BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF010H04

Length=619
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AHJ60264.1|  phenylalanine ammonia-lyase 1                           320   2e-101   Ipomoea purpurea
sp|Q42858.1|PAL2_IPOBA  RecName: Full=Phenylalanine ammonia-lyase       313   1e-98    Ipomoea batatas [batate]
ref|XP_009629066.1|  PREDICTED: phenylalanine ammonia-lyase             285   7e-88    Nicotiana tomentosiformis
dbj|BAF98437.1|  phenylalanine ammonia-lyase                            271   1e-87    Glehnia littoralis
dbj|BAF98438.1|  phenylalanine ammonia-lyase                            271   1e-87    Glehnia littoralis
sp|P14166.1|PAL1_IPOBA  RecName: Full=Phenylalanine ammonia-lyase       283   2e-87    Ipomoea batatas [batate]
gb|AAG49585.1|AF325496_1  phenylalanine ammonia-lyase                   283   3e-87    Ipomoea nil [qian niu]
gb|ABG75911.1|  phenylalanine ammonia-lyase 2                           282   9e-87    Nicotiana attenuata
gb|AIB08913.1|  phenylalanine ammonia-lyase                             266   2e-86    Angelica sinensis [Chinese angelica]
dbj|BAF98439.1|  phenylalanine ammonia-lyase                            266   2e-85    Glehnia littoralis
gb|AAC33966.1|  phenylalanine ammonia-lyase                             274   2e-85    Capsicum chinense [bonnet pepper]
ref|XP_009766905.1|  PREDICTED: phenylalanine ammonia-lyase             278   4e-85    Nicotiana sylvestris
gb|ABG75910.1|  phenylalanine ammonia-lyase 1                           277   5e-85    Nicotiana attenuata
sp|P35512.1|PALY_MALDO  RecName: Full=Phenylalanine ammonia-lyase       263   6e-85    Malus domestica [apple tree]
ref|XP_004246650.1|  PREDICTED: phenylalanine ammonia-lyase-like        277   8e-85    
ref|XP_006367534.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      270   9e-85    
emb|CDP06747.1|  unnamed protein product                                273   9e-85    Coffea canephora [robusta coffee]
gb|AGT63063.1|  phenylalanine ammonia-lyase                             276   1e-84    Solanum tuberosum [potatoes]
ref|XP_009625397.1|  PREDICTED: phenylalanine ammonia-lyase             276   1e-84    Nicotiana tomentosiformis
sp|P35513.2|PAL2_TOBAC  RecName: Full=Phenylalanine ammonia-lyase       276   1e-84    Nicotiana tabacum [American tobacco]
gb|AET41698.1|  phenylalanine ammonia-lyase                             265   2e-84    Prunus salicina [Japanese plum]
ref|XP_004249558.1|  PREDICTED: phenylalanine ammonia-lyase             276   2e-84    Solanum lycopersicum
ref|XP_004246649.1|  PREDICTED: phenylalanine ammonia-lyase-like ...    276   2e-84    Solanum lycopersicum
gb|ACR56688.1|  phenylalanine ammonia-lyase                             275   2e-84    Scutellaria viscidula [zhan mao huang qin]
gb|ACF17667.1|  putative phenylalanine ammonia-lyase                    275   3e-84    Capsicum annuum
gb|ACF94717.1|  phenylalanine ammonia lyase                             263   6e-84    Robinia pseudoacacia [black locust]
ref|XP_009781653.1|  PREDICTED: phenylalanine ammonia-lyase             274   8e-84    Nicotiana sylvestris
ref|XP_003635685.1|  PREDICTED: phenylalanine ammonia-lyase             262   2e-83    Vitis vinifera
gb|AEO92028.1|  phenylalanine ammonia-lyase 2                           273   2e-83    Coffea canephora [robusta coffee]
dbj|BAF36975.1|  phenylalanine ammonia-lyase                            261   2e-83    Lotus japonicus
gb|AIA66448.1|  PAL1                                                    273   3e-83    Capsicum annuum
emb|CDP20698.1|  unnamed protein product                                271   4e-83    Coffea canephora [robusta coffee]
gb|AEL21617.1|  phenylalanine ammonia lyase 2                           272   4e-83    Coffea arabica [arabica coffee]
gb|AEY94464.1|  phenylalanine ammonia-lyase                             262   5e-83    Prunella vulgaris
dbj|BAG31930.1|  phenylalanine ammonia-lyase                            271   7e-83    Daucus carota [carrots]
sp|P45733.1|PAL3_TOBAC  RecName: Full=Phenylalanine ammonia-lyase       271   8e-83    Nicotiana tabacum [American tobacco]
dbj|BAC56977.1|  phenylalanine ammonia-lyase                            271   9e-83    Daucus carota [carrots]
gb|AAK60273.1|AF383150_1  phenylalanine ammonia-lyase 3                 260   9e-83    Manihot esculenta [manioc]
gb|AFC37247.1|  phenylalanine ammonia-lyase                             259   1e-82    Camellia chekiangoleosa
ref|XP_006354336.1|  PREDICTED: phenylalanine ammonia-lyase-like ...    271   1e-82    
dbj|BAA95629.1|  phenylalanine ammonia lyase                            271   1e-82    Catharanthus roseus [chatas]
ref|XP_006354338.1|  PREDICTED: phenylalanine ammonia-lyase-like ...    271   1e-82    Solanum tuberosum [potatoes]
sp|P45729.1|PAL3_PETCR  RecName: Full=Phenylalanine ammonia-lyase 3     270   2e-82    Petroselinum crispum
ref|XP_006364021.1|  PREDICTED: phenylalanine ammonia-lyase-like        270   3e-82    Solanum tuberosum [potatoes]
sp|P45735.1|PALY_VITVI  RecName: Full=Phenylalanine ammonia-lyase       262   3e-82    Vitis vinifera
gb|AGF50184.1|  phenylalanine ammonia lyase                             258   3e-82    Salvia virgata
sp|P45726.1|PALY_CAMSI  RecName: Full=Phenylalanine ammonia-lyase       270   3e-82    Camellia sinensis [black tea]
ref|XP_011094662.1|  PREDICTED: phenylalanine ammonia-lyase             270   3e-82    Sesamum indicum [beniseed]
dbj|BAF36973.1|  phenylalanine ammonia-lyase                            266   4e-82    Lotus japonicus
emb|CAA34715.1|  unnamed protein product                                266   5e-82    Petroselinum crispum
dbj|BAF36972.1|  phenylalanine ammonia-lyase                            268   6e-82    Lotus japonicus
ref|XP_008387584.1|  PREDICTED: phenylalanine ammonia-lyase 1           269   6e-82    
gb|AEA72280.1|  phenylalanine ammonia-lyase                             268   7e-82    Angelica gigas
gb|AAU08174.1|  phenylalanine ammonia-lyase                             269   8e-82    Camellia sinensis [black tea]
ref|XP_004246651.1|  PREDICTED: phenylalanine ammonia-lyase             269   9e-82    
gb|AFG30054.1|  phenylalanine ammonialyase                              269   9e-82    Malus hybrid cultivar
dbj|BAF36971.1|  phenylalanine ammonia-lyase                            268   1e-81    Lotus japonicus
emb|CBJ23826.1|  phenylalanine ammonia-lyase                            268   1e-81    Melissa officinalis [sweet balm]
gb|ADN32767.1|  phenylalanine ammonia-lyase 1                           268   1e-81    Scutellaria baicalensis [Baikal skullcap]
ref|XP_006358655.1|  PREDICTED: phenylalanine ammonia-lyase-like        268   1e-81    Solanum tuberosum [potatoes]
ref|XP_002862326.1|  predicted protein                                  254   1e-81    
ref|XP_011031723.1|  PREDICTED: phenylalanine ammonia-lyase G4          268   2e-81    Populus euphratica
gb|ACF94716.1|  phenylalanine ammonia lyase                             268   2e-81    Robinia pseudoacacia [black locust]
ref|XP_003625662.1|  Phenylalanine ammonia-lyase                        261   2e-81    
ref|XP_004493977.1|  PREDICTED: phenylalanine ammonia-lyase-like        268   2e-81    Cicer arietinum [garbanzo]
gb|AAN52280.1|AF480620_1  phenylalanine ammonia-lyase                   268   2e-81    Populus tremuloides
ref|XP_006354339.1|  PREDICTED: phenylalanine ammonia-lyase-like        268   2e-81    Solanum tuberosum [potatoes]
gb|AFP24940.1|  phenylalanine ammonia lyase                             268   3e-81    Prunus salicina [Japanese plum]
gb|ADI40166.1|  phenylalanine ammonia-lyase                             268   3e-81    Morus alba
sp|P31425.1|PAL1_SOLTU  RecName: Full=Phenylalanine ammonia-lyase 1     268   3e-81    Solanum tuberosum [potatoes]
sp|O23865.1|PAL1_DAUCA  RecName: Full=Phenylalanine ammonia-lyase 1     267   3e-81    Daucus carota [carrots]
sp|O64963.1|PAL1_PRUAV  RecName: Full=Phenylalanine ammonia-lyase 1     267   3e-81    Prunus avium [gean]
gb|AAA34179.2|  phenylalanine ammonia lyase                             267   3e-81    Solanum lycopersicum
gb|AGF50183.1|  phenylalanine ammonia lyase                             255   3e-81    Salvia hypoleuca
sp|P26600.1|PAL5_SOLLC  RecName: Full=Phenylalanine ammonia-lyase...    267   3e-81    Solanum lycopersicum
sp|P35511.1|PAL1_SOLLC  RecName: Full=Phenylalanine ammonia-lyase...    267   3e-81    Solanum lycopersicum
sp|P24481.1|PAL1_PETCR  RecName: Full=Phenylalanine ammonia-lyase 1     267   3e-81    Petroselinum crispum
pdb|1W27|A  Chain A, Phenylalanine Ammonia-Lyase (Pal) From Petro...    267   3e-81    Petroselinum crispum
gb|AEZ01784.1|  phenylalanine ammonia-lyase                             267   4e-81    Pyrus x bretschneideri [bai li]
gb|ABV44808.1|  phenylalanine ammonia lyase 1                           256   4e-81    Eriobotrya japonica [loquat]
sp|O23924.1|PALY_DIGLA  RecName: Full=Phenylalanine ammonia-lyase       266   5e-81    Digitalis lanata [Grecian foxglove]
ref|XP_009373523.1|  PREDICTED: LOW QUALITY PROTEIN: phenylalanin...    267   5e-81    Pyrus x bretschneideri [bai li]
gb|ADF59061.1|  phenylalanine ammonia-lyase 1 precursor                 267   5e-81    Pyrus x bretschneideri [bai li]
ref|XP_007162755.1|  hypothetical protein PHAVU_001G1777000g            253   7e-81    Phaseolus vulgaris [French bean]
gb|AGL50914.1|  phenylalanine ammonia lyase                             266   7e-81    Pyrus communis
ref|XP_009342990.1|  PREDICTED: phenylalanine ammonia-lyase 1           266   7e-81    
gb|AGL81344.1|  phenylalanine ammonia lyase                             266   7e-81    Pyrus communis
ref|XP_008243955.1|  PREDICTED: phenylalanine ammonia-lyase 1           266   8e-81    Prunus mume [ume]
ref|XP_003633985.1|  PREDICTED: phenylalanine ammonia-lyase-like        266   1e-80    Vitis vinifera
gb|ABB70117.2|  phenylalanine ammonia lyase                             266   1e-80    Pyrus communis
gb|AEX32784.1|  phenylalanine ammonia-lyase                             266   1e-80    Vitis vinifera
ref|XP_003635657.2|  PREDICTED: phenylalanine ammonia-lyase-like        266   1e-80    Vitis vinifera
ref|XP_002531677.1|  Phenylalanine ammonia-lyase, putative              266   1e-80    Ricinus communis
gb|ABV71917.1|  PAL                                                     252   1e-80    Plectranthus scutellarioides
ref|XP_008355619.1|  PREDICTED: LOW QUALITY PROTEIN: phenylalanin...    266   1e-80    
ref|XP_006364022.1|  PREDICTED: phenylalanine ammonia-lyase-like        266   1e-80    Solanum tuberosum [potatoes]
pir||JQ1070  phenylalanine ammonia-lyase (EC 4.3.1.5) - soybean  ...    258   2e-80 
ref|XP_008369679.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      265   2e-80    
ref|XP_002267953.1|  PREDICTED: phenylalanine ammonia-lyase             265   2e-80    Vitis vinifera
gb|AHY94892.1|  phenylalanine ammonia lyase                             265   2e-80    Prunella vulgaris
dbj|BAF36969.1|  phenylalanine ammonia-lyase                            258   2e-80    Lotus japonicus
gb|AFN85669.1|  phenylalanine ammonia-lyase                             265   2e-80    Hibiscus cannabinus [bimli-jute]
dbj|BAF36970.1|  phenylalanine ammonia-lyase                            265   2e-80    Lotus japonicus
gb|AHZ31605.1|  phenylalanine ammonia-lyase                             265   2e-80    Olea europaea
gb|AAK84225.1|AF401636_1  phenylalanine ammonia-lyase                   265   3e-80    Rehmannia glutinosa [Chinese foxglove]
gb|AEX32790.1|  phenylalanine ammonia-lyase                             265   3e-80    Vitis vinifera
ref|XP_007009873.1|  Phenylalanine ammonia-lyase 2                      265   3e-80    
ref|XP_002281799.1|  PREDICTED: phenylalanine ammonia-lyase             265   3e-80    Vitis vinifera
ref|XP_007027354.1|  PHE ammonia lyase 1                                265   4e-80    Theobroma cacao [chocolate]
gb|ACF94715.1|  phenylalanine ammonia lyase                             254   5e-80    Robinia pseudoacacia [black locust]
ref|XP_004253518.1|  PREDICTED: phenylalanine ammonia-lyase-like        261   5e-80    
ref|XP_003633987.1|  PREDICTED: phenylalanine ammonia-lyase-like        264   5e-80    Vitis vinifera
gb|ABM67591.1|  phenylalanin ammonia-lyase                              264   5e-80    Vitis vinifera
dbj|BAD94354.1|  phenylalanine ammonia lyase                            254   5e-80    Arabidopsis thaliana [mouse-ear cress]
gb|AGA84059.1|  phenylalanine ammonia lyase                             264   5e-80    Picrorhiza kurrooa
gb|AFZ78651.1|  phenylalanine ammonia-lyase                             264   5e-80    Populus tomentosa [Chinese white poplar]
ref|XP_002312013.1|  phenylalanine ammonia-lyase family protein         264   6e-80    Populus trichocarpa [western balsam poplar]
ref|XP_003633986.1|  PREDICTED: phenylalanine ammonia-lyase-like        264   6e-80    Vitis vinifera
ref|XP_002268181.1|  PREDICTED: phenylalanine ammonia-lyase             264   7e-80    Vitis vinifera
ref|XP_006354337.1|  PREDICTED: phenylalanine ammonia-lyase-like ...    264   7e-80    Solanum tuberosum [potatoes]
gb|AEZ67457.1|  phenylalanine ammonia-lyase                             263   7e-80    Perilla frutescens [beefsteak-mint]
sp|P45728.1|PAL2_PETCR  RecName: Full=Phenylalanine ammonia-lyase 2     264   8e-80    Petroselinum crispum
ref|XP_011041027.1|  PREDICTED: phenylalanine ammonia-lyase G2B-l...    263   8e-80    Populus euphratica
ref|XP_010662075.1|  PREDICTED: phenylalanine ammonia-lyase             263   8e-80    Vitis vinifera
ref|XP_002268256.1|  PREDICTED: phenylalanine ammonia-lyase             263   8e-80    Vitis vinifera
ref|XP_010107519.1|  Phenylalanine ammonia-lyase                        259   8e-80    
ref|XP_011041025.1|  PREDICTED: phenylalanine ammonia-lyase G2B         263   9e-80    Populus euphratica
gb|AID16077.1|  phenylalanine ammonium lyase                            263   1e-79    Morus alba
gb|KJB36583.1|  hypothetical protein B456_006G166000                    263   1e-79    Gossypium raimondii
ref|XP_004234632.2|  PREDICTED: phenylalanine ammonia-lyase             263   1e-79    
ref|XP_007208432.1|  hypothetical protein PRUPE_ppa002099mg             263   1e-79    Prunus persica
emb|CDX74991.1|  BnaA05g07370D                                          254   2e-79    
emb|CAN61378.1|  hypothetical protein VITISV_032212                     262   2e-79    Vitis vinifera
emb|CDX91331.1|  BnaC04g08190D                                          254   2e-79    
sp|Q04593.1|PAL2_PEA  RecName: Full=Phenylalanine ammonia-lyase 2       263   2e-79    Pisum sativum [garden pea]
ref|XP_011041026.1|  PREDICTED: phenylalanine ammonia-lyase G2B-l...    263   2e-79    Populus euphratica
ref|XP_011077338.1|  PREDICTED: phenylalanine ammonia-lyase             262   2e-79    Sesamum indicum [beniseed]
gb|KHG18863.1|  Phenylalanine ammonia-lyase                             263   2e-79    Gossypium arboreum [tree cotton]
gb|KEH24019.1|  phenylalanine ammonia-lyase-like protein                263   2e-79    Medicago truncatula
gb|KEH24018.1|  phenylalanine ammonia-lyase-like protein                262   2e-79    Medicago truncatula
sp|P45732.1|PALY_STYHU  RecName: Full=Phenylalanine ammonia-lyase       262   2e-79    Stylosanthes humilis [alfafinha do nordeste]
gb|KHN17149.1|  Phenylalanine ammonia-lyase 2                           260   3e-79    Glycine soja [wild soybean]
gb|AFK47120.1|  unknown                                                 248   3e-79    Lotus japonicus
ref|XP_002268732.1|  PREDICTED: phenylalanine ammonia-lyase             262   3e-79    Vitis vinifera
emb|CAN77065.1|  hypothetical protein VITISV_009233                     262   3e-79    Vitis vinifera
gb|EYU38541.1|  hypothetical protein MIMGU_mgv1a001582mg                263   3e-79    Erythranthe guttata [common monkey flower]
gb|KHG26972.1|  Phenylalanine ammonia-lyase                             262   3e-79    Gossypium arboreum [tree cotton]
gb|AAK62030.1|  phenylalanine ammonia-lyase 1                           262   3e-79    Manihot esculenta [manioc]
gb|AAK60275.1|AF383152_1  phenylalanine ammonia-lyase 2                 262   3e-79    Manihot esculenta [manioc]
gb|ACC63889.1|  phenylalanine ammonia-lyase                             261   4e-79    Populus trichocarpa [western balsam poplar]
gb|AJR20994.1|  phenylalanine ammonia-lyase                             261   4e-79    Populus szechuanica
gb|AAN52279.1|AF480619_1  phenylalanine ammonia-lyase                   261   5e-79    Populus tremuloides
dbj|BAF36974.1|  phenylalanine ammonia-lyase                            261   5e-79    Lotus japonicus
gb|KJB46526.1|  hypothetical protein B456_007G373700                    260   5e-79    Gossypium raimondii
gb|AAF40224.1|AF237955_1  phenylalanine ammonia-lyase 2                 261   6e-79    Rubus idaeus [European raspberry]
dbj|BAF36968.1|  phenylalanine ammonia-lyase                            261   7e-79    Lotus japonicus
gb|KJB46525.1|  hypothetical protein B456_007G373600                    261   7e-79    Gossypium raimondii
gb|AFQ92048.1|  phenylalanine ammonia-lyase                             247   8e-79    Pyrus pyrifolia [sha li]
dbj|BAF36967.1|  phenylalanine ammonia-lyase                            261   8e-79    Lotus japonicus
dbj|BAA21643.1|  phenylalanine ammonia-lyase                            261   8e-79    Populus sieboldii x Populus grandidentata
gb|KJB62426.1|  hypothetical protein B456_009G416300                    261   8e-79    Gossypium raimondii
gb|KHN00850.1|  Phenylalanine ammonia-lyase 2                           259   9e-79    Glycine soja [wild soybean]
ref|XP_002322884.2|  phenylalanine ammonia-lyase family protein         261   9e-79    Populus trichocarpa [western balsam poplar]
gb|KDO50672.1|  hypothetical protein CISIN_1g037382mg                   257   9e-79    Citrus sinensis [apfelsine]
sp|P45730.1|PALY_POPTR  RecName: Full=Phenylalanine ammonia-lyase       261   1e-78    Populus trichocarpa [western balsam poplar]
ref|XP_010107516.1|  Phenylalanine ammonia-lyase 1                      256   1e-78    
gb|AAQ74878.1|  phenylalanine ammonia lyase                             260   1e-78    Populus trichocarpa x Populus deltoides
gb|ABD42947.1|  phenylalanine ammonia lyase                             260   1e-78    Acacia auriculiformis x Acacia mangium
ref|XP_006589419.1|  PREDICTED: phenylalanine ammonia-lyase 2-lik...    260   1e-78    Glycine max [soybeans]
ref|XP_006290660.1|  hypothetical protein CARUB_v10016752mg             260   1e-78    Capsella rubella
emb|CAB42793.1|  phenylalanine-ammonia lyase                            260   1e-78    Citrus clementina x Citrus reticulata
gb|ACV30588.1|  phenylalanine ammonia-lyase                             248   1e-78    Carica papaya [mamon]
ref|XP_006439143.1|  hypothetical protein CICLE_v10010874mg             249   1e-78    
ref|XP_006481493.1|  PREDICTED: phenylalanine ammonia-lyase-like        260   1e-78    Citrus sinensis [apfelsine]
gb|AEE81750.1|  phenylalanine ammonia lyase                             260   1e-78    Morus alba var. multicaulis
ref|NP_001266106.1|  phenylalanine ammonia-lyase 2                      260   2e-78    Cicer arietinum [garbanzo]
ref|XP_011048535.1|  PREDICTED: phenylalanine ammonia-lyase-like        260   2e-78    Populus euphratica
gb|KHN39030.1|  Phenylalanine ammonia-lyase class 2                     258   2e-78    Glycine soja [wild soybean]
emb|CAL91038.1|  phenylalanine ammonia-lyase 4                          250   2e-78    Cynara cardunculus var. scolymus [artichoke]
ref|NP_001236956.1|  phenylalanine ammonia-lyase 2                      260   2e-78    
gb|AFZ94859.1|  phenylalanine ammonia-lyase                             260   2e-78    Plectranthus scutellarioides
ref|XP_006381441.1|  phenylalanine ammonia-lyase family protein         259   2e-78    Populus trichocarpa [western balsam poplar]
ref|XP_002315308.1|  phenylalanine ammonia-lyase family protein         259   2e-78    Populus trichocarpa [western balsam poplar]
ref|XP_010426963.1|  PREDICTED: phenylalanine ammonia-lyase 2-like      259   2e-78    Camelina sativa [gold-of-pleasure]
prf||2001451A  Phe ammonia lyase                                        259   3e-78 
sp|Q01861.1|PAL1_PEA  RecName: Full=Phenylalanine ammonia-lyase 1       259   3e-78    Pisum sativum [garden pea]
ref|XP_002519521.1|  Phenylalanine ammonia-lyase, putative              259   3e-78    Ricinus communis
gb|AFZ78650.1|  phenylalanine ammonia-lyase                             259   3e-78    Populus tomentosa [Chinese white poplar]
gb|ACE95170.1|  phenylalanine ammonia-lyase                             259   3e-78    Populus tomentosa [Chinese white poplar]
gb|KHG29664.1|  Phenylalanine ammonia-lyase                             259   3e-78    Gossypium arboreum [tree cotton]
gb|AFZ78653.1|  phenylalanine ammonia-lyase                             259   3e-78    Populus tomentosa [Chinese white poplar]
gb|AJO53273.1|  phenylalanine ammonia-lyase                             259   3e-78    Pogostemon cablin
gb|AGF50182.1|  phenylalanine ammonia lyase                             247   4e-78    Salvia officinalis
sp|Q42667.1|PALY_CITLI  RecName: Full=Phenylalanine ammonia-lyase       259   4e-78    Citrus limon [lemon]
gb|ACM44926.1|  phenylalanine ammonia-lyase                             259   4e-78    Euphorbia pulcherrima
ref|XP_010107520.1|  Phenylalanine ammonia-lyase                        259   4e-78    Morus notabilis
gb|ADO64252.1|  PAL                                                     259   5e-78    Epimedium sagittatum
gb|ACS71953.1|  phenylalanine ammonia-lyase                             259   5e-78    Euphorbia pulcherrima
ref|XP_008449240.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      259   5e-78    Cucumis melo [Oriental melon]
ref|XP_006428758.1|  hypothetical protein CICLE_v10011134mg             259   5e-78    
ref|XP_003542541.1|  PREDICTED: phenylalanine ammonia-lyase class...    259   5e-78    
ref|XP_010515816.1|  PREDICTED: phenylalanine ammonia-lyase 2           259   6e-78    Camelina sativa [gold-of-pleasure]
ref|XP_004304440.1|  PREDICTED: phenylalanine ammonia-lyase 1           259   6e-78    Fragaria vesca subsp. vesca
gb|AIY26016.1|  PAL                                                     258   6e-78    Jasminum sambac [Arabian jasmine]
ref|XP_006436446.1|  hypothetical protein CICLE_v10030821mg             259   6e-78    Citrus clementina [clementine]
gb|AEW43005.1|  phenylalanine ammonia lyase                             249   6e-78    Leucaena leucocephala [cassie]
gb|KDO46246.1|  hypothetical protein CISIN_1g004955mg                   259   6e-78    Citrus sinensis [apfelsine]
ref|XP_003590471.1|  Phenylalanine ammonia-lyase                        258   7e-78    Medicago truncatula
sp|O49835.1|PAL1_LITER  RecName: Full=Phenylalanine ammonia-lyase...    258   8e-78    Lithospermum erythrorhizon
ref|XP_009606373.1|  PREDICTED: phenylalanine ammonia-lyase G4-like     258   9e-78    Nicotiana tomentosiformis
ref|XP_002315309.2|  hypothetical protein POPTR_0010s23110g             258   9e-78    
gb|AGE10589.1|  phenylalanine amononia-lyase                            258   1e-77    Lonicera japonica [Japanese honeysuckle]
sp|Q43052.1|PAL2_POPKI  RecName: Full=Phenylalanine ammonia-lyase...    258   1e-77    Populus sieboldii x Populus grandidentata
ref|XP_006403711.1|  hypothetical protein EUTSA_v10010153mg             258   1e-77    Eutrema salsugineum [saltwater cress]
ref|XP_010107518.1|  Phenylalanine ammonia-lyase                        259   1e-77    
sp|P45731.1|PAL1_POPKI  RecName: Full=Phenylalanine ammonia-lyase G1    257   1e-77    Populus sieboldii x Populus grandidentata
ref|XP_010684079.1|  PREDICTED: phenylalanine ammonia-lyase             258   1e-77    Beta vulgaris subsp. vulgaris [field beet]
gb|KHG30005.1|  Phenylalanine ammonia-lyase                             258   1e-77    Gossypium arboreum [tree cotton]
ref|XP_003556238.1|  PREDICTED: phenylalanine ammonia-lyase 2-like      258   1e-77    Glycine max [soybeans]
gb|ACR15762.1|  phenylalanine ammonia-lyase                             258   1e-77    Litchi chinensis [litchi]
gb|ADR78835.1|  phenylalanine ammonia lyase                             254   2e-77    Ziziphus jujuba [Chinese jujube]
emb|CDY18464.1|  BnaA04g21230D                                          250   2e-77    Brassica napus [oilseed rape]
ref|XP_006293761.1|  hypothetical protein CARUB_v10022721mg             258   2e-77    Capsella rubella
gb|KJB73539.1|  hypothetical protein B456_011G238400                    257   2e-77    Gossypium raimondii
ref|XP_010262867.1|  PREDICTED: phenylalanine ammonia-lyase             257   2e-77    Nelumbo nucifera [Indian lotus]
gb|KDO36715.1|  hypothetical protein CISIN_1g016039mg                   249   2e-77    Citrus sinensis [apfelsine]
gb|ABD73282.1|  phenylalanine ammonia-lyase                             257   2e-77    Salvia miltiorrhiza [Chinese salvia]
ref|XP_009794410.1|  PREDICTED: phenylalanine ammonia-lyase-like        257   2e-77    Nicotiana sylvestris
sp|P27990.1|PALY_MEDSA  RecName: Full=Phenylalanine ammonia-lyase       257   2e-77    Medicago sativa [alfalfa]
gb|AGY49231.1|  phenylalanine ammonia lyase                             257   3e-77    Ricinus communis
ref|XP_011010447.1|  PREDICTED: phenylalanine ammonia-lyase             257   3e-77    Populus euphratica
gb|KGN52971.1|  hypothetical protein Csa_4G008250                       244   3e-77    Cucumis sativus [cucumbers]
gb|AAC18870.1|  phenylalanine ammonia lyase                             257   3e-77    Arabidopsis thaliana [mouse-ear cress]
ref|NP_181241.1|  phenylalanine ammonia-lyase 1                         257   3e-77    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010658395.1|  PREDICTED: phenylalanine ammonia-lyase G1          257   3e-77    Vitis vinifera
ref|XP_002881488.1|  hypothetical protein ARALYDRAFT_482690             257   4e-77    
ref|XP_010504083.1|  PREDICTED: phenylalanine ammonia-lyase 2-like      256   4e-77    Camelina sativa [gold-of-pleasure]
gb|AFU82540.1|  phenylalanine ammonia-lyase                             240   4e-77    Artemisia tridentata [big sagebrush]
gb|ACM62741.1|  phenylalanine ammonia-lyase                             256   5e-77    Garcinia mangostana [mangosteen]
gb|ADF59062.1|  phenylalanine ammonia-lyase 2 precursor                 256   5e-77    Pyrus x bretschneideri [bai li]
gb|AFU90757.1|  phenylalanine ammonia-lyase                             256   5e-77    Epimedium sagittatum
gb|ADL09136.1|  phenylanlanine ammonia-lyase                            256   5e-77    Brassica oleracea var. botrytis [cauliflower]
gb|AJO53274.1|  phenylalanine ammonia-lyase                             256   5e-77    Pogostemon cablin
gb|AAX22055.1|  phenylalanine ammonia-lyase                             256   5e-77    Brassica napus [oilseed rape]
sp|Q40910.1|PAL4_POPKI  RecName: Full=Phenylalanine ammonia-lyase G4    253   6e-77    Populus sieboldii x Populus grandidentata
gb|ABI33979.1|  phenylalanine ammonia lyase                             256   6e-77    Jatropha curcas
gb|AHZ30594.1|  phenylalanine ammonia lyase-2                           256   6e-77    Prunus domestica
gb|ABC69916.1|  phenylalanine ammonia-lyase                             256   7e-77    Brassica napus [oilseed rape]
pir||S60043  phenylalanine ammonia-lyase (EC 4.3.1.5) 4 - Japanes...    253   7e-77 
ref|XP_009103852.1|  PREDICTED: phenylalanine ammonia-lyase 2-like      256   7e-77    Brassica rapa
ref|XP_010516949.1|  PREDICTED: phenylalanine ammonia-lyase 1           256   8e-77    Camelina sativa [gold-of-pleasure]
ref|XP_009141625.1|  PREDICTED: phenylalanine ammonia-lyase 1           256   8e-77    Brassica rapa
ref|XP_007144370.1|  hypothetical protein PHAVU_007G150500g             256   8e-77    Phaseolus vulgaris [French bean]
gb|ADN32768.1|  phenylalanine ammonia-lyase 2                           255   9e-77    Scutellaria baicalensis [Baikal skullcap]
dbj|BAH20339.1|  AT3G53260                                              253   9e-77    Arabidopsis thaliana [mouse-ear cress]
gb|ABE03772.1|  phenylalanine ammonia-lyase                             255   1e-76    Arnebia euchroma
gb|ABY89691.1|  phenylalanine ammonialyase 2 protein                    255   1e-76    Brassica rapa subsp. oleifera [biennial turnip rape]
gb|AEV53411.1|  phenylalanine ammonia-lyase 3                           255   1e-76    Populus tomentosa [Chinese white poplar]
gb|EYU34451.1|  hypothetical protein MIMGU_mgv1a002104mg                255   1e-76    Erythranthe guttata [common monkey flower]
ref|XP_004497516.1|  PREDICTED: phenylalanine ammonia-lyase-like        255   1e-76    Cicer arietinum [garbanzo]
ref|XP_007162756.1|  hypothetical protein PHAVU_001G177800g             255   1e-76    Phaseolus vulgaris [French bean]
pir||A24727  phenylalanine ammonia-lyase (EC 4.3.1.5) - kidney be...    250   1e-76 
gb|ABF50788.1|  phenylalanine ammonia-lyase                             255   2e-76    Isatis tinctoria [woad]
gb|AAY82485.1|  phenylalanine ammonia-lyase                             250   2e-76    Ulmus americana
sp|P07218.2|PAL1_PHAVU  RecName: Full=Phenylalanine ammonia-lyase...    250   2e-76    Phaseolus vulgaris [French bean]
gb|KHN02334.1|  Phenylalanine ammonia-lyase 1                           253   2e-76    Glycine soja [wild soybean]
ref|XP_008366650.1|  PREDICTED: phenylalanine ammonia-lyase 1           254   2e-76    Malus domestica [apple tree]
gb|ACZ36441.1|  phenylalanine ammonialyase                              254   2e-76    Brassica oleracea var. alboglabra [Chinese broccoli]
gb|AGW27206.1|  phenylalanine ammonia-lyase 3                           255   2e-76    Salvia miltiorrhiza [Chinese salvia]
dbj|BAO01110.1|  phenylalanine ammonia-lyase                            254   3e-76    Vigna radiata [mung bean]
ref|XP_010253912.1|  PREDICTED: phenylalanine ammonia-lyase             254   3e-76    Nelumbo nucifera [Indian lotus]
ref|XP_009143533.1|  PREDICTED: phenylalanine ammonia-lyase 1           254   3e-76    Brassica rapa
sp|P45734.1|PALY_TRISU  RecName: Full=Phenylalanine ammonia-lyase       254   4e-76    Trifolium subterraneum
prf||2006271A  Phe ammonia lyase                                        254   4e-76 
gb|AIB06732.1|  phenylalanine ammonia lyase                             253   4e-76    Mangifera indica
ref|XP_004143255.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      254   4e-76    Cucumis sativus [cucumbers]
sp|P19142.1|PAL2_PHAVU  RecName: Full=Phenylalanine ammonia-lyase...    253   5e-76    Phaseolus vulgaris [French bean]
gb|AIL23235.1|  phenylalanine ammonia-lyase                             254   5e-76    Astragalus chrysochlorus
gb|AAC18871.1|  phenylalanine ammonia lyase                             253   5e-76    Arabidopsis thaliana [mouse-ear cress]
gb|KHN09507.1|  Phenylalanine ammonia-lyase 1                           253   5e-76    
ref|NP_190894.1|  phenylalanine ammonia-lyase 2                         253   5e-76    
ref|XP_009116020.1|  PREDICTED: LOW QUALITY PROTEIN: phenylalanin...    253   5e-76    
ref|XP_003591877.1|  Phenylalanine ammonia-lyase                        253   5e-76    
gb|AAM12956.1|  phenylalanine ammonia-lyase                             253   6e-76    
ref|XP_004156289.1|  PREDICTED: phenylalanine ammonia-lyase-like        253   6e-76    
gb|AID69536.1|  phenylalanine ammonia-lyase                             249   6e-76    
ref|XP_004246652.1|  PREDICTED: phenylalanine ammonia-lyase-like ...    253   6e-76    
ref|XP_010325983.1|  PREDICTED: phenylalanine ammonia-lyase-like ...    253   6e-76    
ref|XP_006428759.1|  hypothetical protein CICLE_v10011175mg             253   6e-76    
ref|XP_003521397.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      253   6e-76    
gb|KDO50673.1|  hypothetical protein CISIN_1g005031mg                   253   6e-76    
gb|ADA81868.1|  phenylalanine ammonia-lyase                             253   6e-76    
gb|KGN48161.1|  hypothetical protein Csa_6G445740                       249   6e-76    
gb|AAX22053.1|  phenylalanine ammonia-lyase                             253   7e-76    
gb|AAK15640.1|AF326116_1  phenylalanine ammonia-lyase                   253   7e-76    
ref|XP_003554382.1|  PREDICTED: phenylalanine ammonia-lyase 1-lik...    253   7e-76    
ref|XP_006488063.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      253   7e-76    
gb|ABY89690.1|  phenylalanine ammonialyase 1 protein                    253   8e-76    
ref|XP_010509401.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      253   9e-76    
dbj|BAE71252.1|  putative phenylalanine ammonia lyase                   253   9e-76    
gb|ADY02660.1|  phenylalanine ammonia lyase                             252   1e-75    
ref|XP_006424540.1|  hypothetical protein CICLE_v10027912mg             253   1e-75    
ref|XP_009759945.1|  PREDICTED: phenylalanine ammonia-lyase G4-like     253   1e-75    
gb|KDP29132.1|  hypothetical protein JCGZ_16521                         253   1e-75    
gb|AGV54597.1|  phenylalanine ammonia-lyase                             253   1e-75    
ref|XP_010505261.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      253   1e-75    
ref|XP_010553331.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      253   1e-75    
ref|XP_002877909.1|  phenylalanine ammonia-lyase 2                      253   1e-75    
gb|KFK36594.1|  hypothetical protein AALP_AA4G144000                    253   1e-75    
emb|CAL91169.1|  phenylalanine ammonia-lyase 3                          253   1e-75    
gb|ACT53399.1|  phenylalanine ammonia-lyase 2                           253   1e-75    
gb|ACA30407.1|  phenylalanine ammonia-lyase                             252   2e-75    
ref|XP_006410883.1|  hypothetical protein EUTSA_v10016314mg             252   2e-75    
gb|KFK34576.1|  hypothetical protein AALP_AA5G163700                    252   2e-75    
gb|AAZ29733.1|  phenylalanine ammonia lyase                             252   2e-75    
gb|AID51446.1|  phenylalanine ammonia-lyase 3                           252   2e-75    
gb|AIA24411.1|  phenylalanine ammonia-lyase                             252   2e-75    
sp|P27991.1|PAL1_SOYBN  RecName: Full=Phenylalanine ammonia-lyase 1     251   3e-75    
sp|O49836.1|PAL2_LITER  RecName: Full=Phenylalanine ammonia-lyase...    251   3e-75    
gb|ABR14606.1|  phenylalanine ammonia-lyase                             251   3e-75    
gb|AAN32867.1|AF460204_1  phenylalanine ammonia-lyase 2                 249   3e-75    
ref|XP_008449239.1|  PREDICTED: phenylalanine ammonia-lyase-like        251   3e-75    
gb|AAZ29732.1|  phenylalanine ammonia lyase                             251   4e-75    
ref|XP_003521396.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      251   4e-75    
gb|ADY02661.1|  phenylalanine ammonia lyase                             250   4e-75    
gb|AGH13333.1|  phenylalanine ammonia-lyase                             251   4e-75    
dbj|BAJ17655.1|  phenylalanine ammonia lyase                            251   4e-75    
gb|KHG04887.1|  Phenylalanine ammonia-lyase                             251   5e-75    
gb|ABN79671.2|  phenylalanine ammonia-lyase                             251   5e-75    
gb|ABC69917.1|  phenylalanine ammonia-lyase                             251   5e-75    
gb|AAR31107.1|  phenylalanine ammonia-lyase                             251   5e-75    
gb|KJB16792.1|  hypothetical protein B456_002G248000                    251   5e-75    
ref|XP_006424538.1|  hypothetical protein CICLE_v10027913mg             251   5e-75    
emb|CAB42794.1|  phenylalanine-ammonia lyase                            251   6e-75    
dbj|BAF36976.1|  phenylalanine ammonia-lyase                            251   6e-75    
gb|AAX84839.1|  phenylalanine ammonia-lyase                             251   7e-75    
gb|AAM28276.1|  phenylalanine ammonia-lyase                             239   8e-75    
gb|AER12109.1|  PAL                                                     250   8e-75    
gb|AAZ29734.1|  phenylalanine ammonia lyase                             250   9e-75    
gb|ACT32033.1|  phenylalanine ammonia-lyase                             250   9e-75    
gb|ABV44807.1|  phenylalanine ammonia lyase 2                           240   9e-75    
ref|XP_007143727.1|  hypothetical protein PHAVU_007G096300g             250   1e-74    
gb|KGN52973.1|  hypothetical protein Csa_4G008760                       243   1e-74    
gb|AAY82486.1|  phenylalanine ammonia-lyase                             248   1e-74    
gb|AAZ29735.1|  phenylalanine ammonia lyase                             250   1e-74    
ref|XP_007220629.1|  hypothetical protein PRUPE_ppa002328mg             248   1e-74    
ref|XP_011077265.1|  PREDICTED: LOW QUALITY PROTEIN: phenylalanin...    250   1e-74    
gb|ADD12041.1|  phenylalanine ammonia lyase                             249   1e-74    
ref|XP_009596642.1|  PREDICTED: phenylalanine ammonia-lyase G4-like     250   1e-74    
gb|AID51445.1|  phenylalanine ammonia-lyase 2                           249   1e-74    
gb|ADD82537.1|  phenylalanine ammonia-lyase                             247   1e-74    
ref|XP_008449238.1|  PREDICTED: phenylalanine ammonia-lyase             249   2e-74    
ref|XP_004156293.1|  PREDICTED: LOW QUALITY PROTEIN: phenylalanin...    249   2e-74    
ref|XP_004143256.1|  PREDICTED: phenylalanine ammonia-lyase-like        249   2e-74    
ref|XP_010935894.1|  PREDICTED: phenylalanine ammonia-lyase             249   2e-74    
ref|XP_007220630.1|  hypothetical protein PRUPE_ppa002328mg             248   3e-74    
gb|ADY02662.1|  phenylalanine ammonia lyase                             248   3e-74    
gb|AEL21616.1|  phenylalanine ammonia lyase 1                           249   3e-74    
gb|ABQ63094.1|  phenylalanine ammonia-lyase                             249   3e-74    
dbj|BAM28965.1|  phenylalanine ammonia lyase                            238   3e-74    
gb|AFP49806.1|  phenylalanine ammonialyase 1                            249   3e-74    
gb|AFG26322.1|  phenylalanine ammonia-lyase                             248   3e-74    
gb|AAN32866.1|AF460203_1  phenylalanine ammonia-lyase 1                 249   4e-74    
gb|AFP86474.1|  phenylalanine ammonia-lyase                             249   4e-74    
gb|AAD45384.1|  phenylalanine ammonia-lyase                             247   4e-74    
ref|XP_008233304.1|  PREDICTED: phenylalanine ammonia-lyase 1           248   6e-74    
gb|AEH02821.1|  phenylalanine ammonia lyase                             248   6e-74    
gb|AEJ88223.1|  phenylalanine ammonia lyase                             248   7e-74    
gb|AIZ76770.1|  PAL2                                                    239   9e-74    
gb|AAL55242.1|AF299330_1  phenylalanine ammonia-lyase                   247   9e-74    
gb|AIZ76768.1|  PAL2                                                    239   1e-73    
ref|XP_008449237.1|  PREDICTED: phenylalanine ammonia-lyase-like        247   1e-73    
gb|AGU91428.1|  phenylalanine ammonia-lyase                             247   1e-73    
sp|P45727.1|PALY_PERAE  RecName: Full=Phenylalanine ammonia-lyase       244   2e-73    
ref|XP_010528074.1|  PREDICTED: phenylalanine ammonia-lyase 1           247   2e-73    
ref|XP_004143356.1|  PREDICTED: phenylalanine ammonia-lyase-like        246   2e-73    
gb|KGN48164.1|  hypothetical protein Csa_6G445770                       246   3e-73    
ref|XP_008454138.1|  PREDICTED: phenylalanine ammonia-lyase-like        246   3e-73    
gb|KGN48165.1|  hypothetical protein Csa_6G445780                       238   3e-73    
gb|AFJ80777.1|  phenylalanine ammonia-lyase                             246   4e-73    
ref|XP_004167356.1|  PREDICTED: LOW QUALITY PROTEIN: phenylalanin...    245   4e-73    
gb|KGN48162.1|  hypothetical protein Csa_6G445750                       246   4e-73    
ref|XP_007016787.1|  PHE ammonia lyase 1                                246   4e-73    
ref|XP_004143257.1|  PREDICTED: phenylalanine ammonia-lyase-like        246   5e-73    
emb|CAL91037.1|  phenylalanine ammonia-lyase 1                          245   6e-73    
ref|XP_008805217.1|  PREDICTED: phenylalanine ammonia-lyase             245   7e-73    
gb|AGE10605.1|  phenylalanine amononia-lyase                            234   7e-73    
ref|XP_004152158.1|  PREDICTED: phenylalanine ammonia-lyase-like        244   1e-72    
gb|KDP44384.1|  hypothetical protein JCGZ_20064                         244   1e-72    
ref|XP_002285277.1|  PREDICTED: phenylalanine ammonia-lyase             244   1e-72    
gb|AEM63671.1|  phenylalanine ammonia lyase 2                           244   1e-72    
gb|ADC34597.1|  phenylalanine ammonia-lyase                             244   2e-72    
gb|AIZ76769.1|  PAL2                                                    239   2e-72    
gb|EPS61109.1|  phenylalanine ammonia-lyase                             243   2e-72    
gb|AAW78932.1|  phenylalanine-ammonia lyase                             244   2e-72    
ref|XP_002529414.1|  Phenylalanine ammonia-lyase, putative              244   2e-72    
gb|ADQ28104.1|  phenylalanine ammonia-lyase                             244   3e-72    
gb|ACT21093.1|  phenylalanine ammonia-lyase                             243   3e-72    
gb|ACM61988.1|  phenylalanine ammonia-lyase                             243   3e-72    
gb|AIZ76767.1|  PAL2                                                    239   6e-72    
ref|XP_010067318.1|  PREDICTED: phenylalanine ammonia-lyase             243   6e-72    
gb|AEC11891.1|  PAL1                                                    242   8e-72    
gb|AAV98199.1|  phenylalanine ammonialyase 1                            242   8e-72    
gb|AFI71896.1|  phenylalanine ammonia-lyase                             242   8e-72    
ref|XP_008454139.1|  PREDICTED: phenylalanine ammonia-lyase-like        242   9e-72    
ref|XP_008449236.1|  PREDICTED: phenylalanine ammonia-lyase-like        242   9e-72    
ref|XP_010529727.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      242   1e-71    
dbj|BAG70992.1|  phenylalanine ammonia-lyase                            242   1e-71    
gb|AGE10591.1|  phenylalanine amononia-lyase                            241   1e-71    
gb|AAR19393.1|  phenylalanine ammonia-lyase                             241   1e-71    
ref|XP_009392118.1|  PREDICTED: phenylalanine ammonia-lyase-like        241   2e-71    
gb|AHA42443.1|  phenylalanine ammonia lyase                             241   2e-71    
ref|XP_010906526.1|  PREDICTED: phenylalanine ammonia-lyase-like        241   2e-71    
gb|ACT68010.1|  phenylalanine ammonia-lyase                             241   2e-71    
dbj|BAM28963.1|  phenylalanine ammonia lyase                            241   3e-71    
dbj|BAM05604.1|  phenylalanine ammonia lyase                            233   3e-71    
ref|XP_009399473.1|  PREDICTED: phenylalanine ammonia-lyase             241   3e-71    
gb|AHG06397.1|  phenylalanine ammonia lyase 62                          241   3e-71    
gb|ACG56648.1|  phenylalanine ammonia lyase                             240   4e-71    
ref|XP_008454137.1|  PREDICTED: phenylalanine ammonia-lyase-like        240   5e-71    
ref|XP_010031967.1|  PREDICTED: phenylalanine ammonia-lyase-like        240   5e-71    
gb|AGC23439.1|  phenylalanine ammonia-lyase                             240   5e-71    
ref|XP_010067316.1|  PREDICTED: phenylalanine ammonia-lyase             240   7e-71    
dbj|BAM28966.1|  phenylalanine ammonia lyase                            239   8e-71    
gb|ADP09383.1|  phenylalanine ammonia lyase                             223   8e-71    
emb|CAA68064.1|  phenylalanine ammonia-lyase                            230   1e-70    
ref|XP_004152155.1|  PREDICTED: phenylalanine ammonia-lyase-like        239   1e-70    
dbj|BAM28964.1|  phenylalanine ammonia lyase                            239   1e-70    
gb|ACG56647.1|  phenylalanine ammonia lyase                             239   1e-70    
sp|Q9M568.1|PAL1_RUBID  RecName: Full=Phenylalanine ammonia-lyase...    239   1e-70    
gb|EMS57329.1|  Phenylalanine ammonia-lyase                             232   1e-70    
gb|AAP34199.1|  phenylalanine ammonia-lyase                             239   2e-70    
ref|XP_004143259.1|  PREDICTED: phenylalanine ammonia-lyase-like        239   2e-70    
ref|XP_010032174.1|  PREDICTED: phenylalanine ammonia-lyase-like        239   2e-70    
dbj|BAF93189.1|  putative phenylalanine ammonia-lyase                   234   2e-70    
gb|ACZ51372.1|  phenylalanine ammonia-lyase                             238   2e-70    
ref|XP_004143258.1|  PREDICTED: phenylalanine ammonia-lyase-like        238   2e-70    
gb|AEO92029.1|  phenylalanine ammonia-lyase 3                           238   2e-70    
gb|AFP49807.1|  phenylalanine ammonialyase 4                            238   2e-70    
gb|ACG80829.1|  phenylalanine ammonia lyase                             236   3e-70    
gb|AAD47085.1|AF167487_1  phenylalanine ammonia lyase                   230   4e-70    
sp|Q42609.1|PALY_BROFI  RecName: Full=Phenylalanine ammonia-lyase       237   5e-70    
ref|XP_008785254.1|  PREDICTED: phenylalanine ammonia-lyase-like        237   7e-70    
dbj|BAJ85028.1|  predicted protein                                      235   9e-70    
gb|AAO13347.1|  phenylalanine ammonia-lyase2                            236   1e-69    
gb|ADQ39192.1|  phenylalanine ammonia lyase 6                           236   1e-69    
dbj|BAM28967.1|  phenylalanine ammonia lyase                            236   1e-69    
ref|XP_004173358.1|  PREDICTED: phenylalanine ammonia-lyase-like        234   1e-69    
gb|EMS57330.1|  Phenylalanine ammonia-lyase                             228   2e-69    
dbj|BAL49995.1|  phenylalanine ammonia-lyase                            236   2e-69    
gb|ACG80828.1|  phenylalanine ammonia lyase                             233   2e-69    
gb|AIC66437.1|  phenylalanine ammonia lyase                             236   2e-69    
ref|XP_004307376.1|  PREDICTED: phenylalanine ammonia-lyase 1           236   2e-69    
dbj|BAB19128.1|  phenylalanine ammonia-lyase                            234   3e-69    
ref|NP_001053326.1|  Os04g0518400                                       235   5e-69    
ref|XP_010067317.1|  PREDICTED: phenylalanine ammonia-lyase-like        234   7e-69    
gb|AGE10617.1|  phenylalanine amononia-lyase                            232   7e-69    
emb|CAA89005.1|  phenylalanine ammonia-lyase                            229   7e-69    
ref|XP_008463969.1|  PREDICTED: phenylalanine ammonia-lyase-like        234   8e-69    
gb|ADB97626.1|  phenylalanine ammonia-lyase                             234   8e-69    
gb|EMS63272.1|  Phenylalanine ammonia-lyase                             233   8e-69    
ref|XP_009146849.1|  PREDICTED: phenylalanine ammonia-lyase 4           234   8e-69    
ref|XP_006652523.1|  PREDICTED: phenylalanine ammonia-lyase-like        234   9e-69    
gb|EMT29668.1|  Phenylalanine ammonia-lyase                             233   9e-69    
ref|XP_006407581.1|  hypothetical protein EUTSA_v10020168mg             234   1e-68    
ref|XP_002882662.1|  hypothetical protein ARALYDRAFT_897210             234   1e-68    
gb|AJO53272.1|  phenylalanine ammonia-lyase                             234   1e-68    
gb|EMT29669.1|  Phenylalanine ammonia-lyase                             232   1e-68    
ref|XP_006407580.1|  hypothetical protein EUTSA_v10020168mg             234   1e-68    
emb|CDY08611.1|  BnaA05g28470D                                          234   1e-68    
ref|XP_004145752.1|  PREDICTED: phenylalanine ammonia-lyase-like        234   1e-68    
dbj|BAJ88975.1|  predicted protein                                      234   1e-68    
gb|ADA72014.1|  phenylalanine ammonia-lyase                             234   1e-68    
emb|CAJ43711.1|  phenylalanine ammonia lyase                            217   2e-68    
ref|XP_004149916.1|  PREDICTED: phenylalanine ammonia-lyase-like        233   2e-68    
ref|XP_009401948.1|  PREDICTED: phenylalanine ammonia-lyase-like        233   2e-68    
ref|XP_003580144.1|  PREDICTED: phenylalanine ammonia-lyase             233   3e-68    
ref|XP_009413725.1|  PREDICTED: phenylalanine ammonia-lyase-like        233   3e-68    
ref|XP_004239660.1|  PREDICTED: phenylalanine ammonia-lyase-like        233   3e-68    
gb|ADA72013.1|  phenylalanine ammonia-lyase                             233   3e-68    
emb|CAA53733.1|  phenylanaline ammonia-lyase                            231   4e-68    
gb|ADN32766.1|  phenylalanine ammonia-lyase                             232   5e-68    
sp|Q43210.1|PALY_WHEAT  RecName: Full=Phenylalanine ammonia-lyase       232   5e-68    
gb|AGE10590.1|  phenylalanine amononia-lyase                            232   5e-68    
ref|XP_010482945.1|  PREDICTED: phenylalanine ammonia-lyase 4-like      232   6e-68    
ref|XP_002448194.1|  hypothetical protein SORBIDRAFT_06g022750          231   6e-68    
gb|ACZ44834.1|  phenylalanine ammonia-lyase                             232   6e-68    
ref|XP_006647543.1|  PREDICTED: phenylalanine ammonia-lyase-like        231   8e-68    
emb|CDY00922.1|  BnaC05g42780D                                          231   8e-68    
dbj|BAJ85603.1|  predicted protein                                      231   9e-68    
gb|AAW51923.2|  phenylalanine ammonia-lyase 2                           231   9e-68    
gb|ADT63058.1|  phenylalanine ammonia-lyase                             231   1e-67    
gb|AFS28702.1|  putative phenylalanine ammonia-lyase                    227   1e-67    
gb|EMT28133.1|  Phenylalanine ammonia-lyase                             230   1e-67    
ref|XP_010934327.1|  PREDICTED: phenylalanine ammonia-lyase-like        230   2e-67    
ref|XP_010106884.1|  Phenylalanine ammonia-lyase                        228   2e-67    
gb|EMT28134.1|  Phenylalanine ammonia-lyase                             230   3e-67    
gb|AEM63670.1|  phenylalanine ammonia lyase 1                           230   3e-67    
gb|AGZ95690.1|  phenylalanine ammonia-lyase                             230   3e-67    
gb|AAS48415.1|  phenylalanine lyase                                     230   3e-67    



