 1/184 (1%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHG-GELIIPFSAALERSL  619
            E+ N    LT+KP+VYLVN++EKDY RKKNK+L KI  WV ++  G L+IPFS ALE  L
Sbjct  54   EVLNKHLFLTSKPMVYLVNLSEKDYIRKKNKWLIKIKEWVDKYDPGALVIPFSGALELKL  113

Query  618  ADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAA  439
             ++  +E  KY E N  QSALPKIIK GF+A+ L YFFTAGPDEV+ W IR+ TKAPQAA
Sbjct  114  QELSAEERQKYLEANMTQSALPKIIKAGFAALQLEYFFTAGPDEVRAWTIRKGTKAPQAA  173

Query  438  GAIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSG  259
            G IHTDFE+GFI AEVMK+ED KE GSE AVKA GKYRQ+G+ YVV+DGD+IFFKFN   
Sbjct  174  GKIHTDFEKGFIMAEVMKYEDFKEEGSENAVKAAGKYRQQGRNYVVEDGDIIFFKFNTPQ  233

Query  258  GGKK  247
              KK
Sbjct  234  QPKK  237



>ref|XP_009581765.1| PREDICTED: obg-like ATPase 1 [Fulmarus glacialis]
Length=273

 Score =   241 bits (616),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 117/184 (64%), Positives = 140/184 (76%), Gaps = 1/184 (1%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHG-GELIIPFSAALERSL  619
            ++ N     T+KP++YLVN++EKDY RKKNK+L KI  WV +H  G L+IPFS ALE  L
Sbjct  89   DVLNKHLFFTSKPMIYLVNLSEKDYVRKKNKWLIKIKEWVDKHDPGALVIPFSGALELKL  148

Query  618  ADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAA  439
             DM  +E  KY EEN  QSAL KIIK G++A+ L YFFTAGPDEV+ W IR+ TKAPQAA
Sbjct  149  QDMSAEEKQKYLEENMTQSALAKIIKAGYAALQLEYFFTAGPDEVRAWTIRKGTKAPQAA  208

Query  438  GAIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSG  259
            G IHTDFE+GFI AEVMK+ED KE GSE AVKA GKYRQ+G+ Y+V+DGD+IFFKFN   
Sbjct  209  GKIHTDFEKGFIMAEVMKYEDFKEGGSEAAVKAAGKYRQQGRNYIVEDGDIIFFKFNTPQ  268

Query  258  GGKK  247
              KK
Sbjct  269  QPKK  272



>ref|XP_010116935.1| PREDICTED: obg-like ATPase 1 [Chlamydotis macqueenii]
Length=273

 Score =   241 bits (616),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 117/184 (64%), Positives = 140/184 (76%), Gaps = 1/184 (1%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHG-GELIIPFSAALERSL  619
            ++ N     T+KP++YLVN++EKDY RKKNK+L KI  WV +H  G L+IPFS ALE  L
Sbjct  89   DVLNKHLFFTSKPMIYLVNLSEKDYIRKKNKWLIKIKEWVDKHDPGALVIPFSGALELKL  148

Query  618  ADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAA  439
             DM  +E  KY EEN  QSAL KIIK G++A+ L YFFTAGPDEV+ W IR+ TKAPQAA
Sbjct  149  QDMSAEEKQKYLEENMTQSALAKIIKAGYAALQLEYFFTAGPDEVRAWTIRKGTKAPQAA  208

Query  438  GAIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSG  259
            G IHTDFE+GFI AEVMK+ED KE GSE AVKA GKYRQ+G+ Y+V+DGD+IFFKFN   
Sbjct  209  GKIHTDFEKGFIMAEVMKYEDFKEGGSEAAVKAAGKYRQQGRNYIVEDGDIIFFKFNTPQ  268

Query  258  GGKK  247
              KK
Sbjct  269  QPKK  272



>ref|XP_009086253.1| PREDICTED: obg-like ATPase 1 isoform X2 [Serinus canaria]
 ref|XP_009806156.1| PREDICTED: obg-like ATPase 1 [Gavia stellata]
 ref|XP_009892842.1| PREDICTED: obg-like ATPase 1 [Charadrius vociferus]
 ref|XP_010015190.1| PREDICTED: obg-like ATPase 1 [Nestor notabilis]
Length=273

 Score =   241 bits (616),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 117/184 (64%), Positives = 140/184 (76%), Gaps = 1/184 (1%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHG-GELIIPFSAALERSL  619
            ++ N     T+KP++YLVN++EKDY RKKNK+L KI  WV +H  G L+IPFS ALE  L
Sbjct  89   DVLNKHLFFTSKPMIYLVNLSEKDYIRKKNKWLIKIKEWVDKHDPGALVIPFSGALELKL  148

Query  618  ADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAA  439
             DM  +E  KY EEN  QSAL KIIK G++A+ L YFFTAGPDEV+ W IR+ TKAPQAA
Sbjct  149  QDMSAEEKQKYLEENMTQSALAKIIKAGYAALQLEYFFTAGPDEVRAWTIRKGTKAPQAA  208

Query  438  GAIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSG  259
            G IHTDFE+GFI AEVMK+ED KE GSE AVKA GKYRQ+G+ Y+V+DGD+IFFKFN   
Sbjct  209  GKIHTDFEKGFIMAEVMKYEDFKEGGSEAAVKAAGKYRQQGRNYIVEDGDIIFFKFNTPQ  268

Query  258  GGKK  247
              KK
Sbjct  269  QPKK  272



>gb|EPY26360.1| GTP binding protein [Angomonas deanei]
Length=208

 Score =   239 bits (610),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 107/180 (59%), Positives = 138/180 (77%), Gaps = 0/180 (0%)
 Frame = -3

Query  786  NTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHGGELIIPFSAALERSLADMP  607
            NT Q++TAKP ++LVNM+E DY R++NK+L K+  W+ E  GE +IPFSA LE +  +M 
Sbjct  29   NTLQLITAKPAMFLVNMSENDYTRQRNKWLKKLKDWIDEQTGEPMIPFSAELESNFVNMS  88

Query  606  PDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIH  427
            P+E AKYCEENK +S + KII T +  INLI++FTAGPDEVKCW I+R TKAPQAAG IH
Sbjct  89   PEEVAKYCEENKTKSQIHKIITTAYGIINLIHYFTAGPDEVKCWTIQRHTKAPQAAGRIH  148

Query  426  TDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  247
            TD E+GFICAEV+++ED   L SE A +  GK  Q+G+ Y V+DGD+I+FKFN + GGKK
Sbjct  149  TDMEKGFICAEVIEWEDFDRLESEAACRDEGKQHQQGRNYEVKDGDIIYFKFNAAKGGKK  208



>ref|XP_005442958.1| PREDICTED: obg-like ATPase 1 [Falco cherrug]
Length=273

 Score =   241 bits (616),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 117/184 (64%), Positives = 140/184 (76%), Gaps = 1/184 (1%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHG-GELIIPFSAALERSL  619
            ++ N     T+KP++YLVN++EKDY RKKNK+L KI  WV +H  G L+IPFS ALE  L
Sbjct  89   DVLNKHLFFTSKPMIYLVNLSEKDYIRKKNKWLIKIKEWVDKHDPGALVIPFSGALELKL  148

Query  618  ADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAA  439
             DM  +E  KY EEN  QSAL KIIK G++A+ L YFFTAGPDEV+ W IR+ TKAPQAA
Sbjct  149  QDMSAEEKQKYLEENMTQSALAKIIKAGYAALQLEYFFTAGPDEVRAWTIRKGTKAPQAA  208

Query  438  GAIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSG  259
            G IHTDFE+GFI AEVMK+ED KE GSE AVKA GKYRQ+G+ Y+V+DGD+IFFKFN   
Sbjct  209  GKIHTDFEKGFIMAEVMKYEDFKEGGSEAAVKAAGKYRQQGRNYIVEDGDIIFFKFNTPQ  268

Query  258  GGKK  247
              KK
Sbjct  269  QPKK  272



>ref|XP_010162756.1| PREDICTED: obg-like ATPase 1 [Caprimulgus carolinensis]
Length=273

 Score =   241 bits (616),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 117/184 (64%), Positives = 140/184 (76%), Gaps = 1/184 (1%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHG-GELIIPFSAALERSL  619
            ++ N     T+KP++YLVN++EKDY RKKNK+L KI  WV +H  G L+IPFS ALE  L
Sbjct  89   DVLNKHLFFTSKPMIYLVNLSEKDYIRKKNKWLIKIKEWVDKHDPGALVIPFSGALELKL  148

Query  618  ADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAA  439
             DM  +E  KY EEN  QSAL KIIK G++A+ L YFFTAGPDEV+ W IR+ TKAPQAA
Sbjct  149  QDMSAEEKQKYLEENMTQSALAKIIKAGYAALQLEYFFTAGPDEVRAWTIRKGTKAPQAA  208

Query  438  GAIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSG  259
            G IHTDFE+GFI AEVMK+ED KE GSE AVKA GKYRQ+G+ Y+V+DGD+IFFKFN   
Sbjct  209  GKIHTDFEKGFIMAEVMKYEDFKEGGSEAAVKAAGKYRQQGRNYIVEDGDIIFFKFNTPQ  268

Query  258  GGKK  247
              KK
Sbjct  269  QPKK  272



>ref|XP_008929287.1| PREDICTED: obg-like ATPase 1 [Manacus vitellinus]
Length=273

 Score =   241 bits (616),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 117/184 (64%), Positives = 140/184 (76%), Gaps = 1/184 (1%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHG-GELIIPFSAALERSL  619
            ++ N     T+KP++YLVN++EKDY RKKNK+L KI  WV +H  G L+IPFS ALE  L
Sbjct  89   DVLNKHLFFTSKPMIYLVNLSEKDYIRKKNKWLIKIKEWVDKHDPGALVIPFSGALELKL  148

Query  618  ADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAA  439
             DM  +E  KY EEN  QSAL KIIK G++A+ L YFFTAGPDEV+ W IR+ TKAPQAA
Sbjct  149  QDMSAEEKQKYLEENMTQSALAKIIKAGYAALQLEYFFTAGPDEVRAWTIRKGTKAPQAA  208

Query  438  GAIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSG  259
            G IHTDFE+GFI AEVMK+ED KE GSE AVKA GKYRQ+G+ Y+V+DGD+IFFKFN   
Sbjct  209  GKIHTDFEKGFIMAEVMKYEDFKEGGSEAAVKAAGKYRQQGRNYIVEDGDIIFFKFNTPQ  268

Query  258  GGKK  247
              KK
Sbjct  269  QPKK  272



>ref|XP_010073941.1| PREDICTED: obg-like ATPase 1 [Pterocles gutturalis]
Length=273

 Score =   241 bits (616),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 117/184 (64%), Positives = 140/184 (76%), Gaps = 1/184 (1%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHG-GELIIPFSAALERSL  619
            ++ N     T+KP++YLVN++EKDY RKKNK+L KI  WV +H  G L+IPFS ALE  L
Sbjct  89   DVLNKHLFFTSKPMIYLVNLSEKDYIRKKNKWLIKIKEWVDKHDPGALVIPFSGALELKL  148

Query  618  ADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAA  439
             DM  +E  KY EEN  QSAL KIIK G++A+ L YFFTAGPDEV+ W IR+ TKAPQAA
Sbjct  149  QDMSAEEKQKYLEENMTQSALAKIIKAGYAALQLEYFFTAGPDEVRAWTIRKGTKAPQAA  208

Query  438  GAIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSG  259
            G IHTDFE+GFI AEVMK+ED KE GSE AVKA GKYRQ+G+ Y+V+DGD+IFFKFN   
Sbjct  209  GKIHTDFEKGFIMAEVMKYEDFKEGGSEAAVKAAGKYRQQGRNYIVEDGDIIFFKFNTPQ  268

Query  258  GGKK  247
              KK
Sbjct  269  QPKK  272



>ref|XP_004878683.1| PREDICTED: obg-like ATPase 1-like [Heterocephalus glaber]
Length=238

 Score =   240 bits (612),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 118/184 (64%), Positives = 141/184 (77%), Gaps = 1/184 (1%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHG-GELIIPFSAALERSL  619
            E+ N    LT+KP+VYLVN++EKDY RKKNK+L KI  WV ++  G L+IPFS ALE  L
Sbjct  54   EVLNKHLFLTSKPMVYLVNLSEKDYIRKKNKWLIKIKEWVDKYDPGALVIPFSGALELKL  113

Query  618  ADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAA  439
             ++  +E  KY E N  QSALPKIIK GF+A+ L YFFTAGPDEV+ W IR+ TKAPQAA
Sbjct  114  QELSAEERQKYLEANMTQSALPKIIKAGFAALQLEYFFTAGPDEVRAWTIRKGTKAPQAA  173

Query  438  GAIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSG  259
            G IHTDFE+GFI AEVMK+ED KE GSE AVKA GKYRQ+G+ Y+V+DGD+IFFKFN   
Sbjct  174  GKIHTDFEKGFIMAEVMKYEDFKEEGSENAVKAAGKYRQQGRNYIVEDGDIIFFKFNTPQ  233

Query  258  GGKK  247
              KK
Sbjct  234  QPKK  237



>ref|NP_001011708.1| obg-like ATPase 1 isoform 2 [Homo sapiens]
 ref|XP_001928832.2| PREDICTED: Obg-like ATPase 1 [Sus scrofa]
 ref|XP_003824290.1| PREDICTED: obg-like ATPase 1 isoform X2 [Pan paniscus]
 ref|XP_003949968.1| PREDICTED: obg-like ATPase 1 isoform X2 [Pan troglodytes]
 ref|XP_004032862.1| PREDICTED: obg-like ATPase 1-like isoform 2 [Gorilla gorilla 
gorilla]
 ref|XP_004409048.1| PREDICTED: obg-like ATPase 1 isoform 3 [Odobenus rosmarus divergens]
 ref|XP_004577109.1| PREDICTED: obg-like ATPase 1 isoform X4 [Ochotona princeps]
 ref|XP_006213992.1| PREDICTED: obg-like ATPase 1-like [Vicugna pacos]
 ref|XP_006744649.1| PREDICTED: obg-like ATPase 1 isoform X3 [Leptonychotes weddellii]
 ref|XP_011283607.1| PREDICTED: obg-like ATPase 1 isoform X2 [Felis catus]
 ref|XP_011355676.1| PREDICTED: obg-like ATPase 1 isoform X2 [Pteropus vampyrus]
 dbj|BAC11153.1| unnamed protein product [Homo sapiens]
 gb|EAX11150.1| GTP-binding protein PTD004, isoform CRA_b [Homo sapiens]
Length=238

 Score =   240 bits (612),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 118/184 (64%), Positives = 141/184 (77%), Gaps = 1/184 (1%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHG-GELIIPFSAALERSL  619
            E+ N    LT+KP+VYLVN++EKDY RKKNK+L KI  WV ++  G L+IPFS ALE  L
Sbjct  54   EVLNKHLFLTSKPMVYLVNLSEKDYIRKKNKWLIKIKEWVDKYDPGALVIPFSGALELKL  113

Query  618  ADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAA  439
             ++  +E  KY E N  QSALPKIIK GF+A+ L YFFTAGPDEV+ W IR+ TKAPQAA
Sbjct  114  QELSAEERQKYLEANMTQSALPKIIKAGFAALQLEYFFTAGPDEVRAWTIRKGTKAPQAA  173

Query  438  GAIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSG  259
            G IHTDFE+GFI AEVMK+ED KE GSE AVKA GKYRQ+G+ Y+V+DGD+IFFKFN   
Sbjct  174  GKIHTDFEKGFIMAEVMKYEDFKEEGSENAVKAAGKYRQQGRNYIVEDGDIIFFKFNTPQ  233

Query  258  GGKK  247
              KK
Sbjct  234  QPKK  237



>ref|XP_004426695.1| PREDICTED: obg-like ATPase 1 isoform 3 [Ceratotherium simum simum]
 ref|XP_004674580.1| PREDICTED: obg-like ATPase 1 isoform X3 [Condylura cristata]
 ref|XP_005324666.1| PREDICTED: obg-like ATPase 1 isoform X3 [Ictidomys tridecemlineatus]
Length=238

 Score =   240 bits (612),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 118/184 (64%), Positives = 141/184 (77%), Gaps = 1/184 (1%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHG-GELIIPFSAALERSL  619
            E+ N    LT+KP+VYLVN++EKDY RKKNK+L KI  WV ++  G L+IPFS ALE  L
Sbjct  54   EVLNKHLFLTSKPMVYLVNLSEKDYIRKKNKWLIKIKEWVDKYDPGALVIPFSGALELKL  113

Query  618  ADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAA  439
             ++  +E  KY E N  QSALPKIIK GF+A+ L YFFTAGPDEV+ W IR+ TKAPQAA
Sbjct  114  QELSAEERQKYLEANMTQSALPKIIKAGFAALQLEYFFTAGPDEVRAWTIRKGTKAPQAA  173

Query  438  GAIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSG  259
            G IHTDFE+GFI AEVMK+ED KE GSE AVKA GKYRQ+G+ Y+V+DGD+IFFKFN   
Sbjct  174  GKIHTDFEKGFIMAEVMKYEDFKEEGSENAVKAAGKYRQQGRNYIVEDGDIIFFKFNTPQ  233

Query  258  GGKK  247
              KK
Sbjct  234  QPKK  237



>gb|KFP49878.1| Obg-like ATPase 1, partial [Cathartes aura]
 gb|KFQ57717.1| Obg-like ATPase 1, partial [Pelecanus crispus]
 gb|KFV51903.1| Obg-like ATPase 1, partial [Tyto alba]
Length=274

 Score =   241 bits (615),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 117/184 (64%), Positives = 140/184 (76%), Gaps = 1/184 (1%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHG-GELIIPFSAALERSL  619
            ++ N     T+KP++YLVN++EKDY RKKNK+L KI  WV +H  G L+IPFS ALE  L
Sbjct  90   DVLNKHLFFTSKPMIYLVNLSEKDYIRKKNKWLIKIKEWVDKHDPGALVIPFSGALELKL  149

Query  618  ADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAA  439
             DM  +E  KY EEN  QSAL KIIK G++A+ L YFFTAGPDEV+ W IR+ TKAPQAA
Sbjct  150  QDMSAEEKQKYLEENMTQSALAKIIKAGYAALQLEYFFTAGPDEVRAWTIRKGTKAPQAA  209

Query  438  GAIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSG  259
            G IHTDFE+GFI AEVMK+ED KE GSE AVKA GKYRQ+G+ Y+V+DGD+IFFKFN   
Sbjct  210  GKIHTDFEKGFIMAEVMKYEDFKEGGSEAAVKAAGKYRQQGRNYIVEDGDIIFFKFNTPQ  269

Query  258  GGKK  247
              KK
Sbjct  270  QPKK  273



>ref|XP_004220982.1| GTP-binding protein [Plasmodium cynomolgi strain B]
 dbj|GAB64851.1| GTP-binding protein [Plasmodium cynomolgi strain B]
Length=392

 Score =   245 bits (625),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 119/184 (65%), Positives = 138/184 (75%), Gaps = 1/184 (1%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHGGELIIPFSAALERSLA  616
            E+ N F  LTAKPVVYLVNM+E D+ R+KNK+L KI+ WVQE     IIP+ A +E  L 
Sbjct  209  EVINEFNFLTAKPVVYLVNMSESDFIRQKNKYLAKIYNWVQEKNKGTIIPYCADMELKLL  268

Query  615  DMPPDEAAKYCEENKV-QSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAA  439
             M  DE  KY EEN + QS L KI+KTG+  INLI+FFT GPDEVKCW IR+ TKAPQAA
Sbjct  269  SMSEDEKKKYFEENNIKQSMLSKIVKTGYYEINLIHFFTCGPDEVKCWTIRKGTKAPQAA  328

Query  438  GAIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSG  259
            G IHTDFE+GFICAEV K+ DL E  SE  VKA GKY Q+GK YVV+DGD++FFKFNVS 
Sbjct  329  GVIHTDFEKGFICAEVYKYTDLVEFKSEGEVKANGKYLQKGKDYVVEDGDIVFFKFNVSS  388

Query  258  GGKK  247
             GKK
Sbjct  389  SGKK  392



>ref|XP_003961956.1| PREDICTED: obg-like ATPase 1-like [Takifugu rubripes]
Length=398

 Score =   245 bits (626),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 119/184 (65%), Positives = 142/184 (77%), Gaps = 1/184 (1%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHG-GELIIPFSAALERSL  619
            E+ N +  LT+KP++YLVN++EKDY RKKNK+L KI  WV  H  G L+IPFS  LE SL
Sbjct  214  EVLNKYLFLTSKPMIYLVNLSEKDYIRKKNKWLVKIKEWVDGHDPGALVIPFSGGLENSL  273

Query  618  ADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAA  439
             DM  +E  KYC E+K QSAL +IIK G++A+ L YFFTAGPDEV+ W IR+ TKAPQAA
Sbjct  274  QDMSEEEMQKYCVEHKTQSALSRIIKAGYAALQLEYFFTAGPDEVRAWTIRKGTKAPQAA  333

Query  438  GAIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSG  259
            G IHTDFE+GFI AEVMKF+D KE GSE AVKA GKYRQ+G+ YVV+DGD+IFFKFN   
Sbjct  334  GKIHTDFEKGFIMAEVMKFQDFKEEGSESAVKAAGKYRQQGRNYVVEDGDIIFFKFNTPN  393

Query  258  GGKK  247
              KK
Sbjct  394  APKK  397



>emb|CAG09966.1| unnamed protein product, partial [Tetraodon nigroviridis]
Length=346

 Score =   243 bits (621),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 117/184 (64%), Positives = 142/184 (77%), Gaps = 1/184 (1%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHG-GELIIPFSAALERSL  619
            E+ N +  LT+KP++YLVN++EKDY R+KNK+L KI  WV  H  G L+IPFS  LE SL
Sbjct  162  EVLNKYLFLTSKPMIYLVNLSEKDYVRRKNKWLVKIKEWVDGHDPGALVIPFSGGLESSL  221

Query  618  ADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAA  439
             +M  +E  KYC E+K QSAL +IIK G++A+ L YFFTAGPDEV+ W IR+ TKAPQAA
Sbjct  222  QEMSEEEMLKYCTEHKTQSALSRIIKAGYAALQLEYFFTAGPDEVRAWTIRKGTKAPQAA  281

Query  438  GAIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSG  259
            G IHTDFE+GFI AEVMKF+D KE GSE AVKA GKYRQ+G+ YVV+DGD+IFFKFN   
Sbjct  282  GKIHTDFEKGFIMAEVMKFQDFKEEGSESAVKAAGKYRQQGRNYVVEDGDIIFFKFNTPN  341

