BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF011B09

Length=760
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|NP_001238374.1|  60S acidic ribosomal protein P0                    325   3e-107   Glycine max [soybeans]
ref|NP_001239676.1|  uncharacterized protein LOC100777482               323   9e-107   Glycine max [soybeans]
emb|CBI31491.3|  unnamed protein product                                322   1e-106   Vitis vinifera
ref|XP_004149240.1|  PREDICTED: 60S acidic ribosomal protein P0-like    323   2e-106   Cucumis sativus [cucumbers]
ref|XP_002276842.1|  PREDICTED: 60S acidic ribosomal protein P0         323   2e-106   Vitis vinifera
gb|KHG25462.1|  60S acidic ribosomal P0                                 323   2e-106   Gossypium arboreum [tree cotton]
gb|KHG08087.1|  60S acidic ribosomal P0                                 323   2e-106   Gossypium arboreum [tree cotton]
emb|CBI25508.3|  unnamed protein product                                321   4e-106   Vitis vinifera
ref|XP_002268645.1|  PREDICTED: 60S acidic ribosomal protein P0         322   5e-106   Vitis vinifera
ref|XP_004165071.1|  PREDICTED: 60S acidic ribosomal protein P0-like    322   5e-106   
ref|XP_004490967.1|  PREDICTED: 60S acidic ribosomal protein P0-like    321   8e-106   Cicer arietinum [garbanzo]
ref|XP_004490966.1|  PREDICTED: 60S acidic ribosomal protein P0-like    321   8e-106   Cicer arietinum [garbanzo]
emb|CAN80537.1|  hypothetical protein VITISV_003812                     321   1e-105   Vitis vinifera
gb|KJB78787.1|  hypothetical protein B456_013G019000                    321   1e-105   Gossypium raimondii
ref|XP_010067511.1|  PREDICTED: 60S acidic ribosomal protein P0         321   1e-105   Eucalyptus grandis [rose gum]
gb|KJB74261.1|  hypothetical protein B456_011G283700                    321   1e-105   Gossypium raimondii
ref|XP_008463223.1|  PREDICTED: 60S acidic ribosomal protein P0         320   2e-105   Cucumis melo [Oriental melon]
ref|XP_011076719.1|  PREDICTED: 60S acidic ribosomal protein P0         320   2e-105   Sesamum indicum [beniseed]
ref|XP_007153264.1|  hypothetical protein PHAVU_003G020600g             320   2e-105   Phaseolus vulgaris [French bean]
gb|AGV54296.1|  60S acidic ribosomal protein P0                         320   2e-105   Phaseolus vulgaris [French bean]
ref|XP_007157498.1|  hypothetical protein PHAVU_002G074600g             320   2e-105   Phaseolus vulgaris [French bean]
gb|KJB76159.1|  hypothetical protein B456_012G076000                    320   2e-105   Gossypium raimondii
ref|XP_003603496.1|  60S acidic ribosomal protein p0                    319   6e-105   Medicago truncatula
ref|XP_004501267.1|  PREDICTED: 60S acidic ribosomal protein P0-like    319   6e-105   Cicer arietinum [garbanzo]
dbj|BAE71263.1|  putative 60S acidic ribosomal protein P0               318   1e-104   Trifolium pratense [peavine clover]
gb|AFK39880.1|  unknown                                                 317   3e-104   Medicago truncatula
ref|XP_010534571.1|  PREDICTED: 60S acidic ribosomal protein P0-like    317   3e-104   Tarenaya hassleriana [spider flower]
ref|XP_007009052.1|  Ribosomal protein L10 family protein isoform 2     317   3e-104   
ref|XP_007009051.1|  Ribosomal protein L10 family protein isoform 1     317   3e-104   
ref|XP_011042597.1|  PREDICTED: 60S acidic ribosomal protein P0-like    317   4e-104   Populus euphratica
gb|AFK46889.1|  unknown                                                 317   6e-104   Medicago truncatula
ref|XP_003616595.1|  60S acidic ribosomal protein p0                    317   6e-104   Medicago truncatula
gb|EYU18304.1|  hypothetical protein MIMGU_mgv1a010092mg                317   7e-104   Erythranthe guttata [common monkey flower]
gb|ABK95701.1|  unknown                                                 316   1e-103   Populus trichocarpa [western balsam poplar]
emb|CAN76468.1|  hypothetical protein VITISV_030042                     315   2e-103   Vitis vinifera
ref|XP_002526873.1|  60S acidic ribosomal protein P0, putative          315   2e-103   Ricinus communis
gb|EYU43500.1|  hypothetical protein MIMGU_mgv1a010103mg                315   2e-103   Erythranthe guttata [common monkey flower]
ref|XP_010554654.1|  PREDICTED: 60S acidic ribosomal protein P0         315   2e-103   Tarenaya hassleriana [spider flower]
gb|EYU43501.1|  hypothetical protein MIMGU_mgv1a010103mg                315   2e-103   Erythranthe guttata [common monkey flower]
gb|EYU43502.1|  hypothetical protein MIMGU_mgv1a010103mg                312   3e-103   Erythranthe guttata [common monkey flower]
gb|KDP44812.1|  hypothetical protein JCGZ_01312                         315   3e-103   Jatropha curcas
ref|XP_010689885.1|  PREDICTED: 60S acidic ribosomal protein P0         315   3e-103   Beta vulgaris subsp. vulgaris [field beet]
gb|KHG25720.1|  60S acidic ribosomal P0                                 314   4e-103   Gossypium arboreum [tree cotton]
gb|ACJ84880.1|  unknown                                                 315   4e-103   Medicago truncatula
ref|XP_009399833.1|  PREDICTED: 60S acidic ribosomal protein P0-like    314   4e-103   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002312149.1|  60S acidic ribosomal protein P0-A                  314   5e-103   Populus trichocarpa [western balsam poplar]
ref|XP_010534676.1|  PREDICTED: 60S acidic ribosomal protein P0-like    314   5e-103   Tarenaya hassleriana [spider flower]
ref|XP_009409427.1|  PREDICTED: 60S acidic ribosomal protein P0-like    314   7e-103   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009389889.1|  PREDICTED: 60S acidic ribosomal protein P0         314   7e-103   Musa acuminata subsp. malaccensis [pisang utan]
gb|ADR71236.1|  60S acidic ribosomal protein P0B                        313   9e-103   Hevea brasiliensis [jebe]
gb|ADR71235.1|  60S acidic ribosomal protein P0A                        313   1e-102   Hevea brasiliensis [jebe]
gb|AAF34767.1|AF227622_1  60S acidic ribosomal protein PO               313   1e-102   Euphorbia esula [wolf's milk]
ref|XP_011072152.1|  PREDICTED: 60S acidic ribosomal protein P0-like    313   1e-102   
gb|AFK38760.1|  unknown                                                 311   5e-102   Lotus japonicus
ref|XP_010486703.1|  PREDICTED: 60S acidic ribosomal protein P0-3       311   5e-102   Camelina sativa [gold-of-pleasure]
gb|KFK36893.1|  hypothetical protein AALP_AA4G185700                    311   8e-102   Arabis alpina [alpine rockcress]
ref|XP_006848156.1|  hypothetical protein AMTR_s00029p00231170          311   9e-102   Amborella trichopoda
ref|XP_010486773.1|  PREDICTED: 60S acidic ribosomal protein P0-3...    311   1e-101   Camelina sativa [gold-of-pleasure]
ref|XP_002315165.1|  60S acidic ribosomal protein P0-A                  310   1e-101   
gb|ABK94988.1|  unknown                                                 310   1e-101   Populus trichocarpa [western balsam poplar]
ref|XP_007222847.1|  hypothetical protein PRUPE_ppa008800mg             310   2e-101   Prunus persica
ref|XP_010941551.1|  PREDICTED: 60S acidic ribosomal protein P0         310   2e-101   Elaeis guineensis
gb|AAD56335.1|AC009326_22  putative 60S acidic ribosomal protein,...    306   3e-101   Arabidopsis thaliana [mouse-ear cress]
gb|EPS69246.1|  p0 ribosomal protein-like protein                       310   4e-101   Genlisea aurea
ref|XP_002882720.1|  60S acidic ribosomal protein P0                    309   4e-101   
ref|XP_006298124.1|  hypothetical protein CARUB_v10014186mg             309   4e-101   Capsella rubella
ref|NP_187734.1|  60S acidic ribosomal protein P0-3                     309   4e-101   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010464828.1|  PREDICTED: 60S acidic ribosomal protein P0-3...    309   4e-101   Camelina sativa [gold-of-pleasure]
ref|NP_001078125.1|  60S acidic ribosomal protein P0-2                  308   4e-101   Arabidopsis thaliana [mouse-ear cress]
ref|NP_187531.1|  60S acidic ribosomal protein P0-2                     309   5e-101   Arabidopsis thaliana [mouse-ear cress]
gb|AAM63644.1|  putative 60S acidic ribosomal protein P0                309   5e-101   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011035984.1|  PREDICTED: 60S acidic ribosomal protein P0         309   5e-101   Populus euphratica
ref|XP_010256605.1|  PREDICTED: 60S acidic ribosomal protein P0         308   7e-101   Nelumbo nucifera [Indian lotus]
ref|XP_007016138.1|  Ribosomal protein L10 family protein               308   9e-101   
ref|XP_006360336.1|  PREDICTED: 60S acidic ribosomal protein P0-like    308   9e-101   Solanum tuberosum [potatoes]
ref|XP_002884720.1|  60S acidic ribosomal protein P0                    308   9e-101   Arabidopsis lyrata subsp. lyrata
ref|XP_006411245.1|  hypothetical protein EUTSA_v10016954mg             308   1e-100   Eutrema salsugineum [saltwater cress]
ref|XP_004307622.1|  PREDICTED: 60S acidic ribosomal protein P0         308   1e-100   Fragaria vesca subsp. vesca
ref|XP_004247949.1|  PREDICTED: 60S acidic ribosomal protein P0-like    308   1e-100   Solanum lycopersicum
ref|XP_010486480.1|  PREDICTED: 60S acidic ribosomal protein P0-3...    308   2e-100   Camelina sativa [gold-of-pleasure]
emb|CDP14047.1|  unnamed protein product                                308   2e-100   Coffea canephora [robusta coffee]
ref|XP_010469822.1|  PREDICTED: 60S acidic ribosomal protein P0-3...    308   2e-100   Camelina sativa [gold-of-pleasure]
ref|XP_009344598.1|  PREDICTED: 60S acidic ribosomal protein P0         307   2e-100   Pyrus x bretschneideri [bai li]
emb|CDY07906.1|  BnaC03g36170D                                          308   2e-100   Brassica napus [oilseed rape]
gb|AAM65265.1|  60S acidic ribosomal protein P0-C                       307   2e-100   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010247657.1|  PREDICTED: 60S acidic ribosomal protein P0-like    307   2e-100   Nelumbo nucifera [Indian lotus]
ref|XP_006298147.1|  hypothetical protein CARUB_v10014197mg             307   3e-100   Capsella rubella
ref|XP_004307662.1|  PREDICTED: 60S acidic ribosomal protein P0         307   3e-100   Fragaria vesca subsp. vesca
ref|XP_009791710.1|  PREDICTED: 60S acidic ribosomal protein P0         307   3e-100   Nicotiana sylvestris
ref|XP_008392940.1|  PREDICTED: 60S acidic ribosomal protein P0         307   3e-100   Malus domestica [apple tree]
ref|XP_009619762.1|  PREDICTED: 60S acidic ribosomal protein P0-like    307   3e-100   Nicotiana tomentosiformis
ref|XP_010464557.1|  PREDICTED: 60S acidic ribosomal protein P0-3...    307   4e-100   Camelina sativa [gold-of-pleasure]
emb|CDX73962.1|  BnaA03g30850D                                          307   4e-100   
ref|XP_008799093.1|  PREDICTED: 60S acidic ribosomal protein P0         306   5e-100   Phoenix dactylifera
ref|XP_009764939.1|  PREDICTED: 60S acidic ribosomal protein P0-like    306   5e-100   Nicotiana sylvestris
ref|XP_009350848.1|  PREDICTED: 60S acidic ribosomal protein P0-like    306   6e-100   Pyrus x bretschneideri [bai li]
gb|KFK38515.1|  hypothetical protein AALP_AA3G123100                    306   6e-100   Arabis alpina [alpine rockcress]
emb|CDY53103.1|  BnaCnng24330D                                          306   6e-100   Brassica napus [oilseed rape]
ref|XP_008360784.1|  PREDICTED: 60S acidic ribosomal protein P0         306   6e-100   Malus domestica [apple tree]
ref|XP_006435697.1|  hypothetical protein CICLE_v10032141mg             306   8e-100   Citrus clementina [clementine]
ref|XP_009135066.1|  PREDICTED: 60S acidic ribosomal protein P0-2...    306   9e-100   Brassica rapa
ref|XP_009146942.1|  PREDICTED: 60S acidic ribosomal protein P0-2       306   1e-99    Brassica rapa
gb|KDO69054.1|  hypothetical protein CISIN_1g020952mg                   305   1e-99    Citrus sinensis [apfelsine]
ref|XP_009123454.1|  PREDICTED: 60S acidic ribosomal protein P0-2...    306   1e-99    Brassica rapa
ref|XP_006407706.1|  hypothetical protein EUTSA_v10021147mg             305   1e-99    Eutrema salsugineum [saltwater cress]
ref|XP_010095082.1|  60S acidic ribosomal protein P0                    305   1e-99    Morus notabilis
gb|EMS52841.1|  60S acidic ribosomal protein P0                         303   1e-99    Triticum urartu
ref|XP_010926952.1|  PREDICTED: 60S acidic ribosomal protein P0         305   2e-99    Elaeis guineensis
gb|KJB76158.1|  hypothetical protein B456_012G076000                    305   2e-99    Gossypium raimondii
gb|KFK38306.1|  hypothetical protein AALP_AA3G096900                    305   2e-99    Arabis alpina [alpine rockcress]
ref|XP_004145258.1|  PREDICTED: 60S acidic ribosomal protein P0-2...    305   3e-99    Cucumis sativus [cucumbers]
ref|XP_004239781.1|  PREDICTED: 60S acidic ribosomal protein P0         305   3e-99    Solanum lycopersicum
ref|XP_002440235.1|  hypothetical protein SORBIDRAFT_09g028230          304   3e-99    Sorghum bicolor [broomcorn]
ref|XP_009608105.1|  PREDICTED: 60S acidic ribosomal protein P0         303   6e-99    Nicotiana tomentosiformis
ref|NP_181530.1|  60S acidic ribosomal protein P0-1                     303   6e-99    Arabidopsis thaliana [mouse-ear cress]
emb|CDY24932.1|  BnaC03g22400D                                          303   1e-98    Brassica napus [oilseed rape]
ref|XP_011084927.1|  PREDICTED: 60S acidic ribosomal protein P0-like    302   2e-98    Sesamum indicum [beniseed]
gb|EMT02739.1|  60S acidic ribosomal protein P0                         302   2e-98    
ref|XP_002881693.1|  60S acidic ribosomal protein P0                    302   2e-98    
ref|XP_004287422.1|  PREDICTED: 60S acidic ribosomal protein P0-like    302   3e-98    Fragaria vesca subsp. vesca
emb|CDY60988.1|  BnaA03g56530D                                          301   5e-98    Brassica napus [oilseed rape]
ref|XP_009133397.1|  PREDICTED: 60S acidic ribosomal protein P0-1       301   6e-98    Brassica rapa
ref|NP_001275012.1|  60S acidic ribosomal protein P0-like               301   7e-98    Solanum tuberosum [potatoes]
ref|XP_010508934.1|  PREDICTED: 60S acidic ribosomal protein P0-1       300   1e-97    Camelina sativa [gold-of-pleasure]
emb|CDP16385.1|  unnamed protein product                                300   1e-97    Coffea canephora [robusta coffee]
gb|KHN36391.1|  60S acidic ribosomal protein P0                         300   1e-97    Glycine soja [wild soybean]
ref|XP_003573632.1|  PREDICTED: 60S acidic ribosomal protein P0-like    300   2e-97    Brachypodium distachyon [annual false brome]
ref|XP_002525622.1|  60S acidic ribosomal protein P0, putative          300   3e-97    Ricinus communis
gb|AID52928.1|  60S acidic ribosomal protein P0                         299   3e-97    Carthamus tinctorius
ref|XP_008457380.1|  PREDICTED: 60S acidic ribosomal protein P0-like    299   5e-97    Cucumis melo [Oriental melon]
gb|KHN34735.1|  60S acidic ribosomal protein P0                         298   8e-97    Glycine soja [wild soybean]
ref|XP_010517390.1|  PREDICTED: 60S acidic ribosomal protein P0-1...    298   1e-96    Camelina sativa [gold-of-pleasure]
ref|XP_007163525.1|  hypothetical protein PHAVU_001G241400g             297   2e-96    Phaseolus vulgaris [French bean]
ref|XP_003538454.1|  PREDICTED: 60S acidic ribosomal protein P0-like    296   4e-96    Glycine max [soybeans]
ref|XP_001759592.1|  predicted protein                                  296   5e-96    
gb|KDO69055.1|  hypothetical protein CISIN_1g020952mg                   295   1e-95    Citrus sinensis [apfelsine]
gb|KHG21849.1|  60S acidic ribosomal P0-2 -like protein                 291   3e-95    Gossypium arboreum [tree cotton]
gb|KHG01938.1|  60S acidic ribosomal P0-2 -like protein                 291   5e-95    Gossypium arboreum [tree cotton]
ref|XP_001759851.1|  predicted protein                                  293   1e-94    
gb|KJB19895.1|  hypothetical protein B456_003G123400                    292   2e-94    Gossypium raimondii
ref|XP_006296009.1|  hypothetical protein CARUB_v10025153mg             291   4e-94    Capsella rubella
ref|XP_004972933.1|  PREDICTED: 60S acidic ribosomal protein P0-like    290   1e-93    Setaria italica
gb|EYU19990.1|  hypothetical protein MIMGU_mgv1a0100892mg               286   2e-93    Erythranthe guttata [common monkey flower]
ref|XP_004958562.1|  PREDICTED: 60S acidic ribosomal protein P0-like    289   3e-93    Setaria italica
gb|KDO69056.1|  hypothetical protein CISIN_1g036252mg                   288   8e-93    Citrus sinensis [apfelsine]
ref|XP_006435696.1|  hypothetical protein CICLE_v10033862mg             288   8e-93    Citrus clementina [clementine]
gb|ACL52455.1|  unknown                                                 288   1e-92    Zea mays [maize]
ref|NP_001141489.1|  hypothetical protein                               288   1e-92    Zea mays [maize]
ref|XP_010234277.1|  PREDICTED: 60S acidic ribosomal protein P0         287   1e-92    Brachypodium distachyon [annual false brome]
emb|CDP06275.1|  unnamed protein product                                284   3e-92    Coffea canephora [robusta coffee]
gb|ABR26209.1|  60S acidic ribosomal protein p0                         283   3e-92    Oryza sativa Indica Group [Indian rice]
ref|XP_002445000.1|  hypothetical protein SORBIDRAFT_07g002560          286   5e-92    Sorghum bicolor [broomcorn]
ref|XP_006659092.1|  PREDICTED: 60S acidic ribosomal protein P0-like    286   5e-92    Oryza brachyantha
gb|ACF83717.1|  unknown                                                 286   5e-92    Zea mays [maize]
ref|NP_001105482.1|  60S acidic ribosomal protein P0                    286   5e-92    Zea mays [maize]
ref|NP_001060923.1|  Os08g0130500                                       286   6e-92    
gb|ABA95724.1|  60S acidic ribosomal protein P0, putative, expressed    286   7e-92    Oryza sativa Japonica Group [Japonica rice]
gb|ABA91328.1|  60S acidic ribosomal protein P0, putative, expressed    286   7e-92    Oryza sativa Japonica Group [Japonica rice]
gb|EAY82182.1|  hypothetical protein OsI_37384                          286   7e-92    Oryza sativa Indica Group [Indian rice]
gb|ADE76171.1|  unknown                                                 283   8e-92    Picea sitchensis
ref|XP_009799989.1|  PREDICTED: 60S acidic ribosomal protein P0-like    285   2e-91    Nicotiana sylvestris
ref|XP_004241171.1|  PREDICTED: 60S acidic ribosomal protein P0-like    285   2e-91    Solanum lycopersicum
ref|XP_010685586.1|  PREDICTED: 60S acidic ribosomal protein P0         285   2e-91    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009592351.1|  PREDICTED: 60S acidic ribosomal protein P0-like    284   3e-91    Nicotiana tomentosiformis
gb|KDP46515.1|  hypothetical protein JCGZ_08487                         283   5e-91    Jatropha curcas
ref|XP_008779152.1|  PREDICTED: 60S acidic ribosomal protein P0-like    279   1e-90    Phoenix dactylifera
gb|EMT17099.1|  60S acidic ribosomal protein P0                         281   2e-90    
dbj|BAJ92405.1|  predicted protein                                      281   2e-90    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002983859.1|  hypothetical protein SELMODRAFT_268802             281   5e-90    Selaginella moellendorffii
emb|CBX25428.1|  hypothetical_protein                                   281   6e-90    Oryza glaberrima
ref|XP_002960810.1|  hypothetical protein SELMODRAFT_437282             281   7e-90    Selaginella moellendorffii
dbj|BAJ94456.1|  predicted protein                                      280   8e-90    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002974292.1|  hypothetical protein SELMODRAFT_149765             280   9e-90    Selaginella moellendorffii
emb|CDY67524.1|  BnaAnng24540D                                          276   1e-89    Brassica napus [oilseed rape]
ref|XP_006350830.1|  PREDICTED: 60S acidic ribosomal protein P0-like    280   1e-89    Solanum tuberosum [potatoes]
sp|P50345.1|RLA0_LUPLU  RecName: Full=60S acidic ribosomal protei...    277   1e-88    Lupinus luteus
gb|ADU04571.1|  60S acidic ribosomal protein PO                         274   3e-87    Phaseolus vulgaris [French bean]
gb|EYU22330.1|  hypothetical protein MIMGU_mgv1a019166mg                269   1e-86    Erythranthe guttata [common monkey flower]
ref|XP_004296403.1|  PREDICTED: 60S acidic ribosomal protein P0-like    271   3e-86    Fragaria vesca subsp. vesca
ref|XP_008351783.1|  PREDICTED: uncharacterized protein LOC103415220    282   1e-85    
emb|CBI15980.3|  unnamed protein product                                265   5e-85    Vitis vinifera
ref|XP_002279500.1|  PREDICTED: 60S acidic ribosomal protein P0-2...    266   6e-85    Vitis vinifera
ref|XP_002960261.1|  hypothetical protein SELMODRAFT_229877             263   5e-83    Selaginella moellendorffii
ref|XP_002967451.1|  hypothetical protein SELMODRAFT_87354              263   7e-83    Selaginella moellendorffii
gb|EEC82854.1|  hypothetical protein OsI_27702                          258   1e-82    Oryza sativa Indica Group [Indian rice]
gb|EAZ41410.1|  hypothetical protein OsJ_25932                          258   4e-82    Oryza sativa Japonica Group [Japonica rice]
emb|CAN65663.1|  hypothetical protein VITISV_014917                     262   6e-82    Vitis vinifera
ref|XP_006407705.1|  hypothetical protein EUTSA_v10021147mg             250   3e-78    
ref|XP_005850392.1|  hypothetical protein CHLNCDRAFT_59607              246   3e-76    Chlorella variabilis
sp|P29764.1|RLA0_OXYRB  RecName: Full=60S acidic ribosomal protei...    242   9e-75    Oxybasis rubra [pigweed]
gb|KDD72928.1|  hypothetical protein H632_c2720p0                       236   4e-73    Helicosporidium sp. ATCC 50920
ref|XP_001697060.1|  acidic ribosomal protein P0                        231   2e-70    Chlamydomonas reinhardtii
ref|XP_005650079.1|  hypothetical protein COCSUDRAFT_52908              229   6e-70    Coccomyxa subellipsoidea C-169
ref|XP_011402179.1|  60S acidic ribosomal protein P0-2                  223   3e-68    Auxenochlorella protothecoides
ref|XP_002958097.1|  hypothetical protein VOLCADRAFT_84328              224   8e-68    Volvox carteri f. nagariensis
gb|AIN39821.1|  hypothetical protein                                    222   9e-68    Zoysia matrella [Japanese carpet grass]
gb|KIZ02211.1|  60S acidic ribosomal protein P0                         222   4e-67    Monoraphidium neglectum
gb|ABO31368.1|  60S ribosomal protein                                   218   9e-67    Gossypium hirsutum [American cotton]
emb|CBV76074.1|  60S acidic ribosomal protein P0                        219   3e-66    Polytomella sp. Pringsheim 198.80
gb|KCW65655.1|  hypothetical protein EUGRSUZ_G03042                     215   4e-65    Eucalyptus grandis [rose gum]
gb|AJQ18907.1|  acidic ribosomal protein P0                             213   1e-63    Amblyomma cajennense
ref|XP_003743791.1|  PREDICTED: 60S acidic ribosomal protein P0-like    209   3e-62    Galendromus occidentalis
gb|ABB29594.1|  ribosomal protein P0 large subunit                      208   3e-62    Platynereis dumerilii
gb|AAY66850.1|  60S acidic ribosomal protein P0                         209   5e-62    Ixodes scapularis [blacklegged tick]
ref|XP_002399611.1|  60S acidic ribosomal protein P0, putative          209   7e-62    Ixodes scapularis [blacklegged tick]
sp|Q9DG68.1|RLA0_RANSY  RecName: Full=60S acidic ribosomal protei...    208   7e-62    Rana sylvatica
gb|AGQ49465.1|  acidic ribosomal protein P0                             208   8e-62    Rhipicephalus microplus [cattle tick]
ref|NP_001080134.1|  ribosomal protein, large, P0                       208   8e-62    Xenopus laevis [clawed frog]
gb|ABW16870.1|  ribosomal protein P0                                    208   9e-62    Haemaphysalis longicornis
gb|ADV40160.1|  60S acidic ribosomal protein P0                         207   9e-62    Latrodectus hesperus [black widow]
gb|AGX29497.1|  60S acidic ribosomal protein P0                         205   9e-62    Calliphora vicina
ref|NP_989067.1|  ribosomal protein, large, P0                          207   1e-61    Xenopus tropicalis [western clawed frog]
gb|ELT92567.1|  hypothetical protein CAPTEDRAFT_167366                  207   4e-61    Capitella teleta
gb|AJQ18906.1|  acidic ribosomal protein P0                             206   4e-61    Rhipicephalus sanguineus
gb|AJQ18908.1|  acidic ribosomal protein P0                             206   6e-61    Dermacentor nitens
ref|XP_011146226.1|  PREDICTED: 60S acidic ribosomal protein P0-like    206   7e-61    Harpegnathos saltator
gb|ABM55512.1|  putative ribosomal protein P0                           206   8e-61    Maconellicoccus hirsutus [pink hibiscus mealybug]
gb|ABF69531.1|  acidic ribosomal protein P0                             205   1e-60    Strongyloides ratti
ref|XP_011157010.1|  PREDICTED: 60S acidic ribosomal protein P0         205   2e-60    Solenopsis invicta [imported red fire ant]
ref|XP_623106.1|  PREDICTED: 60S acidic ribosomal protein P0 isof...    205   2e-60    Apis mellifera [bee]
ref|XP_006612127.1|  PREDICTED: 60S acidic ribosomal protein P0-like    205   2e-60    Apis dorsata [rock honeybee]
gb|ADD21620.1|  ribosomal protein P0                                    202   4e-60    Hanleya nagelfar
gb|AEL28833.1|  ribosomal protein P0                                    204   5e-60    Heliconius melpomene cythera
ref|XP_011266937.1|  PREDICTED: 60S acidic ribosomal protein P0         204   5e-60    Camponotus floridanus
gb|AAU84931.1|  putative acidic p0 ribosomal protein                    203   5e-60    Aphis citricidus
ref|XP_003398378.1|  PREDICTED: 60S acidic ribosomal protein P0-l...    203   6e-60    Bombus terrestris [large earth bumblebee]
gb|KDR14762.1|  60S acidic ribosomal protein P0                         203   6e-60    Zootermopsis nevadensis
ref|XP_003488353.1|  PREDICTED: 60S acidic ribosomal protein P0-like    203   6e-60    Bombus impatiens
ref|XP_002425010.1|  ribosomal P0 protein, putative                     204   6e-60    Pediculus humanus corporis [human body lice]
gb|AIW62441.1|  60S acidic ribosomal protein                            203   7e-60    Scytodes thoracica
gb|ABV60317.1|  60S acidic ribosomal protein P0-like protein            203   8e-60    Lutzomyia longipalpis
gb|AFM87759.1|  ribosomal protein, large, P0                            203   1e-59    Callorhinchus milii [Australian ghost shark]
ref|XP_001985147.1|  GH14667                                            203   1e-59    Drosophila grimshawi
ref|XP_005107960.1|  PREDICTED: 60S acidic ribosomal protein P0-l...    202   1e-59    Aplysia californica
ref|NP_001119687.1|  ribosomal protein LP0                              202   1e-59    Acyrthosiphon pisum
ref|XP_001958489.1|  GF10946                                            202   1e-59    Drosophila ananassae
dbj|BAN20115.1|  ribosomal protein LP0                                  202   2e-59    Riptortus pedestris
dbj|BAH70543.1|  ACYPI000079                                            202   2e-59    Acyrthosiphon pisum
ref|XP_001422456.1|  Cytosolic 80S ribosomal protein P0; Cytosoli...    202   2e-59    Ostreococcus lucimarinus CCE9901
emb|CDW52119.1|  60S acidic ribosomal protein P0                        202   3e-59    Trichuris trichiura
ref|XP_313349.1|  AGAP003592-PA                                         201   3e-59    Anopheles gambiae str. PEST
gb|AFM87695.1|  ribosomal protein, large, P0                            200   3e-59    Callorhinchus milii [Australian ghost shark]
gb|AAL62465.1|  60S acidic ribosomal protein P0                         201   3e-59    Spodoptera frugiperda
ref|XP_011146290.1|  PREDICTED: 60S acidic ribosomal protein P0-like    201   3e-59    Harpegnathos saltator
gb|AAF31449.1|AF220939_1  60S acidic ribosomal protein P0               201   4e-59    Sarcophaga crassipalpis
emb|CAD29995.1|  ribosomal P0 protein                                   201   4e-59    Bombyx mori [silk moth]
ref|NP_001037123.1|  ribosomal protein P0                               201   4e-59    Bombyx mori [silk moth]
dbj|BAM18929.1|  ribosomal protein LP0                                  201   4e-59    Papilio polytes
gb|KFD51108.1|  hypothetical protein M513_08008                         201   4e-59    Trichuris suis
ref|XP_001352888.1|  GA20389                                            201   5e-59    Drosophila pseudoobscura pseudoobscura
ref|XP_002068394.1|  GK20443                                            201   6e-59    
ref|XP_008544624.1|  PREDICTED: 60S acidic ribosomal protein P0         201   7e-59    Microplitis demolitor
ref|XP_011415179.1|  PREDICTED: 60S acidic ribosomal protein P0-like    200   8e-59    Crassostrea gigas
gb|AFM88893.1|  ribosomal protein, large, P0                            200   8e-59    Callorhinchus milii [Australian ghost shark]
gb|EHJ75936.1|  ribosomal protein P0                                    200   9e-59    
ref|XP_005187209.1|  PREDICTED: 60S acidic ribosomal protein P0         200   1e-58    Musca domestica
ref|XP_001973718.1|  GG16244                                            200   1e-58    Drosophila erecta
gb|AFM89472.1|  ribosomal protein, large, P0                            200   1e-58    Callorhinchus milii [Australian ghost shark]
ref|NP_524211.1|  ribosomal protein LP0, isoform A                      200   1e-58    Drosophila melanogaster
gb|AFM89484.1|  ribosomal protein, large, P0                            200   1e-58    Callorhinchus milii [Australian ghost shark]
gb|KHN76000.1|  60S acidic ribosomal protein P0                         200   1e-58    Toxocara canis
ref|XP_002040897.1|  GM22429                                            200   1e-58    Drosophila sechellia
gb|AEE61707.1|  unknown                                                 200   1e-58    Dendroctonus ponderosae
gb|AFM89459.1|  ribosomal protein, large, P0                            200   1e-58    Callorhinchus milii [Australian ghost shark]
gb|AFM89518.1|  ribosomal protein, large, P0                            200   1e-58    Callorhinchus milii [Australian ghost shark]
gb|AFM86819.1|  ribosomal protein, large, P0                            200   1e-58    Callorhinchus milii [Australian ghost shark]
gb|AFM86446.1|  ribosomal protein, large, P0                            200   1e-58    Callorhinchus milii [Australian ghost shark]
gb|AFM85775.1|  ribosomal protein, large, P0                            200   1e-58    Callorhinchus milii [Australian ghost shark]
gb|AFM85484.1|  ribosomal protein, large, P0                            200   1e-58    Callorhinchus milii [Australian ghost shark]
gb|AFM87161.1|  ribosomal protein, large, P0                            200   1e-58    Callorhinchus milii [Australian ghost shark]
gb|AFM86948.1|  ribosomal protein, large, P0                            200   1e-58    Callorhinchus milii [Australian ghost shark]
ref|XP_002095795.1|  RpLP0                                              200   1e-58    Drosophila yakuba
ref|XP_011347099.1|  PREDICTED: 60S acidic ribosomal protein P0         200   2e-58    Ooceraea biroi
ref|XP_011297993.1|  PREDICTED: 60S acidic ribosomal protein P0         200   2e-58    Fopius arisanus
ref|NP_001279963.1|  ribosomal protein, large, P0                       199   2e-58    Callorhinchus milii [Australian ghost shark]
emb|CAS05791.1|  60S acidic ribosomal protein P0                        196   2e-58    Blaptica dubia
ref|XP_011496436.1|  PREDICTED: 60S acidic ribosomal protein P0         199   2e-58    Ceratosolen solmsi marchali
gb|AFM85937.1|  ribosomal protein, large, P0                            199   2e-58    Callorhinchus milii [Australian ghost shark]
gb|AFM90832.1|  ribosomal protein, large, P0                            199   2e-58    Callorhinchus milii [Australian ghost shark]
emb|CAX76656.1|  deoxyribonuclease                                      199   2e-58    
gb|AAI51696.1|  RPLP0 protein                                           199   2e-58    
gb|AFM87081.1|  ribosomal protein, large, P0                            199   2e-58    
ref|XP_007513516.1|  60S acidic ribosomal protein P0                    199   3e-58    
ref|XP_011208099.1|  PREDICTED: 60S acidic ribosomal protein P0         199   3e-58    
ref|XP_004522331.1|  PREDICTED: 60S acidic ribosomal protein P0-like    199   3e-58    
ref|XP_011196704.1|  PREDICTED: 60S acidic ribosomal protein P0         199   3e-58    
gb|AAP06198.1|  similar to GenBank Accession Number AY072284 60S ...    198   4e-58    
emb|CBM69268.1|  venom protein Ci-40b                                   199   4e-58    
dbj|BAH70537.1|  ACYPI000079                                            199   4e-58    
dbj|BAM17678.1|  ribosomal protein LP0                                  199   4e-58    
gb|AFM86828.1|  ribosomal protein, large, P0                            199   4e-58    
ref|XP_011064775.1|  PREDICTED: 60S acidic ribosomal protein P0         199   4e-58    
gb|ACQ57902.1|  60S acidic ribosomal protein P0                         199   4e-58    
emb|CAX76652.1|  deoxyribonuclease                                      199   5e-58    
gb|AFM87342.1|  ribosomal protein, large, P0                            198   5e-58    
gb|AFM85590.1|  ribosomal protein, large, P0                            198   5e-58    
gb|AFM86675.1|  ribosomal protein, large, P0                            198   6e-58    
gb|AFM86570.1|  ribosomal protein, large, P0                            198   6e-58    
gb|AFM86580.1|  ribosomal protein, large, P0                            198   6e-58    
ref|XP_005987234.1|  PREDICTED: 60S acidic ribosomal protein P0         198   6e-58    
gb|EJW87043.1|  60S acidic ribosomal protein P0                         197   6e-58    
gb|AFD93389.1|  ribosomal protein P0                                    197   7e-58    
gb|AFM85706.1|  ribosomal protein, large, P0                            198   7e-58    
ref|NP_001187030.1|  60S acidic ribosomal protein P0                    198   8e-58    
ref|XP_002505583.1|  predicted protein                                  198   8e-58    
gb|ACY95307.1|  ribosomal protein P0                                    198   8e-58    
gb|AFM86528.1|  ribosomal protein, large, P0                            198   8e-58    
gb|AEE62116.1|  unknown                                                 198   8e-58    
emb|CAX71185.1|  deoxyribonuclease                                      198   9e-58    
gb|ETN64428.1|  60S acidic ribosomal protein P0                         197   1e-57    
ref|XP_001607606.1|  PREDICTED: 60S acidic ribosomal protein P0         197   1e-57    
gb|EPZ33240.1|  Ribosomal protein L10/acidic P0 domain-containing...    197   1e-57    
emb|CAZ28666.1|  60S acidic ribosomal protein P0, putative              197   1e-57    
ref|XP_001851128.1|  60S acidic ribosomal protein P0                    197   1e-57    
ref|XP_010740439.1|  PREDICTED: 60S acidic ribosomal protein P0 i...    196   1e-57    
ref|XP_002674994.1|  predicted protein                                  198   1e-57    
ref|XP_003706895.1|  PREDICTED: 60S acidic ribosomal protein P0-like    197   1e-57    
ref|XP_002154455.2|  PREDICTED: 60S acidic ribosomal protein P0-like    197   1e-57    
emb|CEG01946.1|  Ribosomal protein L10/acidic P0                        197   2e-57    
gb|AFK10546.1|  ribosomal protein, large, P0                            197   2e-57    
ref|XP_975936.1|  PREDICTED: 60S acidic ribosomal protein P0            197   2e-57    
ref|XP_003082807.1|  RLA0_MAIZE 60S acidic ribosomal protein P0 p...    197   2e-57    
gb|ADT80652.1|  ribosomal protein P0                                    197   2e-57    
gb|AFM86966.1|  ribosomal protein, large, P0                            197   2e-57    
ref|XP_006640161.1|  PREDICTED: 60S acidic ribosomal protein P0-like    197   2e-57    
ref|XP_001897742.1|  60S acidic ribosomal protein P0                    197   2e-57    
emb|CAH04311.1|  acidic p0 ribosomal protein                            197   2e-57    
gb|KFH71275.1|  large subunit ribosomal protein LP0                     196   2e-57    
gb|AFM86008.1|  ribosomal protein, large, P0                            196   3e-57    
gb|AFM88521.1|  ribosomal protein, large, P0                            196   3e-57    
gb|EYC13195.1|  hypothetical protein Y032_0044g1026                     196   3e-57    
emb|CAX76657.1|  deoxyribonuclease                                      195   3e-57    
gb|AFX73002.1|  deoxyribonuclease                                       196   3e-57    
emb|CAH04310.1|  acidic p0 ribosomal protein                            196   4e-57    
gb|ADD21618.1|  ribosomal protein P0                                    196   4e-57    
ref|XP_010740438.1|  PREDICTED: 60S acidic ribosomal protein P0 i...    196   4e-57    
gb|AFD93397.1|  ribosomal protein P0                                    195   5e-57    
gb|ABG74704.1|  putative acidic p0 ribosomal protein                    192   6e-57    
gb|KFB37344.1|  hypothetical protein ZHAS_00004637                      204   7e-57    
gb|AFD93398.1|  ribosomal protein P0                                    195   7e-57    
gb|ABF69517.1|  acidic ribosomal protein P0                             193   7e-57    
emb|CAX71184.1|  deoxyribonuclease                                      195   9e-57    
ref|XP_002008961.1|  GI13777                                            195   1e-56    
gb|KHJ98883.1|  ribosomal protein L10                                   199   1e-56    
ref|XP_001655016.1|  AAEL010821-PA                                      194   2e-56    
ref|XP_004996745.1|  arbp-prov protein                                  194   2e-56    
ref|XP_006784596.1|  PREDICTED: 60S acidic ribosomal protein P0-like    194   2e-56    
ref|XP_002047707.1|  GJ13582                                            194   2e-56    
ref|XP_002639809.1|  C. briggsae CBR-RPA-0 protein                      194   2e-56    
gb|ABZ04250.1|  ribosomal protein rplp0                                 194   2e-56    
emb|CBN08637.1|  ribosomal protein, large, P0                           194   3e-56    
ref|XP_003135972.1|  60S acidic ribosomal protein P0                    194   3e-56    
ref|XP_008318611.1|  PREDICTED: 60S acidic ribosomal protein P0         194   3e-56    
gb|ABU63975.1|  ribosomal protein large P0-like protein                 194   3e-56    
ref|XP_008292997.1|  PREDICTED: 60S acidic ribosomal protein P0         193   4e-56    
ref|XP_009440587.1|  PREDICTED: 60S acidic ribosomal protein P0-like    193   4e-56    
ref|XP_010879645.1|  PREDICTED: 60S acidic ribosomal protein P0         193   5e-56    
ref|NP_492766.1|  Protein RLA-0                                         193   5e-56    
emb|CAX71186.1|  deoxyribonuclease                                      193   5e-56    
gb|EGT39704.1|  hypothetical protein CAEBREN_29720                      193   5e-56    
ref|XP_007434308.1|  PREDICTED: 60S acidic ribosomal protein P0-l...    193   6e-56    
dbj|BAF98695.1|  ribosomal protein LP0                                  193   6e-56    
gb|AAT44430.1|  ribosomal protein large P0-like protein                 193   6e-56    
ref|XP_003384811.1|  PREDICTED: 60S acidic ribosomal protein P0-like    193   6e-56    
ref|XP_003112032.1|  CRE-RPA-0 protein                                  192   7e-56    
ref|XP_001626294.1|  predicted protein                                  192   8e-56    
emb|CAQ63458.1|  ribosomal protein                                      192   9e-56    
emb|CCA22079.1|  60S acidic ribosomal protein P0 putative               192   9e-56    
ref|XP_009513921.1|  hypothetical protein PHYSODRAFT_353332             192   9e-56    
ref|XP_002597893.1|  hypothetical protein BRAFLDRAFT_97880              192   9e-56    
gb|ACH70801.1|  acidic ribosomal protein P0                             192   9e-56    
gb|KFZ54738.1|  60S acidic ribosomal protein P0                         191   1e-55    
gb|KFO65132.1|  60S acidic ribosomal protein P0                         191   1e-55    
ref|XP_008639852.1|  PREDICTED: 60S acidic ribosomal protein P0         191   1e-55    
gb|ETN75251.1|  ribosomal protein L10                                   197   1e-55    
ref|XP_006676559.1|  hypothetical protein BATDEDRAFT_15859              192   1e-55    
gb|KFQ10333.1|  60S acidic ribosomal protein P0                         191   1e-55    
gb|ADD21619.1|  ribosomal protein P0                                    191   1e-55    
ref|XP_010396743.1|  PREDICTED: 60S acidic ribosomal protein P0         191   2e-55    
gb|AHB33743.1|  60S acidic ribosomal protein P0                         192   2e-55    
gb|AAM97779.1|  ribosomal protein P0                                    192   2e-55    
ref|XP_008151673.1|  PREDICTED: LOW QUALITY PROTEIN: 60S acidic r...    192   2e-55    
emb|CDQ67134.1|  unnamed protein product                                192   2e-55    
gb|ACI68961.1|  60S acidic ribosomal protein P0                         192   2e-55    
gb|KFQ53080.1|  60S acidic ribosomal protein P0                         190   2e-55    
ref|XP_008501040.1|  PREDICTED: 60S acidic ribosomal protein P0         192   2e-55    
gb|AHW80376.1|  ribosomol protein P0L10e                                191   2e-55    
ref|XP_005421617.1|  PREDICTED: 60S acidic ribosomal protein P0         191   2e-55    
gb|ACO14779.1|  60S acidic ribosomal protein P0                         191   3e-55    
emb|CDQ63253.1|  unnamed protein product                                191   3e-55    
gb|EFX74249.1|  hypothetical protein DAPPUDRAFT_307348                  191   3e-55    
ref|XP_002896775.1|  60S acidic ribosomal protein P0                    191   3e-55    
emb|CBN80296.1|  conserved unknown protein                              190   4e-55    
ref|XP_008904900.1|  hypothetical protein PPTG_11356                    191   4e-55    
ref|XP_005054917.1|  PREDICTED: 60S acidic ribosomal protein P0         191   4e-55    
dbj|BAC10912.1|  putative 60S acidic ribosomal protein P0               187   4e-55    
gb|AEA51110.1|  60S acidic ribosomal protein P0                         190   5e-55    
ref|XP_008924020.1|  PREDICTED: 60S acidic ribosomal protein P0         191   5e-55    
gb|ADF97607.1|  large ribosomal protein P0                              191   6e-55    
ref|XP_002199561.1|  PREDICTED: 60S acidic ribosomal protein P0         191   6e-55    
ref|XP_005524479.1|  PREDICTED: 60S acidic ribosomal protein P0         191   6e-55    
ref|XP_005493516.1|  PREDICTED: 60S acidic ribosomal protein P0         191   6e-55    
ref|XP_010080334.1|  PREDICTED: 60S acidic ribosomal protein P0         189   6e-55    
ref|XP_010572856.1|  PREDICTED: 60S acidic ribosomal protein P0         191   6e-55    
ref|XP_003211127.2|  PREDICTED: 60S acidic ribosomal protein P0         190   7e-55    
ref|XP_009948467.1|  PREDICTED: LOW QUALITY PROTEIN: 60S acidic r...    190   9e-55    
ref|NP_571655.2|  60S acidic ribosomal protein P0                       190   9e-55    
ref|XP_010016668.1|  PREDICTED: LOW QUALITY PROTEIN: 60S acidic r...    190   9e-55    
gb|ESA18298.1|  hypothetical protein GLOINDRAFT_344659                  190   9e-55    
ref|XP_004545259.1|  PREDICTED: 60S acidic ribosomal protein P0-like    190   1e-54    
ref|XP_005918671.1|  PREDICTED: 60S acidic ribosomal protein P0-like    190   1e-54    
ref|XP_005445335.1|  PREDICTED: LOW QUALITY PROTEIN: 60S acidic r...    190   1e-54    
ref|XP_003441603.1|  PREDICTED: 60S acidic ribosomal protein P0         190   1e-54    
ref|XP_006129131.1|  PREDICTED: 60S acidic ribosomal protein P0         189   2e-54    
ref|XP_003226041.1|  PREDICTED: 60S acidic ribosomal protein P0         189   2e-54    
gb|AAS49564.1|  ribosomal protein Large P0                              187   2e-54    
ref|XP_007393561.1|  hypothetical protein PHACADRAFT_171498             189   2e-54    
emb|CAA33199.1|  unnamed protein product                                189   2e-54    
gb|EHB17679.1|  60S acidic ribosomal protein P0                         190   2e-54    
ref|XP_008468123.1|  PREDICTED: 60S acidic ribosomal protein P0         189   2e-54    
ref|XP_008865510.1|  hypothetical protein H310_03433                    189   2e-54    
ref|XP_003973625.1|  PREDICTED: 60S acidic ribosomal protein P0-like    189   2e-54    
ref|XP_009045933.1|  hypothetical protein LOTGIDRAFT_237709             189   2e-54    
ref|XP_010133581.1|  PREDICTED: 60S acidic ribosomal protein P0         188   3e-54    
ref|XP_003380825.1|  60S acidic ribosomal protein P0                    189   3e-54    
ref|XP_006895246.1|  PREDICTED: 60S acidic ribosomal protein P0-like    187   3e-54    
ref|XP_009685789.1|  PREDICTED: LOW QUALITY PROTEIN: 60S acidic r...    189   3e-54    
ref|XP_004591942.1|  PREDICTED: 60S acidic ribosomal protein P0 i...    189   3e-54    
emb|CCI41647.1|  unnamed protein product                                194   3e-54    
ref|XP_006890483.1|  PREDICTED: 60S acidic ribosomal protein P0         189   3e-54    
ref|XP_001363537.1|  PREDICTED: 60S acidic ribosomal protein P0         188   4e-54    
ref|XP_006019892.1|  PREDICTED: 60S acidic ribosomal protein P0         188   4e-54    
ref|XP_008407632.1|  PREDICTED: 60S acidic ribosomal protein P0         188   4e-54    
ref|XP_007554302.1|  PREDICTED: 60S acidic ribosomal protein P0         188   4e-54    
gb|AAH49058.1|  Rplp0 protein                                           188   4e-54    
gb|AHK09711.1|  60S acidic ribosomal protein P0                         188   4e-54    
ref|XP_010306195.1|  PREDICTED: 60S acidic ribosomal protein P0         187   4e-54    
gb|EHH21238.1|  hypothetical protein EGK_04254                          187   5e-54    
ref|XP_004888210.1|  PREDICTED: 60S acidic ribosomal protein P0         188   5e-54    
ref|NP_990318.1|  60S acidic ribosomal protein P0                       188   6e-54    
ref|XP_009886897.1|  PREDICTED: LOW QUALITY PROTEIN: 60S acidic r...    188   6e-54    
dbj|BAG65447.1|  unnamed protein product                                186   6e-54    
ref|XP_010602365.1|  PREDICTED: 60S acidic ribosomal protein P0         187   7e-54    
gb|AHK09710.1|  60S acidic ribosomal protein P0                         186   7e-54    
ref|XP_004636304.1|  PREDICTED: 60S acidic ribosomal protein P0         187   7e-54    
ref|XP_010967878.1|  PREDICTED: 60S acidic ribosomal protein P0         187   7e-54    
ref|XP_004429976.1|  PREDICTED: 60S acidic ribosomal protein P0 i...    187   8e-54    
ref|NP_001239066.1|  ribosomal protein, large, P0                       187   8e-54    
ref|XP_005288756.1|  PREDICTED: 60S acidic ribosomal protein P0         187   8e-54    
ref|XP_003478429.1|  PREDICTED: 60S acidic ribosomal protein P0         187   8e-54    
ref|XP_010996948.1|  PREDICTED: 60S acidic ribosomal protein P0         187   8e-54    
ref|XP_008838692.1|  PREDICTED: 60S acidic ribosomal protein P0         187   8e-54    
ref|XP_009246581.1|  PREDICTED: 60S acidic ribosomal protein P0 i...    187   9e-54    
ref|XP_005876332.1|  PREDICTED: 60S acidic ribosomal protein P0-like    187   9e-54    
gb|KGG51355.1|  ArbP-ProV-like protein                                  187   9e-54    
ref|XP_006192755.1|  PREDICTED: 60S acidic ribosomal protein P0 i...    187   9e-54    
ref|NP_001092068.1|  60S acidic ribosomal protein P0                    187   9e-54    
gb|EJU04978.1|  hypothetical protein DACRYDRAFT_20548                   187   1e-53    
gb|AAS49563.1|  ribosomal protein Large P0                              185   1e-53    
ref|XP_005962035.1|  PREDICTED: 60S acidic ribosomal protein P0 i...    187   1e-53    
ref|XP_011473581.1|  PREDICTED: 60S acidic ribosomal protein P0         186   1e-53    
ref|XP_005709583.1|  PREDICTED: LOW QUALITY PROTEIN: ribosomal pr...    187   1e-53    
ref|XP_003789970.1|  PREDICTED: 60S acidic ribosomal protein P0 i...    187   1e-53    
ref|XP_006053033.1|  PREDICTED: 60S acidic ribosomal protein P0         187   1e-53    
dbj|BAD96188.1|  ribosomal protein P0 variant                           187   1e-53    
gb|KDO34134.1|  hypothetical protein SPRG_01404                         187   1e-53    
ref|XP_004017462.1|  PREDICTED: LOW QUALITY PROTEIN: 60S acidic r...    187   1e-53    
ref|NP_000993.1|  60S acidic ribosomal protein P0                       187   1e-53    
ref|XP_006204865.1|  PREDICTED: 60S acidic ribosomal protein P0         187   1e-53    
gb|AHW68491.1|  60S acidic ribosomal protein P0                         186   1e-53    
gb|ACO12290.1|  60S acidic ribosomal protein P0                         187   1e-53    
ref|XP_003763170.1|  PREDICTED: 60S acidic ribosomal protein P0-like    187   1e-53    
gb|AIS76467.1|  large ribosomal protein P0                              187   2e-53    
ref|XP_005798004.1|  PREDICTED: 60S acidic ribosomal protein P0-like    187   2e-53    
gb|AEA51182.1|  acidic ribosomal protein P0                             183   2e-53    
ref|XP_010366585.1|  PREDICTED: 60S acidic ribosomal protein P0         187   2e-53    
ref|XP_008141153.1|  PREDICTED: 60S acidic ribosomal protein P0         185   2e-53    
gb|AAI02075.1|  Ribosomal protein, large, P0                            187   2e-53    
ref|NP_001182357.1|  acidic ribosomal phosphoprotein PO                 187   2e-53    
ref|NP_001012700.1|  60S acidic ribosomal protein P0                    187   2e-53    
gb|AHW68488.1|  60S acidic ribosomal protein P0                         186   2e-53    
gb|AHW68489.1|  60S acidic ribosomal protein P0                         186   2e-53    
ref|XP_001115939.2|  PREDICTED: 60S acidic ribosomal protein P0-like    186   2e-53    
ref|XP_009039052.1|  hypothetical protein AURANDRAFT_60208              185   2e-53    
ref|XP_008612085.1|  50S ribosomal protein LP0                          186   2e-53    
ref|XP_007643381.1|  PREDICTED: 60S acidic ribosomal protein P0 i...    186   3e-53    
ref|XP_009823852.1|  hypothetical protein H257_02063                    186   3e-53    
ref|XP_005863834.1|  PREDICTED: 60S acidic ribosomal protein P0         186   3e-53    
ref|XP_003063696.1|  predicted protein                                  186   3e-53    
gb|ACO09070.1|  60S acidic ribosomal protein P0                         186   3e-53    
gb|AAH03833.1|  Ribosomal protein, large, P0                            186   3e-53    
ref|XP_005336874.1|  PREDICTED: 60S acidic ribosomal protein P0         186   4e-53    
gb|EHH66765.1|  hypothetical protein EGM_03817                          185   4e-53    
ref|XP_008582193.1|  PREDICTED: 60S acidic ribosomal protein P0         186   4e-53    
gb|KIM26245.1|  hypothetical protein M408DRAFT_194239                   184   4e-53    
ref|XP_003495963.1|  PREDICTED: 60S acidic ribosomal protein P0 i...    186   4e-53    
gb|EFB17077.1|  hypothetical protein PANDA_020357                       185   4e-53    
ref|XP_004664195.1|  PREDICTED: 60S acidic ribosomal protein P0         186   4e-53    
gb|AAH01127.1|  Ribosomal protein, large, P0                            186   5e-53    
ref|XP_005396575.1|  PREDICTED: 60S acidic ribosomal protein P0         186   5e-53    