>gb|AHJ60264.1| phenylalanine ammonia-lyase 1 [Ipomoea purpurea]
Length=707

 Score =   320 bits (819),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 150/152 (99%), Positives = 151/152 (99%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLLRVVDREYVFAYADDPCS NYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED
Sbjct  556  DLLRVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  615

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTE+LTGEKVQSPGEV
Sbjct  616  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEMLTGEKVQSPGEV  675

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
            CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC
Sbjct  676  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  707



>sp|Q42858.1|PAL2_IPOBA RecName: Full=Phenylalanine ammonia-lyase [Ipomoea batatas]
 dbj|BAA11459.1| phenylalanine ammonia-lyase [Ipomoea batatas]
Length=708

 Score =   313 bits (801),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 145/152 (95%), Positives = 151/152 (99%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLLRVVDREYVFAYADDPCSANYPL QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED
Sbjct  557  DLLRVVDREYVFAYADDPCSANYPLFQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  616

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELKA+LPKEVEGARSA+ENGNPAIPNRITECRSYPLYKF+REELGTE+LTGEKV+SPGEV
Sbjct  617  ELKAVLPKEVEGARSAIENGNPAIPNRITECRSYPLYKFVREELGTEMLTGEKVKSPGEV  676

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
            CDKVFTAVCDGGIIDPLLECLKSW+GAPLPIC
Sbjct  677  CDKVFTAVCDGGIIDPLLECLKSWDGAPLPIC  708



>ref|XP_009629066.1| PREDICTED: phenylalanine ammonia-lyase [Nicotiana tomentosiformis]
 sp|P25872.1|PAL1_TOBAC RecName: Full=Phenylalanine ammonia-lyase [Nicotiana tabacum]
 gb|AAA34122.1| phenylalanine ammonia lyase [Nicotiana tabacum]
 dbj|BAA22948.1| phenylalanine ammonia-lyase [Nicotiana tabacum]
Length=715

 Score =   285 bits (728),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 128/152 (84%), Positives = 145/152 (95%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            +LLR+VDREY+FAYADDPCS NYPLMQKLRQVLVDHA+ NGE EKNV++SIFQKI AFED
Sbjct  564  ELLRIVDREYLFAYADDPCSCNYPLMQKLRQVLVDHAMNNGESEKNVNSSIFQKIGAFED  623

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELKA+LPKEVE AR+ALE+GNPAIPNRITECRSYPLY+F+R+ELGTE+LTGEKV+SPGE 
Sbjct  624  ELKAVLPKEVESARAALESGNPAIPNRITECRSYPLYRFVRKELGTELLTGEKVRSPGEE  683

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
            CDKVFTA+C+G IIDP+LECLKSWNGAPLPIC
Sbjct  684  CDKVFTAMCNGQIIDPMLECLKSWNGAPLPIC  715



>dbj|BAF98437.1| phenylalanine ammonia-lyase [Glehnia littoralis]
Length=267

 Score =   271 bits (693),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 127/151 (84%), Positives = 137/151 (91%), Gaps = 0/151 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLLRVVDREY+FAY DDPCSA YPLMQKLRQVLV+HAL+NGE EKN+STSIFQKIAAFED
Sbjct  116  DLLRVVDREYIFAYIDDPCSATYPLMQKLRQVLVEHALKNGETEKNLSTSIFQKIAAFED  175

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELK LLPKEVE AR+ LE+GNPA+PNRI ECRSYPLYKFIREELGT  LTGEKV SPGE 
Sbjct  176  ELKTLLPKEVESARAVLESGNPAVPNRIKECRSYPLYKFIREELGTVYLTGEKVTSPGEE  235

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPI  164
             DKVFTA+C G IIDPL+ECL+SWNGAPLPI
Sbjct  236  FDKVFTAMCKGQIIDPLMECLQSWNGAPLPI  266



>dbj|BAF98438.1| phenylalanine ammonia-lyase [Glehnia littoralis]
Length=267

 Score =   271 bits (692),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 127/152 (84%), Positives = 139/152 (91%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLLRVVDREY+FAY DDPCSA YPLMQKLR+ LV+HAL NG+ E+N+STSIFQKIAAFED
Sbjct  116  DLLRVVDREYIFAYIDDPCSATYPLMQKLRETLVEHALNNGDKERNLSTSIFQKIAAFED  175

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELKALLPKEVE AR+ALE+GNPAIPNRI ECRSYPLYKF+REELGTE LTGEKV+SPGE 
Sbjct  176  ELKALLPKEVESARAALESGNPAIPNRIKECRSYPLYKFVREELGTEYLTGEKVRSPGEE  235

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
             DKVFTA+  G IIDPLLECL+SWNGAPLPIC
Sbjct  236  FDKVFTAMSRGEIIDPLLECLESWNGAPLPIC  267



>sp|P14166.1|PAL1_IPOBA RecName: Full=Phenylalanine ammonia-lyase [Ipomoea batatas]
 gb|AAA33389.1| phenylalanine ammonia-lyase [Ipomoea batatas]
Length=707

 Score =   283 bits (725),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 131/152 (86%), Positives = 142/152 (93%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLLRVVDREYVFAYADDPCSANYPLMQKLRQ LVDHALQNGE+EKN  TSIF K+AAFED
Sbjct  556  DLLRVVDREYVFAYADDPCSANYPLMQKLRQALVDHALQNGENEKNTGTSIFLKVAAFED  615

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELKA+LPKEVE AR A+E+GNPAIPNRI ECRSYPLYKF+RE LGTE+LTGEKV+SPGE 
Sbjct  616  ELKAVLPKEVEAARIAVESGNPAIPNRIKECRSYPLYKFVREGLGTELLTGEKVRSPGEE  675

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
            CDKVFTA+C+G IIDPLLECLKSW+GAPLPIC
Sbjct  676  CDKVFTAMCEGSIIDPLLECLKSWDGAPLPIC  707



>gb|AAG49585.1|AF325496_1 phenylalanine ammonia-lyase [Ipomoea nil]
Length=711

 Score =   283 bits (724),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 131/152 (86%), Positives = 141/152 (93%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLLRVVDREYVFAYADDPCSANYPLMQKLRQ LVDHALQNGE EKN  TSIF K+AAFED
Sbjct  560  DLLRVVDREYVFAYADDPCSANYPLMQKLRQALVDHALQNGESEKNTGTSIFLKVAAFED  619

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELKA+LPKEVE AR A+E+GNPAIPNRI ECRSYPLYKF+RE LGTE+LTGEKV+SPGE 
Sbjct  620  ELKAVLPKEVEAARIAVESGNPAIPNRIKECRSYPLYKFVREGLGTELLTGEKVRSPGEE  679

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
            CDKVFTA+C+G IIDPLLECLKSW+GAPLPIC
Sbjct  680  CDKVFTAMCEGSIIDPLLECLKSWDGAPLPIC  711