Query  258  GGKK  247
              KK
Sbjct  342  APKK  345



>ref|XP_007938961.1| PREDICTED: obg-like ATPase 1 isoform X2 [Orycteropus afer afer]
Length=238

 Score =   240 bits (612),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 118/184 (64%), Positives = 141/184 (77%), Gaps = 1/184 (1%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHG-GELIIPFSAALERSL  619
            E+ N    LT+KP+VYLVN++EKDY RKKNK+L KI  WV ++  G L+IPFS ALE  L
Sbjct  54   EVLNKHLFLTSKPMVYLVNLSEKDYIRKKNKWLIKIKEWVDKYDPGALVIPFSGALELKL  113

Query  618  ADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAA  439
             ++  +E  KY E N  QSALPKIIK GF+A+ L YFFTAGPDEV+ W IR+ TKAPQAA
Sbjct  114  QELSAEERQKYLEANMTQSALPKIIKAGFAALQLEYFFTAGPDEVRAWTIRKGTKAPQAA  173

Query  438  GAIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSG  259
            G IHTDFE+GFI AEVMK+ED KE GSE AVKA GKYRQ+G+ Y+V+DGD+IFFKFN   
Sbjct  174  GKIHTDFEKGFIMAEVMKYEDFKEEGSENAVKAAGKYRQQGRNYIVEDGDIIFFKFNTPQ  233

Query  258  GGKK  247
              KK
Sbjct  234  QPKK  237



>gb|AAF71123.1|AF116721_103 PRO2455 [Homo sapiens]
Length=238

 Score =   240 bits (612),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 118/184 (64%), Positives = 141/184 (77%), Gaps = 1/184 (1%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHG-GELIIPFSAALERSL  619
            E+ N    LT+KP+VYLVN++EKDY RKKNK+L KI  WV ++  G L+IPFS ALE  L
Sbjct  54   EVLNKHLFLTSKPMVYLVNLSEKDYIRKKNKWLIKIKEWVDKYDPGALVIPFSGALELKL  113

Query  618  ADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAA  439
             ++  +E  KY E N  QSALPKIIK GF+A+ L YFFTAGPDEV+ W IR+ TKAPQAA
Sbjct  114  QELSAEERQKYLEANMTQSALPKIIKAGFAALQLEYFFTAGPDEVRAWTIRKGTKAPQAA  173

Query  438  GAIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSG  259
            G IHTDFE+GFI AEVMK+ED KE GSE AVKA GKYRQ+G+ Y+V+DGD+IFFKFN   
Sbjct  174  GKIHTDFEKGFIMAEVMKYEDFKEEGSENAVKAAGKYRQQGRNYIVEDGDIIFFKFNTPR  233

Query  258  GGKK  247
              KK
Sbjct  234  QPKK  237



>ref|XP_009276861.1| PREDICTED: obg-like ATPase 1 [Aptenodytes forsteri]
Length=294

 Score =   241 bits (616),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 117/184 (64%), Positives = 140/184 (76%), Gaps = 1/184 (1%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHG-GELIIPFSAALERSL  619
            ++ N     T+KP++YLVN++EKDY RKKNK+L KI  WV +H  G L+IPFS ALE  L
Sbjct  110  DVLNKHLFFTSKPMIYLVNLSEKDYIRKKNKWLIKIKEWVDKHDPGALVIPFSGALELKL  169

Query  618  ADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAA  439
             DM  +E  KY EEN  QSAL KIIK G++A+ L YFFTAGPDEV+ W IR+ TKAPQAA
Sbjct  170  QDMSAEEKQKYLEENMTQSALAKIIKAGYAALQLEYFFTAGPDEVRAWTIRKGTKAPQAA  229

Query  438  GAIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSG  259
            G IHTDFE+GFI AEVMK+ED KE GSE AVKA GKYRQ+G+ Y+V+DGD+IFFKFN   
Sbjct  230  GKIHTDFEKGFIMAEVMKYEDFKEGGSEAAVKAAGKYRQQGRNYIVEDGDIIFFKFNTPQ  289

Query  258  GGKK  247
              KK
Sbjct  290  QPKK  293



>ref|XP_005921550.1| PREDICTED: obg-like ATPase 1-like isoform X4 [Haplochromis burtoni]
Length=283

 Score =   241 bits (615),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 116/184 (63%), Positives = 139/184 (76%), Gaps = 1/184 (1%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHG-GELIIPFSAALERSL  619
            E+ N +  LT+KP++YLVN++EKDY R+KNK+L KI  WV  H  G L+IPFS  LE  L
Sbjct  99   EVLNKYLFLTSKPMIYLVNLSEKDYIRRKNKWLVKIKEWVDSHDPGALVIPFSGGLESLL  158

Query  618  ADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAA  439
             D   +E  KY  E+K QSAL KIIK G++A+ L YFFTAGPDEV+ W IR+ TKAPQAA
Sbjct  159  QDKSEEERQKYSTEHKTQSALSKIIKAGYAALQLEYFFTAGPDEVRAWTIRKGTKAPQAA  218

Query  438  GAIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSG  259
            G IHTDFERGFI AEVMKF+D KE GSE AVKA GKYRQ+G+ Y+V+DGD+IFFKFN   
Sbjct  219  GKIHTDFERGFIMAEVMKFQDFKEEGSESAVKAAGKYRQQGRNYIVEDGDIIFFKFNAPN  278

Query  258  GGKK  247
              KK
Sbjct  279  APKK  282



>gb|KFV04274.1| Obg-like ATPase 1, partial [Tauraco erythrolophus]
Length=276

 Score =   241 bits (615),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 117/184 (64%), Positives = 140/184 (76%), Gaps = 1/184 (1%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHG-GELIIPFSAALERSL  619
            ++ N     T+KP++YLVN++EKDY RKKNK+L KI  WV +H  G L+IPFS ALE  L
Sbjct  92   DVLNKHLFFTSKPMIYLVNLSEKDYIRKKNKWLIKIKEWVDKHDPGALVIPFSGALELKL  151

Query  618  ADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAA  439
             DM  +E  KY EEN  QSAL KIIK G++A+ L YFFTAGPDEV+ W IR+ TKAPQAA
Sbjct  152  QDMSAEEKQKYLEENMTQSALAKIIKAGYAALQLEYFFTAGPDEVRAWTIRKGTKAPQAA  211

Query  438  GAIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSG  259
            G IHTDFE+GFI AEVMK+ED KE GSE AVKA GKYRQ+G+ Y+V+DGD+IFFKFN   
Sbjct  212  GKIHTDFEKGFIMAEVMKYEDFKEGGSEAAVKAAGKYRQQGRNYIVEDGDIIFFKFNTPQ  271

Query  258  GGKK  247
              KK
Sbjct  272  QPKK  275



>ref|XP_007527278.1| PREDICTED: obg-like ATPase 1 isoform X2 [Erinaceus europaeus]
Length=238

 Score =   239 bits (611),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 118/184 (64%), Positives = 140/184 (76%), Gaps = 1/184 (1%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHG-GELIIPFSAALERSL  619
            E+ N    LT+KP+VYLVN++EKDY RKKNK+L KI  WV  +  G L+IPFS ALE  L
Sbjct  54   EVLNKHLFLTSKPMVYLVNLSEKDYIRKKNKWLIKIKEWVDNYDPGALVIPFSGALELKL  113

Query  618  ADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAA  439
             ++  +E  KY E N  QSALPKIIK GF+A+ L YFFTAGPDEV+ W IR+ TKAPQAA
Sbjct  114  QELSAEERQKYLEANMTQSALPKIIKAGFAALQLEYFFTAGPDEVRAWTIRKGTKAPQAA  173

Query  438  GAIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSG  259
            G IHTDFE+GFI AEVMK+ED KE GSE AVKA GKYRQ+G+ Y+V+DGD+IFFKFN   
Sbjct  174  GKIHTDFEKGFIMAEVMKYEDFKEEGSENAVKAAGKYRQQGRNYIVEDGDIIFFKFNTPQ  233

Query  258  GGKK  247
              KK
Sbjct  234  QPKK  237



>ref|XP_007431000.1| PREDICTED: obg-like ATPase 1-like isoform X3 [Python bivittatus]
Length=353

 Score =   243 bits (620),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 120/184 (65%), Positives = 142/184 (77%), Gaps = 1/184 (1%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHG-GELIIPFSAALERSL  619
            ++ N    LT+KP++YL+N++EKDY RKKNK+L KI  WV +H  G L+IPFS ALE  L
Sbjct  169  DVLNKHLFLTSKPMIYLINLSEKDYIRKKNKWLIKIKEWVDKHDPGALVIPFSGALELKL  228

Query  618  ADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAA  439
             +M  +E  KY EEN  QSALPKIIK G++A+ L YFFTAGPDEV+ W IR+ TKAPQAA
Sbjct  229  QEMSAEEKQKYLEENMTQSALPKIIKAGYAALQLEYFFTAGPDEVRAWTIRKGTKAPQAA  288

Query  438  GAIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSG  259
            G IHTDFE+GFI AEVMKFED KE GSE AVKA GKYRQ+G+ YVV+DGDVIFFKFN   
Sbjct  289  GKIHTDFEKGFIMAEVMKFEDFKEGGSEAAVKAAGKYRQQGRNYVVEDGDVIFFKFNTPQ  348

Query  258  GGKK  247
              KK
Sbjct  349  QPKK  352



>ref|XP_004267373.1| PREDICTED: obg-like ATPase 1 isoform 2 [Orcinus orca]
 ref|XP_004320700.1| PREDICTED: obg-like ATPase 1-like [Tursiops truncatus]
Length=238

 Score =   239 bits (610),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 118/184 (64%), Positives = 141/184 (77%), Gaps = 1/184 (1%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHG-GELIIPFSAALERSL  619
            E+ N    LT+KP+VYLVN++EKDY RKKNK+L KI  WV ++  G L+IPFS ALE  L
Sbjct  54   EVLNKHLFLTSKPMVYLVNLSEKDYIRKKNKWLIKIKEWVDKYDPGALVIPFSGALELKL  113

Query  618  ADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAA  439
             ++  +E  KY E N  QSALPKIIK GF+A+ L YFFTAGPDEV+ W IR+ TKAPQAA
Sbjct  114  QELSAEERQKYLEANMTQSALPKIIKAGFAALQLEYFFTAGPDEVRAWTIRKGTKAPQAA  173

Query  438  GAIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSG  259
            G IHTDFE+GFI AEVMK+ED KE GSE AVKA GKYRQ+G+ Y+V+DGD+IFFKFN   
Sbjct  174  GKIHTDFEKGFIMAEVMKYEDFKEEGSENAVKAAGKYRQQGRNYIVEDGDIIFFKFNTPQ  233

Query  258  GGKK  247
              KK
Sbjct  234  QPKK  237



>ref|XP_009977093.1| PREDICTED: obg-like ATPase 1, partial [Tauraco erythrolophus]
Length=283

 Score =   241 bits (614),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 117/184 (64%), Positives = 140/184 (76%), Gaps = 1/184 (1%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHG-GELIIPFSAALERSL  619
            ++ N     T+KP++YLVN++EKDY RKKNK+L KI  WV +H  G L+IPFS ALE  L
Sbjct  99   DVLNKHLFFTSKPMIYLVNLSEKDYIRKKNKWLIKIKEWVDKHDPGALVIPFSGALELKL  158

Query  618  ADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAA  439
             DM  +E  KY EEN  QSAL KIIK G++A+ L YFFTAGPDEV+ W IR+ TKAPQAA
Sbjct  159  QDMSAEEKQKYLEENMTQSALAKIIKAGYAALQLEYFFTAGPDEVRAWTIRKGTKAPQAA  218

Query  438  GAIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSG  259
            G IHTDFE+GFI AEVMK+ED KE GSE AVKA GKYRQ+G+ Y+V+DGD+IFFKFN   
Sbjct  219  GKIHTDFEKGFIMAEVMKYEDFKEGGSEAAVKAAGKYRQQGRNYIVEDGDIIFFKFNTPQ  278

Query  258  GGKK  247
              KK
Sbjct  279  QPKK  282



>ref|XP_005452974.1| PREDICTED: obg-like ATPase 1-like isoform X5 [Oreochromis niloticus]
Length=350

 Score =   243 bits (620),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 117/184 (64%), Positives = 140/184 (76%), Gaps = 1/184 (1%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHG-GELIIPFSAALERSL  619
            E+ N +  LT+KP++YLVN++EKDY R+KNK+L KI  WV  H  G L+IPFS  LE  L
Sbjct  166  EVLNKYLFLTSKPMIYLVNLSEKDYIRRKNKWLVKIKEWVDSHDPGALVIPFSGGLESLL  225

Query  618  ADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAA  439
             D   +E  KYC E+K QSAL KIIK G++A+ L YFFTAGPDEV+ W IR+ TKAPQAA
Sbjct  226  QDKSEEERQKYCTEHKTQSALSKIIKAGYAALQLEYFFTAGPDEVRAWTIRKGTKAPQAA  285

Query  438  GAIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSG  259
            G IHTDFERGFI AEVMKF+D KE GSE AVKA GKYRQ+G+ Y+V+DGD+IFFKFN   
Sbjct  286  GKIHTDFERGFIMAEVMKFQDFKEEGSESAVKAAGKYRQQGRNYIVEDGDIIFFKFNAPN  345

Query  258  GGKK  247
              KK
Sbjct  346  APKK  349



>ref|XP_007451127.1| PREDICTED: obg-like ATPase 1 isoform X2 [Lipotes vexillifer]
Length=238

 Score =   239 bits (609),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 118/184 (64%), Positives = 141/184 (77%), Gaps = 1/184 (1%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHG-GELIIPFSAALERSL  619
            E+ N    LT+KP+VYLVN++EKDY RKKNK+L KI  WV ++  G L+IPFS ALE  L
Sbjct  54   EVLNKHLFLTSKPMVYLVNLSEKDYIRKKNKWLIKIKEWVDKYDPGALVIPFSGALELKL  113

Query  618  ADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAA  439
             ++  +E  KY E N  QSALPKIIK GF+A+ L YFFTAGPDEV+ W IR+ TKAPQAA
Sbjct  114  QELSAEERQKYLEANMTQSALPKIIKAGFAALQLEYFFTAGPDEVRAWTIRKGTKAPQAA  173

Query  438  GAIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSG  259
            G IHTDFE+GFI AEVMK+ED KE GSE AVKA GKYRQ+G+ Y+V+DGD+IFFKFN   
Sbjct  174  GKIHTDFEKGFIMAEVMKYEDFKEEGSENAVKAAGKYRQQGRNYIVEDGDIIFFKFNAPQ  233

Query  258  GGKK  247
              KK
Sbjct  234  QPKK  237



>gb|EHA99193.1| Obg-like ATPase 1, partial [Heterocephalus glaber]
Length=271

 Score =   240 bits (612),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 118/184 (64%), Positives = 141/184 (77%), Gaps = 1/184 (1%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHG-GELIIPFSAALERSL  619
            E+ N    LT+KP+VYLVN++EKDY RKKNK+L KI  WV ++  G L+IPFS ALE  L
Sbjct  87   EVLNKHLFLTSKPMVYLVNLSEKDYIRKKNKWLIKIKEWVDKYDPGALVIPFSGALELKL  146

Query  618  ADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAA  439
             ++  +E  KY E N  QSALPKIIK GF+A+ L YFFTAGPDEV+ W IR+ TKAPQAA
Sbjct  147  QELSAEERQKYLEANMTQSALPKIIKAGFAALQLEYFFTAGPDEVRAWTIRKGTKAPQAA  206

Query  438  GAIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSG  259
            G IHTDFE+GFI AEVMK+ED KE GSE AVKA GKYRQ+G+ Y+V+DGD+IFFKFN   
Sbjct  207  GKIHTDFEKGFIMAEVMKYEDFKEEGSENAVKAAGKYRQQGRNYIVEDGDIIFFKFNTPQ  266

Query  258  GGKK  247
              KK
Sbjct  267  QPKK  270



>ref|XP_668381.1| GTP-binding protein [Cryptosporidium hominis TU502]
Length=397

 Score =   244 bits (622),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 120/185 (65%), Positives = 144/185 (78%), Gaps = 2/185 (1%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHGGELIIPFSAALERSLA  616
            E+ N  Q LTAKPVVYLVN++EKDY R+KNKFLPKI  WV+EH   +IIP+SA  E +LA
Sbjct  213  ELLNEHQFLTAKPVVYLVNLSEKDYIRQKNKFLPKIAEWVKEHIDGVIIPYSAEFETALA  272

Query  615  DMPPDE--AAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQA  442
            ++  +E   A   E+   +S + KII TG+SA+NL+++FTAG DEVKCW IR  TKAPQA
Sbjct  273  ELHTEEEKMAYIKEKGASKSMIDKIINTGYSALNLLHYFTAGEDEVKCWTIRSGTKAPQA  332

Query  441  AGAIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVS  262
            AG IHTDFERGFICAEV KF DL ELGSE A+KA GKY Q+GK YVV+DGD+IFFKFNV+
Sbjct  333  AGIIHTDFERGFICAEVYKFTDLMELGSEAAIKAAGKYLQKGKDYVVEDGDIIFFKFNVT  392

Query  261  GGGKK  247
              GKK
Sbjct  393  NSGKK  397



>ref|XP_628099.1| yyaF/YCHF TRANSFAC/OBG family small GTpase plus RNA binding domain 
TGS [Cryptosporidium parvum Iowa II]
 gb|EAK88561.1| yyaF/YCHF TRANSFAC/OBG family small GTpase plus RNA binding domain 
TGS [Cryptosporidium parvum Iowa II]
Length=398

 Score =   244 bits (622),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 120/185 (65%), Positives = 144/185 (78%), Gaps = 2/185 (1%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHGGELIIPFSAALERSLA  616
            E+ N  Q LTAKPVVYLVN++EKDY R+KNKFLPKI  WV+EH   +IIP+SA  E +LA
Sbjct  214  ELLNEHQFLTAKPVVYLVNLSEKDYIRQKNKFLPKIAEWVKEHIDGVIIPYSAEFEAALA  273

Query  615  DMPPDE--AAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQA  442
            ++  +E   A   E+   +S + KII TG+SA+NL+++FTAG DEVKCW IR  TKAPQA
Sbjct  274  ELHTEEEKMAYIKEKGASKSMIDKIINTGYSALNLLHYFTAGEDEVKCWTIRSGTKAPQA  333

Query  441  AGAIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVS  262
            AG IHTDFERGFICAEV KF DL ELGSE A+KA GKY Q+GK YVV+DGD+IFFKFNV+
Sbjct  334  AGIIHTDFERGFICAEVYKFTDLMELGSEAAIKAAGKYLQKGKDYVVEDGDIIFFKFNVT  393

Query  261  GGGKK  247
              GKK
Sbjct  394  NSGKK  398



>gb|KFZ54967.1| Obg-like ATPase 1, partial [Caprimulgus carolinensis]
Length=315

 Score =   241 bits (615),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 117/184 (64%), Positives = 140/184 (76%), Gaps = 1/184 (1%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHG-GELIIPFSAALERSL  619
            ++ N     T+KP++YLVN++EKDY RKKNK+L KI  WV +H  G L+IPFS ALE  L
Sbjct  131  DVLNKHLFFTSKPMIYLVNLSEKDYIRKKNKWLIKIKEWVDKHDPGALVIPFSGALELKL  190

Query  618  ADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAA  439
             DM  +E  KY EEN  QSAL KIIK G++A+ L YFFTAGPDEV+ W IR+ TKAPQAA
Sbjct  191  QDMSAEEKQKYLEENMTQSALAKIIKAGYAALQLEYFFTAGPDEVRAWTIRKGTKAPQAA  250

Query  438  GAIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSG  259
            G IHTDFE+GFI AEVMK+ED KE GSE AVKA GKYRQ+G+ Y+V+DGD+IFFKFN   
Sbjct  251  GKIHTDFEKGFIMAEVMKYEDFKEGGSEAAVKAAGKYRQQGRNYIVEDGDIIFFKFNTPQ  310

Query  258  GGKK  247
              KK
Sbjct  311  QPKK  314



>ref|XP_008818190.1| GTP-binding protein YchF [Plasmodium inui San Antonio 1]
 gb|EUD65256.1| GTP-binding protein YchF [Plasmodium inui San Antonio 1]
Length=392

 Score =   243 bits (621),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 120/184 (65%), Positives = 137/184 (74%), Gaps = 1/184 (1%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHGGELIIPFSAALERSLA  616
            E+ N F  LTAKPVVYLVNM+E D+ R+KNK L KI+ WVQE     IIP+ A LE  L 
Sbjct  209  EVINEFNFLTAKPVVYLVNMSESDFIRQKNKHLAKIYNWVQEKNKGTIIPYCADLELKLL  268

Query  615  DMPPDEAAKYCEENKV-QSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAA  439
             M  DE   Y EENK+ QS L KI+KTG+  INLI+FFT GPDEVKCW IR+ TKAPQAA
Sbjct  269  SMSEDEKKTYFEENKIKQSMLNKIVKTGYYEINLIHFFTCGPDEVKCWTIRKGTKAPQAA  328

Query  438  GAIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSG  259
            G IHTDFE+GFICAEV K+ DL E  SE  VKA GKY Q+GK YVV+DGD++FFKFNVS 
Sbjct  329  GVIHTDFEKGFICAEVYKYTDLVEFKSEGEVKANGKYLQKGKDYVVEDGDIVFFKFNVSS  388

Query  258  GGKK  247
             GKK
Sbjct  389  SGKK  392



>ref|XP_009236113.1| PREDICTED: obg-like ATPase 1 isoform X2 [Pongo abelii]
Length=238

 Score =   238 bits (607),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 117/184 (64%), Positives = 141/184 (77%), Gaps = 1/184 (1%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHG-GELIIPFSAALERSL  619
            E+ N    LT+KP+VYLVN++EKDY RKKNK+L KI  WV ++  G L+IPFS ALE  L
Sbjct  54   EVLNKHLFLTSKPMVYLVNLSEKDYIRKKNKWLIKIKEWVDKYDPGALVIPFSGALELKL  113

Query  618  ADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAA  439
             ++  +E  KY E N  QSALPKIIK GF+A+ L YFFTAGP+EV+ W IR+ TKAPQAA
Sbjct  114  QELSAEERQKYLEANMTQSALPKIIKAGFAALQLEYFFTAGPEEVRAWTIRKGTKAPQAA  173

Query  438  GAIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSG  259
            G IHTDFE+GFI AEVMK+ED KE GSE AVKA GKYRQ+G+ Y+V+DGD+IFFKFN   
Sbjct  174  GKIHTDFEKGFIMAEVMKYEDFKEEGSENAVKAAGKYRQQGRNYIVEDGDIIFFKFNTPQ  233