>ref|NP_001238374.1| 60S acidic ribosomal protein P0 [Glycine max]
 sp|P50346.1|RLA0_SOYBN RecName: Full=60S acidic ribosomal protein P0 [Glycine max]
 gb|AAB63814.1| acidic ribosomal protein P0 [Glycine max]
Length=320

 Score =   325 bits (832),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 204/228 (89%), Positives = 211/228 (93%), Gaps = 1/228 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TKG LKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG
Sbjct  94   TKGDLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  153

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGL+VLSVYDNGSVFSPEVLDLTEDD
Sbjct  154  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLVVLSVYDNGSVFSPEVLDLTEDD  213

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L+ KFA GVSMVTSLSLAISYPTLAAAPHM +N YKNVL++AVETDYSFP ADKVKEYLK
Sbjct  214  LIGKFAAGVSMVTSLSLAISYPTLAAAPHMFVNAYKNVLAVAVETDYSFPEADKVKEYLK  273

Query  220  DPSKFavaaapvaaaaagsapaaaaaaeekkeepeeesEDEMGFSLFD  77
            DPSKF   AA  A AAA  APAAAA  EEKKEEP EES+D+MGFSLFD
Sbjct  274  DPSKF-AVAAVAAPAAASGAPAAAAKEEEKKEEPAEESDDDMGFSLFD  320



>ref|NP_001239676.1| uncharacterized protein LOC100777482 [Glycine max]
 gb|ACU20858.1| unknown [Glycine max]
 gb|KHN20859.1| 60S acidic ribosomal protein P0 [Glycine soja]
Length=319

 Score =   323 bits (829),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 203/228 (89%), Positives = 211/228 (93%), Gaps = 2/228 (1%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TKG LKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG
Sbjct  94   TKGDLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  153

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            TVEIITPVELI+KGDKVGSSEAALLAKLGIRPFSYGL+VLSVYDNGSVFSPEVLDLTEDD
Sbjct  154  TVEIITPVELIKKGDKVGSSEAALLAKLGIRPFSYGLVVLSVYDNGSVFSPEVLDLTEDD  213

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L+EKFA GVSMVTSLSLAISYPTLAAAPHM +N YKNVL++AVETDYSFP ADKVKEYLK
Sbjct  214  LIEKFAAGVSMVTSLSLAISYPTLAAAPHMFVNAYKNVLAVAVETDYSFPEADKVKEYLK  273

Query  220  DPSKFavaaapvaaaaagsapaaaaaaeekkeepeeesEDEMGFSLFD  77
            DPSKF  A A VAA AA S   AAA  EEKKEEP EES+D+MGFSLFD
Sbjct  274  DPSKF--AVAAVAAPAAESGAPAAAKEEEKKEEPAEESDDDMGFSLFD  319



>emb|CBI31491.3| unnamed protein product [Vitis vinifera]
Length=292

 Score =   322 bits (825),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 195/228 (86%), Positives = 205/228 (90%), Gaps = 1/228 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            T+G LKEVSEEVAKYKVGAPARVGLVAPIDV+VPPGNTGLDPSQTSFFQVLNIPTKINKG
Sbjct  66   TRGDLKEVSEEVAKYKVGAPARVGLVAPIDVIVPPGNTGLDPSQTSFFQVLNIPTKINKG  125

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGL+VLSVYDNGSVFSPEVLDLTE+D
Sbjct  126  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLVVLSVYDNGSVFSPEVLDLTEED  185

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L+EKFA GVSMVTSLSLAISYPTLAAAPHM +N YKNVLS+AV TDYSFP ADKVKE+LK
Sbjct  186  LMEKFAAGVSMVTSLSLAISYPTLAAAPHMFVNAYKNVLSVAVATDYSFPQADKVKEFLK  245

Query  220  DPSKFavaaapvaaaaagsapaaaaaaeekkeepeeesEDEMGFSLFD  77
            DPSKF   A    AAA     AA    EEKKEEP EES+D+MGFSLFD
Sbjct  246  DPSKF-AVAVAPVAAADAGGSAAPPKEEEKKEEPAEESDDDMGFSLFD  292



>ref|XP_004149240.1| PREDICTED: 60S acidic ribosomal protein P0-like [Cucumis sativus]
 gb|KGN50643.1| 60S acidic ribosomal protein PO [Cucumis sativus]
Length=320

 Score =   323 bits (828),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 201/228 (88%), Positives = 214/228 (94%), Gaps = 1/228 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TKG LKEVSEEVAKYKVGAPARVGLVAPIDV+VPPGNTGLDPSQTSFFQVLNIPTKINKG
Sbjct  94   TKGDLKEVSEEVAKYKVGAPARVGLVAPIDVIVPPGNTGLDPSQTSFFQVLNIPTKINKG  153

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            TVEIITPVELI+KGDKVGSSEAALLAKLGIRPFSYGL+VLSVYDNGSVFSP+VLDLTEDD
Sbjct  154  TVEIITPVELIKKGDKVGSSEAALLAKLGIRPFSYGLVVLSVYDNGSVFSPQVLDLTEDD  213

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            LLEKFALGVSMVTSLSLAISYPTLAAAPHMLIN YKN+L++AV TDYSFP A+KVKEYL 
Sbjct  214  LLEKFALGVSMVTSLSLAISYPTLAAAPHMLINAYKNLLAVAVATDYSFPQAEKVKEYLA  273

Query  220  DPSKFavaaapvaaaaagsapaaaaaaeekkeepeeesEDEMGFSLFD  77
            DPSKF   A  V++A +GSAP AAAA EEKKEEP EES+D+MGFSLFD
Sbjct  274  DPSKF-AVAVAVSSADSGSAPEAAAAVEEKKEEPAEESDDDMGFSLFD  320



>ref|XP_002276842.1| PREDICTED: 60S acidic ribosomal protein P0 [Vitis vinifera]
Length=320

 Score =   323 bits (827),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 195/228 (86%), Positives = 205/228 (90%), Gaps = 1/228 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            T+G LKEVSEEVAKYKVGAPARVGLVAPIDV+VPPGNTGLDPSQTSFFQVLNIPTKINKG
Sbjct  94   TRGDLKEVSEEVAKYKVGAPARVGLVAPIDVIVPPGNTGLDPSQTSFFQVLNIPTKINKG  153

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGL+VLSVYDNGSVFSPEVLDLTE+D
Sbjct  154  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLVVLSVYDNGSVFSPEVLDLTEED  213

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L+EKFA GVSMVTSLSLAISYPTLAAAPHM +N YKNVLS+AV TDYSFP ADKVKE+LK
Sbjct  214  LMEKFAAGVSMVTSLSLAISYPTLAAAPHMFVNAYKNVLSVAVATDYSFPQADKVKEFLK  273

Query  220  DPSKFavaaapvaaaaagsapaaaaaaeekkeepeeesEDEMGFSLFD  77
            DPSKF   A    AAA     AA    EEKKEEP EES+D+MGFSLFD
Sbjct  274  DPSKF-AVAVAPVAAADAGGSAAPPKEEEKKEEPAEESDDDMGFSLFD  320



>gb|KHG25462.1| 60S acidic ribosomal P0 [Gossypium arboreum]
Length=321

 Score =   323 bits (827),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 205/228 (90%), Positives = 215/228 (94%), Gaps = 0/228 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TKG LKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG
Sbjct  94   TKGDLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  153

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            TVEIITPVELI+KGDKVGSSEAALLAKLGIRPFSYGL+VLSVYDNGSVFSPEVLDLTEDD
Sbjct  154  TVEIITPVELIKKGDKVGSSEAALLAKLGIRPFSYGLVVLSVYDNGSVFSPEVLDLTEDD  213

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L+EKFA GVSMVT+LSLAISYPTLAAAPHM INGYKNVL++AV T+YSFP ADKVKEYL 
Sbjct  214  LIEKFASGVSMVTALSLAISYPTLAAAPHMFINGYKNVLAVAVATEYSFPQADKVKEYLA  273

Query  220  DPSKFavaaapvaaaaagsapaaaaaaeekkeepeeesEDEMGFSLFD  77
            DPSKFAVAAAPVA    G+APAAA A EEKK EPEEES+D+MGFSLFD
Sbjct  274  DPSKFAVAAAPVAGGGGGAAPAAAPAEEEKKPEPEEESDDDMGFSLFD  321



>gb|KHG08087.1| 60S acidic ribosomal P0 [Gossypium arboreum]
Length=321

 Score =   323 bits (827),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 200/228 (88%), Positives = 210/228 (92%), Gaps = 0/228 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TKG LKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG
Sbjct  94   TKGDLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  153

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            TVEIITPVELI+KGDKVGSSEAALLAKLGIRPFSYGL+VLSVYDNGSVFSPEVLDLTE+D
Sbjct  154  TVEIITPVELIKKGDKVGSSEAALLAKLGIRPFSYGLVVLSVYDNGSVFSPEVLDLTEED  213

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L+EKFA GVSMVT+LSLAISYPTLAAAPHM IN YKNVLS+AV T+YSFP ADKVKEYL 
Sbjct  214  LIEKFATGVSMVTALSLAISYPTLAAAPHMFINAYKNVLSVAVATEYSFPQADKVKEYLA  273

Query  220  DPSKFavaaapvaaaaagsapaaaaaaeekkeepeeesEDEMGFSLFD  77
            DPSKFAVA A VA  A  +   A AAAEEKK EPEEES+D+MGFSLFD
Sbjct  274  DPSKFAVAVAAVATDAGAAQATATAAAEEKKPEPEEESDDDMGFSLFD  321



>emb|CBI25508.3| unnamed protein product [Vitis vinifera]
Length=292

 Score =   321 bits (823),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 194/228 (85%), Positives = 207/228 (91%), Gaps = 1/228 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TKG LKEVSEEVAKYKVGAPARVGLVAPIDV+VPPGNTGLDPSQTSFFQVLNIPTKINKG
Sbjct  66   TKGDLKEVSEEVAKYKVGAPARVGLVAPIDVIVPPGNTGLDPSQTSFFQVLNIPTKINKG  125

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            TVEIITPVELI+KGDKVGSSEAALLAKLGIRPFSYGL+VLSVYDNGSVFSPEVLDLTE+D
Sbjct  126  TVEIITPVELIKKGDKVGSSEAALLAKLGIRPFSYGLVVLSVYDNGSVFSPEVLDLTEED  185

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L+EKFA GVSMVTSLSLAISYPTLAAAPHM IN YKNVL++AV T+YSFP ADKVKEYLK
Sbjct  186  LIEKFAAGVSMVTSLSLAISYPTLAAAPHMFINAYKNVLAVAVATEYSFPQADKVKEYLK  245

Query  220  DPSKFavaaapvaaaaagsapaaaaaaeekkeepeeesEDEMGFSLFD  77
            DPSKF   A     A+   A  AA+  EEKKEEP+EES+D+MGFSLFD
Sbjct  246  DPSKF-AVATAPVTASDAGAAPAASKEEEKKEEPQEESDDDMGFSLFD  292



>ref|XP_002268645.1| PREDICTED: 60S acidic ribosomal protein P0 [Vitis vinifera]
Length=320

 Score =   322 bits (825),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 194/228 (85%), Positives = 207/228 (91%), Gaps = 1/228 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TKG LKEVSEEVAKYKVGAPARVGLVAPIDV+VPPGNTGLDPSQTSFFQVLNIPTKINKG
Sbjct  94   TKGDLKEVSEEVAKYKVGAPARVGLVAPIDVIVPPGNTGLDPSQTSFFQVLNIPTKINKG  153

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            TVEIITPVELI+KGDKVGSSEAALLAKLGIRPFSYGL+VLSVYDNGSVFSPEVLDLTE+D
Sbjct  154  TVEIITPVELIKKGDKVGSSEAALLAKLGIRPFSYGLVVLSVYDNGSVFSPEVLDLTEED  213

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L+EKFA GVSMVTSLSLAISYPTLAAAPHM IN YKNVL++AV T+YSFP ADKVKEYLK
Sbjct  214  LIEKFAAGVSMVTSLSLAISYPTLAAAPHMFINAYKNVLAVAVATEYSFPQADKVKEYLK  273

Query  220  DPSKFavaaapvaaaaagsapaaaaaaeekkeepeeesEDEMGFSLFD  77
            DPSKF   A     A+   A  AA+  EEKKEEP+EES+D+MGFSLFD
Sbjct  274  DPSKF-AVATAPVTASDAGAAPAASKEEEKKEEPQEESDDDMGFSLFD  320



>ref|XP_004165071.1| PREDICTED: 60S acidic ribosomal protein P0-like [Cucumis sativus]
Length=320

 Score =   322 bits (824),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 201/228 (88%), Positives = 213/228 (93%), Gaps = 1/228 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TKG LKEVSEEVAKYKVGAPARVGLVAPIDV+VPPGNTGLDPSQTSFFQVLNIPTKINKG
Sbjct  94   TKGDLKEVSEEVAKYKVGAPARVGLVAPIDVIVPPGNTGLDPSQTSFFQVLNIPTKINKG  153

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            TVEIITPVELI+KGDKVGSSEAALLAKLGIRPFSYGL+VLSVYDNGSVFSP+VLDLTEDD
Sbjct  154  TVEIITPVELIKKGDKVGSSEAALLAKLGIRPFSYGLVVLSVYDNGSVFSPQVLDLTEDD  213

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            LLEKFALGVSMVTSLSLAISYPTLAAAPHMLIN YKN+L++AV TDYSFP A+KVKEYL 
Sbjct  214  LLEKFALGVSMVTSLSLAISYPTLAAAPHMLINAYKNLLAVAVATDYSFPQAEKVKEYLA  273

Query  220  DPSKFavaaapvaaaaagsapaaaaaaeekkeepeeesEDEMGFSLFD  77
            DPSKF   A  V+AA +GSAP AAA  EEKKEEP EES+D+MGFSLFD
Sbjct  274  DPSKF-AVAVAVSAADSGSAPEAAADVEEKKEEPAEESDDDMGFSLFD  320



>ref|XP_004490967.1| PREDICTED: 60S acidic ribosomal protein P0-like [Cicer arietinum]
Length=321

 Score =   321 bits (823),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 199/228 (87%), Positives = 214/228 (94%), Gaps = 0/228 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TKG LKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG
Sbjct  94   TKGDLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  153

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            TVEIITPVELI+KGDKVGSSEAALLAKLGIRPFSYGL+VLSVYDNGSVF+PEVLDLTED 
Sbjct  154  TVEIITPVELIKKGDKVGSSEAALLAKLGIRPFSYGLVVLSVYDNGSVFTPEVLDLTEDA  213

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L+EKFA+GVSMVTSLSLAISYPTLAAAPHM +N YKNVL++AV T+YSFP ADKVKE+LK
Sbjct  214  LIEKFAIGVSMVTSLSLAISYPTLAAAPHMFVNAYKNVLAVAVATEYSFPEADKVKEFLK  273

Query  220  DPSKFavaaapvaaaaagsapaaaaaaeekkeepeeesEDEMGFSLFD  77
            DPSKFAVAA    AA +G+APAAAA  EEKK+EP EES+D+MGFSLFD
Sbjct  274  DPSKFAVAAVATPAADSGAAPAAAAKEEEKKDEPAEESDDDMGFSLFD  321



>ref|XP_004490966.1| PREDICTED: 60S acidic ribosomal protein P0-like [Cicer arietinum]
Length=321

 Score =   321 bits (823),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 199/228 (87%), Positives = 214/228 (94%), Gaps = 0/228 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TKG LKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG
Sbjct  94   TKGDLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  153

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            TVEIITPVELI+KGDKVGSSEAALLAKLGIRPFSYGL+VLSVYDNGSVF+PEVLDLTED 
Sbjct  154  TVEIITPVELIKKGDKVGSSEAALLAKLGIRPFSYGLVVLSVYDNGSVFTPEVLDLTEDA  213

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L+EKFA+GVSMVTSLSLAISYPTLAAAPHM +N YKNVL++AV T+YSFP ADKVKE+LK
Sbjct  214  LIEKFAIGVSMVTSLSLAISYPTLAAAPHMFVNAYKNVLAVAVATEYSFPEADKVKEFLK  273

Query  220  DPSKFavaaapvaaaaagsapaaaaaaeekkeepeeesEDEMGFSLFD  77
            DPSKFAVAA    AA +G+APAAAA  EEKK+EP EES+D+MGFSLFD
Sbjct  274  DPSKFAVAAVAAPAADSGAAPAAAAKEEEKKDEPAEESDDDMGFSLFD  321



>emb|CAN80537.1| hypothetical protein VITISV_003812 [Vitis vinifera]
Length=320

 Score =   321 bits (822),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 194/228 (85%), Positives = 205/228 (90%), Gaps = 1/228 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            T+G LKEVSEEVAKYKVGAPARVGLVAPIDV+VPPGNTGLDPSQTSFFQVLNIPTKINKG
Sbjct  94   TRGDLKEVSEEVAKYKVGAPARVGLVAPIDVIVPPGNTGLDPSQTSFFQVLNIPTKINKG  153

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGL+VLSVYDNGSVFSPEVLDLTE+D
Sbjct  154  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLVVLSVYDNGSVFSPEVLDLTEED  213

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L+EKFA GVSMVTSLSLAISYPTLAAAPHM +N YKNVLS+AV T+YSFP ADKVKE+LK
Sbjct  214  LMEKFAAGVSMVTSLSLAISYPTLAAAPHMFVNAYKNVLSVAVATEYSFPQADKVKEFLK  273

Query  220  DPSKFavaaapvaaaaagsapaaaaaaeekkeepeeesEDEMGFSLFD  77
            DPSKF   A    AAA     AA    EEKKEEP EES+D+MGFSLFD
Sbjct  274  DPSKF-AVAVAPVAAADAGGSAAPPKEEEKKEEPAEESDDDMGFSLFD  320



>gb|KJB78787.1| hypothetical protein B456_013G019000 [Gossypium raimondii]
Length=321

 Score =   321 bits (822),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 201/228 (88%), Positives = 212/228 (93%), Gaps = 0/228 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TKG LKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG
Sbjct  94   TKGDLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  153

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            TVEIITPVELI+KG+KVGSSEAALLAKLGIRPFSYGL+VLSVYDNGSVFSPEVLDLTE+D
Sbjct  154  TVEIITPVELIKKGEKVGSSEAALLAKLGIRPFSYGLVVLSVYDNGSVFSPEVLDLTEED  213

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L+EKFA GVSMVT+LSLAISYPTLAAAPHM IN YKNVLS+AV T+YSFP ADKVKEYL 
Sbjct  214  LIEKFATGVSMVTALSLAISYPTLAAAPHMFINAYKNVLSVAVATEYSFPQADKVKEYLA  273

Query  220  DPSKFavaaapvaaaaagsapaaaaaaeekkeepeeesEDEMGFSLFD  77
            DPSKFAVA A VA  A  +  AAAAAAEEKK EPEEES+D+MGFSLFD
Sbjct  274  DPSKFAVAVAAVATDAGAAPAAAAAAAEEKKPEPEEESDDDMGFSLFD  321



>ref|XP_010067511.1| PREDICTED: 60S acidic ribosomal protein P0 [Eucalyptus grandis]
 gb|KCW65656.1| hypothetical protein EUGRSUZ_G03042 [Eucalyptus grandis]
Length=320

 Score =   321 bits (822),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 200/228 (88%), Positives = 216/228 (95%), Gaps = 0/228 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TKG LKEVSEEVAKYKVGAPARVGLVAPIDV+VPPGNTGLDPSQTSFFQVLNIPTKINKG
Sbjct  93   TKGDLKEVSEEVAKYKVGAPARVGLVAPIDVIVPPGNTGLDPSQTSFFQVLNIPTKINKG  152

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            TVEIITPVELI+KGDKVGSSEAALLAKLGIRPFSYGL+V SVYDNGSVFSPEVLDLTEDD
Sbjct  153  TVEIITPVELIKKGDKVGSSEAALLAKLGIRPFSYGLVVQSVYDNGSVFSPEVLDLTEDD  212

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L+EKFALGVSMVT+LSLAISYPTLAAAPHM IN YKNVL++AVET+YS+P AD+VKE+LK
Sbjct  213  LMEKFALGVSMVTALSLAISYPTLAAAPHMFINAYKNVLAVAVETEYSYPHADEVKEFLK  272

Query  220  DPSKFavaaapvaaaaagsapaaaaaaeekkeepeeesEDEMGFSLFD  77
            DPSKFAVA AP  AA +G+APAAAA  EEKK+EP EES+D+MGFSLFD
Sbjct  273  DPSKFAVAVAPAGAADSGAAPAAAAKEEEKKDEPAEESDDDMGFSLFD  320



>gb|KJB74261.1| hypothetical protein B456_011G283700 [Gossypium raimondii]
Length=321

 Score =   321 bits (822),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 205/228 (90%), Positives = 217/228 (95%), Gaps = 0/228 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TKG LKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG
Sbjct  94   TKGDLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  153

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            TVEIITPVELI+KG+KVGSSEAALLAKLGIRPFSYGL+VLSVYDNGSVFSPEVLDLTEDD
Sbjct  154  TVEIITPVELIKKGEKVGSSEAALLAKLGIRPFSYGLVVLSVYDNGSVFSPEVLDLTEDD  213

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L+EKFA GVSMVT+LSLAISYPTLAAAPHM INGYKN+L++AV T+YSFP ADKVKEYL 
Sbjct  214  LIEKFATGVSMVTALSLAISYPTLAAAPHMFINGYKNILAVAVATEYSFPQADKVKEYLA  273

Query  220  DPSKFavaaapvaaaaagsapaaaaaaeekkeepeeesEDEMGFSLFD  77
            DPSKFAVAAAPVAAA  G+APAAA A EEKK EPEEES+D+MGFSLFD
Sbjct  274  DPSKFAVAAAPVAAAGGGAAPAAAPAEEEKKPEPEEESDDDMGFSLFD  321



>ref|XP_008463223.1| PREDICTED: 60S acidic ribosomal protein P0 [Cucumis melo]
Length=320

 Score =   320 bits (821),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 202/228 (89%), Positives = 214/228 (94%), Gaps = 1/228 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TKG LKEVSEEVAKYKVGAPARVGLVAPIDV+VPPGNTGLDPSQTSFFQVLNIPTKINKG
Sbjct  94   TKGDLKEVSEEVAKYKVGAPARVGLVAPIDVIVPPGNTGLDPSQTSFFQVLNIPTKINKG  153

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            TVEIITPVELI+KGDKVGSSEAALLAKLGIRPFSYGL+VLSVYDNGSVFSP+VLDLTEDD
Sbjct  154  TVEIITPVELIKKGDKVGSSEAALLAKLGIRPFSYGLVVLSVYDNGSVFSPQVLDLTEDD  213

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            LLEKFALGVSMVTSLSLAISYPTLAAAPHMLIN YKN+L++AV TDYSFP A+KVKEYL 
Sbjct  214  LLEKFALGVSMVTSLSLAISYPTLAAAPHMLINAYKNLLAVAVATDYSFPEAEKVKEYLA  273

Query  220  DPSKFavaaapvaaaaagsapaaaaaaeekkeepeeesEDEMGFSLFD  77
            DPSKF   A  V+AA +GSAP AAAA EEKKEEP EES+D+MGFSLFD
Sbjct  274  DPSKF-AVAVAVSAADSGSAPEAAAAVEEKKEEPAEESDDDMGFSLFD  320



>ref|XP_011076719.1| PREDICTED: 60S acidic ribosomal protein P0 [Sesamum indicum]
Length=321

 Score =   320 bits (821),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 201/228 (88%), Positives = 216/228 (95%), Gaps = 0/228 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TKG LKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG
Sbjct  94   TKGDLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  153

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            TVEIITPVELI+KG+KVGSSEAALL+KLGIRPFSYGL+V+SVYDNGSVFSPEVLDLTEDD
Sbjct  154  TVEIITPVELIKKGEKVGSSEAALLSKLGIRPFSYGLVVISVYDNGSVFSPEVLDLTEDD  213

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L+EKFA+GVSMVTSLSLAI+YPTLAAAPHM IN YKNVL++AV TDYSFP ADKVKEYL 
Sbjct  214  LIEKFAMGVSMVTSLSLAIAYPTLAAAPHMFINAYKNVLAVAVATDYSFPQADKVKEYLA  273

Query  220  DPSKFavaaapvaaaaagsapaaaaaaeekkeepeeesEDEMGFSLFD  77
            DPSKFAVAAA  AAA +G+APAAAA  EEKK+EP EES+D+MGFSLFD
Sbjct  274  DPSKFAVAAAAAAAADSGAAPAAAAKEEEKKDEPAEESDDDMGFSLFD  321



>ref|XP_007153264.1| hypothetical protein PHAVU_003G020600g [Phaseolus vulgaris]
 gb|ESW25258.1| hypothetical protein PHAVU_003G020600g [Phaseolus vulgaris]
Length=320

 Score =   320 bits (820),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 203/228 (89%), Positives = 211/228 (93%), Gaps = 1/228 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TKG LKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG
Sbjct  94   TKGDLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  153

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            TVEIITPVELIRKG+KVGSSEAALLAKLGIRPFSYGL+VLSVYDNGSVFSPEVLDLTEDD
Sbjct  154  TVEIITPVELIRKGEKVGSSEAALLAKLGIRPFSYGLVVLSVYDNGSVFSPEVLDLTEDD  213

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            LLEKFA GVSMVTSLSLAISYPTLAAAPHM +N YKN+LS+A+ TDYSFP ADKVKEYLK
Sbjct  214  LLEKFAAGVSMVTSLSLAISYPTLAAAPHMFVNAYKNLLSVAIATDYSFPEADKVKEYLK  273

Query  220  DPSKFavaaapvaaaaagsapaaaaaaeekkeepeeesEDEMGFSLFD  77
            DPSKF   AA  A AAA  APAAAA  EEKKEEP EES+D+MGFSLFD
Sbjct  274  DPSKF-AVAAVAAPAAASGAPAAAAKEEEKKEEPAEESDDDMGFSLFD  320



>gb|AGV54296.1| 60S acidic ribosomal protein P0 [Phaseolus vulgaris]
Length=320

 Score =   320 bits (820),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 202/228 (89%), Positives = 210/228 (92%), Gaps = 1/228 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TKG LKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG
Sbjct  94   TKGDLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  153

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            TVEIITPVELIRKG+KVGSSEAALLAKLGIRPFSYGL+VLSVYDNGSVFSPEVLDLTEDD
Sbjct  154  TVEIITPVELIRKGEKVGSSEAALLAKLGIRPFSYGLVVLSVYDNGSVFSPEVLDLTEDD  213

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            LLEKFA GVSMVTSLSLAISYPTLAAAPHM +N YKN+LS+A+ TDYSFP ADKVKEYLK
Sbjct  214  LLEKFAAGVSMVTSLSLAISYPTLAAAPHMFVNAYKNLLSVAIATDYSFPEADKVKEYLK  273

Query  220  DPSKFavaaapvaaaaagsapaaaaaaeekkeepeeesEDEMGFSLFD  77
            DPSKF   AA  A AAA  APAAAA  EEK EEP EES+D+MGFSLFD
Sbjct  274  DPSKF-AVAAVAAPAAASGAPAAAAKEEEKMEEPAEESDDDMGFSLFD  320



>ref|XP_007157498.1| hypothetical protein PHAVU_002G074600g [Phaseolus vulgaris]
 gb|ESW29492.1| hypothetical protein PHAVU_002G074600g [Phaseolus vulgaris]
Length=321

 Score =   320 bits (820),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 201/228 (88%), Positives = 213/228 (93%), Gaps = 0/228 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TKG LKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG
Sbjct  94   TKGDLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  153

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            TVEIITPVELIRKG+KVGSSEAALLAKLGIRPFSYGL+VLSVYDNGSVFSPEVLDLTEDD
Sbjct  154  TVEIITPVELIRKGEKVGSSEAALLAKLGIRPFSYGLVVLSVYDNGSVFSPEVLDLTEDD  213

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L+EKF  GVS+VTSLSLAIS+PTLAAAPHM +N YKNVLS+AVETDYS+P ADKVKEYLK
Sbjct  214  LIEKFVSGVSIVTSLSLAISFPTLAAAPHMFVNAYKNVLSVAVETDYSYPEADKVKEYLK  273

Query  220  DPSKFavaaapvaaaaagsapaaaaaaeekkeepeeesEDEMGFSLFD  77
            DPSKFAVAA    AAA+G+  AAAA  EEKKEEP EES+D+MGFSLFD
Sbjct  274  DPSKFAVAATVAPAAASGAPAAAAAKEEEKKEEPAEESDDDMGFSLFD  321



>gb|KJB76159.1| hypothetical protein B456_012G076000 [Gossypium raimondii]
Length=320

 Score =   320 bits (820),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 202/228 (89%), Positives = 211/228 (93%), Gaps = 1/228 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TKG LKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG
Sbjct  94   TKGDLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  153

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            TVEIITPVELI+KGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPEVLDLTEDD
Sbjct  154  TVEIITPVELIKKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPEVLDLTEDD  213

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L+EKFA GVSMVT+LSLAISYPTLAAAPHM INGYKNVL++AV T+YSFP ADKVKEYL 
Sbjct  214  LIEKFATGVSMVTALSLAISYPTLAAAPHMFINGYKNVLAVAVATEYSFPQADKVKEYLA  273

Query  220  DPSKFavaaapvaaaaagsapaaaaaaeekkeepeeesEDEMGFSLFD  77
            DPSKF   AA   AA  G+APAAAA  EEKK EPEEES+D+MGFSLFD
Sbjct  274  DPSKF-AVAAAPVAAGGGAAPAAAAPVEEKKPEPEEESDDDMGFSLFD  320



>ref|XP_003603496.1| 60S acidic ribosomal protein p0 [Medicago truncatula]
 gb|AES73747.1| 60S acidic ribosomal protein P0-1 [Medicago truncatula]
Length=323

 Score =   319 bits (818),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 171/185 (92%), Positives = 178/185 (96%), Gaps = 0/185 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TKG LKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG
Sbjct  94   TKGDLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  153

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            TVEIITPVELI+KGDKVGSSEAALLAKLGIRPFSYGL+VLSVYDNGSVFSPEVLDLTEDD
Sbjct  154  TVEIITPVELIKKGDKVGSSEAALLAKLGIRPFSYGLVVLSVYDNGSVFSPEVLDLTEDD  213

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L+ KFA+GVSMVTSLSLAISYPTLAAAPHM +N YKNVL+ AV T+YSFP ADKVKEYLK
Sbjct  214  LVAKFAIGVSMVTSLSLAISYPTLAAAPHMFVNAYKNVLAFAVATEYSFPEADKVKEYLK  273

Query  220  DPSKF  206
            DPSKF
Sbjct  274  DPSKF  278



>ref|XP_004501267.1| PREDICTED: 60S acidic ribosomal protein P0-like [Cicer arietinum]
Length=322

 Score =   319 bits (817),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 196/229 (86%), Positives = 207/229 (90%), Gaps = 1/229 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TKG LKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG
Sbjct  94   TKGDLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  153

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            TVEIITPVELI+KGDKVGSSEAALLAKLGIRPFSYGL+VLSVYDNGSVFSPEVLDLTED 
Sbjct  154  TVEIITPVELIKKGDKVGSSEAALLAKLGIRPFSYGLVVLSVYDNGSVFSPEVLDLTEDA  213

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L+EKFA+GVSMVTSLSLAISYPTLAAAPHML+N YKNVL++AV T+YS P ADKVKEYLK
Sbjct  214  LIEKFAIGVSMVTSLSLAISYPTLAAAPHMLVNAYKNVLAVAVATEYSSPEADKVKEYLK  273

Query  220  DPSKFavaaapvaaaaagsapaaaaaaeekkeepeeesE-DEMGFSLFD  77
            DPSKFAVAA    AAAA  A  AAA+ EE K+E   E   D+MGFSLFD
Sbjct  274  DPSKFAVAAVAAPAAAASGAAPAAASKEEAKKEEPAEESDDDMGFSLFD  322



>dbj|BAE71263.1| putative 60S acidic ribosomal protein P0 [Trifolium pratense]
 dbj|BAE71276.1| putative 60S acidic ribosomal protein P0 [Trifolium pratense]
Length=321

 Score =   318 bits (815),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 171/185 (92%), Positives = 178/185 (96%), Gaps = 0/185 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TKG LKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG
Sbjct  94   TKGDLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  153

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            TVEIITPVELI+KGDKVGSSEAALLAKL IRPFSYGL+VLSVYDNGSVFSPEVLDLTEDD
Sbjct  154  TVEIITPVELIKKGDKVGSSEAALLAKLAIRPFSYGLVVLSVYDNGSVFSPEVLDLTEDD  213

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L+ KFA+GVSMVTSLSLAISYPTLAAAPHM +N YKNVLSIAV T+YSFP ADKVKE+LK
Sbjct  214  LVAKFAIGVSMVTSLSLAISYPTLAAAPHMFVNAYKNVLSIAVVTEYSFPEADKVKEFLK  273

Query  220  DPSKF  206
            DPSKF
Sbjct  274  DPSKF  278



>gb|AFK39880.1| unknown [Medicago truncatula]
Length=323

 Score =   317 bits (813),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 170/185 (92%), Positives = 177/185 (96%), Gaps = 0/185 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TKG LKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG
Sbjct  94   TKGDLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  153

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            T EIITPVELI+KGDKVGSSEAALLAKLGIRPFSYGL+VLSVYDNGSVFSPEVLDLTEDD
Sbjct  154  TAEIITPVELIKKGDKVGSSEAALLAKLGIRPFSYGLVVLSVYDNGSVFSPEVLDLTEDD  213

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L+ KFA+GVSMVTSLSLAISYPTLAAAPHM +N YKNVL+ AV T+YSFP ADKVKEYLK
Sbjct  214  LVAKFAIGVSMVTSLSLAISYPTLAAAPHMFVNAYKNVLAFAVATEYSFPEADKVKEYLK  273

Query  220  DPSKF  206
            DPSKF
Sbjct  274  DPSKF  278



>ref|XP_010534571.1| PREDICTED: 60S acidic ribosomal protein P0-like [Tarenaya hassleriana]
Length=321

 Score =   317 bits (813),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 198/228 (87%), Positives = 211/228 (93%), Gaps = 0/228 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TKG LKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG
Sbjct  94   TKGDLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  153

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            TVEIITPVELI+KG+KVGSSEAALLAKLGIRPFSYGLIV SVYDNGSVFSPEVLDLTEDD
Sbjct  154  TVEIITPVELIKKGEKVGSSEAALLAKLGIRPFSYGLIVQSVYDNGSVFSPEVLDLTEDD  213

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L+EKFA GVSMVT+LSLA+SYPTLAAAPHM IN YKNVL++AV T+Y+FP A+KVKEYLK
Sbjct  214  LMEKFAAGVSMVTALSLAVSYPTLAAAPHMFINAYKNVLAVAVATEYTFPQAEKVKEYLK  273

Query  220  DPSKFavaaapvaaaaagsapaaaaaaeekkeepeeesEDEMGFSLFD  77
            DPSKFAVAAA       G+APAAAA  EEKKEEP EES+D+MGFSLFD
Sbjct  274  DPSKFAVAAASAGGETGGAAPAAAAKEEEKKEEPAEESDDDMGFSLFD  321



>ref|XP_007009052.1| Ribosomal protein L10 family protein isoform 2 [Theobroma cacao]
 gb|EOY17862.1| Ribosomal protein L10 family protein isoform 2 [Theobroma cacao]
Length=321

 Score =   317 bits (813),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 200/228 (88%), Positives = 211/228 (93%), Gaps = 1/228 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TKG LKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG
Sbjct  95   TKGDLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  154

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            TVEIITPVELI+KGDKVGSSEAALLAKLGIRPFSYGL+VLSVYDNGSVFSPEVLDLTEDD
Sbjct  155  TVEIITPVELIKKGDKVGSSEAALLAKLGIRPFSYGLVVLSVYDNGSVFSPEVLDLTEDD  214

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L+EKFA GVSMVT+LSLAISYPTLAAAPHM IN YKNVL++A+ T+YSFP ADKVKEYL 
Sbjct  215  LVEKFAAGVSMVTALSLAISYPTLAAAPHMFINAYKNVLALAIATEYSFPQADKVKEYLA  274

Query  220  DPSKFavaaapvaaaaagsapaaaaaaeekkeepeeesEDEMGFSLFD  77
            DPSKF   AA   AA AG+APAA AA EEKK EPEEES+D+MGFSLFD
Sbjct  275  DPSKF-AVAAAPVAADAGAAPAAPAAVEEKKPEPEEESDDDMGFSLFD  321