>gb|ABG75911.1| phenylalanine ammonia-lyase 2 [Nicotiana attenuata]
Length=717

 Score =   282 bits (721),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 127/152 (84%), Positives = 145/152 (95%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            +LLRVVDREY+FAYADDPCS NYPLMQKLRQVLVDHA++NGE EKNV++SIFQKI AFED
Sbjct  566  ELLRVVDREYLFAYADDPCSCNYPLMQKLRQVLVDHAMKNGESEKNVNSSIFQKIGAFED  625

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELKA+LPKEVE AR+ALE+GNPAI NRITECRSYPLY+F+R+ELGTE+LTGE+V+SPGE 
Sbjct  626  ELKAVLPKEVENARAALESGNPAIANRITECRSYPLYRFVRKELGTELLTGERVRSPGEE  685

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
            CDKVFTA+C+G IIDP+LECLKSWNGAPLPIC
Sbjct  686  CDKVFTAMCNGQIIDPMLECLKSWNGAPLPIC  717



>gb|AIB08913.1| phenylalanine ammonia-lyase, partial [Angelica sinensis]
Length=233

 Score =   266 bits (681),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 125/151 (83%), Positives = 137/151 (91%), Gaps = 0/151 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLLRVVDREY+FAY DDPCSA YPLMQKLR+ LV+HAL NG+ E+N+STSIFQKIAAFED
Sbjct  83   DLLRVVDREYIFAYIDDPCSATYPLMQKLRETLVEHALNNGDKERNLSTSIFQKIAAFED  142

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELK LLPKEVE AR+ALE+GNPAIPNRI ECRSYPLYKF+REELGTE LTGEKV+SPGE 
Sbjct  143  ELKTLLPKEVESARAALESGNPAIPNRIKECRSYPLYKFVREELGTEYLTGEKVRSPGEE  202

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPI  164
             DKVFTA+  G IIDPLLECL+SWNGAPLPI
Sbjct  203  FDKVFTAMSKGEIIDPLLECLESWNGAPLPI  233



>dbj|BAF98439.1| phenylalanine ammonia-lyase [Glehnia littoralis]
Length=267

 Score =   266 bits (679),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 124/152 (82%), Positives = 137/152 (90%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLLRVVDREY+FAY DDPCSA YPLMQKLRQ LV+HAL NG++E+N+STSIFQKIA FED
Sbjct  116  DLLRVVDREYIFAYIDDPCSATYPLMQKLRQTLVEHALTNGDNERNLSTSIFQKIATFED  175

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELKALLPKEVE AR+ALE+GNPAIPNRI ECRSYPLYKF+REEL T+ LTGEKV+SPGE 
Sbjct  176  ELKALLPKEVESARAALESGNPAIPNRIEECRSYPLYKFVREELATDYLTGEKVRSPGEE  235

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
             DKVFTA+  G IIDPLL CL+SWNGAPLPIC
Sbjct  236  FDKVFTAMSKGEIIDPLLACLESWNGAPLPIC  267



>gb|AAC33966.1| phenylalanine ammonia-lyase [Capsicum chinense]
Length=532

 Score =   274 bits (700),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 125/152 (82%), Positives = 142/152 (93%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            +LLRVVDREY+FAYADDPCS+ YPLMQKLRQVLVDHAL NGE EKNV++SIFQKIAAFED
Sbjct  381  ELLRVVDREYLFAYADDPCSSTYPLMQKLRQVLVDHALNNGESEKNVNSSIFQKIAAFED  440

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELKA+LPKEVE AR  LE+GNP+IPNRITECRSYPLY+ +R+ELGTE+LTGE+V+SPGE 
Sbjct  441  ELKAVLPKEVESARITLESGNPSIPNRITECRSYPLYRLVRKELGTELLTGERVRSPGEE  500

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
             DKVFTA+C+G +IDPLLECLKSWNGAPLPIC
Sbjct  501  IDKVFTAMCNGQVIDPLLECLKSWNGAPLPIC  532



>ref|XP_009766905.1| PREDICTED: phenylalanine ammonia-lyase [Nicotiana sylvestris]
 gb|ACJ66297.1| phenylalanine ammonia-lyase 4 [Nicotiana tabacum]
 gb|ACJ66298.1| phenylalanine ammonia-lyase 4 [Nicotiana tabacum]
Length=717

 Score =   278 bits (710),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 126/152 (83%), Positives = 143/152 (94%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            +LLRVVDREY+FAYADDPCS NYPLMQKLRQVLVDHA+ NGE EKNV++SIFQKI AFED
Sbjct  566  ELLRVVDREYLFAYADDPCSCNYPLMQKLRQVLVDHAMNNGESEKNVNSSIFQKIGAFED  625

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELKA+LPKEVE AR+ALE GNPAI NRITECRSYPLY+F+R+ELGTE+LTGE+V+SPGE 
Sbjct  626  ELKAVLPKEVESARAALECGNPAIANRITECRSYPLYRFVRKELGTELLTGERVRSPGEE  685

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
            C+KVFTA+C+G IIDP+LECLKSWNGAPLPIC
Sbjct  686  CEKVFTAMCNGQIIDPMLECLKSWNGAPLPIC  717



>gb|ABG75910.1| phenylalanine ammonia-lyase 1 [Nicotiana attenuata]
Length=712

 Score =   277 bits (709),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 129/152 (85%), Positives = 140/152 (92%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLLRVVDREYVFAYADD CSANYPLMQKLRQVLVDHALQNGE+EKN ++SIFQKI AFED
Sbjct  561  DLLRVVDREYVFAYADDACSANYPLMQKLRQVLVDHALQNGENEKNANSSIFQKILAFED  620

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELKA+LPKEVE AR ALE+GNPAI NRI ECRSYPLY+F+REELG E+LTGEKV+SPGE 
Sbjct  621  ELKAVLPKEVESARIALESGNPAIANRIKECRSYPLYRFVREELGAELLTGEKVRSPGEE  680

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
            CDKVFTA+C+G IID LLECLK WNGAPLPIC
Sbjct  681  CDKVFTAMCNGQIIDSLLECLKEWNGAPLPIC  712



>sp|P35512.1|PALY_MALDO RecName: Full=Phenylalanine ammonia-lyase, partial [Malus domestica]
 emb|CAA48231.1| phenylalanine ammonia-lyase [Malus sp.]
Length=235

 Score =   263 bits (672),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 122/152 (80%), Positives = 134/152 (88%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLL+VVDREYVFAY DDPCSA YPLMQKLR+VL++HAL NGE EKN STSIFQKI AFE+
Sbjct  84   DLLKVVDREYVFAYIDDPCSATYPLMQKLREVLIEHALTNGESEKNASTSIFQKIGAFEE  143

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELKALLPKEVE ARSA+E GN A+PNRI ECRSYPLYKF+REELG E LTGEKV+SPGE 
Sbjct  144  ELKALLPKEVESARSAIEGGNAAVPNRIAECRSYPLYKFVREELGGEYLTGEKVRSPGEE  203

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
            CDKVF A+C G IIDP+L CL+ WNGAPLPIC
Sbjct  204  CDKVFQAICQGKIIDPILGCLEGWNGAPLPIC  235



>ref|XP_004246650.1| PREDICTED: phenylalanine ammonia-lyase-like [Solanum lycopersicum]
Length=721

 Score =   277 bits (708),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 125/152 (82%), Positives = 143/152 (94%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            +LLRVVDREYVFAYADDPCS+ YPLMQKLRQVLVDHA++NGE EKNV++SIFQKI AFED
Sbjct  570  ELLRVVDREYVFAYADDPCSSTYPLMQKLRQVLVDHAMKNGESEKNVNSSIFQKIVAFED  629

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELKA+LPKEVE AR+ +E+GNPAIPNRITECRSYPLY+ +R+ELG+E+LTGEKV+SPGE 
Sbjct  630  ELKAVLPKEVESARAVVESGNPAIPNRITECRSYPLYRLVRQELGSELLTGEKVRSPGEE  689

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
             DKVFTA+C+G IIDPLLECLKSWNGAPLPIC
Sbjct  690  IDKVFTAMCNGQIIDPLLECLKSWNGAPLPIC  721



>ref|XP_006367534.1| PREDICTED: phenylalanine ammonia-lyase 1-like, partial [Solanum 
tuberosum]
Length=441

 Score =   270 bits (689),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 121/152 (80%), Positives = 141/152 (93%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            +LLRVVDREY+F YADDPCS+ YPLMQKLRQVLVDHA++NGE EKN+++SIFQKI AFED
Sbjct  290  ELLRVVDREYLFTYADDPCSSTYPLMQKLRQVLVDHAMKNGESEKNINSSIFQKIGAFED  349

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            EL A+LPKEVE AR+ LE+GNP+IPNRITECRSYPLY+ +R+ELGTE+LTGEKV+SPGE 
Sbjct  350  ELNAVLPKEVESARALLESGNPSIPNRITECRSYPLYRLVRQELGTELLTGEKVRSPGEE  409

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
             +KVFTA+C+G IIDPLLECLKSWNGAPLPIC
Sbjct  410  IEKVFTAMCNGQIIDPLLECLKSWNGAPLPIC  441



>emb|CDP06747.1| unnamed protein product [Coffea canephora]
Length=557

 Score =   273 bits (697),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 126/152 (83%), Positives = 139/152 (91%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLLRVVDREY FAY DDPCSA YPLMQKLRQVLVDHAL+NG+ EKNV+TSIFQKIAAFED
Sbjct  406  DLLRVVDREYAFAYVDDPCSATYPLMQKLRQVLVDHALKNGDQEKNVNTSIFQKIAAFED  465

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELKA+LPKEVE ARSA+E+GNPAIPNRI ECRSYPLYKF+RE LGTE+L+GEK QSPGEV
Sbjct  466  ELKAVLPKEVESARSAVESGNPAIPNRIRECRSYPLYKFVREVLGTELLSGEKAQSPGEV  525

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
             D+VFTA+  G I+DPLLECL+ WNGAPLPIC
Sbjct  526  FDQVFTAMSKGQIVDPLLECLQEWNGAPLPIC  557



>gb|AGT63063.1| phenylalanine ammonia-lyase [Solanum tuberosum]
Length=722

 Score =   276 bits (707),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 125/152 (82%), Positives = 142/152 (93%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            +LLRVVDREYVFAYADDPCS+ YPLMQKLRQVLVDHA+ NGE EKNV++SIFQKI AFED
Sbjct  571  ELLRVVDREYVFAYADDPCSSTYPLMQKLRQVLVDHAMNNGESEKNVNSSIFQKIVAFED  630

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELKA+LPKEVE AR+ LE+GNP+IPNRITECRSYPLYK +R+ELG+E+LTGEKV+SPGE 
Sbjct  631  ELKAMLPKEVESARAVLESGNPSIPNRITECRSYPLYKLVRQELGSELLTGEKVRSPGEE  690

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
             DKVFTA+C+G IIDPLLECL+SWNGAPLPIC
Sbjct  691  IDKVFTAMCNGQIIDPLLECLQSWNGAPLPIC  722



>ref|XP_009625397.1| PREDICTED: phenylalanine ammonia-lyase [Nicotiana tomentosiformis]
Length=712

 Score =   276 bits (706),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 128/152 (84%), Positives = 140/152 (92%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLLRVVDREYVFAYADD CSANYPLMQKLRQVLVDHALQNGE+EKN ++SIFQKI AFED
Sbjct  561  DLLRVVDREYVFAYADDACSANYPLMQKLRQVLVDHALQNGENEKNANSSIFQKILAFED  620

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELKA+LPKEVE AR+ALE+GNPAI NRI ECRSYPLY+F+R ELG E+LTGEKV+SPGE 
Sbjct  621  ELKAVLPKEVESARAALESGNPAIANRIKECRSYPLYRFVRGELGAELLTGEKVRSPGEE  680

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
            CDKVFTA+C+G IID LLECLK WNGAPLPIC
Sbjct  681  CDKVFTAMCNGQIIDSLLECLKEWNGAPLPIC  712



>sp|P35513.2|PAL2_TOBAC RecName: Full=Phenylalanine ammonia-lyase [Nicotiana tabacum]
 dbj|BAA22947.1| phenylalanine ammonia-lyase [Nicotiana tabacum]
 dbj|BAA22963.1| phenylalanine ammonia-lyase [Nicotiana tabacum]
Length=712

 Score =   276 bits (706),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 128/152 (84%), Positives = 140/152 (92%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLLRVVDREYVFAYADD CSANYPLMQKLRQVLVDHALQNGE+EKN ++SIFQKI AFED
Sbjct  561  DLLRVVDREYVFAYADDACSANYPLMQKLRQVLVDHALQNGENEKNANSSIFQKILAFED  620

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELKA+LPKEVE AR+ALE+GNPAI NRI ECRSYPLY+F+R ELG E+LTGEKV+SPGE 
Sbjct  621  ELKAVLPKEVESARAALESGNPAIANRIKECRSYPLYRFVRGELGAELLTGEKVRSPGEE  680

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
            CDKVFTA+C+G IID LLECLK WNGAPLPIC
Sbjct  681  CDKVFTAMCNGQIIDSLLECLKEWNGAPLPIC  712



>gb|AET41698.1| phenylalanine ammonia-lyase [Prunus salicina]
Length=317

 Score =   265 bits (677),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 121/152 (80%), Positives = 138/152 (91%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLL+VVDREYVFAY DDPCSA YPLMQKLRQVLV+HAL NGE+EKN STSIFQKI AFE+
Sbjct  166  DLLKVVDREYVFAYIDDPCSATYPLMQKLRQVLVEHALTNGENEKNASTSIFQKIVAFEE  225

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELK LLPKEV+ AR+AL++G+  +PNRITECRSYPLYKF+REELG E LTGEKV+SPGE 
Sbjct  226  ELKVLLPKEVDSARAALDSGSAGVPNRITECRSYPLYKFVREELGAEYLTGEKVRSPGEE  285

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
            CDKVF+A+C+G IIDP+LECL+ WNGAPLPIC
Sbjct  286  CDKVFSAICEGKIIDPILECLEGWNGAPLPIC  317



>ref|XP_004249558.1| PREDICTED: phenylalanine ammonia-lyase [Solanum lycopersicum]
Length=711

 Score =   276 bits (705),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 125/152 (82%), Positives = 142/152 (93%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLLR+VDREY+FAYADDPCSANYPLMQKLRQVLV+HALQNGE+EKN S+SIFQKI AFE+
Sbjct  560  DLLRIVDREYLFAYADDPCSANYPLMQKLRQVLVEHALQNGENEKNASSSIFQKIVAFEE  619

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELK++LP+EVE AR ALE+GNPAI NRI ECRSYPLYKF+REELGTE+LTGE+V+SPGE 
Sbjct  620  ELKSVLPREVESARVALESGNPAIANRINECRSYPLYKFVREELGTELLTGERVRSPGEE  679

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
            CDKVFTA+C+G IID LLECLK WNGAPLP+C
Sbjct  680  CDKVFTAMCNGQIIDSLLECLKEWNGAPLPVC  711



>ref|XP_004246649.1| PREDICTED: phenylalanine ammonia-lyase-like isoform X1 [Solanum 
lycopersicum]
Length=721

 Score =   276 bits (705),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 125/152 (82%), Positives = 142/152 (93%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            +LLRVVDREYVFAYADDPCS+ YPLMQKLRQVLVDHA++NGE EKNV++SIFQKI AFED
Sbjct  570  ELLRVVDREYVFAYADDPCSSTYPLMQKLRQVLVDHAMKNGESEKNVNSSIFQKIVAFED  629

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELKA LPKEVE AR+ +E+GNPAIPNRITECRSYPLY+ +R+ELG+E+LTGEKV+SPGE 
Sbjct  630  ELKAALPKEVESARAVVESGNPAIPNRITECRSYPLYRLVRQELGSELLTGEKVRSPGEE  689

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
             DKVFTA+C+G IIDPLLECLKSWNGAPLPIC
Sbjct  690  IDKVFTAMCNGQIIDPLLECLKSWNGAPLPIC  721



>gb|ACR56688.1| phenylalanine ammonia-lyase [Scutellaria viscidula]
Length=711

 Score =   275 bits (704),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 130/152 (86%), Positives = 138/152 (91%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLLRVVDREYVFAY DDPCSANYPLMQKLRQVLVDHAL+NGE+EKN STSIFQKI AFE+
Sbjct  560  DLLRVVDREYVFAYIDDPCSANYPLMQKLRQVLVDHALKNGENEKNASTSIFQKIEAFEE  619

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELKALLPKEVE AR ALE GNPA+PNRITECRSYPLYKFIREE GTE LTGEKV SPGE 
Sbjct  620  ELKALLPKEVESARMALEAGNPAVPNRITECRSYPLYKFIREEAGTEFLTGEKVTSPGEE  679

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
            CDKVFTA+ +G IID LL CL++WNGAPLPIC
Sbjct  680  CDKVFTALTNGFIIDSLLTCLEAWNGAPLPIC  711



>gb|ACF17667.1| putative phenylalanine ammonia-lyase [Capsicum annuum]
Length=717

 Score =   275 bits (704),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 126/152 (83%), Positives = 142/152 (93%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            +LLRVVDREY+FAYADDPCS+ YPLMQKLRQVLVDHAL NGE EKNV++SIFQKIAAFED
Sbjct  566  ELLRVVDREYLFAYADDPCSSTYPLMQKLRQVLVDHALNNGESEKNVNSSIFQKIAAFED  625

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELKA+LPKEVE AR  LE+GNP+IPNRITECRSYPLY+ +R+ELGTE+LTGE+V+SPGE 
Sbjct  626  ELKAVLPKEVESARITLESGNPSIPNRITECRSYPLYRLVRKELGTELLTGERVRSPGEE  685

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
             DKVFTA+C+G IIDPLLECLKSWNGAPLPIC
Sbjct  686  IDKVFTAMCNGQIIDPLLECLKSWNGAPLPIC  717



>gb|ACF94717.1| phenylalanine ammonia lyase [Robinia pseudoacacia]
Length=311

 Score =   263 bits (672),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 123/152 (81%), Positives = 137/152 (90%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLL+VVDRE+VFAY DDPCSA YPLMQKLRQVLVDHAL NGE+EKN++TSIFQKIA FE+
Sbjct  160  DLLKVVDREHVFAYIDDPCSATYPLMQKLRQVLVDHALVNGENEKNLNTSIFQKIATFEE  219

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELKALLPKEVE AR+A E+GN AIPN+I ECRSYPLYKF+REELGT +LTGEKV+SPGE 
Sbjct  220  ELKALLPKEVESARAAYESGNAAIPNKINECRSYPLYKFVREELGTGLLTGEKVRSPGEE  279

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
             DK+FTA+C G IIDPLLECL  WNGAPLPIC
Sbjct  280  FDKLFTAMCQGKIIDPLLECLGEWNGAPLPIC  311



>ref|XP_009781653.1| PREDICTED: phenylalanine ammonia-lyase [Nicotiana sylvestris]
Length=712

 Score =   274 bits (700),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 127/152 (84%), Positives = 139/152 (91%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLLRVVDREYVFAYADD CSANYPLMQKLRQVLVDHAL+NGE+EKN ++SIFQKI AFE 
Sbjct  561  DLLRVVDREYVFAYADDACSANYPLMQKLRQVLVDHALENGENEKNANSSIFQKILAFEG  620

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELKA+LPKEVE AR +LENGNPAI NRI ECRSYPLY+F+REELG E+LTGEKV+SPGE 
Sbjct  621  ELKAVLPKEVESARISLENGNPAIANRIKECRSYPLYRFVREELGAELLTGEKVRSPGEE  680

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
            CDKVFTA+C+G IID LLECLK WNGAPLPIC
Sbjct  681  CDKVFTAMCNGQIIDSLLECLKEWNGAPLPIC  712



>ref|XP_003635685.1| PREDICTED: phenylalanine ammonia-lyase [Vitis vinifera]
Length=308

 Score =   262 bits (669),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 121/152 (80%), Positives = 138/152 (91%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLL+VVDRE+VFAY DDPCSA YPLMQK+RQVLV+HAL NGE+EKN STSIFQKI AFE+
Sbjct  157  DLLKVVDREHVFAYIDDPCSATYPLMQKVRQVLVEHALNNGENEKNGSTSIFQKIVAFEE  216

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELKA+LPKEVE AR  +E+GNP+IPNRI ECRSYPLYKF+REELGT +LTGEKV+SPGE 
Sbjct  217  ELKAVLPKEVESARGGVESGNPSIPNRIKECRSYPLYKFVREELGTGLLTGEKVRSPGED  276

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
             DKVFTA+C+G IIDPLL+CL +WNGAPLPIC
Sbjct  277  FDKVFTAMCEGKIIDPLLDCLSAWNGAPLPIC  308



>gb|AEO92028.1| phenylalanine ammonia-lyase 2 [Coffea canephora]
 gb|AEO94540.1| phenylalanine ammonia-lyase 2 [Coffea canephora]
Length=711

 Score =   273 bits (698),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 126/152 (83%), Positives = 139/152 (91%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLLRVVDREY FAY DDPCSA YPLMQKLRQVLVDHAL+NG+ EKNV+TSIFQKIAAFED
Sbjct  560  DLLRVVDREYAFAYVDDPCSATYPLMQKLRQVLVDHALKNGDQEKNVNTSIFQKIAAFED  619

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELKA+LPKEVE ARSA+E+GNPAIPNRI ECRSYPLYKF+RE LGTE+L+GEK QSPGEV
Sbjct  620  ELKAVLPKEVESARSAVESGNPAIPNRIRECRSYPLYKFVREVLGTELLSGEKAQSPGEV  679

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
             D+VFTA+  G I+DPLLECL+ WNGAPLPIC
Sbjct  680  FDQVFTAMSKGQIVDPLLECLQEWNGAPLPIC  711



>dbj|BAF36975.1| phenylalanine ammonia-lyase [Lotus japonicus]
Length=311

 Score =   261 bits (668),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 120/152 (79%), Positives = 135/152 (89%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLL+VVDRE +FAY DDPC A YPLMQKLRQVLVDHAL NGE+EK+  TSIFQKIA FED
Sbjct  160  DLLKVVDRETLFAYIDDPCLATYPLMQKLRQVLVDHALVNGEYEKDSKTSIFQKIATFED  219

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELK+LLPKEVE AR+A E+GNPA+PN+I ECRSYPLYKF+R+ELGTE+LTGEK +SPGE 
Sbjct  220  ELKSLLPKEVESARAAYESGNPAMPNKINECRSYPLYKFVRKELGTELLTGEKTRSPGEE  279

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
            CDK+FTA+C G IIDPLLECL  WNGAPLPIC
Sbjct  280  CDKLFTAICQGKIIDPLLECLGEWNGAPLPIC  311



>gb|AIA66448.1| PAL1 [Capsicum annuum]
Length=717

 Score =   273 bits (697),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 125/152 (82%), Positives = 141/152 (93%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            +LLRVVDREY+FAYADD CS+ YPLMQKLRQVLVDHAL NGE EKNV++SIFQKIAAFED
Sbjct  566  ELLRVVDREYLFAYADDTCSSTYPLMQKLRQVLVDHALNNGESEKNVNSSIFQKIAAFED  625

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELKA+LPKEVE AR  LE+GNP+IPNRITECRSYPLY+ +R+ELGTE+LTGE+V+SPGE 
Sbjct  626  ELKAVLPKEVESARITLESGNPSIPNRITECRSYPLYRLVRKELGTELLTGERVRSPGEE  685

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
             DKVFTA+C+G IIDPLLECLKSWNGAPLPIC
Sbjct  686  IDKVFTAMCNGQIIDPLLECLKSWNGAPLPIC  717



>emb|CDP20698.1| unnamed protein product [Coffea canephora]
Length=674

 Score =   271 bits (694),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 126/152 (83%), Positives = 138/152 (91%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLLRVVDREY FAY DDPCSA YPLMQKLRQVLVDHAL+NG+ EKNV+TSIFQKIAAFED
Sbjct  523  DLLRVVDREYAFAYVDDPCSATYPLMQKLRQVLVDHALKNGDQEKNVNTSIFQKIAAFED  582

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELKA+LPKEVE ARSA+ENGNPAIPNRI +CRSYPLYKF+RE LGT +LTGEK QSPGEV
Sbjct  583  ELKAVLPKEVESARSAVENGNPAIPNRIRKCRSYPLYKFVREVLGTGLLTGEKAQSPGEV  642

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
             D+VFTA+  G I+DPLLECL+ WNGAPLPIC
Sbjct  643  FDQVFTAMNKGQIVDPLLECLQEWNGAPLPIC  674



>gb|AEL21617.1| phenylalanine ammonia lyase 2 [Coffea arabica]
Length=711

 Score =   272 bits (696),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 126/152 (83%), Positives = 138/152 (91%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLLRVVDREY FAY DDPCSA YPLMQKLRQVLVDHAL+NG+ EKNV+TSIFQKIAAFED
Sbjct  560  DLLRVVDREYAFAYVDDPCSATYPLMQKLRQVLVDHALKNGDQEKNVNTSIFQKIAAFED  619

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELKA+LPKEVE ARSA+E+GNPAIPNRI ECRSYPLYKF+RE LGT +LTGEK QSPGEV
Sbjct  620  ELKAVLPKEVESARSAVESGNPAIPNRIRECRSYPLYKFVREVLGTGLLTGEKAQSPGEV  679

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
             D+VFTA+  G I+DPLLECL+ WNGAPLPIC
Sbjct  680  FDQVFTAMSKGQIVDPLLECLQEWNGAPLPIC  711



>gb|AEY94464.1| phenylalanine ammonia-lyase, partial [Prunella vulgaris]
Length=349

 Score =   262 bits (670),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 124/152 (82%), Positives = 134/152 (88%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            +L+RVVDREYVFAYADDPCSA YPLMQKLRQVLVDHAL+NG+ EKNVSTSIF KI AFE+
Sbjct  198  ELIRVVDREYVFAYADDPCSATYPLMQKLRQVLVDHALKNGDGEKNVSTSIFHKIEAFEE  257

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELKALLPKEVE AR ALE+G PA+ NRI ECRSYPLYKFIRE LGT  LTGEK  SPGE 
Sbjct  258  ELKALLPKEVESARIALESGAPAVANRIAECRSYPLYKFIREGLGTGFLTGEKAVSPGEE  317

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
            CDKVFTA+CDG I+DPLLECL+ WNG PLPIC
Sbjct  318  CDKVFTALCDGLIVDPLLECLQGWNGEPLPIC  349



>dbj|BAG31930.1| phenylalanine ammonia-lyase [Daucus carota]
Length=715

 Score =   271 bits (694),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 126/152 (83%), Positives = 138/152 (91%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLLRVVDREY+FAY DDPCSA YPLMQKLR+ LV+HAL NG+ E+N+STSIFQKIAAFED
Sbjct  564  DLLRVVDREYIFAYIDDPCSATYPLMQKLRETLVEHALNNGDKERNLSTSIFQKIAAFED  623

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELKALLPKEVE AR+A+E+GNPAIPNRI ECRSYPLYKF+REELGTE LTGEKV SPGE 
Sbjct  624  ELKALLPKEVESARAAVESGNPAIPNRIKECRSYPLYKFVREELGTEYLTGEKVTSPGEE  683

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
             DKVFTA+  G IIDPLLECL+SWNGAPLPIC
Sbjct  684  FDKVFTAMTKGEIIDPLLECLQSWNGAPLPIC  715



>sp|P45733.1|PAL3_TOBAC RecName: Full=Phenylalanine ammonia-lyase [Nicotiana tabacum]
 emb|CAA55075.1| phenylalanine ammonia-lyase [Nicotiana tabacum]
Length=712

 Score =   271 bits (694),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 126/152 (83%), Positives = 138/152 (91%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLLRVVDREYVF YADD CSANYPLMQKLRQVLVDHAL+NGE+EKN ++SIFQKI AFE 
Sbjct  561  DLLRVVDREYVFRYADDACSANYPLMQKLRQVLVDHALENGENEKNANSSIFQKILAFEG  620

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELKA+LPKEVE AR +LENGNPAI NRI ECRSYPLY+F+REELG E+LTGEKV+SPGE 
Sbjct  621  ELKAVLPKEVESARISLENGNPAIANRIKECRSYPLYRFVREELGAELLTGEKVRSPGEE  680

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
            CDKVFTA+C+G IID LLECLK WNGAPLPIC
Sbjct  681  CDKVFTAMCNGQIIDSLLECLKEWNGAPLPIC  712



>dbj|BAC56977.1| phenylalanine ammonia-lyase [Daucus carota]
Length=715

 Score =   271 bits (693),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 126/152 (83%), Positives = 138/152 (91%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLLRVVDREY+FAY DDPCSA YPLMQKLR+ LV+HAL NG+ E+N+STSIFQKIAAFED
Sbjct  564  DLLRVVDREYIFAYIDDPCSATYPLMQKLRETLVEHALNNGDKERNLSTSIFQKIAAFED  623

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELKALLPKEVE AR+A+E+GNPAIPNRI ECRSYPLYKF+REELGTE LTGEKV SPGE 
Sbjct  624  ELKALLPKEVESARAAVESGNPAIPNRIKECRSYPLYKFVREELGTEYLTGEKVTSPGEE  683

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
             DKVFTA+  G IIDPLLECL+SWNGAPLPIC
Sbjct  684  FDKVFTAMTKGEIIDPLLECLQSWNGAPLPIC  715



>gb|AAK60273.1|AF383150_1 phenylalanine ammonia-lyase 3 [Manihot esculenta]
Length=315

 Score =   260 bits (665),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 122/152 (80%), Positives = 133/152 (88%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLL+VVDRE VF+Y DD CSA YPLMQKLRQVLVDHAL NGE EKN STSIFQKI AFE+
Sbjct  164  DLLKVVDREQVFSYVDDACSATYPLMQKLRQVLVDHALANGESEKNASTSIFQKIRAFEE  223

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELKALLPKEVE AR A ENGNPAI N+I ECRSYPLYKF+REE+GT +LTGEKV+SPGE 
Sbjct  224  ELKALLPKEVESAREAYENGNPAIANKIKECRSYPLYKFVREEIGTGLLTGEKVRSPGEE  283

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
             DKVFTA+C G IIDP+L+CLK WNGAPLPIC
Sbjct  284  FDKVFTAMCQGKIIDPMLDCLKEWNGAPLPIC  315



>gb|AFC37247.1| phenylalanine ammonia-lyase [Camellia chekiangoleosa]
Length=308

 Score =   259 bits (663),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 122/152 (80%), Positives = 135/152 (89%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            +LLRVVDRE+VF Y DDPCSA YPLMQKLRQVLV+HAL+NG+ EKNVSTSIFQKI AFE+
Sbjct  157  ELLRVVDREHVFEYIDDPCSATYPLMQKLRQVLVEHALKNGDAEKNVSTSIFQKIRAFEE  216

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            EL ALLPKEVE AR A+E+GNP IPNRI ECRSYPLYKF+REELGT  LTGEK  SPGE 
Sbjct  217  ELMALLPKEVESARRAVESGNPGIPNRIKECRSYPLYKFVREELGTGFLTGEKALSPGEE  276