Query  258  GGKK  247
              KK
Sbjct  234  QPKK  237



>ref|XP_008136766.1| PREDICTED: obg-like ATPase 1 isoform X2 [Eptesicus fuscus]
Length=238

 Score =   238 bits (607),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 116/184 (63%), Positives = 141/184 (77%), Gaps = 1/184 (1%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHG-GELIIPFSAALERSL  619
            E+ N +  LT+KP+VYLVN++EKDY RKKNK+L KI  WV +   G L+IPFS ALE  L
Sbjct  54   EVLNKYLFLTSKPMVYLVNLSEKDYIRKKNKWLIKIKEWVDKSDPGALVIPFSGALELKL  113

Query  618  ADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAA  439
             ++  +E  +Y E N  QSALPKIIK GF+A+ L YFFTAGPDEV+ W IR+ TKAPQAA
Sbjct  114  QELSAEERQQYLEANTTQSALPKIIKAGFAALQLEYFFTAGPDEVRAWTIRKGTKAPQAA  173

Query  438  GAIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSG  259
            G IHTDFE+GFI AEVMK++D KE GSE AVKA GKYRQ+G+ Y+V+DGD+IFFKFN   
Sbjct  174  GKIHTDFEKGFIMAEVMKYDDFKEEGSENAVKAAGKYRQQGRNYIVEDGDIIFFKFNTPQ  233

Query  258  GGKK  247
              KK
Sbjct  234  QPKK  237



>ref|XP_005484131.1| PREDICTED: obg-like ATPase 1 [Zonotrichia albicollis]
Length=273

 Score =   239 bits (611),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 117/184 (64%), Positives = 139/184 (76%), Gaps = 1/184 (1%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHG-GELIIPFSAALERSL  619
            ++ N     T+KP++YLVN++EKDY RKKNK+L KI  WV +H  G L+IPFS ALE  L
Sbjct  89   DVLNKHLFFTSKPMIYLVNLSEKDYIRKKNKWLIKIKEWVDKHDPGALVIPFSGALELKL  148

Query  618  ADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAA  439
             DM  +E  KY EEN  QSAL KIIK G++A+ L YFFTAGPDEV+ W IR+ TKAPQAA
Sbjct  149  QDMSAEEKQKYLEENMTQSALAKIIKAGYAALQLEYFFTAGPDEVRAWTIRKGTKAPQAA  208

Query  438  GAIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSG  259
            G IHTDFE+GFI AEVMK+ED K  GSE AVKA GKYRQ+G+ YVV+DGD+IFFKFN   
Sbjct  209  GKIHTDFEKGFIMAEVMKYEDFKGEGSEAAVKAAGKYRQQGRNYVVEDGDIIFFKFNTPQ  268

Query  258  GGKK  247
              KK
Sbjct  269  QPKK  272



>ref|XP_009932339.1| PREDICTED: obg-like ATPase 1 [Opisthocomus hoazin]
Length=273

 Score =   239 bits (610),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 116/184 (63%), Positives = 140/184 (76%), Gaps = 1/184 (1%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHG-GELIIPFSAALERSL  619
            ++ N     T+KP++YLVN++EKDY RKKNK+L KI  WV +H  G L+IPFS ALE  L
Sbjct  89   DVLNKHLFFTSKPMIYLVNLSEKDYVRKKNKWLIKIKEWVDKHDPGALVIPFSGALELKL  148

Query  618  ADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAA  439
             DM  +E  KY EEN  +SAL KIIK G++A+ L YFFTAGPDEV+ W IR+ TKAPQAA
Sbjct  149  QDMSAEEKQKYLEENMKESALAKIIKAGYAALQLEYFFTAGPDEVRAWTIRKGTKAPQAA  208

Query  438  GAIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSG  259
            G IHTDFE+GFI AEVMK+ED KE GSE AVKA GKYRQ+G+ Y+V+DGD+IFFKFN   
Sbjct  209  GKIHTDFEKGFIMAEVMKYEDFKEGGSEAAVKAAGKYRQQGRNYIVEDGDIIFFKFNTPQ  268

Query  258  GGKK  247
              KK
Sbjct  269  QPKK  272



>ref|XP_010605332.1| PREDICTED: obg-like ATPase 1 isoform X2 [Fukomys damarensis]
Length=294

 Score =   240 bits (612),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 118/184 (64%), Positives = 141/184 (77%), Gaps = 1/184 (1%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHG-GELIIPFSAALERSL  619
            E+ N    LT+KP+VYLVN++EKDY RKKNK+L KI  WV ++  G L+IPFS ALE  L
Sbjct  110  EVLNKHLFLTSKPMVYLVNLSEKDYIRKKNKWLIKIKEWVDKYDPGALVIPFSGALELKL  169

Query  618  ADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAA  439
             ++  +E  KY E N  QSALPKIIK GF+A+ L YFFTAGPDEV+ W IR+ TKAPQAA
Sbjct  170  QELSAEERQKYLEANMTQSALPKIIKAGFAALQLEYFFTAGPDEVRAWTIRKGTKAPQAA  229

Query  438  GAIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSG  259
            G IHTDFE+GFI AEVMK+ED KE GSE AVKA GKYRQ+G+ Y+V+DGD+IFFKFN   
Sbjct  230  GKIHTDFEKGFIMAEVMKYEDFKEEGSENAVKAAGKYRQQGRNYIVEDGDIIFFKFNTPQ  289

Query  258  GGKK  247
              KK
Sbjct  290  QPKK  293



>gb|AEB61109.1| obg-like ATPase 1-like protein, partial [Equus caballus]
Length=291

 Score =   239 bits (611),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 118/184 (64%), Positives = 141/184 (77%), Gaps = 1/184 (1%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHG-GELIIPFSAALERSL  619
            E+ N    LT+KP+VYLVN++EKDY RKKNK+L KI  WV ++  G L+IPFS ALE  L
Sbjct  107  EVLNKHLFLTSKPMVYLVNLSEKDYIRKKNKWLIKIKEWVDKYDPGALVIPFSGALELKL  166

Query  618  ADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAA  439
             ++  +E  KY E N  QSALPKIIK GF+A+ L YFFTAGPDEV+ W IR+ TKAPQAA
Sbjct  167  QELSAEERQKYLEANMTQSALPKIIKAGFAALQLEYFFTAGPDEVRAWTIRKGTKAPQAA  226

Query  438  GAIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSG  259
            G IHTDFE+GFI AEVMK+ED KE GSE AVKA GKYRQ+G+ Y+V+DGD+IFFKFN   
Sbjct  227  GKIHTDFEKGFIMAEVMKYEDFKEEGSENAVKAAGKYRQQGRNYIVEDGDIIFFKFNTPQ  286

Query  258  GGKK  247
              KK
Sbjct  287  QPKK  290



>ref|XP_010736092.1| PREDICTED: obg-like ATPase 1 isoform X1 [Larimichthys crocea]
Length=398

 Score =   243 bits (620),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 116/184 (63%), Positives = 141/184 (77%), Gaps = 1/184 (1%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHG-GELIIPFSAALERSL  619
            E+ N +  LT+KP++YL+N++EKDY R+KNK+L KI  WV  H  G L+IPFS  LE  L
Sbjct  214  EVLNKYLFLTSKPMIYLINLSEKDYIRRKNKWLVKIKEWVDSHDPGALVIPFSGGLENKL  273

Query  618  ADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAA  439
             D   +E  KYC E+K QSAL KIIKTG++A+ L YFFTAGPDEV+ W IR+ TKAPQAA
Sbjct  274  QDKSEEETQKYCTEHKTQSALSKIIKTGYAALQLEYFFTAGPDEVRAWTIRKGTKAPQAA  333

Query  438  GAIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSG  259
            G IHTDFE+GFI AEVMKF+D KE GSE AVKA GKYRQ+G+ Y+V+DGD+IFFKFN   
Sbjct  334  GKIHTDFEKGFIMAEVMKFQDFKEEGSENAVKAAGKYRQQGRNYIVEDGDIIFFKFNAPN  393

Query  258  GGKK  247
              KK
Sbjct  394  APKK  397



>ref|XP_009330922.1| PREDICTED: obg-like ATPase 1 isoform X1 [Pygoscelis adeliae]
Length=294

 Score =   239 bits (611),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 116/184 (63%), Positives = 139/184 (76%), Gaps = 1/184 (1%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHG-GELIIPFSAALERSL  619
            ++ N     T+KP++YLVN++EKDY RKKNK+L KI  WV +H  G L+IPFS ALE  L
Sbjct  110  DVLNKHLFFTSKPMIYLVNLSEKDYIRKKNKWLIKIKEWVDKHDPGALVIPFSGALELKL  169

Query  618  ADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAA  439
             DM  +E  KY EEN   SAL KIIK G++A+ L YFFTAGPDEV+ W IR+ TKAPQAA
Sbjct  170  QDMSAEEKQKYLEENMTDSALAKIIKAGYAALQLEYFFTAGPDEVRAWTIRKGTKAPQAA  229

Query  438  GAIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSG  259
            G IHTDFE+GFI AEVMK+ED KE GSE AVKA GKYRQ+G+ Y+V+DGD+IFFKFN   
Sbjct  230  GKIHTDFEKGFIMAEVMKYEDFKEGGSEAAVKAAGKYRQQGRNYIVEDGDIIFFKFNTPQ  289

Query  258  GGKK  247
              KK
Sbjct  290  QPKK  293



>ref|XP_010878192.1| PREDICTED: obg-like ATPase 1 isoform X4 [Esox lucius]
Length=398

 Score =   243 bits (619),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 116/178 (65%), Positives = 140/178 (79%), Gaps = 1/178 (1%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHG-GELIIPFSAALERSL  619
            E+ N +  LT+KP++YL+N++EKDY R+KNK+L KI  WV  H  G L+IPFS  LER L
Sbjct  213  EVLNKYLFLTSKPMIYLINLSEKDYIRRKNKWLVKIKDWVDIHDPGALVIPFSGGLERIL  272

Query  618  ADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAA  439
             DM  +E  KYC+E+K QS L +IIK G+ A+ L YFFTAGPDEV+ W IR+ TKAPQAA
Sbjct  273  QDMSEEEIQKYCKEHKTQSVLTRIIKAGYGALQLEYFFTAGPDEVRAWTIRKGTKAPQAA  332

Query  438  GAIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNV  265
            G IHTDFE+GFI AEVMKFED KE GSE AVKA GKYRQ+GKTYVV+DGD+IFF+FN 
Sbjct  333  GKIHTDFEKGFIMAEVMKFEDFKEGGSENAVKAAGKYRQQGKTYVVEDGDIIFFRFNT  390



>ref|XP_006866714.1| PREDICTED: obg-like ATPase 1 isoform X2 [Chrysochloris asiatica]
Length=238

 Score =   238 bits (606),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 118/184 (64%), Positives = 140/184 (76%), Gaps = 1/184 (1%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQE-HGGELIIPFSAALERSL  619
            E+ N    LT+KP+VYLVN++EKDY RKKNK+L KI  WV +   G L+IPFS ALE  L
Sbjct  54   EVLNKHLFLTSKPMVYLVNLSEKDYIRKKNKWLIKIKEWVDKCDPGALVIPFSGALELKL  113

Query  618  ADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAA  439
             ++  +E  KY E N  QSALPKIIK GF+A+ L YFFTAGPDEV+ W IR+ TKAPQAA
Sbjct  114  QELSAEERQKYLEANMTQSALPKIIKAGFAALQLEYFFTAGPDEVRAWTIRKGTKAPQAA  173

Query  438  GAIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSG  259
            G IHTDFE+GFI AEVMK+ED KE GSE AVKA GKYRQ+G+ Y+V+DGD+IFFKFN   
Sbjct  174  GKIHTDFEKGFIMAEVMKYEDFKEEGSENAVKAAGKYRQQGRNYIVEDGDIIFFKFNTPQ  233

Query  258  GGKK  247
              KK
Sbjct  234  QPKK  237



>ref|XP_007430999.1| PREDICTED: obg-like ATPase 1-like isoform X2 [Python bivittatus]
Length=396

 Score =   243 bits (619),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 120/184 (65%), Positives = 142/184 (77%), Gaps = 1/184 (1%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHG-GELIIPFSAALERSL  619
            ++ N    LT+KP++YL+N++EKDY RKKNK+L KI  WV +H  G L+IPFS ALE  L
Sbjct  212  DVLNKHLFLTSKPMIYLINLSEKDYIRKKNKWLIKIKEWVDKHDPGALVIPFSGALELKL  271

Query  618  ADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAA  439
             +M  +E  KY EEN  QSALPKIIK G++A+ L YFFTAGPDEV+ W IR+ TKAPQAA
Sbjct  272  QEMSAEEKQKYLEENMTQSALPKIIKAGYAALQLEYFFTAGPDEVRAWTIRKGTKAPQAA  331

Query  438  GAIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSG  259
            G IHTDFE+GFI AEVMKFED KE GSE AVKA GKYRQ+G+ YVV+DGDVIFFKFN   
Sbjct  332  GKIHTDFEKGFIMAEVMKFEDFKEGGSEAAVKAAGKYRQQGRNYVVEDGDVIFFKFNTPQ  391

Query  258  GGKK  247
              KK
Sbjct  392  QPKK  395



>ref|XP_010878191.1| PREDICTED: obg-like ATPase 1 isoform X3 [Esox lucius]
Length=399

 Score =   243 bits (619),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 116/178 (65%), Positives = 140/178 (79%), Gaps = 1/178 (1%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHG-GELIIPFSAALERSL  619
            E+ N +  LT+KP++YL+N++EKDY R+KNK+L KI  WV  H  G L+IPFS  LER L
Sbjct  214  EVLNKYLFLTSKPMIYLINLSEKDYIRRKNKWLVKIKDWVDIHDPGALVIPFSGGLERIL  273

Query  618  ADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAA  439
             DM  +E  KYC+E+K QS L +IIK G+ A+ L YFFTAGPDEV+ W IR+ TKAPQAA
Sbjct  274  QDMSEEEIQKYCKEHKTQSVLTRIIKAGYGALQLEYFFTAGPDEVRAWTIRKGTKAPQAA  333

Query  438  GAIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNV  265
            G IHTDFE+GFI AEVMKFED KE GSE AVKA GKYRQ+GKTYVV+DGD+IFF+FN 
Sbjct  334  GKIHTDFEKGFIMAEVMKFEDFKEGGSENAVKAAGKYRQQGKTYVVEDGDIIFFRFNT  391



>ref|XP_004757606.1| PREDICTED: obg-like ATPase 1-like [Mustela putorius furo]
Length=228

 Score =   237 bits (604),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 116/184 (63%), Positives = 140/184 (76%), Gaps = 1/184 (1%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHG-GELIIPFSAALERSL  619
            E+ N    LT+KP+VYLVN++EKDY RKKNK+L KI  WV ++  G L+IPFS ALE  L
Sbjct  44   EVLNKHLFLTSKPMVYLVNLSEKDYIRKKNKWLIKIKEWVDKYDPGALVIPFSGALELKL  103

Query  618  ADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAA  439
             ++  +E  KY E N  QSALPKIIK GF+A+   YFFTAGPDEV+ W IR+ TKAPQAA
Sbjct  104  QELSAEERQKYLEANMTQSALPKIIKAGFAALQREYFFTAGPDEVRAWTIRKGTKAPQAA  163

Query  438  GAIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSG  259
            G IHTDFE+GFI AEVMK+ED K+ GSE AVKA GKYRQ+G+ Y+V+DGD+IFFKFN   
Sbjct  164  GKIHTDFEKGFIMAEVMKYEDFKDEGSENAVKAAGKYRQQGRNYIVEDGDIIFFKFNTPQ  223

Query  258  GGKK  247
              KK
Sbjct  224  QPKK  227



>ref|XP_003447358.1| PREDICTED: obg-like ATPase 1-like isoform X1 [Oreochromis niloticus]
Length=396

 Score =   242 bits (618),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 117/184 (64%), Positives = 140/184 (76%), Gaps = 1/184 (1%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHG-GELIIPFSAALERSL  619
            E+ N +  LT+KP++YLVN++EKDY R+KNK+L KI  WV  H  G L+IPFS  LE  L
Sbjct  212  EVLNKYLFLTSKPMIYLVNLSEKDYIRRKNKWLVKIKEWVDSHDPGALVIPFSGGLESLL  271

Query  618  ADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAA  439
             D   +E  KYC E+K QSAL KIIK G++A+ L YFFTAGPDEV+ W IR+ TKAPQAA
Sbjct  272  QDKSEEERQKYCTEHKTQSALSKIIKAGYAALQLEYFFTAGPDEVRAWTIRKGTKAPQAA  331

Query  438  GAIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSG  259
            G IHTDFERGFI AEVMKF+D KE GSE AVKA GKYRQ+G+ Y+V+DGD+IFFKFN   
Sbjct  332  GKIHTDFERGFIMAEVMKFQDFKEEGSESAVKAAGKYRQQGRNYIVEDGDIIFFKFNAPN  391

Query  258  GGKK  247
              KK
Sbjct  392  APKK  395



>ref|XP_010878190.1| PREDICTED: obg-like ATPase 1 isoform X2 [Esox lucius]
Length=432

 Score =   243 bits (621),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 116/178 (65%), Positives = 140/178 (79%), Gaps = 1/178 (1%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHG-GELIIPFSAALERSL  619
            E+ N +  LT+KP++YL+N++EKDY R+KNK+L KI  WV  H  G L+IPFS  LER L
Sbjct  247  EVLNKYLFLTSKPMIYLINLSEKDYIRRKNKWLVKIKDWVDIHDPGALVIPFSGGLERIL  306

Query  618  ADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAA  439
             DM  +E  KYC+E+K QS L +IIK G+ A+ L YFFTAGPDEV+ W IR+ TKAPQAA
Sbjct  307  QDMSEEEIQKYCKEHKTQSVLTRIIKAGYGALQLEYFFTAGPDEVRAWTIRKGTKAPQAA  366

Query  438  GAIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNV  265
            G IHTDFE+GFI AEVMKFED KE GSE AVKA GKYRQ+GKTYVV+DGD+IFF+FN 
Sbjct  367  GKIHTDFEKGFIMAEVMKFEDFKEGGSENAVKAAGKYRQQGKTYVVEDGDIIFFRFNT  424



>ref|XP_001515633.1| PREDICTED: obg-like ATPase 1 isoform X1 [Ornithorhynchus anatinus]
 ref|XP_007669441.1| PREDICTED: obg-like ATPase 1 isoform X1 [Ornithorhynchus anatinus]
 ref|XP_007669442.1| PREDICTED: obg-like ATPase 1 isoform X2 [Ornithorhynchus anatinus]
Length=396

 Score =   242 bits (618),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 119/184 (65%), Positives = 142/184 (77%), Gaps = 1/184 (1%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHG-GELIIPFSAALERSL  619
            E+ N    LT+KP++YLVN++EKDY RKKNK+L KI  WV +H  G L+IPFS ALE  L
Sbjct  212  EVLNKHLFLTSKPMIYLVNLSEKDYIRKKNKWLIKIKEWVDKHDPGALVIPFSGALELKL  271

Query  618  ADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAA  439
             +M  +E  KY EEN  QSALPKIIK G++A+ L YFFTAGPDEV+ W IR+ TKAPQAA
Sbjct  272  QEMSAEEKQKYLEENMTQSALPKIIKAGYAALQLEYFFTAGPDEVRAWTIRKGTKAPQAA  331

Query  438  GAIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSG  259
            G IHTDFE+GFI AEVMK+ED KE GSE AVKA GKYRQ+G+ Y+V+DGD+IFFKFN   
Sbjct  332  GKIHTDFEKGFIMAEVMKYEDFKEEGSETAVKAAGKYRQQGRNYIVEDGDIIFFKFNTPQ  391

Query  258  GGKK  247
              KK
Sbjct  392  QPKK  395



>ref|XP_010878189.1| PREDICTED: obg-like ATPase 1 isoform X1 [Esox lucius]
Length=433

 Score =   243 bits (621),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 116/178 (65%), Positives = 140/178 (79%), Gaps = 1/178 (1%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHG-GELIIPFSAALERSL  619
            E+ N +  LT+KP++YL+N++EKDY R+KNK+L KI  WV  H  G L+IPFS  LER L
Sbjct  248  EVLNKYLFLTSKPMIYLINLSEKDYIRRKNKWLVKIKDWVDIHDPGALVIPFSGGLERIL  307

Query  618  ADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAA  439
             DM  +E  KYC+E+K QS L +IIK G+ A+ L YFFTAGPDEV+ W IR+ TKAPQAA
Sbjct  308  QDMSEEEIQKYCKEHKTQSVLTRIIKAGYGALQLEYFFTAGPDEVRAWTIRKGTKAPQAA  367

Query  438  GAIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNV  265
            G IHTDFE+GFI AEVMKFED KE GSE AVKA GKYRQ+GKTYVV+DGD+IFF+FN 
Sbjct  368  GKIHTDFEKGFIMAEVMKFEDFKEGGSENAVKAAGKYRQQGKTYVVEDGDIIFFRFNT  425



>ref|XP_001368232.1| PREDICTED: Obg-like ATPase 1 [Monodelphis domestica]
Length=396

 Score =   242 bits (618),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 119/184 (65%), Positives = 142/184 (77%), Gaps = 1/184 (1%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHG-GELIIPFSAALERSL  619
            E+ N    LT+KP++YLVN++EKDY RKKNK+L KI  WV +H  G L+IPFS ALE  L
Sbjct  212  EVLNKHLFLTSKPMIYLVNLSEKDYIRKKNKWLIKIKEWVDKHDPGALVIPFSGALELKL  271

Query  618  ADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAA  439
             +M  +E  KY EEN  QSALPKIIK G++A+ L YFFTAGPDEV+ W IR+ TKAPQAA
Sbjct  272  QEMSAEEKQKYLEENMTQSALPKIIKAGYAALQLEYFFTAGPDEVRAWTIRKGTKAPQAA  331

Query  438  GAIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSG  259
            G IHTDFE+GFI AEVMK+ED KE GSE AVKA GKYRQ+G+ Y+V+DGD+IFFKFN   
Sbjct  332  GKIHTDFEKGFIMAEVMKYEDFKEEGSENAVKAAGKYRQQGRNYIVEDGDIIFFKFNTPQ  391

Query  258  GGKK  247
              KK
Sbjct  392  QPKK  395



>ref|XP_007430998.1| PREDICTED: obg-like ATPase 1-like isoform X1 [Python bivittatus]
Length=401