>ref|XP_007009051.1| Ribosomal protein L10 family protein isoform 1 [Theobroma cacao]
 gb|EOY17861.1| Ribosomal protein L10 family protein isoform 1 [Theobroma cacao]
Length=320

 Score =   317 bits (813),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 200/228 (88%), Positives = 211/228 (93%), Gaps = 1/228 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TKG LKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG
Sbjct  94   TKGDLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  153

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            TVEIITPVELI+KGDKVGSSEAALLAKLGIRPFSYGL+VLSVYDNGSVFSPEVLDLTEDD
Sbjct  154  TVEIITPVELIKKGDKVGSSEAALLAKLGIRPFSYGLVVLSVYDNGSVFSPEVLDLTEDD  213

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L+EKFA GVSMVT+LSLAISYPTLAAAPHM IN YKNVL++A+ T+YSFP ADKVKEYL 
Sbjct  214  LVEKFAAGVSMVTALSLAISYPTLAAAPHMFINAYKNVLALAIATEYSFPQADKVKEYLA  273

Query  220  DPSKFavaaapvaaaaagsapaaaaaaeekkeepeeesEDEMGFSLFD  77
            DPSKF   AA   AA AG+APAA AA EEKK EPEEES+D+MGFSLFD
Sbjct  274  DPSKF-AVAAAPVAADAGAAPAAPAAVEEKKPEPEEESDDDMGFSLFD  320



>ref|XP_011042597.1| PREDICTED: 60S acidic ribosomal protein P0-like [Populus euphratica]
Length=321

 Score =   317 bits (812),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 196/228 (86%), Positives = 211/228 (93%), Gaps = 0/228 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TKG LKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG
Sbjct  94   TKGDLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  153

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            TVEIITPVELI+KGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSP VLDLTEDD
Sbjct  154  TVEIITPVELIKKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPTVLDLTEDD  213

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L+EKFA G++M+TSLSLAISYPTLAAAPHM IN YKN+L++AV T+YS+P A++VKE+LK
Sbjct  214  LVEKFATGIAMITSLSLAISYPTLAAAPHMFINAYKNILAVAVATEYSYPQAEEVKEFLK  273

Query  220  DPSKFavaaapvaaaaagsapaaaaaaeekkeepeeesEDEMGFSLFD  77
            DPSKFAVAA P AAAAA     AAA  EEKKEEP EES+D+MGFSLFD
Sbjct  274  DPSKFAVAAVPAAAAAAPGGAPAAAKEEEKKEEPAEESDDDMGFSLFD  321



>gb|AFK46889.1| unknown [Medicago truncatula]
Length=323

 Score =   317 bits (811),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 193/229 (84%), Positives = 208/229 (91%), Gaps = 0/229 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TKG LKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG
Sbjct  94   TKGDLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  153

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            TVEIITPVELI+KGDKVGSSEAALLAKLGIRPFSYGL+VLSVYDNGSVF+PEVLDLTEDD
Sbjct  154  TVEIITPVELIKKGDKVGSSEAALLAKLGIRPFSYGLVVLSVYDNGSVFNPEVLDLTEDD  213

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L+ KFA+GVSMVTSLSLAISYPTLAAAPHM +N YKNVL++AV T+YSFP ADKVKE+LK
Sbjct  214  LVAKFAIGVSMVTSLSLAISYPTLAAAPHMFVNAYKNVLAVAVATEYSFPEADKVKEFLK  273

Query  220  DPSKFavaaapvaaaaagsapaaaaaaeekkeepeeesEDEMGFSLFDD  74
            DPSKFAVAA    A  +G+ PA AAAA     EPEEES+D++GF LF D
Sbjct  274  DPSKFAVAAVAAPADVSGATPAPAAAAAAAAAEPEEESDDDIGFGLFGD  322



>ref|XP_003616595.1| 60S acidic ribosomal protein p0 [Medicago truncatula]
 gb|AES99553.1| 60S acidic ribosomal protein P0-1 [Medicago truncatula]
Length=323

 Score =   317 bits (811),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 193/229 (84%), Positives = 208/229 (91%), Gaps = 0/229 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TKG LKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG
Sbjct  94   TKGDLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  153

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            TVEIITPVELI+KGDKVGSSEAALLAKLGIRPFSYGL+VLSVYDNGSVF+PEVLDLTEDD
Sbjct  154  TVEIITPVELIKKGDKVGSSEAALLAKLGIRPFSYGLVVLSVYDNGSVFNPEVLDLTEDD  213

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L+ KFA+GVSMVTSLSLAISYPTLAAAPHM +N YKNVL++AV T+YSFP ADKVKE+LK
Sbjct  214  LVAKFAIGVSMVTSLSLAISYPTLAAAPHMFVNAYKNVLAVAVATEYSFPEADKVKEFLK  273

Query  220  DPSKFavaaapvaaaaagsapaaaaaaeekkeepeeesEDEMGFSLFDD  74
            DPSKFAVAA    A  +G+ PA AAAA     EPEEES+D++GF LF D
Sbjct  274  DPSKFAVAAVAAPADVSGATPAPAAAAAAAAAEPEEESDDDIGFGLFGD  322



>gb|EYU18304.1| hypothetical protein MIMGU_mgv1a010092mg [Erythranthe guttata]
Length=322

 Score =   317 bits (811),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 166/185 (90%), Positives = 178/185 (96%), Gaps = 0/185 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TKG LKEV+EEVAK+KVGAPARVGLVAPIDV+VPPGNTGLDPSQTSFFQVLNIPTKINKG
Sbjct  94   TKGDLKEVTEEVAKFKVGAPARVGLVAPIDVIVPPGNTGLDPSQTSFFQVLNIPTKINKG  153

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            TVEI+TPVELI+KGDKVGSSEAALL+KLGIRPFSYGL+VL VYDNGSVFSPEVLDLTEDD
Sbjct  154  TVEIVTPVELIKKGDKVGSSEAALLSKLGIRPFSYGLVVLKVYDNGSVFSPEVLDLTEDD  213

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L+ KFA+GVSMVTSL+LAISYPTLAAAPHM IN YKNVL++AV TDYSFPLADKVKEYL 
Sbjct  214  LVGKFAMGVSMVTSLALAISYPTLAAAPHMFINAYKNVLAVAVATDYSFPLADKVKEYLA  273

Query  220  DPSKF  206
            DPSKF
Sbjct  274  DPSKF  278



>gb|ABK95701.1| unknown [Populus trichocarpa]
Length=322

 Score =   316 bits (809),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 194/229 (85%), Positives = 210/229 (92%), Gaps = 1/229 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TKG LKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG
Sbjct  94   TKGDLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  153

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            TVEIITPVELI+KGDKVGSSEAALLAKLGIRPFSYGL+VLSVYDNGSVFSP VLDLTEDD
Sbjct  154  TVEIITPVELIKKGDKVGSSEAALLAKLGIRPFSYGLVVLSVYDNGSVFSPTVLDLTEDD  213

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L+EKFA G++M+TSLSLAISYPTLAAAPHMLIN YKN+LS+AV T+YS+P A++VKE+LK
Sbjct  214  LVEKFATGITMITSLSLAISYPTLAAAPHMLINAYKNILSVAVATEYSYPQAEEVKEFLK  273

Query  220  DPSKFavaaapvaaaaagsapaaaaaaeekkeepeeesE-DEMGFSLFD  77
            DPSKFAVAAAP AAAAA    A AAA EE+K+E   E   D+MGFSLFD
Sbjct  274  DPSKFAVAAAPAAAAAAAPGGAPAAAKEEEKKEEPAEESDDDMGFSLFD  322



>emb|CAN76468.1| hypothetical protein VITISV_030042 [Vitis vinifera]
Length=303

 Score =   315 bits (806),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 189/224 (84%), Positives = 204/224 (91%), Gaps = 1/224 (0%)
 Frame = -1

Query  748  LKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEI  569
            ++EVSEEVAKYKVGAPARVGLVAPIDV+VPPGNTGLDPSQTSFFQVLNIPTKINKGTVEI
Sbjct  81   IREVSEEVAKYKVGAPARVGLVAPIDVIVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEI  140

Query  568  ITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldlteddllEK  389
            ITPVELI+KGDKVGSSEAALLAKLGIRPFSYGL+VLSVYDNGSVFSPEVLDLTE+DL+EK
Sbjct  141  ITPVELIKKGDKVGSSEAALLAKLGIRPFSYGLVVLSVYDNGSVFSPEVLDLTEEDLIEK  200

Query  388  FALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSK  209
            FA GVSMVTSLSLAISYPTLAAAPHM IN YKNVL++AV T+YSFP ADKVKEYLKDPSK
Sbjct  201  FAAGVSMVTSLSLAISYPTLAAAPHMFINAYKNVLAVAVATEYSFPQADKVKEYLKDPSK  260

Query  208  FavaaapvaaaaagsapaaaaaaeekkeepeeesEDEMGFSLFD  77
            F   A     A+   A  AA+  EEKKEEP+EES+D+MGFSLFD
Sbjct  261  F-AVATAPVTASDAGAAPAASKEEEKKEEPQEESDDDMGFSLFD  303



>ref|XP_002526873.1| 60S acidic ribosomal protein P0, putative [Ricinus communis]
 gb|EEF35504.1| 60S acidic ribosomal protein P0, putative [Ricinus communis]
Length=320

 Score =   315 bits (808),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 198/228 (87%), Positives = 209/228 (92%), Gaps = 1/228 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TKG LKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG
Sbjct  94   TKGDLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  153

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            TVEIITPVELI+KGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPEVLDLTEDD
Sbjct  154  TVEIITPVELIKKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPEVLDLTEDD  213

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L+ KFA+GVSMVTSL+LAISYPTLAAAPHM IN YKN L+IAV T+Y+FP A+KVKEYL+
Sbjct  214  LIGKFAIGVSMVTSLALAISYPTLAAAPHMFINAYKNALAIAVATEYTFPQAEKVKEYLE  273

Query  220  DPSKFavaaapvaaaaagsapaaaaaaeekkeepeeesEDEMGFSLFD  77
            DPSKF   A  VA  AA  APAAAA  EEKKEEP EES+D+MGFSLFD
Sbjct  274  DPSKF-AVAVAVAPVAAAGAPAAAAKEEEKKEEPAEESDDDMGFSLFD  320



>gb|EYU43500.1| hypothetical protein MIMGU_mgv1a010103mg [Erythranthe guttata]
Length=322

 Score =   315 bits (808),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 165/185 (89%), Positives = 177/185 (96%), Gaps = 0/185 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TKG LKEV+EEVAK+KVGAPARVGLVAPIDV+VPPGNTGLDPSQTSFFQVLNIPTKINKG
Sbjct  94   TKGDLKEVTEEVAKFKVGAPARVGLVAPIDVIVPPGNTGLDPSQTSFFQVLNIPTKINKG  153

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            TVEI+TPVELI+KGDKVGSSEAALL+KLGIRPFSYGL+V  VYDNGSVFSPEVLDLTEDD
Sbjct  154  TVEIVTPVELIKKGDKVGSSEAALLSKLGIRPFSYGLVVTKVYDNGSVFSPEVLDLTEDD  213

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L+ KFA+GVSMVTSL+LAISYPTLAAAPHM IN YKNVL++AV TDYSFPLADKVKEYL 
Sbjct  214  LIVKFAMGVSMVTSLALAISYPTLAAAPHMFINAYKNVLAVAVATDYSFPLADKVKEYLA  273

Query  220  DPSKF  206
            DPSKF
Sbjct  274  DPSKF  278



>ref|XP_010554654.1| PREDICTED: 60S acidic ribosomal protein P0 [Tarenaya hassleriana]
Length=320

 Score =   315 bits (807),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 195/228 (86%), Positives = 210/228 (92%), Gaps = 1/228 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TKG LKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG
Sbjct  94   TKGDLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  153

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            TVEIITPVELI+KGDKVGSSEAALLAKLGIRPFSYGLIV SVYDNGSVFSPEVLDLTEDD
Sbjct  154  TVEIITPVELIKKGDKVGSSEAALLAKLGIRPFSYGLIVQSVYDNGSVFSPEVLDLTEDD  213

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L+EKFA GVSMVT+LSLAISYPTLAAAPHM IN YKNVL++A+ T+Y+FP A+KVKEYLK
Sbjct  214  LMEKFAAGVSMVTALSLAISYPTLAAAPHMFINAYKNVLAVAIATEYTFPQAEKVKEYLK  273

Query  220  DPSKFavaaapvaaaaagsapaaaaaaeekkeepeeesEDEMGFSLFD  77
            DPSK    AA ++A   G+APAAA+  EEKKEEP EES+D+MGFSLFD
Sbjct  274  DPSKL-AVAAAMSAGDGGAAPAAASKEEEKKEEPAEESDDDMGFSLFD  320



>gb|EYU43501.1| hypothetical protein MIMGU_mgv1a010103mg [Erythranthe guttata]
Length=321

 Score =   315 bits (807),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 165/185 (89%), Positives = 177/185 (96%), Gaps = 0/185 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TKG LKEV+EEVAK+KVGAPARVGLVAPIDV+VPPGNTGLDPSQTSFFQVLNIPTKINKG
Sbjct  93   TKGDLKEVTEEVAKFKVGAPARVGLVAPIDVIVPPGNTGLDPSQTSFFQVLNIPTKINKG  152

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            TVEI+TPVELI+KGDKVGSSEAALL+KLGIRPFSYGL+V  VYDNGSVFSPEVLDLTEDD
Sbjct  153  TVEIVTPVELIKKGDKVGSSEAALLSKLGIRPFSYGLVVTKVYDNGSVFSPEVLDLTEDD  212

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L+ KFA+GVSMVTSL+LAISYPTLAAAPHM IN YKNVL++AV TDYSFPLADKVKEYL 
Sbjct  213  LIVKFAMGVSMVTSLALAISYPTLAAAPHMFINAYKNVLAVAVATDYSFPLADKVKEYLA  272

Query  220  DPSKF  206
            DPSKF
Sbjct  273  DPSKF  277



>gb|EYU43502.1| hypothetical protein MIMGU_mgv1a010103mg [Erythranthe guttata]
Length=242

 Score =   312 bits (799),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 165/185 (89%), Positives = 177/185 (96%), Gaps = 0/185 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TKG LKEV+EEVAK+KVGAPARVGLVAPIDV+VPPGNTGLDPSQTSFFQVLNIPTKINKG
Sbjct  14   TKGDLKEVTEEVAKFKVGAPARVGLVAPIDVIVPPGNTGLDPSQTSFFQVLNIPTKINKG  73

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            TVEI+TPVELI+KGDKVGSSEAALL+KLGIRPFSYGL+V  VYDNGSVFSPEVLDLTEDD
Sbjct  74   TVEIVTPVELIKKGDKVGSSEAALLSKLGIRPFSYGLVVTKVYDNGSVFSPEVLDLTEDD  133

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L+ KFA+GVSMVTSL+LAISYPTLAAAPHM IN YKNVL++AV TDYSFPLADKVKEYL 
Sbjct  134  LIVKFAMGVSMVTSLALAISYPTLAAAPHMFINAYKNVLAVAVATDYSFPLADKVKEYLA  193

Query  220  DPSKF  206
            DPSKF
Sbjct  194  DPSKF  198



>gb|KDP44812.1| hypothetical protein JCGZ_01312 [Jatropha curcas]
Length=321

 Score =   315 bits (807),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 202/228 (89%), Positives = 218/228 (96%), Gaps = 0/228 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TKG LKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG
Sbjct  94   TKGDLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  153

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            TVEIITPVELI+KG+KVGSSEAALLAKLGIRPFSYGL+VLSVYDNGSVFSPEVLDLTEDD
Sbjct  154  TVEIITPVELIKKGEKVGSSEAALLAKLGIRPFSYGLVVLSVYDNGSVFSPEVLDLTEDD  213

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L+EKFA GVSMVTSL+LA+SYPTLAAAP+M IN YKNVL+++V TDY+FP A+KVKEYL+
Sbjct  214  LVEKFATGVSMVTSLALAVSYPTLAAAPYMFINAYKNVLAVSVATDYTFPQAEKVKEYLE  273

Query  220  DPSKFavaaapvaaaaagsapaaaaaaeekkeepeeesEDEMGFSLFD  77
            DPSKFAVAAAPVAAA AG+APAAAA  EEKKEEP EES+D+MGFSLFD
Sbjct  274  DPSKFAVAAAPVAAATAGAAPAAAAKEEEKKEEPAEESDDDMGFSLFD  321



>ref|XP_010689885.1| PREDICTED: 60S acidic ribosomal protein P0 [Beta vulgaris subsp. 
vulgaris]
Length=321

 Score =   315 bits (806),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 196/228 (86%), Positives = 206/228 (90%), Gaps = 0/228 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TKG LKEV EE++KYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG
Sbjct  94   TKGDLKEVREEISKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  153

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            TVEIIT VELI+KGDKVGSSEAALLAKLGIRPFSYGL + SVYDNGSVFSPEVLDLTE+D
Sbjct  154  TVEIITAVELIKKGDKVGSSEAALLAKLGIRPFSYGLAIESVYDNGSVFSPEVLDLTEED  213

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            LL KFA GVSMVTSL LAISYPTLAAAPHM INGYKNVL+IA+ETDY FP A+KVKEYLK
Sbjct  214  LLAKFASGVSMVTSLCLAISYPTLAAAPHMFINGYKNVLAIALETDYDFPEAEKVKEYLK  273

Query  220  DPSKFavaaapvaaaaagsapaaaaaaeekkeepeeesEDEMGFSLFD  77
            DPSKFAVAA    AAAA    AAAA  EEKKEEP EES+D+MGFSLFD
Sbjct  274  DPSKFAVAAPAAGAAAASGGGAAAAKEEEKKEEPAEESDDDMGFSLFD  321



>gb|KHG25720.1| 60S acidic ribosomal P0 [Gossypium arboreum]
Length=320

 Score =   314 bits (805),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 199/228 (87%), Positives = 209/228 (92%), Gaps = 1/228 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TKG LKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG
Sbjct  94   TKGDLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  153

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            TVEIITPVELI+KGDKVGSSEAALLAKLGIRPFSYGL+VLSVYDNGSVFSPEVLDLTEDD
Sbjct  154  TVEIITPVELIKKGDKVGSSEAALLAKLGIRPFSYGLVVLSVYDNGSVFSPEVLDLTEDD  213

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L+EKFA GVSMVT+LSLAISYPTLAA PHM INGYKNVL++AV T+YSF  ADKVKEYL 
Sbjct  214  LIEKFASGVSMVTALSLAISYPTLAAVPHMFINGYKNVLAVAVATEYSFRQADKVKEYLA  273

Query  220  DPSKFavaaapvaaaaagsapaaaaaaeekkeepeeesEDEMGFSLFD  77
            DPSKF   A    AAA G+APAAA  AEEKK EPEEES+D+MGFSLFD
Sbjct  274  DPSKF-AVATAPVAAAGGAAPAAAVPAEEKKPEPEEESDDDMGFSLFD  320



>gb|ACJ84880.1| unknown [Medicago truncatula]
Length=323

 Score =   315 bits (806),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 169/185 (91%), Positives = 176/185 (95%), Gaps = 0/185 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TKG LKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG
Sbjct  94   TKGDLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  153

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            T EIITPVELI+KGDKVGSSEAALLAKLGI PFSYGL+VLSVYDNGSVFSPEVLDLTEDD
Sbjct  154  TAEIITPVELIKKGDKVGSSEAALLAKLGITPFSYGLVVLSVYDNGSVFSPEVLDLTEDD  213

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L+ KFA+GVSMVTSLSLAISYPTLAAAPHM +N YKNVL+ AV T+YSFP ADKVKEYLK
Sbjct  214  LVAKFAIGVSMVTSLSLAISYPTLAAAPHMFVNAYKNVLAFAVATEYSFPEADKVKEYLK  273

Query  220  DPSKF  206
            DPSKF
Sbjct  274  DPSKF  278



>ref|XP_009399833.1| PREDICTED: 60S acidic ribosomal protein P0-like [Musa acuminata 
subsp. malaccensis]
Length=319

 Score =   314 bits (805),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 191/228 (84%), Positives = 207/228 (91%), Gaps = 2/228 (1%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TKG LKEVSEEVAKY+VGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG
Sbjct  94   TKGDLKEVSEEVAKYQVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  153

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            TVEIITPVELI+KG+KVGSSEAALLAKLGIRPFSYGLI+LSVYDNGSVFSPEVLDLTEDD
Sbjct  154  TVEIITPVELIKKGEKVGSSEAALLAKLGIRPFSYGLIILSVYDNGSVFSPEVLDLTEDD  213

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L+EKFA GVSMVTSLSLA+SYPTLAAAPHM IN YKNVL++A+ T+Y+FP A+K+KEYLK
Sbjct  214  LIEKFAAGVSMVTSLSLAVSYPTLAAAPHMFINAYKNVLAVAIATEYTFPQAEKIKEYLK  273

Query  220  DPSKFavaaapvaaaaagsapaaaaaaeekkeepeeesEDEMGFSLFD  77
            DPSKF  A A        +A  AAA AEEKKEEP EES+D+MGFSLFD
Sbjct  274  DPSKF--AVAATPVTEEAAAAPAAAPAEEKKEEPAEESDDDMGFSLFD  319



>ref|XP_002312149.1| 60S acidic ribosomal protein P0-A [Populus trichocarpa]
 gb|EEE89516.1| 60S acidic ribosomal protein P0-A [Populus trichocarpa]
Length=322

 Score =   314 bits (805),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 193/229 (84%), Positives = 209/229 (91%), Gaps = 1/229 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TKG LKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG
Sbjct  94   TKGDLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  153

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            TVEIITPVELI+KGDKVGSSEAALLAKLGIRPFSYGL+VLSVYDNGSVFSP VLDLTEDD
Sbjct  154  TVEIITPVELIKKGDKVGSSEAALLAKLGIRPFSYGLVVLSVYDNGSVFSPTVLDLTEDD  213

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L+EKFA G++M+TSLSLAISYPTLAAAPHM IN YKN+LS+AV T+YS+P A++VKE+LK
Sbjct  214  LVEKFATGITMITSLSLAISYPTLAAAPHMFINAYKNILSVAVATEYSYPQAEEVKEFLK  273

Query  220  DPSKFavaaapvaaaaagsapaaaaaaeekkeepeeesE-DEMGFSLFD  77
            DPSKFAVAAAP AAAAA    A AAA EE+K+E   E   D+MGFSLFD
Sbjct  274  DPSKFAVAAAPAAAAAAAPGGAPAAAKEEEKKEEPAEESDDDMGFSLFD  322



>ref|XP_010534676.1| PREDICTED: 60S acidic ribosomal protein P0-like [Tarenaya hassleriana]
Length=320

 Score =   314 bits (805),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 201/228 (88%), Positives = 215/228 (94%), Gaps = 0/228 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TKG LKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG
Sbjct  93   TKGDLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  152

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            TVEIITPVELI+KG+KVGSSEAALLAKLGIRPFSYGLIV SVYDNGSVFSPEVLDLTEDD
Sbjct  153  TVEIITPVELIKKGEKVGSSEAALLAKLGIRPFSYGLIVESVYDNGSVFSPEVLDLTEDD  212

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L+EKFA GVSMVT+L+LA+SYPTLAAAPHM IN YKNVLS+A+ T+YSFP A+KVKE+LK
Sbjct  213  LMEKFAAGVSMVTALALAVSYPTLAAAPHMFINAYKNVLSVALATEYSFPQAEKVKEFLK  272

Query  220  DPSKFavaaapvaaaaagsapaaaaaaeekkeepeeesEDEMGFSLFD  77
            DPSKFAVAAAPVA  A G+APAAAA  EEKKEEP EES+D+MGFSLFD
Sbjct  273  DPSKFAVAAAPVAGNAGGAAPAAAAKEEEKKEEPAEESDDDMGFSLFD  320



>ref|XP_009409427.1| PREDICTED: 60S acidic ribosomal protein P0-like [Musa acuminata 
subsp. malaccensis]
Length=320

 Score =   314 bits (804),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 192/228 (84%), Positives = 208/228 (91%), Gaps = 1/228 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TKG LKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG
Sbjct  94   TKGDLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  153

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            TVEIITPVELIRKG+KVGSSEAALLAKLGIRPFSYGL++LSVYDNGSVFSPEVLDLTEDD
Sbjct  154  TVEIITPVELIRKGEKVGSSEAALLAKLGIRPFSYGLVILSVYDNGSVFSPEVLDLTEDD  213

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L+EKFA GVS+VTSLSLAISYPTL AAPHM IN YKNVL++A+ T+YSFP A+KVKEYLK
Sbjct  214  LIEKFAAGVSLVTSLSLAISYPTLVAAPHMFINAYKNVLAVAIATEYSFPHAEKVKEYLK  273

Query  220  DPSKFavaaapvaaaaagsapaaaaaaeekkeepeeesEDEMGFSLFD  77
            DPSKF   AA    A   +A +++A AEEKKEEP EES+D+MGFSLFD
Sbjct  274  DPSKF-AVAAAPVVAEVAAAASSSAPAEEKKEEPAEESDDDMGFSLFD  320



>ref|XP_009389889.1| PREDICTED: 60S acidic ribosomal protein P0 [Musa acuminata subsp. 
malaccensis]
Length=319

 Score =   314 bits (804),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 190/228 (83%), Positives = 207/228 (91%), Gaps = 2/228 (1%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TKG LKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG
Sbjct  94   TKGDLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  153

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            TVEIITPVELI+KG+KVGSSEAALLAKLGIRPFSYGL++LSVYDNGSVFSPEVLDL+EDD
Sbjct  154  TVEIITPVELIKKGEKVGSSEAALLAKLGIRPFSYGLVILSVYDNGSVFSPEVLDLSEDD  213

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L+EKFA G+SMVTSLSLA+SYPTLAAAPHM IN YKNVL++A+ T+Y+FP A+KVKEYLK
Sbjct  214  LIEKFAAGISMVTSLSLAVSYPTLAAAPHMFINAYKNVLAVAIATEYTFPQAEKVKEYLK  273

Query  220  DPSKFavaaapvaaaaagsapaaaaaaeekkeepeeesEDEMGFSLFD  77
            DPSKF  A A    AA  +A   A  AEEKKEEP EES+D+MGFSLFD
Sbjct  274  DPSKF--AVAAPVVAAEAAAAPTAEPAEEKKEEPAEESDDDMGFSLFD  319



>gb|ADR71236.1| 60S acidic ribosomal protein P0B [Hevea brasiliensis]
Length=320

 Score =   313 bits (803),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 168/185 (91%), Positives = 177/185 (96%), Gaps = 0/185 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TKG LKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG
Sbjct  94   TKGDLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  153

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            TVEIITPVELI+KGDKVGSSEAALLAKLGIRPFSYGL+VLS YDNGSVFSPEVLDLTEDD
Sbjct  154  TVEIITPVELIKKGDKVGSSEAALLAKLGIRPFSYGLVVLSAYDNGSVFSPEVLDLTEDD  213

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L+EKFA GVSMVTSL+LAISYPTLAAAPHM +N YKNVL+IAV T+YSFP A+ V+EYLK
Sbjct  214  LVEKFATGVSMVTSLALAISYPTLAAAPHMFVNAYKNVLAIAVATEYSFPRAETVREYLK  273

Query  220  DPSKF  206
            DPSKF
Sbjct  274  DPSKF  278



>gb|ADR71235.1| 60S acidic ribosomal protein P0A [Hevea brasiliensis]
Length=320

 Score =   313 bits (802),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 168/185 (91%), Positives = 177/185 (96%), Gaps = 0/185 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TKG LKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG
Sbjct  94   TKGDLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  153

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            TVEIITPVELI+KGDKVGSSEAALLAKLGIRPFSYGL+VLS YDNGSVFSPEVLDLTEDD
Sbjct  154  TVEIITPVELIKKGDKVGSSEAALLAKLGIRPFSYGLVVLSAYDNGSVFSPEVLDLTEDD  213

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L+EKFA GVSMVTSL+LAISYPTLAAAPHM +N YKNVL+IAV T+YSFP A+ V+EYLK
Sbjct  214  LVEKFATGVSMVTSLALAISYPTLAAAPHMFVNAYKNVLAIAVATEYSFPRAETVREYLK  273

Query  220  DPSKF  206
            DPSKF
Sbjct  274  DPSKF  278



>gb|AAF34767.1|AF227622_1 60S acidic ribosomal protein PO [Euphorbia esula]
Length=317

 Score =   313 bits (802),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 164/185 (89%), Positives = 177/185 (96%), Gaps = 0/185 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TKG LKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG
Sbjct  91   TKGDLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  150

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            TVEIITPVELI+KGDKVGSSEAALLAKLGIRPFSYGL+V +VYD+G+VFSPEVL+LTEDD
Sbjct  151  TVEIITPVELIKKGDKVGSSEAALLAKLGIRPFSYGLVVQTVYDSGTVFSPEVLNLTEDD  210

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L+ KFA+GVSM+TSL+L++SYPTLAAAPHM IN YKNVL+IAV TDYSFP ADKVKEYL 
Sbjct  211  LMAKFAIGVSMITSLALSVSYPTLAAAPHMFINAYKNVLAIAVSTDYSFPQADKVKEYLA  270

Query  220  DPSKF  206
            DPSKF
Sbjct  271  DPSKF  275



>ref|XP_011072152.1| PREDICTED: 60S acidic ribosomal protein P0-like [Sesamum indicum]
Length=330

 Score =   313 bits (803),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 168/185 (91%), Positives = 178/185 (96%), Gaps = 0/185 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TKG LKEV EEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG
Sbjct  94   TKGDLKEVREEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  153

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            TVEIITPVELI+KG+KVGSSEAALL+KLGIRPFSYGLIVLSVY++GSVFSPEVLDLTEDD
Sbjct  154  TVEIITPVELIKKGEKVGSSEAALLSKLGIRPFSYGLIVLSVYESGSVFSPEVLDLTEDD  213

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L+EKFA+GVSMV SLSLAI+YPTLAAAPHM IN YKN+LS+AVETDYSFP ADKVKEYL 
Sbjct  214  LVEKFAMGVSMVASLSLAITYPTLAAAPHMFINAYKNLLSVAVETDYSFPQADKVKEYLA  273

Query  220  DPSKF  206
            DPSKF
Sbjct  274  DPSKF  278



>gb|AFK38760.1| unknown [Lotus japonicus]
Length=322

 Score =   311 bits (798),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 165/185 (89%), Positives = 178/185 (96%), Gaps = 0/185 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TKG LKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG
Sbjct  93   TKGDLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  152

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            TVEIITPVELI+KGDKVGSSEAALLAKLGIRPFSYGL+VLSVYDNGSV SPEVLDLTEDD
Sbjct  153  TVEIITPVELIKKGDKVGSSEAALLAKLGIRPFSYGLVVLSVYDNGSVLSPEVLDLTEDD  212

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L+ KFA+GVSMVT+LSLAIS+PTLAAAPHM +N YKN+L++A+ T+YSFP AD+VKEYLK
Sbjct  213  LVGKFAIGVSMVTALSLAISFPTLAAAPHMFVNAYKNILAVALATEYSFPQADEVKEYLK  272

Query  220  DPSKF  206
            DPSKF
Sbjct  273  DPSKF  277



>ref|XP_010486703.1| PREDICTED: 60S acidic ribosomal protein P0-3 [Camelina sativa]
Length=323

 Score =   311 bits (798),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 165/185 (89%), Positives = 176/185 (95%), Gaps = 0/185 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TKG LKEVSEEVAKYKVGAPARVGLVAPIDVVV PGNTGLDPSQTSFFQVLNIPTKINKG
Sbjct  93   TKGDLKEVSEEVAKYKVGAPARVGLVAPIDVVVQPGNTGLDPSQTSFFQVLNIPTKINKG  152

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            TVEIITPVELI++GDKVGSSEAALLAKLGIRPFSYGL+V SVYDNGSVFSPEVLDLTED 
Sbjct  153  TVEIITPVELIKQGDKVGSSEAALLAKLGIRPFSYGLVVQSVYDNGSVFSPEVLDLTEDQ  212

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L+EKFA G+SMVTSL+LA+SYPTLAAAPHM IN YKNVL+IAV TDY+FP A+KVKE+LK
Sbjct  213  LVEKFASGISMVTSLALAVSYPTLAAAPHMFINAYKNVLAIAVATDYTFPQAEKVKEFLK  272

Query  220  DPSKF  206
            DPSKF
Sbjct  273  DPSKF  277



>gb|KFK36893.1| hypothetical protein AALP_AA4G185700 [Arabis alpina]
Length=318

 Score =   311 bits (796),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 163/185 (88%), Positives = 177/185 (96%), Gaps = 0/185 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TKG LKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG
Sbjct  94   TKGDLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  153

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            TVEIITPVELI+KGDKVGSSEAALLAKLGIRPFSYGL+V SVYDNGSVFSP+VL+LTED 
Sbjct  154  TVEIITPVELIKKGDKVGSSEAALLAKLGIRPFSYGLVVESVYDNGSVFSPDVLNLTEDS  213

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L+EKFA+GVSM+T+LSLAISYPTLAAAPHM IN YKNVL++A+ T+YSFP A+ VKE+LK
Sbjct  214  LVEKFAVGVSMITALSLAISYPTLAAAPHMFINAYKNVLAVALATEYSFPQAENVKEFLK  273

Query  220  DPSKF  206
            DPSKF
Sbjct  274  DPSKF  278



>ref|XP_006848156.1| hypothetical protein AMTR_s00029p00231170 [Amborella trichopoda]
 gb|ERN09737.1| hypothetical protein AMTR_s00029p00231170 [Amborella trichopoda]
Length=322

 Score =   311 bits (796),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 165/185 (89%), Positives = 178/185 (96%), Gaps = 0/185 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TKG LKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG
Sbjct  94   TKGDLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  153

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            TVEIITPVELI+KG+KVGSSEAALLAKLGIRPFSYGL+VLSVYDNGSVFSPEVLDLTE+D
Sbjct  154  TVEIITPVELIKKGEKVGSSEAALLAKLGIRPFSYGLVVLSVYDNGSVFSPEVLDLTEED  213

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L+EKF +GVSMVT+LSL+ISYPTLAAAPHM INGYKN L+IAV TDY+F  A++VKEYLK
Sbjct  214  LIEKFDIGVSMVTALSLSISYPTLAAAPHMFINGYKNALAIAVATDYTFAQAEQVKEYLK  273

Query  220  DPSKF  206
            DP+KF
Sbjct  274  DPTKF  278



>ref|XP_010486773.1| PREDICTED: 60S acidic ribosomal protein P0-3-like [Camelina sativa]
Length=324

 Score =   311 bits (796),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 165/185 (89%), Positives = 176/185 (95%), Gaps = 0/185 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TKG LKEVSEEVAKYKVGAPARVGLVAPIDVVV PGNTGLDPSQTSFFQVLNIPTKINKG
Sbjct  93   TKGDLKEVSEEVAKYKVGAPARVGLVAPIDVVVQPGNTGLDPSQTSFFQVLNIPTKINKG  152

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            TVEIITPVELI++GDKVGSSEAALLAKLGIRPFSYGL+V SVYDNGSVFSPEVLDLTED 
Sbjct  153  TVEIITPVELIKQGDKVGSSEAALLAKLGIRPFSYGLVVQSVYDNGSVFSPEVLDLTEDQ  212

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L+EKFA G+SMVTSL+LA+SYPTLAAAPHM IN YKNVL+IAV TDY+FP A+KVKE+LK
Sbjct  213  LVEKFASGISMVTSLALAVSYPTLAAAPHMFINAYKNVLAIAVATDYTFPQAEKVKEFLK  272

Query  220  DPSKF  206
            DPSKF
Sbjct  273  DPSKF  277



>ref|XP_002315165.1| 60S acidic ribosomal protein P0-A [Populus trichocarpa]
 gb|EEF01336.1| 60S acidic ribosomal protein P0-A [Populus trichocarpa]
Length=320

 Score =   310 bits (795),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 191/228 (84%), Positives = 204/228 (89%), Gaps = 1/228 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TKG LKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG
Sbjct  94   TKGDLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  153

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            TVEIITPVELI+KGDKVGSSEAALLAKLGIRPFSYGL+VLS YDNGSVFSPEVLDLTEDD
Sbjct  154  TVEIITPVELIKKGDKVGSSEAALLAKLGIRPFSYGLVVLSAYDNGSVFSPEVLDLTEDD  213

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L++KFA GVSM+ SLSLA SYPTLAAAPHM IN YKNVL++AV T+YSFP A+KVKE+L+
Sbjct  214  LIDKFAAGVSMIASLSLATSYPTLAAAPHMFINAYKNVLAVAVATEYSFPQAEKVKEFLE  273

Query  220  DPSKFavaaapvaaaaagsapaaaaaaeekkeepeeesEDEMGFSLFD  77
            DPSKF   AA    AAA     AAA  EEKKEEP EES+D+MGFSLFD
Sbjct  274  DPSKF-AVAAAPVTAAASGGAPAAAKEEEKKEEPAEESDDDMGFSLFD  320



>gb|ABK94988.1| unknown [Populus trichocarpa]
 gb|ABK95694.1| unknown [Populus trichocarpa]
Length=320

 Score =   310 bits (795),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 191/228 (84%), Positives = 204/228 (89%), Gaps = 1/228 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TKG LKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG
Sbjct  94   TKGDLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  153

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            TVEIITPVELI+KGDKVGSSEAALLAKLGIRPFSYGL+VLS YDNGSVFSPEVLDLTEDD
Sbjct  154  TVEIITPVELIKKGDKVGSSEAALLAKLGIRPFSYGLVVLSAYDNGSVFSPEVLDLTEDD  213

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L++KFA GVSM+ SLSLA SYPTLAAAPHM IN YKNVL++AV T+YSFP A+KVKE+L+
Sbjct  214  LIDKFAAGVSMIASLSLATSYPTLAAAPHMFINAYKNVLAVAVATEYSFPQAEKVKEFLE  273

Query  220  DPSKFavaaapvaaaaagsapaaaaaaeekkeepeeesEDEMGFSLFD  77
            DPSKF   AA    AAA     AAA  EEKKEEP EES+D+MGFSLFD
Sbjct  274  DPSKF-AVAAAPVTAAASGGAPAAAKEEEKKEEPAEESDDDMGFSLFD  320



>ref|XP_007222847.1| hypothetical protein PRUPE_ppa008800mg [Prunus persica]
 ref|XP_008222707.1| PREDICTED: 60S acidic ribosomal protein P0 [Prunus mume]
 gb|EMJ24046.1| hypothetical protein PRUPE_ppa008800mg [Prunus persica]
Length=319

 Score =   310 bits (794),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 164/185 (89%), Positives = 178/185 (96%), Gaps = 0/185 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TKG LKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG
Sbjct  94   TKGDLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  153

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            TVEIITPVELI+KGDKVGSSEAALLAKLGIRPFSYGL+V +VYDNGSVFSPEVLDLTEDD
Sbjct  154  TVEIITPVELIKKGDKVGSSEAALLAKLGIRPFSYGLVVQTVYDNGSVFSPEVLDLTEDD  213

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L+ KFALGVSMVTSL+LAI+YPTLAAAPHM +N YKNVL++++ T+Y+FP A+KVKEYLK
Sbjct  214  LMVKFALGVSMVTSLALAIAYPTLAAAPHMFLNAYKNVLAVSLATEYTFPQAEKVKEYLK  273

Query  220  DPSKF  206
            DPSKF
Sbjct  274  DPSKF  278



>ref|XP_010941551.1| PREDICTED: 60S acidic ribosomal protein P0 [Elaeis guineensis]
Length=321

 Score =   310 bits (794),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 196/228 (86%), Positives = 211/228 (93%), Gaps = 0/228 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TKG LKEV EEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG
Sbjct  94   TKGDLKEVREEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  153

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGL++ +VYDNGSVFSPEVLDLTEDD
Sbjct  154  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLVIQAVYDNGSVFSPEVLDLTEDD  213

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L+EKFA GVSMVTSLSLA+SYPTL AAPHM IN YKNVL++A+ T+Y+F  A+KVKEYLK
Sbjct  214  LVEKFAAGVSMVTSLSLALSYPTLVAAPHMFINAYKNVLAVAIATEYTFEQAEKVKEYLK  273

Query  220  DPSKFavaaapvaaaaagsapaaaaaaeekkeepeeesEDEMGFSLFD  77
            DPSKFAVAA   AAAAA +APAAAA  EEKKEEP EES+++MGFSLFD
Sbjct  274  DPSKFAVAAPVEAAAAAAAAPAAAAKEEEKKEEPAEESDEDMGFSLFD  321



>gb|AAD56335.1|AC009326_22 putative 60S acidic ribosomal protein, 5' partial [Arabidopsis 
thaliana]
Length=230

 Score =   306 bits (784),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 164/185 (89%), Positives = 175/185 (95%), Gaps = 0/185 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TKG LKEVSEEVAKYKVGAPARVGLVAPIDVVV PGNTGLDPSQTSFFQVLNIPTKINKG
Sbjct  3    TKGDLKEVSEEVAKYKVGAPARVGLVAPIDVVVQPGNTGLDPSQTSFFQVLNIPTKINKG  62

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            TVEIITPVELI++GDKVGSSEAALLAKLGIRPFSYGL+V SVYDNGSVFSPEVLDLTED 
Sbjct  63   TVEIITPVELIKQGDKVGSSEAALLAKLGIRPFSYGLVVQSVYDNGSVFSPEVLDLTEDQ  122

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L+EKFA G+SMVTSL+LA+SYPTLAAAPHM IN YKN L+IAV T+Y+FP A+KVKEYLK
Sbjct  123  LVEKFASGISMVTSLALAVSYPTLAAAPHMFINAYKNALAIAVATEYTFPQAEKVKEYLK  182

Query  220  DPSKF  206
            DPSKF
Sbjct  183  DPSKF  187



>gb|EPS69246.1| p0 ribosomal protein-like protein, partial [Genlisea aurea]
Length=329

 Score =   310 bits (793),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 199/229 (87%), Positives = 212/229 (93%), Gaps = 1/229 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TKG LKEVSEE+ KY+VGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG
Sbjct  101  TKGDLKEVSEEIGKYQVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  160

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            TVEIITPVELI+KG+KVGSSEAALLAKLGIRPFSYGLIV  VYDNGSVFSPEVL+LTEDD
Sbjct  161  TVEIITPVELIKKGEKVGSSEAALLAKLGIRPFSYGLIVTIVYDNGSVFSPEVLNLTEDD  220

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L+EKFA G+SMVT+LSL ISYPTLAAAPHM IN YKNVLS+A+ETDYSFP ADKVKEYL 
Sbjct  221  LIEKFASGISMVTALSLGISYPTLAAAPHMFINAYKNVLSLALETDYSFPQADKVKEYLA  280

Query  220  DPSKFavaaapvaaaaag-sapaaaaaaeekkeepeeesEDEMGFSLFD  77
            DPSKFAVAAAPVA AA   SAPAAAA  EEKK+EP EES+D+MGFSLFD
Sbjct  281  DPSKFAVAAAPVATAADSGSAPAAAAKEEEKKDEPAEESDDDMGFSLFD  329



>ref|XP_002882720.1| 60S acidic ribosomal protein P0 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH58979.1| 60S acidic ribosomal protein P0 [Arabidopsis lyrata subsp. lyrata]
Length=323

 Score =   309 bits (792),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 164/185 (89%), Positives = 175/185 (95%), Gaps = 0/185 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TKG LKEVSEEVAKYKVGAPARVGLVAPIDVVV PGNTGLDPSQTSFFQVLNIPTKINKG
Sbjct  93   TKGDLKEVSEEVAKYKVGAPARVGLVAPIDVVVQPGNTGLDPSQTSFFQVLNIPTKINKG  152

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            TVEIITPVELI++GDKVGSSEAALLAKLGIRPFSYGL+V SVYDNGSVFSPEVLDLTED 
Sbjct  153  TVEIITPVELIKQGDKVGSSEAALLAKLGIRPFSYGLVVQSVYDNGSVFSPEVLDLTEDQ  212

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L+EKFA G+SMVTSL+LA+SYPTLAAAPHM IN YKN L+IAV TDY+FP A+KVKE+LK
Sbjct  213  LVEKFASGISMVTSLALAVSYPTLAAAPHMFINAYKNALAIAVATDYTFPQAEKVKEFLK  272

Query  220  DPSKF  206
            DPSKF
Sbjct  273  DPSKF  277



>ref|XP_006298124.1| hypothetical protein CARUB_v10014186mg [Capsella rubella]
 gb|EOA31022.1| hypothetical protein CARUB_v10014186mg [Capsella rubella]
Length=323

 Score =   309 bits (792),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 164/185 (89%), Positives = 175/185 (95%), Gaps = 0/185 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TKG LKEVSEEVAKYKVGAPARVGLVAPIDVVV PGNTGLDPSQTSFFQVLNIPTKINKG
Sbjct  93   TKGDLKEVSEEVAKYKVGAPARVGLVAPIDVVVQPGNTGLDPSQTSFFQVLNIPTKINKG  152

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            TVEIITPVELI++GDKVGSSEAALLAKLGIRPFSYGL+V SVYDNGSVFSPEVLDLTED 
Sbjct  153  TVEIITPVELIKQGDKVGSSEAALLAKLGIRPFSYGLVVQSVYDNGSVFSPEVLDLTEDQ  212

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L+EKFA G+SMVTSL+LA+SYPTLAAAPHM IN YKN L+IAV TDY+FP A+KVKE+LK
Sbjct  213  LVEKFASGISMVTSLALAVSYPTLAAAPHMFINAYKNALAIAVATDYTFPQAEKVKEFLK  272