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
             DKVFTA+C+G +IDPLL+CLKSWNGAPLPIC
Sbjct  277  FDKVFTAMCEGQVIDPLLDCLKSWNGAPLPIC  308



>ref|XP_006354336.1| PREDICTED: phenylalanine ammonia-lyase-like isoform X1 [Solanum 
tuberosum]
Length=719

 Score =   271 bits (693),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 122/152 (80%), Positives = 140/152 (92%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            +LL+VVD+EY+FAY DDPC++NYPLMQKLRQVLVDHA+ NGE EKNV++SIFQKI AFED
Sbjct  568  ELLQVVDKEYLFAYVDDPCNSNYPLMQKLRQVLVDHAMNNGESEKNVNSSIFQKIVAFED  627

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELK +LPKEVE AR  +E+GNPAIPNRITECRSYPLY+ +REELGTE+LTGEKV+SPGE 
Sbjct  628  ELKVVLPKEVESARVVVESGNPAIPNRITECRSYPLYRLVREELGTEVLTGEKVRSPGEE  687

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
             DKVFTA+C+G IIDPLLECLKSWNGAPLPIC
Sbjct  688  IDKVFTAMCNGQIIDPLLECLKSWNGAPLPIC  719



>dbj|BAA95629.1| phenylalanine ammonia lyase [Catharanthus roseus]
Length=716

 Score =   271 bits (693),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 125/152 (82%), Positives = 137/152 (90%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DL+RVVDREYVFAY DDPCS  YPLM+KLRQV+VDHALQNGE EKNV+TSIFQKIAAFED
Sbjct  565  DLIRVVDREYVFAYVDDPCSGTYPLMEKLRQVIVDHALQNGESEKNVNTSIFQKIAAFED  624

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELK +LPKEVE AR+ALENGNPAIPNRI ECRSYPLYKF+RE++G E LTGEK +SPGE 
Sbjct  625  ELKTVLPKEVESARTALENGNPAIPNRIKECRSYPLYKFVREDVGAEFLTGEKDRSPGEE  684

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
             DKVFTA+C+  IIDPLLECLK WNGAPLPIC
Sbjct  685  FDKVFTAMCNEKIIDPLLECLKEWNGAPLPIC  716



>ref|XP_006354338.1| PREDICTED: phenylalanine ammonia-lyase-like isoform X3 [Solanum 
tuberosum]
Length=723

 Score =   271 bits (693),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 122/152 (80%), Positives = 140/152 (92%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            +LL+VVD+EY+FAY DDPC++NYPLMQKLRQVLVDHA+ NGE EKNV++SIFQKI AFED
Sbjct  572  ELLQVVDKEYLFAYVDDPCNSNYPLMQKLRQVLVDHAMNNGESEKNVNSSIFQKIVAFED  631

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELK +LPKEVE AR  +E+GNPAIPNRITECRSYPLY+ +REELGTE+LTGEKV+SPGE 
Sbjct  632  ELKVVLPKEVESARVVVESGNPAIPNRITECRSYPLYRLVREELGTEVLTGEKVRSPGEE  691

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
             DKVFTA+C+G IIDPLLECLKSWNGAPLPIC
Sbjct  692  IDKVFTAMCNGQIIDPLLECLKSWNGAPLPIC  723



>sp|P45729.1|PAL3_PETCR RecName: Full=Phenylalanine ammonia-lyase 3 [Petroselinum crispum]
 emb|CAA57057.1| phenylalanine ammonia-lyase 3 [Petroselinum crispum]
Length=718

 Score =   270 bits (691),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 126/152 (83%), Positives = 139/152 (91%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLLRVVDREY+FAY DDPCSA YPLMQKLR+ LV+HAL NG+ E+N+STSIFQKIAAFED
Sbjct  567  DLLRVVDREYIFAYIDDPCSATYPLMQKLRETLVEHALNNGDKERNLSTSIFQKIAAFED  626

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELKALLPKEVE AR+ALE+GNPAIPNRI ECRSYPLYKF+REELGTE LTGEKV+SPGE 
Sbjct  627  ELKALLPKEVETARAALESGNPAIPNRIKECRSYPLYKFVREELGTEYLTGEKVRSPGEE  686

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
             +KVFTA+  G IIDPLLECL+SWNGAPLPIC
Sbjct  687  FEKVFTAMSKGEIIDPLLECLESWNGAPLPIC  718



>ref|XP_006364021.1| PREDICTED: phenylalanine ammonia-lyase-like [Solanum tuberosum]
Length=723

 Score =   270 bits (691),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 122/152 (80%), Positives = 141/152 (93%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            +LLRVVDREY+FAYADDPCS+NYPLMQKLRQVLVD A++NGE EKNV++SIFQKI AFED
Sbjct  572  ELLRVVDREYLFAYADDPCSSNYPLMQKLRQVLVDQAMKNGESEKNVNSSIFQKIGAFED  631

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            EL A+LPKEVE  R+ +E+GNP+IPNRITECRSYPLY+ +R+ELGTE+LTGEKV+SPGE 
Sbjct  632  ELIAVLPKEVESVRAVVESGNPSIPNRITECRSYPLYRLVRQELGTELLTGEKVRSPGEE  691

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
             DKVFTA+C+G IIDPLLECLKSWNGAPLPIC
Sbjct  692  IDKVFTAMCNGQIIDPLLECLKSWNGAPLPIC  723



>sp|P45735.1|PALY_VITVI RecName: Full=Phenylalanine ammonia-lyase, partial [Vitis vinifera]
 emb|CAA53581.1| phenylalanine ammonium lyase [Vitis vinifera]
Length=416

 Score =   262 bits (669),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 121/152 (80%), Positives = 137/152 (90%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLL+VVDRE+VFAY DDPCSA YPLMQK+RQVLV+HAL NGE EKN STSIFQKI AFE+
Sbjct  265  DLLKVVDREHVFAYIDDPCSATYPLMQKVRQVLVEHALNNGESEKNGSTSIFQKIGAFEE  324

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELKA+LPKEVE AR  +E+GNP+IPNRI ECRSYPLYKF+REELGT +LTGEKV+SPGE 
Sbjct  325  ELKAVLPKEVESARDGVESGNPSIPNRIKECRSYPLYKFVREELGTGLLTGEKVRSPGED  384

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
             DKVFTA+C+G IIDPLL+CL +WNGAPLPIC
Sbjct  385  FDKVFTAMCEGKIIDPLLDCLSAWNGAPLPIC  416



>gb|AGF50184.1| phenylalanine ammonia lyase, partial [Salvia virgata]
Length=282

 Score =   258 bits (658),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 120/152 (79%), Positives = 133/152 (88%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DL+RVVDREYVF+Y DDPC A YPLMQKLRQVLV+HAL+NGE EKN STSIFQKI  FE+
Sbjct  131  DLIRVVDREYVFSYVDDPCLATYPLMQKLRQVLVEHALKNGEGEKNASTSIFQKIEQFEE  190

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELKALLPKEVE AR ALE+G+PA+PNRI ECRSYPLYKF+REELG   LTGEK  SPGE 
Sbjct  191  ELKALLPKEVEAARLALESGSPAVPNRIAECRSYPLYKFVREELGAGFLTGEKAVSPGEE  250

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
            CDKVFTA+C+G I+DPLL+CLK WNG PLPIC
Sbjct  251  CDKVFTALCNGLIVDPLLDCLKGWNGQPLPIC  282



>sp|P45726.1|PALY_CAMSI RecName: Full=Phenylalanine ammonia-lyase [Camellia sinensis]
 dbj|BAA05643.1| phenylalanine ammonia-lyase [Camellia sinensis]
Length=714

 Score =   270 bits (689),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 123/152 (81%), Positives = 138/152 (91%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLLRVVDREY+FAY DDPCSA YPLMQKLRQVLV+HAL+NGE EKN+STSIFQKI AFE+
Sbjct  563  DLLRVVDREYIFAYIDDPCSATYPLMQKLRQVLVEHALKNGESEKNLSTSIFQKIRAFEE  622

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            E+K LLPKEVE  R+A+ENGN AIPNRI ECRSYPLYKF+REELGTE+LTGEKV+SPGE 
Sbjct  623  EIKTLLPKEVESTRAAIENGNSAIPNRIKECRSYPLYKFVREELGTELLTGEKVRSPGEE  682

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
             DKVFTA+C G +IDPL++CLK WNGAPLPIC
Sbjct  683  FDKVFTALCKGEMIDPLMDCLKEWNGAPLPIC  714



>ref|XP_011094662.1| PREDICTED: phenylalanine ammonia-lyase [Sesamum indicum]
Length=711

 Score =   270 bits (689),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 128/152 (84%), Positives = 136/152 (89%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLLRVVDREYVFAY DDPCSA YPLMQKLRQVLVDHAL+NG+ EK++STSIFQKI AFED
Sbjct  560  DLLRVVDREYVFAYIDDPCSATYPLMQKLRQVLVDHALKNGDGEKSLSTSIFQKIEAFED  619

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELKALLPKEVE AR ALE+GNPAI NRITECRSYPLYKFIREELGT  LTGEKV SPGE 
Sbjct  620  ELKALLPKEVESARIALESGNPAIANRITECRSYPLYKFIREELGTNFLTGEKVTSPGEE  679

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
            CDKVFTA+  G I+DPLL+CL  WNGAPLPIC
Sbjct  680  CDKVFTALSKGLIVDPLLKCLDGWNGAPLPIC  711



>dbj|BAF36973.1| phenylalanine ammonia-lyase [Lotus japonicus]
Length=569

 Score =   266 bits (680),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 123/152 (81%), Positives = 136/152 (89%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLL+VVDRE VFAY DDPCSA YPLMQKLRQVLVDHAL N E+EKN +TSIFQKI+ FED
Sbjct  418  DLLKVVDREVVFAYIDDPCSATYPLMQKLRQVLVDHALVNAENEKNQNTSIFQKISTFED  477

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELK+LLPKEVE AR+A E+GNP IPN+I ECRSYPLYKF+REELGTE+LTGEKV+SPGE 
Sbjct  478  ELKSLLPKEVESARNAYESGNPVIPNKINECRSYPLYKFVREELGTELLTGEKVRSPGEE  537

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
            CDK+FTA+C G IIDPLLECL  WNGAPLPIC
Sbjct  538  CDKLFTAICQGKIIDPLLECLGEWNGAPLPIC  569



>emb|CAA34715.1| unnamed protein product [Petroselinum crispum]
Length=580

 Score =   266 bits (681),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 124/152 (82%), Positives = 138/152 (91%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLLRVVDREY+FAY DDPCSA YPLMQKLRQ LV+HAL+NG++E+N+STSIFQKIA FED
Sbjct  429  DLLRVVDREYIFAYIDDPCSATYPLMQKLRQTLVEHALKNGDNERNLSTSIFQKIATFED  488

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELKALLPKEVE AR+ALE+GNPAIPNRI ECRSYPLYKF+R+ELGTE LTGEKV SPGE 
Sbjct  489  ELKALLPKEVESARAALESGNPAIPNRIEECRSYPLYKFVRKELGTEYLTGEKVTSPGEE  548

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
             +KVF A+  G IIDPLLECL+SWNGAPLPIC
Sbjct  549  FEKVFIAMSKGEIIDPLLECLESWNGAPLPIC  580



>dbj|BAF36972.1| phenylalanine ammonia-lyase [Lotus japonicus]
Length=688

 Score =   268 bits (686),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 124/152 (82%), Positives = 138/152 (91%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLL+VVDRE VFAY DDPCSA YPLMQKLRQVLVDHAL N E+EKN++TSIFQKIA FED
Sbjct  537  DLLKVVDRETVFAYIDDPCSATYPLMQKLRQVLVDHALVNEENEKNMNTSIFQKIATFED  596

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELK+LLPKEVE AR+A E+GNPAIPN+I ECRSYPLYKF+RE LGTE+LTGEKV+SPGE 
Sbjct  597  ELKSLLPKEVESARAAYESGNPAIPNKINECRSYPLYKFVREGLGTELLTGEKVRSPGEE  656

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
            CDK+FTA+C+G IIDPLLECL  WNGAPLPIC
Sbjct  657  CDKLFTAICEGKIIDPLLECLGEWNGAPLPIC  688



>ref|XP_008387584.1| PREDICTED: phenylalanine ammonia-lyase 1 [Malus domestica]
Length=720

 Score =   269 bits (688),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 124/152 (82%), Positives = 135/152 (89%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLL+VVDREYVFAY DDPCSA YPLMQKLRQVLV+HAL NGE EKN STSIFQKI AFE+
Sbjct  569  DLLKVVDREYVFAYIDDPCSATYPLMQKLRQVLVEHALTNGESEKNASTSIFQKIGAFEE  628

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELKALLPKEVE ARSA+E+GN A+PNRI ECRSYPLYKF+REELG E LTGEKV+SPGE 
Sbjct  629  ELKALLPKEVESARSAIESGNAAVPNRIAECRSYPLYKFVREELGGEYLTGEKVRSPGEE  688

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
            CDKVF A+C G IIDP+L CL+ WNGAPLPIC
Sbjct  689  CDKVFQAICQGKIIDPILGCLEGWNGAPLPIC  720



>gb|AEA72280.1| phenylalanine ammonia-lyase, partial [Angelica gigas]
Length=699

 Score =   268 bits (686),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 125/152 (82%), Positives = 137/152 (90%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLLRVVDREY+FAY DDPCSA YPLMQKLRQ LV+HAL NG++E+N+STSIFQKIA FED
Sbjct  548  DLLRVVDREYIFAYIDDPCSATYPLMQKLRQTLVEHALTNGDNERNLSTSIFQKIATFED  607

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELKALLPKEVE AR+ALE+GNPAIPNRI ECRSYPLYKF+REELGTE LTGEK +SPGE 
Sbjct  608  ELKALLPKEVESARAALESGNPAIPNRIEECRSYPLYKFVREELGTEYLTGEKARSPGEE  667

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
             DKVFTA+  G IIDPLL CL+SWNGAPLPIC
Sbjct  668  FDKVFTAMSRGEIIDPLLACLESWNGAPLPIC  699



>gb|AAU08174.1| phenylalanine ammonia-lyase [Camellia sinensis]
Length=714

 Score =   269 bits (687),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 123/152 (81%), Positives = 138/152 (91%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLLRVVDREY+FAY DDPCSA YPLMQKLRQVLV+HAL+NGE EKN+STSIFQKI AFE+
Sbjct  563  DLLRVVDREYIFAYIDDPCSATYPLMQKLRQVLVEHALKNGESEKNLSTSIFQKIRAFEE  622

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            E+K LLPKEVE  R+A+ENGN AIPNRI ECRSYPLYKF+REELGTE+LTGEKV+SPGE 
Sbjct  623  EIKTLLPKEVESTRAAIENGNSAIPNRIKECRSYPLYKFVREELGTELLTGEKVRSPGEE  682

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
             DKVFTA+C G +IDPL++CLK WNGAPLPIC
Sbjct  683  FDKVFTALCKGEMIDPLMDCLKEWNGAPLPIC  714



>ref|XP_004246651.1| PREDICTED: phenylalanine ammonia-lyase [Solanum lycopersicum]
Length=721

 Score =   269 bits (687),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 120/152 (79%), Positives = 141/152 (93%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            +LL+VV+REY+F YADDPCS+ YPLMQKLRQVLVDHA++NGE EKNV++SIFQKI AFED
Sbjct  570  ELLQVVEREYLFTYADDPCSSTYPLMQKLRQVLVDHAMKNGESEKNVNSSIFQKIVAFED  629

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELKA+LPKEVE AR+ +E+GNPAIPNRITECRSYPLY+ +R+E+GTE+LTGEKV+SPGE 
Sbjct  630  ELKAVLPKEVESARAVVESGNPAIPNRITECRSYPLYRLVRQEVGTELLTGEKVRSPGEE  689

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
             DKVFTA C+G IIDPLLECLKSWNGAP+PIC
Sbjct  690  IDKVFTAFCNGQIIDPLLECLKSWNGAPIPIC  721



>gb|AFG30054.1| phenylalanine ammonialyase [Malus hybrid cultivar]
Length=720

 Score =   269 bits (687),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 124/152 (82%), Positives = 135/152 (89%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLL+VVDREYVFAY DDPCSA YPLMQKLRQVLV+HAL NGE EKN STSIFQKI AFE+
Sbjct  569  DLLKVVDREYVFAYIDDPCSATYPLMQKLRQVLVEHALTNGESEKNASTSIFQKIGAFEE  628

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELKALLPKEVE ARSA+E+GN A+PNRI ECRSYPLYKF+REELG E LTGEKV+SPGE 
Sbjct  629  ELKALLPKEVESARSAIESGNAAVPNRIAECRSYPLYKFVREELGGEYLTGEKVRSPGEE  688

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
            CDKVF A+C G IIDP+L CL+ WNGAPLPIC
Sbjct  689  CDKVFQAICQGKIIDPILGCLEGWNGAPLPIC  720



>dbj|BAF36971.1| phenylalanine ammonia-lyase [Lotus japonicus]
Length=717

 Score =   268 bits (686),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 123/152 (81%), Positives = 135/152 (89%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLL+VVDRE +FAY DDPCSA YPLMQKLRQVLVDHAL NGE+EKN  TSIFQKIA FED
Sbjct  566  DLLKVVDRETLFAYIDDPCSATYPLMQKLRQVLVDHALVNGENEKNSKTSIFQKIATFED  625

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELK+LLPKEVE AR+A E+GNP IPN+I ECRSYPLYKF+REELGTE+LTGEK +SPGE 
Sbjct  626  ELKSLLPKEVESARAAYESGNPTIPNKINECRSYPLYKFVREELGTELLTGEKTRSPGEE  685

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
            CDK+FTA+C G IIDPLLECL  WNGAPLPIC
Sbjct  686  CDKLFTAICQGKIIDPLLECLGEWNGAPLPIC  717



>emb|CBJ23826.1| phenylalanine ammonia-lyase [Melissa officinalis]
Length=709

 Score =   268 bits (686),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 126/152 (83%), Positives = 136/152 (89%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DL+RVVDREYVFAY DDPCSA YPLMQKLRQVLV+HAL+NGE EKN STSIFQKI AFE+
Sbjct  558  DLIRVVDREYVFAYIDDPCSATYPLMQKLRQVLVEHALKNGEGEKNASTSIFQKIEAFEE  617

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELK LLPKEVE AR+ALE+GNPAI NRI ECRSYPLYKFIREELG + LTGEKV SPGE 
Sbjct  618  ELKTLLPKEVESARTALESGNPAIANRIAECRSYPLYKFIREELGADFLTGEKVVSPGEE  677

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
            CDKVFTA+ +G IIDPLLECL+ WNGAPLPIC
Sbjct  678  CDKVFTALSNGLIIDPLLECLQGWNGAPLPIC  709



>gb|ADN32767.1| phenylalanine ammonia-lyase 1 [Scutellaria baicalensis]
Length=711

 Score =   268 bits (686),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 127/152 (84%), Positives = 136/152 (89%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLLRVVDREYVFAY DDPCSANYPLMQKLRQVLVDHAL+NGE+EKN STSI Q+I AFE+
Sbjct  560  DLLRVVDREYVFAYIDDPCSANYPLMQKLRQVLVDHALKNGENEKNASTSILQEIEAFEE  619

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELKALLPKEVE AR ALE GNPA+PNRITECRSYPLYKFIR E GTE LTGEKV SPGE 
Sbjct  620  ELKALLPKEVESARMALEAGNPAVPNRITECRSYPLYKFIRGEAGTEFLTGEKVTSPGEE  679

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
            CDKVFTA+ +G IID LL CL++WNGAPLPIC
Sbjct  680  CDKVFTALTNGFIIDQLLTCLEAWNGAPLPIC  711



>ref|XP_006358655.1| PREDICTED: phenylalanine ammonia-lyase-like [Solanum tuberosum]
Length=709

 Score =   268 bits (685),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 122/152 (80%), Positives = 141/152 (93%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            +LL VVDREY+FAYADDPCS+NYPLMQKLRQVLVD+A++NGE EKNV++SIFQKI AFED
Sbjct  558  ELLLVVDREYLFAYADDPCSSNYPLMQKLRQVLVDYAMKNGESEKNVNSSIFQKIGAFED  617

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELK +LP EVE AR  LE+GNP+IPNRITECRSYPLY+F+R+ELGTE+LTGE+V+SPGE 
Sbjct  618  ELKVVLPNEVENARVILESGNPSIPNRITECRSYPLYRFVRKELGTELLTGERVRSPGED  677

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
             DKVFTA+C+G IIDPLLECLKSWNGAPLPIC
Sbjct  678  IDKVFTALCNGQIIDPLLECLKSWNGAPLPIC  709



>ref|XP_002862326.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH38584.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=220

 Score =   254 bits (648),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 116/152 (76%), Positives = 132/152 (87%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            +LL+VVDRE V+ YADDPCSA YPL+QKLRQV+VDHAL NGE EKN  TSIF KI AFE+
Sbjct  69   NLLKVVDREQVYTYADDPCSATYPLIQKLRQVIVDHALINGESEKNAVTSIFHKIGAFEE  128

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELKA+LPKEVE AR+A +NG  AIPNRI ECRSYPLY+F+REELGTE+LTGEKV SPGE 
Sbjct  129  ELKAVLPKEVEAARAAYDNGTSAIPNRIKECRSYPLYRFVREELGTELLTGEKVTSPGEE  188

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
             DKVFTA+C+G IIDP+LECL  WNGAP+PIC
Sbjct  189  FDKVFTAICEGKIIDPMLECLNEWNGAPIPIC  220



>ref|XP_011031723.1| PREDICTED: phenylalanine ammonia-lyase G4 [Populus euphratica]
Length=711

 Score =   268 bits (685),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 125/152 (82%), Positives = 134/152 (88%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLL+VVDRE+VF Y DDPCSA YPLMQKLRQVLVDHAL NGE E N STSIFQKI AFE+
Sbjct  560  DLLKVVDREHVFTYIDDPCSATYPLMQKLRQVLVDHALMNGEKEHNSSTSIFQKIGAFEE  619

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELKALLPKEVE AR  LENGNPAIPNRITECRSYPLYKF+REELGT +LTGEKV SPGE 
Sbjct  620  ELKALLPKEVESARHELENGNPAIPNRITECRSYPLYKFVREELGTILLTGEKVGSPGEE  679

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
             DKVFTA+C G +IDP+LECLK WNGAPLP+C
Sbjct  680  FDKVFTAICAGKLIDPMLECLKEWNGAPLPLC  711



>gb|ACF94716.1| phenylalanine ammonia lyase [Robinia pseudoacacia]
Length=719

 Score =   268 bits (685),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 125/152 (82%), Positives = 137/152 (90%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLL+VVDREYVFAY DDPCSA YPLMQKLRQVLVDHAL NGE+EKN++TSIFQKIA FED
Sbjct  568  DLLKVVDREYVFAYIDDPCSATYPLMQKLRQVLVDHALVNGEYEKNLNTSIFQKIATFED  627

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELKALLPKEVE AR+A E+GNPAIPN+I ECRSYPLYKF+REELGT +LTGEKV+SPG  
Sbjct  628  ELKALLPKEVESARAAYESGNPAIPNKIKECRSYPLYKFVREELGTGLLTGEKVRSPGGE  687

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
             DK+FTA+C G IIDPLLECL  WNGAPLPIC
Sbjct  688  FDKLFTAMCRGKIIDPLLECLGEWNGAPLPIC  719



>ref|XP_003625662.1| Phenylalanine ammonia-lyase [Medicago truncatula]
Length=456

 Score =   261 bits (667),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 121/152 (80%), Positives = 134/152 (88%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLL+VVDRE+VFAY DDPCSA YPL QKLRQVLVDHAL NGE EKN++TSIFQKIA FE+
Sbjct  305  DLLKVVDREHVFAYIDDPCSATYPLSQKLRQVLVDHALVNGESEKNLNTSIFQKIATFEE  364

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELK+LLPKEVE AR+A E+GNP IPN+I  CRSYPLYKF+REELGT +LTGE V SPGEV
Sbjct  365  ELKSLLPKEVESARTAYESGNPTIPNKINGCRSYPLYKFVREELGTGLLTGENVISPGEV  424

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
            CDK+FTA+C G IIDPLLECL  WNGAPLPIC
Sbjct  425  CDKLFTAMCQGKIIDPLLECLGEWNGAPLPIC  456



>ref|XP_004493977.1| PREDICTED: phenylalanine ammonia-lyase-like [Cicer arietinum]
Length=723

 Score =   268 bits (685),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 123/152 (81%), Positives = 136/152 (89%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLL+VVDRE+VFAY DDPCSA YPLMQKLRQVLVDHAL NGE+EKN++TSIFQKIA FED
Sbjct  572  DLLKVVDREHVFAYIDDPCSATYPLMQKLRQVLVDHALVNGENEKNLNTSIFQKIATFED  631

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELK LLPKEVE AR+A E+GNPAIPN+I  CRSYPLYKF+REELGT +LTGEKV SPGE 
Sbjct  632  ELKTLLPKEVESARAAYESGNPAIPNKINGCRSYPLYKFVREELGTSLLTGEKVISPGEE  691

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
            CDK+FTA+C G IIDPLLECL  WNGAPLP+C
Sbjct  692  CDKLFTAMCQGKIIDPLLECLGEWNGAPLPVC  723



>gb|AAN52280.1|AF480620_1 phenylalanine ammonia-lyase [Populus tremuloides]
Length=711

 Score =   268 bits (684),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 125/152 (82%), Positives = 133/152 (88%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLL+VVDRE+VF Y DDPCSA YPLMQKLRQVLVDHAL NGE E N STSIFQKI  FED
Sbjct  560  DLLKVVDREHVFTYIDDPCSATYPLMQKLRQVLVDHALMNGEKEHNSSTSIFQKIGVFED  619

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELKALLPKEVE AR  LENGNPAIPNRITECRSYPLYKF+REELGT +LTGEKV SPGE 
Sbjct  620  ELKALLPKEVESARLELENGNPAIPNRITECRSYPLYKFVREELGTILLTGEKVGSPGEE  679

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
             DKVFTA+C G +IDP+LECLK WNGAPLP+C
Sbjct  680  FDKVFTAICAGKLIDPMLECLKEWNGAPLPLC  711



>ref|XP_006354339.1| PREDICTED: phenylalanine ammonia-lyase-like [Solanum tuberosum]
Length=722

 Score =   268 bits (684),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 121/152 (80%), Positives = 138/152 (91%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            +LL+VV+REY+F YADDPCS  YPLMQKLRQVLVDHA++NGE E NV++SIFQKI AFED
Sbjct  571  ELLQVVEREYLFTYADDPCSCTYPLMQKLRQVLVDHAMKNGESESNVNSSIFQKIVAFED  630

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELKA+LPKEVE AR  LE+GNP IPNRITECRSYPLY+F+R+ELGTE+LTGEK++SPGE 
Sbjct  631  ELKAVLPKEVESARVVLESGNPVIPNRITECRSYPLYRFVRKELGTEVLTGEKIRSPGEE  690

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
             DKVFTA C+G IIDPLLECLKSWNGAPLPIC
Sbjct  691  IDKVFTAFCNGQIIDPLLECLKSWNGAPLPIC  722



>gb|AFP24940.1| phenylalanine ammonia lyase [Prunus salicina]
Length=717

 Score =   268 bits (684),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 121/152 (80%), Positives = 138/152 (91%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLL+VVDREYVFAY DDPCSA YPLMQKLRQVLV+HAL NGE+EKN STSIFQKI AFE+
Sbjct  566  DLLKVVDREYVFAYIDDPCSATYPLMQKLRQVLVEHALTNGENEKNASTSIFQKIVAFEE  625

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELK LLPKEV+ AR+AL++G+  +PNRITECRSYPLYKF+REELG E LTGEKV+SPGE 
Sbjct  626  ELKVLLPKEVDSARAALDSGSAGVPNRITECRSYPLYKFVREELGAEYLTGEKVRSPGEE  685

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
            CDKVF+A+C+G IIDP+LECL+ WNGAPLPIC
Sbjct  686  CDKVFSAICEGKIIDPILECLEGWNGAPLPIC  717



>gb|ADI40166.1| phenylalanine ammonia-lyase [Morus alba]
Length=726

 Score =   268 bits (684),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 121/152 (80%), Positives = 138/152 (91%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLL+VVDREYVFAY DDPCSA YPLMQKLRQVLV+HAL NGE+EKN STSIFQKI AFE+
Sbjct  575  DLLKVVDREYVFAYIDDPCSATYPLMQKLRQVLVEHALTNGENEKNASTSIFQKIVAFEE  634

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELK LLPKEV+ AR+AL++G+  +PNRITECRSYPLYKF+REELG E LTGEKV+SPGE 
Sbjct  635  ELKVLLPKEVDSARAALDSGSAGVPNRITECRSYPLYKFVREELGAEYLTGEKVRSPGEE  694

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
            CDKVFTA+C+G IIDP+L+CL+ WNGAPLPIC
Sbjct  695  CDKVFTAICEGKIIDPILDCLEGWNGAPLPIC  726



>sp|P31425.1|PAL1_SOLTU RecName: Full=Phenylalanine ammonia-lyase 1 [Solanum tuberosum]
Length=720

 Score =   268 bits (684),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 120/152 (79%), Positives = 140/152 (92%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            +LLRVVDREY+F YADDPCS+ YPLMQKLRQVLVDHA++NGE EKN+++SIFQKI AFED
Sbjct  569  ELLRVVDREYLFTYADDPCSSTYPLMQKLRQVLVDHAMKNGESEKNINSSIFQKIGAFED  628

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            EL A+LPKEVE AR+ LE+GNP+IPNRITECRSYPLY+ +R+ELGTE+LTGEKV+SPGE 
Sbjct  629  ELNAVLPKEVESARALLESGNPSIPNRITECRSYPLYRLVRQELGTELLTGEKVRSPGEE  688

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
             +KVFTA+C+G I DPLLECLKSWNGAPLPIC
Sbjct  689  IEKVFTAMCNGQINDPLLECLKSWNGAPLPIC  720



>sp|O23865.1|PAL1_DAUCA RecName: Full=Phenylalanine ammonia-lyase 1 [Daucus carota]
 dbj|BAA23367.1| phenylalanine ammonia-lyase [Daucus carota]
Length=708

 Score =   267 bits (683),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 127/152 (84%), Positives = 136/152 (89%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLLRVVDREY+FAY DDPCSA YPLMQKLRQVLV+HAL+NGE EKN+STSIFQKIAAFED
Sbjct  557  DLLRVVDREYIFAYIDDPCSATYPLMQKLRQVLVEHALKNGETEKNLSTSIFQKIAAFED  616

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELKALLPKEVE AR+ +E+GNPAIPNRI ECRSYPLYKFIREELGT  LTGEKV SPGE 
Sbjct  617  ELKALLPKEVESARAVVESGNPAIPNRIKECRSYPLYKFIREELGTVYLTGEKVTSPGEE  676

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
             DKVFTA+  G IIDPLL CL+SWNGAPLPI 
Sbjct  677  FDKVFTAMSKGEIIDPLLACLESWNGAPLPIA  708