 Score =   242 bits (618),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 120/184 (65%), Positives = 142/184 (77%), Gaps = 1/184 (1%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHG-GELIIPFSAALERSL  619
            ++ N    LT+KP++YL+N++EKDY RKKNK+L KI  WV +H  G L+IPFS ALE  L
Sbjct  217  DVLNKHLFLTSKPMIYLINLSEKDYIRKKNKWLIKIKEWVDKHDPGALVIPFSGALELKL  276

Query  618  ADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAA  439
             +M  +E  KY EEN  QSALPKIIK G++A+ L YFFTAGPDEV+ W IR+ TKAPQAA
Sbjct  277  QEMSAEEKQKYLEENMTQSALPKIIKAGYAALQLEYFFTAGPDEVRAWTIRKGTKAPQAA  336

Query  438  GAIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSG  259
            G IHTDFE+GFI AEVMKFED KE GSE AVKA GKYRQ+G+ YVV+DGDVIFFKFN   
Sbjct  337  GKIHTDFEKGFIMAEVMKFEDFKEGGSEAAVKAAGKYRQQGRNYVVEDGDVIFFKFNTPQ  396

Query  258  GGKK  247
              KK
Sbjct  397  QPKK  400



>ref|XP_005452973.1| PREDICTED: obg-like ATPase 1-like isoform X4 [Oreochromis niloticus]
Length=398

 Score =   242 bits (618),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 117/184 (64%), Positives = 140/184 (76%), Gaps = 1/184 (1%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHG-GELIIPFSAALERSL  619
            E+ N +  LT+KP++YLVN++EKDY R+KNK+L KI  WV  H  G L+IPFS  LE  L
Sbjct  214  EVLNKYLFLTSKPMIYLVNLSEKDYIRRKNKWLVKIKEWVDSHDPGALVIPFSGGLESLL  273

Query  618  ADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAA  439
             D   +E  KYC E+K QSAL KIIK G++A+ L YFFTAGPDEV+ W IR+ TKAPQAA
Sbjct  274  QDKSEEERQKYCTEHKTQSALSKIIKAGYAALQLEYFFTAGPDEVRAWTIRKGTKAPQAA  333

Query  438  GAIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSG  259
            G IHTDFERGFI AEVMKF+D KE GSE AVKA GKYRQ+G+ Y+V+DGD+IFFKFN   
Sbjct  334  GKIHTDFERGFIMAEVMKFQDFKEEGSESAVKAAGKYRQQGRNYIVEDGDIIFFKFNAPN  393

Query  258  GGKK  247
              KK
Sbjct  394  APKK  397



>ref|XP_008116320.1| PREDICTED: obg-like ATPase 1 isoform X2 [Anolis carolinensis]
Length=395

 Score =   242 bits (617),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 116/184 (63%), Positives = 143/184 (78%), Gaps = 1/184 (1%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHG-GELIIPFSAALERSL  619
            ++ N +  LT+KP++YLVN++EKDY RKKN++L KI  WV +H  G L+IPFS ALE  L
Sbjct  211  DVLNKYLFLTSKPMIYLVNLSEKDYIRKKNRWLIKIKEWVDKHDPGALVIPFSGALELKL  270

Query  618  ADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAA  439
             +M  +E  KY EEN  QSALPKIIK G++A+ L YFFTAGPDEV+ W IR+ TKAPQAA
Sbjct  271  QEMSAEEKQKYLEENMTQSALPKIIKAGYAALQLEYFFTAGPDEVRAWTIRKGTKAPQAA  330

Query  438  GAIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSG  259
            G IH+DFE+GFI AEVMKFED KE G+E AVKA GKYRQ+G+ Y+V+DGD+IFFKFN   
Sbjct  331  GKIHSDFEKGFIMAEVMKFEDFKEGGTEAAVKAAGKYRQQGRNYIVEDGDIIFFKFNTPQ  390

Query  258  GGKK  247
              KK
Sbjct  391  QPKK  394



>ref|XP_005723778.1| PREDICTED: obg-like ATPase 1-like [Pundamilia nyererei]
 ref|XP_005934395.1| PREDICTED: obg-like ATPase 1-like [Haplochromis burtoni]
Length=395

 Score =   242 bits (617),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 117/184 (64%), Positives = 139/184 (76%), Gaps = 1/184 (1%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHG-GELIIPFSAALERSL  619
            E+ N +  LT+KP++YLVN++EKDY RKKNK+L KI  WV  H  G ++IP S ALE  L
Sbjct  211  EVLNKYLFLTSKPMIYLVNLSEKDYIRKKNKWLAKIKEWVDAHDPGAMVIPLSGALEFKL  270

Query  618  ADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAA  439
             DM  +E  KYCEE K QS L KIIKTG++A+ L YFFTAGPDEV+ W IR+ TKAPQAA
Sbjct  271  QDMEEEERNKYCEEQKTQSVLTKIIKTGYAALQLEYFFTAGPDEVRAWTIRKGTKAPQAA  330

Query  438  GAIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSG  259
            G IHTDFE+GFI AEVMKF D KE GSE A KA GKYRQ+G+ Y+V+DGD+IFFKFN   
Sbjct  331  GKIHTDFEKGFIMAEVMKFTDFKEEGSETAAKAAGKYRQQGRNYIVEDGDIIFFKFNTPN  390

Query  258  GGKK  247
              KK
Sbjct  391  APKK  394



>ref|XP_003442972.1| PREDICTED: obg-like ATPase 1-like [Oreochromis niloticus]
 ref|XP_004540365.1| PREDICTED: obg-like ATPase 1-like isoform X1 [Maylandia zebra]
 ref|XP_004540366.1| PREDICTED: obg-like ATPase 1-like isoform X2 [Maylandia zebra]
Length=395

 Score =   242 bits (617),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 117/184 (64%), Positives = 139/184 (76%), Gaps = 1/184 (1%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHG-GELIIPFSAALERSL  619
            E+ N +  LT+KP++YLVN++EKDY RKKNK+L KI  WV  H  G ++IP S ALE  L
Sbjct  211  EVLNKYLFLTSKPMIYLVNLSEKDYIRKKNKWLAKIKEWVDAHDPGAMVIPLSGALEFKL  270

Query  618  ADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAA  439
             DM  +E  KYCEE K QS L KIIKTG++A+ L YFFTAGPDEV+ W IR+ TKAPQAA
Sbjct  271  QDMEEEERNKYCEEQKTQSVLTKIIKTGYAALQLEYFFTAGPDEVRAWTIRKGTKAPQAA  330

Query  438  GAIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSG  259
            G IHTDFE+GFI AEVMKF D KE GSE A KA GKYRQ+G+ Y+V+DGD+IFFKFN   
Sbjct  331  GKIHTDFEKGFIMAEVMKFTDFKEEGSETAAKAAGKYRQQGRNYIVEDGDIIFFKFNTPN  390

Query  258  GGKK  247
              KK
Sbjct  391  APKK  394



>ref|XP_005510535.1| PREDICTED: obg-like ATPase 1-like, partial [Columba livia]
Length=362

 Score =   241 bits (615),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 117/184 (64%), Positives = 141/184 (77%), Gaps = 1/184 (1%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHG-GELIIPFSAALERSL  619
            ++ N +   T+KP++YLVN++EKDY RKKNK+L KI  WV +H  G L+IPFS ALE  L
Sbjct  178  DVLNKYLFFTSKPMIYLVNLSEKDYIRKKNKWLIKIKEWVDKHDPGALVIPFSGALELKL  237

Query  618  ADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAA  439
             DM  +E  KY EEN  QSAL KIIK G++A+ L YFFTAGPDEV+ W IR+ TKAPQAA
Sbjct  238  QDMSAEEKQKYLEENMTQSALAKIIKAGYAALQLEYFFTAGPDEVRAWTIRKGTKAPQAA  297

Query  438  GAIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSG  259
            G IHTDFE+GFI AEVMK+ED KE GSE AVKA GKYRQ+G+ Y+V+DGD+IFFKFN   
Sbjct  298  GKIHTDFEKGFIMAEVMKYEDFKEEGSEAAVKAAGKYRQQGRNYIVEDGDIIFFKFNTPQ  357

Query  258  GGKK  247
              KK
Sbjct  358  QPKK  361



>ref|XP_003764019.1| PREDICTED: obg-like ATPase 1 [Sarcophilus harrisii]
Length=396

 Score =   242 bits (617),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 119/184 (65%), Positives = 142/184 (77%), Gaps = 1/184 (1%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHG-GELIIPFSAALERSL  619
            E+ N    LT+KP++YLVN++EKDY RKKNK+L KI  WV +H  G L+IPFS ALE  L
Sbjct  212  EVLNKHLFLTSKPMIYLVNLSEKDYIRKKNKWLIKIKEWVDKHDPGALVIPFSGALELKL  271

Query  618  ADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAA  439
             +M  +E  KY EEN  QSALPKIIK G++A+ L YFFTAGPDEV+ W IR+ TKAPQAA
Sbjct  272  QEMSAEEKQKYLEENMTQSALPKIIKAGYAALQLEYFFTAGPDEVRAWTIRKGTKAPQAA  331

Query  438  GAIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSG  259
            G IHTDFE+GFI AEVMK+ED KE GSE AVKA GKYRQ+G+ Y+V+DGD+IFFKFN   
Sbjct  332  GKIHTDFEKGFIMAEVMKYEDFKEEGSENAVKAAGKYRQQGRNYIVEDGDIIFFKFNTPQ  391

Query  258  GGKK  247
              KK
Sbjct  392  QPKK  395



>ref|XP_006744648.1| PREDICTED: obg-like ATPase 1 isoform X2 [Leptonychotes weddellii]
Length=308

 Score =   239 bits (610),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 118/184 (64%), Positives = 141/184 (77%), Gaps = 1/184 (1%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHG-GELIIPFSAALERSL  619
            E+ N    LT+KP+VYLVN++EKDY RKKNK+L KI  WV ++  G L+IPFS ALE  L
Sbjct  124  EVLNKHLFLTSKPMVYLVNLSEKDYIRKKNKWLIKIKEWVDKYDPGALVIPFSGALELKL  183

Query  618  ADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAA  439
             ++  +E  KY E N  QSALPKIIK GF+A+ L YFFTAGPDEV+ W IR+ TKAPQAA
Sbjct  184  QELSAEERQKYLEANMTQSALPKIIKAGFAALQLEYFFTAGPDEVRAWTIRKGTKAPQAA  243

Query  438  GAIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSG  259
            G IHTDFE+GFI AEVMK+ED KE GSE AVKA GKYRQ+G+ Y+V+DGD+IFFKFN   
Sbjct  244  GKIHTDFEKGFIMAEVMKYEDFKEEGSENAVKAAGKYRQQGRNYIVEDGDIIFFKFNTPQ  303

Query  258  GGKK  247
              KK
Sbjct  304  QPKK  307



>ref|NP_001026425.1| obg-like ATPase 1 [Gallus gallus]
 sp|Q5ZM25.1|OLA1_CHICK RecName: Full=Obg-like ATPase 1 [Gallus gallus]
 emb|CAG31218.1| hypothetical protein RCJMB04_3f20 [Gallus gallus]
Length=396

 Score =   241 bits (616),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 118/184 (64%), Positives = 141/184 (77%), Gaps = 1/184 (1%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHG-GELIIPFSAALERSL  619
            ++ N     T+KP++YLVN++EKDY RKKNK+L KI  WV +H  G L+IPFS ALE  L
Sbjct  212  DVLNKHLFFTSKPMIYLVNLSEKDYIRKKNKWLIKIKEWVDKHDPGALVIPFSGALELKL  271

Query  618  ADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAA  439
             DM  +E  KY EEN  QSALPKIIK G++A+ L YFFTAGPDEV+ W IR+ TKAPQAA
Sbjct  272  QDMSAEEKQKYLEENMTQSALPKIIKAGYAALQLEYFFTAGPDEVRAWTIRKGTKAPQAA  331

Query  438  GAIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSG  259
            G IHTDFE+GFI AEVMK+ED KE GSE AVKA GKYRQ+G+ Y+V+DGD+IFFKFN   
Sbjct  332  GKIHTDFEKGFIMAEVMKYEDFKEGGSEAAVKAAGKYRQQGRNYIVEDGDIIFFKFNTPQ  391

Query  258  GGKK  247
              KK
Sbjct  392  QPKK  395



>ref|XP_009952424.1| PREDICTED: obg-like ATPase 1, partial [Leptosomus discolor]
Length=277

 Score =   238 bits (606),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 116/184 (63%), Positives = 139/184 (76%), Gaps = 1/184 (1%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHG-GELIIPFSAALERSL  619
            ++ N     T+KP++YLVN++EKDY RKKNK+L KI  WV +H  G L+IPFS ALE  L
Sbjct  93   DVLNKHLFFTSKPMIYLVNLSEKDYIRKKNKWLIKIKEWVDKHDPGALVIPFSGALELKL  152

Query  618  ADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAA  439
             DM  +E  KY EEN   SAL KIIK G++A+ L YFFTAGPDEV+ W IR+ TKAPQAA
Sbjct  153  QDMSAEEKQKYLEENMXXSALAKIIKAGYAALQLEYFFTAGPDEVRAWTIRKGTKAPQAA  212

Query  438  GAIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSG  259
            G IHTDFE+GFI AEVMK+ED KE GSE AVKA GKYRQ+G+ Y+V+DGD+IFFKFN   
Sbjct  213  GKIHTDFEKGFIMAEVMKYEDFKEGGSEAAVKAAGKYRQQGRNYIVEDGDIIFFKFNTPQ  272

Query  258  GGKK  247
              KK
Sbjct  273  QPKK  276



>emb|CEG70465.1| Putative Obg-like ATPase 1 [Rhizopus microsporus]
 emb|CEI95966.1| Putative Obg-like ATPase 1 [Rhizopus microsporus]
Length=398

 Score =   241 bits (616),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 115/184 (63%), Positives = 141/184 (77%), Gaps = 1/184 (1%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHG-GELIIPFSAALERSL  619
            E+ N   +LTAKPV+YL N++EKDY RKKNK+LPKI AW+ E+  G+++IP+S A E  L
Sbjct  214  EVINGLHLLTAKPVIYLANLSEKDYLRKKNKWLPKIKAWIDENSPGDMMIPYSGAYEYRL  273

Query  618  ADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAA  439
                 +E  +  +EN   S LPKII  G++A+ LIYFFT GPDEV+ W IR+ TKAPQAA
Sbjct  274  TLASAEEKEQIQKENNAPSVLPKIIVNGYAALQLIYFFTGGPDEVRAWTIRKNTKAPQAA  333

Query  438  GAIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSG  259
            G IHTDFERGFI AEVMK+EDLKELGSE AVKA GKY Q+GK YVV+DGD+I+FKFNV+ 
Sbjct  334  GVIHTDFERGFIMAEVMKYEDLKELGSESAVKAAGKYMQKGKEYVVEDGDIIYFKFNVTA  393

Query  258  GGKK  247
              KK
Sbjct  394  PAKK  397



>ref|XP_006798459.1| PREDICTED: obg-like ATPase 1-like [Neolamprologus brichardi]
Length=395

 Score =   241 bits (616),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 117/184 (64%), Positives = 139/184 (76%), Gaps = 1/184 (1%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHG-GELIIPFSAALERSL  619
            E+ N +  LT+KP++YLVN++EKDY RKKNK+L KI  WV  H  G ++IP S ALE  L
Sbjct  211  EVLNKYLFLTSKPMLYLVNLSEKDYIRKKNKWLAKIKEWVDAHDPGAMVIPLSGALEFKL  270

Query  618  ADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAA  439
             DM  +E  KYCEE K QS L KIIKTG++A+ L YFFTAGPDEV+ W IR+ TKAPQAA
Sbjct  271  QDMEEEERNKYCEEQKTQSVLTKIIKTGYAALQLEYFFTAGPDEVRAWTIRKGTKAPQAA  330

Query  438  GAIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSG  259
            G IHTDFE+GFI AEVMKF D KE GSE A KA GKYRQ+G+ Y+V+DGD+IFFKFN   
Sbjct  331  GKIHTDFEKGFIMAEVMKFTDFKEEGSETAAKAAGKYRQQGRNYIVEDGDIIFFKFNTPN  390

Query  258  GGKK  247
              KK
Sbjct  391  APKK  394



>ref|XP_005452972.1| PREDICTED: obg-like ATPase 1-like isoform X3 [Oreochromis niloticus]
Length=423

 Score =   242 bits (618),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 117/184 (64%), Positives = 140/184 (76%), Gaps = 1/184 (1%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHG-GELIIPFSAALERSL  619
            E+ N +  LT+KP++YLVN++EKDY R+KNK+L KI  WV  H  G L+IPFS  LE  L
Sbjct  239  EVLNKYLFLTSKPMIYLVNLSEKDYIRRKNKWLVKIKEWVDSHDPGALVIPFSGGLESLL  298

Query  618  ADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAA  439
             D   +E  KYC E+K QSAL KIIK G++A+ L YFFTAGPDEV+ W IR+ TKAPQAA
Sbjct  299  QDKSEEERQKYCTEHKTQSALSKIIKAGYAALQLEYFFTAGPDEVRAWTIRKGTKAPQAA  358

Query  438  GAIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSG  259
            G IHTDFERGFI AEVMKF+D KE GSE AVKA GKYRQ+G+ Y+V+DGD+IFFKFN   
Sbjct  359  GKIHTDFERGFIMAEVMKFQDFKEEGSESAVKAAGKYRQQGRNYIVEDGDIIFFKFNAPN  418

Query  258  GGKK  247
              KK
Sbjct  419  APKK  422



>gb|ETE71660.1| Obg-like ATPase 1, partial [Ophiophagus hannah]
Length=369

 Score =   240 bits (613),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 119/184 (65%), Positives = 141/184 (77%), Gaps = 1/184 (1%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHG-GELIIPFSAALERSL  619
            ++ N    LT+KP+ YL+N++EKDY RKKNK+L KI  WV +H  G L+IPFS ALE  L
Sbjct  185  DVLNKHLFLTSKPMTYLINLSEKDYIRKKNKWLIKIKEWVDKHDPGALVIPFSGALELKL  244

Query  618  ADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAA  439
             +M  +E  KY EEN  QSALPKIIK G++A+ L YFFTAGPDEV+ W IR+ TKAPQAA
Sbjct  245  QEMDAEEKQKYLEENMTQSALPKIIKAGYAALQLEYFFTAGPDEVRAWTIRKGTKAPQAA  304

Query  438  GAIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSG  259
            G IHTDFE+GFI AEVMKFED KE GSE AVKA GKYRQ+G+ YVV+DGD+IFFKFN   
Sbjct  305  GKIHTDFEKGFIMAEVMKFEDFKEGGSEVAVKAAGKYRQQGRNYVVEDGDIIFFKFNTPQ  364

Query  258  GGKK  247
              KK
Sbjct  365  QPKK  368



>ref|XP_006788528.1| PREDICTED: obg-like ATPase 1-like [Neolamprologus brichardi]
Length=398

 Score =   241 bits (615),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 116/184 (63%), Positives = 140/184 (76%), Gaps = 1/184 (1%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHG-GELIIPFSAALERSL  619
            E+ N +  LT+KP++YLVN++EKDY R+KNK+L KI  WV  H  G L+IPFS  LE  L
Sbjct  214  EVLNKYLFLTSKPMIYLVNLSEKDYIRRKNKWLVKIKEWVDSHDPGALVIPFSGGLESLL  273

Query  618  ADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAA  439
             D   +E  KYC E+K QSA+ KIIK G++A+ L YFFTAGPDEV+ W IR+ TKAPQAA
Sbjct  274  QDKSEEERQKYCTEHKTQSAVSKIIKAGYAALQLEYFFTAGPDEVRAWTIRKGTKAPQAA  333

Query  438  GAIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSG  259
            G IHTDFERGFI AEVMKF+D KE GSE AVKA GKYRQ+G+ Y+V+DGD+IFFKFN   
Sbjct  334  GKIHTDFERGFIMAEVMKFQDFKEEGSESAVKAAGKYRQQGRNYIVEDGDIIFFKFNAPN  393

Query  258  GGKK  247
              KK
Sbjct  394  APKK  397



>ref|XP_004557802.1| PREDICTED: obg-like ATPase 1-like isoform X2 [Maylandia zebra]
Length=350

 Score =   239 bits (611),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 116/184 (63%), Positives = 139/184 (76%), Gaps = 1/184 (1%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHG-GELIIPFSAALERSL  619
            E+ N +  LT+KP++YLVN++EKDY R+KNK+L KI  WV  H  G L+IPFS  LE  L
Sbjct  166  EVLNKYLFLTSKPMIYLVNLSEKDYIRRKNKWLVKIKEWVDSHDPGALVIPFSGGLESLL  225

Query  618  ADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAA  439
             D   +E  KY  E+K QSAL KIIK G++A+ L YFFTAGPDEV+ W IR+ TKAPQAA
Sbjct  226  QDKSEEERQKYSTEHKTQSALSKIIKAGYAALQLEYFFTAGPDEVRAWTIRKGTKAPQAA  285

Query  438  GAIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSG  259
            G IHTDFERGFI AEVMKF+D KE GSE AVKA GKYRQ+G+ Y+V+DGD+IFFKFN   
Sbjct  286  GKIHTDFERGFIMAEVMKFQDFKEEGSESAVKAAGKYRQQGRNYIVEDGDIIFFKFNAPN  345

Query  258  GGKK  247
              KK
Sbjct  346  APKK  349



>ref|XP_008297045.1| PREDICTED: obg-like ATPase 1 [Stegastes partitus]
Length=398

 Score =   241 bits (615),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 116/184 (63%), Positives = 140/184 (76%), Gaps = 1/184 (1%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHG-GELIIPFSAALERSL  619
            E+ N +  LT+KP++YLVN++EKDY R+KNK+L KI  WV  H  G L+IPFS  LE  L
Sbjct  214  EVLNKYLFLTSKPMIYLVNLSEKDYIRRKNKWLVKIKEWVDSHDPGALVIPFSGGLESQL  273

Query  618  ADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAA  439
             D   +E  KYC E+K QSAL KIIK G++A+ L YFFTAGPDEV+ W IR+ TKAPQAA
Sbjct  274  QDSSEEERQKYCTEHKTQSALSKIIKAGYAALQLEYFFTAGPDEVRAWTIRKGTKAPQAA  333

Query  438  GAIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSG  259
            G IHTDFE+GFI AEVMKF+D KE GSE AVKA GKYRQ+G+ Y+V+DGD+IFFKFN   
Sbjct  334  GKIHTDFEKGFIMAEVMKFQDFKEEGSENAVKAAGKYRQQGRNYIVEDGDIIFFKFNAPN  393