Query  220  DPSKF  206
            DPSKF
Sbjct  273  DPSKF  277



>ref|NP_187734.1| 60S acidic ribosomal protein P0-3 [Arabidopsis thaliana]
 sp|P57691.1|RLA03_ARATH RecName: Full=60S acidic ribosomal protein P0-3 [Arabidopsis 
thaliana]
 gb|AAG50973.1|AC073395_15 60S acidic ribosomal protein, putative; 58619-59992 [Arabidopsis 
thaliana]
 gb|AAL07229.1| putative 60S acidic ribosomal protein [Arabidopsis thaliana]
 gb|AAM14140.1| putative 60S acidic ribosomal protein [Arabidopsis thaliana]
 gb|AEE75020.1| 60S acidic ribosomal protein P0-3 [Arabidopsis thaliana]
Length=323

 Score =   309 bits (792),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 164/185 (89%), Positives = 175/185 (95%), Gaps = 0/185 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TKG LKEVSEEVAKYKVGAPARVGLVAPIDVVV PGNTGLDPSQTSFFQVLNIPTKINKG
Sbjct  93   TKGDLKEVSEEVAKYKVGAPARVGLVAPIDVVVQPGNTGLDPSQTSFFQVLNIPTKINKG  152

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            TVEIITPVELI++GDKVGSSEAALLAKLGIRPFSYGL+V SVYDNGSVFSPEVLDLTED 
Sbjct  153  TVEIITPVELIKQGDKVGSSEAALLAKLGIRPFSYGLVVQSVYDNGSVFSPEVLDLTEDQ  212

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L+EKFA G+SMVTSL+LA+SYPTLAAAPHM IN YKN L+IAV TDY+FP A+KVKE+LK
Sbjct  213  LVEKFASGISMVTSLALAVSYPTLAAAPHMFINAYKNALAIAVATDYTFPQAEKVKEFLK  272

Query  220  DPSKF  206
            DPSKF
Sbjct  273  DPSKF  277



>ref|XP_010464828.1| PREDICTED: 60S acidic ribosomal protein P0-3-like [Camelina sativa]
Length=324

 Score =   309 bits (792),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 164/185 (89%), Positives = 175/185 (95%), Gaps = 0/185 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TKG LKEVSEEVAKYKVGAPARVGLVAPIDVVV PGNTGLDPSQTSFFQVLNIPTKINKG
Sbjct  93   TKGDLKEVSEEVAKYKVGAPARVGLVAPIDVVVQPGNTGLDPSQTSFFQVLNIPTKINKG  152

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            TVEIITPVELI++GDKVGSSEAALLAKLGIRPFSYGL+V SVYDNGSVFSPEVLDLTED 
Sbjct  153  TVEIITPVELIKQGDKVGSSEAALLAKLGIRPFSYGLVVQSVYDNGSVFSPEVLDLTEDQ  212

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L+EKFA G+SMVTSL+LA+SYPTLAAAPHM IN YKN L+IAV TDY+FP A+KVKE+LK
Sbjct  213  LVEKFASGISMVTSLALAVSYPTLAAAPHMFINAYKNALAIAVATDYTFPQAEKVKEFLK  272

Query  220  DPSKF  206
            DPSKF
Sbjct  273  DPSKF  277



>ref|NP_001078125.1| 60S acidic ribosomal protein P0-2 [Arabidopsis thaliana]
 gb|AEE74737.1| 60S acidic ribosomal protein P0-2 [Arabidopsis thaliana]
Length=287

 Score =   308 bits (789),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 164/185 (89%), Positives = 175/185 (95%), Gaps = 0/185 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TKG LKEVSEEVAKYKVGAPARVGLVAPIDVVV PGNTGLDPSQTSFFQVLNIPTKINKG
Sbjct  60   TKGDLKEVSEEVAKYKVGAPARVGLVAPIDVVVQPGNTGLDPSQTSFFQVLNIPTKINKG  119

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            TVEIITPVELI++GDKVGSSEAALLAKLGIRPFSYGL+V SVYDNGSVFSPEVLDLTED 
Sbjct  120  TVEIITPVELIKQGDKVGSSEAALLAKLGIRPFSYGLVVQSVYDNGSVFSPEVLDLTEDQ  179

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L+EKFA G+SMVTSL+LA+SYPTLAAAPHM IN YKN L+IAV T+Y+FP A+KVKEYLK
Sbjct  180  LVEKFASGISMVTSLALAVSYPTLAAAPHMFINAYKNALAIAVATEYTFPQAEKVKEYLK  239

Query  220  DPSKF  206
            DPSKF
Sbjct  240  DPSKF  244



>ref|NP_187531.1| 60S acidic ribosomal protein P0-2 [Arabidopsis thaliana]
 sp|Q42112.2|RLA02_ARATH RecName: Full=60S acidic ribosomal protein P0-2 [Arabidopsis 
thaliana]
 gb|AAF14020.1|AC011436_4 putative 60S acidic ribosomal protein P0 [Arabidopsis thaliana]
 gb|AAK44040.1|AF370225_1 putative 60S acidic ribosomal protein P0 [Arabidopsis thaliana]
 gb|AAL15223.1| putative 60S acidic ribosomal protein P0 [Arabidopsis thaliana]
 gb|AEE74736.1| 60S acidic ribosomal protein P0-2 [Arabidopsis thaliana]
Length=320

 Score =   309 bits (791),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 164/185 (89%), Positives = 175/185 (95%), Gaps = 0/185 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TKG LKEVSEEVAKYKVGAPARVGLVAPIDVVV PGNTGLDPSQTSFFQVLNIPTKINKG
Sbjct  93   TKGDLKEVSEEVAKYKVGAPARVGLVAPIDVVVQPGNTGLDPSQTSFFQVLNIPTKINKG  152

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            TVEIITPVELI++GDKVGSSEAALLAKLGIRPFSYGL+V SVYDNGSVFSPEVLDLTED 
Sbjct  153  TVEIITPVELIKQGDKVGSSEAALLAKLGIRPFSYGLVVQSVYDNGSVFSPEVLDLTEDQ  212

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L+EKFA G+SMVTSL+LA+SYPTLAAAPHM IN YKN L+IAV T+Y+FP A+KVKEYLK
Sbjct  213  LVEKFASGISMVTSLALAVSYPTLAAAPHMFINAYKNALAIAVATEYTFPQAEKVKEYLK  272

Query  220  DPSKF  206
            DPSKF
Sbjct  273  DPSKF  277



>gb|AAM63644.1| putative 60S acidic ribosomal protein P0 [Arabidopsis thaliana]
Length=320

 Score =   309 bits (791),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 164/185 (89%), Positives = 175/185 (95%), Gaps = 0/185 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TKG LKEVSEEVAKYKVGAPARVGLVAPIDVVV PGNTGLDPSQTSFFQVLNIPTKINKG
Sbjct  93   TKGDLKEVSEEVAKYKVGAPARVGLVAPIDVVVQPGNTGLDPSQTSFFQVLNIPTKINKG  152

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            TVEIITPVELI++GDKVGSSEAALLAKLGIRPFSYGL+V SVYDNGSVFSPEVLDLTED 
Sbjct  153  TVEIITPVELIKQGDKVGSSEAALLAKLGIRPFSYGLVVQSVYDNGSVFSPEVLDLTEDQ  212

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L+EKFA G+SMVTSL+LA+SYPTLAAAPHM IN YKN L+IAV T+Y+FP A+KVKEYLK
Sbjct  213  LVEKFASGISMVTSLALAVSYPTLAAAPHMFINAYKNALAIAVATEYTFPQAEKVKEYLK  272

Query  220  DPSKF  206
            DPSKF
Sbjct  273  DPSKF  277



>ref|XP_011035984.1| PREDICTED: 60S acidic ribosomal protein P0 [Populus euphratica]
Length=320

 Score =   309 bits (791),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 190/228 (83%), Positives = 205/228 (90%), Gaps = 1/228 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TKG LKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG
Sbjct  94   TKGDLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  153

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            TVEIITPVELI+KGDKVGSSEAALLAKLGIRPFSYGL+VLS YDNGSVFSPEVLDLTEDD
Sbjct  154  TVEIITPVELIKKGDKVGSSEAALLAKLGIRPFSYGLVVLSAYDNGSVFSPEVLDLTEDD  213

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L+EKFA GVSM+ SLSLA SYPTLAAAPHM IN YKN+L++AV T+YS+P A+KVKE+L+
Sbjct  214  LVEKFAAGVSMIASLSLATSYPTLAAAPHMFINAYKNILAVAVATEYSYPQAEKVKEFLE  273

Query  220  DPSKFavaaapvaaaaagsapaaaaaaeekkeepeeesEDEMGFSLFD  77
            DPSKF   AA    AAA  +  AAA  EEKKEEP EES+D+MGFSLFD
Sbjct  274  DPSKF-AVAAAPVTAAASGSAPAAAKEEEKKEEPAEESDDDMGFSLFD  320



>ref|XP_010256605.1| PREDICTED: 60S acidic ribosomal protein P0 [Nelumbo nucifera]
Length=319

 Score =   308 bits (790),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 164/185 (89%), Positives = 175/185 (95%), Gaps = 0/185 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TKG LKEVSEEV KYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG
Sbjct  94   TKGDLKEVSEEVGKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  153

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            TVEIITPVELI+KGDKVGSSEAALL+KLGIRPFSYGLI+ SVYDNGSVFSPEVLDLTEDD
Sbjct  154  TVEIITPVELIKKGDKVGSSEAALLSKLGIRPFSYGLIIQSVYDNGSVFSPEVLDLTEDD  213

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L+EKFA GVSM T+L+LA+SYP LAAAPHM +N YKNVL++AV TDYSFP A+KVKEYLK
Sbjct  214  LVEKFAAGVSMATALALAVSYPMLAAAPHMFVNAYKNVLAVAVATDYSFPQAEKVKEYLK  273

Query  220  DPSKF  206
            DPSKF
Sbjct  274  DPSKF  278



>ref|XP_007016138.1| Ribosomal protein L10 family protein [Theobroma cacao]
 gb|EOY33757.1| Ribosomal protein L10 family protein [Theobroma cacao]
Length=321

 Score =   308 bits (790),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 164/185 (89%), Positives = 175/185 (95%), Gaps = 0/185 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TKG LKEV EEVAKYKVGAPARVGL+APIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG
Sbjct  94   TKGDLKEVREEVAKYKVGAPARVGLIAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  153

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            TVEIITPVELI+KGDKVGSSEAALL+KLGIRPFSYGL+VLSVYD+GSVFSPEVLDLTEDD
Sbjct  154  TVEIITPVELIKKGDKVGSSEAALLSKLGIRPFSYGLVVLSVYDSGSVFSPEVLDLTEDD  213

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L+EKFA GVSM  SLSLAISYPTLAAAPHM +N YKN L++AV +DYSFP A+KVKEYLK
Sbjct  214  LVEKFANGVSMAASLSLAISYPTLAAAPHMFVNAYKNALAVAVASDYSFPQAEKVKEYLK  273

Query  220  DPSKF  206
            DPSKF
Sbjct  274  DPSKF  278



>ref|XP_006360336.1| PREDICTED: 60S acidic ribosomal protein P0-like [Solanum tuberosum]
Length=320

 Score =   308 bits (790),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 157/185 (85%), Positives = 179/185 (97%), Gaps = 0/185 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TKG LKE+ EEVAKYKVGAPARVGLVAP+DV+VPPGNTGLDPSQTSFFQVLNIPTKIN+G
Sbjct  94   TKGDLKEIKEEVAKYKVGAPARVGLVAPVDVIVPPGNTGLDPSQTSFFQVLNIPTKINRG  153

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            TVEIITPVELI+KGDKVGSSEAALL+KLGIRPFSYGL+V+SVYDNGSVFSPEVLDLT++D
Sbjct  154  TVEIITPVELIKKGDKVGSSEAALLSKLGIRPFSYGLVVISVYDNGSVFSPEVLDLTDED  213

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L+EKFA GV+M+T+LSLAISYPTLAAAPHM++NGYKNVL +A+ET+Y++P A +VKEYLK
Sbjct  214  LVEKFAAGVAMMTTLSLAISYPTLAAAPHMIVNGYKNVLCVALETEYTYPQAQQVKEYLK  273

Query  220  DPSKF  206
            DPSKF
Sbjct  274  DPSKF  278



>ref|XP_002884720.1| 60S acidic ribosomal protein P0 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH60979.1| 60S acidic ribosomal protein P0 [Arabidopsis lyrata subsp. lyrata]
Length=322

 Score =   308 bits (790),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 164/185 (89%), Positives = 175/185 (95%), Gaps = 0/185 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TKG LKEVSEEVAKYKVGAPARVGLVAPIDVVV PGNTGLDPSQTSFFQVLNIPTKINKG
Sbjct  93   TKGDLKEVSEEVAKYKVGAPARVGLVAPIDVVVQPGNTGLDPSQTSFFQVLNIPTKINKG  152

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            TVEIITPVELI++GDKVGSSEAALLAKLGIRPFSYGL+V SVYDNGSVFSPEVLDLTED 
Sbjct  153  TVEIITPVELIKQGDKVGSSEAALLAKLGIRPFSYGLVVQSVYDNGSVFSPEVLDLTEDQ  212

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L+EKFA G+SMVTSL+LAISYPTLAAAPHM IN YKN L+IAV T+Y+FP A+KVKE+LK
Sbjct  213  LVEKFASGISMVTSLALAISYPTLAAAPHMFINAYKNALAIAVATEYTFPQAEKVKEFLK  272

Query  220  DPSKF  206
            DPSKF
Sbjct  273  DPSKF  277



>ref|XP_006411245.1| hypothetical protein EUTSA_v10016954mg [Eutrema salsugineum]
 gb|ESQ52698.1| hypothetical protein EUTSA_v10016954mg [Eutrema salsugineum]
Length=317

 Score =   308 bits (789),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 165/185 (89%), Positives = 176/185 (95%), Gaps = 0/185 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TKG LKEVSEEVAKYKVGAPARVGLVAPIDVVV PGNTGLDPSQTSFFQVLNIPTKINKG
Sbjct  94   TKGDLKEVSEEVAKYKVGAPARVGLVAPIDVVVQPGNTGLDPSQTSFFQVLNIPTKINKG  153

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            TVEIITPVELI+KGDKVGSSEAALLAKLGIRPFSYGLIV SVYDNGSVFSPEVL+LTEDD
Sbjct  154  TVEIITPVELIKKGDKVGSSEAALLAKLGIRPFSYGLIVESVYDNGSVFSPEVLNLTEDD  213

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L+EKFA GVS++T+LSLAISYPTLAAAPHM +N YKNVL+IA+ T+YSFP AD VKE+LK
Sbjct  214  LVEKFAAGVSLITALSLAISYPTLAAAPHMFLNAYKNVLAIALATEYSFPQADNVKEFLK  273

Query  220  DPSKF  206
            DPSKF
Sbjct  274  DPSKF  278



>ref|XP_004307622.1| PREDICTED: 60S acidic ribosomal protein P0 [Fragaria vesca subsp. 
vesca]
Length=321

 Score =   308 bits (789),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 191/229 (83%), Positives = 205/229 (90%), Gaps = 1/229 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TKG LKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG
Sbjct  93   TKGDLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  152

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            TVEIITPVELI+KGDKVGSSEAALLAKLGIRPFSYGL+V  VYDNGSVFSPEVLDLTEDD
Sbjct  153  TVEIITPVELIKKGDKVGSSEAALLAKLGIRPFSYGLVVQMVYDNGSVFSPEVLDLTEDD  212

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L+ KFA GVS VT+L+LAISYPT+AAAPHM +N YKNVL+IAV T+YSFP ADKVKEYL+
Sbjct  213  LMIKFASGVSNVTALALAISYPTIAAAPHMFLNAYKNVLAIAVATEYSFPQADKVKEYLE  272

Query  220  DPSKFavaaapvaaaaagsapaaaaaaeekkeepeeesE-DEMGFSLFD  77
            DPSKFAV+ A  AAAA G+A  AAAA EE K+E   E   D+MGFSLFD
Sbjct  273  DPSKFAVSVAAPAAAAGGAAAPAAAAKEEAKKEEPAEESDDDMGFSLFD  321



>ref|XP_004247949.1| PREDICTED: 60S acidic ribosomal protein P0-like [Solanum lycopersicum]
Length=320

 Score =   308 bits (789),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 156/185 (84%), Positives = 178/185 (96%), Gaps = 0/185 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TKG LKE+ EEVAKYKVGAPARVGL+AP+DV+VPPGNTGLDPSQTSFFQVLNI TKINKG
Sbjct  94   TKGDLKEIKEEVAKYKVGAPARVGLIAPVDVIVPPGNTGLDPSQTSFFQVLNIATKINKG  153

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            TVEIITPVELI+KGDKVGSSEAALL+KLGIRPFSYGL+V+SVYDNGSVFSP+VLDLT++D
Sbjct  154  TVEIITPVELIKKGDKVGSSEAALLSKLGIRPFSYGLVVISVYDNGSVFSPQVLDLTDED  213

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L+EKFA GV+M+T+LSLAISYPTLAAAPHM++NGYKNVL +AVET+Y++P A +VKEYLK
Sbjct  214  LVEKFAAGVTMITTLSLAISYPTLAAAPHMIVNGYKNVLGVAVETEYTYPQAQQVKEYLK  273

Query  220  DPSKF  206
            DPSKF
Sbjct  274  DPSKF  278



>ref|XP_010486480.1| PREDICTED: 60S acidic ribosomal protein P0-3-like [Camelina sativa]
Length=321

 Score =   308 bits (788),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 163/185 (88%), Positives = 175/185 (95%), Gaps = 0/185 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TKG LKEVSEEVAKYKVGAPARVGLVAPIDVVV PGNTGLDPSQTSFFQVLNIPTKINKG
Sbjct  93   TKGDLKEVSEEVAKYKVGAPARVGLVAPIDVVVQPGNTGLDPSQTSFFQVLNIPTKINKG  152

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            TVEIITPVELI++GDKVGSSEAALLAKLGIRPFSYGL+V SVYDNGSVFSPEVLDLTED 
Sbjct  153  TVEIITPVELIKQGDKVGSSEAALLAKLGIRPFSYGLVVQSVYDNGSVFSPEVLDLTEDQ  212

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L+EKFA G+SMVTSL+LA+SYPTLAAAPHM IN YKN L+IAV T+Y+FP A+KVKE+LK
Sbjct  213  LVEKFASGISMVTSLALAVSYPTLAAAPHMFINAYKNALAIAVATEYTFPQAEKVKEFLK  272

Query  220  DPSKF  206
            DPSKF
Sbjct  273  DPSKF  277



>emb|CDP14047.1| unnamed protein product [Coffea canephora]
Length=320

 Score =   308 bits (788),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 203/228 (89%), Positives = 211/228 (93%), Gaps = 1/228 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TKG LKE+SEEVAKYKVGAPARVGLVAP+DVVVPPGNTGLDPSQTSFFQVLNIPTKINKG
Sbjct  94   TKGDLKEISEEVAKYKVGAPARVGLVAPVDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  153

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGL+VLSVYDNGSVFSPEVLDLTEDD
Sbjct  154  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLVVLSVYDNGSVFSPEVLDLTEDD  213

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L+EKFALGVSMVTSLSLAISYPTLAAAPHM INGYKNVL+IAVETDYSFP ADKVKEYL+
Sbjct  214  LIEKFALGVSMVTSLSLAISYPTLAAAPHMFINGYKNVLAIAVETDYSFPQADKVKEYLE  273

Query  220  DPSKFavaaapvaaaaagsapaaaaaaeekkeepeeesEDEMGFSLFD  77
            DPSKF   AA   AAA   A  AAA  EEKKEEP EES+D+MGFSLFD
Sbjct  274  DPSKF-AVAAAPVAAADSGAAPAAAKEEEKKEEPAEESDDDMGFSLFD  320



>ref|XP_010469822.1| PREDICTED: 60S acidic ribosomal protein P0-3-like [Camelina sativa]
Length=321

 Score =   308 bits (788),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 163/185 (88%), Positives = 175/185 (95%), Gaps = 0/185 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TKG LKEVSEEVAKYKVGAPARVGLVAPIDVVV PGNTGLDPSQTSFFQVLNIPTKINKG
Sbjct  93   TKGDLKEVSEEVAKYKVGAPARVGLVAPIDVVVQPGNTGLDPSQTSFFQVLNIPTKINKG  152

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            TVEIITPVELI++GDKVGSSEAALLAKLGIRPFSYGL+V SVYDNGSVFSPEVLDLTED 
Sbjct  153  TVEIITPVELIKQGDKVGSSEAALLAKLGIRPFSYGLVVQSVYDNGSVFSPEVLDLTEDQ  212

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L+EKFA G+SMVTSL+LA+SYPTLAAAPHM IN YKN L+IAV T+Y+FP A+KVKE+LK
Sbjct  213  LVEKFASGISMVTSLALAVSYPTLAAAPHMFINAYKNALAIAVATEYTFPQAEKVKEFLK  272

Query  220  DPSKF  206
            DPSKF
Sbjct  273  DPSKF  277



>ref|XP_009344598.1| PREDICTED: 60S acidic ribosomal protein P0 [Pyrus x bretschneideri]
Length=321

 Score =   307 bits (787),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 165/185 (89%), Positives = 177/185 (96%), Gaps = 0/185 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TKG LKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG
Sbjct  94   TKGDLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  153

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            TVEIITPVELI+KGDKVGSSEAALLAKLGIRPFSYGL+V  VYDNGSVFSPEVLDLTEDD
Sbjct  154  TVEIITPVELIKKGDKVGSSEAALLAKLGIRPFSYGLVVEMVYDNGSVFSPEVLDLTEDD  213

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L+EKFA GVSMVTSL+LAISYPTLAAAPHM +N YKNVL++++ T+YSFP A+KVKE+LK
Sbjct  214  LMEKFASGVSMVTSLALAISYPTLAAAPHMFLNAYKNVLAVSIATEYSFPQAEKVKEFLK  273

Query  220  DPSKF  206
            DPSKF
Sbjct  274  DPSKF  278



>emb|CDY07906.1| BnaC03g36170D [Brassica napus]
Length=323

 Score =   308 bits (788),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 163/185 (88%), Positives = 175/185 (95%), Gaps = 0/185 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TKG LKEVSEEVAKYKVGAPARVGLVAPIDVVV PGNTGLDPSQTSFFQVLNIPTKINKG
Sbjct  93   TKGDLKEVSEEVAKYKVGAPARVGLVAPIDVVVQPGNTGLDPSQTSFFQVLNIPTKINKG  152

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            TVEIITPVELI++GDKVGSSEAALLAKLGIRPFSYGL+V SVYDNGSVFSPEVLDLTEDD
Sbjct  153  TVEIITPVELIKQGDKVGSSEAALLAKLGIRPFSYGLVVQSVYDNGSVFSPEVLDLTEDD  212

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L++KFA G+SMVTSL+LAIS+PTLAAAPHM IN YKN L+I V T+Y+FP A+KVKEYLK
Sbjct  213  LVQKFAAGISMVTSLALAISFPTLAAAPHMFINAYKNALAICVATEYTFPQAEKVKEYLK  272

Query  220  DPSKF  206
            DPSKF
Sbjct  273  DPSKF  277



>gb|AAM65265.1| 60S acidic ribosomal protein P0-C [Arabidopsis thaliana]
Length=323

 Score =   307 bits (787),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 163/185 (88%), Positives = 175/185 (95%), Gaps = 0/185 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TKG LKEVSEEVAKYKVGAPARVGLVAPIDVVV PGNTGLDPSQTSFFQVLNIPTKINKG
Sbjct  93   TKGDLKEVSEEVAKYKVGAPARVGLVAPIDVVVQPGNTGLDPSQTSFFQVLNIPTKINKG  152

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            TVEIITPVELI++GDKVGSSEAALLAKLGIRPFSYGL+V SVYDNGSVFSPEVLDLTED 
Sbjct  153  TVEIITPVELIKQGDKVGSSEAALLAKLGIRPFSYGLVVQSVYDNGSVFSPEVLDLTEDQ  212

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L+EKFA G+SMVTSL+LA+SYPTLAAAPHM IN YKN L+IAV T+Y+FP A+KVKE+LK
Sbjct  213  LVEKFASGISMVTSLALAVSYPTLAAAPHMFINAYKNALAIAVATNYTFPQAEKVKEFLK  272

Query  220  DPSKF  206
            DPSKF
Sbjct  273  DPSKF  277



>ref|XP_010247657.1| PREDICTED: 60S acidic ribosomal protein P0-like [Nelumbo nucifera]
Length=320

 Score =   307 bits (787),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 189/228 (83%), Positives = 205/228 (90%), Gaps = 1/228 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TKG LKEVSEEVAKYKVGAPARVGL+APIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG
Sbjct  94   TKGDLKEVSEEVAKYKVGAPARVGLIAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  153

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            TVEIITPVELI+KG+KVGSSEAALLAKLGIRPFSYGL +LSVYDNGSVFSPEVLDLTEDD
Sbjct  154  TVEIITPVELIKKGEKVGSSEAALLAKLGIRPFSYGLNILSVYDNGSVFSPEVLDLTEDD  213

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L+EKF  GVSMVT+LSLA+SYPTLAAAPHM +N YKNVL++AV T+YS+P A++VKEYLK
Sbjct  214  LMEKFVSGVSMVTALSLAVSYPTLAAAPHMFVNAYKNVLAVAVATEYSYPQAEQVKEYLK  273

Query  220  DPSKFavaaapvaaaaagsapaaaaaaeekkeepeeesEDEMGFSLFD  77
            DPSKF   AA   AAA      AAA  EEKKEEP EES+D+MGFSLFD
Sbjct  274  DPSKF-AVAAAPLAAAPSGGAPAAAPVEEKKEEPAEESDDDMGFSLFD  320



>ref|XP_006298147.1| hypothetical protein CARUB_v10014197mg [Capsella rubella]
 gb|EOA31045.1| hypothetical protein CARUB_v10014197mg [Capsella rubella]
Length=322

 Score =   307 bits (787),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 163/185 (88%), Positives = 175/185 (95%), Gaps = 0/185 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TKG LKEVSEEVAKYKVGAPARVGLVAPIDVVV PGNTGLDPSQTSFFQVLNIPTKINKG
Sbjct  93   TKGDLKEVSEEVAKYKVGAPARVGLVAPIDVVVQPGNTGLDPSQTSFFQVLNIPTKINKG  152

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            TVEIITPVELI++GDKVGSSEAALLAKLGIRPFSYGL+V SVYDNGSVFSPEVLDLTED 
Sbjct  153  TVEIITPVELIKQGDKVGSSEAALLAKLGIRPFSYGLVVQSVYDNGSVFSPEVLDLTEDQ  212

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L+EKFA G+SMVTSL+LA+SYPTLAAAPHM IN YKN L+IAV T+Y+FP A+KVKE+LK
Sbjct  213  LVEKFASGISMVTSLALAVSYPTLAAAPHMFINAYKNALAIAVATEYTFPQAEKVKEFLK  272

Query  220  DPSKF  206
            DPSKF
Sbjct  273  DPSKF  277



>ref|XP_004307662.1| PREDICTED: 60S acidic ribosomal protein P0 [Fragaria vesca subsp. 
vesca]
Length=321

 Score =   307 bits (787),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 165/185 (89%), Positives = 175/185 (95%), Gaps = 0/185 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TKG LKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG
Sbjct  93   TKGDLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  152

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            TVEIITPVELI+KGDKVGSSEAALLAKLGIRPFSYGL+V  VYDNGSVFSPEVLDLTEDD
Sbjct  153  TVEIITPVELIKKGDKVGSSEAALLAKLGIRPFSYGLVVQMVYDNGSVFSPEVLDLTEDD  212

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L+ KFA GVS VT+L+LAISYPT+AAAPHM +N YKNVL+IAV T+YSFP ADKVKEYL+
Sbjct  213  LMIKFASGVSNVTALALAISYPTIAAAPHMFLNAYKNVLAIAVATEYSFPQADKVKEYLE  272

Query  220  DPSKF  206
            DPSKF
Sbjct  273  DPSKF  277



>ref|XP_009791710.1| PREDICTED: 60S acidic ribosomal protein P0 [Nicotiana sylvestris]
Length=321

 Score =   307 bits (786),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 200/228 (88%), Positives = 210/228 (92%), Gaps = 0/228 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TKG LKEVSEEVAKYKVGAPARVGLVAP+DVVVPPGNTGLDPSQTSFFQVLNIPTKINKG
Sbjct  94   TKGDLKEVSEEVAKYKVGAPARVGLVAPVDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  153

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            TVEIITPVELI+KGDKVGSSEAALLAKLGIRPFSYGL+VLSVYDNGSVFSPEVLDLTEDD
Sbjct  154  TVEIITPVELIKKGDKVGSSEAALLAKLGIRPFSYGLVVLSVYDNGSVFSPEVLDLTEDD  213

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L+EKFA+GVSMVTSLSLAISYPTLAAAPHM  N YKNVL+IAVETDYSFPLADKVKEYL+
Sbjct  214  LIEKFAMGVSMVTSLSLAISYPTLAAAPHMFTNAYKNVLAIAVETDYSFPLADKVKEYLE  273

Query  220  DPSKFavaaapvaaaaagsapaaaaaaeekkeepeeesEDEMGFSLFD  77
            DPSKF   AA   AAA   A  AAA  EEKK+EP EES+D+MGFSLFD
Sbjct  274  DPSKFTAVAAAPVAAAGSGAAPAAAKEEEKKDEPAEESDDDMGFSLFD  321



>ref|XP_008392940.1| PREDICTED: 60S acidic ribosomal protein P0 [Malus domestica]
Length=321

 Score =   307 bits (786),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 163/185 (88%), Positives = 176/185 (95%), Gaps = 0/185 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TKG LKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG
Sbjct  94   TKGDLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  153

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            TVEIITPVELI+KGDKVGSSEAALLAKLGIRPFSYGL+V  VYDNGSVFSPEVLDLTEDD
Sbjct  154  TVEIITPVELIKKGDKVGSSEAALLAKLGIRPFSYGLVVEMVYDNGSVFSPEVLDLTEDD  213

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L+ KFA GVSMVTSL+LA+SYPTLAAAPHM +N YKNVL++++ T+YSFP A+KVKE+LK
Sbjct  214  LMVKFASGVSMVTSLALAVSYPTLAAAPHMFLNAYKNVLAVSIATEYSFPQAEKVKEFLK  273

Query  220  DPSKF  206
            DPSKF
Sbjct  274  DPSKF  278



>ref|XP_009619762.1| PREDICTED: 60S acidic ribosomal protein P0-like [Nicotiana tomentosiformis]
Length=323

 Score =   307 bits (786),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 161/185 (87%), Positives = 177/185 (96%), Gaps = 0/185 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TKG LKE+ EEVAKYKVGAPARVGLVAP+DV+VP GNTGLDPSQTSFFQVLNIPTKINKG
Sbjct  94   TKGDLKEIKEEVAKYKVGAPARVGLVAPVDVIVPTGNTGLDPSQTSFFQVLNIPTKINKG  153

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            TVEIITPVELI+KGDKVGSSEAALLAKLGIRPFSYGL+V+SVYDNGSVFSPEVLDLTEDD
Sbjct  154  TVEIITPVELIKKGDKVGSSEAALLAKLGIRPFSYGLVVVSVYDNGSVFSPEVLDLTEDD  213

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L+EKFA GVSMVT+LSLA+SYPTLAAAP+M + GYKNVL++ VET+YS+P AD+VKEYLK
Sbjct  214  LMEKFATGVSMVTTLSLAVSYPTLAAAPYMFVKGYKNVLAVTVETEYSYPQADQVKEYLK  273

Query  220  DPSKF  206
            DPSKF
Sbjct  274  DPSKF  278



>ref|XP_010464557.1| PREDICTED: 60S acidic ribosomal protein P0-3-like [Camelina sativa]
 ref|XP_010464558.1| PREDICTED: 60S acidic ribosomal protein P0-3-like [Camelina sativa]
Length=321

 Score =   307 bits (786),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 163/185 (88%), Positives = 175/185 (95%), Gaps = 0/185 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TKG LKEVSEEVAKYKVGAPARVGLVAPIDVVV PGNTGLDPSQTSFFQVLNIPTKINKG
Sbjct  93   TKGDLKEVSEEVAKYKVGAPARVGLVAPIDVVVQPGNTGLDPSQTSFFQVLNIPTKINKG  152

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            TVEIITPVELI++GDKVGSSEAALLAKLGIRPFSYGL+V SVYDNGSVFSPEVLDLTED 
Sbjct  153  TVEIITPVELIKQGDKVGSSEAALLAKLGIRPFSYGLVVQSVYDNGSVFSPEVLDLTEDQ  212

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L+EKFA G+SMVTSL+LA+SYPTLAAAPHM IN YKN L+IAV T+Y+FP A+KVKE+LK
Sbjct  213  LVEKFASGISMVTSLALAVSYPTLAAAPHMFINAYKNALAIAVVTEYTFPQAEKVKEFLK  272

Query  220  DPSKF  206
            DPSKF
Sbjct  273  DPSKF  277



>emb|CDX73962.1| BnaA03g30850D [Brassica napus]
Length=323

 Score =   307 bits (786),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 162/185 (88%), Positives = 175/185 (95%), Gaps = 0/185 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TKG LKEVSEEVAKYKVGAPARVGLVAPIDVVV PGNTGLDPSQTSFFQVLNIPTKINKG
Sbjct  93   TKGDLKEVSEEVAKYKVGAPARVGLVAPIDVVVQPGNTGLDPSQTSFFQVLNIPTKINKG  152

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            TVEIITPVELI++GDKVGSSEAALLAKLGIRPFSYGL+V SVYDNGSVFSPEVLDLTEDD
Sbjct  153  TVEIITPVELIKQGDKVGSSEAALLAKLGIRPFSYGLVVQSVYDNGSVFSPEVLDLTEDD  212

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L++KFA G+SMVTSL+LAIS+PTLAAAPHM IN YKN L+I + T+Y+FP A+KVKEYLK
Sbjct  213  LVQKFAAGISMVTSLALAISFPTLAAAPHMFINAYKNALAICIATEYTFPQAEKVKEYLK  272

Query  220  DPSKF  206
            DPSKF
Sbjct  273  DPSKF  277



>ref|XP_008799093.1| PREDICTED: 60S acidic ribosomal protein P0 [Phoenix dactylifera]
Length=320

 Score =   306 bits (785),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 194/228 (85%), Positives = 211/228 (93%), Gaps = 1/228 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TKG LKEV EEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG
Sbjct  94   TKGDLKEVREEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  153

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            TVEIITPVELIRKG+KVGSSEAALLAKLGIRPFSYGL++ SVY+NGSVFSPEVLDLTEDD
Sbjct  154  TVEIITPVELIRKGEKVGSSEAALLAKLGIRPFSYGLVIQSVYENGSVFSPEVLDLTEDD  213

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L+EKFA G+SMVTSLSLA+SYPTLAAAPHM IN YKNVL++A+ T+Y+FP A+KVKE+L+
Sbjct  214  LIEKFAAGLSMVTSLSLALSYPTLAAAPHMFINAYKNVLAVAIATEYTFPQAEKVKEFLE  273

Query  220  DPSKFavaaapvaaaaagsapaaaaaaeekkeepeeesEDEMGFSLFD  77
            DPSKF   AAPVAAA A S PAAAA  EEKK EPEEES+D+MGFSLFD
Sbjct  274  DPSKF-AVAAPVAAAEAASTPAAAAKEEEKKAEPEEESDDDMGFSLFD  320



>ref|XP_009764939.1| PREDICTED: 60S acidic ribosomal protein P0-like [Nicotiana sylvestris]
Length=323

 Score =   306 bits (785),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 159/185 (86%), Positives = 178/185 (96%), Gaps = 0/185 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TKG LKE+ EEVAKYKVGAPARVGLVAP+DV+VP GNTGLDPSQTSFFQVLNIPTKINKG
Sbjct  94   TKGDLKEIKEEVAKYKVGAPARVGLVAPVDVIVPTGNTGLDPSQTSFFQVLNIPTKINKG  153

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            TVEI+TPVELI+KGDKVGSSEAALLAKLGIRPFSYGL+++SVYDNGSVFSPEVL+LTEDD
Sbjct  154  TVEIMTPVELIKKGDKVGSSEAALLAKLGIRPFSYGLVMVSVYDNGSVFSPEVLELTEDD  213

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L+EKFA GVSMVT+LSLA+SYPTLAAAP+M + GY+NVL++AVETDYS+P AD+VKEYLK
Sbjct  214  LMEKFATGVSMVTTLSLAVSYPTLAAAPYMFVKGYENVLAVAVETDYSYPQADQVKEYLK  273

Query  220  DPSKF  206
            DPSKF
Sbjct  274  DPSKF  278



>ref|XP_009350848.1| PREDICTED: 60S acidic ribosomal protein P0-like [Pyrus x bretschneideri]
Length=321

 Score =   306 bits (784),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 164/185 (89%), Positives = 176/185 (95%), Gaps = 0/185 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TKG LKEVSEEV KYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG
Sbjct  94   TKGDLKEVSEEVGKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  153

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            TVEIITPVELI+KGDKVGSSEAALLAKLGIRPFSYGL+V  VYDNGSVFSPEVLDLTEDD
Sbjct  154  TVEIITPVELIKKGDKVGSSEAALLAKLGIRPFSYGLVVQMVYDNGSVFSPEVLDLTEDD  213

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L+EKFA GVSMVTSL+LAISYPTLAAAPHM +N YKNVL++++ T+YSFP A+KVKE+LK
Sbjct  214  LMEKFASGVSMVTSLALAISYPTLAAAPHMFLNAYKNVLAVSIATEYSFPQAEKVKEFLK  273

Query  220  DPSKF  206
            DPSKF
Sbjct  274  DPSKF  278



>gb|KFK38515.1| hypothetical protein AALP_AA3G123100 [Arabis alpina]
Length=324

 Score =   306 bits (784),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 160/185 (86%), Positives = 175/185 (95%), Gaps = 0/185 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TKG LKEVSEEVAKYKVGAPARVGLVAPIDVVV PGNTGLDPSQTSFFQVLNIPTKINKG
Sbjct  93   TKGDLKEVSEEVAKYKVGAPARVGLVAPIDVVVQPGNTGLDPSQTSFFQVLNIPTKINKG  152

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            TVEIITPVELI++GDKVGSSEAALLAKLGIRPFSYGL+V SVYDNGSVF P+VL+LTED 
Sbjct  153  TVEIITPVELIKQGDKVGSSEAALLAKLGIRPFSYGLVVQSVYDNGSVFKPDVLNLTEDA  212

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L+EKFA+G+SMVTSL+LAISYPTLAAAPHM IN YKN L+I+V T+Y+FP A+KVKE+LK
Sbjct  213  LVEKFAVGISMVTSLALAISYPTLAAAPHMFINAYKNALAISVATEYTFPQAEKVKEFLK  272

Query  220  DPSKF  206
            DPSKF
Sbjct  273  DPSKF  277



>emb|CDY53103.1| BnaCnng24330D [Brassica napus]
Length=323

 Score =   306 bits (784),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 162/185 (88%), Positives = 176/185 (95%), Gaps = 0/185 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TKG LKEVSEEVAKYKVGAPARVGLVAPIDVVV PGNTGLDPSQTSFFQVLNIPTKINKG
Sbjct  93   TKGDLKEVSEEVAKYKVGAPARVGLVAPIDVVVQPGNTGLDPSQTSFFQVLNIPTKINKG  152

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            TVEIITPVELI++GDKVGSSEAALLAKLGIRPFSYGL+V SVYDNGSVFSPEVLDLTEDD
Sbjct  153  TVEIITPVELIKQGDKVGSSEAALLAKLGIRPFSYGLVVQSVYDNGSVFSPEVLDLTEDD  212

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L++KFA G+SMVTSL+LAIS+PTLAAAPHM IN YKN L+I+V T+Y+FP A+KVKE+LK
Sbjct  213  LVQKFAAGISMVTSLALAISFPTLAAAPHMFINAYKNALAISVATEYTFPQAEKVKEFLK  272

Query  220  DPSKF  206
            DPSKF
Sbjct  273  DPSKF  277



>ref|XP_008360784.1| PREDICTED: 60S acidic ribosomal protein P0 [Malus domestica]
Length=321

 Score =   306 bits (784),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 164/185 (89%), Positives = 176/185 (95%), Gaps = 0/185 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TKG LKEVSEEV KYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG
Sbjct  94   TKGDLKEVSEEVGKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  153

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            TVEIITPVELI+KGDKVGSSEAALLAKLGIRPFSYGL+V  VYDNGSVFSPEVLDLTEDD
Sbjct  154  TVEIITPVELIKKGDKVGSSEAALLAKLGIRPFSYGLVVQMVYDNGSVFSPEVLDLTEDD  213

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L+EKFA GVSMVTSL+LAISYPTLAAAPHM +N YKNVL++++ T+YSFP A+KVKE+LK
Sbjct  214  LMEKFASGVSMVTSLALAISYPTLAAAPHMFLNAYKNVLAVSIATEYSFPQAEKVKEFLK  273

Query  220  DPSKF  206
            DPSKF
Sbjct  274  DPSKF  278



>ref|XP_006435697.1| hypothetical protein CICLE_v10032141mg [Citrus clementina]
 ref|XP_006486350.1| PREDICTED: 60S acidic ribosomal protein P0-like [Citrus sinensis]
 gb|ESR48937.1| hypothetical protein CICLE_v10032141mg [Citrus clementina]
Length=319

 Score =   306 bits (783),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 162/185 (88%), Positives = 175/185 (95%), Gaps = 0/185 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TKG LKEV EEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG
Sbjct  94   TKGDLKEVKEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  153

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGL+V SVY+NGSV+SPEVLDL+EDD
Sbjct  154  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLVVQSVYENGSVYSPEVLDLSEDD  213

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L+EKFA  VSMVT+L+LAISYPTLAAAPHM +N YKNV+++A+ T+YSFP ADKVKEYL 
Sbjct  214  LVEKFASSVSMVTALALAISYPTLAAAPHMFVNAYKNVVAVALATEYSFPQADKVKEYLA  273

Query  220  DPSKF  206
            DPSKF
Sbjct  274  DPSKF  278



>ref|XP_009135066.1| PREDICTED: 60S acidic ribosomal protein P0-2-like [Brassica rapa]
Length=323

 Score =   306 bits (783),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 161/185 (87%), Positives = 175/185 (95%), Gaps = 0/185 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TKG LKEVSEEVAKYKVGAPARVGLVAPIDVVV PGNTGLDPSQTSFFQVLNIPTKINKG
Sbjct  93   TKGDLKEVSEEVAKYKVGAPARVGLVAPIDVVVQPGNTGLDPSQTSFFQVLNIPTKINKG  152

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            TVEIITPVELI++GDKVGSSEAALLAKLGIRPFSYGL+V SVYDNGSVFSPEVLDLTEDD
Sbjct  153  TVEIITPVELIKQGDKVGSSEAALLAKLGIRPFSYGLVVQSVYDNGSVFSPEVLDLTEDD  212

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L++KFA G+SMVTSL+LAIS+PT+AAAPHM IN YKN L+I + T+Y+FP A+KVKEYLK
Sbjct  213  LVQKFAAGISMVTSLALAISFPTIAAAPHMFINAYKNALAICIATEYTFPQAEKVKEYLK  272

Query  220  DPSKF  206
            DPSKF
Sbjct  273  DPSKF  277



>ref|XP_009146942.1| PREDICTED: 60S acidic ribosomal protein P0-2 [Brassica rapa]
 emb|CDY44688.1| BnaA05g29180D [Brassica napus]
Length=323

 Score =   306 bits (783),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 162/185 (88%), Positives = 176/185 (95%), Gaps = 0/185 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TKG LKEVSEEVAKYKVGAPARVGLVAPIDVVV PGNTGLDPSQTSFFQVLNIPTKINKG
Sbjct  93   TKGDLKEVSEEVAKYKVGAPARVGLVAPIDVVVQPGNTGLDPSQTSFFQVLNIPTKINKG  152

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            TVEIITPVELI++GDKVGSSEAALLAKLGIRPFSYGL+V SVYDNGSVFSPEVLDLTEDD
Sbjct  153  TVEIITPVELIKQGDKVGSSEAALLAKLGIRPFSYGLVVQSVYDNGSVFSPEVLDLTEDD  212

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L++KFA G+SMVTSL+LAIS+PTLAAAPHM IN YKN L+I+V T+Y+FP A+KVKE+LK
Sbjct  213  LVQKFAAGISMVTSLALAISFPTLAAAPHMFINAYKNALAISVATEYTFPQAEKVKEFLK  272

Query  220  DPSKF  206
            DPSKF
Sbjct  273  DPSKF  277



>gb|KDO69054.1| hypothetical protein CISIN_1g020952mg [Citrus sinensis]
Length=319

 Score =   305 bits (782),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 162/185 (88%), Positives = 175/185 (95%), Gaps = 0/185 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TKG LKEV EEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG
Sbjct  94   TKGDLKEVKEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  153

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGL+V SVY+NGSV+SPEVLDL+EDD
Sbjct  154  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLVVQSVYENGSVYSPEVLDLSEDD  213

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L+EKFA  VSMVT+L+LAISYPTLAAAPHM +N YKNV+++A+ T+YSFP ADKVKEYL 
Sbjct  214  LVEKFASSVSMVTALALAISYPTLAAAPHMFVNAYKNVVAVALATEYSFPQADKVKEYLA  273

Query  220  DPSKF  206
            DPSKF
Sbjct  274  DPSKF  278



>ref|XP_009123454.1| PREDICTED: 60S acidic ribosomal protein P0-2-like [Brassica rapa]
Length=323

 Score =   306 bits (783),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 162/185 (88%), Positives = 176/185 (95%), Gaps = 0/185 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TKG LKEVSEEVAKYKVGAPARVGLVAPIDVVV PGNTGLDPSQTSFFQVLNIPTKINKG
Sbjct  93   TKGDLKEVSEEVAKYKVGAPARVGLVAPIDVVVQPGNTGLDPSQTSFFQVLNIPTKINKG  152