>sp|O64963.1|PAL1_PRUAV RecName: Full=Phenylalanine ammonia-lyase 1 [Prunus avium]
 gb|AAC78457.1| phenylalanine ammonia-lyase [Prunus avium]
Length=717

 Score =   267 bits (683),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 121/152 (80%), Positives = 138/152 (91%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLL+VVDREYVFAY DDPCSA YPLMQKLRQVLV+HAL NGE+EKN STSIFQKI AFE+
Sbjct  566  DLLKVVDREYVFAYIDDPCSATYPLMQKLRQVLVEHALTNGENEKNASTSIFQKIVAFEE  625

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELK LLPKEV+ AR+AL++G+  +PNRITECRSYPLYKF+REELG E LTGEKV+SPGE 
Sbjct  626  ELKVLLPKEVDSARAALDSGSAGVPNRITECRSYPLYKFVREELGAEYLTGEKVRSPGEE  685

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
            CDKVFTA+C+G IIDP+L+CL+ WNGAPLPIC
Sbjct  686  CDKVFTAICEGKIIDPILDCLEGWNGAPLPIC  717



>gb|AAA34179.2| phenylalanine ammonia lyase [Solanum lycopersicum]
Length=704

 Score =   267 bits (683),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 122/152 (80%), Positives = 138/152 (91%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            +LLRVVDREY+FAYADDPCS+NYPLMQKLRQVLVD A++NGE EKNV++SIFQKI AFED
Sbjct  553  ELLRVVDREYLFAYADDPCSSNYPLMQKLRQVLVDQAMKNGESEKNVNSSIFQKIGAFED  612

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            EL A+LPKEVE  R+  E+GNP I NRITECRSYPLY+ +REELGTE+LTGEKV+SPGE 
Sbjct  613  ELIAVLPKEVESVRAVFESGNPLIRNRITECRSYPLYRLVREELGTELLTGEKVRSPGEE  672

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
             DKVFTA+C+G IIDPLLECLKSWNGAPLPIC
Sbjct  673  IDKVFTAICNGQIIDPLLECLKSWNGAPLPIC  704



>gb|AGF50183.1| phenylalanine ammonia lyase, partial [Salvia hypoleuca]
Length=282

 Score =   255 bits (652),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 118/152 (78%), Positives = 132/152 (87%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DL+RVVDREYVF+Y DDPC A YPLMQKLRQVLV+HAL+NGE EKN STSIF KI  FE+
Sbjct  131  DLIRVVDREYVFSYVDDPCLATYPLMQKLRQVLVEHALKNGEGEKNASTSIFHKIEQFEE  190

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELKALLPKEVE AR ALE+G+PA+PNRI ECRSYPLYKF+RE+LG   LTGEK  SPGE 
Sbjct  191  ELKALLPKEVEAARMALESGSPAVPNRIAECRSYPLYKFVREQLGAGFLTGEKAVSPGEE  250

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
            CDKVFTA+C+G I+DPLL+CLK WNG PLPIC
Sbjct  251  CDKVFTALCNGLIVDPLLDCLKGWNGQPLPIC  282



>sp|P26600.1|PAL5_SOLLC RecName: Full=Phenylalanine ammonia-lyase; Short=PAL [Solanum 
lycopersicum]
 gb|AAA34176.1| phenylalanine ammonia-lyase [Solanum lycopersicum]
Length=721

 Score =   267 bits (683),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 119/152 (78%), Positives = 141/152 (93%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            +LL+VV+REY+F YADDPCS+ YPLMQKLRQVLVDHA++NGE EKN+++SIFQKI AFED
Sbjct  570  ELLQVVEREYLFTYADDPCSSTYPLMQKLRQVLVDHAMKNGESEKNLNSSIFQKIVAFED  629

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELKA+LPKEVE AR+ +E+GNPAIPNRITECRSYPLY+ +R+E+GTE+LTGEKV+SPGE 
Sbjct  630  ELKAVLPKEVESARAVVESGNPAIPNRITECRSYPLYRLVRQEVGTELLTGEKVRSPGEE  689

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
             DKVFTA C+G IIDPLLECLKSWNGAP+PIC
Sbjct  690  IDKVFTAFCNGQIIDPLLECLKSWNGAPIPIC  721



>sp|P35511.1|PAL1_SOLLC RecName: Full=Phenylalanine ammonia-lyase; Short=PAL [Solanum 
lycopersicum]
Length=704

 Score =   267 bits (682),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 122/152 (80%), Positives = 138/152 (91%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            +LLRVVDREY+FAYADDPCS+NYPLMQKLRQVLVD A++NGE EKNV++SIFQKI AFED
Sbjct  553  ELLRVVDREYLFAYADDPCSSNYPLMQKLRQVLVDQAMKNGESEKNVNSSIFQKIGAFED  612

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            EL A+LPKEVE  R+  E+GNP I NRITECRSYPLY+ +REELGTE+LTGEKV+SPGE 
Sbjct  613  ELIAVLPKEVESVRAVFESGNPLIRNRITECRSYPLYRLVREELGTELLTGEKVRSPGEE  672

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
             DKVFTA+C+G IIDPLLECLKSWNGAPLPIC
Sbjct  673  IDKVFTAICNGQIIDPLLECLKSWNGAPLPIC  704



>sp|P24481.1|PAL1_PETCR RecName: Full=Phenylalanine ammonia-lyase 1 [Petroselinum crispum]
 emb|CAA68938.1| PAL1 protein [Petroselinum crispum]
Length=716

 Score =   267 bits (683),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 124/152 (82%), Positives = 138/152 (91%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLLRVVDREY+FAY DDPCSA YPLMQKLRQ LV+HAL+NG++E+N+STSIFQKIA FED
Sbjct  565  DLLRVVDREYIFAYIDDPCSATYPLMQKLRQTLVEHALKNGDNERNLSTSIFQKIATFED  624

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELKALLPKEVE AR+ALE+GNPAIPNRI ECRSYPLYKF+R+ELGTE LTGEKV SPGE 
Sbjct  625  ELKALLPKEVESARAALESGNPAIPNRIEECRSYPLYKFVRKELGTEYLTGEKVTSPGEE  684

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
             +KVF A+  G IIDPLLECL+SWNGAPLPIC
Sbjct  685  FEKVFIAMSKGEIIDPLLECLESWNGAPLPIC  716



>pdb|1W27|A Chain A, Phenylalanine Ammonia-Lyase (Pal) From Petroselinum 
Crispum
 pdb|1W27|B Chain B, Phenylalanine Ammonia-Lyase (Pal) From Petroselinum 
Crispum
Length=714

 Score =   267 bits (683),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 124/152 (82%), Positives = 138/152 (91%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLLRVVDREY+FAY DDPCSA YPLMQKLRQ LV+HAL+NG++E+N+STSIFQKIA FED
Sbjct  563  DLLRVVDREYIFAYIDDPCSATYPLMQKLRQTLVEHALKNGDNERNLSTSIFQKIATFED  622

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELKALLPKEVE AR+ALE+GNPAIPNRI ECRSYPLYKF+R+ELGTE LTGEKV SPGE 
Sbjct  623  ELKALLPKEVESARAALESGNPAIPNRIEECRSYPLYKFVRKELGTEYLTGEKVTSPGEE  682

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
             +KVF A+  G IIDPLLECL+SWNGAPLPIC
Sbjct  683  FEKVFIAMSKGEIIDPLLECLESWNGAPLPIC  714



>gb|AEZ01784.1| phenylalanine ammonia-lyase [Pyrus x bretschneideri]
Length=719

 Score =   267 bits (682),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 123/152 (81%), Positives = 135/152 (89%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLL+VVDREYVFAY DDPCSA YPLMQKLR+VLV+HAL NGE EKN STSIFQKI AFE+
Sbjct  568  DLLKVVDREYVFAYIDDPCSATYPLMQKLREVLVEHALTNGESEKNASTSIFQKIGAFEE  627

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELKALLPKEVE ARSA+E+GN A+PNRI ECRSYPLYKF+REELG E LTGEKV+SPGE 
Sbjct  628  ELKALLPKEVESARSAIESGNAAVPNRIAECRSYPLYKFVREELGGEYLTGEKVRSPGEE  687

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
            CDKVF A+C G IIDP+L CL+ WNGAPLPIC
Sbjct  688  CDKVFQAICQGKIIDPILGCLEGWNGAPLPIC  719



>gb|ABV44808.1| phenylalanine ammonia lyase 1 [Eriobotrya japonica]
Length=330

 Score =   256 bits (655),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 118/151 (78%), Positives = 133/151 (88%), Gaps = 0/151 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLL+VVDREYVF Y DDPCSA YPLMQKLR VLV+HAL NG+ E++ STSIFQKIAAFE+
Sbjct  179  DLLKVVDREYVFTYIDDPCSATYPLMQKLRHVLVEHALSNGDKERSTSTSIFQKIAAFEE  238

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELKALLPKEVE  R+  ENG  AIPNRI ECRSYPLYKF+REELGT++LTGEKV+SPGE 
Sbjct  239  ELKALLPKEVETTRAEYENGKTAIPNRIKECRSYPLYKFVREELGTDLLTGEKVRSPGEE  298

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPI  164
            CDKVF+A+C G +IDPLL+CLK WNGAPLPI
Sbjct  299  CDKVFSAMCAGKLIDPLLDCLKEWNGAPLPI  329



>sp|O23924.1|PALY_DIGLA RecName: Full=Phenylalanine ammonia-lyase [Digitalis lanata]
 emb|CAA05251.1| phenylalanine ammonia lyase [Digitalis lanata]
Length=713

 Score =   266 bits (681),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 125/152 (82%), Positives = 135/152 (89%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLLRVVDREYVFAY DDPCSA YPLMQKLRQVLV+HAL+NGE+EKN STSIFQKI AFE 
Sbjct  562  DLLRVVDREYVFAYVDDPCSATYPLMQKLRQVLVEHALKNGENEKNASTSIFQKIEAFEA  621

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELKA+LPKEVE AR ALE+G PAI NRITECRSYPLYKFIREELGT  LTGEKV SPGE 
Sbjct  622  ELKAVLPKEVESARVALEDGKPAIANRITECRSYPLYKFIREELGTNFLTGEKVMSPGEE  681

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
            CD+VFTA+  G I+DPLL+CL+ WNGAPLPIC
Sbjct  682  CDRVFTAMSKGLIVDPLLKCLEGWNGAPLPIC  713



>ref|XP_009373523.1| PREDICTED: LOW QUALITY PROTEIN: phenylalanine ammonia-lyase 1-like 
[Pyrus x bretschneideri]
Length=719

 Score =   267 bits (682),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 123/152 (81%), Positives = 135/152 (89%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLL+VVDREYVFAY DDPCSA YPLMQKLR+VLV+HAL NGE EKN STSIFQKI AFE+
Sbjct  568  DLLKVVDREYVFAYIDDPCSATYPLMQKLREVLVEHALTNGESEKNASTSIFQKIGAFEE  627

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELKALLPKEVE ARSA+E+GN A+PNRI ECRSYPLYKF+REELG E LTGEKV+SPGE 
Sbjct  628  ELKALLPKEVESARSAIESGNAAVPNRIAECRSYPLYKFVREELGGEYLTGEKVRSPGEE  687

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
            CDKVF A+C G IIDP+L CL+ WNGAPLPIC
Sbjct  688  CDKVFQAICQGKIIDPILGCLEGWNGAPLPIC  719



>gb|ADF59061.1| phenylalanine ammonia-lyase 1 precursor [Pyrus x bretschneideri]
Length=719

 Score =   267 bits (682),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 123/152 (81%), Positives = 135/152 (89%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLL+VVDREYVFAY DDPCSA YPLMQKLR+VLV+HAL NGE EKN STSIFQKI AFE+
Sbjct  568  DLLKVVDREYVFAYIDDPCSATYPLMQKLREVLVEHALTNGESEKNASTSIFQKIGAFEE  627

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELKALLPKEVE ARSA+E+GN A+PNRI ECRSYPLYKF+REELG E LTGEKV+SPGE 
Sbjct  628  ELKALLPKEVESARSAIESGNAAVPNRIAECRSYPLYKFVREELGGEYLTGEKVRSPGEE  687

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
            CDKVF A+C G IIDP+L CL+ WNGAPLPIC
Sbjct  688  CDKVFQAICQGKIIDPILGCLEGWNGAPLPIC  719



>ref|XP_007162755.1| hypothetical protein PHAVU_001G1777000g, partial [Phaseolus vulgaris]
 gb|ESW34749.1| hypothetical protein PHAVU_001G1777000g, partial [Phaseolus vulgaris]
Length=240

 Score =   253 bits (645),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 117/152 (77%), Positives = 132/152 (87%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLL+VVDREYVF+Y DDPCS  YPLMQKLRQVLVDHAL N E+EK+V+TSIFQKIA FE+
Sbjct  89   DLLKVVDREYVFSYIDDPCSGTYPLMQKLRQVLVDHALINAENEKDVNTSIFQKIATFEE  148

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELK +LPKEVE  R+A E+G  AIPN+I ECRSYPLYKF+REELGT +LTGEKV+SPGE 
Sbjct  149  ELKTILPKEVESTRAAYESGKAAIPNKIKECRSYPLYKFVREELGTGLLTGEKVKSPGEE  208

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
             DK+FTA+C G IIDPLLECL  WNGAPLPIC
Sbjct  209  FDKLFTAICQGKIIDPLLECLGEWNGAPLPIC  240



>gb|AGL50914.1| phenylalanine ammonia lyase [Pyrus communis]
Length=720

 Score =   266 bits (681),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 122/152 (80%), Positives = 134/152 (88%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLL+VVDREYVFAY DDPCSA YPLMQKLRQVLV+HAL NGE EKN STSIFQKI AFE+
Sbjct  569  DLLKVVDREYVFAYIDDPCSATYPLMQKLRQVLVEHALTNGESEKNASTSIFQKIGAFEE  628

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELK LLPKEVE ARSA+E+GN A+PNRI ECRSYPLYKF+REELG E LTGEKV+SPGE 
Sbjct  629  ELKTLLPKEVESARSAIESGNAAVPNRIAECRSYPLYKFVREELGGEYLTGEKVRSPGEE  688

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
            CD+VF A+C G IIDP+L CL+ WNGAPLPIC
Sbjct  689  CDRVFQAICQGKIIDPILGCLEGWNGAPLPIC  720



>ref|XP_009342990.1| PREDICTED: phenylalanine ammonia-lyase 1 [Pyrus x bretschneideri]
Length=720

 Score =   266 bits (681),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 122/152 (80%), Positives = 134/152 (88%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLL+VVDREYVFAY DDPCSA YPLMQKLRQVLV+HAL NGE EKN STSIFQKI AFE+
Sbjct  569  DLLKVVDREYVFAYIDDPCSATYPLMQKLRQVLVEHALTNGESEKNASTSIFQKIGAFEE  628

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELK LLPKEVE ARSA+E+GN A+PNRI ECRSYPLYKF+REELG E LTGEKV+SPGE 
Sbjct  629  ELKTLLPKEVESARSAIESGNAAVPNRIAECRSYPLYKFVREELGGEYLTGEKVRSPGEE  688

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
            CD+VF A+C G IIDP+L CL+ WNGAPLPIC
Sbjct  689  CDRVFQAICQGKIIDPILGCLEGWNGAPLPIC  720



>gb|AGL81344.1| phenylalanine ammonia lyase [Pyrus communis]
Length=720

 Score =   266 bits (681),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 122/152 (80%), Positives = 134/152 (88%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLL+VVDREYVFAY DDPCSA YPLMQKLRQVLV+HAL NGE EKN STSIFQKI AFE+
Sbjct  569  DLLKVVDREYVFAYIDDPCSATYPLMQKLRQVLVEHALTNGESEKNASTSIFQKIGAFEE  628

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELK LLPKEVE ARSA+E+GN A+PNRI ECRSYPLYKF+REELG E LTGEKV+SPGE 
Sbjct  629  ELKTLLPKEVESARSAIESGNAAVPNRIAECRSYPLYKFVREELGGEYLTGEKVRSPGEE  688

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
            CD+VF A+C G IIDP+L CL+ WNGAPLPIC
Sbjct  689  CDRVFQAICQGKIIDPILGCLEGWNGAPLPIC  720



>ref|XP_008243955.1| PREDICTED: phenylalanine ammonia-lyase 1 [Prunus mume]
Length=717

 Score =   266 bits (680),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 120/152 (79%), Positives = 138/152 (91%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLL+VVDREYVFAY DDPCSA YPLMQKLRQVLV+HAL NGE+EKN STSIFQKI AFE+
Sbjct  566  DLLKVVDREYVFAYIDDPCSATYPLMQKLRQVLVEHALTNGENEKNASTSIFQKIVAFEE  625

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELK LLPKEV+ AR+AL++G+  +PNRITECRSYPLYKF+REELG E LTGEKV+SPGE 
Sbjct  626  ELKVLLPKEVDSARAALDSGSAGVPNRITECRSYPLYKFVREELGAEYLTGEKVRSPGEE  685

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
            CDKVF+A+C+G IIDP+L+CL+ WNGAPLPIC
Sbjct  686  CDKVFSAICEGKIIDPILDCLEGWNGAPLPIC  717



>ref|XP_003633985.1| PREDICTED: phenylalanine ammonia-lyase-like [Vitis vinifera]
Length=710

 Score =   266 bits (679),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 122/152 (80%), Positives = 138/152 (91%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLL+VVDRE+VFAY DDPCSA YPLMQKLRQVLV+HAL NGE+EKN STSIFQKI AFE+
Sbjct  559  DLLKVVDREHVFAYIDDPCSATYPLMQKLRQVLVEHALSNGENEKNGSTSIFQKIVAFEE  618

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELKA+LPKEVE AR  +E+GNP+IPNRI ECRSYPLYKF+REELGT +LTGEKV+SPGE 
Sbjct  619  ELKAVLPKEVESARGGVESGNPSIPNRIKECRSYPLYKFVREELGTGLLTGEKVRSPGEE  678

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
             DKVFTA+C+G IIDPLL+CL +WNGAPLPIC
Sbjct  679  FDKVFTAMCEGKIIDPLLDCLSAWNGAPLPIC  710



>gb|ABB70117.2| phenylalanine ammonia lyase [Pyrus communis]
Length=720

 Score =   266 bits (680),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 122/152 (80%), Positives = 134/152 (88%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLL+VVDREYVFAY DDPCSA YPLMQKLRQVLV+HAL NGE EKN STSIFQKI AFE+
Sbjct  569  DLLKVVDREYVFAYIDDPCSATYPLMQKLRQVLVEHALTNGESEKNASTSIFQKIGAFEE  628

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELK LLPKEVE ARSA+E+GN A+PNRI ECRSYPLYKF+REELG E LTGEKV+SPGE 
Sbjct  629  ELKTLLPKEVESARSAIESGNAAVPNRIAECRSYPLYKFVREELGGEYLTGEKVRSPGEE  688

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
            CD+VF A+C G IIDP+L CL+ WNGAPLPIC
Sbjct  689  CDRVFQAICQGKIIDPILGCLEGWNGAPLPIC  720



>gb|AEX32784.1| phenylalanine ammonia-lyase [Vitis vinifera]
Length=710

 Score =   266 bits (679),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 122/152 (80%), Positives = 139/152 (91%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLL+VVDRE+VFAY DDPCSA YPLMQK+RQVLV+HAL NGE+EKN STSIFQKIAAFE+
Sbjct  559  DLLKVVDREHVFAYIDDPCSATYPLMQKVRQVLVEHALNNGENEKNGSTSIFQKIAAFEE  618

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELKA+LPKEVE AR  +E+GNP+IPNRI ECRSYPLYKF+REELGT +LTGEKV+SPGE 
Sbjct  619  ELKAVLPKEVESARGGVESGNPSIPNRIKECRSYPLYKFVREELGTGLLTGEKVRSPGED  678

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
             DKVFTA+C+G IIDPLL+CL +WNGAPLPIC
Sbjct  679  FDKVFTAMCEGKIIDPLLDCLSAWNGAPLPIC  710



>ref|XP_003635657.2| PREDICTED: phenylalanine ammonia-lyase-like [Vitis vinifera]
Length=710

 Score =   266 bits (679),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 122/152 (80%), Positives = 139/152 (91%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLL+VVDRE+VFAY DDPCSA YPLMQK+RQVLV+HAL NGE+EKN STSIFQKIAAFE+
Sbjct  559  DLLKVVDREHVFAYIDDPCSATYPLMQKVRQVLVEHALNNGENEKNGSTSIFQKIAAFEE  618

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELKA+LPKEVE AR  +E+GNP+IPNRI ECRSYPLYKF+REELGT +LTGEKV+SPGE 
Sbjct  619  ELKAVLPKEVESARGGVESGNPSIPNRIKECRSYPLYKFVREELGTGLLTGEKVRSPGED  678

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
             DKVFTA+C+G IIDPLL+CL +WNGAPLPIC
Sbjct  679  FDKVFTAMCEGKIIDPLLDCLSAWNGAPLPIC  710



>ref|XP_002531677.1| Phenylalanine ammonia-lyase, putative [Ricinus communis]
 gb|EEF30696.1| Phenylalanine ammonia-lyase, putative [Ricinus communis]
Length=719

 Score =   266 bits (679),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 122/152 (80%), Positives = 136/152 (89%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLL+VVDREY+FAY DDPCSA YPLMQKLRQVLVDHAL NGE EKN STSIFQKI AFE+
Sbjct  568  DLLKVVDREYIFAYIDDPCSATYPLMQKLRQVLVDHALLNGEKEKNSSTSIFQKIGAFEE  627

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELKALLPKEVE AR+  +NGNPAIPN+I ECRSYPLYKF+REELGT +LTGEK++SPGE 
Sbjct  628  ELKALLPKEVENARTEYDNGNPAIPNKIKECRSYPLYKFVREELGTGLLTGEKIRSPGEE  687

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
             DKVF+A+C G +IDP+LECLK WNGAPLPIC
Sbjct  688  FDKVFSAMCAGKLIDPMLECLKEWNGAPLPIC  719



>gb|ABV71917.1| PAL [Solenostemon scutellarioides]
Length=233

 Score =   252 bits (643),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 119/150 (79%), Positives = 129/150 (86%), Gaps = 0/150 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DL+RVVDREYVFAY DDPCSA YPLMQKLRQVLVDHALQNGE+EKNV TSIF KI +FE+
Sbjct  84   DLIRVVDREYVFAYIDDPCSATYPLMQKLRQVLVDHALQNGENEKNVGTSIFHKIESFEE  143

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELKALLPKE E AR +LE+GNPAI NRI ECRSYPLYKFIR ELG   LTGEK  SPGE 
Sbjct  144  ELKALLPKEDESARISLESGNPAIANRIAECRSYPLYKFIRGELGASFLTGEKATSPGEE  203

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLP  167
            C+KVFTA+  G I+DPLLECL+ WNGAPLP
Sbjct  204  CEKVFTALSKGLIVDPLLECLQGWNGAPLP  233



>ref|XP_008355619.1| PREDICTED: LOW QUALITY PROTEIN: phenylalanine ammonia-lyase 1-like 
[Malus domestica]
Length=720

 Score =   266 bits (679),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 122/152 (80%), Positives = 134/152 (88%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLL+VVDREYVFAY DDPCSA YPLMQKLR+VL +HAL NGE EKN STSIFQKI AFE+
Sbjct  569  DLLKVVDREYVFAYIDDPCSATYPLMQKLREVLXEHALTNGESEKNASTSIFQKIGAFEE  628

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELKALLPKEVE ARSA+E+GN A+PNRI ECRSYPLYKF+REELG E LTGEKV+SPGE 
Sbjct  629  ELKALLPKEVESARSAIESGNAAVPNRIAECRSYPLYKFVREELGGEYLTGEKVRSPGEE  688

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
            CDKVF A+C G IIDP+L CL+ WNGAPLPIC
Sbjct  689  CDKVFQAICQGKIIDPILGCLEGWNGAPLPIC  720



>ref|XP_006364022.1| PREDICTED: phenylalanine ammonia-lyase-like [Solanum tuberosum]
Length=723

 Score =   266 bits (679),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 119/152 (78%), Positives = 139/152 (91%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            +LLRVVDREY+FAYADDPCS+NYPLMQKLRQVLVD A++NGE EK+ ++SIFQKI AFED
Sbjct  572  ELLRVVDREYLFAYADDPCSSNYPLMQKLRQVLVDQAMKNGESEKHFNSSIFQKIGAFED  631

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            EL A+LPKEVE  R+ +E+GNP+IPNRITECRSYPLY+ +R+ELGTE+LTGEK++SPGE 
Sbjct  632  ELIAVLPKEVESVRAVVESGNPSIPNRITECRSYPLYRLVRQELGTEVLTGEKIRSPGEE  691

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
             DKVFTA C+G IIDPLLECLKSWNGAPLPIC
Sbjct  692  IDKVFTAFCNGQIIDPLLECLKSWNGAPLPIC  723



>pir||JQ1070 phenylalanine ammonia-lyase (EC 4.3.1.5) - soybean  (fragment)
Length=416

 Score =   258 bits (658),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 121/152 (80%), Positives = 132/152 (87%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLL+VVDREY FAY DDPCS  YPLMQKLRQVLVD+AL NGE+EKN +TSIFQKIA+FE+
Sbjct  265  DLLKVVDREYTFAYIDDPCSGTYPLMQKLRQVLVDYALANGENEKNTNTSIFQKIASFEE  324

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELK LLPKEVEGAR A EN   AIPN+I ECRSYPLYKF+REELGT +LTGE+V SPGE 
Sbjct  325  ELKTLLPKEVEGARVAYENDQCAIPNKIKECRSYPLYKFVREELGTALLTGERVISPGEE  384

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
            CDKVFTA+C G IIDPLLECL  WNGAPLPIC
Sbjct  385  CDKVFTALCQGNIIDPLLECLGEWNGAPLPIC  416



>ref|XP_008369679.1| PREDICTED: phenylalanine ammonia-lyase 1-like [Malus domestica]
Length=720

 Score =   265 bits (678),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 122/152 (80%), Positives = 134/152 (88%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLL+VVDREYVFAY DDPCSA YPLMQKLR+VL +HAL NGE EKN STSIFQKI AFE+
Sbjct  569  DLLKVVDREYVFAYIDDPCSATYPLMQKLREVLXEHALTNGESEKNASTSIFQKIGAFEE  628

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELKALLPKEVE ARSA+E+GN A+PNRI ECRSYPLYKF+REELG E LTGEKV+SPGE 
Sbjct  629  ELKALLPKEVESARSAIESGNAAVPNRIAECRSYPLYKFVREELGGEYLTGEKVRSPGEE  688

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
            CDKVF A+C G IIDP+L CL+ WNGAPLPIC
Sbjct  689  CDKVFQAICQGKIIDPILGCLEGWNGAPLPIC  720



>ref|XP_002267953.1| PREDICTED: phenylalanine ammonia-lyase [Vitis vinifera]
Length=710

 Score =   265 bits (678),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 122/152 (80%), Positives = 138/152 (91%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLL+VVDRE+VFAY DDPCSA YPLMQKLRQVLV+HAL NGE+EKN STSIFQKI AFE+
Sbjct  559  DLLKVVDREHVFAYIDDPCSATYPLMQKLRQVLVEHALSNGENEKNGSTSIFQKIVAFEE  618

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELKA+LPKEVE AR A+E+GNP+ PNRI ECRSYPLYKF+REELGT +LTGEKV+SPGE 
Sbjct  619  ELKAVLPKEVESARGAVESGNPSTPNRIKECRSYPLYKFVREELGTGLLTGEKVRSPGED  678

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
             DKVFTA+C+G IIDPLL+CL +WNGAPLPIC
Sbjct  679  FDKVFTAMCEGKIIDPLLDCLSAWNGAPLPIC  710



>gb|AHY94892.1| phenylalanine ammonia lyase [Prunella vulgaris]
Length=710

 Score =   265 bits (677),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 124/152 (82%), Positives = 134/152 (88%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            +L+RVVDREYVFAYADDPCSA YPLMQKLRQVLVDHAL+NG+ EKNVSTSIF KI AFE+
Sbjct  559  ELIRVVDREYVFAYADDPCSATYPLMQKLRQVLVDHALKNGDGEKNVSTSIFHKIEAFEE  618

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELKALLPKEVE AR ALE+G PA+ NRI ECRSYPLYKFIRE LGT  LTGEK  SPGE 
Sbjct  619  ELKALLPKEVESARIALESGAPAVANRIAECRSYPLYKFIREGLGTGFLTGEKAVSPGEE  678

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
            CDKVFTA+CDG I+DPLLECL+ WNG PLPIC
Sbjct  679  CDKVFTALCDGLIVDPLLECLQGWNGEPLPIC  710



>dbj|BAF36969.1| phenylalanine ammonia-lyase [Lotus japonicus]
Length=437

 Score =   258 bits (659),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 120/152 (79%), Positives = 134/152 (88%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLL+VVDRE +FAY DDPC A YPLMQKLRQVLVDHAL NGE+EK+  TSIFQKI +FED
Sbjct  286  DLLKVVDRETLFAYIDDPCLATYPLMQKLRQVLVDHALVNGENEKDSKTSIFQKIGSFED  345

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELK+LLPKEVE AR+A E+GNPAIPN+I ECRSYPLYKF+REELGTE+LTGEK +SPGE 
Sbjct  346  ELKSLLPKEVESARAAYESGNPAIPNKINECRSYPLYKFVREELGTELLTGEKSRSPGEE  405

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
             DK+FTA+C G IIDPLLECL  WNGAPLPIC
Sbjct  406  FDKLFTAICQGKIIDPLLECLGEWNGAPLPIC  437



>gb|AFN85669.1| phenylalanine ammonia-lyase [Hibiscus cannabinus]
Length=715

 Score =   265 bits (678),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 123/152 (81%), Positives = 136/152 (89%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLL+VVD EYVFAY DDPCSA YPLMQKLRQVLV+HAL NGE+EKN STSIFQKIAAFE+
Sbjct  564  DLLKVVDCEYVFAYVDDPCSATYPLMQKLRQVLVEHALTNGENEKNTSTSIFQKIAAFEE  623

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELK +LPKEVE AR +LENGN AIPNRI +CRSYPLYKF+REE+GT +LTGEKV+SPGE 
Sbjct  624  ELKVVLPKEVESARVSLENGNAAIPNRIKDCRSYPLYKFVREEIGTGLLTGEKVKSPGEE  683

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
             DKVFTA+C G IIDP+LECLK WNGAPLPIC
Sbjct  684  FDKVFTAICQGKIIDPMLECLKEWNGAPLPIC  715



>dbj|BAF36970.1| phenylalanine ammonia-lyase [Lotus japonicus]
Length=704

 Score =   265 bits (677),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 121/152 (80%), Positives = 135/152 (89%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLL+VVDRE +F+Y DDPCSA YPLMQKLRQVLVDHAL NGE+EK+  TSIFQKIA FED
Sbjct  553  DLLKVVDRETLFSYIDDPCSATYPLMQKLRQVLVDHALVNGENEKDSKTSIFQKIATFED  612