Query  258  GGKK  247
              KK
Sbjct  394  APKK  397



>ref|XP_005723547.1| PREDICTED: obg-like ATPase 1-like isoform X4 [Pundamilia nyererei]
 ref|XP_005921549.1| PREDICTED: obg-like ATPase 1-like isoform X3 [Haplochromis burtoni]
Length=348

 Score =   239 bits (610),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 116/184 (63%), Positives = 139/184 (76%), Gaps = 1/184 (1%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHG-GELIIPFSAALERSL  619
            E+ N +  LT+KP++YLVN++EKDY R+KNK+L KI  WV  H  G L+IPFS  LE  L
Sbjct  164  EVLNKYLFLTSKPMIYLVNLSEKDYIRRKNKWLVKIKEWVDSHDPGALVIPFSGGLESLL  223

Query  618  ADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAA  439
             D   +E  KY  E+K QSAL KIIK G++A+ L YFFTAGPDEV+ W IR+ TKAPQAA
Sbjct  224  QDKSEEERQKYSTEHKTQSALSKIIKAGYAALQLEYFFTAGPDEVRAWTIRKGTKAPQAA  283

Query  438  GAIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSG  259
            G IHTDFERGFI AEVMKF+D KE GSE AVKA GKYRQ+G+ Y+V+DGD+IFFKFN   
Sbjct  284  GKIHTDFERGFIMAEVMKFQDFKEEGSESAVKAAGKYRQQGRNYIVEDGDIIFFKFNAPN  343

Query  258  GGKK  247
              KK
Sbjct  344  APKK  347



>ref|XP_004786306.1| PREDICTED: obg-like ATPase 1-like [Mustela putorius furo]
Length=255

 Score =   236 bits (602),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 116/184 (63%), Positives = 140/184 (76%), Gaps = 1/184 (1%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHG-GELIIPFSAALERSL  619
            E+ N    LT+KP+VYLVN++EKDY RKKNK+L KI  WV ++  G L+IPFS ALE  L
Sbjct  71   EVLNKHLFLTSKPMVYLVNLSEKDYIRKKNKWLIKIKEWVDKYDPGALVIPFSGALELKL  130

Query  618  ADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAA  439
             ++  +E  KY E N  QSALPKIIK GF+A+   YFFTAGPDEV+ W IR+ TKAPQAA
Sbjct  131  QELSAEERQKYLEANMTQSALPKIIKAGFAALQREYFFTAGPDEVRAWTIRKGTKAPQAA  190

Query  438  GAIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSG  259
            G IHTDFE+GFI AEVMK+ED K+ GSE AVKA GKYRQ+G+ Y+V+DGD+IFFKFN   
Sbjct  191  GKIHTDFEKGFIMAEVMKYEDFKDEGSENAVKAAGKYRQQGRNYIVEDGDIIFFKFNTPQ  250

Query  258  GGKK  247
              KK
Sbjct  251  QPKK  254



>ref|XP_006003587.1| PREDICTED: obg-like ATPase 1 isoform X1 [Latimeria chalumnae]
Length=401

 Score =   241 bits (615),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 119/184 (65%), Positives = 141/184 (77%), Gaps = 1/184 (1%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHG-GELIIPFSAALERSL  619
            E+ N    LT+KP++YLVN++EKDY RKKNK+L KI  WV +H  G L+IPFS ALE  L
Sbjct  217  EVLNKHLFLTSKPMIYLVNLSEKDYIRKKNKWLIKIKEWVDKHDPGALVIPFSGALELKL  276

Query  618  ADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAA  439
             DM  +E  KY EE K QSAL KIIK G++A+ L YFFTAGPDEV+ W I++ TKAPQAA
Sbjct  277  QDMSDEEKQKYLEEYKTQSALSKIIKAGYAALQLEYFFTAGPDEVRAWTIKKGTKAPQAA  336

Query  438  GAIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSG  259
            G IHTDFE+GFI AEVMKFED KE GSE AVKA GKYRQ+G+ Y+V+DGD+IFFKFN   
Sbjct  337  GKIHTDFEKGFIMAEVMKFEDFKEGGSEAAVKAAGKYRQQGRNYIVEDGDIIFFKFNTPQ  396

Query  258  GGKK  247
              KK
Sbjct  397  QSKK  400



>gb|EDL27121.1| RIKEN cDNA 2810409H07, isoform CRA_a [Mus musculus]
 gb|EDL27122.1| RIKEN cDNA 2810409H07, isoform CRA_a [Mus musculus]
Length=309

 Score =   238 bits (607),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 117/184 (64%), Positives = 141/184 (77%), Gaps = 1/184 (1%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHG-GELIIPFSAALERSL  619
            E+ N    LT+KP+VYLVN++EKDY RKKNK+L KI  WV ++  G L+IPFS ALE  L
Sbjct  125  EVLNKHLFLTSKPMVYLVNLSEKDYIRKKNKWLIKIKEWVDKYDPGALVIPFSGALELKL  184

Query  618  ADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAA  439
             ++  +E  KY E N  QSALPKIIK GF+A+ L YFFTAGPDEV+ W IR+ TKAPQAA
Sbjct  185  QELSAEERQKYLEANMTQSALPKIIKAGFAALQLEYFFTAGPDEVRAWTIRKGTKAPQAA  244

Query  438  GAIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSG  259
            G IHTDFE+GFI AEVMK+ED K+ GSE AVKA GKYRQ+G+ Y+V+DGD+IFFKFN   
Sbjct  245  GKIHTDFEKGFIMAEVMKYEDFKDEGSENAVKAAGKYRQQGRNYIVEDGDIIFFKFNTPQ  304

Query  258  GGKK  247
              KK
Sbjct  305  QPKK  308



>ref|XP_006003588.1| PREDICTED: obg-like ATPase 1 isoform X2 [Latimeria chalumnae]
 ref|XP_006003589.1| PREDICTED: obg-like ATPase 1 isoform X3 [Latimeria chalumnae]
 ref|XP_006003590.1| PREDICTED: obg-like ATPase 1 isoform X4 [Latimeria chalumnae]
Length=396

 Score =   241 bits (614),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 119/184 (65%), Positives = 141/184 (77%), Gaps = 1/184 (1%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHG-GELIIPFSAALERSL  619
            E+ N    LT+KP++YLVN++EKDY RKKNK+L KI  WV +H  G L+IPFS ALE  L
Sbjct  212  EVLNKHLFLTSKPMIYLVNLSEKDYIRKKNKWLIKIKEWVDKHDPGALVIPFSGALELKL  271

Query  618  ADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAA  439
             DM  +E  KY EE K QSAL KIIK G++A+ L YFFTAGPDEV+ W I++ TKAPQAA
Sbjct  272  QDMSDEEKQKYLEEYKTQSALSKIIKAGYAALQLEYFFTAGPDEVRAWTIKKGTKAPQAA  331

Query  438  GAIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSG  259
            G IHTDFE+GFI AEVMKFED KE GSE AVKA GKYRQ+G+ Y+V+DGD+IFFKFN   
Sbjct  332  GKIHTDFEKGFIMAEVMKFEDFKEGGSEAAVKAAGKYRQQGRNYIVEDGDIIFFKFNTPQ  391

Query  258  GGKK  247
              KK
Sbjct  392  QSKK  395



>gb|KFO14346.1| Obg-like ATPase 1, partial [Balearica regulorum gibbericeps]
Length=362

 Score =   239 bits (611),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 118/184 (64%), Positives = 140/184 (76%), Gaps = 1/184 (1%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHG-GELIIPFSAALERSL  619
            ++ N     T+KP++YLVN++EKDY RKKNK+L KI  WV +H  G L+IPFS ALE  L
Sbjct  178  DVLNKHLFFTSKPMIYLVNLSEKDYIRKKNKWLIKIKEWVDKHDPGALVIPFSGALELKL  237

Query  618  ADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAA  439
             DM  +E  KY EEN  QSAL KIIK G++A+ L YFFTAGPDEV+ W IR+ TKAPQAA
Sbjct  238  QDMSAEEKQKYLEENMTQSALAKIIKAGYAALQLEYFFTAGPDEVRAWTIRKGTKAPQAA  297

Query  438  GAIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSG  259
            G IHTDFE+GFI AEVMK+ED KE GSE AVKA GKYRQ+G+ YVV+DGD+IFFKFN   
Sbjct  298  GKIHTDFEKGFIMAEVMKYEDFKEGGSEAAVKAAGKYRQQGRNYVVEDGDIIFFKFNTPQ  357

Query  258  GGKK  247
              KK
Sbjct  358  QPKK  361



>ref|XP_005723546.1| PREDICTED: obg-like ATPase 1-like isoform X3 [Pundamilia nyererei]
Length=350

 Score =   239 bits (610),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 116/184 (63%), Positives = 139/184 (76%), Gaps = 1/184 (1%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHG-GELIIPFSAALERSL  619
            E+ N +  LT+KP++YLVN++EKDY R+KNK+L KI  WV  H  G L+IPFS  LE  L
Sbjct  166  EVLNKYLFLTSKPMIYLVNLSEKDYIRRKNKWLVKIKEWVDSHDPGALVIPFSGGLESLL  225

Query  618  ADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAA  439
             D   +E  KY  E+K QSAL KIIK G++A+ L YFFTAGPDEV+ W IR+ TKAPQAA
Sbjct  226  QDKSEEERQKYSTEHKTQSALSKIIKAGYAALQLEYFFTAGPDEVRAWTIRKGTKAPQAA  285

Query  438  GAIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSG  259
            G IHTDFERGFI AEVMKF+D KE GSE AVKA GKYRQ+G+ Y+V+DGD+IFFKFN   
Sbjct  286  GKIHTDFERGFIMAEVMKFQDFKEEGSESAVKAAGKYRQQGRNYIVEDGDIIFFKFNAPN  345

Query  258  GGKK  247
              KK
Sbjct  346  APKK  349



>ref|XP_003225685.1| PREDICTED: obg-like ATPase 1 isoform X1 [Anolis carolinensis]
 ref|XP_008116319.1| PREDICTED: obg-like ATPase 1 isoform X1 [Anolis carolinensis]
Length=396

 Score =   241 bits (614),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 116/184 (63%), Positives = 143/184 (78%), Gaps = 1/184 (1%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHG-GELIIPFSAALERSL  619
            ++ N +  LT+KP++YLVN++EKDY RKKN++L KI  WV +H  G L+IPFS ALE  L
Sbjct  212  DVLNKYLFLTSKPMIYLVNLSEKDYIRKKNRWLIKIKEWVDKHDPGALVIPFSGALELKL  271

Query  618  ADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAA  439
             +M  +E  KY EEN  QSALPKIIK G++A+ L YFFTAGPDEV+ W IR+ TKAPQAA
Sbjct  272  QEMSAEEKQKYLEENMTQSALPKIIKAGYAALQLEYFFTAGPDEVRAWTIRKGTKAPQAA  331

Query  438  GAIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSG  259
            G IH+DFE+GFI AEVMKFED KE G+E AVKA GKYRQ+G+ Y+V+DGD+IFFKFN   
Sbjct  332  GKIHSDFEKGFIMAEVMKFEDFKEGGTEAAVKAAGKYRQQGRNYIVEDGDIIFFKFNTPQ  391

Query  258  GGKK  247
              KK
Sbjct  392  QPKK  395



>gb|ETW37410.1| GTP-binding protein YchF [Plasmodium falciparum Tanzania (2000708)]
Length=364

 Score =   239 bits (611),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 117/184 (64%), Positives = 139/184 (76%), Gaps = 1/184 (1%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHGGELIIPFSAALERSLA  616
            E+ N +  LTAKPVVYLVNM+E D+ R+KNK+L KI+ WVQE     IIP+SA +E+ + 
Sbjct  181  EVLNEYNFLTAKPVVYLVNMSEADFIRQKNKYLAKIYNWVQEKNKGTIIPYSAEVEQKIL  240

Query  615  DMPPDEAAKYCEENKV-QSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAA  439
             M  +E  +Y E N + QS L KIIKTG+  INLI+FFT G DEVKCW IR+ TKAPQAA
Sbjct  241  SMDEEEKKQYFETNNIKQSMLNKIIKTGYYEINLIHFFTCGHDEVKCWTIRKGTKAPQAA  300

Query  438  GAIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSG  259
            G IHTDFE+GFICAEV K+ DL E  SE  VKA GKY Q+GK YVV+DGD+IFFKFNVS 
Sbjct  301  GVIHTDFEKGFICAEVYKYTDLVEYKSEGEVKANGKYLQKGKDYVVEDGDIIFFKFNVSS  360

Query  258  GGKK  247
            GGKK
Sbjct  361  GGKK  364



>gb|EWC89308.1| GTP-binding protein YchF [Plasmodium falciparum NF54]
Length=363

 Score =   239 bits (611),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 117/184 (64%), Positives = 139/184 (76%), Gaps = 1/184 (1%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHGGELIIPFSAALERSLA  616
            E+ N +  LTAKPVVYLVNM+E D+ R+KNK+L KI+ WVQE     IIP+SA +E+ + 
Sbjct  180  EVLNEYNFLTAKPVVYLVNMSEADFIRQKNKYLAKIYNWVQEKNKGTIIPYSAEVEQKIL  239

Query  615  DMPPDEAAKYCEENKV-QSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAA  439
             M  +E  +Y E N + QS L KIIKTG+  INLI+FFT G DEVKCW IR+ TKAPQAA
Sbjct  240  SMDEEEKKQYFETNNIKQSMLNKIIKTGYYEINLIHFFTCGHDEVKCWTIRKGTKAPQAA  299

Query  438  GAIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSG  259
            G IHTDFE+GFICAEV K+ DL E  SE  VKA GKY Q+GK YVV+DGD+IFFKFNVS 
Sbjct  300  GVIHTDFEKGFICAEVYKYTDLVEYKSEGEVKANGKYLQKGKDYVVEDGDIIFFKFNVSS  359

Query  258  GGKK  247
            GGKK
Sbjct  360  GGKK  363



>gb|ETW39419.1| GTP-binding protein YchF, partial [Plasmodium falciparum NF135/5.C10]
Length=364

 Score =   239 bits (611),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 117/184 (64%), Positives = 139/184 (76%), Gaps = 1/184 (1%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHGGELIIPFSAALERSLA  616
            E+ N +  LTAKPVVYLVNM+E D+ R+KNK+L KI+ WVQE     IIP+SA +E+ + 
Sbjct  181  EVLNEYNFLTAKPVVYLVNMSEADFIRQKNKYLAKIYNWVQEKNKGTIIPYSAEVEQKIL  240

Query  615  DMPPDEAAKYCEENKV-QSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAA  439
             M  +E  +Y E N + QS L KIIKTG+  INLI+FFT G DEVKCW IR+ TKAPQAA
Sbjct  241  SMDEEEKKQYFETNNIKQSMLNKIIKTGYYEINLIHFFTCGHDEVKCWTIRKGTKAPQAA  300

Query  438  GAIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSG  259
            G IHTDFE+GFICAEV K+ DL E  SE  VKA GKY Q+GK YVV+DGD+IFFKFNVS 
Sbjct  301  GVIHTDFEKGFICAEVYKYTDLVEYKSEGEVKANGKYLQKGKDYVVEDGDIIFFKFNVSS  360

Query  258  GGKK  247
            GGKK
Sbjct  361  GGKK  364



>emb|CDQ57167.1| unnamed protein product [Oncorhynchus mykiss]
Length=399

 Score =   241 bits (614),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 115/178 (65%), Positives = 138/178 (78%), Gaps = 1/178 (1%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHG-GELIIPFSAALERSL  619
            E+ N +  LT+KP++YL+N++EKDY R+KNK+L KI  WV  H  G L+IPFS  +E  L
Sbjct  214  EVLNKYLFLTSKPMIYLINLSEKDYIRRKNKWLVKIKEWVDSHDPGALVIPFSGGVESLL  273

Query  618  ADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAA  439
             DM  +E  KYC E+K QS L +IIK G+ A+ L YFFTAGPDEV+ W IR+ TKAPQAA
Sbjct  274  QDMSEEEIQKYCTEHKAQSVLTRIIKAGYGALQLEYFFTAGPDEVRAWTIRKGTKAPQAA  333

Query  438  GAIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNV  265
            G IHTDFE+GFI AEVMKFED KE GSE AVKA GKYRQ+GKTY+V+DGDVIFFKFN 
Sbjct  334  GKIHTDFEKGFIMAEVMKFEDFKEGGSENAVKAAGKYRQQGKTYIVEDGDVIFFKFNT  391



>gb|KFW10028.1| Obg-like ATPase 1, partial [Fulmarus glacialis]
Length=362

 Score =   239 bits (611),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 117/184 (64%), Positives = 140/184 (76%), Gaps = 1/184 (1%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHG-GELIIPFSAALERSL  619
            ++ N     T+KP++YLVN++EKDY RKKNK+L KI  WV +H  G L+IPFS ALE  L
Sbjct  178  DVLNKHLFFTSKPMIYLVNLSEKDYVRKKNKWLIKIKEWVDKHDPGALVIPFSGALELKL  237

Query  618  ADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAA  439
             DM  +E  KY EEN  QSAL KIIK G++A+ L YFFTAGPDEV+ W IR+ TKAPQAA
Sbjct  238  QDMSAEEKQKYLEENMTQSALAKIIKAGYAALQLEYFFTAGPDEVRAWTIRKGTKAPQAA  297

Query  438  GAIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSG  259
            G IHTDFE+GFI AEVMK+ED KE GSE AVKA GKYRQ+G+ Y+V+DGD+IFFKFN   
Sbjct  298  GKIHTDFEKGFIMAEVMKYEDFKEGGSEAAVKAAGKYRQQGRNYIVEDGDIIFFKFNTPQ  357

Query  258  GGKK  247
              KK
Sbjct  358  QPKK  361



>gb|ETW50152.1| GTP-binding protein YchF [Plasmodium falciparum MaliPS096_E11]
Length=368

 Score =   239 bits (611),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 117/184 (64%), Positives = 139/184 (76%), Gaps = 1/184 (1%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHGGELIIPFSAALERSLA  616
            E+ N +  LTAKPVVYLVNM+E D+ R+KNK+L KI+ WVQE     IIP+SA +E+ + 
Sbjct  185  EVLNEYNFLTAKPVVYLVNMSEADFIRQKNKYLAKIYNWVQEKNKGTIIPYSAEVEQKIL  244

Query  615  DMPPDEAAKYCEENKV-QSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAA  439
             M  +E  +Y E N + QS L KIIKTG+  INLI+FFT G DEVKCW IR+ TKAPQAA
Sbjct  245  SMDEEEKKQYFETNNIKQSMLNKIIKTGYYEINLIHFFTCGHDEVKCWTIRKGTKAPQAA  304

Query  438  GAIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSG  259
            G IHTDFE+GFICAEV K+ DL E  SE  VKA GKY Q+GK YVV+DGD+IFFKFNVS 
Sbjct  305  GVIHTDFEKGFICAEVYKYTDLVEYKSEGEVKANGKYLQKGKDYVVEDGDIIFFKFNVSS  364

Query  258  GGKK  247
            GGKK
Sbjct  365  GGKK  368



>ref|XP_005798398.1| PREDICTED: obg-like ATPase 1-like [Xiphophorus maculatus]
Length=395

 Score =   240 bits (613),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 114/184 (62%), Positives = 139/184 (76%), Gaps = 1/184 (1%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHG-GELIIPFSAALERSL  619
            E+ N +  LT+KP++YLVN++EKDY RKKNK+L KI  WV  H  G ++IP S A+E  L
Sbjct  211  EVLNKYLFLTSKPMIYLVNLSEKDYIRKKNKWLAKIKEWVDAHDPGAMVIPLSGAVEAKL  270

Query  618  ADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAA  439
             +M  +E+ KYCEE K QS L KIIKTG++ + L YFFTAGPDEV+ W IR+ TKAPQAA
Sbjct  271  QEMEEEESTKYCEEQKTQSVLTKIIKTGYAGLQLEYFFTAGPDEVRAWTIRKGTKAPQAA  330

Query  438  GAIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSG  259
            G IHTDFE+GFI AEVMKF D KE GSE A KA GKYRQ+G+ Y+V+DGD+IFFKFN   
Sbjct  331  GKIHTDFEKGFIMAEVMKFNDFKEEGSESAAKAAGKYRQQGRNYIVEDGDIIFFKFNTPN  390

Query  258  GGKK  247
              KK
Sbjct  391  APKK  394



>gb|KFM07037.1| Obg-like ATPase 1, partial [Aptenodytes forsteri]
 gb|KFQ51755.1| Obg-like ATPase 1, partial [Nestor notabilis]
 gb|KFV50449.1| Obg-like ATPase 1, partial [Gavia stellata]
Length=362

 Score =   239 bits (610),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 117/184 (64%), Positives = 140/184 (76%), Gaps = 1/184 (1%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHG-GELIIPFSAALERSL  619
            ++ N     T+KP++YLVN++EKDY RKKNK+L KI  WV +H  G L+IPFS ALE  L
Sbjct  178  DVLNKHLFFTSKPMIYLVNLSEKDYIRKKNKWLIKIKEWVDKHDPGALVIPFSGALELKL  237

Query  618  ADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAA  439
             DM  +E  KY EEN  QSAL KIIK G++A+ L YFFTAGPDEV+ W IR+ TKAPQAA
Sbjct  238  QDMSAEEKQKYLEENMTQSALAKIIKAGYAALQLEYFFTAGPDEVRAWTIRKGTKAPQAA  297

Query  438  GAIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSG  259
            G IHTDFE+GFI AEVMK+ED KE GSE AVKA GKYRQ+G+ Y+V+DGD+IFFKFN   
Sbjct  298  GKIHTDFEKGFIMAEVMKYEDFKEGGSEAAVKAAGKYRQQGRNYIVEDGDIIFFKFNTPQ  357

Query  258  GGKK  247
              KK
Sbjct  358  QPKK  361



>ref|XP_006636567.1| PREDICTED: obg-like ATPase 1-like isoform X2 [Lepisosteus oculatus]
Length=348

 Score =   239 bits (609),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 115/184 (63%), Positives = 140/184 (76%), Gaps = 1/184 (1%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHG-GELIIPFSAALERSL  619
            E+ N +  LT+KP++YLVN++EKDY RKKNK+L KI  WV  H  G ++IPFS  LE  L
Sbjct  164  EVLNKYLFLTSKPMIYLVNLSEKDYIRKKNKWLVKIKEWVDSHDPGAMVIPFSGGLELKL  223

Query  618  ADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAA  439
             DM  +E  KY EE+K QS L KIIK+G++A+ L YFFTAGPDEV+ W IR+ TKAPQAA
Sbjct  224  QDMSDEEKEKYTEEHKTQSVLTKIIKSGYAALQLEYFFTAGPDEVRAWTIRKGTKAPQAA  283