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            TVEIITPVELI++GDKVGSSEAALLAKLGIRPFSYGL+V SVYDNGSVFSPEVLDLTEDD
Sbjct  153  TVEIITPVELIKQGDKVGSSEAALLAKLGIRPFSYGLVVQSVYDNGSVFSPEVLDLTEDD  212

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L++KFA G+SMVTSL+LAIS+PTLAAAPHM IN YKN L+I+V T+Y+FP A+KVKE+LK
Sbjct  213  LVQKFAAGISMVTSLALAISFPTLAAAPHMFINAYKNALAISVATEYTFPQAEKVKEFLK  272

Query  220  DPSKF  206
            DPSKF
Sbjct  273  DPSKF  277



>ref|XP_006407706.1| hypothetical protein EUTSA_v10021147mg [Eutrema salsugineum]
 gb|ESQ49159.1| hypothetical protein EUTSA_v10021147mg [Eutrema salsugineum]
Length=322

 Score =   305 bits (782),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 161/185 (87%), Positives = 176/185 (95%), Gaps = 0/185 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TKG LKEVSEEVAKYKVGAPARVGLVAPIDVVV PGNTGLDPSQTSFFQVLNIPTKINKG
Sbjct  93   TKGDLKEVSEEVAKYKVGAPARVGLVAPIDVVVQPGNTGLDPSQTSFFQVLNIPTKINKG  152

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            TVEIITPVELI++GDKVGSSEAALLAKLGIRPFSYGL+V SVYDNGSVFSPEVL+LTEDD
Sbjct  153  TVEIITPVELIKQGDKVGSSEAALLAKLGIRPFSYGLVVQSVYDNGSVFSPEVLNLTEDD  212

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L+EKFA G+SMVTSL+LA+SYPT+AAAPHM IN YKN L+I+V T+Y+FP A+KVKE+LK
Sbjct  213  LVEKFAAGISMVTSLALAVSYPTIAAAPHMFINAYKNALAISVATEYTFPQAEKVKEFLK  272

Query  220  DPSKF  206
            DPSKF
Sbjct  273  DPSKF  277



>ref|XP_010095082.1| 60S acidic ribosomal protein P0 [Morus notabilis]
 gb|EXB58188.1| 60S acidic ribosomal protein P0 [Morus notabilis]
Length=320

 Score =   305 bits (782),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 186/228 (82%), Positives = 205/228 (90%), Gaps = 1/228 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TKG LKEVSEEVAKYKVGAPARVGLVAPIDV+VPPGNTGLDPSQTSFFQVLNIPTKINKG
Sbjct  94   TKGDLKEVSEEVAKYKVGAPARVGLVAPIDVIVPPGNTGLDPSQTSFFQVLNIPTKINKG  153

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            TVEIITPVELI+KG+KVGSSEAALL+KLGIRPFSYGL+VLSVYDNGSVFSPEVLDLTEDD
Sbjct  154  TVEIITPVELIKKGEKVGSSEAALLSKLGIRPFSYGLVVLSVYDNGSVFSPEVLDLTEDD  213

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L+EKFA GVS+VTSL+LAISYPTLAAAPH   N YKNVL++AV T+Y+FP A+KVKE+L+
Sbjct  214  LVEKFAAGVSLVTSLALAISYPTLAAAPHFFTNAYKNVLAVAVATEYTFPQAEKVKEFLE  273

Query  220  DPSKFavaaapvaaaaagsapaaaaaaeekkeepeeesEDEMGFSLFD  77
            DPSKF   +A   A A  +A   AA  EEKKEEP EES+D+MGFSLFD
Sbjct  274  DPSKF-AVSAAPVADAGAAAAPVAAKEEEKKEEPAEESDDDMGFSLFD  320



>gb|EMS52841.1| 60S acidic ribosomal protein P0 [Triticum urartu]
Length=263

 Score =   303 bits (777),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 158/185 (85%), Positives = 176/185 (95%), Gaps = 0/185 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TKG LKEV EEVAKYKVGAPARVGL+APIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG
Sbjct  36   TKGDLKEVREEVAKYKVGAPARVGLIAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  95

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            +VEI+  V+LI+KGDKVGSSEAALLAKLGIRPFSYGL++ +VYD+GSVFSPEVLDLTE+D
Sbjct  96   SVEIVAHVDLIKKGDKVGSSEAALLAKLGIRPFSYGLVITNVYDDGSVFSPEVLDLTEED  155

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L+EKFA GVSMV SLSLA+SYPTLAAAPHM +NGYKNVL++AVET+YSFP AD++KEYLK
Sbjct  156  LMEKFACGVSMVASLSLAVSYPTLAAAPHMFLNGYKNVLALAVETEYSFPHADQIKEYLK  215

Query  220  DPSKF  206
            DPSKF
Sbjct  216  DPSKF  220



>ref|XP_010926952.1| PREDICTED: 60S acidic ribosomal protein P0 [Elaeis guineensis]
Length=320

 Score =   305 bits (781),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 161/185 (87%), Positives = 176/185 (95%), Gaps = 0/185 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TKG LKEV EEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG
Sbjct  94   TKGDLKEVREEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  153

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            TVEI+TPVELI+KGDKVGSSEAALLAKLGIRPFSYGL++ SVYDNGSVFSPEVLDLTEDD
Sbjct  154  TVEIVTPVELIKKGDKVGSSEAALLAKLGIRPFSYGLVIQSVYDNGSVFSPEVLDLTEDD  213

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L+EKFA GVSMVTSLSLA+SYPT+AAAPHM IN YKNVL++A+ T+Y+FP A K+KE+L+
Sbjct  214  LIEKFAAGVSMVTSLSLALSYPTVAAAPHMFINAYKNVLAVAIATEYTFPQAKKLKEFLE  273

Query  220  DPSKF  206
            DPSKF
Sbjct  274  DPSKF  278



>gb|KJB76158.1| hypothetical protein B456_012G076000 [Gossypium raimondii]
Length=315

 Score =   305 bits (781),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 197/228 (86%), Positives = 206/228 (90%), Gaps = 6/228 (3%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TKG LKEVSEEV     GAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG
Sbjct  94   TKGDLKEVSEEV-----GAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  148

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            TVEIITPVELI+KGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPEVLDLTEDD
Sbjct  149  TVEIITPVELIKKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPEVLDLTEDD  208

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L+EKFA GVSMVT+LSLAISYPTLAAAPHM INGYKNVL++AV T+YSFP ADKVKEYL 
Sbjct  209  LIEKFATGVSMVTALSLAISYPTLAAAPHMFINGYKNVLAVAVATEYSFPQADKVKEYLA  268

Query  220  DPSKFavaaapvaaaaagsapaaaaaaeekkeepeeesEDEMGFSLFD  77
            DPSKF   AA   AA  G+APAAAA  EEKK EPEEES+D+MGFSLFD
Sbjct  269  DPSKF-AVAAAPVAAGGGAAPAAAAPVEEKKPEPEEESDDDMGFSLFD  315



>gb|KFK38306.1| hypothetical protein AALP_AA3G096900 [Arabis alpina]
Length=323

 Score =   305 bits (780),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 158/185 (85%), Positives = 176/185 (95%), Gaps = 0/185 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TKG LKEVSEEVAKYKVGAPARVGLVAPIDVVV PGNTGLDPSQTSFFQVLNIPTKINKG
Sbjct  93   TKGDLKEVSEEVAKYKVGAPARVGLVAPIDVVVQPGNTGLDPSQTSFFQVLNIPTKINKG  152

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            TVEIITPVELI++GDKVGSSEAALLAKLGIRPFSYGL+V SVYDNGSVF+P+VL+LTED 
Sbjct  153  TVEIITPVELIKQGDKVGSSEAALLAKLGIRPFSYGLVVQSVYDNGSVFNPDVLNLTEDA  212

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L+EKFA+G+SMVTSL+LAISYPTLA+APHM IN YKN L+I+V T+Y+FP A++VKE+LK
Sbjct  213  LVEKFAVGISMVTSLALAISYPTLASAPHMFINAYKNALAISVATEYTFPQAEQVKEFLK  272

Query  220  DPSKF  206
            DPSKF
Sbjct  273  DPSKF  277



>ref|XP_004145258.1| PREDICTED: 60S acidic ribosomal protein P0-2-like [Cucumis sativus]
 ref|XP_004152959.1| PREDICTED: 60S acidic ribosomal protein P0-2-like [Cucumis sativus]
 ref|XP_004168551.1| PREDICTED: 60S acidic ribosomal protein P0-2-like [Cucumis sativus]
 gb|KGN65800.1| hypothetical protein Csa_1G530120 [Cucumis sativus]
Length=320

 Score =   305 bits (780),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 161/185 (87%), Positives = 174/185 (94%), Gaps = 0/185 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TKG LKEV EEVAKYKVGAPARVGLVAPIDV+VPPGNTGLDPSQTSFFQVLNIPTKINKG
Sbjct  94   TKGDLKEVKEEVAKYKVGAPARVGLVAPIDVIVPPGNTGLDPSQTSFFQVLNIPTKINKG  153

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            TVEIITPVELI+KGDKVGSSEAALL+KLGIRPFSYGLIV+SVYDNGSVFSP VLDL+E+D
Sbjct  154  TVEIITPVELIKKGDKVGSSEAALLSKLGIRPFSYGLIVVSVYDNGSVFSPAVLDLSEED  213

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            LLEKF  GVSMV SLSLA+S+PTLAAAPHMLIN YKN L+IAV T+YSF  AD++KE+LK
Sbjct  214  LLEKFLAGVSMVASLSLAVSFPTLAAAPHMLINAYKNALAIAVATEYSFSEADEIKEFLK  273

Query  220  DPSKF  206
            DPSKF
Sbjct  274  DPSKF  278



>ref|XP_004239781.1| PREDICTED: 60S acidic ribosomal protein P0 [Solanum lycopersicum]
Length=321

 Score =   305 bits (780),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 201/228 (88%), Positives = 211/228 (93%), Gaps = 0/228 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TKG LKEVSEEVAKYKVGAPARVGLVAP+DVVVPPGNTGLDPSQTSFFQVLNIPTKINKG
Sbjct  94   TKGDLKEVSEEVAKYKVGAPARVGLVAPVDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  153

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            TVEIITPVELI+KGDKVGSSEAALLAKLGIRPFSYGL+VLSVYDNGSVFSPEVLDLTEDD
Sbjct  154  TVEIITPVELIKKGDKVGSSEAALLAKLGIRPFSYGLVVLSVYDNGSVFSPEVLDLTEDD  213

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L+EKFA+GVSMVTSL+LAISYPTLAAAPHM  N YKNVL+IA+ETDYSFPLADKVKEYL 
Sbjct  214  LIEKFAMGVSMVTSLALAISYPTLAAAPHMFTNAYKNVLAIAIETDYSFPLADKVKEYLA  273

Query  220  DPSKFavaaapvaaaaagsapaaaaaaeekkeepeeesEDEMGFSLFD  77
            DPSKFA  AA  AAAA   A  AAA  EEKKEEP EES+D+MGFSLFD
Sbjct  274  DPSKFAAVAAAPAAAAGSGAAPAAAKEEEKKEEPAEESDDDMGFSLFD  321



>ref|XP_002440235.1| hypothetical protein SORBIDRAFT_09g028230 [Sorghum bicolor]
 gb|EES18665.1| hypothetical protein SORBIDRAFT_09g028230 [Sorghum bicolor]
Length=319

 Score =   304 bits (779),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 177/229 (77%), Positives = 198/229 (86%), Gaps = 3/229 (1%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TKG LKEV EEVAKYKVGAPARVGLVAP+DVVV PGNTGLDPSQTSFFQVLNIPTKINKG
Sbjct  94   TKGDLKEVREEVAKYKVGAPARVGLVAPVDVVVSPGNTGLDPSQTSFFQVLNIPTKINKG  153

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            TVEIITPVELI+KGDKVGSSE+ALLAKLGIRPFSYGL +++VY++GSVFSPEVLDLTE+D
Sbjct  154  TVEIITPVELIKKGDKVGSSESALLAKLGIRPFSYGLQIVNVYEDGSVFSPEVLDLTEED  213

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L+EKF+ GVSMV SLSL +SYPTLAAAPHM INGYKNVL++AVETDYS+P AD++KEYLK
Sbjct  214  LVEKFSAGVSMVASLSLVVSYPTLAAAPHMFINGYKNVLAVAVETDYSYPHADEIKEYLK  273

Query  220  DPSKFavaaapvaaaaagsapaaaaaaeekkeepeeesEDEMGFSLFDD  74
            DPSKFAVAA   AA +  SA         + +E  +    EMGFSLFDD
Sbjct  274  DPSKFAVAAPVAAADSGASAAPKEEEKAPESDEESDG---EMGFSLFDD  319



>ref|XP_009608105.1| PREDICTED: 60S acidic ribosomal protein P0 [Nicotiana tomentosiformis]
Length=320

 Score =   303 bits (777),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 200/228 (88%), Positives = 210/228 (92%), Gaps = 1/228 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TKG LKEVSEEVAKYKVGAPARVGLVAP+DVVVPPGNTGLDPSQTSFFQVLNIPTKINKG
Sbjct  94   TKGDLKEVSEEVAKYKVGAPARVGLVAPVDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  153

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            TVEIITPVELI+KGDKVGSSEAALLAKLGIRPFSYGL+VLSVYDNGSVFSPEVLDLTEDD
Sbjct  154  TVEIITPVELIKKGDKVGSSEAALLAKLGIRPFSYGLVVLSVYDNGSVFSPEVLDLTEDD  213

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L+EKFA+GVSMVTSLSLAISYPTLAAAPHM  N YKNVL+IAVETDYSFPLADKVKEYL+
Sbjct  214  LIEKFAMGVSMVTSLSLAISYPTLAAAPHMFTNAYKNVLAIAVETDYSFPLADKVKEYLE  273

Query  220  DPSKFavaaapvaaaaagsapaaaaaaeekkeepeeesEDEMGFSLFD  77
            DPSKF  A      AAAGS  A AAA EE+KEEP E S+D+MGFSLFD
Sbjct  274  DPSKF-AAVVAAPVAAAGSGAAPAAAKEEEKEEPAEVSDDDMGFSLFD  320



>ref|NP_181530.1| 60S acidic ribosomal protein P0-1 [Arabidopsis thaliana]
 sp|O04204.1|RLA01_ARATH RecName: Full=60S acidic ribosomal protein P0-1 [Arabidopsis 
thaliana]
 gb|AAB95286.1| 60S acidic ribosomal protein P0 [Arabidopsis thaliana]
 gb|AAN71918.1| putative 60S acidic ribosomal protein P0 [Arabidopsis thaliana]
 gb|AEC09763.1| 60S acidic ribosomal protein P0-1 [Arabidopsis thaliana]
Length=317

 Score =   303 bits (777),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 160/185 (86%), Positives = 176/185 (95%), Gaps = 0/185 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TKG LKEVSEEVAKYKVGAPARVGLVAPIDVVV PGNTGLDPSQTSFFQVLNIPTKINKG
Sbjct  94   TKGDLKEVSEEVAKYKVGAPARVGLVAPIDVVVQPGNTGLDPSQTSFFQVLNIPTKINKG  153

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            TVEIITPVELI+KGDKVGSSEAALLAKLGIRPFSYGL+V SVYDNGSVF+PEVL+LTEDD
Sbjct  154  TVEIITPVELIKKGDKVGSSEAALLAKLGIRPFSYGLVVESVYDNGSVFNPEVLNLTEDD  213

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L+EKFA GVSM+T+LSLAISYPT+AAAPHM +N YKNVL++A+ T+YSFP A+ VKE+LK
Sbjct  214  LVEKFAAGVSMITALSLAISYPTVAAAPHMFLNAYKNVLAVALATEYSFPQAENVKEFLK  273

Query  220  DPSKF  206
            DP+KF
Sbjct  274  DPTKF  278



>emb|CDY24932.1| BnaC03g22400D [Brassica napus]
Length=319

 Score =   303 bits (775),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 162/185 (88%), Positives = 175/185 (95%), Gaps = 0/185 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TKG LKEVSEEVAKYKVGAPARVGLVAPIDVVV PGNTGLDPSQTSFFQVLNIPTKINKG
Sbjct  94   TKGDLKEVSEEVAKYKVGAPARVGLVAPIDVVVQPGNTGLDPSQTSFFQVLNIPTKINKG  153

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            TVEIITPVELI+KGDKVGSSEAALLAKLGIRPFSYGL+V SVYDNGSVF PEVL+LTEDD
Sbjct  154  TVEIITPVELIKKGDKVGSSEAALLAKLGIRPFSYGLVVESVYDNGSVFDPEVLNLTEDD  213

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L+EKFA GVS+VT+LSLAISYPT+AAAPHM IN YKNVL++A+ T+YSFP A+ VKE+LK
Sbjct  214  LVEKFAAGVSLVTALSLAISYPTIAAAPHMFINAYKNVLAVALATEYSFPQAENVKEFLK  273

Query  220  DPSKF  206
            DPSKF
Sbjct  274  DPSKF  278



>ref|XP_011084927.1| PREDICTED: 60S acidic ribosomal protein P0-like [Sesamum indicum]
Length=315

 Score =   302 bits (774),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 163/179 (91%), Positives = 173/179 (97%), Gaps = 0/179 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TKG LKEV EEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG
Sbjct  94   TKGDLKEVREEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  153

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            TVEIITPVELI+KG+KVGSSEAALL+KLGIRPFSYGLIVLSVY++GSVFSPEVLDLTEDD
Sbjct  154  TVEIITPVELIKKGEKVGSSEAALLSKLGIRPFSYGLIVLSVYESGSVFSPEVLDLTEDD  213

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYL  224
            L+EKFA+GVSMV SLSLAI+YPTLAAAPHM IN YKN+LS+AVETDYSFP ADKVKEYL
Sbjct  214  LVEKFAMGVSMVASLSLAITYPTLAAAPHMFINAYKNLLSVAVETDYSFPQADKVKEYL  272



>gb|EMT02739.1| 60S acidic ribosomal protein P0 [Aegilops tauschii]
Length=322

 Score =   302 bits (774),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 157/185 (85%), Positives = 174/185 (94%), Gaps = 0/185 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TKG LKEV EEVAKYKVGAPARVGL+APIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG
Sbjct  95   TKGDLKEVREEVAKYKVGAPARVGLIAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  154

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            +VEI+  V+LI+KGDKVGSSEA LLAKLGIRPFSYGL++ +VY +GSVFSPEVLDLTE+D
Sbjct  155  SVEIVAHVDLIKKGDKVGSSEATLLAKLGIRPFSYGLVITNVYGDGSVFSPEVLDLTEED  214

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L+EKFA GVSMV SLSLA+SYPTLAAAPHM +NGYKNVL++AVETDYSFP AD++KEYLK
Sbjct  215  LMEKFACGVSMVASLSLAVSYPTLAAAPHMFLNGYKNVLALAVETDYSFPHADQIKEYLK  274

Query  220  DPSKF  206
            DPSKF
Sbjct  275  DPSKF  279



>ref|XP_002881693.1| 60S acidic ribosomal protein P0 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH57952.1| 60S acidic ribosomal protein P0 [Arabidopsis lyrata subsp. lyrata]
Length=317

 Score =   302 bits (773),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 159/185 (86%), Positives = 176/185 (95%), Gaps = 0/185 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TKG LKEVSEEVAKYKVGAPARVGLVAPIDVVV PGNTGLDPSQTSFFQVLNIPTKINKG
Sbjct  94   TKGDLKEVSEEVAKYKVGAPARVGLVAPIDVVVQPGNTGLDPSQTSFFQVLNIPTKINKG  153

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            TVEIITPVELI+KGDKVGSSEAALLAKLGIRPFSYGL+V SVYDNGSVF+PEVL+LTEDD
Sbjct  154  TVEIITPVELIKKGDKVGSSEAALLAKLGIRPFSYGLVVESVYDNGSVFNPEVLNLTEDD  213

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L+EKFA GVSM+T++SLAISYPT+AAAPHM +N YKNVL++A+ T+YSFP A+ VKE+LK
Sbjct  214  LVEKFAAGVSMITAISLAISYPTVAAAPHMFLNAYKNVLAVALATEYSFPQAENVKEFLK  273

Query  220  DPSKF  206
            DP+KF
Sbjct  274  DPTKF  278



>ref|XP_004287422.1| PREDICTED: 60S acidic ribosomal protein P0-like [Fragaria vesca 
subsp. vesca]
Length=321

 Score =   302 bits (773),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 161/185 (87%), Positives = 173/185 (94%), Gaps = 0/185 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TKG LKEV EEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG
Sbjct  93   TKGDLKEVREEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  152

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            TVEII PVELI+KGDKVGSSEAALLAKLGIRPFSYGL+V  VYDNGSVFSPEVLDLTEDD
Sbjct  153  TVEIIMPVELIKKGDKVGSSEAALLAKLGIRPFSYGLVVQMVYDNGSVFSPEVLDLTEDD  212

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L+ KFA GVS VT+L++A+SYPT+AAAPHM +N YKNVL+IAV T+YSFP ADKVKEYL+
Sbjct  213  LMIKFASGVSNVTALAMAVSYPTIAAAPHMFLNAYKNVLAIAVATEYSFPQADKVKEYLE  272

Query  220  DPSKF  206
            DPSKF
Sbjct  273  DPSKF  277



>emb|CDY60988.1| BnaA03g56530D [Brassica napus]
Length=318

 Score =   301 bits (771),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 161/185 (87%), Positives = 174/185 (94%), Gaps = 0/185 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TKG LKEVSEEVAKYKVGAPARVGLVAPIDVVV PGNTGLDPSQTSFFQVLNIPTKINKG
Sbjct  94   TKGDLKEVSEEVAKYKVGAPARVGLVAPIDVVVQPGNTGLDPSQTSFFQVLNIPTKINKG  153

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            TVEIITPVELI+KGDKVGSSEAALLAKLGIRPFSYGL+V SVYDNGSVF PEVL+LTEDD
Sbjct  154  TVEIITPVELIKKGDKVGSSEAALLAKLGIRPFSYGLVVESVYDNGSVFDPEVLNLTEDD  213

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L+EKFA GVS+VT+ SLAISYPT+AAAPHM IN YKNVL++A+ T+YSFP A+ VKE+LK
Sbjct  214  LVEKFAAGVSLVTAFSLAISYPTIAAAPHMFINAYKNVLAVALATEYSFPQAENVKEFLK  273

Query  220  DPSKF  206
            DPSKF
Sbjct  274  DPSKF  278



>ref|XP_009133397.1| PREDICTED: 60S acidic ribosomal protein P0-1 [Brassica rapa]
Length=319

 Score =   301 bits (771),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 161/185 (87%), Positives = 174/185 (94%), Gaps = 0/185 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TKG LKEVSEEVAKYKVGAPARVGLVAPIDVVV PGNTGLDPSQTSFFQVLNIPTKINKG
Sbjct  94   TKGDLKEVSEEVAKYKVGAPARVGLVAPIDVVVQPGNTGLDPSQTSFFQVLNIPTKINKG  153

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            TVEIITPVELI+KGDKVGSSEAALLAKLGIRPFSYGL+V SVYDNGSVF PEVL+LTEDD
Sbjct  154  TVEIITPVELIKKGDKVGSSEAALLAKLGIRPFSYGLVVESVYDNGSVFDPEVLNLTEDD  213

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L+EKFA GVS+VT+ SLAISYPT+AAAPHM IN YKNVL++A+ T+YSFP A+ VKE+LK
Sbjct  214  LVEKFAAGVSLVTAFSLAISYPTIAAAPHMFINAYKNVLAVALATEYSFPQAENVKEFLK  273

Query  220  DPSKF  206
            DPSKF
Sbjct  274  DPSKF  278



>ref|NP_001275012.1| 60S acidic ribosomal protein P0-like [Solanum tuberosum]
 gb|ABB29933.1| P0 ribosomal protein-like [Solanum tuberosum]
 gb|ABB87111.1| P0 ribosomal protein-like [Solanum tuberosum]
Length=320

 Score =   301 bits (770),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 199/228 (87%), Positives = 209/228 (92%), Gaps = 1/228 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TKG LKEVSEEVAKYKVGAPARVGLVAP+DVVVPPGNTGLDPSQTSFFQVLNIPTKINKG
Sbjct  94   TKGDLKEVSEEVAKYKVGAPARVGLVAPVDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  153

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            TVEIITPVELI+KGDKVGSSEAALLAKLGIRPFSYGL+V+SVYDNGSVFSPEVLDLTEDD
Sbjct  154  TVEIITPVELIKKGDKVGSSEAALLAKLGIRPFSYGLVVVSVYDNGSVFSPEVLDLTEDD  213

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L+EKFA+GVSMVTSL+LAISYPTLAAAPHM  N YKNVL+IAVETDYSFPLADKVKEYL 
Sbjct  214  LIEKFAMGVSMVTSLALAISYPTLAAAPHMFTNAYKNVLAIAVETDYSFPLADKVKEYLA  273

Query  220  DPSKFavaaapvaaaaagsapaaaaaaeekkeepeeesEDEMGFSLFD  77
            DPSKF   AA  AAAA   A  AAA  EEKKEEP E S+D+MGFSLFD
Sbjct  274  DPSKF-AVAAAPAAAAGSGAAPAAAKEEEKKEEPAEVSDDDMGFSLFD  320



>ref|XP_010508934.1| PREDICTED: 60S acidic ribosomal protein P0-1 [Camelina sativa]
Length=318

 Score =   300 bits (769),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 160/185 (86%), Positives = 173/185 (94%), Gaps = 0/185 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TKG LKEVSEEVAKYKVGAPARVGLVAPIDVVV PGNTGLDPSQTSFFQVLNIPTKINKG
Sbjct  94   TKGDLKEVSEEVAKYKVGAPARVGLVAPIDVVVQPGNTGLDPSQTSFFQVLNIPTKINKG  153

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            TVEIITPVELI+KGDKVGSSEAALLAKLGIRPFSYGL+V SVYDNGSVF+PEVL+LTEDD
Sbjct  154  TVEIITPVELIKKGDKVGSSEAALLAKLGIRPFSYGLVVESVYDNGSVFNPEVLNLTEDD  213

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L+EKFA GVSM T+LSLAISYPTLAAA HM +N YKN L++A+ T+YSFP A+ VKE+LK
Sbjct  214  LVEKFAAGVSMTTALSLAISYPTLAAATHMFLNAYKNALAVALATEYSFPQAENVKEFLK  273

Query  220  DPSKF  206
            DPSKF
Sbjct  274  DPSKF  278



>emb|CDP16385.1| unnamed protein product [Coffea canephora]
Length=322

 Score =   300 bits (769),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 158/185 (85%), Positives = 173/185 (94%), Gaps = 0/185 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TKG LKE+SEEV+KYKVGAPARVGL+AP DVVVPPGNTGLDPSQTSFFQVLNIPTKINKG
Sbjct  94   TKGDLKEISEEVSKYKVGAPARVGLIAPDDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  153

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            TVEIIT VELI+KGDKVGSSE+ALL+KLG+RPFSYGLIV +VY+NGSVFSPEVLDLTEDD
Sbjct  154  TVEIITAVELIKKGDKVGSSESALLSKLGVRPFSYGLIVQAVYENGSVFSPEVLDLTEDD  213

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L  KF +G+SM TSLSL ISYP L+AAPHMLINGYKN L+IAVET+YSFP AD+VKEYLK
Sbjct  214  LAVKFLVGLSMATSLSLEISYPALSAAPHMLINGYKNALAIAVETEYSFPQADEVKEYLK  273

Query  220  DPSKF  206
            DPSKF
Sbjct  274  DPSKF  278



>gb|KHN36391.1| 60S acidic ribosomal protein P0 [Glycine soja]
Length=321

 Score =   300 bits (769),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 183/228 (80%), Positives = 203/228 (89%), Gaps = 0/228 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TKG +KEV E V+KYKV APARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG
Sbjct  94   TKGDVKEVKEVVSKYKVAAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  153

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            TVEIITPVELI KGDKVGSSEAALL+KL IRPFSYGL V+SVY+NGSVFSPEVLDLTEDD
Sbjct  154  TVEIITPVELIMKGDKVGSSEAALLSKLAIRPFSYGLAVVSVYENGSVFSPEVLDLTEDD  213

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L+ KFA GV MV+SLSLAISYP++AAAPHM +N YKN+L++AV T+YSFP ADKVKEYLK
Sbjct  214  LVVKFAEGVCMVSSLSLAISYPSIAAAPHMFVNSYKNILAVAVATEYSFPEADKVKEYLK  273

Query  220  DPSKFavaaapvaaaaagsapaaaaaaeekkeepeeesEDEMGFSLFD  77
            DPSKFAVA     A  +G+APAAA+  EEKKEE  +ES+D+MGFSLFD
Sbjct  274  DPSKFAVAVVAAPATKSGAAPAAASKVEEKKEEAADESDDDMGFSLFD  321



>ref|XP_003573632.1| PREDICTED: 60S acidic ribosomal protein P0-like [Brachypodium 
distachyon]
Length=323

 Score =   300 bits (767),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 155/185 (84%), Positives = 174/185 (94%), Gaps = 0/185 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TKG LKEV EEVAKYKVGAPARVGL+APIDVVVP GNTGLDP+QTSFFQVLNIPTKINKG
Sbjct  97   TKGDLKEVREEVAKYKVGAPARVGLIAPIDVVVPAGNTGLDPTQTSFFQVLNIPTKINKG  156

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            TVEII  V+LI+KGDKVGSSEAALLAKLGIRPFSYGL++  VYD+GSVFSPEVLDLTE+D
Sbjct  157  TVEIIANVDLIKKGDKVGSSEAALLAKLGIRPFSYGLVITQVYDDGSVFSPEVLDLTEED  216

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L+E+FA GVSMV SLSLA+SYPT+AAAPHM +NGYKNVL++A+ETDYS+P AD++KEYLK
Sbjct  217  LMERFASGVSMVASLSLAVSYPTMAAAPHMFLNGYKNVLAVALETDYSYPHADQIKEYLK  276

Query  220  DPSKF  206
            DPSKF
Sbjct  277  DPSKF  281



>ref|XP_002525622.1| 60S acidic ribosomal protein P0, putative [Ricinus communis]
 gb|EEF36740.1| 60S acidic ribosomal protein P0, putative [Ricinus communis]
Length=323

 Score =   300 bits (767),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 155/185 (84%), Positives = 177/185 (96%), Gaps = 0/185 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TKG LKEV EE+AKYKVGAPARVGL+APIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG
Sbjct  94   TKGELKEVREEIAKYKVGAPARVGLIAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  153

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            TVEIITPV++I+KG+KVGSSE+ALLAKLGIRPFSYGL+VL+VYD+GSVFSPEVLDLT+DD
Sbjct  154  TVEIITPVDIIKKGEKVGSSESALLAKLGIRPFSYGLVVLTVYDSGSVFSPEVLDLTDDD  213

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L+ KFA GVSMV SLSL++S+PT+AAAPHM +NGYKNVLS+A+ ++YSFP A+KVKEYLK
Sbjct  214  LVAKFASGVSMVASLSLSLSFPTIAAAPHMFVNGYKNVLSVAMVSEYSFPQAEKVKEYLK  273

Query  220  DPSKF  206
            DPSKF
Sbjct  274  DPSKF  278



>gb|AID52928.1| 60S acidic ribosomal protein P0 [Carthamus tinctorius]
Length=321

 Score =   299 bits (766),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 171/185 (92%), Positives = 180/185 (97%), Gaps = 0/185 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TKG LKEV EEVAKYKVGAPARVGLVAP+DVVVPPGNTGLDPSQTSFFQVLNIPTKINKG
Sbjct  93   TKGDLKEVREEVAKYKVGAPARVGLVAPVDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  152

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            TVEIITPVELI+KGDKVGSSEAALLAKLGIRPFSYGL+VL+VYDNGSVFSPEVLDLTEDD
Sbjct  153  TVEIITPVELIKKGDKVGSSEAALLAKLGIRPFSYGLVVLTVYDNGSVFSPEVLDLTEDD  212

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L+EKFALGVSMVTSL+LAI YPT+AAAPHMLIN YKN L+IAVETDYSFPLADKVKEYL+
Sbjct  213  LIEKFALGVSMVTSLALAIHYPTIAAAPHMLINAYKNALAIAVETDYSFPLADKVKEYLE  272

Query  220  DPSKF  206
            DPSKF
Sbjct  273  DPSKF  277



>ref|XP_008457380.1| PREDICTED: 60S acidic ribosomal protein P0-like [Cucumis melo]
Length=320

 Score =   299 bits (765),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 159/182 (87%), Positives = 171/182 (94%), Gaps = 0/182 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TKG LKEV EEVAKYKVGAPARVGLVAPIDV+VPPGNTGLDPSQTSFFQVLNIPTKINKG
Sbjct  94   TKGDLKEVKEEVAKYKVGAPARVGLVAPIDVIVPPGNTGLDPSQTSFFQVLNIPTKINKG  153

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            TVEIITPVELI+KGDKVGSSEAALL+KLGIRPFSYGLIV+SVYDNGSVFSP VLDLTE+D
Sbjct  154  TVEIITPVELIKKGDKVGSSEAALLSKLGIRPFSYGLIVVSVYDNGSVFSPAVLDLTEED  213

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            LLEKF  GVSMV SLSLA+S+PTLAAAPHMLIN YKN L+IAV T+YSF  AD++KE+LK
Sbjct  214  LLEKFLAGVSMVASLSLAVSFPTLAAAPHMLINAYKNALAIAVATEYSFSEADEIKEFLK  273

Query  220  DP  215
            DP
Sbjct  274  DP  275



>gb|KHN34735.1| 60S acidic ribosomal protein P0 [Glycine soja]
Length=320

 Score =   298 bits (764),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 176/228 (77%), Positives = 197/228 (86%), Gaps = 1/228 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TKG +KEV E V+KYKV APARVGLVAPIDV+VPPGNTGLDPSQTSFFQVLNIPTKINKG
Sbjct  94   TKGDVKEVKEVVSKYKVAAPARVGLVAPIDVIVPPGNTGLDPSQTSFFQVLNIPTKINKG  153

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            TVEI+TPVELI KGDKVGSSEAALL+KL IRPFSYGL V+SVYDNGSVFSPEVLDLTEDD
Sbjct  154  TVEIVTPVELIMKGDKVGSSEAALLSKLAIRPFSYGLAVVSVYDNGSVFSPEVLDLTEDD  213

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L+ KFA GV MV+SLSLAISYP++AAAPHM +N YKN+L++AV T+YSFP ADKVKEYLK
Sbjct  214  LVVKFAEGVCMVSSLSLAISYPSIAAAPHMFVNSYKNILAVAVATEYSFPEADKVKEYLK  273

Query  220  DPSKFavaaapvaaaaagsapaaaaaaeekkeepeeesEDEMGFSLFD  77
            DPSKF   A   A A    A  AAA+  E+K+E  +ES+D+MGFSLFD
Sbjct  274  DPSKF-AVAVVAAPATKSGAAPAAASKVEEKKEEADESDDDMGFSLFD  320



>ref|XP_010517390.1| PREDICTED: 60S acidic ribosomal protein P0-1-like [Camelina sativa]
Length=318

 Score =   298 bits (762),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 158/185 (85%), Positives = 172/185 (93%), Gaps = 0/185 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
             KG LKEVSEEVAKYKVGAPARVGLVAPIDVVV PGNTGLDPSQTSFFQVLNIPTKINKG
Sbjct  94   NKGDLKEVSEEVAKYKVGAPARVGLVAPIDVVVQPGNTGLDPSQTSFFQVLNIPTKINKG  153

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            TVEIITPVELI+KGDKVGSSEAALLAKLGIRPFSYGL+V SVYDNGSVF+PEVL+LTEDD
Sbjct  154  TVEIITPVELIKKGDKVGSSEAALLAKLGIRPFSYGLVVESVYDNGSVFNPEVLNLTEDD  213

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L+EKFA GVSM+T+LSLA SYPTLAAAPHM +N YKN L +A+ T+YSFP A+ VKE++K
Sbjct  214  LVEKFAAGVSMITALSLAASYPTLAAAPHMFLNAYKNALVVALATEYSFPQAENVKEFVK  273

Query  220  DPSKF  206
            DPSKF
Sbjct  274  DPSKF  278



>ref|XP_007163525.1| hypothetical protein PHAVU_001G241400g [Phaseolus vulgaris]
 gb|ESW35519.1| hypothetical protein PHAVU_001G241400g [Phaseolus vulgaris]
Length=317

 Score =   297 bits (760),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 178/228 (78%), Positives = 199/228 (87%), Gaps = 4/228 (2%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TKG +KEVSE VAKYKVGAPARVGL+APIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG
Sbjct  94   TKGDVKEVSEVVAKYKVGAPARVGLIAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  153

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            TVEIITPVELIRKG+KVGSSEAALL+KL IRPFSYGL+V+SVYDNGSVFSP VL+LT+DD
Sbjct  154  TVEIITPVELIRKGEKVGSSEAALLSKLAIRPFSYGLVVVSVYDNGSVFSPAVLNLTDDD  213

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L+  FA GVSMV+SLSLAISYPT+AAA HM  N YKNVL++AV T+YSFP AD+VKE+LK
Sbjct  214  LVNMFANGVSMVSSLSLAISYPTIAAALHMFANSYKNVLAVAVVTEYSFPEADEVKEFLK  273

Query  220  DPSKFavaaapvaaaaagsapaaaaaaeekkeepeeesEDEMGFSLFD  77
            DPSKF    A    AA  +  A AAA EE+K+E  EES+D+MGFSLFD
Sbjct  274  DPSKF----AVAVVAATATDSAPAAAKEEEKKEEPEESDDDMGFSLFD  317



>ref|XP_003538454.1| PREDICTED: 60S acidic ribosomal protein P0-like [Glycine max]
Length=320

 Score =   296 bits (759),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 175/228 (77%), Positives = 196/228 (86%), Gaps = 1/228 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TKG +KEV E V+KYKV APARVGLVAPIDV+VPPGNTGLDPSQTSFFQVLNIPTKINKG
Sbjct  94   TKGDVKEVKEVVSKYKVAAPARVGLVAPIDVIVPPGNTGLDPSQTSFFQVLNIPTKINKG  153

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            TVEI+TPVELI KGDKVGSSEA LL+KL IRPFSYGL V+SVYDNGSVFSPEVLDLTEDD
Sbjct  154  TVEIVTPVELIMKGDKVGSSEAVLLSKLAIRPFSYGLAVVSVYDNGSVFSPEVLDLTEDD  213

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L+ KFA GV MV+SLSLAISYP++AAAPHM +N YKN+L++AV T+YSFP ADKVKEYLK
Sbjct  214  LVVKFAEGVCMVSSLSLAISYPSIAAAPHMFVNSYKNILAVAVATEYSFPEADKVKEYLK  273

Query  220  DPSKFavaaapvaaaaagsapaaaaaaeekkeepeeesEDEMGFSLFD  77
            DPSKF   A   A A    A  AAA+  E+K+E  +ES+D+MGFSLFD
Sbjct  274  DPSKF-AVAVVAAPATKSGAAPAAASKVEEKKEEADESDDDMGFSLFD  320



>ref|XP_001759592.1| predicted protein [Physcomitrella patens]
 gb|EDQ75504.1| predicted protein [Physcomitrella patens]
Length=319

 Score =   296 bits (758),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 180/228 (79%), Positives = 202/228 (89%), Gaps = 2/228 (1%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TKG LKEV EE+AKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG
Sbjct  94   TKGDLKEVREEIAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  153

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            TVEII PVEL+ KGDKVGSSEAALLAKLGIRPFSYGL+V+++YDNGSVF+PEVLDLTEDD
Sbjct  154  TVEIIAPVELVHKGDKVGSSEAALLAKLGIRPFSYGLVVVNIYDNGSVFAPEVLDLTEDD  213

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            LL+KFA GVS V ++SLA++YPTLAA PH  +N YKN+L+IAVET+YSFPLA+K KEYLK
Sbjct  214  LLDKFAAGVSTVAAVSLALNYPTLAAVPHSFVNSYKNLLAIAVETEYSFPLAEKTKEYLK  273

Query  220  DPSKFavaaapvaaaaagsapaaaaaaeekkeepeeesEDEMGFSLFD  77
            DPSKF  A A   AA   S+  AAAA EE+K E +EES+D+MGFSLFD
Sbjct  274  DPSKF--AVAAAPAATESSSAPAAAAKEEEKVEEKEESDDDMGFSLFD  319



>gb|KDO69055.1| hypothetical protein CISIN_1g020952mg [Citrus sinensis]
Length=318

 Score =   295 bits (755),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 157/179 (88%), Positives = 170/179 (95%), Gaps = 0/179 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TKG LKEV EEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG
Sbjct  94   TKGDLKEVKEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  153

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGL+V SVY+NGSV+SPEVLDL+EDD
Sbjct  154  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLVVQSVYENGSVYSPEVLDLSEDD  213

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYL  224
            L+EKFA  VSMVT+L+LAISYPTLAAAPHM +N YKNV+++A+ T+YSFP ADKVKEYL
Sbjct  214  LVEKFASSVSMVTALALAISYPTLAAAPHMFVNAYKNVVAVALATEYSFPQADKVKEYL  272



>gb|KHG21849.1| 60S acidic ribosomal P0-2 -like protein [Gossypium arboreum]
Length=237

 Score =   291 bits (745),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 154/185 (83%), Positives = 172/185 (93%), Gaps = 0/185 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TKG LKEV EE+AKYKVGAPARVGLVAPIDV+VPPGNTGLDPSQTSFFQVLNIPTKINKG
Sbjct  10   TKGDLKEVREEIAKYKVGAPARVGLVAPIDVIVPPGNTGLDPSQTSFFQVLNIPTKINKG  69

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            TVEI+T VELIRKG+KVGSSEAALL+KLGIRPFSYGL+V+SVYDNG+VFSPEVLDLTEDD
Sbjct  70   TVEIVTAVELIRKGEKVGSSEAALLSKLGIRPFSYGLVVVSVYDNGTVFSPEVLDLTEDD  129

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L+EKF   +S VTSLSLA+S+PTLAAAPHM IN YK  LS+AV T+Y+FP A+K+KEYLK
Sbjct  130  LMEKFRSWLSNVTSLSLAVSFPTLAAAPHMFINAYKTALSLAVATEYTFPQAEKIKEYLK  189

Query  220  DPSKF  206
            DP+KF
Sbjct  190  DPTKF  194



>gb|KHG01938.1| 60S acidic ribosomal P0-2 -like protein [Gossypium arboreum]
Length=253

 Score =   291 bits (746),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 154/185 (83%), Positives = 172/185 (93%), Gaps = 0/185 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TKG LKEV EE+AKYKVGAPARVGLVAPIDV+VPPGNTGLDPSQTSFFQVLNIPTKINKG
Sbjct  26   TKGDLKEVREEIAKYKVGAPARVGLVAPIDVIVPPGNTGLDPSQTSFFQVLNIPTKINKG  85

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            TVEI+T VELIRKG+KVGSSEAALL+KLGIRPFSYGL+V+SVYDNG+VFSPEVLDLTEDD
Sbjct  86   TVEIVTAVELIRKGEKVGSSEAALLSKLGIRPFSYGLVVVSVYDNGTVFSPEVLDLTEDD  145

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L+EKF   +S VTSLSLA+S+PTLAAAPHM IN YK  LS+AV T+Y+FP A+K+KEYLK
Sbjct  146  LMEKFRSWLSNVTSLSLAVSFPTLAAAPHMFINAYKTALSLAVATEYTFPQAEKIKEYLK  205

Query  220  DPSKF  206
            DP+KF
Sbjct  206  DPTKF  210



>ref|XP_001759851.1| predicted protein [Physcomitrella patens]
 gb|EDQ75355.1| predicted protein [Physcomitrella patens]
Length=318

 Score =   293 bits (749),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 179/228 (79%), Positives = 202/228 (89%), Gaps = 3/228 (1%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TKG LKEV EE+ KYKVGAPARVGLVAPIDV+VPPGNTGLDPSQTSFFQVLNIPTKINKG
Sbjct  94   TKGDLKEVREEIGKYKVGAPARVGLVAPIDVIVPPGNTGLDPSQTSFFQVLNIPTKINKG  153

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            TVEII PVEL+ KGDKVGSSEAALLAKLGIRPFSYGL+V+++YDNGS+F+PEVLDLTEDD
Sbjct  154  TVEIIAPVELVHKGDKVGSSEAALLAKLGIRPFSYGLVVVNIYDNGSLFAPEVLDLTEDD  213

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            LL+KFA GVS V ++SLA++YPTLAA PH  +N YKN+L+IAVET+YSFPLA+K KEYLK
Sbjct  214  LLDKFAAGVSTVAAVSLALNYPTLAAVPHSFVNAYKNLLAIAVETEYSFPLAEKTKEYLK  273

Query  220  DPSKFavaaapvaaaaagsapaaaaaaeekkeepeeesEDEMGFSLFD  77
            DPSKF   AA  A  AA SA  AAAA EE+K E +EES+D+MGFSLFD
Sbjct  274  DPSKF---AAATAPVAAESAAPAAAAKEEEKPEEKEESDDDMGFSLFD  318



>gb|KJB19895.1| hypothetical protein B456_003G123400 [Gossypium raimondii]
Length=321

 Score =   292 bits (748),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 154/185 (83%), Positives = 172/185 (93%), Gaps = 0/185 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TKG LKEV EE+AKYKVGAPARVGLVAPIDV+VPPGNTGLDPSQTSFFQVLNIPTKINKG
Sbjct  94   TKGDLKEVREEIAKYKVGAPARVGLVAPIDVIVPPGNTGLDPSQTSFFQVLNIPTKINKG  153