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELK+LLPKEVE AR+A E+GNP IPN+I ECRSYPLYKF+REELGTE+LTGEK +SPGE 
Sbjct  613  ELKSLLPKEVESARAAYESGNPTIPNKINECRSYPLYKFVREELGTELLTGEKTRSPGEE  672

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
            CDK+FTA+C G IIDPLLECL  WNGAPLPIC
Sbjct  673  CDKLFTAICQGKIIDPLLECLGEWNGAPLPIC  704



>gb|AHZ31605.1| phenylalanine ammonia-lyase [Olea europaea]
 gb|AHZ31606.1| phenylalanine ammonia-lyase [Olea europaea]
Length=713

 Score =   265 bits (677),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 125/152 (82%), Positives = 134/152 (88%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLLRVVDREYVFAY DDPCSA YPLMQKLRQVLV+HAL+NGE EK  +TSIFQKI AFED
Sbjct  562  DLLRVVDREYVFAYIDDPCSATYPLMQKLRQVLVEHALKNGETEKEANTSIFQKIGAFED  621

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            EL A LPKEVE AR ALE+GNPAIPN+I ECRSYPLYKF+REELGTE+LTGEKV+SPGE 
Sbjct  622  ELIANLPKEVESARIALESGNPAIPNKINECRSYPLYKFVREELGTELLTGEKVRSPGEE  681

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
            CDKVFTA+  G IIDPLLECL  WNG PLPIC
Sbjct  682  CDKVFTAMSKGLIIDPLLECLNGWNGEPLPIC  713



>gb|AAK84225.1|AF401636_1 phenylalanine ammonia-lyase [Rehmannia glutinosa]
Length=708

 Score =   265 bits (676),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 127/152 (84%), Positives = 133/152 (88%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLLRVVDREYVFAY DDPCS  YPLMQKLRQVLVDHAL NGE EKNVSTSIFQKI AFE 
Sbjct  557  DLLRVVDREYVFAYIDDPCSGTYPLMQKLRQVLVDHALNNGESEKNVSTSIFQKIEAFEV  616

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELKA+LPKEVE AR ALE+GNPAI NRITECRSYPLYKFIREELGT  LTGEKV SPGE 
Sbjct  617  ELKAILPKEVESARIALESGNPAIGNRITECRSYPLYKFIREELGTNYLTGEKVVSPGEE  676

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
            CDKVFTA+  G I+DPLL+CL+ WNGAP PIC
Sbjct  677  CDKVFTALSKGLIVDPLLKCLEGWNGAPPPIC  708



>gb|AEX32790.1| phenylalanine ammonia-lyase [Vitis vinifera]
Length=710

 Score =   265 bits (676),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 121/152 (80%), Positives = 138/152 (91%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLL+VVDRE+VFAY DDPCSA YPLMQK+RQVLV+HAL NGE+EKN STSIFQKI AFE+
Sbjct  559  DLLKVVDREHVFAYIDDPCSATYPLMQKVRQVLVEHALNNGENEKNGSTSIFQKIVAFEE  618

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELKA+LPKEVE AR  +E+GNP+IPNRI ECRSYPLYKF+REELGT +LTGEKV+SPGE 
Sbjct  619  ELKAVLPKEVESARGGVESGNPSIPNRIKECRSYPLYKFVREELGTGLLTGEKVRSPGED  678

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
             DKVFTA+C+G IIDPLL+CL +WNGAPLPIC
Sbjct  679  FDKVFTAICEGKIIDPLLDCLSAWNGAPLPIC  710



>ref|XP_007009873.1| Phenylalanine ammonia-lyase 2 [Theobroma cacao]
 gb|EOY18683.1| Phenylalanine ammonia-lyase 2 [Theobroma cacao]
Length=713

 Score =   265 bits (676),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 123/152 (81%), Positives = 133/152 (88%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLLRVVDREY++AY DDPCSA YPLMQKLRQVLVDHAL NG+ EKN +TSIFQKI AFE+
Sbjct  562  DLLRVVDREYLYAYVDDPCSATYPLMQKLRQVLVDHALMNGDREKNSTTSIFQKIGAFEE  621

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELK LLPKEVEGAR   ENGN AIPNRI ECRSYPLYKF+RE LGT +LTGEKV SPGE 
Sbjct  622  ELKTLLPKEVEGARIEFENGNAAIPNRIEECRSYPLYKFVREVLGTSLLTGEKVISPGEE  681

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
            CDKVF+A+C G +IDPLLECLK WNGAPLPIC
Sbjct  682  CDKVFSAMCAGKLIDPLLECLKEWNGAPLPIC  713



>ref|XP_002281799.1| PREDICTED: phenylalanine ammonia-lyase [Vitis vinifera]
Length=710

 Score =   265 bits (676),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 121/152 (80%), Positives = 136/152 (89%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLL+VVDREY+FAY DDPCS  YPLMQK+RQVLV+HAL NGE+EKNVSTSIFQKI AFE+
Sbjct  559  DLLKVVDREYIFAYIDDPCSETYPLMQKVRQVLVEHALNNGENEKNVSTSIFQKIVAFEE  618

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELKALLPKEVE  R+ LE+GNP IPNRI +CRSYPLYKF+REELGT +LTGEKV+SPGE 
Sbjct  619  ELKALLPKEVESTRAGLESGNPFIPNRIKDCRSYPLYKFVREELGTGLLTGEKVRSPGEE  678

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
             DKVFTA+C+G IIDPLL+CL  WNGAPLPIC
Sbjct  679  FDKVFTAMCEGKIIDPLLDCLSGWNGAPLPIC  710



>ref|XP_007027354.1| PHE ammonia lyase 1 [Theobroma cacao]
 gb|EOY07856.1| PHE ammonia lyase 1 [Theobroma cacao]
Length=722

 Score =   265 bits (676),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 122/152 (80%), Positives = 134/152 (88%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLL+ VD EYVFAY DDPCSA YPLMQKLRQVLV+HAL NGE+EKN STSIFQK+AAFE+
Sbjct  571  DLLKAVDSEYVFAYIDDPCSATYPLMQKLRQVLVEHALANGENEKNASTSIFQKVAAFEE  630

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELKA+LPKEVE AR +LENGN  IPNRI ECRSYPLYKF+REELGT +LTGE V+SPGE 
Sbjct  631  ELKAILPKEVESARLSLENGNAGIPNRIQECRSYPLYKFVREELGTGLLTGENVKSPGEE  690

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
             DKVFTA+C G IIDP+LECLK WNGAPLPIC
Sbjct  691  FDKVFTAMCQGKIIDPMLECLKEWNGAPLPIC  722



>gb|ACF94715.1| phenylalanine ammonia lyase [Robinia pseudoacacia]
Length=332

 Score =   254 bits (648),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 120/152 (79%), Positives = 130/152 (86%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLL+VVDREYVFAY DD CSA YPLMQKLRQVLVDHAL N + EKN++TSIFQKI  FE+
Sbjct  181  DLLKVVDREYVFAYVDDACSATYPLMQKLRQVLVDHALANADGEKNLNTSIFQKITTFEE  240

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELK LLPKEVE AR A ENG  AIPN+I ECRSYPLYKF+REELGT +LTGEKV SPGE 
Sbjct  241  ELKTLLPKEVESARVAYENGQCAIPNKIEECRSYPLYKFVREELGTGLLTGEKVISPGEE  300

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
            CDK+FTA+C G IIDPLLECL  WNGAPLPIC
Sbjct  301  CDKLFTAMCQGKIIDPLLECLGEWNGAPLPIC  332



>ref|XP_004253518.1| PREDICTED: phenylalanine ammonia-lyase-like, partial [Solanum 
lycopersicum]
Length=582

 Score =   261 bits (667),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 120/151 (79%), Positives = 138/151 (91%), Gaps = 0/151 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            +LL VVDREY+FAYADDPCS+NYPLMQKLRQVLVD+A++NGE EKNV++SIFQKI AFED
Sbjct  431  ELLLVVDREYLFAYADDPCSSNYPLMQKLRQVLVDYAMKNGESEKNVNSSIFQKIGAFED  490

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELK +LP EVE AR  LE G+P IPNRITECRSYPLY+F+R+ELGTE+LTGE+V+SPGE 
Sbjct  491  ELKVVLPDEVENARVVLEGGSPLIPNRITECRSYPLYRFVRKELGTELLTGERVRSPGED  550

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPI  164
             DKVFTA+C+G IIDPLLECLKSWNGAPLPI
Sbjct  551  VDKVFTALCNGQIIDPLLECLKSWNGAPLPI  581



>ref|XP_003633987.1| PREDICTED: phenylalanine ammonia-lyase-like [Vitis vinifera]
Length=710

 Score =   264 bits (675),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 121/152 (80%), Positives = 138/152 (91%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLL+VVDRE+VFAY DDPCSA YPLMQK+RQVLV+HAL NGE+EKN STSIFQKI AFE+
Sbjct  559  DLLKVVDREHVFAYIDDPCSATYPLMQKVRQVLVEHALNNGENEKNGSTSIFQKIVAFEE  618

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELKA+LPKEVE AR  +E+GNP+IPNRI ECRSYPLYKF+REELGT +LTGEKV+SPGE 
Sbjct  619  ELKAVLPKEVESARGGVESGNPSIPNRIKECRSYPLYKFVREELGTGLLTGEKVRSPGED  678

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
             DKVFTA+C+G IIDPLL+CL +WNGAPLPIC
Sbjct  679  FDKVFTAMCEGKIIDPLLDCLSAWNGAPLPIC  710



>gb|ABM67591.1| phenylalanin ammonia-lyase [Vitis vinifera]
Length=710

 Score =   264 bits (675),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 121/152 (80%), Positives = 138/152 (91%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLL+VVDRE+VFAY DDPCSA YPLMQK+RQVLV+HAL NGE+EKN STSIFQKI AFE+
Sbjct  559  DLLKVVDREHVFAYIDDPCSATYPLMQKVRQVLVEHALNNGENEKNGSTSIFQKIGAFEE  618

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELKA+LPKEVE AR  +E+GNP+IPNRI ECRSYPLYKF+REELGT +LTGEKV+SPGE 
Sbjct  619  ELKAVLPKEVESARDGVESGNPSIPNRIKECRSYPLYKFVREELGTGLLTGEKVRSPGED  678

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
             DKVFTA+C+G IIDPLL+CL +WNGAPLPIC
Sbjct  679  FDKVFTAMCEGKIIDPLLDCLSAWNGAPLPIC  710



>dbj|BAD94354.1| phenylalanine ammonia lyase [Arabidopsis thaliana]
Length=357

 Score =   254 bits (650),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 116/152 (76%), Positives = 132/152 (87%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLL+VVDRE V+ YADDPCSA YPL+QKLRQV+VDHAL NGE EKN  TSIF KI AFE+
Sbjct  206  DLLKVVDREQVYTYADDPCSATYPLIQKLRQVIVDHALINGESEKNAVTSIFHKIGAFEE  265

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELKA+LPKEVE AR+A +NG  AIPNRI ECRSYPLY+F+REELGTE+LTGEKV SPGE 
Sbjct  266  ELKAVLPKEVEAARAAYDNGTSAIPNRIKECRSYPLYRFVREELGTELLTGEKVTSPGEE  325

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
             DKVFTA+C+G IIDP++ECL  WNGAP+PIC
Sbjct  326  FDKVFTAICEGKIIDPMMECLNEWNGAPIPIC  357



>gb|AGA84059.1| phenylalanine ammonia lyase [Picrorhiza kurrooa]
Length=713

 Score =   264 bits (675),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 125/152 (82%), Positives = 134/152 (88%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLLRVVDREYVFAY DDPCSA YPLMQKLRQVLVD+AL+NGE EKN STSIF KI AFE+
Sbjct  562  DLLRVVDREYVFAYVDDPCSATYPLMQKLRQVLVDNALKNGESEKNASTSIFHKIEAFEE  621

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELK+LLPKEVE AR ALE GNPAI NRI ECRSYPLYKFIREELGTE LTGEKV SPGE 
Sbjct  622  ELKSLLPKEVESARIALEAGNPAIGNRIKECRSYPLYKFIREELGTEYLTGEKVISPGEE  681

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
            CDK+FTA+  G I+DPLL+CL+ WNGAPLPIC
Sbjct  682  CDKIFTAISKGLIVDPLLKCLEGWNGAPLPIC  713



>gb|AFZ78651.1| phenylalanine ammonia-lyase [Populus tomentosa]
Length=711

 Score =   264 bits (674),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 123/152 (81%), Positives = 132/152 (87%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLL+VVDRE+ F Y DDPCSA YPLMQKLRQVLVDHAL NGE E N STSIFQKI AFE+
Sbjct  560  DLLKVVDREHAFTYIDDPCSATYPLMQKLRQVLVDHALMNGEKEHNSSTSIFQKIGAFEE  619

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELK LLPKEVE AR  LENGNPAIPNRITECRSYPLYKF+REELGT +LTGEKV SPGE 
Sbjct  620  ELKTLLPKEVENARLELENGNPAIPNRITECRSYPLYKFVREELGTILLTGEKVGSPGEE  679

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
             DKVFTA+C G +IDP+LECLK WNGAPLP+C
Sbjct  680  FDKVFTAICAGKLIDPMLECLKEWNGAPLPLC  711



>ref|XP_002312013.1| phenylalanine ammonia-lyase family protein [Populus trichocarpa]
 gb|ACC63890.1| phenylalanine ammonia-lyase [Populus trichocarpa]
 gb|EEE89380.1| phenylalanine ammonia-lyase family protein [Populus trichocarpa]
Length=711

 Score =   264 bits (674),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 123/152 (81%), Positives = 132/152 (87%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLL+VVDRE+ F Y DDPCSA YPLMQKLRQVLVDHAL NGE E N STSIFQKI AFE+
Sbjct  560  DLLKVVDREHAFTYIDDPCSATYPLMQKLRQVLVDHALMNGEKEHNSSTSIFQKIGAFEE  619

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELK LLPKEVE AR  LENGNPAIPNRITECRSYPLYKF+REELGT +LTGEKV SPGE 
Sbjct  620  ELKTLLPKEVENARLELENGNPAIPNRITECRSYPLYKFVREELGTILLTGEKVGSPGEE  679

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
             DKVFTA+C G +IDP+LECLK WNGAPLP+C
Sbjct  680  FDKVFTAICAGKLIDPMLECLKEWNGAPLPLC  711



>ref|XP_003633986.1| PREDICTED: phenylalanine ammonia-lyase-like [Vitis vinifera]
Length=710

 Score =   264 bits (674),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 121/152 (80%), Positives = 138/152 (91%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLL+VVDRE+VFAY DDPCSA YPLMQK+RQVLV+HAL NGE+EKN STSIFQKI AFE+
Sbjct  559  DLLKVVDREHVFAYIDDPCSATYPLMQKVRQVLVEHALNNGENEKNGSTSIFQKIGAFEE  618

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELKA+LPKEVE AR  +E+GNP+IPNRI ECRSYPLYKF+REELGT +LTGEKV+SPGE 
Sbjct  619  ELKAVLPKEVESARDGVESGNPSIPNRIKECRSYPLYKFVREELGTGLLTGEKVRSPGED  678

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
             DKVFTA+C+G IIDPLL+CL +WNGAPLPIC
Sbjct  679  FDKVFTAMCEGKIIDPLLDCLSAWNGAPLPIC  710



>ref|XP_002268181.1| PREDICTED: phenylalanine ammonia-lyase [Vitis vinifera]
 ref|XP_010662070.1| PREDICTED: phenylalanine ammonia-lyase [Vitis vinifera]
Length=710

 Score =   264 bits (674),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 121/152 (80%), Positives = 138/152 (91%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLL+VVDRE+VFAY DDPCSA YPLMQK+RQVLV+HAL NGE+EKN STSIFQKI AFE+
Sbjct  559  DLLKVVDREHVFAYIDDPCSATYPLMQKVRQVLVEHALNNGENEKNGSTSIFQKIVAFEE  618

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELKA+LPKEVE AR  +E+GNP+IPNRI ECRSYPLYKF+REELGT +LTGEKV+SPGE 
Sbjct  619  ELKAVLPKEVESARGGVESGNPSIPNRIRECRSYPLYKFVREELGTGLLTGEKVRSPGED  678

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
             DKVFTA+C+G IIDPLL+CL +WNGAPLPIC
Sbjct  679  FDKVFTAMCEGKIIDPLLDCLSAWNGAPLPIC  710



>ref|XP_006354337.1| PREDICTED: phenylalanine ammonia-lyase-like isoform X2 [Solanum 
tuberosum]
Length=719

 Score =   264 bits (674),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 118/152 (78%), Positives = 139/152 (91%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            +LL+VV+REY+F YADDPCS+ YPLMQKLRQVLVDHA++NG  E NV++SIFQKI AFE+
Sbjct  568  ELLQVVEREYLFTYADDPCSSTYPLMQKLRQVLVDHAMKNGVSETNVNSSIFQKIVAFEE  627

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELKA+LPKEVE AR+ LE+GNP+IPNRITECRSYPLY+ +R+ELGTE+LTGEK++SPGE 
Sbjct  628  ELKAVLPKEVESARAMLESGNPSIPNRITECRSYPLYRLVRQELGTEVLTGEKIRSPGEE  687

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
             DKVFTA C+G IIDPLLECLKSWNGAPLPIC
Sbjct  688  IDKVFTAFCNGQIIDPLLECLKSWNGAPLPIC  719



>gb|AEZ67457.1| phenylalanine ammonia-lyase [Perilla frutescens]
Length=711

 Score =   263 bits (673),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 123/152 (81%), Positives = 132/152 (87%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DL+ VVDREYVFAY DDPCSA YPLMQKLRQVLVDHAL+NGE EKNVSTSIF KI AFE+
Sbjct  560  DLISVVDREYVFAYIDDPCSATYPLMQKLRQVLVDHALKNGETEKNVSTSIFHKIEAFEE  619

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELKALLPKEVE AR ALE GNPAI NRI+ECRSYPLYKFIREELG   LTGEK  SPGE 
Sbjct  620  ELKALLPKEVESARIALEGGNPAIANRISECRSYPLYKFIREELGASFLTGEKTTSPGEE  679

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
            CD+VFTA+ +G I+DPLL CL+ WNGAPLPIC
Sbjct  680  CDRVFTALSNGLIVDPLLNCLQGWNGAPLPIC  711



>sp|P45728.1|PAL2_PETCR RecName: Full=Phenylalanine ammonia-lyase 2 [Petroselinum crispum]
 emb|CAA57056.1| phenylalanine ammonia-lyase 2 [Petroselinum crispum]
Length=716

 Score =   264 bits (674),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 122/152 (80%), Positives = 136/152 (89%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLLR VDREY+FAY DDPCSA YPLMQKLRQ LV+HAL+NG++E+N++TSIFQKIA FED
Sbjct  565  DLLRFVDREYIFAYIDDPCSATYPLMQKLRQTLVEHALKNGDNERNMNTSIFQKIATFED  624

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELKALLPKEVE AR+ALE+GNPAIPNRI ECRSYPLYKF+R+ELG E LTGEKV SPGE 
Sbjct  625  ELKALLPKEVESARAALESGNPAIPNRIEECRSYPLYKFVRKELGIEYLTGEKVTSPGEE  684

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
             DKVF A+  G IIDPLLECL+SWNGAPLPIC
Sbjct  685  FDKVFIAMSKGEIIDPLLECLESWNGAPLPIC  716



>ref|XP_011041027.1| PREDICTED: phenylalanine ammonia-lyase G2B-like isoform X2 [Populus 
euphratica]
Length=711

 Score =   263 bits (673),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 121/152 (80%), Positives = 135/152 (89%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLL+VVDRE+VF+Y DDPCSA YPLMQKLRQVLV+HAL NGE E+N +TSIFQKI +FE+
Sbjct  560  DLLKVVDREHVFSYIDDPCSATYPLMQKLRQVLVEHALVNGERERNSTTSIFQKIGSFEE  619

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELK LLPKEVE AR  +ENGNPAIPNRI ECRSYPLYKF+REELGT +LTGEKV+SPGE 
Sbjct  620  ELKTLLPKEVENARLEVENGNPAIPNRIKECRSYPLYKFVREELGTRLLTGEKVKSPGEE  679

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
             DKVFTA+C G +IDPLLECLK WNGAPLPIC
Sbjct  680  FDKVFTAICAGKLIDPLLECLKEWNGAPLPIC  711



>ref|XP_010662075.1| PREDICTED: phenylalanine ammonia-lyase [Vitis vinifera]
Length=710

 Score =   263 bits (673),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 121/152 (80%), Positives = 138/152 (91%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLL+VVDRE+VFAY DDPCSA YPLMQK+RQVLV+HAL NGE+EKN STSIFQKI AFE+
Sbjct  559  DLLKVVDREHVFAYIDDPCSATYPLMQKVRQVLVEHALNNGENEKNGSTSIFQKILAFEE  618

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELKA+LPKEVE AR  +E+GNP+IPNRI ECRSYPLYKF+REELGT +LTGEKV+SPGE 
Sbjct  619  ELKAVLPKEVESARGGVESGNPSIPNRIKECRSYPLYKFVREELGTGLLTGEKVRSPGED  678

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
             DKVFTA+C+G IIDPLL+CL +WNGAPLPIC
Sbjct  679  FDKVFTAMCEGKIIDPLLDCLSAWNGAPLPIC  710



>ref|XP_002268256.1| PREDICTED: phenylalanine ammonia-lyase [Vitis vinifera]
Length=710

 Score =   263 bits (673),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 121/152 (80%), Positives = 137/152 (90%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLL+VVDRE+VFAY DDPCSA YPLMQK+RQVLV+HAL NGE EKN STSIFQKI AFE+
Sbjct  559  DLLKVVDREHVFAYIDDPCSATYPLMQKVRQVLVEHALNNGESEKNGSTSIFQKIGAFEE  618

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELKA+LPKEVE AR  +E+GNP+IPNRI ECRSYPLYKF+REELGT +LTGEKV+SPGE 
Sbjct  619  ELKAVLPKEVESARDGVESGNPSIPNRIKECRSYPLYKFVREELGTGLLTGEKVRSPGED  678

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
             DKVFTA+C+G IIDPLL+CL +WNGAPLPIC
Sbjct  679  FDKVFTAMCEGKIIDPLLDCLSAWNGAPLPIC  710



>ref|XP_010107519.1| Phenylalanine ammonia-lyase [Morus notabilis]
 gb|EXC16201.1| Phenylalanine ammonia-lyase [Morus notabilis]
Length=535

 Score =   259 bits (662),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 120/152 (79%), Positives = 133/152 (88%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLL+VVDREYV+AY DDPCSA YPLMQ LRQVLV+HAL NGE EKN STSIFQKIAAFE+
Sbjct  384  DLLKVVDREYVYAYIDDPCSATYPLMQTLRQVLVEHALTNGESEKNTSTSIFQKIAAFEE  443

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELK+LLPKEVE AR A ENGN AI N+ITECRSYPLYKF+REELGT +LTGEKV+SPGE 
Sbjct  444  ELKSLLPKEVESARIAYENGNAAISNKITECRSYPLYKFVREELGTSLLTGEKVRSPGEE  503

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
             DKV+TA+C G +IDP+LECL  WNG PLPIC
Sbjct  504  FDKVYTAMCQGKLIDPMLECLSGWNGEPLPIC  535



>ref|XP_011041025.1| PREDICTED: phenylalanine ammonia-lyase G2B [Populus euphratica]
Length=711

 Score =   263 bits (673),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 121/152 (80%), Positives = 135/152 (89%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLL+VVDRE+VF+Y DDPCSA YPLMQKLRQVLV+HAL NGE E+N +TSIFQKI +FE+
Sbjct  560  DLLKVVDREHVFSYIDDPCSATYPLMQKLRQVLVEHALVNGERERNSTTSIFQKIGSFEE  619

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELK LLPKEVE AR  +ENGNPAIPNRI ECRSYPLYKF+REELGT +LTGEKV+SPGE 
Sbjct  620  ELKTLLPKEVENARLEVENGNPAIPNRIKECRSYPLYKFVREELGTRLLTGEKVKSPGEE  679

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
             DKVFTA+C G +IDPLLECLK WNGAPLPIC
Sbjct  680  FDKVFTAICAGKLIDPLLECLKEWNGAPLPIC  711



>gb|AID16077.1| phenylalanine ammonium lyase [Morus alba]
Length=726

 Score =   263 bits (673),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 120/152 (79%), Positives = 135/152 (89%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLL+VVDREYV+AY DDPCSA YPLMQ LRQVLV+HAL NGE EKN STSIFQKIAAFE+
Sbjct  575  DLLKVVDREYVYAYIDDPCSATYPLMQTLRQVLVEHALTNGESEKNTSTSIFQKIAAFEE  634

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELKALLPKEVE AR+A ENGN AI N+ITECRSYPLYKF+RE+LGT +LTGEKV+SPGE 
Sbjct  635  ELKALLPKEVESARTAYENGNAAISNKITECRSYPLYKFVREQLGTSLLTGEKVRSPGEE  694

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
             DKV+TA+C G +IDP+LECL+ WNG PLPIC
Sbjct  695  FDKVYTAMCQGKLIDPMLECLRGWNGEPLPIC  726



>gb|KJB36583.1| hypothetical protein B456_006G166000 [Gossypium raimondii]
Length=720

 Score =   263 bits (673),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 121/152 (80%), Positives = 136/152 (89%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLL+ VDREYVFAY DDPCSA YPLMQKLRQVLV+HAL NGE+EKN STSIFQKIAAFE+
Sbjct  569  DLLKAVDREYVFAYIDDPCSATYPLMQKLRQVLVEHALTNGENEKNASTSIFQKIAAFEE  628

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELKA+LPKEVE AR+++ENGN AIPN+I ECRS+PLYKF+REELGT +LTGE V SPGE 
Sbjct  629  ELKAVLPKEVESARASVENGNAAIPNKIKECRSFPLYKFVREELGTGLLTGENVMSPGEE  688

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
             DKVFTA+C G IIDP+LECL+ WNGAPLPIC
Sbjct  689  FDKVFTAMCQGRIIDPMLECLEEWNGAPLPIC  720



>ref|XP_004234632.2| PREDICTED: phenylalanine ammonia-lyase [Solanum lycopersicum]
Length=720

 Score =   263 bits (672),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 120/152 (79%), Positives = 137/152 (90%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            +LLRVVDREY+FAY DDPCS+NYPLMQKLRQVLVD A++NGE EKNV++SIFQKI AFED
Sbjct  569  ELLRVVDREYLFAYVDDPCSSNYPLMQKLRQVLVDQAMKNGESEKNVNSSIFQKIGAFED  628

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            EL A+LPKEVE  R+ +E+GNP I NRITECRSYPLY+ +REELGTE+LTGEKV+SPGE 
Sbjct  629  ELIAVLPKEVESVRAVVESGNPLIRNRITECRSYPLYRLVREELGTELLTGEKVRSPGEE  688

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
             DKVFTA+C+G IIDPLLECLK WNGAPLPIC
Sbjct  689  IDKVFTAMCNGQIIDPLLECLKRWNGAPLPIC  720



>ref|XP_007208432.1| hypothetical protein PRUPE_ppa002099mg [Prunus persica]
 gb|EMJ09631.1| hypothetical protein PRUPE_ppa002099mg [Prunus persica]
Length=717

 Score =   263 bits (672),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 118/152 (78%), Positives = 137/152 (90%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLL+VVDREYVFAY DDPC+A YPLMQKLRQVLV+HAL NGE+EKN STSIFQKI AFE+
Sbjct  566  DLLKVVDREYVFAYIDDPCNATYPLMQKLRQVLVEHALTNGENEKNASTSIFQKIVAFEE  625

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELK LLPKEV+ AR+AL++G   +PNRITECRSYPLYKF+REELG E LTGE+V+SPGE 
Sbjct  626  ELKVLLPKEVDSARAALDSGTAGVPNRITECRSYPLYKFVREELGAEYLTGEEVRSPGEE  685

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
            CDKVF+A+C+G IIDP+L+CL+ WNGAPLPIC
Sbjct  686  CDKVFSAICEGKIIDPILDCLEGWNGAPLPIC  717



>emb|CDX74991.1| BnaA05g07370D [Brassica napus]
Length=380

 Score =   254 bits (649),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 116/152 (76%), Positives = 130/152 (86%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLL+VVDRE V+ YADDPCSA YPL+QKLRQV+VDHAL NGE EKN  TSIF KI AFE+
Sbjct  229  DLLKVVDREQVYTYADDPCSATYPLIQKLRQVIVDHALVNGESEKNAMTSIFHKIGAFEE  288

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELKA+LP EVE AR A +NG  AIPNRI ECRSYPLY+F+REELGTE+LTGEKV SPGE 
Sbjct  289  ELKAVLPDEVEAARVAYDNGTSAIPNRIKECRSYPLYRFVREELGTELLTGEKVTSPGEE  348

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
             DKVFTA+C+G IIDPL+ECL  WNGAP+PIC
Sbjct  349  FDKVFTAICEGKIIDPLMECLSEWNGAPIPIC  380



>emb|CAN61378.1| hypothetical protein VITISV_032212 [Vitis vinifera]
Length=686

 Score =   262 bits (670),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 120/152 (79%), Positives = 137/152 (90%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLL+VVDRE+VFAY DDPCSA YPLMQ +RQVLV+HAL NGE+EKN STSIFQKI AFE+
Sbjct  535  DLLKVVDREHVFAYIDDPCSATYPLMQNVRQVLVEHALNNGENEKNGSTSIFQKILAFEE  594

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELKA+LPKEVE AR  +E+GNP+IPNRI ECRSYPLYKF+REELGT +LTGEKV+SPGE 
Sbjct  595  ELKAVLPKEVESARGGVESGNPSIPNRIKECRSYPLYKFVREELGTGLLTGEKVRSPGED  654

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
             DKVFTA+C+G IIDPLL+CL +WNGAPLPIC
Sbjct  655  FDKVFTAMCEGKIIDPLLDCLSAWNGAPLPIC  686



>emb|CDX91331.1| BnaC04g08190D [Brassica napus]
Length=380

 Score =   254 bits (648),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 116/152 (76%), Positives = 130/152 (86%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLL+VVDRE V+ YADDPCSA YPL+QKLRQV+VDHAL NGE EKN  TSIF KI AFE+
Sbjct  229  DLLKVVDREQVYTYADDPCSATYPLIQKLRQVIVDHALVNGESEKNAMTSIFHKIGAFEE  288

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELKA+LP EVE AR A +NG  AIPNRI ECRSYPLY+F+REELGTE+LTGEKV SPGE 
Sbjct  289  ELKAVLPDEVEAARVAYDNGTSAIPNRIKECRSYPLYRFVREELGTELLTGEKVTSPGEE  348

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
             DKVFTA+C+G IIDPL+ECL  WNGAP+PIC
Sbjct  349  FDKVFTAICEGKIIDPLMECLSEWNGAPIPIC  380