Query  438  GAIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSG  259
            G IH+DFE+GFI AEVMKF+D KE GSE AVKA GKYRQ+G+ Y V+DGD+IFFKFN   
Sbjct  284  GKIHSDFEKGFIMAEVMKFQDFKEEGSESAVKAAGKYRQQGRNYTVEDGDIIFFKFNTPN  343

Query  258  GGKK  247
              KK
Sbjct  344  QPKK  347



>gb|ETW28438.1| GTP-binding protein YchF [Plasmodium falciparum FCH/4]
Length=391

 Score =   240 bits (612),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 117/184 (64%), Positives = 139/184 (76%), Gaps = 1/184 (1%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHGGELIIPFSAALERSLA  616
            E+ N +  LTAKPVVYLVNM+E D+ R+KNK+L KI+ WVQE     IIP+SA +E+ + 
Sbjct  208  EVLNEYNFLTAKPVVYLVNMSEADFIRQKNKYLAKIYNWVQEKNKGTIIPYSAEVEQKIL  267

Query  615  DMPPDEAAKYCEENKV-QSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAA  439
             M  +E  +Y E N + QS L KIIKTG+  INLI+FFT G DEVKCW IR+ TKAPQAA
Sbjct  268  SMDEEEKKQYFETNNIKQSMLNKIIKTGYYEINLIHFFTCGHDEVKCWTIRKGTKAPQAA  327

Query  438  GAIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSG  259
            G IHTDFE+GFICAEV K+ DL E  SE  VKA GKY Q+GK YVV+DGD+IFFKFNVS 
Sbjct  328  GVIHTDFEKGFICAEVYKYTDLVEYKSEGEVKANGKYLQKGKDYVVEDGDIIFFKFNVSS  387

Query  258  GGKK  247
            GGKK
Sbjct  388  GGKK  391



>gb|KFV08740.1| Obg-like ATPase 1, partial [Pterocles gutturalis]
Length=362

 Score =   239 bits (610),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 117/184 (64%), Positives = 140/184 (76%), Gaps = 1/184 (1%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHG-GELIIPFSAALERSL  619
            ++ N     T+KP++YLVN++EKDY RKKNK+L KI  WV +H  G L+IPFS ALE  L
Sbjct  178  DVLNKHLFFTSKPMIYLVNLSEKDYIRKKNKWLIKIKEWVDKHDPGALVIPFSGALELKL  237

Query  618  ADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAA  439
             DM  +E  KY EEN  QSAL KIIK G++A+ L YFFTAGPDEV+ W IR+ TKAPQAA
Sbjct  238  QDMSAEEKQKYLEENMTQSALAKIIKAGYAALQLEYFFTAGPDEVRAWTIRKGTKAPQAA  297

Query  438  GAIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSG  259
            G IHTDFE+GFI AEVMK+ED KE GSE AVKA GKYRQ+G+ Y+V+DGD+IFFKFN   
Sbjct  298  GKIHTDFEKGFIMAEVMKYEDFKEGGSEAAVKAAGKYRQQGRNYIVEDGDIIFFKFNTPQ  357

Query  258  GGKK  247
              KK
Sbjct  358  QPKK  361



>gb|KFP41102.1| Obg-like ATPase 1, partial [Chlamydotis macqueenii]
Length=362

 Score =   239 bits (609),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 117/184 (64%), Positives = 140/184 (76%), Gaps = 1/184 (1%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHG-GELIIPFSAALERSL  619
            ++ N     T+KP++YLVN++EKDY RKKNK+L KI  WV +H  G L+IPFS ALE  L
Sbjct  178  DVLNKHLFFTSKPMIYLVNLSEKDYIRKKNKWLIKIKEWVDKHDPGALVIPFSGALELKL  237

Query  618  ADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAA  439
             DM  +E  KY EEN  QSAL KIIK G++A+ L YFFTAGPDEV+ W IR+ TKAPQAA
Sbjct  238  QDMSAEEKQKYLEENMTQSALAKIIKAGYAALQLEYFFTAGPDEVRAWTIRKGTKAPQAA  297

Query  438  GAIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSG  259
            G IHTDFE+GFI AEVMK+ED KE GSE AVKA GKYRQ+G+ Y+V+DGD+IFFKFN   
Sbjct  298  GKIHTDFEKGFIMAEVMKYEDFKEGGSEAAVKAAGKYRQQGRNYIVEDGDIIFFKFNTPQ  357

Query  258  GGKK  247
              KK
Sbjct  358  QPKK  361



>ref|XP_005452971.1| PREDICTED: obg-like ATPase 1-like isoform X2 [Oreochromis niloticus]
Length=471

 Score =   242 bits (618),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 117/184 (64%), Positives = 140/184 (76%), Gaps = 1/184 (1%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHG-GELIIPFSAALERSL  619
            E+ N +  LT+KP++YLVN++EKDY R+KNK+L KI  WV  H  G L+IPFS  LE  L
Sbjct  287  EVLNKYLFLTSKPMIYLVNLSEKDYIRRKNKWLVKIKEWVDSHDPGALVIPFSGGLESLL  346

Query  618  ADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAA  439
             D   +E  KYC E+K QSAL KIIK G++A+ L YFFTAGPDEV+ W IR+ TKAPQAA
Sbjct  347  QDKSEEERQKYCTEHKTQSALSKIIKAGYAALQLEYFFTAGPDEVRAWTIRKGTKAPQAA  406

Query  438  GAIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSG  259
            G IHTDFERGFI AEVMKF+D KE GSE AVKA GKYRQ+G+ Y+V+DGD+IFFKFN   
Sbjct  407  GKIHTDFERGFIMAEVMKFQDFKEEGSESAVKAAGKYRQQGRNYIVEDGDIIFFKFNAPN  466

Query  258  GGKK  247
              KK
Sbjct  467  APKK  470



>gb|KFH07802.1| putative GTP-binding protein, partial [Toxoplasma gondii VAND]
Length=192

 Score =   233 bits (594),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 116/185 (63%), Positives = 141/185 (76%), Gaps = 2/185 (1%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHGGELIIPFSAALERSLA  616
            E+ N +Q LTAK VVYLVNM+EKD+ R+KNK+L KIH WV+ +    IIP+SA  E  LA
Sbjct  8    EVLNEYQFLTAKQVVYLVNMSEKDFIRQKNKWLAKIHGWVEANVSGPIIPYSAQFESKLA  67

Query  615  DMPPDEA-AKYCEE-NKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQA  442
            ++P D A  KY ++    +S L KI+ TG+ A++LI+FFT G DEVKCW IR+ TKAPQA
Sbjct  68   ELPDDAAREKYIKDVGASRSQLDKIVTTGYHALHLIHFFTCGEDEVKCWTIRQGTKAPQA  127

Query  441  AGAIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVS  262
            AG IHTDFERGFICAEV K+EDL   GSE AVKA GKY Q+GK YVV+DGD+IFFKFNV+
Sbjct  128  AGVIHTDFERGFICAEVYKYEDLVAAGSENAVKAAGKYLQKGKDYVVEDGDIIFFKFNVT  187

Query  261  GGGKK  247
              GKK
Sbjct  188  NSGKK  192



>ref|XP_002261143.1| GTP-binding protein [Plasmodium knowlesi strain H]
 emb|CAQ38331.1| GTP-binding protein, putative [Plasmodium knowlesi strain H]
Length=392

 Score =   240 bits (612),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 117/184 (64%), Positives = 136/184 (74%), Gaps = 1/184 (1%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHGGELIIPFSAALERSLA  616
            E+ N +  LTAKPVVYLVNM+E D+ R+KNK L KI+ WVQE     IIP+ A +E  L 
Sbjct  209  EVINEYNFLTAKPVVYLVNMSETDFIRQKNKHLAKIYNWVQEKNKGTIIPYCADMELKLL  268

Query  615  DMPPDEAAKYCEENKV-QSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAA  439
             M  DE   Y EENK+ QS L KI+KTG+  INLI+FFT G DEVKCW IR+ TKAPQAA
Sbjct  269  SMSEDEKKTYFEENKIKQSMLSKIVKTGYYEINLIHFFTCGADEVKCWTIRKGTKAPQAA  328

Query  438  GAIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSG  259
            G IHTDFE+GFICAEV K+ DL E  SE  VKA G+Y Q+GK YVV+DGD+IFFKFNVS 
Sbjct  329  GVIHTDFEKGFICAEVYKYTDLVEFKSESEVKANGRYLQKGKDYVVEDGDIIFFKFNVSS  388

Query  258  GGKK  247
             GKK
Sbjct  389  SGKK  392



>gb|KFW86891.1| Obg-like ATPase 1, partial [Manacus vitellinus]
Length=370

 Score =   239 bits (609),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 117/184 (64%), Positives = 140/184 (76%), Gaps = 1/184 (1%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHG-GELIIPFSAALERSL  619
            ++ N     T+KP++YLVN++EKDY RKKNK+L KI  WV +H  G L+IPFS ALE  L
Sbjct  186  DVLNKHLFFTSKPMIYLVNLSEKDYIRKKNKWLIKIKEWVDKHDPGALVIPFSGALELKL  245

Query  618  ADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAA  439
             DM  +E  KY EEN  QSAL KIIK G++A+ L YFFTAGPDEV+ W IR+ TKAPQAA
Sbjct  246  QDMSAEEKQKYLEENMTQSALAKIIKAGYAALQLEYFFTAGPDEVRAWTIRKGTKAPQAA  305

Query  438  GAIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSG  259
            G IHTDFE+GFI AEVMK+ED KE GSE AVKA GKYRQ+G+ Y+V+DGD+IFFKFN   
Sbjct  306  GKIHTDFEKGFIMAEVMKYEDFKEGGSEAAVKAAGKYRQQGRNYIVEDGDIIFFKFNTPQ  365

Query  258  GGKK  247
              KK
Sbjct  366  QPKK  369



>ref|XP_008275154.1| PREDICTED: obg-like ATPase 1 [Stegastes partitus]
Length=395

 Score =   239 bits (611),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 117/184 (64%), Positives = 138/184 (75%), Gaps = 1/184 (1%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHG-GELIIPFSAALERSL  619
            E+ N +  LT+KP++YLVN++EKDY RKKNK+L KI  WV  H  G L+IP S ALE  L
Sbjct  211  EVLNKYLFLTSKPMIYLVNLSEKDYIRKKNKWLAKIKEWVDAHDPGALVIPLSGALESKL  270

Query  618  ADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAA  439
             DM  +E  KYCEE K QS L KIIKTG++A+ L YFFTAGPDEV+ W IR+  KAPQAA
Sbjct  271  FDMEEEERNKYCEELKTQSVLTKIIKTGYAALQLEYFFTAGPDEVRAWTIRKGAKAPQAA  330

Query  438  GAIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSG  259
            G IHTDFE+GFI AEVMK+ D KE GSE A KA GKYRQ+G+ YVV+DGD+IFFKFN   
Sbjct  331  GKIHTDFEKGFIMAEVMKYSDFKEEGSESAAKAAGKYRQQGRNYVVEDGDIIFFKFNTPN  390

Query  258  GGKK  247
              KK
Sbjct  391  APKK  394



>ref|XP_007576845.1| PREDICTED: obg-like ATPase 1 [Poecilia formosa]
Length=395

 Score =   239 bits (611),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 115/184 (63%), Positives = 138/184 (75%), Gaps = 1/184 (1%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHG-GELIIPFSAALERSL  619
            E+ N +  LT+KP++YLVN++EKDY RKKNK+L KI  WV  H  G ++IP S A+E  L
Sbjct  211  EVLNKYLFLTSKPMIYLVNLSEKDYIRKKNKWLAKIKEWVDAHDPGAMVIPLSGAVEAKL  270

Query  618  ADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAA  439
             +M  +E  KYCEE K QS L KIIKTG++ + L YFFTAGPDEV+ W IR+ TKAPQAA
Sbjct  271  QEMEEEERTKYCEEQKTQSVLTKIIKTGYAGLQLEYFFTAGPDEVRAWTIRKGTKAPQAA  330

Query  438  GAIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSG  259
            G IHTDFE+GFI AEVMKF D KE GSE A KA GKYRQ+G+ YVV+DGD+IFFKFN   
Sbjct  331  GKIHTDFEKGFIMAEVMKFNDFKEEGSESAAKAAGKYRQQGRNYVVEDGDIIFFKFNTPN  390

Query  258  GGKK  247
              KK
Sbjct  391  APKK  394



>ref|XP_005237197.1| PREDICTED: obg-like ATPase 1 [Falco peregrinus]
Length=395

 Score =   239 bits (611),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 117/184 (64%), Positives = 140/184 (76%), Gaps = 1/184 (1%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHG-GELIIPFSAALERSL  619
            ++ N     T+KP++YLVN++EKDY RKKNK+L KI  WV +H  G L+IPFS ALE  L
Sbjct  211  DVLNKHLFFTSKPMIYLVNLSEKDYIRKKNKWLIKIKEWVDKHDPGALVIPFSGALELKL  270

Query  618  ADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAA  439
             DM  +E  KY EEN  QSAL KIIK G++A+ L YFFTAGPDEV+ W IR+ TKAPQAA
Sbjct  271  QDMSAEEKQKYLEENMTQSALAKIIKAGYAALQLEYFFTAGPDEVRAWTIRKGTKAPQAA  330

Query  438  GAIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSG  259
            G IHTDFE+GFI AEVMK+ED KE GSE AVKA GKYRQ+G+ Y+V+DGD+IFFKFN   
Sbjct  331  GKIHTDFEKGFIMAEVMKYEDFKEGGSEAAVKAAGKYRQQGRNYIVEDGDIIFFKFNTPQ  390

Query  258  GGKK  247
              KK
Sbjct  391  QPKK  394



>ref|XP_004774421.1| PREDICTED: obg-like ATPase 1-like isoform X2 [Mustela putorius 
furo]
 ref|XP_004790976.1| PREDICTED: obg-like ATPase 1 isoform X2 [Mustela putorius furo]
Length=363

 Score =   238 bits (608),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 118/184 (64%), Positives = 141/184 (77%), Gaps = 1/184 (1%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHG-GELIIPFSAALERSL  619
            E+ N    LT+KP+VYLVN++EKDY RKKNK+L KI  WV ++  G L+IPFS ALE  L
Sbjct  179  EVLNKHLFLTSKPMVYLVNLSEKDYIRKKNKWLIKIKEWVDKYDPGALVIPFSGALELKL  238

Query  618  ADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAA  439
             ++  +E  KY E N  QSALPKIIK GF+A+ L YFFTAGPDEV+ W IR+ TKAPQAA
Sbjct  239  QELSAEERQKYLEANMTQSALPKIIKAGFAALQLEYFFTAGPDEVRAWTIRKGTKAPQAA  298

Query  438  GAIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSG  259
            G IHTDFE+GFI AEVMK+ED KE GSE AVKA GKYRQ+G+ Y+V+DGD+IFFKFN   
Sbjct  299  GKIHTDFEKGFIMAEVMKYEDFKEEGSENAVKAAGKYRQQGRNYIVEDGDIIFFKFNTPQ  358

Query  258  GGKK  247
              KK
Sbjct  359  QPKK  362



>ref|XP_008565607.1| PREDICTED: obg-like ATPase 1 [Galeopterus variegatus]
Length=348

 Score =   238 bits (607),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 118/184 (64%), Positives = 141/184 (77%), Gaps = 1/184 (1%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHG-GELIIPFSAALERSL  619
            E+ N    LT+KP+VYLVN++EKDY RKKNK+L KI  WV ++  G L+IPFS ALE  L
Sbjct  164  EVLNKHLFLTSKPMVYLVNLSEKDYIRKKNKWLIKIKEWVDKYDPGALVIPFSGALELKL  223

Query  618  ADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAA  439
             ++  +E  KY E N  QSALPKIIK GF+A+ L YFFTAGPDEV+ W IR+ TKAPQAA
Sbjct  224  QELSAEERQKYLEANMTQSALPKIIKAGFAALQLEYFFTAGPDEVRAWTIRKGTKAPQAA  283

Query  438  GAIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSG  259
            G IHTDFE+GFI AEVMK+ED KE GSE AVKA GKYRQ+G+ Y+V+DGD+IFFKFN   
Sbjct  284  GKIHTDFEKGFIMAEVMKYEDFKEEGSENAVKAAGKYRQQGRNYIVEDGDIIFFKFNTPQ  343

Query  258  GGKK  247
              KK
Sbjct  344  QPKK  347



>gb|EPY25232.1| GTP binding protein [Angomonas deanei]
Length=208

 Score =   233 bits (594),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 103/180 (57%), Positives = 137/180 (76%), Gaps = 0/180 (0%)
 Frame = -3

Query  786  NTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHGGELIIPFSAALERSLADMP  607
            NT Q++TAKP ++LVNM+E DY R++NK+L K+  W+ E  GE +IPFSA LE +  +M 
Sbjct  29   NTLQLITAKPAMFLVNMSENDYTRQRNKWLKKLKDWIDEQTGEPMIPFSAELESNFVNMS  88

Query  606  PDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIH  427
            P+E AKYCEENK +S + KII T +  INLI++FTAGP EV+CW I+R TKAPQAAG IH
Sbjct  89   PEEVAKYCEENKTKSQIHKIITTAYGIINLIHYFTAGPGEVRCWTIQRHTKAPQAAGCIH  148

Query  426  TDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  247
            +D E+GFICA+V+++ED   L SE A +  GK  Q+G+ Y V+DGD+I+FKFN + GGKK
Sbjct  149  SDMEKGFICADVIEWEDFDRLESEAACRDEGKQHQQGRNYEVKDGDIIYFKFNAAKGGKK  208



>ref|XP_008397950.1| PREDICTED: obg-like ATPase 1 [Poecilia reticulata]
Length=395

 Score =   239 bits (609),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 115/184 (63%), Positives = 138/184 (75%), Gaps = 1/184 (1%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHG-GELIIPFSAALERSL  619
            E+ N +  LT+KP++YLVN++EKDY RKKNK+L KI  WV  H  G ++IP S A+E  L
Sbjct  211  EVLNKYLFLTSKPMIYLVNLSEKDYIRKKNKWLAKIKEWVDAHDPGAMVIPLSGAVEAKL  270

Query  618  ADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAA  439
             +M  +E+ KYCEE K QS L KIIKTG++ + L YFFTAGPDEV+ W IR+ TKAPQAA
Sbjct  271  QEMEEEESTKYCEEQKTQSVLTKIIKTGYAGLQLEYFFTAGPDEVRAWTIRKGTKAPQAA  330

Query  438  GAIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSG  259
            G IHTDFE+GFI AEVMKF D KE GSE A KA GKYRQ G+ YVV+DGD+IFFKFN   
Sbjct  331  GKIHTDFEKGFIMAEVMKFNDFKEEGSESAAKAAGKYRQLGRNYVVEDGDIIFFKFNTPN  390

Query  258  GGKK  247
              KK
Sbjct  391  APKK  394



>ref|XP_002198993.1| PREDICTED: obg-like ATPase 1 isoform 1 [Taeniopygia guttata]
 ref|XP_004176777.1| PREDICTED: obg-like ATPase 1 isoform 2 [Taeniopygia guttata]
Length=396

 Score =   239 bits (609),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 118/184 (64%), Positives = 140/184 (76%), Gaps = 1/184 (1%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHG-GELIIPFSAALERSL  619
            ++ N     T+KP++YLVN++EKDY RKKNK+L KI  WV +H  G L+IPFS ALE  L
Sbjct  212  DVLNKHLFFTSKPMIYLVNLSEKDYIRKKNKWLIKIKEWVDKHDPGALVIPFSGALELKL  271

Query  618  ADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAA  439
             DM  +E  KY EEN  QSAL KIIK G++A+ L YFFTAGPDEV+ W IR+ TKAPQAA
Sbjct  272  QDMSAEEKQKYLEENMTQSALAKIIKAGYAALQLEYFFTAGPDEVRAWTIRKGTKAPQAA  331

Query  438  GAIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSG  259
            G IHTDFE+GFI AEVMK+ED KE GSE AVKA GKYRQ+G+ YVV+DGD+IFFKFN   
Sbjct  332  GKIHTDFEKGFIMAEVMKYEDFKEGGSEAAVKAAGKYRQQGRNYVVEDGDIIFFKFNTPQ  391

Query  258  GGKK  247
              KK
Sbjct  392  QPKK  395



>ref|XP_004703787.1| PREDICTED: obg-like ATPase 1 isoform X1 [Echinops telfairi]
Length=396

 Score =   239 bits (609),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 120/184 (65%), Positives = 141/184 (77%), Gaps = 1/184 (1%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHG-GELIIPFSAALERSL  619
            E+ N    LT+KP+VYLVN++EKDY RKKNK+L KI  WV ++  G L+IPFS ALE  L
Sbjct  212  EVLNKHLFLTSKPMVYLVNLSEKDYIRKKNKWLIKIKEWVDKYDPGALVIPFSGALELKL  271

Query  618  ADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAA  439
             ++  +E  KY E N  QSALPKIIK GFSA+ L YFFTAGPDEV+ W +R+ TKAPQAA
Sbjct  272  QELSAEERQKYLEANMTQSALPKIIKAGFSALQLEYFFTAGPDEVRAWTVRKGTKAPQAA  331

Query  438  GAIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSG  259
            G IHTDFE+GFI AEVMK+ED KE GSE AVKA GKYRQ+G+ YVV+DGDVIFFKFN   
Sbjct  332  GKIHTDFEKGFIMAEVMKYEDFKEEGSENAVKAAGKYRQQGRNYVVEDGDVIFFKFNTPQ  391

Query  258  GGKK  247
              KK
Sbjct  392  QPKK  395



>ref|XP_005519864.1| PREDICTED: obg-like ATPase 1 isoform X1 [Pseudopodoces humilis]
 ref|XP_005519865.1| PREDICTED: obg-like ATPase 1 isoform X2 [Pseudopodoces humilis]
 ref|XP_005519866.1| PREDICTED: obg-like ATPase 1 isoform X3 [Pseudopodoces humilis]
 ref|XP_008632970.1| PREDICTED: obg-like ATPase 1 isoform X1 [Corvus brachyrhynchos]
 ref|XP_008632971.1| PREDICTED: obg-like ATPase 1 isoform X1 [Corvus brachyrhynchos]
 gb|KFO59967.1| Obg-like ATPase 1 [Corvus brachyrhynchos]
Length=396