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            TVEI+T VELIRKG+KVGSSEAALL+KLGIRPFSYGL+V+SVYDNG+VFSPEVLDLTEDD
Sbjct  154  TVEIVTAVELIRKGEKVGSSEAALLSKLGIRPFSYGLVVVSVYDNGTVFSPEVLDLTEDD  213

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L+EKF   +S VTSLSLA+S+PTLAAAPHM IN YK  LS+AV T+Y+FP A+K+KEYLK
Sbjct  214  LMEKFRSWLSNVTSLSLAVSFPTLAAAPHMFINAYKTALSLAVATEYTFPQAEKIKEYLK  273

Query  220  DPSKF  206
            DP+KF
Sbjct  274  DPTKF  278



>ref|XP_006296009.1| hypothetical protein CARUB_v10025153mg [Capsella rubella]
 gb|EOA28907.1| hypothetical protein CARUB_v10025153mg [Capsella rubella]
Length=319

 Score =   291 bits (746),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 154/185 (83%), Positives = 170/185 (92%), Gaps = 0/185 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TKG LKEVSEEVAKYKVGAPARVGLV PIDVVV PGNTGLDPSQTSFFQVLNIPTKINKG
Sbjct  94   TKGDLKEVSEEVAKYKVGAPARVGLVTPIDVVVQPGNTGLDPSQTSFFQVLNIPTKINKG  153

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            TVEIITPVELI+KGDKVGSSEAALLAKLGIRPFSYGL V SVYDNGSVF+PEVL+LTEDD
Sbjct  154  TVEIITPVELIKKGDKVGSSEAALLAKLGIRPFSYGLAVESVYDNGSVFNPEVLNLTEDD  213

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L++KFA GVSM+T+LSLA SYPTLAAAPHM +N YKNV+++A  T+YSFP ++ VKE LK
Sbjct  214  LVDKFAAGVSMITALSLAASYPTLAAAPHMFLNAYKNVVAVAFATEYSFPRSENVKECLK  273

Query  220  DPSKF  206
            DP+ +
Sbjct  274  DPTSW  278



>ref|XP_004972933.1| PREDICTED: 60S acidic ribosomal protein P0-like [Setaria italica]
Length=319

 Score =   290 bits (742),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 189/229 (83%), Positives = 205/229 (90%), Gaps = 3/229 (1%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TKG LKEV EEVAKYKVGAPARVGLVAP+DVVVPPGNTGLDPSQTSFFQVLNIPTKINKG
Sbjct  94   TKGDLKEVREEVAKYKVGAPARVGLVAPVDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  153

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            TVEIITPVELI+KGDKVGSSE+ALLAKLGIRPFSYGL +++VY++GSVFSPEVLDLTEDD
Sbjct  154  TVEIITPVELIKKGDKVGSSESALLAKLGIRPFSYGLQIVNVYEDGSVFSPEVLDLTEDD  213

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L+EKFA GVSMV SLSLA+SYPTLAAAPHM INGYKNVL++AVETDYS+P ADK+KEYLK
Sbjct  214  LVEKFATGVSMVASLSLALSYPTLAAAPHMFINGYKNVLAVAVETDYSYPHADKIKEYLK  273

Query  220  DPSKFavaaapvaaaaagsapaaaaaaeekkeepeeesEDEMGFSLFDD  74
            DPSKF   A     AA GS  AAA   EEK  EP EES++EMGFSLFDD
Sbjct  274  DPSKF---AVAAPVAAVGSGAAAAPKEEEKAPEPAEESDEEMGFSLFDD  319



>gb|EYU19990.1| hypothetical protein MIMGU_mgv1a0100892mg, partial [Erythranthe 
guttata]
Length=213

 Score =   286 bits (731),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 152/169 (90%), Positives = 162/169 (96%), Gaps = 0/169 (0%)
 Frame = -1

Query  712  VGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDK  533
            VGAPARVGLVAPIDV+VPPGNTGLDPSQTSFFQVLNIPTKINKGTVEI+TPVELI+KGDK
Sbjct  1    VGAPARVGLVAPIDVIVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIVTPVELIKKGDK  60

Query  532  VGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldlteddllEKFALGVSMVTSLS  353
            VGSSEAALL+KLGIRPFSYGL+V  VYDNGSVFSPEVLDLTEDDL+ KFA+GVSMVTSL+
Sbjct  61   VGSSEAALLSKLGIRPFSYGLVVTKVYDNGSVFSPEVLDLTEDDLIGKFAMGVSMVTSLA  120

Query  352  LAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  206
            LAISYPTLAAAPHM IN YKNVL++AV TDYSFPLADKVKEYL DPSKF
Sbjct  121  LAISYPTLAAAPHMFINAYKNVLAVAVATDYSFPLADKVKEYLADPSKF  169



>ref|XP_004958562.1| PREDICTED: 60S acidic ribosomal protein P0-like [Setaria italica]
Length=319

 Score =   289 bits (740),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 188/228 (82%), Positives = 206/228 (90%), Gaps = 2/228 (1%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TKG LKEV EEVAKYKVGAPARVGLVAP+DVVVPPGNTGLDPSQTSFFQVLNIPTKINKG
Sbjct  94   TKGDLKEVREEVAKYKVGAPARVGLVAPVDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  153

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            TVEIITPVELI+KGDKVGSSE+ALLAKLGIRPFSYGL V++VY++GSVFSPEVLDLTE+D
Sbjct  154  TVEIITPVELIKKGDKVGSSESALLAKLGIRPFSYGLQVINVYEDGSVFSPEVLDLTEED  213

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L+EKFA GVSMV SLSLA+SYPTLAAAPHM INGYKNVL++AVETDYS+P ADK+KEYLK
Sbjct  214  LIEKFATGVSMVASLSLALSYPTLAAAPHMFINGYKNVLAVAVETDYSYPHADKIKEYLK  273

Query  220  DPSKFavaaapvaaaaagsapaaaaaaeekkeepeeesEDEMGFSLFD  77
            DPSKF  AAA   A+A   A AA    E+K EEP EES+D+MGFSLFD
Sbjct  274  DPSKF--AAAAPVASADSGAAAAPKEEEKKAEEPAEESDDDMGFSLFD  319



>gb|KDO69056.1| hypothetical protein CISIN_1g036252mg [Citrus sinensis]
Length=318

 Score =   288 bits (737),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 152/185 (82%), Positives = 168/185 (91%), Gaps = 0/185 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TKG LKEVS+EV+K+KV APARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG
Sbjct  94   TKGDLKEVSDEVSKHKVAAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  153

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            TVEIITPVELI+KGD+VGSSE+ALL+KL I+PFSYGLIV+SVY+NGSV+SPEVLDLTEDD
Sbjct  154  TVEIITPVELIKKGDRVGSSESALLSKLAIKPFSYGLIVMSVYENGSVYSPEVLDLTEDD  213

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            +  KF   VS V SL+L+I YPT+AAAPH  INGYKNVLS AV T+YSF  ADKVKEYLK
Sbjct  214  IATKFLEAVSRVASLALSIRYPTIAAAPHFFINGYKNVLSFAVATEYSFSQADKVKEYLK  273

Query  220  DPSKF  206
            DPSKF
Sbjct  274  DPSKF  278



>ref|XP_006435696.1| hypothetical protein CICLE_v10033862mg [Citrus clementina]
 ref|XP_006486351.1| PREDICTED: 60S acidic ribosomal protein P0-like [Citrus sinensis]
 gb|ESR48936.1| hypothetical protein CICLE_v10033862mg [Citrus clementina]
Length=318

 Score =   288 bits (737),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 152/185 (82%), Positives = 168/185 (91%), Gaps = 0/185 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TKG LKEVS+EV+K+KV APARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG
Sbjct  94   TKGDLKEVSDEVSKHKVAAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  153

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            TVEIITPVELI+KGD+VGSSE+ALL+KL I+PFSYGLIV+SVY+NGSV+SPEVLDLTEDD
Sbjct  154  TVEIITPVELIKKGDRVGSSESALLSKLAIKPFSYGLIVMSVYENGSVYSPEVLDLTEDD  213

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            +  KF   VS V SL+L+I YPT+AAAPH  INGYKNVLS AV T+YSF  ADKVKEYLK
Sbjct  214  IATKFLEAVSRVASLALSIRYPTIAAAPHFFINGYKNVLSFAVATEYSFSQADKVKEYLK  273

Query  220  DPSKF  206
            DPSKF
Sbjct  274  DPSKF  278



>gb|ACL52455.1| unknown [Zea mays]
Length=319

 Score =   288 bits (736),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 188/229 (82%), Positives = 205/229 (90%), Gaps = 3/229 (1%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TKG LKEV EEVAKYKVGAPARVGLVAP+DVVVPPGNTGLDPSQTSFFQVLNIPTKINKG
Sbjct  94   TKGDLKEVREEVAKYKVGAPARVGLVAPVDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  153

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            TVEIITPVELI+KG+KVGSSE+ALLAKLGIRPFSYGL V SVY++GSVFSPEVLDL+E+D
Sbjct  154  TVEIITPVELIKKGEKVGSSESALLAKLGIRPFSYGLQVTSVYEDGSVFSPEVLDLSEED  213

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L+EKFA GVSMV SLSLA+SYPTLAA PHM INGYKNVL++AVETDYS+P ADK+KEYLK
Sbjct  214  LIEKFATGVSMVASLSLALSYPTLAAVPHMFINGYKNVLAVAVETDYSYPHADKIKEYLK  273

Query  220  DPSKFavaaapvaaaaagsapaaaaaaeekkeepeeesEDEMGFSLFDD  74
            DPSKF   A    AAAA S+ AAA   EEK  EP EES++EMGFSLFDD
Sbjct  274  DPSKF---AVAAPAAAADSSAAAAPKEEEKAPEPAEESDEEMGFSLFDD  319



>ref|NP_001141489.1| hypothetical protein [Zea mays]
 gb|ACF86473.1| unknown [Zea mays]
 gb|AFW61287.1| hypothetical protein ZEAMMB73_391125 [Zea mays]
Length=319

 Score =   288 bits (736),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 187/229 (82%), Positives = 204/229 (89%), Gaps = 3/229 (1%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TKG LKEV EEVAKYKVGAPARVGLVAP+DVVVPPGNTGLDPSQTSFFQVLNIPTKINKG
Sbjct  94   TKGDLKEVREEVAKYKVGAPARVGLVAPVDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  153

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            TVEIITPVELI+KG+KVGSSE+ALLAKLGIRPFSYGL V SVY++GSVFSPEVLDL+E+D
Sbjct  154  TVEIITPVELIKKGEKVGSSESALLAKLGIRPFSYGLQVTSVYEDGSVFSPEVLDLSEED  213

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L+EKFA GVSMV SLSLA+SYPTLAA PHM INGYKNVL++AVETDYS+P ADK+KEYLK
Sbjct  214  LIEKFATGVSMVASLSLALSYPTLAAVPHMFINGYKNVLAVAVETDYSYPHADKIKEYLK  273

Query  220  DPSKFavaaapvaaaaagsapaaaaaaeekkeepeeesEDEMGFSLFDD  74
            DPSKF   A     AAA S+ AAA   EEK  EP EES++EMGFSLFDD
Sbjct  274  DPSKF---AVAAPVAAADSSAAAAPKEEEKAPEPAEESDEEMGFSLFDD  319



>ref|XP_010234277.1| PREDICTED: 60S acidic ribosomal protein P0 [Brachypodium distachyon]
Length=321

 Score =   287 bits (735),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 187/229 (82%), Positives = 204/229 (89%), Gaps = 1/229 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TKG LKEV EEVAKYKVGAPARVGLVAP+DVVVPPGNTGLDPSQTSFFQVLNIPTKINKG
Sbjct  94   TKGDLKEVREEVAKYKVGAPARVGLVAPVDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  153

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            TVEIITPVELI+KGDKVGSSE+ALLAKLGIRPFSYGL++ +VYD+GSVFSPEVLDLTE+D
Sbjct  154  TVEIITPVELIKKGDKVGSSESALLAKLGIRPFSYGLVINNVYDSGSVFSPEVLDLTEED  213

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L++KFA GVSMV SLSLAISYPT+AAAPHM IN YKNVL+IAVETDYS+P  DK+KEYLK
Sbjct  214  LMDKFASGVSMVASLSLAISYPTIAAAPHMFINAYKNVLAIAVETDYSYPHGDKIKEYLK  273

Query  220  DPSKFavaaapvaaaaagsapaaaaaaeekkeepeeesEDEMGFSLFDD  74
            DPSKFAVAA   AAA+ G+A AA    E+K E  EE    EMGFSLFDD
Sbjct  274  DPSKFAVAAPAAAAASGGAAAAAPKEEEKKDEPEEESDG-EMGFSLFDD  321



>emb|CDP06275.1| unnamed protein product [Coffea canephora]
Length=247

 Score =   284 bits (726),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 149/185 (81%), Positives = 169/185 (91%), Gaps = 0/185 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TKG LKE+SEEV+KYKVGAPAR GL+A +DVVVPPGNTG DPSQTSFFQVLNIPT INKG
Sbjct  39   TKGDLKEISEEVSKYKVGAPARAGLIAAVDVVVPPGNTGPDPSQTSFFQVLNIPTNINKG  98

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            TVEIIT VELI+ GDK GSSE+ALL+KLGIRPFSYGLIV SV+DNGSVFSP+VL+LTEDD
Sbjct  99   TVEIITAVELIKNGDKDGSSESALLSKLGIRPFSYGLIVPSVFDNGSVFSPDVLNLTEDD  158

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            ++EKF+LG+SM TSL+L ISYP+L+AAPH+LINGYKN L IAVET+YSF  ADKV EYLK
Sbjct  159  VVEKFSLGLSMATSLALGISYPSLSAAPHILINGYKNALVIAVETEYSFSQADKVNEYLK  218

Query  220  DPSKF  206
            DPS+F
Sbjct  219  DPSEF  223



>gb|ABR26209.1| 60S acidic ribosomal protein p0 [Oryza sativa Indica Group]
Length=238

 Score =   283 bits (725),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 162/185 (88%), Positives = 178/185 (96%), Gaps = 0/185 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TKG LKEV EEVAKYKVGAPARVGLVAP+DVVVPPGNTGLDPSQTSFFQVLNIPTKINKG
Sbjct  13   TKGDLKEVREEVAKYKVGAPARVGLVAPVDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  72

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            TVEIITPVELI+KGDKVGSSE+ALLAKLGIRPFSYGL++ +VYD+GSVFSPEVLDLTEDD
Sbjct  73   TVEIITPVELIKKGDKVGSSESALLAKLGIRPFSYGLVITNVYDSGSVFSPEVLDLTEDD  132

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L+EKFA GVSMV S+SLAISYPT+AAAPHM +NGYKNVL++AVET+YS+P ADK+KEYLK
Sbjct  133  LMEKFASGVSMVASVSLAISYPTIAAAPHMFLNGYKNVLAVAVETEYSYPHADKIKEYLK  192

Query  220  DPSKF  206
            DPSKF
Sbjct  193  DPSKF  197



>ref|XP_002445000.1| hypothetical protein SORBIDRAFT_07g002560 [Sorghum bicolor]
 gb|EES14495.1| hypothetical protein SORBIDRAFT_07g002560 [Sorghum bicolor]
Length=319

 Score =   286 bits (732),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 163/185 (88%), Positives = 176/185 (95%), Gaps = 0/185 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TKG LKEV EEVAKYKVGAPARVGLVAP+DVVVPPGNTGLDPSQTSFFQVLNIPTKINKG
Sbjct  94   TKGDLKEVREEVAKYKVGAPARVGLVAPVDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  153

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            TVEIITPVELI+KGDKVGSSE+ALLAKLGIRPFSYGL V +VY++GSVFSPEVLDL+E+D
Sbjct  154  TVEIITPVELIKKGDKVGSSESALLAKLGIRPFSYGLQVTNVYEDGSVFSPEVLDLSEED  213

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L+EKFA GVSMV SLSLAISYPTLAA PHM INGYKNVL++AVETDYS+P ADK+KEYLK
Sbjct  214  LIEKFATGVSMVASLSLAISYPTLAAVPHMFINGYKNVLAVAVETDYSYPHADKIKEYLK  273

Query  220  DPSKF  206
            DPSKF
Sbjct  274  DPSKF  278



>ref|XP_006659092.1| PREDICTED: 60S acidic ribosomal protein P0-like [Oryza brachyantha]
Length=319

 Score =   286 bits (731),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 161/185 (87%), Positives = 178/185 (96%), Gaps = 0/185 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TKG LKEV EEVAKYKVGAPARVGLVAP+DVVVPPGNTGLDPSQTSFFQVLNIPTKINKG
Sbjct  94   TKGDLKEVREEVAKYKVGAPARVGLVAPVDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  153

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            TVEIITPVELI+KGDKVGSSE+ALLAKLGIRPFSYGL++ +VYD+GSVFSPEVLDLTE+D
Sbjct  154  TVEIITPVELIKKGDKVGSSESALLAKLGIRPFSYGLVITNVYDSGSVFSPEVLDLTEED  213

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L+EKFA GVSMV S+SLAISYPT+AAAPHM +NGYKNVL++AVET+YS+P ADK+KEYLK
Sbjct  214  LMEKFASGVSMVASVSLAISYPTIAAAPHMFLNGYKNVLAVAVETEYSYPHADKIKEYLK  273

Query  220  DPSKF  206
            DPSKF
Sbjct  274  DPSKF  278



>gb|ACF83717.1| unknown [Zea mays]
 gb|AFW74477.1| 60S acidic ribosomal protein P0 [Zea mays]
Length=319

 Score =   286 bits (731),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 163/185 (88%), Positives = 176/185 (95%), Gaps = 0/185 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TKG LKEV EEVAKYKVGAPARVGLVAP+DVVVPPGNTGLDPSQTSFFQVLNIPTKINKG
Sbjct  94   TKGDLKEVREEVAKYKVGAPARVGLVAPVDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  153

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            TVEIITPVELI+KG+KVGSSE+ALLAKLGIRPFSYGL V SVY++GSVFSPEVLDL+E+D
Sbjct  154  TVEIITPVELIKKGEKVGSSESALLAKLGIRPFSYGLQVTSVYEDGSVFSPEVLDLSEED  213

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L+EKFA GVSMV SLSLAISYPTLAA PHM INGYKNVL++AVETDYS+P ADK+KEYLK
Sbjct  214  LIEKFATGVSMVASLSLAISYPTLAAVPHMFINGYKNVLAVAVETDYSYPHADKIKEYLK  273

Query  220  DPSKF  206
            DPSKF
Sbjct  274  DPSKF  278



>ref|NP_001105482.1| 60S acidic ribosomal protein P0 [Zea mays]
 sp|O24573.3|RLA0_MAIZE RecName: Full=60S acidic ribosomal protein P0 [Zea mays]
 emb|CAA69256.1| 60S acidic ribosomal protein P0 [Zea mays]
Length=319

 Score =   286 bits (731),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 163/185 (88%), Positives = 176/185 (95%), Gaps = 0/185 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TKG LKEV EEVAKYKVGAPARVGLVAP+DVVVPPGNTGLDPSQTSFFQVLNIPTKINKG
Sbjct  94   TKGDLKEVREEVAKYKVGAPARVGLVAPVDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  153

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            TVEIITPVELI+KG+KVGSSE+ALLAKLGIRPFSYGL V SVY++GSVFSPEVLDL+E+D
Sbjct  154  TVEIITPVELIKKGEKVGSSESALLAKLGIRPFSYGLQVTSVYEDGSVFSPEVLDLSEED  213

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L+EKFA GVSMV SLSLAISYPTLAA PHM INGYKNVL++AVETDYS+P ADK+KEYLK
Sbjct  214  LIEKFATGVSMVASLSLAISYPTLAAVPHMFINGYKNVLAVAVETDYSYPHADKIKEYLK  273

Query  220  DPSKF  206
            DPSKF
Sbjct  274  DPSKF  278



>ref|NP_001060923.1| Os08g0130500 [Oryza sativa Japonica Group]
 sp|P41095.3|RLA0_ORYSJ RecName: Full=60S acidic ribosomal protein P0 [Oryza sativa Japonica 
Group]
 pdb|3J61|QQ Chain q, Localization Of The Large Subunit Ribosomal Proteins 
Into A 5.5 A Cryo-em Map Of Triticum Aestivum Translating 80s 
Ribosome
 dbj|BAA04668.1| acidic ribosomal protein P0 [Oryza sativa Japonica Group]
 dbj|BAC66723.1| 60S acidic ribosomal protein P0 [Oryza sativa Japonica Group]
 dbj|BAF22837.1| Os08g0130500 [Oryza sativa Japonica Group]
 dbj|BAG89244.1| unnamed protein product [Oryza sativa Japonica Group]
Length=319

 Score =   286 bits (731),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 162/185 (88%), Positives = 178/185 (96%), Gaps = 0/185 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TKG LKEV EEVAKYKVGAPARVGLVAP+DVVVPPGNTGLDPSQTSFFQVLNIPTKINKG
Sbjct  94   TKGDLKEVREEVAKYKVGAPARVGLVAPVDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  153

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            TVEIITPVELI+KGDKVGSSE+ALLAKLGIRPFSYGL++ +VYD+GSVFSPEVLDLTEDD
Sbjct  154  TVEIITPVELIKKGDKVGSSESALLAKLGIRPFSYGLVITNVYDSGSVFSPEVLDLTEDD  213

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L+EKFA GVSMV S+SLAISYPT+AAAPHM +NGYKNVL++AVET+YS+P ADK+KEYLK
Sbjct  214  LMEKFASGVSMVASVSLAISYPTIAAAPHMFLNGYKNVLAVAVETEYSYPHADKIKEYLK  273

Query  220  DPSKF  206
            DPSKF
Sbjct  274  DPSKF  278



>gb|ABA95724.1| 60S acidic ribosomal protein P0, putative, expressed [Oryza sativa 
Japonica Group]
 gb|EAZ19563.1| hypothetical protein OsJ_35136 [Oryza sativa Japonica Group]
Length=320

 Score =   286 bits (731),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 161/185 (87%), Positives = 178/185 (96%), Gaps = 0/185 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TKG LKEV EEVAKYKVGAPARVGLVAP+DVVVPPGNTGLDPSQTSFFQVLNIPTKINKG
Sbjct  94   TKGDLKEVREEVAKYKVGAPARVGLVAPVDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  153

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            TVEIITPVELI+KGDKVGSSE+ALLAKLGIRPFSYGL++ +VYD+GSVFSPEVLDLTE+D
Sbjct  154  TVEIITPVELIKKGDKVGSSESALLAKLGIRPFSYGLVITNVYDSGSVFSPEVLDLTEED  213

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L+EKFA GVSMV S+SLAISYPT+AAAPHM +NGYKNVL++AVET+YS+P ADK+KEYLK
Sbjct  214  LMEKFASGVSMVASVSLAISYPTIAAAPHMFLNGYKNVLAVAVETEYSYPHADKIKEYLK  273

Query  220  DPSKF  206
            DPSKF
Sbjct  274  DPSKF  278



>gb|ABA91328.1| 60S acidic ribosomal protein P0, putative, expressed [Oryza sativa 
Japonica Group]
 gb|EAY79838.1| hypothetical protein OsI_34997 [Oryza sativa Indica Group]
 gb|EAZ41411.1| hypothetical protein OsJ_25933 [Oryza sativa Japonica Group]
Length=320

 Score =   286 bits (731),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 161/185 (87%), Positives = 178/185 (96%), Gaps = 0/185 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TKG LKEV EEVAKYKVGAPARVGLVAP+DVVVPPGNTGLDPSQTSFFQVLNIPTKINKG
Sbjct  94   TKGDLKEVREEVAKYKVGAPARVGLVAPVDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  153

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            TVEIITPVELI+KGDKVGSSE+ALLAKLGIRPFSYGL++ +VYD+GSVFSPEVLDLTE+D
Sbjct  154  TVEIITPVELIKKGDKVGSSESALLAKLGIRPFSYGLVITNVYDSGSVFSPEVLDLTEED  213

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L+EKFA GVSMV S+SLAISYPT+AAAPHM +NGYKNVL++AVET+YS+P ADK+KEYLK
Sbjct  214  LMEKFASGVSMVASVSLAISYPTIAAAPHMFLNGYKNVLAVAVETEYSYPHADKIKEYLK  273

Query  220  DPSKF  206
            DPSKF
Sbjct  274  DPSKF  278



>gb|EAY82182.1| hypothetical protein OsI_37384 [Oryza sativa Indica Group]
 emb|CBX24392.1| hypothetical_protein [Oryza glaberrima]
Length=320

 Score =   286 bits (731),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 161/185 (87%), Positives = 178/185 (96%), Gaps = 0/185 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TKG LKEV EEVAKYKVGAPARVGLVAP+DVVVPPGNTGLDPSQTSFFQVLNIPTKINKG
Sbjct  94   TKGDLKEVREEVAKYKVGAPARVGLVAPVDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  153

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            TVEIITPVELI+KGDKVGSSE+ALLAKLGIRPFSYGL++ +VYD+GSVFSPEVLDLTE+D
Sbjct  154  TVEIITPVELIKKGDKVGSSESALLAKLGIRPFSYGLVITNVYDSGSVFSPEVLDLTEED  213

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L+EKFA GVSMV S+SLAISYPT+AAAPHM +NGYKNVL++AVET+YS+P ADK+KEYLK
Sbjct  214  LMEKFASGVSMVASVSLAISYPTIAAAPHMFLNGYKNVLAVAVETEYSYPHADKIKEYLK  273

Query  220  DPSKF  206
            DPSKF
Sbjct  274  DPSKF  278



>gb|ADE76171.1| unknown [Picea sitchensis]
Length=266

 Score =   283 bits (725),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 194/228 (85%), Positives = 210/228 (92%), Gaps = 0/228 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TKG LKEV EEVAKYKVGAPARVGLVAP+DVVVPPGNTGLDPSQTSFFQVLNIPTKINKG
Sbjct  39   TKGDLKEVREEVAKYKVGAPARVGLVAPVDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  98

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            TVEIITPVELI+KG+KVGSSEAALLAKLGIRPFSYGL+V SVYDNGSVF PEVLDLTEDD
Sbjct  99   TVEIITPVELIKKGEKVGSSEAALLAKLGIRPFSYGLVVQSVYDNGSVFDPEVLDLTEDD  158

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L+EKFA G+S VT+LSLAISYPT+AA PH +INGYKNVL+IA+E DYSFPLA+KVKEYLK
Sbjct  159  LIEKFAAGISTVTALSLAISYPTIAAVPHAIINGYKNVLAIAIELDYSFPLAEKVKEYLK  218

Query  220  DPSKFavaaapvaaaaagsapaaaaaaeekkeepeeesEDEMGFSLFD  77
            DPSKFAVAAAPVA+A   +  AAA   EEKK EPEEESE++MGFSLFD
Sbjct  219  DPSKFAVAAAPVASATEAAPAAAAPKEEEKKPEPEEESEEDMGFSLFD  266



>ref|XP_009799989.1| PREDICTED: 60S acidic ribosomal protein P0-like [Nicotiana sylvestris]
Length=319

 Score =   285 bits (728),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 152/185 (82%), Positives = 169/185 (91%), Gaps = 0/185 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            T+G LKEVS+EV+KYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG
Sbjct  94   TRGDLKEVSDEVSKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  153

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            TVEI  PVE+I+KG+KVGSSE+ALL+KLGI+PFSYGLIV  VYD+GSVFSPEVLDLTEDD
Sbjct  154  TVEITIPVEIIKKGEKVGSSESALLSKLGIKPFSYGLIVQFVYDSGSVFSPEVLDLTEDD  213

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L+ KFA G+S V  LS+ +SYPTLAA PHM INGYKNVLS A+ T+YSFP A+KVKEYLK
Sbjct  214  LIAKFAAGLSNVVGLSMLLSYPTLAAIPHMFINGYKNVLSFAIATEYSFPQAEKVKEYLK  273

Query  220  DPSKF  206
            DPSKF
Sbjct  274  DPSKF  278



>ref|XP_004241171.1| PREDICTED: 60S acidic ribosomal protein P0-like [Solanum lycopersicum]
Length=318

 Score =   285 bits (728),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 148/185 (80%), Positives = 170/185 (92%), Gaps = 0/185 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TKG LKEVS+EV+KYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG
Sbjct  94   TKGDLKEVSDEVSKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  153

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            TVEIITPVE+I+KG+KVGSSE+ALL+KL I+PFSYGLIV SVYDNGSVFSPEVL+LT++D
Sbjct  154  TVEIITPVEIIKKGEKVGSSESALLSKLLIKPFSYGLIVQSVYDNGSVFSPEVLELTDND  213

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L+ +FA G++ V  LS+ ++YPTLAA PH+ IN YKNVLS A+ T+YSFP A+KVKEYLK
Sbjct  214  LVARFAAGLTNVVGLSMTLNYPTLAAIPHIFINSYKNVLSFAIATEYSFPQAEKVKEYLK  273

Query  220  DPSKF  206
            DPSKF
Sbjct  274  DPSKF  278



>ref|XP_010685586.1| PREDICTED: 60S acidic ribosomal protein P0 [Beta vulgaris subsp. 
vulgaris]
Length=324

 Score =   285 bits (728),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 146/185 (79%), Positives = 169/185 (91%), Gaps = 0/185 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TKG LKEVSEE+ KYKVGAPARVGLVAPIDVV+PPGNTGLDPSQTSFFQ LNIPTKINKG
Sbjct  98   TKGDLKEVSEELGKYKVGAPARVGLVAPIDVVIPPGNTGLDPSQTSFFQALNIPTKINKG  157

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            TVEIITPVE+I+KGDKVGSSEA LL+KL I+PFSYGL+V  V+++GSV+ PE+LDLTEDD
Sbjct  158  TVEIITPVEIIKKGDKVGSSEAMLLSKLAIKPFSYGLVVQKVFEDGSVYDPEILDLTEDD  217

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L  KFA GV+ VT+L+LAISYPT+AAAPHM IN YKNVL+++V TDY+FP A+++KEYLK
Sbjct  218  LALKFAAGVANVTALALAISYPTIAAAPHMFINAYKNVLAVSVATDYTFPEAEEIKEYLK  277

Query  220  DPSKF  206
            DPSKF
Sbjct  278  DPSKF  282



>ref|XP_009592351.1| PREDICTED: 60S acidic ribosomal protein P0-like [Nicotiana tomentosiformis]
Length=319

 Score =   284 bits (726),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 150/185 (81%), Positives = 169/185 (91%), Gaps = 0/185 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            T+G LKEVS+EV+KYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKIN+G
Sbjct  94   TRGDLKEVSDEVSKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINRG  153

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            TVEI  PVE+I+KG+KVGSSE+ALL+KLGI+PFSYGLIV  VYD+GSVFSPEVLDLTE+D
Sbjct  154  TVEITIPVEIIKKGEKVGSSESALLSKLGIKPFSYGLIVQFVYDSGSVFSPEVLDLTEND  213

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L+ KFA G+S V  LS+ +SYPTLAA PHM INGYKNVLS A+ T+YSFP A+KVKEYLK
Sbjct  214  LIAKFAAGLSNVVGLSMLLSYPTLAAIPHMFINGYKNVLSFAIATEYSFPQAEKVKEYLK  273

Query  220  DPSKF  206
            DPSKF
Sbjct  274  DPSKF  278



>gb|KDP46515.1| hypothetical protein JCGZ_08487 [Jatropha curcas]
Length=319

 Score =   283 bits (725),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 150/185 (81%), Positives = 171/185 (92%), Gaps = 0/185 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TKG LKEV EE+AKYKVGAPARVGL+APIDVVVPPG TGLDPS TSFFQ LNIPTKINKG
Sbjct  94   TKGDLKEVREEIAKYKVGAPARVGLIAPIDVVVPPGPTGLDPSMTSFFQALNIPTKINKG  153

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            +VEI+T V+LI+KG+KVGSSE+ALLAKL IRPFSYGLIV SVYDNGSVFSPEVLDLTEDD
Sbjct  154  SVEIVTAVDLIKKGEKVGSSESALLAKLQIRPFSYGLIVFSVYDNGSVFSPEVLDLTEDD  213

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L+E+F  GVSMVTSLSL+IS+PTLAAAPHM +N YKNVLS++V T+Y+FP A++VKE+L+
Sbjct  214  LVERFVNGVSMVTSLSLSISFPTLAAAPHMFLNAYKNVLSVSVATEYTFPQAEQVKEFLE  273

Query  220  DPSKF  206
            DPSKF
Sbjct  274  DPSKF  278



>ref|XP_008779152.1| PREDICTED: 60S acidic ribosomal protein P0-like [Phoenix dactylifera]
Length=221

 Score =   279 bits (713),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 177/213 (83%), Positives = 196/213 (92%), Gaps = 1/213 (0%)
 Frame = -1

Query  715  KVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGD  536
            +VGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELI+KG+
Sbjct  10   QVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGE  69

Query  535  KVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldlteddllEKFALGVSMVTSL  356
            KVGSSEAALLAKLGIRPFSYGLI+ SVYDNGSVFSPEVLDLTEDDL+E+FA GVS+VTSL
Sbjct  70   KVGSSEAALLAKLGIRPFSYGLIIQSVYDNGSVFSPEVLDLTEDDLVERFAAGVSIVTSL  129

Query  355  SLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKFavaaapvaaa  176
            SLA+SYPT+AAAPHM IN YKNVL++A+ T+Y+FP A+KVKE+LKDPSKF   A PV AA
Sbjct  130  SLALSYPTIAAAPHMFINAYKNVLAVAIATEYTFPQAEKVKEFLKDPSKF-AVAVPVEAA  188

Query  175  aagsapaaaaaaeekkeepeeesEDEMGFSLFD  77
             A +APAAAA  EEK EEP EES+D+MGFSLFD
Sbjct  189  DAAAAPAAAAKEEEKNEEPAEESDDDMGFSLFD  221



>gb|EMT17099.1| 60S acidic ribosomal protein P0 [Aegilops tauschii]
Length=320

 Score =   281 bits (720),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 176/229 (77%), Positives = 199/229 (87%), Gaps = 2/229 (1%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TKG LKEV EEVAKYKVGAPARVGLVAP+DVVVPPGNTGLDPSQTSFFQVLNIPTKINKG
Sbjct  94   TKGDLKEVREEVAKYKVGAPARVGLVAPVDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  153

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            TVEI  PVELI+KGDKVGSSE+ALLAKLGIRPFSYGL++ +VYD+GSVFSPEVLDLTE+D
Sbjct  154  TVEITIPVELIKKGDKVGSSESALLAKLGIRPFSYGLVICNVYDSGSVFSPEVLDLTEED  213

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L++KFA GVSMV SLSLAISYPT+AAAPHM +N YKNVL++A+ETDYS+  ADK+KEYLK
Sbjct  214  LMDKFASGVSMVASLSLAISYPTMAAAPHMFLNAYKNVLAVALETDYSYDHADKIKEYLK  273

Query  220  DPSKFavaaapvaaaaagsapaaaaaaeekkeepeeesEDEMGFSLFDD  74
            DPSKFAVAA   AA+   +A A     ++ + E E +   EMGFSLFDD
Sbjct  274  DPSKFAVAAPAAAASGGAAAAAPKEEEKKDEPEEESDG--EMGFSLFDD  320



>dbj|BAJ92405.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=320

 Score =   281 bits (720),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 176/229 (77%), Positives = 200/229 (87%), Gaps = 2/229 (1%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TKG LKEV EEVAKYKVGAPARVGLVAP+DVVVPPGNTGLDPSQTSFFQVLNIPTKINKG
Sbjct  94   TKGDLKEVREEVAKYKVGAPARVGLVAPVDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  153

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            TVEI  PVELI+KGDKVGSSE+ALLAKLGIRPFSYGL++ +VYD+GSVFSPEVLDLTE+D
Sbjct  154  TVEITIPVELIKKGDKVGSSESALLAKLGIRPFSYGLVICNVYDSGSVFSPEVLDLTEED  213

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L++KFA GVSMV SLSLAISYPT+AAAPHM +N YKNVL++A+ETDYS+  ADK+KEYLK
Sbjct  214  LMDKFASGVSMVASLSLAISYPTMAAAPHMFLNAYKNVLAVALETDYSYDHADKIKEYLK  273

Query  220  DPSKFavaaapvaaaaagsapaaaaaaeekkeepeeesEDEMGFSLFDD  74
            DPSKFAVAA   AA+   +A A     ++++ E E +   EMGFSLFDD
Sbjct  274  DPSKFAVAAPAAAASGGAAAAAPKEEEKKEEPEEESDG--EMGFSLFDD  320



>ref|XP_002983859.1| hypothetical protein SELMODRAFT_268802 [Selaginella moellendorffii]
 gb|EFJ14871.1| hypothetical protein SELMODRAFT_268802 [Selaginella moellendorffii]
Length=322

 Score =   281 bits (719),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 148/185 (80%), Positives = 165/185 (89%), Gaps = 0/185 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TKG LKEV EEVAKYKVGAPARVGLVAPIDV +PPG+TGLDPSQTSFFQVLNIPTKINKG
Sbjct  94   TKGDLKEVREEVAKYKVGAPARVGLVAPIDVTIPPGSTGLDPSQTSFFQVLNIPTKINKG  153

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            TVEI++ VELI+KG+KVGSSEAALLAKLGIRPFSYGL+V  VYD+GSVF P VLDLTEDD
Sbjct  154  TVEIVSSVELIKKGEKVGSSEAALLAKLGIRPFSYGLVVQMVYDDGSVFDPAVLDLTEDD  213

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L+ +FA GVS V +LSLAI YPTLAAA H  +N YKNVL++A+ TDYS+P A+ VKEYLK
Sbjct  214  LVGRFAAGVSAVAALSLAIGYPTLAAATHCFLNSYKNVLAVALATDYSYPHAETVKEYLK  273

Query  220  DPSKF  206
            DPSKF
Sbjct  274  DPSKF  278



>emb|CBX25428.1| hypothetical_protein [Oryza glaberrima]
Length=322

 Score =   281 bits (718),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 161/187 (86%), Positives = 178/187 (95%), Gaps = 2/187 (1%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVG--APARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKIN  587
            TKG LKEV EEVAKYKVG  APARVGLVAP+DVVVPPGNTGLDPSQTSFFQVLNIPTKIN
Sbjct  94   TKGDLKEVREEVAKYKVGVGAPARVGLVAPVDVVVPPGNTGLDPSQTSFFQVLNIPTKIN  153

Query  586  KGTVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldlte  407
            KGTVEIITPVELI+KGDKVGSSE+ALLAKLGIRPFSYGL++ +VYD+GSVFSPEVLDLTE
Sbjct  154  KGTVEIITPVELIKKGDKVGSSESALLAKLGIRPFSYGLVITNVYDSGSVFSPEVLDLTE  213

Query  406  ddllEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEY  227
            +DL+EKFA GVSMV S+SLAISYPT+AAAPHM +NGYKNVL++AVET+YS+P ADK+KEY
Sbjct  214  EDLMEKFASGVSMVASVSLAISYPTIAAAPHMFLNGYKNVLAVAVETEYSYPHADKIKEY  273

Query  226  LKDPSKF  206
            LKDPSKF
Sbjct  274  LKDPSKF  280



>ref|XP_002960810.1| hypothetical protein SELMODRAFT_437282 [Selaginella moellendorffii]
 gb|EFJ38349.1| hypothetical protein SELMODRAFT_437282 [Selaginella moellendorffii]
Length=321

 Score =   281 bits (718),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 172/228 (75%), Positives = 192/228 (84%), Gaps = 0/228 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TKG LKEV EEVAKYKVGAPARVGLVAPIDV +PPG+TGLDPSQTSFFQVLNIPTKINKG
Sbjct  94   TKGDLKEVREEVAKYKVGAPARVGLVAPIDVTIPPGSTGLDPSQTSFFQVLNIPTKINKG  153

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            TVEI++ VELI+KG+KVGSSEAALLAKLGIRPFSYGL+V  VYD+GSVF P VLDLTEDD
Sbjct  154  TVEIVSSVELIKKGEKVGSSEAALLAKLGIRPFSYGLVVQMVYDDGSVFDPAVLDLTEDD  213

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L+ +FA GVS V +LSLAI YPTLAAA H  +N YKNVL++A+ TDYS+P A+  KEYLK
Sbjct  214  LVGRFATGVSAVAALSLAIGYPTLAAATHYFLNSYKNVLAVALATDYSYPHAETAKEYLK  273

Query  220  DPSKFavaaapvaaaaagsapaaaaaaeekkeepeeesEDEMGFSLFD  77
            DPSKFAVAAAP A+     A       EEKK EPEEES+D+MG SLFD
Sbjct  274  DPSKFAVAAAPAASETPADAAGGGKVEEEKKVEPEEESDDDMGLSLFD  321



>dbj|BAJ94456.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=320

 Score =   280 bits (717),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 157/185 (85%), Positives = 174/185 (94%), Gaps = 0/185 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TKG LKEV EEVAKYKVGAPARVGLVAP+DVVVPPGNTGLDPSQTSFFQVLNIPTKINKG
Sbjct  94   TKGDLKEVREEVAKYKVGAPARVGLVAPVDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  153

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            TVEI  PVELI+KGDKVGSSE+ALLAKLGIRPFSYGL++ +VYD+GSVFSPEVLDLTE+D
Sbjct  154  TVEITIPVELIKKGDKVGSSESALLAKLGIRPFSYGLVICNVYDSGSVFSPEVLDLTEED  213

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L++KFA GVSMV SLSLAISYPT+AAAPHM +N YKNVL++A+ETDYS+  ADK+KEYLK
Sbjct  214  LMDKFASGVSMVASLSLAISYPTMAAAPHMFLNAYKNVLAVALETDYSYDHADKIKEYLK  273

Query  220  DPSKF  206
            DPSKF
Sbjct  274  DPSKF  278



>ref|XP_002974292.1| hypothetical protein SELMODRAFT_149765 [Selaginella moellendorffii]
 ref|XP_002985667.1| hypothetical protein SELMODRAFT_181962 [Selaginella moellendorffii]
 gb|EFJ13245.1| hypothetical protein SELMODRAFT_181962 [Selaginella moellendorffii]
 gb|EFJ24514.1| hypothetical protein SELMODRAFT_149765 [Selaginella moellendorffii]
Length=318

 Score =   280 bits (717),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 148/185 (80%), Positives = 165/185 (89%), Gaps = 0/185 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TKG LKEV EEVAKYKVGAPARVGLVAPIDV +PPG+TGLDPSQTSFFQVLNIPTKINKG
Sbjct  94   TKGDLKEVREEVAKYKVGAPARVGLVAPIDVTIPPGSTGLDPSQTSFFQVLNIPTKINKG  153

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            TVEI++ VELI+KG+KVGSSEAALLAKLGIRPFSYGL+V  VYD+GSVF P VLDLTEDD
Sbjct  154  TVEIVSSVELIKKGEKVGSSEAALLAKLGIRPFSYGLVVQMVYDDGSVFDPAVLDLTEDD  213

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L+ +FA GVS V +LSLAI YPTLAAA H  +N YKNVL++A+ TDYS+P A+ VKEYLK
Sbjct  214  LVGRFAAGVSAVAALSLAIGYPTLAAASHYFLNSYKNVLAVALATDYSYPQAETVKEYLK  273

Query  220  DPSKF  206
            DPSKF
Sbjct  274  DPSKF  278



>emb|CDY67524.1| BnaAnng24540D [Brassica napus]
 emb|CDY67517.1| BnaAnng24470D [Brassica napus]
Length=222

 Score =   276 bits (707),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 147/170 (86%), Positives = 162/170 (95%), Gaps = 0/170 (0%)
 Frame = -1

Query  715  KVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGD  536
            +VGAPARVGLVAPIDVVV PGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELI++GD
Sbjct  7    QVGAPARVGLVAPIDVVVQPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKQGD  66

Query  535  KVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldlteddllEKFALGVSMVTSL  356
            KVGSSEAALLAKLGIRPFSYGL+V SVYDNGSVFSPEVLDLTEDDL++KFA G+SMVTSL
Sbjct  67   KVGSSEAALLAKLGIRPFSYGLVVQSVYDNGSVFSPEVLDLTEDDLVQKFAAGISMVTSL  126

Query  355  SLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  206
            +LAIS+PTLAAAPHM IN YKN L+I+V T+Y+FP A+KVKE+LKDPSKF
Sbjct  127  ALAISFPTLAAAPHMFINAYKNALAISVATEYTFPQAEKVKEFLKDPSKF  176



>ref|XP_006350830.1| PREDICTED: 60S acidic ribosomal protein P0-like [Solanum tuberosum]
Length=318

 Score =   280 bits (715),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 146/183 (80%), Positives = 167/183 (91%), Gaps = 0/183 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TKG LKEVS+EV+KYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG
Sbjct  94   TKGDLKEVSDEVSKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  153

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            TVEIITPVE+I+KG+KVGSSE+ALL+KL I+PFSYGLIV SVYDNGSVFSPEVL+LT++D
Sbjct  154  TVEIITPVEIIKKGEKVGSSESALLSKLLIKPFSYGLIVQSVYDNGSVFSPEVLELTDND  213

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L+ +FA G++ V  LS+ + YPTLAA PHM IN YKNVLS A+ T+YSFP A+KVKEYLK
Sbjct  214  LVARFAAGLTNVVGLSMILDYPTLAAIPHMFINSYKNVLSFAIATEYSFPQAEKVKEYLK  273

Query  220  DPS  212
            +PS
Sbjct  274  NPS  276



>sp|P50345.1|RLA0_LUPLU RecName: Full=60S acidic ribosomal protein P0 [Lupinus luteus]
 emb|CAA63786.1| P0 ribosomal protein [Lupinus luteus]
Length=322