>sp|Q04593.1|PAL2_PEA RecName: Full=Phenylalanine ammonia-lyase 2 [Pisum sativum]
 dbj|BAA00887.1| phenylalanine ammonia-lyase [Pisum sativum]
Length=724

 Score =   263 bits (671),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 122/152 (80%), Positives = 131/152 (86%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLLRVVDRE+VF+Y DDPCSA YPLMQKLRQVLVDHAL NGE EKN++TSIFQKIA FED
Sbjct  573  DLLRVVDREHVFSYIDDPCSATYPLMQKLRQVLVDHALVNGESEKNLNTSIFQKIATFED  632

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELK LLPKEVE AR A ENGN  I N+I ECRSYPLYKF+REELGT +LTGEKV SPGE 
Sbjct  633  ELKTLLPKEVESARGAYENGNTTISNKIKECRSYPLYKFVREELGTSLLTGEKVISPGEE  692

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
            CDK+FTA+C G IIDPLLECL  WNGAPLPI 
Sbjct  693  CDKLFTAICQGKIIDPLLECLGDWNGAPLPIS  724



>ref|XP_011041026.1| PREDICTED: phenylalanine ammonia-lyase G2B-like isoform X1 [Populus 
euphratica]
Length=749

 Score =   263 bits (672),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 121/152 (80%), Positives = 135/152 (89%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLL+VVDRE+VF+Y DDPCSA YPLMQKLRQVLV+HAL NGE E+N +TSIFQKI +FE+
Sbjct  598  DLLKVVDREHVFSYIDDPCSATYPLMQKLRQVLVEHALVNGERERNSTTSIFQKIGSFEE  657

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELK LLPKEVE AR  +ENGNPAIPNRI ECRSYPLYKF+REELGT +LTGEKV+SPGE 
Sbjct  658  ELKTLLPKEVENARLEVENGNPAIPNRIKECRSYPLYKFVREELGTRLLTGEKVKSPGEE  717

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
             DKVFTA+C G +IDPLLECLK WNGAPLPIC
Sbjct  718  FDKVFTAICAGKLIDPLLECLKEWNGAPLPIC  749



>ref|XP_011077338.1| PREDICTED: phenylalanine ammonia-lyase [Sesamum indicum]
Length=712

 Score =   262 bits (670),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 123/152 (81%), Positives = 136/152 (89%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLLRVVDREYVFAY DDPCS NYPLMQKLRQVLV+HAL+NG++EKN+STSIFQKI AFED
Sbjct  561  DLLRVVDREYVFAYVDDPCSENYPLMQKLRQVLVEHALKNGDNEKNLSTSIFQKIGAFED  620

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELKALLPKEVE AR ALE+GNPAI NRI ECRSYPLY+FIREELGT  LTGEKV SPGE 
Sbjct  621  ELKALLPKEVESARIALESGNPAIANRIKECRSYPLYRFIREELGTGFLTGEKVTSPGEE  680

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
             DKVFTA+  G I+DPLL+CL+ W+G+PLPIC
Sbjct  681  GDKVFTALSKGLIVDPLLKCLEGWSGSPLPIC  712



>gb|KHG18863.1| Phenylalanine ammonia-lyase [Gossypium arboreum]
Length=720

 Score =   263 bits (671),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 120/152 (79%), Positives = 135/152 (89%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLL+ VDREYVFAY DDPCSA Y +MQKLRQVLV+HAL NGE+EKN STSIFQKIAAFE+
Sbjct  569  DLLKAVDREYVFAYIDDPCSATYSMMQKLRQVLVEHALTNGENEKNASTSIFQKIAAFEE  628

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELKA+LPKEVE AR+++ENGN AIPN+I ECRS+PLYKF+REELGT +LTGE V SPGE 
Sbjct  629  ELKAVLPKEVESARASVENGNAAIPNKIKECRSFPLYKFVREELGTGLLTGENVMSPGEE  688

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
             DKVFTA+C G IIDP+LECLK WNGAPLPIC
Sbjct  689  FDKVFTAMCQGKIIDPMLECLKEWNGAPLPIC  720



>gb|KEH24019.1| phenylalanine ammonia-lyase-like protein [Medicago truncatula]
Length=724

 Score =   263 bits (671),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 121/152 (80%), Positives = 134/152 (88%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLL+VVDRE+VFAY DDPCSA YPL QKLRQVLVDHAL NGE EKN++TSIFQKIA FE+
Sbjct  573  DLLKVVDREHVFAYIDDPCSATYPLSQKLRQVLVDHALVNGESEKNLNTSIFQKIATFEE  632

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELK+LLPKEVE AR+A E+GNP IPN+I  CRSYPLYKF+REELGT +LTGE V SPGEV
Sbjct  633  ELKSLLPKEVESARTAYESGNPTIPNKINGCRSYPLYKFVREELGTGLLTGENVISPGEV  692

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
            CDK+FTA+C G IIDPLLECL  WNGAPLPIC
Sbjct  693  CDKLFTAMCQGKIIDPLLECLGEWNGAPLPIC  724



>gb|KEH24018.1| phenylalanine ammonia-lyase-like protein [Medicago truncatula]
Length=724

 Score =   262 bits (670),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 121/152 (80%), Positives = 134/152 (88%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLL+VVDRE+VFAY DDPCSA YPL QKLRQVLVDHAL NGE EKN++TSIFQKIA FE+
Sbjct  573  DLLKVVDREHVFAYIDDPCSATYPLSQKLRQVLVDHALVNGESEKNLNTSIFQKIATFEE  632

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELK+LLPKEVE AR+A E+GNP IPN+I  CRSYPLYKF+REELGT +LTGE V SPGEV
Sbjct  633  ELKSLLPKEVESARTAYESGNPTIPNKINGCRSYPLYKFVREELGTGLLTGENVISPGEV  692

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
            CDK+FTA+C G IIDPLLECL  WNGAPLPIC
Sbjct  693  CDKLFTAMCQGKIIDPLLECLGEWNGAPLPIC  724



>sp|P45732.1|PALY_STYHU RecName: Full=Phenylalanine ammonia-lyase [Stylosanthes humilis]
 gb|AAA99500.1| phenylalanine ammonia lyase [Stylosanthes humilis]
Length=715

 Score =   262 bits (670),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 120/152 (79%), Positives = 134/152 (88%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLL++VDREY FAY DDPCSA YPLMQKLRQVLV+HAL N E+EKNV+TSIFQKI  FE+
Sbjct  564  DLLKIVDREYCFAYIDDPCSATYPLMQKLRQVLVEHALANAENEKNVNTSIFQKITTFEE  623

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELK LLPKEVEGAR A ENG  AIPN+I ECRSYPLYKF+REELGTE+LTGEKV+SPGE 
Sbjct  624  ELKTLLPKEVEGARIAYENGQSAIPNKIKECRSYPLYKFVREELGTEMLTGEKVRSPGEE  683

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
            CDK+FTA+C G IIDPLLEC+  WNGAPLP+C
Sbjct  684  CDKLFTAMCQGKIIDPLLECIGEWNGAPLPLC  715



>gb|KHN17149.1| Phenylalanine ammonia-lyase 2 [Glycine soja]
Length=619

 Score =   260 bits (664),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 120/152 (79%), Positives = 133/152 (88%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLL++VDREYV+AY DDPCSA YPLMQKLR VLVDHALQNG+ E + STSIFQKI AFE+
Sbjct  468  DLLKIVDREYVYAYIDDPCSATYPLMQKLRLVLVDHALQNGDKEASSSTSIFQKIGAFEE  527

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            EL ALLPKEVE AR  +ENGNPAIPNRI ECRSYPLYKF+RE LGT +LTGEKV+SPGE 
Sbjct  528  ELNALLPKEVESARIEVENGNPAIPNRIKECRSYPLYKFVRENLGTTLLTGEKVKSPGEE  587

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
             DKVFTA+C+G  IDPLL+CLK WNGAPLPIC
Sbjct  588  SDKVFTALCEGKFIDPLLDCLKEWNGAPLPIC  619



>gb|AFK47120.1| unknown [Lotus japonicus]
Length=206

 Score =   248 bits (632),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 118/152 (78%), Positives = 130/152 (86%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLL VVDRE VFAY DDPCS  YPLMQKLRQ LVDHAL+N + EKNV+TSIFQKIA FED
Sbjct  55   DLLTVVDREDVFAYIDDPCSGTYPLMQKLRQSLVDHALENADAEKNVNTSIFQKIAIFED  114

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELKA+LPKEVE AR A +NG  AIPN+I ECRSYPLYKF+REELGT +LTGEKV+SPGE 
Sbjct  115  ELKAILPKEVESARVAYDNGESAIPNKIKECRSYPLYKFVREELGTGLLTGEKVKSPGED  174

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
             DK+FTA+C G IIDP+LECL  WNGAPLPIC
Sbjct  175  FDKLFTAMCQGKIIDPILECLGEWNGAPLPIC  206



>ref|XP_002268732.1| PREDICTED: phenylalanine ammonia-lyase [Vitis vinifera]
Length=710

 Score =   262 bits (669),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 120/152 (79%), Positives = 137/152 (90%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLL+VVDRE+VFAY DDPCSA YPLMQK+RQVLV+HAL NGE+EKN STSIFQKI AFE+
Sbjct  559  DLLKVVDREHVFAYIDDPCSATYPLMQKVRQVLVEHALNNGENEKNGSTSIFQKIGAFEE  618

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELKA+LPKEVE AR  +E+GNP+IPNRI ECRSYPLYKF+REELGT +LTGE V+SPGE 
Sbjct  619  ELKAVLPKEVESARDGVESGNPSIPNRIKECRSYPLYKFVREELGTGLLTGETVRSPGED  678

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
             DKVFTA+C+G IIDPLL+CL +WNGAPLPIC
Sbjct  679  FDKVFTAMCEGKIIDPLLDCLSAWNGAPLPIC  710



>emb|CAN77065.1| hypothetical protein VITISV_009233 [Vitis vinifera]
Length=707

 Score =   262 bits (669),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 120/151 (79%), Positives = 137/151 (91%), Gaps = 0/151 (0%)
 Frame = -1

Query  613  LLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDE  434
            LL+VVDRE+VFAY DDPCSA YPLMQK+RQVLV+HAL NGE+EKN STSIFQKI AFE+E
Sbjct  557  LLKVVDREHVFAYIDDPCSATYPLMQKVRQVLVEHALNNGENEKNGSTSIFQKIVAFEEE  616

Query  433  LKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVC  254
            LKA+LPKEVE AR  +E+GNP+IPNRI ECRSYPLYKF+REELGT +LTGEKV+SPGE  
Sbjct  617  LKAVLPKEVESARGGVESGNPSIPNRIRECRSYPLYKFVREELGTGLLTGEKVRSPGEDF  676

Query  253  DKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
            DKVFTA+C+G IIDPLL+CL +WNGAPLPIC
Sbjct  677  DKVFTAMCEGKIIDPLLDCLSAWNGAPLPIC  707



>gb|EYU38541.1| hypothetical protein MIMGU_mgv1a001582mg [Erythranthe guttata]
Length=790

 Score =   263 bits (673),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 121/152 (80%), Positives = 136/152 (89%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLLRVVDREYVFAY DDPCS  YPLMQKLR+VLVDHAL+NG+++KN +TSIFQKI AFE+
Sbjct  639  DLLRVVDREYVFAYIDDPCSGTYPLMQKLREVLVDHALKNGDNQKNAATSIFQKIEAFEE  698

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELKA+LPKEVE ARSA+ENGN A+ NRI ECRSYPLYKF+REELGTE LTGEK+ SPGE 
Sbjct  699  ELKAVLPKEVESARSAVENGNAAVGNRIKECRSYPLYKFMREELGTEFLTGEKLTSPGEE  758

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
            CDKVFTA+  G I+DPLLECL+ WNGAPLPIC
Sbjct  759  CDKVFTALSKGLIVDPLLECLEGWNGAPLPIC  790



>gb|KHG26972.1| Phenylalanine ammonia-lyase [Gossypium arboreum]
Length=710

 Score =   262 bits (669),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 120/152 (79%), Positives = 134/152 (88%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLLRVVDREY++AYADDPCSANYPL+QKLRQVLVDHAL NG+ EK+ +TSIFQKI  FE+
Sbjct  559  DLLRVVDREYLYAYADDPCSANYPLIQKLRQVLVDHALMNGDREKDSTTSIFQKIGVFEE  618

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELK  LPKEVE AR+  ENGNPAIPN+I ECRSYPLYKF+RE LGT +LTGEKV SPGE 
Sbjct  619  ELKTHLPKEVESARTEFENGNPAIPNKIEECRSYPLYKFVREVLGTNLLTGEKVISPGEE  678

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
            CDKVFTA+C G +IDPLL+CLK WNGAPLPIC
Sbjct  679  CDKVFTAMCAGKLIDPLLDCLKDWNGAPLPIC  710



>gb|AAK62030.1| phenylalanine ammonia-lyase 1 [Manihot esculenta]
Length=710

 Score =   262 bits (669),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 119/152 (78%), Positives = 133/152 (88%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLL+VVDREYV+AY DDPCSA YPLMQKLRQVLVDHA+ NGE EKN STSIFQKI AFE+
Sbjct  559  DLLKVVDREYVYAYVDDPCSATYPLMQKLRQVLVDHAMMNGEKEKNSSTSIFQKIGAFEE  618

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELK LLPKEVE AR+  ENGNPAI N+I ECRSYPLYKF+REELG  +LTGEK++SPGE 
Sbjct  619  ELKTLLPKEVESARTEYENGNPAISNKIKECRSYPLYKFVREELGCSLLTGEKIRSPGEE  678

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
             DKVF+A+C G +IDP+LECLK WNGAPLPIC
Sbjct  679  FDKVFSAICAGKLIDPMLECLKEWNGAPLPIC  710



>gb|AAK60275.1|AF383152_1 phenylalanine ammonia-lyase 2 [Manihot esculenta]
Length=712

 Score =   262 bits (669),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 121/152 (80%), Positives = 133/152 (88%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLL+VVDRE VF+Y DD CSA YPLMQKLRQVLVDHAL NGE EKN STSIFQKI AFE+
Sbjct  561  DLLKVVDREQVFSYVDDACSATYPLMQKLRQVLVDHALANGESEKNASTSIFQKIRAFEE  620

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELKALLPKEVE AR A ENGNPAI N+I ECRSYPLYKF+REE+GT +LTGEK++SPGE 
Sbjct  621  ELKALLPKEVESAREAYENGNPAIANKIKECRSYPLYKFVREEIGTGLLTGEKIRSPGEE  680

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
             DKVFTA+C G IIDP+L+CLK WNGAPLPIC
Sbjct  681  FDKVFTAMCQGKIIDPMLDCLKEWNGAPLPIC  712



>gb|ACC63889.1| phenylalanine ammonia-lyase [Populus trichocarpa]
Length=711

 Score =   261 bits (668),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 120/152 (79%), Positives = 135/152 (89%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLL+VVDRE+VF+Y DDPCSA YPLMQKLRQVLV+HAL NGE E+N +TSIFQKI +FE+
Sbjct  560  DLLKVVDREHVFSYIDDPCSATYPLMQKLRQVLVEHALVNGERERNSTTSIFQKIGSFEE  619

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELK LLPKEVE AR  +ENGNPAIPNRI ECRSYPLYKF+REELGT +LTGEKV+SPGE 
Sbjct  620  ELKTLLPKEVESARLEVENGNPAIPNRIKECRSYPLYKFVREELGTSLLTGEKVKSPGEE  679

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
             DKVFTA+C G +IDPLLECLK W+GAPLPIC
Sbjct  680  FDKVFTAICAGKLIDPLLECLKEWDGAPLPIC  711



>gb|AJR20994.1| phenylalanine ammonia-lyase [Populus szechuanica]
Length=711

 Score =   261 bits (668),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 120/152 (79%), Positives = 135/152 (89%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLL+VVDRE+VF+Y DDPCSA YPLMQKLRQVLV+HAL NGE E+N +TSIFQKI +FE+
Sbjct  560  DLLKVVDREHVFSYIDDPCSATYPLMQKLRQVLVEHALVNGERERNSTTSIFQKIGSFEE  619

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELK LLPKEVE AR  +ENGNPAIPNRI ECRSYPLYKF+REELGT +LTGEKV+SPGE 
Sbjct  620  ELKTLLPKEVESARLEVENGNPAIPNRIKECRSYPLYKFVREELGTSLLTGEKVKSPGEE  679

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
             DKVFTA+C G +IDPLLECLK W+GAPLPIC
Sbjct  680  FDKVFTAICAGKLIDPLLECLKEWDGAPLPIC  711



>gb|AAN52279.1|AF480619_1 phenylalanine ammonia-lyase [Populus tremuloides]
Length=714

 Score =   261 bits (668),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 122/152 (80%), Positives = 136/152 (89%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            +LL+VVDRE VFAYADDPCSA YPLMQKLRQVLVDHAL NGE+EKN STS+FQKIAAFED
Sbjct  563  ELLKVVDREDVFAYADDPCSATYPLMQKLRQVLVDHALANGENEKNASTSVFQKIAAFED  622

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELKALLPKEVE AR+A ++GN AI N+I ECRSYPLYKF+REELGT +LTGE V+SPGE 
Sbjct  623  ELKALLPKEVESARAAYDSGNSAIENKIKECRSYPLYKFVREELGTGLLTGENVRSPGEE  682

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
             DKVFTA+C+G IIDP+LECL  WNGAPLPIC
Sbjct  683  FDKVFTAMCEGKIIDPMLECLGEWNGAPLPIC  714



>dbj|BAF36974.1| phenylalanine ammonia-lyase [Lotus japonicus]
Length=684

 Score =   261 bits (666),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 120/152 (79%), Positives = 134/152 (88%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLL+VVDRE +FAY DDPC A YPLMQKLRQVLVDHAL NGE+EK+  TSIFQKIA FED
Sbjct  533  DLLKVVDRETLFAYIDDPCLATYPLMQKLRQVLVDHALVNGENEKDSKTSIFQKIATFED  592

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELK+LLPKEVE AR+A E+GNPAIPN+I ECRSYPLYKF+REELGTE+LTGEK +SPGE 
Sbjct  593  ELKSLLPKEVESARAAYESGNPAIPNKINECRSYPLYKFVREELGTELLTGEKTRSPGEE  652

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
             DK+FTA+C G IIDPL+ECL  WNGAPLPIC
Sbjct  653  FDKLFTAICQGKIIDPLMECLGEWNGAPLPIC  684



>gb|KJB46526.1| hypothetical protein B456_007G373700 [Gossypium raimondii]
Length=670

 Score =   260 bits (665),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 118/152 (78%), Positives = 134/152 (88%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLL+ VD EYVF+Y DDPCSA YPLMQKLRQVLV+HAL NG +E N STSIFQKIAAFE+
Sbjct  519  DLLKAVDHEYVFSYIDDPCSATYPLMQKLRQVLVEHALSNGNNENNASTSIFQKIAAFEE  578

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELK LLPKEVE +R ++ENGNPAIPN+IT+CRSYPLYKF+REELGT +LTGEKV+SPGE 
Sbjct  579  ELKTLLPKEVENSRVSIENGNPAIPNKITKCRSYPLYKFVREELGTGLLTGEKVKSPGEE  638

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
             DKVF A+C G +IDP+LECLK WNGAPLPIC
Sbjct  639  FDKVFIAMCQGKVIDPMLECLKEWNGAPLPIC  670



>gb|AAF40224.1|AF237955_1 phenylalanine ammonia-lyase 2 [Rubus idaeus]
Length=730

 Score =   261 bits (668),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 119/152 (78%), Positives = 133/152 (88%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLL VV+REY+FAY DDPCSA YPLMQ+LRQVLV+HAL NGE+EKN STSIFQKI AFE+
Sbjct  579  DLLMVVEREYLFAYIDDPCSATYPLMQRLRQVLVEHALTNGENEKNASTSIFQKITAFEE  638

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELK +LPKEVE AR+A E+GN AIPNRI ECRSYPLYKF+REELG E LTGEKV+SPGE 
Sbjct  639  ELKTILPKEVESARAAYESGNAAIPNRIVECRSYPLYKFVREELGGEFLTGEKVRSPGEE  698

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
            CDKVFTA+C G IIDP+L+CL  WNG PLPIC
Sbjct  699  CDKVFTAMCQGNIIDPILDCLSGWNGEPLPIC  730



>dbj|BAF36968.1| phenylalanine ammonia-lyase [Lotus japonicus]
Length=690

 Score =   261 bits (666),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 120/152 (79%), Positives = 134/152 (88%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLL+VVDRE +FAY DDPC A YPLMQKLRQVLVDHAL NGE+EK+  TSIFQKIA FED
Sbjct  539  DLLKVVDRETLFAYIDDPCLATYPLMQKLRQVLVDHALVNGENEKDSKTSIFQKIATFED  598

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELK+LLPKEVE AR+A E+GNPAIPN+I ECRSYPLYKF+REELGTE+LTGEK +SPGE 
Sbjct  599  ELKSLLPKEVESARAAYESGNPAIPNKINECRSYPLYKFVREELGTELLTGEKTRSPGEE  658

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
             DK+FTA+C G IIDPL+ECL  WNGAPLPIC
Sbjct  659  FDKLFTAICQGKIIDPLMECLGEWNGAPLPIC  690



>gb|KJB46525.1| hypothetical protein B456_007G373600 [Gossypium raimondii]
Length=718

 Score =   261 bits (667),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 118/152 (78%), Positives = 134/152 (88%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLL+ VD EYVF+Y DDPCSA YPLMQKLRQVLV+HAL NG +E N STSIFQKIAAFE+
Sbjct  567  DLLKAVDHEYVFSYIDDPCSATYPLMQKLRQVLVEHALSNGNNENNASTSIFQKIAAFEE  626

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELK LLPKEVE +R +++NGNPAIPN+ITECRSYPLYKF+REELGT +LTGEKV+SPGE 
Sbjct  627  ELKTLLPKEVENSRVSIQNGNPAIPNKITECRSYPLYKFVREELGTGLLTGEKVKSPGEE  686

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
             DKVF A+C G +IDP+LECLK WNGAPLPIC
Sbjct  687  FDKVFIAMCQGKVIDPMLECLKEWNGAPLPIC  718



>gb|AFQ92048.1| phenylalanine ammonia-lyase, partial [Pyrus pyrifolia]
Length=234

 Score =   247 bits (631),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 115/151 (76%), Positives = 129/151 (85%), Gaps = 0/151 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLL+VVDREYVFAY DDPCSA YPLMQKLR VLV+HAL NGE E +  TSIFQKI AFE+
Sbjct  83   DLLKVVDREYVFAYIDDPCSATYPLMQKLRHVLVEHALSNGEKEISTGTSIFQKITAFEE  142

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELK LLPKEV+ A +  ENG  AIPNRI ECRSYPLYKF+REELGT++LTG+KV+SPGE 
Sbjct  143  ELKTLLPKEVDNAWAEYENGKTAIPNRIKECRSYPLYKFVREELGTDLLTGDKVRSPGEE  202

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPI  164
            CDKVF A+C G +IDPLL+CLK WNGAPLPI
Sbjct  203  CDKVFNAMCAGKLIDPLLDCLKEWNGAPLPI  233



>dbj|BAF36967.1| phenylalanine ammonia-lyase [Lotus japonicus]
Length=730

 Score =   261 bits (667),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 121/152 (80%), Positives = 133/152 (88%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLL+VVDRE VFAY DDPC A YPLMQKLRQVLVDHAL NGE+EK+  TSIFQKIA FED
Sbjct  579  DLLKVVDREAVFAYIDDPCLATYPLMQKLRQVLVDHALVNGENEKDSKTSIFQKIATFED  638

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELK+LLPKEVE AR+A E+GNP I N+I ECRSYPLYKF+REELGTE+LTGEK +SPGE 
Sbjct  639  ELKSLLPKEVESARAAYESGNPTISNKINECRSYPLYKFVREELGTELLTGEKSRSPGEE  698

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
            CDK+FTA+C G IIDPLLECL  WNGAPLPIC
Sbjct  699  CDKLFTAICQGKIIDPLLECLGEWNGAPLPIC  730



>dbj|BAA21643.1| phenylalanine ammonia-lyase [Populus sieboldii x Populus grandidentata]
Length=715

 Score =   261 bits (666),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 122/152 (80%), Positives = 135/152 (89%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            +LL+VVDRE VFAYADDPCSA YPLMQKLRQVLVDHAL NGE+EKN STS+FQKIAAFED
Sbjct  564  ELLKVVDREDVFAYADDPCSATYPLMQKLRQVLVDHALANGENEKNASTSVFQKIAAFED  623

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELKALLPKEVE AR+A ++GN AI N+I ECRSYPLYKF+REELGT +LTGE V+SPGE 
Sbjct  624  ELKALLPKEVESARAAYDSGNSAIENKIKECRSYPLYKFVREELGTGLLTGENVRSPGEE  683

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
             DKVFTA+C G IIDP+LECL  WNGAPLPIC
Sbjct  684  FDKVFTAMCQGKIIDPMLECLGEWNGAPLPIC  715



>gb|KJB62426.1| hypothetical protein B456_009G416300 [Gossypium raimondii]
Length=721

 Score =   261 bits (667),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 121/152 (80%), Positives = 132/152 (87%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLL+ VDREYVFAY DDPCSA YPLMQKLRQVLV+HAL NGE EKN STSIFQKI  FE+
Sbjct  570  DLLKAVDREYVFAYIDDPCSATYPLMQKLRQVLVEHALTNGESEKNTSTSIFQKITDFEE  629

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            EL+A+LPKEVE AR  LENGN AIPN I +CRSYPLYKF+REELGT +LTGEKV+SPGE 
Sbjct  630  ELQAVLPKEVESARVTLENGNAAIPNMIKDCRSYPLYKFVREELGTGLLTGEKVKSPGEE  689

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
             DKVFTA+C G IIDP+LECLK WNGAPLPIC
Sbjct  690  FDKVFTAMCQGKIIDPMLECLKEWNGAPLPIC  721



>gb|KHN00850.1| Phenylalanine ammonia-lyase 2 [Glycine soja]
Length=619

 Score =   259 bits (661),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 120/152 (79%), Positives = 133/152 (88%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLL++VDREYV+AY DDPCSA YPLMQKLR VLVDHALQNG+ E N STSIFQKI AFE+
Sbjct  468  DLLKIVDREYVYAYIDDPCSATYPLMQKLRLVLVDHALQNGDKEVNSSTSIFQKIGAFEE  527

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            EL ALLPKEVE AR  +ENGNPAIPNRI ECRSYPLYKF+RE LGT +LTGEKV+SPGE 
Sbjct  528  ELNALLPKEVESARIEVENGNPAIPNRIKECRSYPLYKFVRENLGTTLLTGEKVKSPGEE  587

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
             DKVFTA+C+G +IDPLL+CLK W GAPLPIC
Sbjct  588  FDKVFTALCEGKLIDPLLDCLKEWKGAPLPIC  619



>ref|XP_002322884.2| phenylalanine ammonia-lyase family protein [Populus trichocarpa]
 gb|ACC63887.1| phenylalanine ammonia-lyase [Populus trichocarpa]
 gb|EEF04645.2| phenylalanine ammonia-lyase family protein [Populus trichocarpa]
Length=715

 Score =   261 bits (666),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 120/152 (79%), Positives = 135/152 (89%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            +LL+VVDREYVFAY DDPCSA YPLMQKLRQV VDHAL+NGE+EKN STS+FQKI AFE+
Sbjct  564  ELLKVVDREYVFAYVDDPCSATYPLMQKLRQVFVDHALENGENEKNFSTSVFQKIEAFEE  623

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELKALLPKEVE AR+A ++GN AI N+I ECRSYPLYKF+REELGT +LTGEKVQSPGE 
Sbjct  624  ELKALLPKEVESARAAYDSGNSAIDNKIKECRSYPLYKFVREELGTVLLTGEKVQSPGEE  683

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
             DKVFTA+C G IIDP+LECL  WNG+PLPIC
Sbjct  684  FDKVFTAMCQGKIIDPMLECLGEWNGSPLPIC  715



>gb|KDO50672.1| hypothetical protein CISIN_1g037382mg [Citrus sinensis]
Length=555

 Score =   257 bits (656),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 118/152 (78%), Positives = 131/152 (86%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLL+  DRE+VFAY DDPCSA YPLMQKLRQVLV+HAL NGE+EKN ++SIFQKIAAFE+
Sbjct  404  DLLKAADREHVFAYIDDPCSATYPLMQKLRQVLVEHALNNGENEKNANSSIFQKIAAFEE  463

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELKA+LPKEVE AR  +ENGNP IPNRI ECRSYPLY+ +REELGT  LTGEKV SPGE 
Sbjct  464  ELKAVLPKEVENARQTVENGNPTIPNRIKECRSYPLYRLVREELGTNFLTGEKVTSPGEE  523

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
             DKVFTA+C G IIDP+LECL  WNGAPLPIC
Sbjct  524  FDKVFTAMCQGKIIDPMLECLWEWNGAPLPIC  555



>sp|P45730.1|PALY_POPTR RecName: Full=Phenylalanine ammonia-lyase [Populus trichocarpa]
 pir||JQ2265 phenylalanine ammonia-lyase (EC 4.3.1.5) - western balsam poplar 
x cottonwood
 gb|AAA33805.1| phenylalanine ammonia lyase [Populus trichocarpa x Populus deltoides]
Length=715

 Score =   261 bits (666),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 120/152 (79%), Positives = 135/152 (89%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            +LL+VVDREYVFAY DDPCSA YPLMQKLRQV VDHAL+NGE+EKN STS+FQKI AFE+
Sbjct  564  ELLKVVDREYVFAYVDDPCSATYPLMQKLRQVFVDHALENGENEKNFSTSVFQKIEAFEE  623

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELKALLPKEVE AR+A ++GN AI N+I ECRSYPLYKF+REELGT +LTGEKVQSPGE 
Sbjct  624  ELKALLPKEVESARAAYDSGNSAIDNKIKECRSYPLYKFVREELGTVLLTGEKVQSPGEE  683

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
             DKVFTA+C G IIDP+LECL  WNG+PLPIC
Sbjct  684  FDKVFTAMCQGKIIDPMLECLGEWNGSPLPIC  715



>ref|XP_010107516.1| Phenylalanine ammonia-lyase 1 [Morus notabilis]
 gb|EXC16198.1| Phenylalanine ammonia-lyase 1 [Morus notabilis]
Length=534

 Score =   256 bits (655),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 118/152 (78%), Positives = 131/152 (86%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLL+VVDREYV+ Y DDPCSA YPLMQ LRQVLV+HAL NGE EKN STSIFQKIAAFE+
Sbjct  383  DLLKVVDREYVYTYIDDPCSATYPLMQTLRQVLVEHALTNGESEKNTSTSIFQKIAAFEE  442

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELK+ LPKEVE AR A ENGN AI N+ITECRSYPLYKF+REELGT +LTGEKV+SPGE 
Sbjct  443  ELKSFLPKEVESARIAYENGNAAISNKITECRSYPLYKFVREELGTSLLTGEKVRSPGEE  502