 Score =   239 bits (609),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 118/184 (64%), Positives = 140/184 (76%), Gaps = 1/184 (1%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHG-GELIIPFSAALERSL  619
            ++ N     T+KP++YLVN++EKDY RKKNK+L KI  WV +H  G L+IPFS ALE  L
Sbjct  212  DVLNKHLFFTSKPMIYLVNLSEKDYIRKKNKWLIKIKEWVDKHDPGALVIPFSGALELKL  271

Query  618  ADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAA  439
             DM  +E  KY EEN  QSAL KIIK G++A+ L YFFTAGPDEV+ W IR+ TKAPQAA
Sbjct  272  QDMSAEEKQKYLEENMTQSALAKIIKAGYAALQLEYFFTAGPDEVRAWTIRKGTKAPQAA  331

Query  438  GAIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSG  259
            G IHTDFE+GFI AEVMK+ED KE GSE AVKA GKYRQ+G+ YVV+DGD+IFFKFN   
Sbjct  332  GKIHTDFEKGFIMAEVMKYEDFKEGGSEAAVKAAGKYRQQGRNYVVEDGDIIFFKFNTPQ  391

Query  258  GGKK  247
              KK
Sbjct  392  QPKK  395



>ref|XP_001349125.1| conserved GTP-binding protein, putative [Plasmodium falciparum 
3D7]
 emb|CAD50971.1| conserved GTP-binding protein, putative [Plasmodium falciparum 
3D7]
 gb|ETW57156.1| GTP-binding protein YchF [Plasmodium falciparum Palo Alto/Uganda]
 gb|ETW60067.1| GTP-binding protein YchF [Plasmodium falciparum CAMP/Malaysia]
 gb|EUR73781.1| GTP-binding protein YchF [Plasmodium falciparum 7G8]
 gb|EUT88305.1| GTP-binding protein YchF [Plasmodium falciparum Santa Lucia]
 gb|EWC77445.1| GTP-binding protein YchF [Plasmodium falciparum UGT5.1]
Length=393

 Score =   239 bits (609),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 117/184 (64%), Positives = 139/184 (76%), Gaps = 1/184 (1%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHGGELIIPFSAALERSLA  616
            E+ N +  LTAKPVVYLVNM+E D+ R+KNK+L KI+ WVQE     IIP+SA +E+ + 
Sbjct  210  EVLNEYNFLTAKPVVYLVNMSEADFIRQKNKYLAKIYNWVQEKNKGTIIPYSAEVEQKIL  269

Query  615  DMPPDEAAKYCEENKV-QSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAA  439
             M  +E  +Y E N + QS L KIIKTG+  INLI+FFT G DEVKCW IR+ TKAPQAA
Sbjct  270  SMDEEEKKQYFETNNIKQSMLNKIIKTGYYEINLIHFFTCGHDEVKCWTIRKGTKAPQAA  329

Query  438  GAIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSG  259
            G IHTDFE+GFICAEV K+ DL E  SE  VKA GKY Q+GK YVV+DGD+IFFKFNVS 
Sbjct  330  GVIHTDFEKGFICAEVYKYTDLVEYKSEGEVKANGKYLQKGKDYVVEDGDIIFFKFNVSS  389

Query  258  GGKK  247
            GGKK
Sbjct  390  GGKK  393



>ref|XP_009070315.1| PREDICTED: obg-like ATPase 1 [Acanthisitta chloris]
Length=396

 Score =   239 bits (609),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 118/184 (64%), Positives = 140/184 (76%), Gaps = 1/184 (1%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHG-GELIIPFSAALERSL  619
            ++ N     T+KP++YLVN++EKDY RKKNK+L KI  WV +H  G L+IPFS ALE  L
Sbjct  212  DVLNKHLFFTSKPMIYLVNLSEKDYIRKKNKWLIKIKEWVDKHDPGALVIPFSGALELKL  271

Query  618  ADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAA  439
             DM  +E  KY EEN  QSAL KIIK G++A+ L YFFTAGPDEV+ W IR+ TKAPQAA
Sbjct  272  QDMSAEEKQKYLEENMTQSALAKIIKAGYAALQLEYFFTAGPDEVRAWTIRKGTKAPQAA  331

Query  438  GAIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSG  259
            G IHTDFE+GFI AEVMK+ED KE GSE AVKA GKYRQ+G+ YVV+DGD+IFFKFN   
Sbjct  332  GKIHTDFEKGFIMAEVMKYEDFKEGGSEAAVKAAGKYRQQGRNYVVEDGDIIFFKFNTPQ  391

Query  258  GGKK  247
              KK
Sbjct  392  QPKK  395



>ref|XP_004601222.1| PREDICTED: obg-like ATPase 1 isoform X1 [Sorex araneus]
Length=396

 Score =   239 bits (609),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 118/184 (64%), Positives = 142/184 (77%), Gaps = 1/184 (1%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHG-GELIIPFSAALERSL  619
            E+ N +  LT+KP+VYLVN++EKDY RKKNK+L KI  WV ++  G L+IPFS ALE  L
Sbjct  212  EVLNKYLFLTSKPMVYLVNLSEKDYIRKKNKWLIKIKEWVDKYDPGALVIPFSGALELKL  271

Query  618  ADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAA  439
             ++  +E  KY E N  QSALPKIIK GF+A+ L YFFTAGPDEV+ W IR+ TKAPQAA
Sbjct  272  QELSAEERQKYLEANMTQSALPKIIKAGFAALQLEYFFTAGPDEVRAWTIRKGTKAPQAA  331

Query  438  GAIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSG  259
            G IHTDFE+GFI AEVMK+ED KE GSE AVKA GKYRQ+G+ Y+V+DGD+IFFKFN   
Sbjct  332  GKIHTDFEKGFIMAEVMKYEDFKEEGSENAVKAAGKYRQQGRNYIVEDGDIIFFKFNTPQ  391

Query  258  GGKK  247
              KK
Sbjct  392  QPKK  395



>ref|XP_005049114.1| PREDICTED: obg-like ATPase 1 [Ficedula albicollis]
Length=396

 Score =   239 bits (609),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 118/184 (64%), Positives = 140/184 (76%), Gaps = 1/184 (1%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHG-GELIIPFSAALERSL  619
            ++ N     T+KP++YLVN++EKDY RKKNK+L KI  WV +H  G L+IPFS ALE  L
Sbjct  212  DVLNKHLFFTSKPMIYLVNLSEKDYIRKKNKWLIKIKEWVDKHDPGALVIPFSGALELKL  271

Query  618  ADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAA  439
             DM  +E  KY EEN  QSAL KIIK G++A+ L YFFTAGPDEV+ W IR+ TKAPQAA
Sbjct  272  QDMSAEEKQKYLEENMTQSALAKIIKAGYAALQLEYFFTAGPDEVRAWTIRKGTKAPQAA  331

Query  438  GAIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSG  259
            G IHTDFE+GFI AEVMK+ED KE GSE AVKA GKYRQ+G+ YVV+DGD+IFFKFN   
Sbjct  332  GKIHTDFEKGFIMAEVMKYEDFKEGGSEAAVKAAGKYRQQGRNYVVEDGDIIFFKFNTPQ  391

Query  258  GGKK  247
              KK
Sbjct  392  QPKK  395



>ref|XP_005799467.1| PREDICTED: obg-like ATPase 1-like [Xiphophorus maculatus]
Length=409

 Score =   239 bits (610),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 115/184 (63%), Positives = 139/184 (76%), Gaps = 1/184 (1%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHG-GELIIPFSAALERSL  619
            ++ N +  LT+KP++YLVN++EKDY R+KNK+L KI  WV  H  G L+IPFS  LE  L
Sbjct  225  DVLNKYLFLTSKPMIYLVNLSEKDYIRRKNKWLVKIKEWVDSHDPGALVIPFSGNLESRL  284

Query  618  ADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAA  439
             DM  +E  K C+E+K QSAL KIIK G++A+ L YFFT GPDEV+ W IR+ TKAPQAA
Sbjct  285  QDMSEEERQKCCKEHKTQSALSKIIKAGYAALQLEYFFTTGPDEVRAWTIRKGTKAPQAA  344

Query  438  GAIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSG  259
            G IHTDFERGFI AEVMKF+D KE GSE AVKA GKYRQ+G+ Y V+DGD+IFFKFN   
Sbjct  345  GKIHTDFERGFIMAEVMKFQDFKEEGSESAVKAAGKYRQQGRNYTVEDGDIIFFKFNAPN  404

Query  258  GGKK  247
              KK
Sbjct  405  APKK  408



>ref|XP_005723544.1| PREDICTED: obg-like ATPase 1-like isoform X1 [Pundamilia nyererei]
 ref|XP_005921547.1| PREDICTED: obg-like ATPase 1-like isoform X1 [Haplochromis burtoni]
Length=398

 Score =   239 bits (609),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 116/184 (63%), Positives = 139/184 (76%), Gaps = 1/184 (1%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHG-GELIIPFSAALERSL  619
            E+ N +  LT+KP++YLVN++EKDY R+KNK+L KI  WV  H  G L+IPFS  LE  L
Sbjct  214  EVLNKYLFLTSKPMIYLVNLSEKDYIRRKNKWLVKIKEWVDSHDPGALVIPFSGGLESLL  273

Query  618  ADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAA  439
             D   +E  KY  E+K QSAL KIIK G++A+ L YFFTAGPDEV+ W IR+ TKAPQAA
Sbjct  274  QDKSEEERQKYSTEHKTQSALSKIIKAGYAALQLEYFFTAGPDEVRAWTIRKGTKAPQAA  333

Query  438  GAIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSG  259
            G IHTDFERGFI AEVMKF+D KE GSE AVKA GKYRQ+G+ Y+V+DGD+IFFKFN   
Sbjct  334  GKIHTDFERGFIMAEVMKFQDFKEEGSESAVKAAGKYRQQGRNYIVEDGDIIFFKFNAPN  393

Query  258  GGKK  247
              KK
Sbjct  394  APKK  397



>ref|XP_005723545.1| PREDICTED: obg-like ATPase 1-like isoform X2 [Pundamilia nyererei]
 ref|XP_005921548.1| PREDICTED: obg-like ATPase 1-like isoform X2 [Haplochromis burtoni]
Length=396

 Score =   239 bits (609),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 116/184 (63%), Positives = 139/184 (76%), Gaps = 1/184 (1%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHG-GELIIPFSAALERSL  619
            E+ N +  LT+KP++YLVN++EKDY R+KNK+L KI  WV  H  G L+IPFS  LE  L
Sbjct  212  EVLNKYLFLTSKPMIYLVNLSEKDYIRRKNKWLVKIKEWVDSHDPGALVIPFSGGLESLL  271

Query  618  ADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAA  439
             D   +E  KY  E+K QSAL KIIK G++A+ L YFFTAGPDEV+ W IR+ TKAPQAA
Sbjct  272  QDKSEEERQKYSTEHKTQSALSKIIKAGYAALQLEYFFTAGPDEVRAWTIRKGTKAPQAA  331

Query  438  GAIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSG  259
            G IHTDFERGFI AEVMKF+D KE GSE AVKA GKYRQ+G+ Y+V+DGD+IFFKFN   
Sbjct  332  GKIHTDFERGFIMAEVMKFQDFKEEGSESAVKAAGKYRQQGRNYIVEDGDIIFFKFNAPN  391

Query  258  GGKK  247
              KK
Sbjct  392  APKK  395



>ref|XP_004557801.1| PREDICTED: obg-like ATPase 1-like isoform X1 [Maylandia zebra]
Length=398

 Score =   239 bits (609),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 116/184 (63%), Positives = 139/184 (76%), Gaps = 1/184 (1%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHG-GELIIPFSAALERSL  619
            E+ N +  LT+KP++YLVN++EKDY R+KNK+L KI  WV  H  G L+IPFS  LE  L
Sbjct  214  EVLNKYLFLTSKPMIYLVNLSEKDYIRRKNKWLVKIKEWVDSHDPGALVIPFSGGLESLL  273

Query  618  ADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAA  439
             D   +E  KY  E+K QSAL KIIK G++A+ L YFFTAGPDEV+ W IR+ TKAPQAA
Sbjct  274  QDKSEEERQKYSTEHKTQSALSKIIKAGYAALQLEYFFTAGPDEVRAWTIRKGTKAPQAA  333

Query  438  GAIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSG  259
            G IHTDFERGFI AEVMKF+D KE GSE AVKA GKYRQ+G+ Y+V+DGD+IFFKFN   
Sbjct  334  GKIHTDFERGFIMAEVMKFQDFKEEGSESAVKAAGKYRQQGRNYIVEDGDIIFFKFNAPN  393

Query  258  GGKK  247
              KK
Sbjct  394  APKK  397



>gb|KFH16391.1| putative GTP-binding protein, partial [Toxoplasma gondii MAS]
Length=223

 Score =   233 bits (594),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 116/185 (63%), Positives = 141/185 (76%), Gaps = 2/185 (1%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHGGELIIPFSAALERSLA  616
            E+ N +Q LTAK VVYLVNM+EKD+ R+KNK+L KIH WV+ +    IIP+SA  E  LA
Sbjct  39   EVLNEYQFLTAKQVVYLVNMSEKDFIRQKNKWLAKIHGWVEANVSGPIIPYSAQFESKLA  98

Query  615  DMPPDEA-AKYCEE-NKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQA  442
            ++P D A  KY ++    +S L KI+ TG+ A++LI+FFT G DEVKCW IR+ TKAPQA
Sbjct  99   ELPDDAAREKYIKDVGASRSQLDKIVTTGYHALHLIHFFTCGEDEVKCWTIRQGTKAPQA  158

Query  441  AGAIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVS  262
            AG IHTDFERGFICAEV K+EDL   GSE AVKA GKY Q+GK YVV+DGD+IFFKFNV+
Sbjct  159  AGVIHTDFERGFICAEVYKYEDLVAAGSENAVKAAGKYLQKGKDYVVEDGDIIFFKFNVT  218

Query  261  GGGKK  247
              GKK
Sbjct  219  NSGKK  223



>gb|EPY39657.1| GTP binding protein [Angomonas deanei]
 gb|EPY42446.1| GTP binding protein [Angomonas deanei]
Length=392

 Score =   238 bits (608),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 108/180 (60%), Positives = 138/180 (77%), Gaps = 0/180 (0%)
 Frame = -3

Query  786  NTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHGGELIIPFSAALERSLADMP  607
            NT Q++TAKP ++LVNM+E DY R++NK+L K+  W+ E  GE +IPFSA LE +  +M 
Sbjct  213  NTLQLITAKPAMFLVNMSENDYTRQRNKWLKKLKDWIDEQTGEPMIPFSAELESNFVNMS  272

Query  606  PDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIH  427
            P+E AKYCEENK +S + KII T +  INLI++FTAGPDEVKCW I+R TKAPQAAG IH
Sbjct  273  PEEVAKYCEENKTKSQIHKIITTAYGIINLIHYFTAGPDEVKCWTIQRHTKAPQAAGRIH  332

Query  426  TDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  247
            TD E+GFICAEV+++ED   L SE A +  GK  Q+G+ Y V+DGD+IFFKFN + GGKK
Sbjct  333  TDMEKGFICAEVIEWEDFDRLESEAACRDEGKQHQQGRNYEVKDGDIIFFKFNAAKGGKK  392



>ref|XP_007546548.1| PREDICTED: obg-like ATPase 1 [Poecilia formosa]
Length=398

 Score =   238 bits (608),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 116/184 (63%), Positives = 139/184 (76%), Gaps = 1/184 (1%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHG-GELIIPFSAALERSL  619
            ++ N +  LT+KPV+YLVN++EKDY R+KNK+L KI  WV  H  G L+IPFS  LE  L
Sbjct  214  DVLNKYLFLTSKPVIYLVNVSEKDYIRRKNKWLVKIKEWVDSHDPGALVIPFSGNLESRL  273

Query  618  ADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAA  439
             DM  +E  K C+E+K QSAL KIIK G++A+ L YFFT GPDEV+ W IR+ TKAPQAA
Sbjct  274  QDMSEEERQKCCKEHKTQSALSKIIKAGYAALQLEYFFTTGPDEVRAWTIRKGTKAPQAA  333

Query  438  GAIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSG  259
            G IHTDFERGFI AEVMKF+D KE GSE AVKA GKYRQ+G+ Y V+DGD+IFFKFN   
Sbjct  334  GKIHTDFERGFIMAEVMKFQDFKEEGSESAVKAAGKYRQQGRNYTVEDGDIIFFKFNAPN  393

Query  258  GGKK  247
              KK
Sbjct  394  APKK  397



>ref|XP_009680050.1| PREDICTED: obg-like ATPase 1 [Struthio camelus australis]
 gb|KFV84859.1| Obg-like ATPase 1 [Struthio camelus australis]
Length=396

 Score =   238 bits (608),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 117/184 (64%), Positives = 140/184 (76%), Gaps = 1/184 (1%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHG-GELIIPFSAALERSL  619
            ++ N     T+KP++YLVN++EKDY RKKNK+L KI  WV +H  G L+IPFS ALE  L
Sbjct  212  DVLNKHLFFTSKPMIYLVNLSEKDYIRKKNKWLIKIKEWVDKHDPGALVIPFSGALELKL  271

Query  618  ADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAA  439
             DM  +E  KY EEN  QSAL KIIK G++A+ L YFFTAGPDEV+ W IR+ TKAPQAA
Sbjct  272  QDMSAEEKQKYLEENMTQSALAKIIKAGYAALQLEYFFTAGPDEVRAWTIRKGTKAPQAA  331

Query  438  GAIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSG  259
            G IHTDFE+GFI AEVMK+ED KE GSE AVKA GKYRQ+G+ Y+V+DGD+IFFKFN   
Sbjct  332  GKIHTDFEKGFIMAEVMKYEDFKEGGSEAAVKAAGKYRQQGRNYIVEDGDIIFFKFNTPQ  391

Query  258  GGKK  247
              KK
Sbjct  392  QPKK  395



>ref|XP_009639084.1| PREDICTED: obg-like ATPase 1 [Egretta garzetta]
 gb|KFP17586.1| Obg-like ATPase 1 [Egretta garzetta]
Length=396

 Score =   238 bits (608),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 117/184 (64%), Positives = 140/184 (76%), Gaps = 1/184 (1%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHG-GELIIPFSAALERSL  619
            ++ N     T+KP++YLVN++EKDY RKKNK+L KI  WV +H  G L+IPFS ALE  L
Sbjct  212  DVLNKHLFFTSKPMIYLVNLSEKDYIRKKNKWLIKIKEWVDKHDPGALVIPFSGALELKL  271

Query  618  ADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAA  439
             DM  +E  KY EEN  QSAL KIIK G++A+ L YFFTAGPDEV+ W IR+ TKAPQAA
Sbjct  272  QDMSAEEKQKYLEENMTQSALAKIIKAGYAALQLEYFFTAGPDEVRAWTIRKGTKAPQAA  331

Query  438  GAIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSG  259
            G IHTDFE+GFI AEVMK+ED KE GSE AVKA GKYRQ+G+ Y+V+DGD+IFFKFN   
Sbjct  332  GKIHTDFEKGFIMAEVMKYEDFKEGGSEAAVKAAGKYRQQGRNYIVEDGDIIFFKFNTPQ  391

Query  258  GGKK  247
              KK
Sbjct  392  QPKK  395



>ref|XP_005152654.1| PREDICTED: obg-like ATPase 1 [Melopsittacus undulatus]
 ref|XP_009086251.1| PREDICTED: obg-like ATPase 1 isoform X1 [Serinus canaria]
 ref|XP_009086252.1| PREDICTED: obg-like ATPase 1 isoform X1 [Serinus canaria]
 ref|XP_009460338.1| PREDICTED: obg-like ATPase 1 [Nipponia nippon]
 ref|XP_009703255.1| PREDICTED: obg-like ATPase 1 [Cariama cristata]
 ref|XP_009863599.1| PREDICTED: obg-like ATPase 1 [Apaloderma vittatum]
 ref|XP_009904955.1| PREDICTED: obg-like ATPase 1 [Picoides pubescens]
 ref|XP_009994461.1| PREDICTED: obg-like ATPase 1 [Chaetura pelagica]
 gb|KFP67376.1| Obg-like ATPase 1 [Cariama cristata]
 gb|KFP84928.1| Obg-like ATPase 1 [Apaloderma vittatum]
 gb|KFQ94658.1| Obg-like ATPase 1 [Nipponia nippon]
 gb|KFU88570.1| Obg-like ATPase 1 [Chaetura pelagica]
 gb|KFV72142.1| Obg-like ATPase 1 [Picoides pubescens]
Length=396

 Score =   238 bits (608),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 117/184 (64%), Positives = 140/184 (76%), Gaps = 1/184 (1%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHG-GELIIPFSAALERSL  619
            ++ N     T+KP++YLVN++EKDY RKKNK+L KI  WV +H  G L+IPFS ALE  L
Sbjct  212  DVLNKHLFFTSKPMIYLVNLSEKDYIRKKNKWLIKIKEWVDKHDPGALVIPFSGALELKL  271

Query  618  ADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAA  439
             DM  +E  KY EEN  QSAL KIIK G++A+ L YFFTAGPDEV+ W IR+ TKAPQAA
Sbjct  272  QDMSAEEKQKYLEENMTQSALAKIIKAGYAALQLEYFFTAGPDEVRAWTIRKGTKAPQAA  331

Query  438  GAIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSG  259
            G IHTDFE+GFI AEVMK+ED KE GSE AVKA GKYRQ+G+ Y+V+DGD+IFFKFN   
Sbjct  332  GKIHTDFEKGFIMAEVMKYEDFKEGGSEAAVKAAGKYRQQGRNYIVEDGDIIFFKFNTPQ  391

Query  258  GGKK  247
              KK
Sbjct  392  QPKK  395



>ref|XP_010564826.1| PREDICTED: obg-like ATPase 1 [Haliaeetus leucocephalus]
Length=396

 Score =   238 bits (608),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 117/184 (64%), Positives = 140/184 (76%), Gaps = 1/184 (1%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHG-GELIIPFSAALERSL  619
            ++ N     T+KP++YLVN++EKDY RKKNK+L KI  WV +H  G L+IPFS ALE  L
Sbjct  212  DVLNKHLFFTSKPMIYLVNLSEKDYIRKKNKWLIKIKEWVDKHDPGALVIPFSGALELKL  271

Query  618  ADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAA  439
             DM  +E  KY EEN  QSAL KIIK G++A+ L YFFTAGPDEV+ W IR+ TKAPQAA
Sbjct  272  QDMSAEEKQKYLEENMTQSALAKIIKAGYAALQLEYFFTAGPDEVRAWTIRKGTKAPQAA  331

Query  438  GAIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSG  259
            G IHTDFE+GFI AEVMK+ED KE GSE AVKA GKYRQ+G+ Y+V+DGD+IFFKFN   
Sbjct  332  GKIHTDFEKGFIMAEVMKYEDFKEGGSEAAVKAAGKYRQQGRNYIVEDGDIIFFKFNTPQ  391