 Score =   277 bits (709),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 183/229 (80%), Positives = 196/229 (86%), Gaps = 0/229 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TKG LKEVSEEVAKYKVGAPA VGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG
Sbjct  94   TKGYLKEVSEEVAKYKVGAPACVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  153

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            TVEIITPVELI+KGDKVGSSEAALLAKLGIRPFSYGL+VLSVYDNGSVF PEVLDLTEDD
Sbjct  154  TVEIITPVELIKKGDKVGSSEAALLAKLGIRPFSYGLVVLSVYDNGSVFKPEVLDLTEDD  213

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            LLEKFA+GVS       +   P  +AAPH+ IN YKNVL++AV T+YSFP AD+VKEYLK
Sbjct  214  LLEKFAIGVSQCYFSDTSHFIPNPSAAPHVFINAYKNVLAVAVATEYSFPQADEVKEYLK  273

Query  220  DPSKFavaaapvaaaaagsapaaaaaaeekkeepeeesEDEMGFSLFDD  74
            DPSKFA  AA  A AA   A  AAAA  EK+EEP EES+DEMGF LFD+
Sbjct  274  DPSKFAAVAAAAAPAADSGAAPAAAAKAEKEEEPAEESDDEMGFGLFDE  322



>gb|ADU04571.1| 60S acidic ribosomal protein PO [Phaseolus vulgaris]
 gb|AGV54610.1| 60S acidic ribosomal protein P0 [Phaseolus vulgaris]
Length=320

 Score =   274 bits (700),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 182/228 (80%), Positives = 189/228 (83%), Gaps = 1/228 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TKG LKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG
Sbjct  94   TKGDLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  153

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            TVEIITPVELIRKG+KVGSSE   LA L  RP   GL  L       VFSPE  DLTEDD
Sbjct  154  TVEIITPVELIRKGEKVGSSELHCLASLAFRPSHMGLGALLFIKMAPVFSPEGPDLTEDD  213

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            LLEKFA GVSMVT LSLAISYPTLAAAPHM +N YKN+LS+A+ TDYSFP ADKVKEYLK
Sbjct  214  LLEKFAAGVSMVTFLSLAISYPTLAAAPHMFVNAYKNLLSVAIATDYSFPEADKVKEYLK  273

Query  220  DPSKFavaaapvaaaaagsapaaaaaaeekkeepeeesEDEMGFSLFD  77
            DPSKF   AA  A AAA  APAAAA  EEK EEP EES+D+MGFSLFD
Sbjct  274  DPSKF-AVAAVAAPAAASGAPAAAAKEEEKMEEPAEESDDDMGFSLFD  320



>gb|EYU22330.1| hypothetical protein MIMGU_mgv1a019166mg, partial [Erythranthe 
guttata]
Length=230

 Score =   269 bits (687),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 144/163 (88%), Positives = 153/163 (94%), Gaps = 0/163 (0%)
 Frame = -1

Query  712  VGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDK  533
            VGAPARVGLVAPIDV+VP GNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELI+KG+K
Sbjct  4    VGAPARVGLVAPIDVIVPRGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGNK  63

Query  532  VGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldlteddllEKFALGVSMVTSLS  353
            VGSSEAALL+KLGIRPFSYGL+VLSVYDNGSV+SPEVL L  DDL+ KFA+GVSMV SLS
Sbjct  64   VGSSEAALLSKLGIRPFSYGLVVLSVYDNGSVYSPEVLHLPVDDLVAKFAMGVSMVNSLS  123

Query  352  LAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYL  224
            LAISYPTLAAA HM INGYKNVL+ AVET YSFPLADKVKEYL
Sbjct  124  LAISYPTLAAALHMFINGYKNVLAAAVETGYSFPLADKVKEYL  166



>ref|XP_004296403.1| PREDICTED: 60S acidic ribosomal protein P0-like [Fragaria vesca 
subsp. vesca]
Length=319

 Score =   271 bits (693),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 155/185 (84%), Positives = 168/185 (91%), Gaps = 0/185 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TKG LKEV EEVAKYKVGAPARVGLVAP+DVVVPPGNTGLDPSQTSFFQVLNIPTKINKG
Sbjct  93   TKGDLKEVKEEVAKYKVGAPARVGLVAPVDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  152

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            TVEIITPVELI+KGDKVGSSEAALL+KL IRPFSYGL+V  VYDNGSVFSPEVLDLTE+D
Sbjct  153  TVEIITPVELIKKGDKVGSSEAALLSKLAIRPFSYGLVVQMVYDNGSVFSPEVLDLTEED  212

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L  KFA   S V +L+LAISYPT+ AAPHM +N YKNVL++AV T++SFP ADKVKEYLK
Sbjct  213  LAVKFASSASNVAALALAISYPTVVAAPHMFLNAYKNVLAVAVATEFSFPQADKVKEYLK  272

Query  220  DPSKF  206
            DPSKF
Sbjct  273  DPSKF  277



>ref|XP_008351783.1| PREDICTED: uncharacterized protein LOC103415220 [Malus domestica]
Length=762

 Score =   282 bits (721),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 149/170 (88%), Positives = 162/170 (95%), Gaps = 0/170 (0%)
 Frame = -1

Query  715  KVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGD  536
            KVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELI+KGD
Sbjct  550  KVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGD  609

Query  535  KVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldlteddllEKFALGVSMVTSL  356
            KVGSSEAALLAKLGIRPFSYGL+V  VYDNGSVFSPEVLDLTEDDL+ KFA GVSMVTSL
Sbjct  610  KVGSSEAALLAKLGIRPFSYGLVVEMVYDNGSVFSPEVLDLTEDDLMVKFASGVSMVTSL  669

Query  355  SLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  206
            +LA+SYPTLAAAPHM +N YKNVL++++ T+YSFP A+KVKE+LKDPSKF
Sbjct  670  ALAVSYPTLAAAPHMFLNAYKNVLAVSIATEYSFPQAEKVKEFLKDPSKF  719



>emb|CBI15980.3| unnamed protein product [Vitis vinifera]
Length=245

 Score =   265 bits (678),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 144/185 (78%), Positives = 162/185 (88%), Gaps = 0/185 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TKG LK VS+EVAKYKVGAPAR G+VAPIDVV+ PG+TGLDP+ TSFFQVLNIPTKINKG
Sbjct  18   TKGDLKGVSDEVAKYKVGAPARAGVVAPIDVVIQPGSTGLDPALTSFFQVLNIPTKINKG  77

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
             VEI+ PV+L++KGDKVGSSEAALLAKLG + FSYGL+VLSV DNGSVFSP+VLDLT+DD
Sbjct  78   AVEIVVPVQLVKKGDKVGSSEAALLAKLGKKSFSYGLVVLSVSDNGSVFSPKVLDLTDDD  137

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L EKF+ GVSM  SLSLAISYPTLAAA HM IN   NVL++AV  +YSFP A +VKEYLK
Sbjct  138  LAEKFSAGVSMKASLSLAISYPTLAAALHMFINACNNVLTVAVVAEYSFPQAQQVKEYLK  197

Query  220  DPSKF  206
            DPSKF
Sbjct  198  DPSKF  202



>ref|XP_002279500.1| PREDICTED: 60S acidic ribosomal protein P0-2-like [Vitis vinifera]
Length=286

 Score =   266 bits (681),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 144/185 (78%), Positives = 162/185 (88%), Gaps = 0/185 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TKG LK VS+EVAKYKVGAPAR G+VAPIDVV+ PG+TGLDP+ TSFFQVLNIPTKINKG
Sbjct  59   TKGDLKGVSDEVAKYKVGAPARAGVVAPIDVVIQPGSTGLDPALTSFFQVLNIPTKINKG  118

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
             VEI+ PV+L++KGDKVGSSEAALLAKLG + FSYGL+VLSV DNGSVFSP+VLDLT+DD
Sbjct  119  AVEIVVPVQLVKKGDKVGSSEAALLAKLGKKSFSYGLVVLSVSDNGSVFSPKVLDLTDDD  178

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L EKF+ GVSM  SLSLAISYPTLAAA HM IN   NVL++AV  +YSFP A +VKEYLK
Sbjct  179  LAEKFSAGVSMKASLSLAISYPTLAAALHMFINACNNVLTVAVVAEYSFPQAQQVKEYLK  238

Query  220  DPSKF  206
            DPSKF
Sbjct  239  DPSKF  243



>ref|XP_002960261.1| hypothetical protein SELMODRAFT_229877 [Selaginella moellendorffii]
 gb|EFJ37800.1| hypothetical protein SELMODRAFT_229877 [Selaginella moellendorffii]
Length=323

 Score =   263 bits (672),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 139/185 (75%), Positives = 157/185 (85%), Gaps = 0/185 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            T+G LKEV E +AKYKVGAPARVGLVAPIDV + PG+TGLDPS TSFFQ LNIPTKINKG
Sbjct  94   TRGDLKEVREVIAKYKVGAPARVGLVAPIDVTIQPGSTGLDPSHTSFFQALNIPTKINKG  153

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            TVEI++ VELI KG KVGSSEAALLAKL IRPFSYGL+V  VYD+GSVF P VLDLT+DD
Sbjct  154  TVEIVSSVELISKGTKVGSSEAALLAKLRIRPFSYGLVVRRVYDSGSVFDPAVLDLTDDD  213

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L+ KFA GVS V ++SLA+ YPTLAAA H  +N YKNVL+IA+ TDYS+P A+  KEYLK
Sbjct  214  LVAKFAEGVSAVAAISLALGYPTLAAAAHFFLNSYKNVLAIALSTDYSYPQAENAKEYLK  273

Query  220  DPSKF  206
            DPSKF
Sbjct  274  DPSKF  278



>ref|XP_002967451.1| hypothetical protein SELMODRAFT_87354 [Selaginella moellendorffii]
 gb|EFJ32050.1| hypothetical protein SELMODRAFT_87354 [Selaginella moellendorffii]
Length=323

 Score =   263 bits (671),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 139/185 (75%), Positives = 157/185 (85%), Gaps = 0/185 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            T+G LKEV E +AKYKVGAPARVGLVAPIDV + PG+TGLDPS TSFFQ LNIPTKINKG
Sbjct  94   TRGDLKEVREVIAKYKVGAPARVGLVAPIDVTIQPGSTGLDPSHTSFFQALNIPTKINKG  153

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            TVEI++ VELI KG KVGSSEAALLAKL IRPFSYGL+V  VYD+GSVF P VLDLT+DD
Sbjct  154  TVEIVSSVELISKGTKVGSSEAALLAKLRIRPFSYGLVVRRVYDSGSVFDPAVLDLTDDD  213

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L+ KFA GVS V ++SLA+ YPTLAAA H  +N YKNVL+IA+ TDYS+P A+  KEYLK
Sbjct  214  LVAKFAEGVSAVAAISLALGYPTLAAAAHFFLNSYKNVLAIALSTDYSYPQAENAKEYLK  273

Query  220  DPSKF  206
            DPSKF
Sbjct  274  DPSKF  278



>gb|EEC82854.1| hypothetical protein OsI_27702 [Oryza sativa Indica Group]
Length=216

 Score =   258 bits (659),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 148/169 (88%), Positives = 164/169 (97%), Gaps = 0/169 (0%)
 Frame = -1

Query  712  VGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDK  533
            VGAPARVGLVAP+DVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELI+KGDK
Sbjct  7    VGAPARVGLVAPVDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDK  66

Query  532  VGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldlteddllEKFALGVSMVTSLS  353
            VGSSE+ALLAKLGIRPFSYGL++ +VYD+GSVFSPEVLDLTEDDL+EKFA GVSMV S+S
Sbjct  67   VGSSESALLAKLGIRPFSYGLVITNVYDSGSVFSPEVLDLTEDDLMEKFASGVSMVASVS  126

Query  352  LAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  206
            LAISYPT+AAAPHM +NGYKNVL++AVET+YS+P ADK+KEYLKDPSKF
Sbjct  127  LAISYPTIAAAPHMFLNGYKNVLAVAVETEYSYPHADKIKEYLKDPSKF  175



>gb|EAZ41410.1| hypothetical protein OsJ_25932 [Oryza sativa Japonica Group]
Length=235

 Score =   258 bits (658),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 148/171 (87%), Positives = 165/171 (96%), Gaps = 0/171 (0%)
 Frame = -1

Query  718  YKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKG  539
            + VGAPARVGLVAP+DVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELI+KG
Sbjct  24   FMVGAPARVGLVAPVDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKG  83

Query  538  DKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldlteddllEKFALGVSMVTS  359
            DKVGSSE+ALLAKLGIRPFSYGL++ +VYD+GSVFSPEVLDLTEDDL+EKFA GVSMV S
Sbjct  84   DKVGSSESALLAKLGIRPFSYGLVITNVYDSGSVFSPEVLDLTEDDLMEKFASGVSMVAS  143

Query  358  LSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  206
            +SLAISYPT+AAAPHM +NGYKNVL++AVET+YS+P ADK+KEYLKDPSKF
Sbjct  144  VSLAISYPTIAAAPHMFLNGYKNVLAVAVETEYSYPHADKIKEYLKDPSKF  194



>emb|CAN65663.1| hypothetical protein VITISV_014917 [Vitis vinifera]
Length=379

 Score =   262 bits (670),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 142/185 (77%), Positives = 160/185 (86%), Gaps = 0/185 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TK  LK VS+EVAKYK GAPAR G+VAPIDVV+ PG+TGLDP+ TSFFQVLNIPTKINKG
Sbjct  94   TKEDLKGVSDEVAKYKXGAPARXGVVAPIDVVIQPGSTGLDPAXTSFFQVLNIPTKINKG  153

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
             VEI+ PV+L++KGDKVGSSEAALLAKLG + FSYGL+VLSV DNGSVFSP+VLDLT+DD
Sbjct  154  AVEIVVPVQLVKKGDKVGSSEAALLAKLGKKXFSYGLVVLSVXDNGSVFSPKVLDLTDDD  213

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L EKF+ GVSM  SLSLAISYPTLAAA HM IN   NVL++AV  +YSFP A +VKEYLK
Sbjct  214  LAEKFSAGVSMKASLSLAISYPTLAAALHMFINACNNVLTVAVVAEYSFPQAQQVKEYLK  273

Query  220  DPSKF  206
            DPSKF
Sbjct  274  DPSKF  278



>ref|XP_006407705.1| hypothetical protein EUTSA_v10021147mg [Eutrema salsugineum]
 gb|ESQ49158.1| hypothetical protein EUTSA_v10021147mg [Eutrema salsugineum]
Length=298

 Score =   250 bits (638),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 139/185 (75%), Positives = 153/185 (83%), Gaps = 24/185 (13%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TKG LKEVSEEVAKYKVGAPARVGLVAPIDVVV PGNTGLDPSQTSFFQVLNIPTKINKG
Sbjct  93   TKGDLKEVSEEVAKYKVGAPARVGLVAPIDVVVQPGNTGLDPSQTSFFQVLNIPTKINKG  152

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            TVEIITPVELI++GDK                        SVYDNGSVFSPEVL+LTEDD
Sbjct  153  TVEIITPVELIKQGDK------------------------SVYDNGSVFSPEVLNLTEDD  188

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L+EKFA G+SMVTSL+LA+SYPT+AAAPHM IN YKN L+I+V T+Y+FP A+KVKE+LK
Sbjct  189  LVEKFAAGISMVTSLALAVSYPTIAAAPHMFINAYKNALAISVATEYTFPQAEKVKEFLK  248

Query  220  DPSKF  206
            DPSKF
Sbjct  249  DPSKF  253



>ref|XP_005850392.1| hypothetical protein CHLNCDRAFT_59607 [Chlorella variabilis]
 gb|EFN58290.1| hypothetical protein CHLNCDRAFT_59607 [Chlorella variabilis]
Length=314

 Score =   246 bits (627),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 127/185 (69%), Positives = 151/185 (82%), Gaps = 0/185 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TKG L EV + +  +KVGAPARVGLVAP DV +P GNTG+DPSQTSFFQVLNIPTKINKG
Sbjct  93   TKGDLNEVRKLIDDFKVGAPARVGLVAPNDVTIPGGNTGMDPSQTSFFQVLNIPTKINKG  152

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            +VEI   V LI+ GDKVG+SEA LLAKLGI+PFSYGL++L VYDNGS++ P+VLD+T+DD
Sbjct  153  SVEITADVHLIKTGDKVGASEATLLAKLGIKPFSYGLVILQVYDNGSLYDPKVLDITDDD  212

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L      G+  V +  L +SYPT+A+ PH LINGYKNVL+IAVETDYSFPLA+KVK +L 
Sbjct  213  LGNLITAGLRNVAAACLELSYPTIASVPHSLINGYKNVLAIAVETDYSFPLAEKVKAFLA  272

Query  220  DPSKF  206
            DPS F
Sbjct  273  DPSAF  277



>sp|P29764.1|RLA0_OXYRB RecName: Full=60S acidic ribosomal protein P0; AltName: Full=Light-induced 
34 kDa protein [Oxybasis rubra]
 emb|CAA33276.1| 34kD light-induced protein [Oxybasis rubra]
Length=321

 Score =   242 bits (617),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 133/149 (89%), Positives = 140/149 (94%), Gaps = 0/149 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TKG L +V EE++KYKVGAPAR GLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG
Sbjct  94   TKGDLNQVREEISKYKVGAPARFGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  153

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            TVEIIT VELI+KG+KVGSSEAALLAKLGIRPFSYGL V SVYD+GSVFSPEVLDLTEDD
Sbjct  154  TVEIITAVELIKKGEKVGSSEAALLAKLGIRPFSYGLNVESVYDDGSVFSPEVLDLTEDD  213

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPH  314
            LL +FA GVSMVTSLSLAISYPTLAAAPH
Sbjct  214  LLARFATGVSMVTSLSLAISYPTLAAAPH  242



>gb|KDD72928.1| hypothetical protein H632_c2720p0, partial [Helicosporidium sp. 
ATCC 50920]
Length=273

 Score =   236 bits (602),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 117/185 (63%), Positives = 155/185 (84%), Gaps = 0/185 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TK  L ++ + V+KY VGAPARVG+VAP DV +  GNTG+DPSQTSFFQ LN+PTKINKG
Sbjct  89   TKADLNDLRDRVSKYTVGAPARVGVVAPTDVTIYAGNTGMDPSQTSFFQALNVPTKINKG  148

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            TVEI++ + LI  GDKVG+S+A LLAKLGI+PF+YGL++ +VYDNG++++P+VLD+TEDD
Sbjct  149  TVEIVSDMHLITAGDKVGASQATLLAKLGIKPFTYGLVLRNVYDNGALYNPKVLDITEDD  208

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L+   + G++ V + SL +++PTLA+APH +++G+KNVLS+AV TDYSFPLADKVK YL 
Sbjct  209  LVAAMSRGIANVAAASLQLNFPTLASAPHSIVHGFKNVLSVAVATDYSFPLADKVKAYLA  268

Query  220  DPSKF  206
            DPS F
Sbjct  269  DPSAF  273



>ref|XP_001697060.1| acidic ribosomal protein P0 [Chlamydomonas reinhardtii]
 gb|EDP00752.1| acidic ribosomal protein P0 [Chlamydomonas reinhardtii]
Length=320

 Score =   231 bits (588),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 114/185 (62%), Positives = 151/185 (82%), Gaps = 0/185 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            T G L +V +E+AKYKVGAPARVG VAP DVV+  G TG+DPSQTSFFQ L I TKINKG
Sbjct  99   TNGDLSQVKDEIAKYKVGAPARVGAVAPEDVVIKAGGTGMDPSQTSFFQALGIATKINKG  158

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            T+EI++ V +++ G++VG S+A LLAKLG++PF YGL++L V ++G+V+ P+V+D+T++D
Sbjct  159  TIEIVSDVVVVKAGERVGPSQATLLAKLGVKPFKYGLLILKVIESGAVYDPKVMDITDED  218

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            ++     G+  V +LSL   YPTLAAAPH++I+GYKNVL+IAVETDY+FPLA KVK+YL 
Sbjct  219  MMASVIAGIREVAALSLGAQYPTLAAAPHVIIDGYKNVLAIAVETDYTFPLAQKVKDYLA  278

Query  220  DPSKF  206
            DPSKF
Sbjct  279  DPSKF  283



>ref|XP_005650079.1| hypothetical protein COCSUDRAFT_52908 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE25535.1| hypothetical protein COCSUDRAFT_52908 [Coccomyxa subellipsoidea 
C-169]
Length=319

 Score =   229 bits (584),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 115/185 (62%), Positives = 150/185 (81%), Gaps = 0/185 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TK  L E+ +E+ KYKVGAPARVGLVAP  VVVP GNTGLDPSQTSFFQ LNIPTKIN+G
Sbjct  95   TKADLAELRDEIEKYKVGAPARVGLVAPNSVVVPAGNTGLDPSQTSFFQALNIPTKINRG  154

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            TVEI++ V LI+  +KVG SEA LL+KLGI+PFSYGL++L V+++G+++ P+VLD+ ++D
Sbjct  155  TVEIVSDVHLIKASEKVGGSEATLLSKLGIKPFSYGLVLLKVFEDGAMYDPKVLDIKDED  214

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L++     ++ + + SL + YPTLA+ PH +INGYKNVL+I+V TDY FPLA+KVK +L 
Sbjct  215  LMDSVMTAITRIAAASLELGYPTLASIPHSVINGYKNVLAISVATDYDFPLAEKVKAFLA  274

Query  220  DPSKF  206
            DPS F
Sbjct  275  DPSAF  279



>ref|XP_011402179.1| 60S acidic ribosomal protein P0-2 [Auxenochlorella protothecoides]
 gb|KFM29126.1| 60S acidic ribosomal protein P0-2 [Auxenochlorella protothecoides]
Length=273

 Score =   223 bits (569),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 112/174 (64%), Positives = 144/174 (83%), Gaps = 0/174 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            T+G L EV +++ ++KVGAPARVGLVAP DV V  GNTG+DPSQTSFFQ LNI TKINKG
Sbjct  93   TQGDLNEVRDKIQEFKVGAPARVGLVAPNDVTVYAGNTGMDPSQTSFFQALNISTKINKG  152

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            TVEI++ V LI+ G+KVG+S+A LLAKLGI+PF+YGL+V  VYDNGS++ P+VLD+T++ 
Sbjct  153  TVEIVSDVHLIKPGEKVGASQATLLAKLGIKPFTYGLVVKQVYDNGSLYDPKVLDITDET  212

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADK  239
            L +    G+  V + SLA+ +PT+A+APH LINGYKN L+IAVETDY+FPLA+K
Sbjct  213  LGDLLTAGIRNVAAASLALDFPTMASAPHSLINGYKNALAIAVETDYTFPLAEK  266



>ref|XP_002958097.1| hypothetical protein VOLCADRAFT_84328 [Volvox carteri f. nagariensis]
 gb|EFJ40828.1| hypothetical protein VOLCADRAFT_84328 [Volvox carteri f. nagariensis]
Length=321

 Score =   224 bits (571),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 111/185 (60%), Positives = 148/185 (80%), Gaps = 0/185 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            T G L +V +E+AKYKVGAPARVG  A  DVV+  G TG+DPSQTSFFQ L I TKINKG
Sbjct  99   TNGDLSQVKDEIAKYKVGAPARVGATANEDVVIKAGGTGMDPSQTSFFQALGIATKINKG  158

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            T+EI++ V +++ GD+VG+S+A LLAKLGI+PF YGL +L V ++G+V+ P+V+++T++D
Sbjct  159  TIEIVSDVVVVKTGDRVGASQATLLAKLGIKPFKYGLQILKVIESGAVYDPKVMEITDED  218

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            +L      +  V++LSL   YPTL AAPH++I+GYKNVL+IA+ETDY+FPLA KVK+YL 
Sbjct  219  ILSSVMTAIREVSALSLGARYPTLVAAPHVIIDGYKNVLAIALETDYTFPLAQKVKDYLA  278

Query  220  DPSKF  206
            DPSKF
Sbjct  279  DPSKF  283



>gb|AIN39821.1| hypothetical protein, partial [Zoysia matrella]
Length=262

 Score =   222 bits (565),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 135/159 (85%), Positives = 144/159 (91%), Gaps = 0/159 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TKG LKEV EEV KYKVGAPARVGLVAP+DVVVPPGNTGLDPSQTSFFQVLNIPTKINKG
Sbjct  94   TKGDLKEVREEVGKYKVGAPARVGLVAPVDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  153

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            TVEIITPVELI+KGDKVGSSE+ALLAKLGIRPFSYGL++ +VYD GSVFSPEVLDLT+DD
Sbjct  154  TVEIITPVELIKKGDKVGSSESALLAKLGIRPFSYGLVITNVYDAGSVFSPEVLDLTDDD  213

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVL  284
            L+EKFA GVSMV SLSLA+SYPTLAAAP     G K  L
Sbjct  214  LVEKFASGVSMVASLSLALSYPTLAAAPTCSSMGTKTCL  252



>gb|KIZ02211.1| 60S acidic ribosomal protein P0 [Monoraphidium neglectum]
Length=313

 Score =   222 bits (565),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 121/181 (67%), Positives = 145/181 (80%), Gaps = 0/181 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TK  L  V +E+AKYKVGAPARVGLVAP DV +P G TG+DPSQTSFFQ LNI TKINKG
Sbjct  93   TKADLASVKDEIAKYKVGAPARVGLVAPNDVTIPGGGTGMDPSQTSFFQALNIATKINKG  152

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            T++I+  V LI+ GDKVG+SEAALL KLGI+PF YGL +L VY+NGS+F   VL +T++ 
Sbjct  153  TIDIVNDVHLIKAGDKVGASEAALLGKLGIKPFKYGLEILKVYENGSLFDAAVLSITDEA  212

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            LL   A  ++ V +LSLA +YPTLA+ PH ++NGYKNVL+IAVETDYSFPLADKVK YL 
Sbjct  213  LLGSAAAALANVAALSLAANYPTLASIPHSVVNGYKNVLAIAVETDYSFPLADKVKAYLA  272

Query  220  D  218
            D
Sbjct  273  D  273



>gb|ABO31368.1| 60S ribosomal protein [Gossypium hirsutum]
Length=228

 Score =   218 bits (555),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 121/138 (88%), Positives = 131/138 (95%), Gaps = 0/138 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TKG LKEV EE+AKYKVGAPARVGLVAPIDV+VPPGNTGLDPSQTSFFQVLNIPTKINKG
Sbjct  90   TKGDLKEVREEIAKYKVGAPARVGLVAPIDVIVPPGNTGLDPSQTSFFQVLNIPTKINKG  149

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            TVEI+T VELIRKG+KVGSSEAALL+KLGIRPFSYGL+V+SVYDNG+VFSPEVLDLTEDD
Sbjct  150  TVEIVTAVELIRKGEKVGSSEAALLSKLGIRPFSYGLVVVSVYDNGTVFSPEVLDLTEDD  209

Query  400  llEKFALGVSMVTSLSLA  347
            L+EKF   +S VTSLSLA
Sbjct  210  LMEKFRSWLSNVTSLSLA  227



>emb|CBV76074.1| 60S acidic ribosomal protein P0 [Polytomella sp. Pringsheim 198.80]
Length=314

 Score =   219 bits (559),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 112/185 (61%), Positives = 144/185 (78%), Gaps = 0/185 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            T   L +V +E+AKYKVGAPARVG  A  +V V  G+TG+DPSQTSFFQ L + TKINKG
Sbjct  93   TNQDLNQVKDEIAKYKVGAPARVGATATEEVTVKAGSTGMDPSQTSFFQALGVATKINKG  152

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            T+EI++ V ++R GD+VG S+A LLAKLGI+PF YGL +L +++ GS+F P VLD+T++D
Sbjct  153  TIEIVSDVIVVRVGDRVGPSQATLLAKLGIKPFKYGLTLLKIFEEGSLFDPAVLDITDED  212

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            +LE     +  V + SL   Y TLAA PH++INGYKNVL++A+ETDYSFPLA+KVKEYL 
Sbjct  213  MLESVVAAIRNVAAFSLGAHYATLAAVPHVVINGYKNVLAVAIETDYSFPLAEKVKEYLA  272

Query  220  DPSKF  206
            DPSKF
Sbjct  273  DPSKF  277



>gb|KCW65655.1| hypothetical protein EUGRSUZ_G03042 [Eucalyptus grandis]
Length=266

 Score =   215 bits (548),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 106/111 (95%), Positives = 109/111 (98%), Gaps = 0/111 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TKG LKEVSEEVAKYKVGAPARVGLVAPIDV+VPPGNTGLDPSQTSFFQVLNIPTKINKG
Sbjct  93   TKGDLKEVSEEVAKYKVGAPARVGLVAPIDVIVPPGNTGLDPSQTSFFQVLNIPTKINKG  152

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSP  428
            TVEIITPVELI+KGDKVGSSEAALLAKLGIRPFSYGL+V SVYDNGSVFSP
Sbjct  153  TVEIITPVELIKKGDKVGSSEAALLAKLGIRPFSYGLVVQSVYDNGSVFSP  203



>gb|AJQ18907.1| acidic ribosomal protein P0 [Amblyomma cajennense]
Length=318

 Score =   213 bits (543),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 132/228 (58%), Positives = 168/228 (74%), Gaps = 0/228 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TK  L EV E++ + KV APAR G +AP+DV++P  NTGL P +TSFFQ L IPTKI+KG
Sbjct  91   TKEDLTEVREKIIENKVKAPARAGALAPLDVMIPAQNTGLGPEKTSFFQALQIPTKISKG  150

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            T+EI+  + LI+K D+VG+SEA LL  L I PFSYGL +L VYD+G+VFSP++LD+T +D
Sbjct  151  TIEILNEIHLIKKDDRVGASEATLLNMLNISPFSYGLKILQVYDSGTVFSPDILDITPED  210

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L   F  GV  V S+SLAI YPT+A+APH ++NG KN+++IAVETD +F  A+  KEYLK
Sbjct  211  LRSAFVEGVRNVASVSLAIGYPTVASAPHSIVNGLKNLIAIAVETDITFKEAEMAKEYLK  270

Query  220  DPSKFavaaapvaaaaagsapaaaaaaeekkeepeeesEDEMGFSLFD  77
            DPSKFA AAAP A   A +A    A  EE K+E  EE +D+MGF LFD
Sbjct  271  DPSKFAAAAAPAAGGGAAAAKPEEAKKEEAKKEESEEEDDDMGFGLFD  318



>ref|XP_003743791.1| PREDICTED: 60S acidic ribosomal protein P0-like [Metaseiulus 
occidentalis]
Length=316

 Score =   209 bits (533),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 112/185 (61%), Positives = 139/185 (75%), Gaps = 0/185 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TK  L EV E++   KV APAR G +AP+DV VP  NTGL P +TSFFQ L+IPTKI+KG
Sbjct  91   TKEDLCEVREKIMNNKVQAPARAGAIAPVDVHVPAQNTGLGPEKTSFFQALHIPTKISKG  150

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            T+EII  + LI+ GDKVG+SEA LL  L I PFSYGLI+ +VYDNG++F+PEVLD+T +D
Sbjct  151  TIEIINDIHLIKVGDKVGASEATLLNMLNISPFSYGLIIQAVYDNGTIFAPEVLDITPED  210

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L  +F  GV  V ++SL I YPTLA+APH ++NG KN++SIA+ TD  F  A   KEYLK
Sbjct  211  LKARFMNGVRNVAAVSLKIGYPTLASAPHSIVNGLKNLISIALSTDIEFEAAKLAKEYLK  270

Query  220  DPSKF  206
            DPSKF
Sbjct  271  DPSKF  275



>gb|ABB29594.1| ribosomal protein P0 large subunit [Platynereis dumerilii]
Length=273

 Score =   208 bits (529),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 105/185 (57%), Positives = 141/185 (76%), Gaps = 0/185 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TK  L EV E +   KV APA+ G +AP DV +P  NTGL P +TSFFQ L IPTKI +G
Sbjct  55   TKLDLSEVREIIMANKVAAPAKTGAIAPCDVSIPAQNTGLGPEKTSFFQALAIPTKIARG  114

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            T+EI+  V+L+R GDKVG SEA LL  L + PF+YGL++L VYD+G+VFSP +LD+T+DD
Sbjct  115  TIEILNEVKLLRTGDKVGMSEATLLNMLNVSPFTYGLVILQVYDSGTVFSPAILDITDDD  174

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L  +F  GV+ ++ ++LAI YPT+A+ PH++ING+KN+L+IA ETD  F  A+++KE+LK
Sbjct  175  LRARFMQGVTNLSCVALAIGYPTVASVPHLVINGFKNLLAIAAETDIEFKEAEQMKEFLK  234

Query  220  DPSKF  206
            DPSKF
Sbjct  235  DPSKF  239



>gb|AAY66850.1| 60S acidic ribosomal protein P0 [Ixodes scapularis]
Length=319

 Score =   209 bits (531),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 109/185 (59%), Positives = 142/185 (77%), Gaps = 0/185 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TK  L EV E++ + KV APAR G +AP+DV++P  NTGL P +TSFFQ L IPTKI+KG
Sbjct  91   TKEDLGEVREKIIENKVKAPARAGALAPLDVMIPAQNTGLGPEKTSFFQALQIPTKISKG  150

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            T+EI+  + LI+K D+VG+SEA LL  L I PFSYGL +L VYD+G+VFSPE+LD+T +D
Sbjct  151  TIEILNEIHLIKKDDRVGASEATLLNMLNISPFSYGLKILQVYDSGTVFSPEILDITPED  210

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L   F  GV  V S+SLAI YPT+A+APH ++NG KN++++A+ETD +F  A+  KEYLK
Sbjct  211  LRSAFVEGVRNVASVSLAIGYPTVASAPHSIVNGLKNLIAVALETDITFKEAEMAKEYLK  270

Query  220  DPSKF  206
            DPSKF
Sbjct  271  DPSKF  275



>ref|XP_002399611.1| 60S acidic ribosomal protein P0, putative [Ixodes scapularis]
 gb|EEC09184.1| 60S acidic ribosomal protein P0, putative [Ixodes scapularis]
Length=319

 Score =   209 bits (531),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 109/185 (59%), Positives = 142/185 (77%), Gaps = 0/185 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TK  L EV E++ + KV APAR G +AP+DV++P  NTGL P +TSFFQ L IPTKI+KG
Sbjct  91   TKEDLGEVREKIIENKVKAPARAGALAPLDVMIPAQNTGLGPEKTSFFQALQIPTKISKG  150

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            T+EI+  + LI+K D+VG+SEA LL  L I PFSYGL +L VYD+G+VFSPE+LD+T +D
Sbjct  151  TIEILNEIHLIKKDDRVGASEATLLNMLNISPFSYGLKILQVYDSGTVFSPEILDITPED  210

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L   F  GV  V S+SLAI YPT+A+APH ++NG KN++++A+ETD +F  A+  KEYLK
Sbjct  211  LRSAFVEGVRNVASVSLAIGYPTVASAPHSIVNGLKNLIAVALETDITFKEAEMAKEYLK  270

Query  220  DPSKF  206
            DPSKF
Sbjct  271  DPSKF  275



>sp|Q9DG68.1|RLA0_RANSY RecName: Full=60S acidic ribosomal protein P0; AltName: Full=60S 
ribosomal protein L10E [Rana sylvatica]
 gb|AAG09233.1| brain acidic ribosomal phosphoprotein P0 [Rana sylvatica]
Length=315

 Score =   208 bits (530),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 111/185 (60%), Positives = 138/185 (75%), Gaps = 0/185 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TK  L EV + +   KV A AR G +AP DV VP  NTGL P +TSFFQ L I TKI++G
Sbjct  91   TKEDLAEVRDMLLANKVPASARAGAIAPCDVTVPAQNTGLGPEKTSFFQALGITTKISRG  150

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            T+EI++ V+LI+ GDKVG+SEA LL  L I PFS+GLI+  VYDNGS++SPEVLD+TED 
Sbjct  151  TIEILSDVQLIKTGDKVGASEATLLNMLNISPFSFGLIIQQVYDNGSIYSPEVLDITEDA  210

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L  +F  GV  + S+ L I YPT+A+ PH ++NGYK VL++AVETDYSFPLADKVK +L 
Sbjct  211  LRARFLEGVRNIASVCLQIGYPTVASVPHSVVNGYKRVLALAVETDYSFPLADKVKAFLA  270

Query  220  DPSKF  206
            DPS F
Sbjct  271  DPSAF  275



>gb|AGQ49465.1| acidic ribosomal protein P0 [Rhipicephalus microplus]
Length=318

 Score =   208 bits (530),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 128/228 (56%), Positives = 166/228 (73%), Gaps = 0/228 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TK  L EV E++   KV APAR G +AP+DV++P  NTGL P +TSFFQ L IPTKI+KG
Sbjct  91   TKEDLTEVREKIIDNKVKAPARAGALAPLDVMIPAQNTGLGPEKTSFFQALQIPTKISKG  150

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            T+EI+  + LI+K D+VG+SEA LL  L I PFSYGL +L VYD+G+VFSP++LD+T +D
Sbjct  151  TIEILNEIHLIKKDDRVGASEATLLNMLNISPFSYGLKILQVYDSGTVFSPDILDITPED  210

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L   F  GV  V ++SL+I YPT+A+ PH ++NG KN+++IAVETD +F  A+  KEYLK
Sbjct  211  LRSAFVEGVRNVAAVSLSIGYPTVASVPHSIVNGLKNLIAIAVETDITFKEAEMAKEYLK  270

Query  220  DPSKFavaaapvaaaaagsapaaaaaaeekkeepeeesEDEMGFSLFD  77
            DPSKFA AAAP A   A +A    +  EE K+E  EE +D+MGF LFD
Sbjct  271  DPSKFAAAAAPAAGGGAAAAKPEESKKEEAKKEESEEEDDDMGFGLFD  318



>ref|NP_001080134.1| ribosomal protein, large, P0 [Xenopus laevis]
 gb|AAH42268.1| Arbp-prov protein [Xenopus laevis]
Length=315

 Score =   208 bits (530),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 112/183 (61%), Positives = 137/183 (75%), Gaps = 0/183 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TK  L EV + +   KV A AR G +AP +V VP  NTGL P +TSFFQ L I TKI++G
Sbjct  91   TKEDLTEVRDMLLANKVPASARAGAIAPCEVTVPAQNTGLGPEKTSFFQALGITTKISRG  150

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            T+EI++ V+LI+ GDKVG+SEA LL  L I PFSYGLI+  VYDNGS++SPEVLD+TE+ 
Sbjct  151  TIEILSDVQLIKTGDKVGASEATLLNMLNISPFSYGLIIQQVYDNGSIYSPEVLDITEEA  210

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L  +F  GV  V S+ L I YPT+A+ PH +INGYK VL+IAVETDYSFPLADKVK +L 
Sbjct  211  LHVRFLEGVRNVASVCLQIGYPTVASVPHSVINGYKRVLAIAVETDYSFPLADKVKAFLA  270

Query  220  DPS  212
            DPS
Sbjct  271  DPS  273



>gb|ABW16870.1| ribosomal protein P0 [Haemaphysalis longicornis]
Length=320

 Score =   208 bits (530),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 107/185 (58%), Positives = 142/185 (77%), Gaps = 0/185 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TK  L EV E++ + KV APAR G +AP+DV++P  NTGL P +TSFFQ L IPTKI+KG
Sbjct  91   TKEDLTEVREKIIENKVKAPARAGALAPLDVMIPAQNTGLGPEKTSFFQALQIPTKISKG  150

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            T+EI+  + LI+K D+VG+SEA LL  L I PFSYGL +L VYD+G+VF+P++LD+T +D
Sbjct  151  TIEILNEIHLIKKDDRVGASEATLLNMLNISPFSYGLKILQVYDSGTVFAPDILDITPED  210

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L   F  GV  V S+SLAI YPT+A+APH ++NG KN+++IA+ETD +F  A+  KEY+K
Sbjct  211  LRSAFVEGVRNVASVSLAIGYPTVASAPHSIVNGLKNLIAIALETDITFKEAEMAKEYMK  270

Query  220  DPSKF  206
            DPSKF
Sbjct  271  DPSKF  275



>gb|ADV40160.1| 60S acidic ribosomal protein P0 [Latrodectus hesperus]
Length=298

 Score =   207 bits (528),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 108/185 (58%), Positives = 139/185 (75%), Gaps = 0/185 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TK  L EV +++   KV APAR G +AP DV++ P NTGL P +TSFFQ L IPTKI+KG
Sbjct  91   TKEDLVEVRDKIMDNKVKAPARAGAIAPCDVILQPQNTGLGPEKTSFFQALQIPTKISKG  150

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            T+EI+  + LI+K DKVG+SEA LL  L + PF+YGL +  VYD+G+VFSPE+LD+T +D
Sbjct  151  TIEILNEIHLIKKEDKVGASEATLLNMLNVSPFTYGLKIRQVYDSGTVFSPEILDITSED  210

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L  KF  GV  V S+SL ISYPTLA+ PH ++NG KN+++IAVETD +F  A+  KEYLK
Sbjct  211  LRAKFMEGVLNVASVSLEISYPTLASVPHSIVNGLKNLIAIAVETDITFEAAEMAKEYLK  270

Query  220  DPSKF  206
            DP+KF
Sbjct  271  DPTKF  275



>gb|AGX29497.1| 60S acidic ribosomal protein P0, partial [Calliphora vicina]
Length=227

 Score =   205 bits (522),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 106/185 (57%), Positives = 140/185 (76%), Gaps = 0/185 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TKG L E+ +++ + KV APAR G +AP+DV++P  NTGL P +TSFFQ L+IPTKI+KG
Sbjct  43   TKGDLAEIRDKLLESKVRAPARAGAIAPLDVIIPAQNTGLGPEKTSFFQALSIPTKISKG  102

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            T+EII  V +++ GDKVG+SEA LL  L I PFSYGLIV  VYD+GS+FSPE+LD+  +D
Sbjct  103  TIEIINDVPILKPGDKVGASEATLLNMLNISPFSYGLIVSQVYDSGSIFSPEILDIKPED  162

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L  KF  GV+ + S+ L I YPT+A+APH + NG+KN+L+IA  T+  F  A  +KEY+K
Sbjct  163  LRAKFQAGVANLASVCLEIGYPTIASAPHSIANGFKNLLAIAATTEVEFKEATTIKEYIK  222

Query  220  DPSKF  206
            DPSKF
Sbjct  223  DPSKF  227



>ref|NP_989067.1| ribosomal protein, large, P0 [Xenopus (Silurana) tropicalis]
 gb|AAH61299.1| acidic ribosomal phosphoprotein P0 [Xenopus (Silurana) tropicalis]
Length=314

 Score =   207 bits (528),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 113/183 (62%), Positives = 137/183 (75%), Gaps = 0/183 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TK  L EV + +   KV A AR G +AP  VVVP  NTGL P +TSFFQ L I TKI++G
Sbjct  91   TKEDLTEVRDMLLANKVPACARAGAIAPCGVVVPAQNTGLGPEKTSFFQALGITTKISRG  150

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            T+EI++ V+LI+ GDKVG+SEA LL  L I PFSYGLI+  VYDNGS++SPEVLD+TE+ 
Sbjct  151  TIEILSDVQLIKTGDKVGASEATLLNMLNISPFSYGLIIQQVYDNGSIYSPEVLDITEEA  210

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L  +F  GV  V S+ L I YPT+A+ PH +INGYK VL+IAVETDYSFPLADKVK +L 
Sbjct  211  LHVRFLEGVRNVASVCLQIGYPTVASVPHSVINGYKRVLAIAVETDYSFPLADKVKAFLA  270

Query  220  DPS  212
            DPS
Sbjct  271  DPS  273



>gb|ELT92567.1| hypothetical protein CAPTEDRAFT_167366, partial [Capitella teleta]
Length=320

 Score =   207 bits (526),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 106/185 (57%), Positives = 140/185 (76%), Gaps = 0/185 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TKG L EV + + + +VGAPA+ G +AP+ V+V   NTGL P +TSFFQ L IPTKI KG
Sbjct  91   TKGDLTEVRKIIQENRVGAPAKAGALAPLSVMVTARNTGLGPEKTSFFQALAIPTKITKG  150

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            T+EI+  V+LI++G+KVG+SEA LL  L I PFSYGL++  VYD+G+VF P +LD+++DD
Sbjct  151  TIEILNDVQLIKEGEKVGASEATLLTMLKIMPFSYGLVIQQVYDSGTVFHPSILDMSDDD  210

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            +  KF  GVS V SL LAI YPTLA+ PH ++NG+KN+L++A  TD  F  A+ VKE+LK
Sbjct  211  IRGKFMSGVSRVASLCLAIGYPTLASVPHSVVNGFKNLLAVAAATDVEFKEAETVKEFLK  270

Query  220  DPSKF  206
            DPSKF
Sbjct  271  DPSKF  275



>gb|AJQ18906.1| acidic ribosomal protein P0, partial [Rhipicephalus sanguineus]
Length=314

 Score =   206 bits (525),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 107/185 (58%), Positives = 140/185 (76%), Gaps = 0/185 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TK  L EV E++   KV APAR G +AP+DV++P  NTGL P +TSFFQ L IPTKI+KG
Sbjct  91   TKEDLTEVREKIIDNKVKAPARAGALAPLDVMIPAQNTGLGPEKTSFFQALQIPTKISKG  150

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            T+EI+  + LI+K D+VG+SEA LL  L I PFSYGL +L VYD+G+VFSP++LD+T +D
Sbjct  151  TIEILNEIHLIKKDDRVGASEATLLNMLNISPFSYGLKILQVYDSGTVFSPDILDITPED  210

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L   F  GV  V ++SL+I YPT+A+ PH ++NG KN+++IAVETD +F  A+  KEYLK
Sbjct  211  LRSAFVEGVRNVAAVSLSIGYPTVASVPHSIVNGLKNLIAIAVETDITFKEAEMAKEYLK  270