Query  258  GGKK  247
              KK
Sbjct  392  QPKK  395



>ref|XP_008933239.1| PREDICTED: obg-like ATPase 1 [Merops nubicus]
 gb|KFQ24822.1| Obg-like ATPase 1 [Merops nubicus]
Length=396

 Score =   238 bits (608),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 117/184 (64%), Positives = 140/184 (76%), Gaps = 1/184 (1%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHG-GELIIPFSAALERSL  619
            ++ N     T+KP++YLVN++EKDY RKKNK+L KI  WV +H  G L+IPFS ALE  L
Sbjct  212  DVLNKHLFFTSKPMIYLVNLSEKDYIRKKNKWLIKIKEWVDKHDPGALVIPFSGALELKL  271

Query  618  ADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAA  439
             DM  +E  KY EEN  QSAL KIIK G++A+ L YFFTAGPDEV+ W IR+ TKAPQAA
Sbjct  272  QDMSAEEKQKYLEENMTQSALAKIIKAGYAALQLEYFFTAGPDEVRAWTIRKGTKAPQAA  331

Query  438  GAIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSG  259
            G IHTDFE+GFI AEVMK+ED KE GSE AVKA GKYRQ+G+ Y+V+DGD+IFFKFN   
Sbjct  332  GKIHTDFEKGFIMAEVMKYEDFKEGGSEAAVKAAGKYRQQGRNYIVEDGDIIFFKFNTPQ  391

Query  258  GGKK  247
              KK
Sbjct  392  QPKK  395



>ref|XP_001612801.1| GTP-binding protein [Plasmodium vivax Sal-1]
 gb|EDL43074.1| GTP-binding protein, putative [Plasmodium vivax]
Length=392

 Score =   238 bits (607),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 118/184 (64%), Positives = 136/184 (74%), Gaps = 1/184 (1%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHGGELIIPFSAALERSLA  616
            E+ N F  LTAKPVVYLVNM+E D+ R+KNK L KI+ WVQE     IIP+ A +E  L 
Sbjct  209  EVINEFNFLTAKPVVYLVNMSEADFIRQKNKHLAKIYNWVQEKNKGTIIPYCADMELKLL  268

Query  615  DMPPDEAAKYCEENKV-QSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAA  439
             M  +E   Y +EN V QS L KIIKTG+  INLI+FFT GPDEVKCW IR+ TKAPQAA
Sbjct  269  SMSEEEKNAYFKENNVKQSMLSKIIKTGYYEINLIHFFTCGPDEVKCWTIRKGTKAPQAA  328

Query  438  GAIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSG  259
            G IHTDFE+GFICAEV K+ DL E  SE  VKA GKY Q+GK YVV+DGD++FFKFNVS 
Sbjct  329  GVIHTDFEKGFICAEVYKYADLVEFKSEGEVKANGKYLQKGKDYVVEDGDIVFFKFNVSS  388

Query  258  GGKK  247
             GKK
Sbjct  389  SGKK  392



>gb|KFR10255.1| Obg-like ATPase 1, partial [Opisthocomus hoazin]
Length=362

 Score =   237 bits (604),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 116/184 (63%), Positives = 140/184 (76%), Gaps = 1/184 (1%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHG-GELIIPFSAALERSL  619
            ++ N     T+KP++YLVN++EKDY RKKNK+L KI  WV +H  G L+IPFS ALE  L
Sbjct  178  DVLNKHLFFTSKPMIYLVNLSEKDYVRKKNKWLIKIKEWVDKHDPGALVIPFSGALELKL  237

Query  618  ADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAA  439
             DM  +E  KY EEN  +SAL KIIK G++A+ L YFFTAGPDEV+ W IR+ TKAPQAA
Sbjct  238  QDMSAEEKQKYLEENMKESALAKIIKAGYAALQLEYFFTAGPDEVRAWTIRKGTKAPQAA  297

Query  438  GAIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSG  259
            G IHTDFE+GFI AEVMK+ED KE GSE AVKA GKYRQ+G+ Y+V+DGD+IFFKFN   
Sbjct  298  GKIHTDFEKGFIMAEVMKYEDFKEGGSEAAVKAAGKYRQQGRNYIVEDGDIIFFKFNTPQ  357

Query  258  GGKK  247
              KK
Sbjct  358  QPKK  361



>ref|NP_001268915.1| obg-like ATPase 1 isoform 2 [Danio rerio]
Length=348

 Score =   236 bits (603),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 115/184 (63%), Positives = 136/184 (74%), Gaps = 1/184 (1%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHG-GELIIPFSAALERSL  619
            E+ N    LT+KP++YLVN++EKDY RKKNK+L KI  WV  H  G L+IP S   E   
Sbjct  164  EVLNKHLFLTSKPMIYLVNLSEKDYIRKKNKWLVKIKEWVDAHDPGALVIPLSGGFESKY  223

Query  618  ADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAA  439
             DM  +E  KYCEENK QS L KIIK+G+SA+ L YFFTAGPDEV+ W +R+ TKAPQAA
Sbjct  224  QDMSDEEKQKYCEENKTQSILTKIIKSGYSALQLEYFFTAGPDEVRAWTVRKGTKAPQAA  283

Query  438  GAIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSG  259
            G IHTDFE+GFI AEVMKF D KE GSE A KA GKYRQ+G+ Y+V+DGD+IFFKFN   
Sbjct  284  GKIHTDFEKGFIMAEVMKFTDFKEEGSENAAKAAGKYRQQGRNYIVEDGDIIFFKFNTPN  343

Query  258  GGKK  247
              KK
Sbjct  344  QPKK  347



>ref|XP_006878885.1| PREDICTED: obg-like ATPase 1-like [Elephantulus edwardii]
Length=396

 Score =   238 bits (607),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 118/184 (64%), Positives = 141/184 (77%), Gaps = 1/184 (1%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHG-GELIIPFSAALERSL  619
            E+ N    LT+KP+VYLVN++EKDY RKKNK+L KI  WV ++  G L+IPFS ALE  L
Sbjct  212  EVLNKHLFLTSKPMVYLVNLSEKDYIRKKNKWLIKIKEWVDKYDPGALVIPFSGALELKL  271

Query  618  ADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAA  439
             ++  +E  KY E N  QSALPKIIK GF+A+ L YFFTAGPDEV+ W IR+ TKAPQAA
Sbjct  272  QELSAEERQKYLEANMTQSALPKIIKAGFAALQLEYFFTAGPDEVRAWTIRKGTKAPQAA  331

Query  438  GAIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSG  259
            G IHTDFE+GFI AEVMK+ED KE GSE AVKA GKYRQ+G+ Y+V+DGD+IFFKFN   
Sbjct  332  GKIHTDFEKGFIMAEVMKYEDFKEEGSENAVKAAGKYRQQGRNYIVEDGDIIFFKFNTPQ  391

Query  258  GGKK  247
              KK
Sbjct  392  QSKK  395



>emb|CEI96573.1| Putative Obg-like ATPase 1 [Rhizopus microsporus]
Length=398

 Score =   238 bits (607),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 113/184 (61%), Positives = 140/184 (76%), Gaps = 1/184 (1%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHG-GELIIPFSAALERSL  619
            E+ N   +LTAKPV+YL N++EKDY RKKNK+LPKI AW+ E+  G+++IP+S A E  L
Sbjct  214  EVINGLHLLTAKPVIYLANLSEKDYIRKKNKWLPKIKAWIDENSPGDMMIPYSGAYEYRL  273

Query  618  ADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAA  439
                 +E  +  +EN   S L KII  G++A+ LIYFFT GPDEV+ W IR+ TKAPQAA
Sbjct  274  TLASAEEKEQIQKENNAPSVLSKIIVNGYAALQLIYFFTGGPDEVRAWTIRKNTKAPQAA  333

Query  438  GAIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSG  259
            G IHTDFERGFI AEVMK+EDLKELGSE AVKA GKY Q+GK Y+V+DGD+I+FKFNV+ 
Sbjct  334  GVIHTDFERGFIMAEVMKYEDLKELGSESAVKAAGKYMQKGKDYIVEDGDIIYFKFNVTA  393

Query  258  GGKK  247
              KK
Sbjct  394  PAKK  397



>emb|CDO63681.1| GTP-binding protein, putative [Plasmodium reichenowi]
Length=393

 Score =   238 bits (606),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 116/184 (63%), Positives = 139/184 (76%), Gaps = 1/184 (1%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHGGELIIPFSAALERSLA  616
            E+ N +  LTAKPVVYLVNM+E D+ R+KNK+L KI+ WVQE     IIP+SA +E+ + 
Sbjct  210  EVLNEYNFLTAKPVVYLVNMSEADFIRQKNKYLAKIYNWVQEKNKGTIIPYSAEVEQKIL  269

Query  615  DMPPDEAAKYCEENKV-QSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAA  439
             M  +E  +Y + N + QS L KIIKTG+  INLI+FFT G DEVKCW IR+ TKAPQAA
Sbjct  270  SMDEEEKKQYFQTNNIKQSMLNKIIKTGYYEINLIHFFTCGHDEVKCWTIRKGTKAPQAA  329

Query  438  GAIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSG  259
            G IHTDFE+GFICAEV K+ DL E  SE  VKA GKY Q+GK YVV+DGD+IFFKFNVS 
Sbjct  330  GVIHTDFEKGFICAEVYKYTDLVEYKSEGEVKANGKYLQKGKDYVVEDGDIIFFKFNVSS  389

Query  258  GGKK  247
            GGKK
Sbjct  390  GGKK  393



>ref|XP_006636566.1| PREDICTED: obg-like ATPase 1-like isoform X1 [Lepisosteus oculatus]
Length=401

 Score =   238 bits (607),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 115/184 (63%), Positives = 140/184 (76%), Gaps = 1/184 (1%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHG-GELIIPFSAALERSL  619
            E+ N +  LT+KP++YLVN++EKDY RKKNK+L KI  WV  H  G ++IPFS  LE  L
Sbjct  217  EVLNKYLFLTSKPMIYLVNLSEKDYIRKKNKWLVKIKEWVDSHDPGAMVIPFSGGLELKL  276

Query  618  ADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAA  439
             DM  +E  KY EE+K QS L KIIK+G++A+ L YFFTAGPDEV+ W IR+ TKAPQAA
Sbjct  277  QDMSDEEKEKYTEEHKTQSVLTKIIKSGYAALQLEYFFTAGPDEVRAWTIRKGTKAPQAA  336

Query  438  GAIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSG  259
            G IH+DFE+GFI AEVMKF+D KE GSE AVKA GKYRQ+G+ Y V+DGD+IFFKFN   
Sbjct  337  GKIHSDFEKGFIMAEVMKFQDFKEEGSESAVKAAGKYRQQGRNYTVEDGDIIFFKFNTPN  396

Query  258  GGKK  247
              KK
Sbjct  397  QPKK  400



>ref|XP_010988428.1| PREDICTED: obg-like ATPase 1 [Camelus dromedarius]
Length=396

 Score =   238 bits (606),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 118/184 (64%), Positives = 141/184 (77%), Gaps = 1/184 (1%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHG-GELIIPFSAALERSL  619
            E+ N    LT+KP+VYLVN++EKDY RKKNK+L KI  WV ++  G L+IPFS ALE  L
Sbjct  212  EVLNKHLFLTSKPMVYLVNLSEKDYIRKKNKWLIKIKEWVDKYDPGALVIPFSGALELKL  271

Query  618  ADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAA  439
             ++  +E  KY E N  QSALPKIIK GF+A+ L YFFTAGPDEV+ W IR+ TKAPQAA
Sbjct  272  QELSAEERQKYLEANMTQSALPKIIKAGFAALQLEYFFTAGPDEVRAWTIRKGTKAPQAA  331

Query  438  GAIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSG  259
            G IHTDFE+GFI AEVMK+ED KE GSE AVKA GKYRQ+G+ Y+V+DGD+IFFKFN   
Sbjct  332  GKIHTDFEKGFIMAEVMKYEDFKEEGSENAVKAAGKYRQQGRNYIVEDGDIIFFKFNTPQ  391

Query  258  GGKK  247
              KK
Sbjct  392  QPKK  395



>gb|AIC56285.1| OLA1, partial [synthetic construct]
Length=396

 Score =   238 bits (606),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 118/184 (64%), Positives = 141/184 (77%), Gaps = 1/184 (1%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHG-GELIIPFSAALERSL  619
            E+ N    LT+KP+VYLVN++EKDY RKKNK+L KI  WV ++  G L+IPFS ALE  L
Sbjct  212  EVLNKHLFLTSKPMVYLVNLSEKDYIRKKNKWLIKIKEWVDKYDPGALVIPFSGALELKL  271

Query  618  ADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAA  439
             ++  +E  KY E N  QSALPKIIK GF+A+ L YFFTAGPDEV+ W IR+ TKAPQAA
Sbjct  272  QELSAEERQKYLEANMTQSALPKIIKAGFAALQLEYFFTAGPDEVRAWTIRKGTKAPQAA  331

Query  438  GAIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSG  259
            G IHTDFE+GFI AEVMK+ED KE GSE AVKA GKYRQ+G+ Y+V+DGD+IFFKFN   
Sbjct  332  GKIHTDFEKGFIMAEVMKYEDFKEEGSENAVKAAGKYRQQGRNYIVEDGDIIFFKFNTPH  391

Query  258  GGKK  247
              KK
Sbjct  392  QPKK  395



>gb|EPY23726.1| GTP binding protein [Strigomonas culicis]
Length=270

 Score =   233 bits (595),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 105/180 (58%), Positives = 138/180 (77%), Gaps = 0/180 (0%)
 Frame = -3

Query  786  NTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHGGELIIPFSAALERSLADMP  607
            NT Q+LTAKP ++L+NM+E D+ R++NK+L K+  W+ E  GE +IPFSA LE S  +M 
Sbjct  91   NTIQLLTAKPAMFLINMSENDFCRQRNKWLKKLKDWIDEQTGEPMIPFSAELESSFLNMS  150

Query  606  PDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIH  427
            P+E   YCEE+K +S + KII T ++ INLI++FTAGPDEVKCW I+R TKAPQAAG IH
Sbjct  151  PEEVHAYCEEHKTKSQIHKIINTAYNVINLIHYFTAGPDEVKCWTIQRGTKAPQAAGRIH  210

Query  426  TDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  247
            +D E+GFICAEV+++ED + L SE A +  GK  Q G+TY V+DGD+IFFKFN + GGKK
Sbjct  211  SDMEKGFICAEVIEWEDFERLKSESACRDEGKQHQHGRTYEVKDGDIIFFKFNAAKGGKK  270



>ref|XP_004476856.1| PREDICTED: obg-like ATPase 1 isoform 2 [Dasypus novemcinctus]
Length=396

 Score =   238 bits (606),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 119/184 (65%), Positives = 141/184 (77%), Gaps = 1/184 (1%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHG-GELIIPFSAALERSL  619
            E+ N    LT+KP+VYLVN++EKDY RKKNK+L KI  WV ++  G L+IPFS ALE  L
Sbjct  212  EVLNKHLFLTSKPMVYLVNLSEKDYIRKKNKWLIKIKEWVDKYDPGALVIPFSGALELKL  271

Query  618  ADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAA  439
             ++  +E  KY E N  QSALPKIIK GF+A+ L YFFTAGPDEV+ W IR+ TKAPQAA
Sbjct  272  QELSAEERQKYLEANMTQSALPKIIKAGFAALQLEYFFTAGPDEVRAWTIRKGTKAPQAA  331

Query  438  GAIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSG  259
            G IHTDFE+GFI AEVMK+ED KE GSE AVKA GKYRQ+G+ YVV+DGD+IFFKFN   
Sbjct  332  GKIHTDFEKGFIMAEVMKYEDFKEEGSENAVKAAGKYRQQGRNYVVEDGDIIFFKFNTPQ  391

Query  258  GGKK  247
              KK
Sbjct  392  QPKK  395



>ref|XP_003253776.1| PREDICTED: obg-like ATPase 1 isoform 1 [Nomascus leucogenys]
Length=396

 Score =   238 bits (606),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 119/184 (65%), Positives = 141/184 (77%), Gaps = 1/184 (1%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHG-GELIIPFSAALERSL  619
            E+ N    LT+KP+VYLVN++EKDY RKKNK+L KI  WV ++  G L+IPFS ALE  L
Sbjct  212  EVLNKHLFLTSKPMVYLVNLSEKDYIRKKNKWLIKIKEWVDKYDPGALVIPFSGALELKL  271

Query  618  ADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAA  439
             ++  +E  KY E N  QSALPKIIK GF+A+ L YFFTAGPDEV+ W IR+ TKAPQAA
Sbjct  272  QELSAEERQKYLEANMTQSALPKIIKAGFAALQLEYFFTAGPDEVRAWTIRKGTKAPQAA  331

Query  438  GAIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSG  259
            G IHTDFE+GFI AEVMK+ED KE GSE AVKA GKYRQ+G+ YVV+DGD+IFFKFN   
Sbjct  332  GKIHTDFEKGFIMAEVMKYEDFKEEGSENAVKAAGKYRQQGRNYVVEDGDIIFFKFNTPQ  391

Query  258  GGKK  247
              KK
Sbjct  392  QPKK  395



>ref|XP_004476855.1| PREDICTED: obg-like ATPase 1 isoform 1 [Dasypus novemcinctus]
Length=403

 Score =   238 bits (606),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 119/184 (65%), Positives = 141/184 (77%), Gaps = 1/184 (1%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHG-GELIIPFSAALERSL  619
            E+ N    LT+KP+VYLVN++EKDY RKKNK+L KI  WV ++  G L+IPFS ALE  L
Sbjct  219  EVLNKHLFLTSKPMVYLVNLSEKDYIRKKNKWLIKIKEWVDKYDPGALVIPFSGALELKL  278

Query  618  ADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAA  439
             ++  +E  KY E N  QSALPKIIK GF+A+ L YFFTAGPDEV+ W IR+ TKAPQAA
Sbjct  279  QELSAEERQKYLEANMTQSALPKIIKAGFAALQLEYFFTAGPDEVRAWTIRKGTKAPQAA  338

Query  438  GAIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSG  259
            G IHTDFE+GFI AEVMK+ED KE GSE AVKA GKYRQ+G+ YVV+DGD+IFFKFN   
Sbjct  339  GKIHTDFEKGFIMAEVMKYEDFKEEGSENAVKAAGKYRQQGRNYVVEDGDIIFFKFNTPQ  398

Query  258  GGKK  247
              KK
Sbjct  399  QPKK  402



>ref|XP_010605331.1| PREDICTED: obg-like ATPase 1 isoform X1 [Fukomys damarensis]
Length=397

 Score =   238 bits (606),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 118/184 (64%), Positives = 141/184 (77%), Gaps = 1/184 (1%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHG-GELIIPFSAALERSL  619
            E+ N    LT+KP+VYLVN++EKDY RKKNK+L KI  WV ++  G L+IPFS ALE  L
Sbjct  213  EVLNKHLFLTSKPMVYLVNLSEKDYIRKKNKWLIKIKEWVDKYDPGALVIPFSGALELKL  272

Query  618  ADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAA  439
             ++  +E  KY E N  QSALPKIIK GF+A+ L YFFTAGPDEV+ W IR+ TKAPQAA
Sbjct  273  QELSAEERQKYLEANMTQSALPKIIKAGFAALQLEYFFTAGPDEVRAWTIRKGTKAPQAA  332

Query  438  GAIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSG  259
            G IHTDFE+GFI AEVMK+ED KE GSE AVKA GKYRQ+G+ Y+V+DGD+IFFKFN   
Sbjct  333  GKIHTDFEKGFIMAEVMKYEDFKEEGSENAVKAAGKYRQQGRNYIVEDGDIIFFKFNTPQ  392

Query  258  GGKK  247
              KK
Sbjct  393  QPKK  396



>ref|XP_005573571.1| PREDICTED: uncharacterized LOC101926459 isoform X2 [Macaca fascicularis]
Length=398

 Score =   238 bits (606),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 118/184 (64%), Positives = 141/184 (77%), Gaps = 1/184 (1%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHG-GELIIPFSAALERSL  619
            E+ N    LT+KP+VYLVN++EKDY RKKNK+L KI  WV ++  G L+IPFS ALE  L
Sbjct  214  EVLNKHLFLTSKPMVYLVNLSEKDYIRKKNKWLIKIKEWVDKYDPGALVIPFSGALELKL  273

Query  618  ADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAA  439
             ++  +E  KY E N  QSALPKIIK GF+A+ L YFFTAGPDEV+ W IR+ TKAPQAA
Sbjct  274  QELSAEERQKYLEANMTQSALPKIIKAGFAALQLEYFFTAGPDEVRAWTIRKGTKAPQAA  333

Query  438  GAIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSG  259
            G IHTDFE+GFI AEVMK+ED KE GSE AVKA GKYRQ+G+ Y+V+DGD+IFFKFN   
Sbjct  334  GKIHTDFEKGFIMAEVMKYEDFKEEGSENAVKAAGKYRQQGRNYIVEDGDIIFFKFNTPQ  393

Query  258  GGKK  247
              KK
Sbjct  394  QPKK  397



>ref|XP_004674578.1| PREDICTED: obg-like ATPase 1 isoform X1 [Condylura cristata]
Length=396

 Score =   237 bits (605),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 118/184 (64%), Positives = 141/184 (77%), Gaps = 1/184 (1%)
 Frame = -3

Query  795  EIXNTFQVLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHG-GELIIPFSAALERSL  619
            E+ N    LT+KP+VYLVN++EKDY RKKNK+L KI  WV ++  G L+IPFS ALE  L
Sbjct  212  EVLNKHLFLTSKPMVYLVNLSEKDYIRKKNKWLIKIKEWVDKYDPGALVIPFSGALELKL  271

Query  618  ADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAA  439
             ++  +E  KY E N  QSALPKIIK GF+A+ L YFFTAGPDEV+ W IR+ TKAPQAA
Sbjct  272  QELSAEERQKYLEANMTQSALPKIIKAGFAALQLEYFFTAGPDEVRAWTIRKGTKAPQAA  331

Query  438  GAIHTDFERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSG  259
            G IHTDFE+GFI AEVMK+ED KE GSE AVKA GKYRQ+G+ Y+V+DGD+IFFKFN   
Sbjct  332  GKIHTDFEKGFIMAEVMKYEDFKEEGSENAVKAAGKYRQQGRNYIVEDGDIIFFKFNTPQ  391

Query  258  GGKK  247
              KK
Sbjct  392  QPKK  395



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1606838546005