Query  220  DPSKF  206
            DPSKF
Sbjct  271  DPSKF  275



>gb|AJQ18908.1| acidic ribosomal protein P0, partial [Dermacentor nitens]
Length=314

 Score =   206 bits (524),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 107/185 (58%), Positives = 140/185 (76%), Gaps = 0/185 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TK  L EV E++   KV APAR G +AP+DV++P  NTGL P +TSFFQ L IPTKI+KG
Sbjct  91   TKEDLTEVREKIIDNKVKAPARAGALAPLDVMIPAQNTGLGPEKTSFFQALQIPTKISKG  150

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            T+EI+  + LI+K D+VG+SEA LL  L I PFSYGL +L VYD+G+VFSP++LD+T +D
Sbjct  151  TIEILNEIHLIKKDDRVGASEATLLNMLNISPFSYGLKILQVYDSGTVFSPDILDITPED  210

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L   F  GV  V ++SL+I YPT+A+ PH ++NG KN+++IAVETD +F  A+  KEYLK
Sbjct  211  LRSAFVEGVRNVAAVSLSIGYPTVASVPHSIVNGLKNLIAIAVETDITFKEAEMAKEYLK  270

Query  220  DPSKF  206
            DPSKF
Sbjct  271  DPSKF  275



>ref|XP_011146226.1| PREDICTED: 60S acidic ribosomal protein P0-like [Harpegnathos 
saltator]
 gb|EFN79997.1| 60S acidic ribosomal protein P0 [Harpegnathos saltator]
Length=316

 Score =   206 bits (524),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 128/228 (56%), Positives = 169/228 (74%), Gaps = 2/228 (1%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            T+G L EV +++ + KV APAR G +AP+ VV+P  NTGL P +TSFFQ L+IPTKI+KG
Sbjct  91   TRGDLIEVRDKLLENKVRAPARAGAIAPLSVVIPAQNTGLGPEKTSFFQALSIPTKISKG  150

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            T+EII  V +++ GDKVG+SEA LL  L I PFSYGL+V  VYD+G++F+PE+LD+  +D
Sbjct  151  TIEIINDVHILKPGDKVGASEATLLNMLNISPFSYGLLVEQVYDSGTIFAPEILDIKPED  210

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L EKF  GV+ V S+ LAISYPT+A+APH + NG+KN+L+IA  TD  F  A  +KEY+K
Sbjct  211  LREKFLAGVANVASICLAISYPTIASAPHSVANGFKNLLAIAAVTDVEFAEAATIKEYIK  270

Query  220  DPSKFavaaapvaaaaagsapaaaaaaeekkeepeeesEDEMGFSLFD  77
            DPSKF  AAA VA  +  +    AA  +E+K+E  EES+D+MGF LFD
Sbjct  271  DPSKF--AAATVAVQSDATVDTPAAEKKEEKKEESEESDDDMGFGLFD  316



>gb|ABM55512.1| putative ribosomal protein P0 [Maconellicoccus hirsutus]
Length=317

 Score =   206 bits (523),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 108/185 (58%), Positives = 141/185 (76%), Gaps = 0/185 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            T+  L E+ E++ + KV APAR G +AP  VV+P  NTGL P +TSFFQ L+IPTKI+KG
Sbjct  91   TRSDLVEIREKLLENKVQAPARAGAIAPCPVVIPAQNTGLGPEKTSFFQALSIPTKISKG  150

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            T+EII  V ++++GDKVG+SEA LL  L I PFSYGL V  VYD+G++F P +LD+  +D
Sbjct  151  TIEIINDVHILKEGDKVGASEATLLNMLNISPFSYGLGVQMVYDSGTIFEPRILDIKPED  210

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            LL KF+ GV+ V +L LAISYP++A+ PHMLING KN+L+IA ET+  F  A+ +KEYLK
Sbjct  211  LLAKFSEGVANVAALCLAISYPSVASVPHMLINGLKNLLAIAAETEIEFKEAETMKEYLK  270

Query  220  DPSKF  206
            DPSKF
Sbjct  271  DPSKF  275



>gb|ABF69531.1| acidic ribosomal protein P0 [Strongyloides ratti]
 emb|CEF70114.1| 60S acidic ribosomal protein P0 [Strongyloides ratti]
Length=313

 Score =   205 bits (522),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 108/185 (58%), Positives = 139/185 (75%), Gaps = 0/185 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            T   L E  +++ + K GAPA+ G +AP DV +PP NTG+ P +TSFFQ L IPTKI++G
Sbjct  91   THEDLGETRKKLLENKRGAPAKAGAIAPCDVKLPPQNTGMGPEKTSFFQALQIPTKISRG  150

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            T+EI+  V LI  GDKVG+SEAALL  L I PFSYGL VL VYDNG+++SP VLD+T++D
Sbjct  151  TIEILNEVHLISTGDKVGASEAALLNMLNITPFSYGLEVLHVYDNGTIYSPSVLDMTDED  210

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L EKF  GV+ + SLSL + YPT A+APH ++NG+KN+LSIA  TD +F  A+ +KEYL 
Sbjct  211  LREKFMEGVTRIASLSLGLGYPTRASAPHSIVNGFKNLLSIAAVTDVTFKQAETLKEYLA  270

Query  220  DPSKF  206
            DPSKF
Sbjct  271  DPSKF  275



>ref|XP_011157010.1| PREDICTED: 60S acidic ribosomal protein P0 [Solenopsis invicta]
 gb|EFZ19789.1| hypothetical protein SINV_09784 [Solenopsis invicta]
Length=318

 Score =   205 bits (521),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 125/228 (55%), Positives = 169/228 (74%), Gaps = 0/228 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            T+G L EV +++ + KV APAR G +AP+ V++P  NTGL P +TSFFQ L+IPTKI+KG
Sbjct  91   TRGDLIEVRDKLLENKVRAPARAGAIAPLSVIIPAQNTGLGPEKTSFFQALSIPTKISKG  150

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            T+EII  V +++ GDKVG+SEA LL  L I PFSYGL+V  VYD+G++F+PE+LD+  +D
Sbjct  151  TIEIINDVHILKPGDKVGASEATLLNMLNISPFSYGLLVEQVYDSGTIFAPEILDIKPED  210

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L EKF  GV+ + S+ LAI YPT+A+APH ++NG+KN+L++A  TD  F  A  +KEY+K
Sbjct  211  LREKFMAGVANLASVCLAIGYPTVASAPHSIVNGFKNLLAVAAVTDVEFAEAATIKEYIK  270

Query  220  DPSKFavaaapvaaaaagsapaaaaaaeekkeepeeesEDEMGFSLFD  77
            DPSKFA  AA VAA    +A A AA  +E+K+E  E  +D+MGF LFD
Sbjct  271  DPSKFAAVAAAVAAPVTAAADAPAAEKKEEKKEESESEDDDMGFGLFD  318



>ref|XP_623106.1| PREDICTED: 60S acidic ribosomal protein P0 isoformX1 [Apis mellifera]
 ref|XP_003695681.1| PREDICTED: 60S acidic ribosomal protein P0-like [Apis florea]
 ref|XP_006562125.1| PREDICTED: 60S acidic ribosomal protein P0 isoform X2 [Apis mellifera]
Length=317

 Score =   205 bits (521),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 105/185 (57%), Positives = 142/185 (77%), Gaps = 0/185 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            T+G L EV +++ + KV APAR G +AP+ V++P  NTGL P +TSFFQ L+IPTKI+KG
Sbjct  91   TRGDLIEVRDKLLENKVRAPARAGAIAPLSVIIPAQNTGLGPEKTSFFQALSIPTKISKG  150

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            T+EII  V +++ GDKVG+SEA LL  L I PFSYGL+V  VYD+G++F+PE+LD+  +D
Sbjct  151  TIEIINDVHILKPGDKVGASEATLLNMLNISPFSYGLLVEQVYDSGTIFAPEILDIKPED  210

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L EKF  GV+ + ++ LAI YPT+A+APH + NG+KN+L+IA  TD  FP A  +KEY+K
Sbjct  211  LCEKFMAGVANLAAVCLAIGYPTIASAPHSIANGFKNLLAIAAVTDIEFPEATTIKEYIK  270

Query  220  DPSKF  206
            DPSKF
Sbjct  271  DPSKF  275



>ref|XP_006612127.1| PREDICTED: 60S acidic ribosomal protein P0-like [Apis dorsata]
Length=317

 Score =   205 bits (521),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 105/185 (57%), Positives = 142/185 (77%), Gaps = 0/185 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            T+G L EV +++ + KV APAR G +AP+ V++P  NTGL P +TSFFQ L+IPTKI+KG
Sbjct  91   TRGDLIEVRDKLLENKVRAPARAGAIAPLSVIIPAQNTGLGPEKTSFFQALSIPTKISKG  150

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            T+EII  V +++ GDKVG+SEA LL  L I PFSYGL+V  VYD+G++F+PE+LD+  +D
Sbjct  151  TIEIINDVHILKPGDKVGASEATLLNMLNISPFSYGLLVEQVYDSGTIFAPEILDIKPED  210

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L EKF  GV+ + ++ LAI YPT+A+APH + NG+KN+L+IA  TD  FP A  +KEY+K
Sbjct  211  LCEKFMAGVANLAAVCLAIGYPTIASAPHSIANGFKNLLAIAAVTDIEFPEATTIKEYIK  270

Query  220  DPSKF  206
            DPSKF
Sbjct  271  DPSKF  275



>gb|ADD21620.1| ribosomal protein P0, partial [Hanleya nagelfar]
Length=274

 Score =   202 bits (515),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 107/185 (58%), Positives = 139/185 (75%), Gaps = 0/185 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TK  L ++   + + KV APA+ G +AP+DV +P  NTGL P +TSFFQ L+IPTKI +G
Sbjct  74   TKEDLLDIRSLLTENKVKAPAKPGAIAPLDVKIPGQNTGLGPEKTSFFQALSIPTKITRG  133

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            T+EI+  V LI++GDKVG+SEA LL  L I PF+YGL+V  VYD+GSV+ P +LD+  DD
Sbjct  134  TIEILNEVNLIKEGDKVGASEATLLNMLNISPFNYGLMVQMVYDSGSVYEPMILDIKMDD  193

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L E+F LGV  + S+SLAI YPT+A+APH +ING+K +L+IAVETD  F  A+  KEYLK
Sbjct  194  LRERFMLGVRNIASISLAIGYPTVASAPHSIINGFKRLLAIAVETDIDFEEANMAKEYLK  253

Query  220  DPSKF  206
            DPSKF
Sbjct  254  DPSKF  258



>gb|AEL28833.1| ribosomal protein P0 [Heliconius melpomene cythera]
Length=316

 Score =   204 bits (518),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 105/185 (57%), Positives = 142/185 (77%), Gaps = 0/185 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            T+G L EV +++ + KV APAR G +AP+ VV+P  NTGL P +T+FFQ L+IPTKI+KG
Sbjct  91   TRGDLVEVRDKLLENKVRAPARPGAIAPLAVVIPAHNTGLGPEKTAFFQALSIPTKISKG  150

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            T+EII  V +++ GDKVG+SEA LL  L I PFSYGL+V  VYD+G++F+P +LD+  +D
Sbjct  151  TIEIINDVHILKPGDKVGASEATLLNMLNISPFSYGLVVKQVYDSGTIFAPAILDIKPED  210

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L  KF  GV+ V +LSLAISYPTLA+APH + NG+KN+L+IA  +D  F  A+ +KE++K
Sbjct  211  LRAKFQEGVANVAALSLAISYPTLASAPHSIANGFKNLLAIAAVSDVEFKEANTIKEFIK  270

Query  220  DPSKF  206
            DPSKF
Sbjct  271  DPSKF  275



>ref|XP_011266937.1| PREDICTED: 60S acidic ribosomal protein P0 [Camponotus floridanus]
 gb|EFN61067.1| 60S acidic ribosomal protein P0 [Camponotus floridanus]
Length=318

 Score =   204 bits (518),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 127/228 (56%), Positives = 171/228 (75%), Gaps = 0/228 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            T+G L EV +++ + KV APAR G +AP+ V++P  NTGL P +TSFFQ L+IPTKI+KG
Sbjct  91   TRGDLIEVRDKLLENKVRAPARAGAIAPLSVIIPAQNTGLGPEKTSFFQALSIPTKISKG  150

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            T+EII  V +++ GDKVG+SEA LL  L I PFSYGL+V  VYD+G++F+PE+LD+  +D
Sbjct  151  TIEIINDVHILKPGDKVGASEATLLNMLNISPFSYGLLVEQVYDSGTIFAPEILDIKPED  210

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L EKF  GV+ + S+ L+I YPT+A+APH + NG+KN+L+IA  T+  FP A  +KEY+K
Sbjct  211  LREKFMAGVANLASVCLSIGYPTVASAPHSIANGFKNLLAIAAVTEVEFPEAATIKEYIK  270

Query  220  DPSKFavaaapvaaaaagsapaaaaaaeekkeepeeesEDEMGFSLFD  77
            DPSKFA AA  VAA AA +A A AA  +E+K+E  E  +D+MGF LFD
Sbjct  271  DPSKFAAAATAVAAPAAAAADATAAEKKEEKKEESESEDDDMGFGLFD  318



>gb|AAU84931.1| putative acidic p0 ribosomal protein [Aphis citricidus]
Length=314

 Score =   203 bits (517),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 107/185 (58%), Positives = 141/185 (76%), Gaps = 0/185 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            T+  L E+ +++ + KV APAR G +AP  VV+P  NTGL P +TSFFQ L+IPTKI+KG
Sbjct  91   TRSDLVEIRDKLLENKVRAPARPGAIAPCPVVIPAQNTGLGPEKTSFFQALSIPTKISKG  150

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            T+EII  V ++++GDKVG+SEA LL  L I PFSYGL V  VYD+G++F PE+LD+  +D
Sbjct  151  TIEIINDVHILKEGDKVGASEATLLNMLNISPFSYGLAVQMVYDSGTIFEPEILDIKPED  210

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            LL+ F +GVS VT+  LAISYPT+ +APHMLING+KN++++A ET+  F  A   KEYLK
Sbjct  211  LLKTFLIGVSQVTAACLAISYPTIVSAPHMLINGFKNLVAVAAETEIEFKEATTFKEYLK  270

Query  220  DPSKF  206
            DPSKF
Sbjct  271  DPSKF  275



>ref|XP_003398378.1| PREDICTED: 60S acidic ribosomal protein P0-like isoform 1 [Bombus 
terrestris]
 ref|XP_003398379.1| PREDICTED: 60S acidic ribosomal protein P0-like isoform 2 [Bombus 
terrestris]
Length=317

 Score =   203 bits (517),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 105/185 (57%), Positives = 142/185 (77%), Gaps = 0/185 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            T+G L EV +++ + KV APAR G +AP+ V++P  NTGL P +TSFFQ L+IPTKI+KG
Sbjct  91   TRGDLIEVRDKLLENKVRAPARAGAIAPLSVIIPAQNTGLGPEKTSFFQALSIPTKISKG  150

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            T+EII  V +++ GDKVG+SEA LL  L I PFSYGL+V  VYD+G++F+PE+LD+  +D
Sbjct  151  TIEIINDVHILKPGDKVGASEATLLNMLNISPFSYGLLVEQVYDSGTIFAPEILDIKPED  210

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L EKF  GV+ + ++ LAI YPT+A+APH + NG+KN+L+IA  TD  FP A  +KEY+K
Sbjct  211  LREKFMAGVANLAAVCLAIGYPTVASAPHSIANGFKNLLAIAAVTDIEFPEATTIKEYIK  270

Query  220  DPSKF  206
            DPSKF
Sbjct  271  DPSKF  275



>gb|KDR14762.1| 60S acidic ribosomal protein P0 [Zootermopsis nevadensis]
Length=316

 Score =   203 bits (517),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 103/185 (56%), Positives = 141/185 (76%), Gaps = 0/185 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            T+G L EV +++ + KV APAR G +AP  V++P  NTGL P +TSFFQ L+IPTKI+KG
Sbjct  91   TRGDLVEVRDKLLENKVRAPARNGAIAPCPVIIPAQNTGLGPEKTSFFQALSIPTKISKG  150

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            T+EII  V ++++GDKVG+S+A LL  L I PFSYGL+V  VYD+G++F P +LD+  +D
Sbjct  151  TIEIINDVHILKEGDKVGASDATLLNMLNISPFSYGLLVQMVYDSGTIFEPAILDIKPED  210

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L  KFA GV+ + ++ L+ISYPTLA+APH ++NG+KN+L+IA  TD  F  A  +KE+LK
Sbjct  211  LRVKFAEGVARLAAVCLSISYPTLASAPHSVVNGFKNLLAIAAATDVEFKEAQTIKEFLK  270

Query  220  DPSKF  206
            DPSKF
Sbjct  271  DPSKF  275



>ref|XP_003488353.1| PREDICTED: 60S acidic ribosomal protein P0-like [Bombus impatiens]
Length=317

 Score =   203 bits (517),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 105/185 (57%), Positives = 142/185 (77%), Gaps = 0/185 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            T+G L EV +++ + KV APAR G +AP+ V++P  NTGL P +TSFFQ L+IPTKI+KG
Sbjct  91   TRGDLIEVRDKLLENKVRAPARAGAIAPLSVIIPAQNTGLGPEKTSFFQALSIPTKISKG  150

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            T+EII  V +++ GDKVG+SEA LL  L I PFSYGL+V  VYD+G++F+PE+LD+  +D
Sbjct  151  TIEIINDVHILKPGDKVGASEATLLNMLNISPFSYGLLVEQVYDSGTIFAPEILDIKPED  210

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L EKF  GV+ + ++ LAI YPT+A+APH + NG+KN+L+IA  TD  FP A  +KEY+K
Sbjct  211  LREKFMAGVANLAAVCLAIGYPTVASAPHSIANGFKNLLAIAAVTDIEFPEAATIKEYIK  270

Query  220  DPSKF  206
            DPSKF
Sbjct  271  DPSKF  275



>ref|XP_002425010.1| ribosomal P0 protein, putative [Pediculus humanus corporis]
 gb|EEB12272.1| ribosomal P0 protein, putative [Pediculus humanus corporis]
Length=324

 Score =   204 bits (518),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 101/185 (55%), Positives = 142/185 (77%), Gaps = 0/185 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TKG L EV  ++ + KV APA+ G +AP  V++P  NTGL P +TSFFQ L+IPTKI+KG
Sbjct  91   TKGDLVEVRNKILENKVRAPAKNGAIAPCAVIIPAQNTGLGPEKTSFFQALSIPTKISKG  150

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            T+EI   V ++++GDKVG+S+A LL  L I PF+YGL+V  VYD+G++F P++LD+  +D
Sbjct  151  TIEITNDVHILKEGDKVGASDATLLNMLNISPFNYGLVVEMVYDSGTIFEPKILDIKPED  210

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L  KF  GVS + S+ L+ISYPT+A+APH+++NG+KN+L++A  +D  F  A++VKEYLK
Sbjct  211  LRAKFLEGVSCLASVCLSISYPTVASAPHLIVNGFKNLLAVAAASDVEFKEAERVKEYLK  270

Query  220  DPSKF  206
            DPSKF
Sbjct  271  DPSKF  275



>gb|AIW62441.1| 60S acidic ribosomal protein [Scytodes thoracica]
Length=320

 Score =   203 bits (517),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 106/185 (57%), Positives = 137/185 (74%), Gaps = 0/185 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TK  L EV +++   KV APAR G +AP DV++ P NTGL P +TSFFQ L IPTKI+KG
Sbjct  91   TKEDLVEVRDKIIDNKVKAPARAGAIAPCDVILQPQNTGLGPEKTSFFQALQIPTKISKG  150

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            T+EI   + LI+K DKVG+SEA LL  L + PF+YGL +  VYD+G+VFSPE+LD+T +D
Sbjct  151  TIEISNEIHLIKKEDKVGASEATLLNMLNVSPFTYGLKIRQVYDSGTVFSPEILDITSED  210

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L  KF  GV  + S+SL I YPTLA+ PH +ING KN+++IA+ETD +F  A+  KEY+K
Sbjct  211  LQAKFMEGVVNIASVSLQIGYPTLASVPHSIINGLKNLIAIALETDITFKEAEMAKEYMK  270

Query  220  DPSKF  206
            DPSKF
Sbjct  271  DPSKF  275



>gb|ABV60317.1| 60S acidic ribosomal protein P0-like protein [Lutzomyia longipalpis]
Length=317

 Score =   203 bits (516),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 102/185 (55%), Positives = 141/185 (76%), Gaps = 0/185 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TKG L EV +++ + KV APAR G +AP++V++P  NTGL P +TSFFQ L+IPTKI+KG
Sbjct  91   TKGDLNEVRDKLTESKVRAPARAGAIAPLEVIIPAQNTGLGPEKTSFFQALSIPTKISKG  150

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            T+EII  V +++ GDKVG+SEAALL  L I PF YGL++  VYD+GS+FSPE+LD+  +D
Sbjct  151  TIEIINDVPILKPGDKVGASEAALLNMLNISPFQYGLLIEQVYDSGSIFSPEILDIKPED  210

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            +  KF  GV+ + ++ L+I YPTLA+APH + NG+KN+L+IA  T+  F  A  +KE++K
Sbjct  211  IRAKFQQGVANLAAVCLSIGYPTLASAPHSIANGFKNLLAIAATTEVEFAEATTIKEFIK  270

Query  220  DPSKF  206
            DPSKF
Sbjct  271  DPSKF  275



>gb|AFM87759.1| ribosomal protein, large, P0 [Callorhinchus milii]
Length=313

 Score =   203 bits (516),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 108/183 (59%), Positives = 138/183 (75%), Gaps = 0/183 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TKG L E+ + +   KV A AR G +AP DV VP  NTGL P +TSFFQ L I TKI++G
Sbjct  91   TKGDLCEIRDMLLSNKVPACARAGALAPCDVTVPAQNTGLGPEKTSFFQALGITTKISRG  150

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            T+EI++ V LI+ GDKVG+SEA LL  L I PFSYGL+++ VYDNGSV++PEVLD+TE+ 
Sbjct  151  TIEILSDVPLIKVGDKVGASEATLLNMLNISPFSYGLMIMQVYDNGSVYNPEVLDITEEA  210

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L ++F  GV  V S+ L I YPT+A+ PH +INGY+ VL++AVETDY FPLA+KVK +L 
Sbjct  211  LQQRFLEGVRNVASVCLQIGYPTIASIPHSVINGYRRVLAVAVETDYVFPLAEKVKAFLA  270

Query  220  DPS  212
            DPS
Sbjct  271  DPS  273



>ref|XP_001985147.1| GH14667 [Drosophila grimshawi]
 gb|EDV97495.1| GH14667 [Drosophila grimshawi]
Length=318

 Score =   203 bits (516),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 124/228 (54%), Positives = 163/228 (71%), Gaps = 0/228 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TKG L EV +++ + KV APAR G +AP+ V++P  NTGL P +TSFFQ L+IPTKI+KG
Sbjct  91   TKGDLAEVRDKLLESKVRAPARPGAIAPLHVIIPAQNTGLGPEKTSFFQALSIPTKISKG  150

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            T+EII  V +++ GDKVG+SEA LL  L I PFSYGL+V  VYD+GS+FSPE+LD+  +D
Sbjct  151  TIEIINDVPILKPGDKVGASEATLLNMLNISPFSYGLLVSQVYDSGSIFSPEILDIKPED  210

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L  KF  GV+ + ++ L++ YPT+A+APH + NG+KN+L+IA  TD  F  A  +KEY+K
Sbjct  211  LRAKFQQGVANLAAVCLSVGYPTIASAPHSVANGFKNLLAIAATTDVDFKEATTIKEYIK  270

Query  220  DPSKFavaaapvaaaaagsapaaaaaaeekkeepeeesEDEMGFSLFD  77
            DPSKFA AAA  A AA G   A      +K E   EE +D+MGF LFD
Sbjct  271  DPSKFAAAAASSAPAAGGGGAAEKKEEAKKAESESEEEDDDMGFGLFD  318



>ref|XP_005107960.1| PREDICTED: 60S acidic ribosomal protein P0-like isoform X1 [Aplysia 
californica]
 ref|XP_005107961.1| PREDICTED: 60S acidic ribosomal protein P0-like isoform X2 [Aplysia 
californica]
Length=313

 Score =   202 bits (515),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 106/185 (57%), Positives = 139/185 (75%), Gaps = 0/185 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TK  L E+   + + KV APAR G VAP+DV VP   T L P +TSFFQ L+IPTKI KG
Sbjct  91   TKEDLSEIRTILVENKVQAPARAGAVAPLDVKVPAQTTTLGPEKTSFFQALSIPTKITKG  150

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            T+EI+  V LI++G+KVG SE+ LL  L I PF+YGL++ +VYD+G++FSP +LD+T DD
Sbjct  151  TIEILNEVSLIKEGEKVGQSESTLLNMLNISPFTYGLLIENVYDSGTIFSPAILDITNDD  210

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            ++ KF  GV  + S+SLAI YPT A+APH +ING+KN+L+IAV T+Y F  A++ KEYLK
Sbjct  211  IISKFMSGVRNIASVSLAIGYPTAASAPHSIINGFKNLLAIAVSTEYDFAEAEQTKEYLK  270

Query  220  DPSKF  206
            DPSKF
Sbjct  271  DPSKF  275



>ref|NP_001119687.1| ribosomal protein LP0 [Acyrthosiphon pisum]
 gb|ABD72685.1| putative acidic p0 ribosomal protein [Acyrthosiphon pisum]
 dbj|BAH70530.1| ACYPI000079 [Acyrthosiphon pisum]
 dbj|BAH70531.1| ACYPI000079 [Acyrthosiphon pisum]
 dbj|BAH70532.1| ACYPI000079 [Acyrthosiphon pisum]
 dbj|BAH70533.1| ACYPI000079 [Acyrthosiphon pisum]
 dbj|BAH70534.1| ACYPI000079 [Acyrthosiphon pisum]
 dbj|BAH70535.1| ACYPI000079 [Acyrthosiphon pisum]
 dbj|BAH70536.1| ACYPI000079 [Acyrthosiphon pisum]
 dbj|BAH70538.1| ACYPI000079 [Acyrthosiphon pisum]
 dbj|BAH70539.1| ACYPI000079 [Acyrthosiphon pisum]
 dbj|BAH70540.1| ACYPI000079 [Acyrthosiphon pisum]
 dbj|BAH70541.1| ACYPI000079 [Acyrthosiphon pisum]
Length=314

 Score =   202 bits (515),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 106/185 (57%), Positives = 141/185 (76%), Gaps = 0/185 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            T+  L E+ +++ + KV APAR G +AP  VV+P  NTGL P +TSFFQ L+IPTKI+KG
Sbjct  91   TRSDLVEIRDKLLENKVRAPARPGAIAPCPVVIPAQNTGLGPEKTSFFQALSIPTKISKG  150

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            T+EII  V ++++GDKVG+SEA LL  L I PF+YGL V  VYD+G++F PE+LD+  +D
Sbjct  151  TIEIINDVHILKEGDKVGASEATLLNMLNISPFNYGLAVQMVYDSGTIFEPEILDIKPED  210

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            LL+ F +GVS VT+  LAISYPT+ +APHMLING+KN++++A ET+  F  A   KEYLK
Sbjct  211  LLKTFLIGVSQVTAACLAISYPTIVSAPHMLINGFKNLVAVAAETEIEFKEATTFKEYLK  270

Query  220  DPSKF  206
            DPSKF
Sbjct  271  DPSKF  275



>ref|XP_001958489.1| GF10946 [Drosophila ananassae]
 gb|EDV41295.1| GF10946 [Drosophila ananassae]
Length=317

 Score =   202 bits (515),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 105/185 (57%), Positives = 141/185 (76%), Gaps = 0/185 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TKG L EV +++ + KV APAR G +AP++V++P  NTGL P +TSFFQ L+IPTKI+KG
Sbjct  91   TKGDLAEVRDKLLESKVRAPARPGAIAPLNVIIPAQNTGLGPEKTSFFQALSIPTKISKG  150

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            T+EII  V +++ GDKVG+SEA LL  L I PFSYGLIV  VYD+GS+FSPE+LD+  +D
Sbjct  151  TIEIINDVPILKPGDKVGASEATLLNMLNISPFSYGLIVNQVYDSGSIFSPEILDIKPED  210

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L  KF  GV+ + ++ L++ YPT+A+APH + NG+KN+L+IA  TD  F  A  +KEY+K
Sbjct  211  LRAKFQQGVANLAAVCLSVGYPTIASAPHSIANGFKNLLAIAATTDVEFKEATTIKEYIK  270

Query  220  DPSKF  206
            DPSKF
Sbjct  271  DPSKF  275



>dbj|BAN20115.1| ribosomal protein LP0 [Riptortus pedestris]
Length=315

 Score =   202 bits (514),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 100/185 (54%), Positives = 140/185 (76%), Gaps = 0/185 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            T+G L EV E++ + KV APAR G +AP  VV+P  NTGL P +TSFFQ L+IPTKI+KG
Sbjct  91   TRGELTEVREKLLQNKVRAPARAGAIAPCPVVIPAQNTGLGPEKTSFFQALSIPTKISKG  150

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            T+EII  V ++++GDKVG+SEA LL  L I PFSYGL+V  VYD+G++F P++LD+  ++
Sbjct  151  TIEIINDVHILKEGDKVGASEATLLNMLNISPFSYGLVVEMVYDSGTIFEPKILDIKPEE  210

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L  +F  G + + ++ L ISYPT+A+APH + NG+KN+L++A  T+  F  A+++KEYLK
Sbjct  211  LRIRFLEGAARLAAVCLEISYPTIASAPHSIANGFKNLLAVAAVTEIEFKEAERLKEYLK  270

Query  220  DPSKF  206
            DPSKF
Sbjct  271  DPSKF  275



>dbj|BAH70543.1| ACYPI000079 [Acyrthosiphon pisum]
Length=314

 Score =   202 bits (514),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 106/185 (57%), Positives = 141/185 (76%), Gaps = 0/185 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            T+  L E+ +++ + KV APAR G +AP  VV+P  NTGL P +TSFFQ L+IPTKI+KG
Sbjct  91   TRSDLVEIRDKLLENKVRAPARPGAIAPCPVVIPAQNTGLGPGKTSFFQALSIPTKISKG  150

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            T+EII  V ++++GDKVG+SEA LL  L I PF+YGL V  VYD+G++F PE+LD+  +D
Sbjct  151  TIEIINDVHILKEGDKVGASEATLLNMLNISPFNYGLAVQMVYDSGTIFEPEILDIKPED  210

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            LL+ F +GVS VT+  LAISYPT+ +APHMLING+KN++++A ET+  F  A   KEYLK
Sbjct  211  LLKTFLIGVSQVTAACLAISYPTIVSAPHMLINGFKNLVAVAAETEIEFKEATTFKEYLK  270

Query  220  DPSKF  206
            DPSKF
Sbjct  271  DPSKF  275



>ref|XP_001422456.1| Cytosolic 80S ribosomal protein P0; Cytosolic 60S large ribosomal 
subunit protein P0 [Ostreococcus lucimarinus CCE9901]
 gb|ABP00773.1| Cytosolic 80S ribosomal protein P0; Cytosolic 60S large ribosomal 
subunit protein P0 [Ostreococcus lucimarinus CCE9901]
Length=313

 Score =   202 bits (513),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 103/182 (57%), Positives = 140/182 (77%), Gaps = 0/182 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TKG L +V +++ ++ V APARVG +AP++VVVP G TG++PSQTSFFQ LNI TKINKG
Sbjct  92   TKGDLLDVRKKIQQFVVPAPARVGAIAPVEVVVPAGPTGMEPSQTSFFQTLNIATKINKG  151

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            T+EI+  + +++ GD+V SS AALL K+   PF+YGLIV+ VYD G+++   VLD+T + 
Sbjct  152  TIEILNDIVVLQPGDRVSSSAAALLGKMKFTPFTYGLIVMEVYDKGAMYPSAVLDITNET  211

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L +KF  GV+ V SLSLA  YPTLA+ PH ++N YKNVL+I++ TDY+F LA KVK+YL 
Sbjct  212  LEKKFMSGVAQVASLSLASGYPTLASVPHSIVNAYKNVLAISIGTDYTFELAQKVKDYLA  271

Query  220  DP  215
            +P
Sbjct  272  NP  273



>emb|CDW52119.1| 60S acidic ribosomal protein P0 [Trichuris trichiura]
Length=316

 Score =   202 bits (513),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 101/185 (55%), Positives = 138/185 (75%), Gaps = 0/185 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TK  L+EV E +   KV APA+ G++APIDV +P  NTGL P +TSFFQ L+IPTKI+KG
Sbjct  91   TKENLREVRESIVSKKVAAPAKAGMIAPIDVTLPAQNTGLSPDKTSFFQALSIPTKISKG  150

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            T+EI+  + LI+  +KVG+SEA LL  L I PFSYGL++  VYD GS++ P +LD+T +D
Sbjct  151  TIEILNDIHLIKANEKVGASEATLLNMLNIMPFSYGLVMKKVYDAGSIYDPSILDVTPED  210

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L +K +  V  + S+SL I+YP  A+APHM+ N +KN+L+IA +TD +F  A+K+KEYLK
Sbjct  211  LRDKVSQAVRNIASISLRINYPNAASAPHMIANAFKNLLAIAAQTDVTFKEAEKMKEYLK  270

Query  220  DPSKF  206
            DPS+F
Sbjct  271  DPSRF  275



>ref|XP_313349.1| AGAP003592-PA [Anopheles gambiae str. PEST]
 ref|XP_003436533.1| AGAP003592-PB [Anopheles gambiae str. PEST]
 gb|EAA08855.2| AGAP003592-PA [Anopheles gambiae str. PEST]
 gb|EGK97075.1| AGAP003592-PB [Anopheles gambiae str. PEST]
Length=314

 Score =   201 bits (512),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 103/185 (56%), Positives = 140/185 (76%), Gaps = 0/185 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TKG L E+ +++ + KV APAR G +AP++VV+P  NTGL P +TSFFQ L+IPTKI+KG
Sbjct  91   TKGDLAEIRDKLTESKVRAPARAGAIAPLEVVIPAQNTGLGPEKTSFFQALSIPTKISKG  150

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            T+EII  V +++ GDKVG+SEA LL  L I PFSYGL +  VYD+GS+FSPE+LD+  +D
Sbjct  151  TIEIINDVPILKPGDKVGASEATLLNMLNISPFSYGLQIQQVYDSGSIFSPEILDIKAED  210

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L  KF  GV+ + ++SL I YPTLA+ PH + NG++N+L+IA  T+  F  A+ VKE++K
Sbjct  211  LRAKFQAGVANLAAVSLQIGYPTLASVPHSIANGFRNLLAIAAVTEVEFKEAETVKEFIK  270

Query  220  DPSKF  206
            DPSKF
Sbjct  271  DPSKF  275



>gb|AFM87695.1| ribosomal protein, large, P0 [Callorhinchus milii]
Length=274

 Score =   200 bits (509),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 107/183 (58%), Positives = 137/183 (75%), Gaps = 0/183 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TK  L E+ + +   KV A AR G +AP DV VP  NTGL P +TSFFQ L I TKI++G
Sbjct  52   TKEDLCEIRDMLLSNKVPACARAGALAPCDVTVPAQNTGLGPEKTSFFQALGITTKISRG  111

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            T+EI++ V LI+ GDKVG+SEA LL  L I PFSYGL+++ VYDNGSV++PEVLD+TE+ 
Sbjct  112  TIEILSDVPLIKVGDKVGASEATLLNTLNISPFSYGLMIMQVYDNGSVYNPEVLDITEEA  171

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L ++F  GV  V S+ L I YPT+A+ PH +INGY+ VL++AVETDY FPLA+KVK +L 
Sbjct  172  LQQRFLEGVRNVASVCLQIGYPTIASIPHSVINGYRRVLAVAVETDYVFPLAEKVKAFLA  231

Query  220  DPS  212
            DPS
Sbjct  232  DPS  234



>gb|AAL62465.1| 60S acidic ribosomal protein P0 [Spodoptera frugiperda]
Length=315

 Score =   201 bits (512),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 104/185 (56%), Positives = 142/185 (77%), Gaps = 0/185 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            T+G L +V +++ + KV APAR G +AP+ VV+P  NTGL P +TSFFQ L+IPTKI+KG
Sbjct  91   TRGDLVDVRDKLLENKVRAPARPGAIAPLSVVIPAHNTGLGPEKTSFFQALSIPTKISKG  150

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            T+EII  V +++ GDKVG+SEA LL  L I PFSYGL+V  VYD+G++F+P +LD+  +D
Sbjct  151  TIEIINDVHILKPGDKVGASEATLLNMLNISPFSYGLVVKQVYDSGTIFAPAILDIKPED  210

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L EKF  GV+ V +LSLAI YPT+A+APH ++NG+KN+L+IA  T+  F  A  +KE++K
Sbjct  211  LREKFMAGVANVAALSLAIGYPTVASAPHSIVNGFKNLLAIAAVTEVEFKEAQTIKEFIK  270

Query  220  DPSKF  206
            DPSKF
Sbjct  271  DPSKF  275



>ref|XP_011146290.1| PREDICTED: 60S acidic ribosomal protein P0-like [Harpegnathos 
saltator]
 gb|EFN80029.1| 60S acidic ribosomal protein P0 [Harpegnathos saltator]
Length=316

 Score =   201 bits (512),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 105/185 (57%), Positives = 141/185 (76%), Gaps = 0/185 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            T+G L EV +++ + KV APAR G +AP+ VV+P  NTGL P +TSFFQ L+IPTKI+KG
Sbjct  91   TRGDLIEVRDKLLENKVRAPARAGAIAPLSVVIPAQNTGLGPEKTSFFQALSIPTKISKG  150

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            T+EII  V +++ GDKVG+SEA LL  L I PFSYGL+V  VYD+G++F+PE+LD+  +D
Sbjct  151  TIEIINDVHILKPGDKVGASEATLLNMLNISPFSYGLLVEQVYDSGTIFAPEILDIKPED  210

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L EKF  GV+ + S+ L+I YPT+A+APH + NG+KN+L+IA  TD  F  A  +KEY+K
Sbjct  211  LREKFLAGVANIASICLSIGYPTVASAPHSIANGFKNLLAIAAVTDVEFAEAATIKEYIK  270

Query  220  DPSKF  206
            DPSKF
Sbjct  271  DPSKF  275



>gb|AAF31449.1|AF220939_1 60S acidic ribosomal protein P0 [Sarcophaga crassipalpis]
Length=316

 Score =   201 bits (512),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 105/185 (57%), Positives = 140/185 (76%), Gaps = 0/185 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TKG L EV +++ + KV APAR G +AP+ V++P  NTGL P +TSFFQ L+IPTKI+KG
Sbjct  91   TKGDLAEVRDKLLESKVRAPARAGAIAPLPVIIPAQNTGLGPEKTSFFQALSIPTKISKG  150

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            T+EII  V +++ GDKVG+SEA LL  L I PFSYGLI+  VYD+GS+FSPE+LD+  +D
Sbjct  151  TIEIINDVPILKPGDKVGASEATLLNMLNISPFSYGLIINQVYDSGSIFSPEILDIKPED  210

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L  KF  GV+ + ++SL I YPT+A+APH + NG+KN+L+IA  T+  F  A  +KEY+K
Sbjct  211  LRAKFQAGVANLAAVSLEIGYPTIASAPHNIANGFKNLLAIAATTEVEFKEATTIKEYIK  270

Query  220  DPSKF  206
            DPSKF
Sbjct  271  DPSKF  275



>emb|CAD29995.1| ribosomal P0 protein [Bombyx mori]
Length=316

 Score =   201 bits (512),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 105/185 (57%), Positives = 141/185 (76%), Gaps = 0/185 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            T+G L EV +++ + KV APAR G +AP+ VV+P  NTGL P +TSFFQ L+IPTKI+KG
Sbjct  91   TRGDLVEVRDKLLENKVQAPARPGAIAPLSVVIPAHNTGLGPEKTSFFQALSIPTKISKG  150

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            T+EII  V +++ GDKVG+SEA LL  L I PFSYGL+V  VYD+G++F+PE+LD+  +D
Sbjct  151  TIEIINDVHILKPGDKVGASEATLLNMLNISPFSYGLVVKQVYDSGTIFAPEILDIKPED  210

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L  KF  GV+ V +LSLAI YPT+A+APH + NG+KN+L+IA  T+  F  A  +KE++K
Sbjct  211  LRAKFQAGVANVAALSLAIGYPTIASAPHSIANGFKNLLAIAAVTEVEFEEATTIKEFIK  270

Query  220  DPSKF  206
            DPSKF
Sbjct  271  DPSKF  275



>ref|NP_001037123.1| ribosomal protein P0 [Bombyx mori]
 gb|AAV34809.1| ribosomal protein P0 [Bombyx mori]
Length=316

 Score =   201 bits (512),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 105/185 (57%), Positives = 141/185 (76%), Gaps = 0/185 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            T+G L EV +++ + KV APAR G +AP+ VV+P  NTGL P +TSFFQ L+IPTKI+KG
Sbjct  91   TRGDLVEVRDKLLENKVQAPARPGAIAPLSVVIPAHNTGLGPEKTSFFQALSIPTKISKG  150

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            T+EII  V +++ GDKVG+SEA LL  L I PFSYGL+V  VYD+G++F+PE+LD+  +D
Sbjct  151  TIEIINDVHILKPGDKVGASEATLLNMLNISPFSYGLVVKQVYDSGTIFAPEILDIKPED  210

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L  KF  GV+ V +LSLAI YPT+A+APH + NG+KN+L+IA  T+  F  A  +KE++K
Sbjct  211  LRAKFQAGVANVAALSLAIGYPTIASAPHSIANGFKNLLAIAAVTEVEFEEATTIKEFIK  270

Query  220  DPSKF  206
            DPSKF
Sbjct  271  DPSKF  275



>dbj|BAM18929.1| ribosomal protein LP0 [Papilio polytes]
Length=317

 Score =   201 bits (512),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 105/185 (57%), Positives = 139/185 (75%), Gaps = 0/185 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            T+G L EV +++ + KV APAR G +AP+ VV+P  NTGL P +TSFFQ L+IPTKI+KG
Sbjct  91   TRGDLVEVRDKLLENKVRAPARPGAIAPLSVVIPAHNTGLGPEKTSFFQALSIPTKISKG  150

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            T+EII  V +++ GDKVG+SEA LL  L I PFSYGL+V  VYD+G++F+P +LD+  +D
Sbjct  151  TIEIINDVHILKPGDKVGASEATLLNMLNISPFSYGLVVKQVYDSGTIFAPAILDIKPED  210

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L  KF  GV+ V ++SLA  YPTLA+APH L NG+KN+L+IA  TD  F  A  +KE++K
Sbjct  211  LRAKFMEGVANVAAVSLAAGYPTLASAPHSLANGFKNLLAIAAVTDVEFKEATTIKEFIK  270

Query  220  DPSKF  206
            DPSKF
Sbjct  271  DPSKF  275



>gb|KFD51108.1| hypothetical protein M513_08008 [Trichuris suis]
 gb|KFD63076.1| hypothetical protein M514_08008 [Trichuris suis]
 gb|KHJ46226.1| ribosomal protein L10 [Trichuris suis]
Length=315

 Score =   201 bits (511),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 101/185 (55%), Positives = 138/185 (75%), Gaps = 0/185 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TK  L+EV E +   KV APA+ G++AP+DV +P  NTGL P +TSFFQ L+IPTKI+KG
Sbjct  91   TKENLREVREAIISKKVAAPAKAGMIAPVDVTLPAQNTGLSPDKTSFFQALSIPTKISKG  150

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            T+EI+  + LI+  +KVG+SEA LL  L I PFSYGL++  VYD GS++ P +LD+T +D
Sbjct  151  TIEILNDIHLIKANEKVGASEATLLNMLNIMPFSYGLVMKKVYDTGSIYDPSILDVTPED  210

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L +K +  V  + S+SL I+YP  A+APHM+ N +KN+L+IA +TD +F  A+K+KEYLK
Sbjct  211  LRDKVSQAVRNIASISLRINYPNAASAPHMIANAFKNLLAIAAQTDVTFKEAEKMKEYLK  270

Query  220  DPSKF  206
            DPSKF
Sbjct  271  DPSKF  275



>ref|XP_001352888.1| GA20389 [Drosophila pseudoobscura pseudoobscura]
 gb|EAL30389.1| GA20389 [Drosophila pseudoobscura pseudoobscura]
Length=317

 Score =   201 bits (511),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 104/185 (56%), Positives = 141/185 (76%), Gaps = 0/185 (0%)
 Frame = -1

Query  760  TKGXLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG  581
            TKG L EV +++ + KV APAR G +AP++V++P  NTGL P +TSFFQ L+IPTKI+KG
Sbjct  91   TKGDLAEVRDKLLESKVRAPARPGAIAPLNVIIPAQNTGLGPEKTSFFQALSIPTKISKG  150

Query  580  TVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldltedd  401
            T+EII  V +++ GDKVG+SEA LL  L I PFSYGLIV  VYD+GS+FSPE+LD+  +D
Sbjct  151  TIEIINDVPILKPGDKVGASEATLLNMLNISPFSYGLIVSQVYDSGSIFSPEILDIKPED  210

Query  400  llEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLK  221
            L  KF  GV+ + ++ L++ YPT+A+APH + NG+KN+L+IA  T+  F  A  +KEY+K
Sbjct  211  LRAKFQQGVANLAAVCLSVGYPTIASAPHSIANGFKNLLAIAATTEVEFKEATTIKEYIK  270

Query  220  DPSKF  206
            DPSKF
Sbjct  271  DPSKF  275



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1427696849470