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
             DKV+TA+C G +IDP+LECL  WNG PLPIC
Sbjct  503  FDKVYTAMCQGKLIDPMLECLSGWNGEPLPIC  534



>gb|AAQ74878.1| phenylalanine ammonia lyase [Populus trichocarpa x Populus deltoides]
Length=711

 Score =   260 bits (665),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 120/152 (79%), Positives = 134/152 (88%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLL+VVDRE+VF+Y DDPCSA YPLMQKLRQVLV+HAL NGE E N +TSIFQKI +FE+
Sbjct  560  DLLKVVDREHVFSYIDDPCSATYPLMQKLRQVLVEHALVNGERETNSTTSIFQKIGSFEE  619

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELK LLPKEVE AR  +ENGNPAIPNRI ECRSYPLYKF+REELGT +LTGEKV+SPGE 
Sbjct  620  ELKTLLPKEVESARLEVENGNPAIPNRIKECRSYPLYKFVREELGTSLLTGEKVKSPGEE  679

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
             DKVFTA+C G +IDPLLECLK W+GAPLPIC
Sbjct  680  FDKVFTAICAGKLIDPLLECLKEWDGAPLPIC  711



>gb|ABD42947.1| phenylalanine ammonia lyase [Acacia auriculiformis x Acacia mangium]
Length=714

 Score =   260 bits (665),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 119/152 (78%), Positives = 134/152 (88%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLL+VVDRE+VF Y DDP SA YPLMQKLRQVLVDHAL+NG++EKN STSIFQKIAAFE+
Sbjct  563  DLLKVVDREHVFTYIDDPTSATYPLMQKLRQVLVDHALENGDNEKNSSTSIFQKIAAFEE  622

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELK LLPKEVE AR+A ENGN ++PN+I ECRSYPLYKF+RE+LG  +LTGEK +SPGE 
Sbjct  623  ELKTLLPKEVERARTAYENGNSSVPNKIKECRSYPLYKFVREDLGAGLLTGEKTRSPGEE  682

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
            CDKVFTA+C G IIDPLLECL  WNGAPLPIC
Sbjct  683  CDKVFTALCQGKIIDPLLECLGEWNGAPLPIC  714



>ref|XP_006589419.1| PREDICTED: phenylalanine ammonia-lyase 2-like isoform X1 [Glycine 
max]
 ref|XP_006589420.1| PREDICTED: phenylalanine ammonia-lyase 2-like isoform X2 [Glycine 
max]
Length=717

 Score =   260 bits (665),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 120/152 (79%), Positives = 133/152 (88%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLL++VDREYV+AY DDPCSA YPLMQKLR VLVDHALQNG+ E + STSIFQKI AFE+
Sbjct  566  DLLKIVDREYVYAYIDDPCSATYPLMQKLRLVLVDHALQNGDKEASSSTSIFQKIGAFEE  625

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            EL ALLPKEVE AR  +ENGNPAIPNRI ECRSYPLYKF+RE LGT +LTGEKV+SPGE 
Sbjct  626  ELNALLPKEVESARIEVENGNPAIPNRIKECRSYPLYKFVRENLGTTLLTGEKVKSPGEE  685

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
             DKVFTA+C+G  IDPLL+CLK WNGAPLPIC
Sbjct  686  SDKVFTALCEGKFIDPLLDCLKEWNGAPLPIC  717



>ref|XP_006290660.1| hypothetical protein CARUB_v10016752mg [Capsella rubella]
 gb|EOA23558.1| hypothetical protein CARUB_v10016752mg [Capsella rubella]
Length=718

 Score =   260 bits (665),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 119/152 (78%), Positives = 133/152 (88%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLL+VVDRE VF YADDPCSA YPLMQKLRQV+VDHAL NGE EKN  TSIFQKI AFE+
Sbjct  567  DLLKVVDREQVFTYADDPCSATYPLMQKLRQVIVDHALSNGETEKNAGTSIFQKIGAFEE  626

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELKA+LPKEVE  R+A  +GN AIPNRI ECRSYPLYKF+REELGT++LTGEKV SPGE 
Sbjct  627  ELKAVLPKEVEATRAAYGSGNAAIPNRIKECRSYPLYKFVREELGTKLLTGEKVVSPGEE  686

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
             DKVFTA+C+G IIDPL++CLK WNGAP+PIC
Sbjct  687  FDKVFTAMCEGKIIDPLMDCLKEWNGAPIPIC  718



>emb|CAB42793.1| phenylalanine-ammonia lyase [Citrus clementina x Citrus reticulata]
Length=721

 Score =   260 bits (665),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 118/152 (78%), Positives = 132/152 (87%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLL+  DRE+VFAY DDPCSA YPLMQKLRQVLV+HAL NGE+EKN ++SIFQKIAAFE+
Sbjct  570  DLLKAADREHVFAYIDDPCSATYPLMQKLRQVLVEHALNNGENEKNANSSIFQKIAAFEE  629

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELKA+LPKEVE AR  +ENGNP IPNRI ECRSYPLY+ +REELGT  LTGEKV SPGE 
Sbjct  630  ELKAVLPKEVENARQTVENGNPTIPNRIKECRSYPLYRLVREELGTNFLTGEKVTSPGEK  689

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
             DKVFTA+C G IIDP+LECL+ WNGAPLPIC
Sbjct  690  FDKVFTAMCQGKIIDPMLECLREWNGAPLPIC  721



>gb|ACV30588.1| phenylalanine ammonia-lyase [Carica papaya]
Length=268

 Score =   248 bits (633),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 116/151 (77%), Positives = 130/151 (86%), Gaps = 0/151 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLL+VVDREY+FAYADDPCSA YPLMQKLRQVLVDHAL N + +KN  +SIF KI AFE+
Sbjct  117  DLLKVVDREYLFAYADDPCSATYPLMQKLRQVLVDHALINADRDKNSGSSIFHKIGAFEE  176

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELK LLPKEVEG R  +E GN AIPNRI ECRSYPLYKF+REELGT +LTGEKV+SPGE 
Sbjct  177  ELKTLLPKEVEGTRLEVEAGNAAIPNRIKECRSYPLYKFVREELGTGLLTGEKVRSPGEE  236

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPI  164
             DKVF+A+C G +IDPLL+CLK WNGAPLPI
Sbjct  237  FDKVFSAMCAGKMIDPLLDCLKEWNGAPLPI  267



>ref|XP_006439143.1| hypothetical protein CICLE_v10010874mg [Citrus clementina]
 gb|ESR52383.1| hypothetical protein CICLE_v10010874mg [Citrus clementina]
Length=308

 Score =   249 bits (636),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 117/152 (77%), Positives = 128/152 (84%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLL+VVDREYVF+YADDPCSA YPLM+KLRQVLVDHAL N E  KN + SIF KI AFE+
Sbjct  157  DLLKVVDREYVFSYADDPCSATYPLMRKLRQVLVDHALTNNEDLKNANASIFLKIGAFEE  216

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELK LLPKEVE ARSA E+GN  IPNRI ECRSYPLY+F+REELG   LTGEK  SPGE 
Sbjct  217  ELKTLLPKEVESARSAFESGNLEIPNRIKECRSYPLYRFVREELGARYLTGEKAISPGEE  276

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
            CDKVFTA+C G IIDPLLECLK W+G+PLPIC
Sbjct  277  CDKVFTAICQGKIIDPLLECLKEWDGSPLPIC  308



>ref|XP_006481493.1| PREDICTED: phenylalanine ammonia-lyase-like [Citrus sinensis]
Length=721

 Score =   260 bits (665),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 118/152 (78%), Positives = 132/152 (87%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLL+  DRE+VFAY DDPCSA YPLMQKLRQVLV+HAL NGE+EKN ++SIFQKIAAFE+
Sbjct  570  DLLKAADREHVFAYIDDPCSATYPLMQKLRQVLVEHALNNGENEKNANSSIFQKIAAFEE  629

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELKA+LPKEVE AR  +ENGNP IPNRI ECRSYPLY+ +REELGT  LTGEKV SPGE 
Sbjct  630  ELKAVLPKEVENARQTVENGNPTIPNRIKECRSYPLYRLVREELGTNFLTGEKVTSPGEK  689

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
             DKVFTA+C G IIDP+LECL+ WNGAPLPIC
Sbjct  690  FDKVFTAMCQGKIIDPMLECLREWNGAPLPIC  721



>gb|AEE81750.1| phenylalanine ammonia lyase [Morus alba var. multicaulis]
Length=726

 Score =   260 bits (665),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 119/152 (78%), Positives = 133/152 (88%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLL+VVDREYV+AY DDPCSA YPLMQ LRQVLV+HAL NGE EKN STSIFQKIAAFE+
Sbjct  575  DLLKVVDREYVYAYIDDPCSATYPLMQTLRQVLVEHALTNGESEKNTSTSIFQKIAAFEE  634

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELKALLPKEVE AR+A ENGN AI N+ITECRSYPLYKF+RE+LGT +LTGEKV+SPGE 
Sbjct  635  ELKALLPKEVESARTAYENGNAAISNKITECRSYPLYKFVREQLGTSLLTGEKVRSPGEE  694

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
             DKV+TA+C G +IDP+L CL  WNG PLPIC
Sbjct  695  FDKVYTAMCQGKLIDPMLACLSGWNGEPLPIC  726



>ref|NP_001266106.1| phenylalanine ammonia-lyase 2 [Cicer arietinum]
 sp|Q9SMK9.1|PAL2_CICAR RecName: Full=Phenylalanine ammonia-lyase 2 [Cicer arietinum]
 emb|CAB60719.1| phenylalanine ammonia-lyase [Cicer arietinum]
Length=718

 Score =   260 bits (665),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 118/152 (78%), Positives = 130/152 (86%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLL VV+REYVFAY DDPCSA YPLMQKLR VLVDHAL+NG+ E N STSIFQKI AFE 
Sbjct  567  DLLNVVEREYVFAYIDDPCSATYPLMQKLRHVLVDHALENGDREGNSSTSIFQKIGAFEQ  626

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELK LLPKEVE  R  +ENGNPA+PNRI ECRSYPLYKF+RE LGT +LTGEK++SPGE 
Sbjct  627  ELKTLLPKEVESVRVDVENGNPAVPNRIIECRSYPLYKFVRENLGTSLLTGEKIRSPGEE  686

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
            CDKVF A+CDG  IDP+L+CLK WNGAPLPIC
Sbjct  687  CDKVFAALCDGRFIDPMLDCLKEWNGAPLPIC  718



>ref|XP_011048535.1| PREDICTED: phenylalanine ammonia-lyase-like [Populus euphratica]
Length=714

 Score =   260 bits (665),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 121/152 (80%), Positives = 136/152 (89%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            +LL+VVDRE VFAYADDPCSANYPLM+KLRQVLVDHAL NGE+EKN STS+FQKI AFE+
Sbjct  563  ELLKVVDREDVFAYADDPCSANYPLMKKLRQVLVDHALANGENEKNASTSVFQKIGAFEE  622

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELKALLPKEVE AR+A ++GN AI N+I ECRSYPLYKF+REELGT +LTGEKV+SPGE 
Sbjct  623  ELKALLPKEVESARAAYDSGNSAIENKIKECRSYPLYKFVREELGTGLLTGEKVRSPGEE  682

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
             DKVFTA+C G IIDP+LECL  WNGAPLPIC
Sbjct  683  FDKVFTAMCQGKIIDPMLECLGEWNGAPLPIC  714



>gb|KHN39030.1| Phenylalanine ammonia-lyase class 2 [Glycine soja]
Length=619

 Score =   258 bits (659),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 121/152 (80%), Positives = 131/152 (86%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLL+VVDREY FAY DDPCS  YPLMQKLRQVLVD+AL NGE+EKN +TSIFQKIA FE+
Sbjct  468  DLLKVVDREYTFAYIDDPCSGTYPLMQKLRQVLVDYALANGENEKNTNTSIFQKIATFEE  527

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELK LLPKEVEGAR A EN   AIPN+I ECRSYPLYKF+REELGT +LTGE+V SPGE 
Sbjct  528  ELKTLLPKEVEGARVAYENDQCAIPNKIKECRSYPLYKFVREELGTALLTGERVISPGEE  587

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
            CDKVFTA+C G IIDPLLECL  WNGAPLPIC
Sbjct  588  CDKVFTALCQGKIIDPLLECLGEWNGAPLPIC  619



>emb|CAL91038.1| phenylalanine ammonia-lyase 4 [Cynara cardunculus var. scolymus]
Length=339

 Score =   250 bits (639),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 117/152 (77%), Positives = 129/152 (85%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLLRVVDREYVFAY DDPCSA YPLMQ+LRQVLVDHAL NGE EKN +TSIFQKIA FED
Sbjct  188  DLLRVVDREYVFAYIDDPCSATYPLMQRLRQVLVDHALNNGETEKNTNTSIFQKIATFED  247

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELKA+LPKEVE  R+A E  + +IPNRI  CRSYPLY+F+REELG   LTGEKV SPGE 
Sbjct  248  ELKAILPKEVESVRTAYETDSLSIPNRIKACRSYPLYRFVREELGGGFLTGEKVTSPGEE  307

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
             DKVFTA+C G +IDPLLEC++ WNGAPLPIC
Sbjct  308  FDKVFTAMCKGELIDPLLECVEGWNGAPLPIC  339



>ref|NP_001236956.1| phenylalanine ammonia-lyase 2 [Glycine max]
 gb|ACS88364.1| phenylalanine ammonia-lyase 2 [Glycine max]
 gb|ACU30058.1| phenylalanine ammonia-lyase 2 [Glycine max]
Length=717

 Score =   260 bits (664),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 122/152 (80%), Positives = 131/152 (86%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLL+VVDREY FAY DDPCS  YPLMQKLRQVLVD+AL NGE+EKN STSIFQKIA FE+
Sbjct  566  DLLKVVDREYTFAYIDDPCSGTYPLMQKLRQVLVDYALANGENEKNTSTSIFQKIATFEE  625

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELK LLPKEVEGAR A EN   AIPN+I ECRSYPLYKF+REELGT +LTGE+V SPGE 
Sbjct  626  ELKTLLPKEVEGARVAYENDQCAIPNKIKECRSYPLYKFVREELGTALLTGERVISPGEE  685

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
            CDKVFTA+C G IIDPLLECL  WNGAPLPIC
Sbjct  686  CDKVFTALCQGKIIDPLLECLGEWNGAPLPIC  717



>gb|AFZ94859.1| phenylalanine ammonia-lyase [Solenostemon scutellarioides]
Length=711

 Score =   260 bits (664),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 122/152 (80%), Positives = 133/152 (88%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLLRVVDREYVFAY DDPCSANYPLMQKLRQVLVDHAL+NG+ EKNV TSIFQKI  FE+
Sbjct  560  DLLRVVDREYVFAYIDDPCSANYPLMQKLRQVLVDHALKNGDSEKNVGTSIFQKIQVFEE  619

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            EL A+LPKEVE AR ALE GNPAIPNRI ECRSYPLY FIREELGTE LTGEK  SPGE 
Sbjct  620  ELTAVLPKEVEAARIALEAGNPAIPNRIKECRSYPLYSFIREELGTEFLTGEKTVSPGEE  679

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
             +KVFTA+ +G I+DPLL+CL++WNG PLPIC
Sbjct  680  GEKVFTALSNGLIVDPLLKCLEAWNGEPLPIC  711



>ref|XP_006381441.1| phenylalanine ammonia-lyase family protein [Populus trichocarpa]
 gb|ACC63888.1| phenylalanine ammonia-lyase [Populus trichocarpa]
 gb|ERP59238.1| phenylalanine ammonia-lyase family protein [Populus trichocarpa]
Length=714

 Score =   259 bits (663),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 121/152 (80%), Positives = 135/152 (89%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            +LL+VVDRE VFAYADDPCSA YPLMQKLRQVLVDHAL NGE+EKN STS+FQKI AFE+
Sbjct  563  ELLKVVDREDVFAYADDPCSATYPLMQKLRQVLVDHALANGENEKNTSTSVFQKITAFEE  622

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELKALLPKEVE AR+A ++GN AI N+I ECRSYPLYKF+REELGT +LTGEKV+SPGE 
Sbjct  623  ELKALLPKEVESARAAYDSGNSAIENKIKECRSYPLYKFVREELGTGLLTGEKVRSPGEE  682

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
             DKVFTA+C G IIDP+LECL  WNGAPLPIC
Sbjct  683  FDKVFTAMCQGKIIDPMLECLGEWNGAPLPIC  714



>ref|XP_002315308.1| phenylalanine ammonia-lyase family protein [Populus trichocarpa]
 gb|ACC63891.1| phenylalanine ammonia-lyase [Populus trichocarpa]
 gb|EEF01479.1| phenylalanine ammonia-lyase family protein [Populus trichocarpa]
Length=711

 Score =   259 bits (663),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 119/152 (78%), Positives = 134/152 (88%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLL+VVDRE+VF+Y DDPCSA YPLMQ LRQVLV+HAL NGE E+N +TSIFQKI +FE+
Sbjct  560  DLLKVVDREHVFSYIDDPCSATYPLMQNLRQVLVEHALVNGERERNSTTSIFQKIGSFEE  619

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELK LLPKEVE AR  +ENGNPAIPNRI ECRSYPLYKF+REELGT +LTGEKV+SPGE 
Sbjct  620  ELKTLLPKEVESARLEVENGNPAIPNRIKECRSYPLYKFVREELGTSLLTGEKVKSPGEE  679

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
             DKVFTA+C G +IDPLLECLK W+GAPLPIC
Sbjct  680  FDKVFTAICAGKLIDPLLECLKEWDGAPLPIC  711



>ref|XP_010426963.1| PREDICTED: phenylalanine ammonia-lyase 2-like [Camelina sativa]
Length=718

 Score =   259 bits (663),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 118/152 (78%), Positives = 132/152 (87%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLL+VVDRE VF Y DDPCSA YPLMQKLRQV+VDHAL NGE EKN  TSIFQKI AFE+
Sbjct  567  DLLKVVDREQVFTYVDDPCSATYPLMQKLRQVIVDHALSNGETEKNAGTSIFQKIGAFEE  626

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELKA+LPKEVE  R+A  NG  AIPNRITECRSYPLYKF+REELGT++LTGEKV SPGE 
Sbjct  627  ELKAVLPKEVEATRAAYGNGTAAIPNRITECRSYPLYKFVREELGTKLLTGEKVVSPGEE  686

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
             DKVFTA+C+G +IDPL++CLK WNGAP+PIC
Sbjct  687  FDKVFTAMCEGKMIDPLMDCLKEWNGAPIPIC  718



>prf||2001451A Phe ammonia lyase
Length=723

 Score =   259 bits (663),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 118/152 (78%), Positives = 132/152 (87%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLLRVVDRE+VFAY DDPCSA YPLMQKLRQVLVDHAL NGE EKN++TSIFQKIA FED
Sbjct  572  DLLRVVDREHVFAYIDDPCSATYPLMQKLRQVLVDHALVNGESEKNLNTSIFQKIATFED  631

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELK LLPKEVE  R+A E+GNP +PN+I  CRSYPLY+F+R+ELGT +LTGEKV SPGE 
Sbjct  632  ELKTLLPKEVESTRAAYESGNPTVPNKINGCRSYPLYRFVRQELGTGLLTGEKVISPGEE  691

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
            CDK+FTA+C G IIDPLL+CL  WNGAPLPI 
Sbjct  692  CDKLFTAICQGKIIDPLLQCLGDWNGAPLPIS  723



>sp|Q01861.1|PAL1_PEA RecName: Full=Phenylalanine ammonia-lyase 1 [Pisum sativum]
 dbj|BAA00885.1| phenylalanine ammonia-lyase [Pisum sativum]
 dbj|BAA00886.1| phenylalanine ammonia-lyase [Pisum sativum]
Length=723

 Score =   259 bits (663),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 118/152 (78%), Positives = 132/152 (87%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLLRVVDRE+VFAY DDPCSA YPLMQKLRQVLVDHAL NGE EKN++TSIFQKIA FED
Sbjct  572  DLLRVVDREHVFAYIDDPCSATYPLMQKLRQVLVDHALVNGESEKNLNTSIFQKIATFED  631

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELK LLPKEVE  R+A E+GNP +PN+I  CRSYPLY+F+R+ELGT +LTGEKV SPGE 
Sbjct  632  ELKTLLPKEVESTRAAYESGNPTVPNKINGCRSYPLYRFVRQELGTGLLTGEKVISPGEE  691

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
            CDK+FTA+C G IIDPLL+CL  WNGAPLPI 
Sbjct  692  CDKLFTAICQGKIIDPLLQCLGDWNGAPLPIS  723



>ref|XP_002519521.1| Phenylalanine ammonia-lyase, putative [Ricinus communis]
 gb|EEF42935.1| Phenylalanine ammonia-lyase, putative [Ricinus communis]
Length=714

 Score =   259 bits (663),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 118/152 (78%), Positives = 133/152 (88%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLL+VVDREYVFAYADDPCSA YPLMQKLRQ+LV+HAL NGE+EKN  TS+FQKI+AFE+
Sbjct  563  DLLKVVDREYVFAYADDPCSATYPLMQKLRQILVEHALANGENEKNAGTSVFQKISAFEE  622

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELK LLPKEVE  R A E+GNPA  NRI ECRSYPLYKF+REELGT +LTG+KV SPGE 
Sbjct  623  ELKTLLPKEVESVRIAYESGNPATANRIKECRSYPLYKFVREELGTGLLTGDKVMSPGEE  682

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
             DKVFTA+C G IIDP+++CLK WNGAPLPIC
Sbjct  683  FDKVFTAMCQGKIIDPMMDCLKEWNGAPLPIC  714



>gb|AFZ78650.1| phenylalanine ammonia-lyase [Populus tomentosa]
Length=714

 Score =   259 bits (663),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 121/152 (80%), Positives = 135/152 (89%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            +LL+VVDRE VFAYADDPCSA YPLMQKLRQV VDHAL+NGE+EKN STS+FQKI AFE+
Sbjct  563  ELLKVVDREDVFAYADDPCSATYPLMQKLRQVFVDHALENGENEKNFSTSVFQKIEAFEE  622

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELKALLPKEVE AR+A ++GN AI N+I ECRSYPLYKF+REELGT +LTGEKVQSPGE 
Sbjct  623  ELKALLPKEVESARAAYDSGNSAIDNKIKECRSYPLYKFVREELGTVLLTGEKVQSPGEE  682

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
             DKVFTA+C G IIDP+LECL  WNGAPLPIC
Sbjct  683  FDKVFTAMCQGKIIDPMLECLGEWNGAPLPIC  714



>gb|ACE95170.1| phenylalanine ammonia-lyase [Populus tomentosa]
Length=714

 Score =   259 bits (663),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 121/152 (80%), Positives = 135/152 (89%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            +LL+VVDRE VFAYADDPCSA YPLMQKLRQVLVDHAL NGE+EKN STS+FQKIA FE+
Sbjct  563  ELLKVVDREDVFAYADDPCSATYPLMQKLRQVLVDHALANGENEKNASTSVFQKIATFEE  622

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELKALLPKEVE AR+A ++GN AI N+I ECRSYPLYKF+REELGT +LTGEKV+SPGE 
Sbjct  623  ELKALLPKEVESARAAYDSGNSAIENKIKECRSYPLYKFVREELGTGLLTGEKVRSPGEE  682

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
             DKVFTA+C G IIDP+LECL  WNGAPLPIC
Sbjct  683  FDKVFTAMCQGKIIDPMLECLGEWNGAPLPIC  714



>gb|KHG29664.1| Phenylalanine ammonia-lyase [Gossypium arboreum]
Length=721

 Score =   259 bits (663),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 121/152 (80%), Positives = 131/152 (86%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLL+ VDREYVF Y DDPCSA YPLMQKLRQVLV+HAL NGE EKN STSIFQKIA FE+
Sbjct  570  DLLKAVDREYVFVYIDDPCSATYPLMQKLRQVLVEHALTNGESEKNTSTSIFQKIADFEE  629

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            EL A+LPKEVE AR  LENGN AIPN I +CRSYPLYKF+REELGT +LTGEKV+SPGE 
Sbjct  630  ELHAVLPKEVESARVTLENGNAAIPNMIKDCRSYPLYKFVREELGTGLLTGEKVKSPGEE  689

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
             DKVFTA+C G IIDP+LECLK WNGAPLPIC
Sbjct  690  FDKVFTAMCQGKIIDPMLECLKEWNGAPLPIC  721



>gb|AFZ78653.1| phenylalanine ammonia-lyase [Populus tomentosa]
Length=711

 Score =   259 bits (662),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 119/152 (78%), Positives = 134/152 (88%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLL+VVDRE+VF+Y DDPCSA YPLMQ LRQVLV+HAL NGE E+N +TSIFQKI +FE+
Sbjct  560  DLLKVVDREHVFSYIDDPCSATYPLMQNLRQVLVEHALVNGERERNSTTSIFQKIGSFEE  619

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELK LLPKEVE AR  +ENGNPAIPNRI ECRSYPLYKF+REELGT +LTGEKV+SPGE 
Sbjct  620  ELKTLLPKEVESARLEVENGNPAIPNRIKECRSYPLYKFVREELGTSLLTGEKVKSPGEE  679

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
             DKVFTA+C G +IDPLLECLK W+GAPLPIC
Sbjct  680  FDKVFTAICAGKLIDPLLECLKEWDGAPLPIC  711



>gb|AJO53273.1| phenylalanine ammonia-lyase [Pogostemon cablin]
Length=711

 Score =   259 bits (662),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 121/152 (80%), Positives = 133/152 (88%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLLRVVDREYVFAYADDPCS NYPLMQKLRQVLVDHAL NG+ EKN STSIFQKI AFE+
Sbjct  560  DLLRVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALNNGDKEKNASTSIFQKIQAFEE  619

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELKA+LPKEVEGAR A+E G   I NRI ECRSYPLYKFIREE+GTE LTGEKV SPGE 
Sbjct  620  ELKAVLPKEVEGARLAVEGGKEVIGNRIKECRSYPLYKFIREEVGTEFLTGEKVTSPGEE  679

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
            CDKVF A+ +G ++DPL +CL++WNGAPLPIC
Sbjct  680  CDKVFKALTNGLMVDPLFKCLEAWNGAPLPIC  711



>gb|AGF50182.1| phenylalanine ammonia lyase, partial [Salvia officinalis]
Length=282

 Score =   247 bits (631),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 116/152 (76%), Positives = 131/152 (86%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DL+RVVDREYVF+Y DDPC A YPLMQKLRQVLV+HAL+NGE EK+VSTSIF KI  FE+
Sbjct  131  DLIRVVDREYVFSYIDDPCLATYPLMQKLRQVLVEHALKNGEGEKSVSTSIFHKIEQFEE  190

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            EL ALLPKEVE AR ALE+G+PA+PNRI ECRSYPLYKFIRE+LG   LTGEK  SPGE 
Sbjct  191  ELMALLPKEVESARIALESGSPAVPNRIAECRSYPLYKFIREDLGAGFLTGEKAVSPGEE  250

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
            CD VFTA+ +G I+DPLL+CLK+WNG PLPIC
Sbjct  251  CDMVFTALSNGLIVDPLLDCLKAWNGQPLPIC  282



>sp|Q42667.1|PALY_CITLI RecName: Full=Phenylalanine ammonia-lyase [Citrus limon]
 gb|AAB67733.1| phenylalanine ammonia-lyase [Citrus limon]
Length=722

 Score =   259 bits (662),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 119/152 (78%), Positives = 135/152 (89%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DL++VVDREYVFAY DDPCSA+ PLMQKLRQVLVDHAL NG+ EKN +TSIFQKI AFED
Sbjct  569  DLIKVVDREYVFAYIDDPCSASSPLMQKLRQVLVDHALDNGDREKNSTTSIFQKIGAFED  628

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELK LLPKEVE AR+ LE+GN AIPNRI ECRSYPLYK +RE++GT +LTGEKV+SPGE 
Sbjct  629  ELKTLLPKEVEIARTELESGNAAIPNRIKECRSYPLYKIVREDIGTSLLTGEKVRSPGEE  688

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
             DKVFTA+C+G +IDP+LECLK WNGAPLPIC
Sbjct  689  FDKVFTAMCEGKLIDPMLECLKEWNGAPLPIC  720



>gb|ACM44926.1| phenylalanine ammonia-lyase [Euphorbia pulcherrima]
Length=721

 Score =   259 bits (662),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 119/152 (78%), Positives = 135/152 (89%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            +LL+VVDREYVFAYADDPCS+ YPLMQKLRQV+VDHAL NG++EKN +TSIFQKI+AFE 
Sbjct  570  ELLKVVDREYVFAYADDPCSSTYPLMQKLRQVIVDHALLNGDNEKNANTSIFQKISAFEA  629

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELK LLPKEVE AR+A E+GN  IPNRI ECRSYPLYKF+REE GT ILTG+KV+SPGE 
Sbjct  630  ELKTLLPKEVEAARAAYESGNAPIPNRIMECRSYPLYKFVREEQGTGILTGDKVRSPGEE  689

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
             DKVFTA+C G IIDPL++CLK WNGAPLPIC
Sbjct  690  FDKVFTAMCQGKIIDPLMDCLKEWNGAPLPIC  721



>ref|XP_010107520.1| Phenylalanine ammonia-lyase [Morus notabilis]
 gb|EXC16202.1| Phenylalanine ammonia-lyase [Morus notabilis]
Length=725

 Score =   259 bits (662),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 119/152 (78%), Positives = 132/152 (87%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLL+VVDREYV+ Y DDPCSA YPLMQ LRQVLV+HAL NGE EKN STSIFQKIAAFE+
Sbjct  574  DLLKVVDREYVYTYIDDPCSATYPLMQTLRQVLVEHALTNGESEKNTSTSIFQKIAAFEE  633

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELK+LLPKEVE AR A ENGN AI N+ITECRSYPLYKF+REELGT +LTGEKV+SPGE 
Sbjct  634  ELKSLLPKEVESARIAYENGNAAISNKITECRSYPLYKFVREELGTSLLTGEKVRSPGEE  693

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
             DKV+TA+C G +IDP+LECL  WNG PLPIC
Sbjct  694  FDKVYTAMCQGKLIDPMLECLSGWNGEPLPIC  725



>gb|ADO64252.1| PAL [Epimedium sagittatum]
Length=708

 Score =   259 bits (661),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 116/152 (76%), Positives = 136/152 (89%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLL+V+DREY+FAY DDPCSA YPLMQKLRQVLVDHAL NG++EK+++TSIFQKI+ FE+
Sbjct  557  DLLKVIDREYIFAYIDDPCSATYPLMQKLRQVLVDHALLNGQNEKDLNTSIFQKISTFEE  616

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELKALLPKEVE  R+A+E+GNP IPNRI ECRSYPLYKF+REELGTE+LTGEKV+SPGE 
Sbjct  617  ELKALLPKEVESMRTAIESGNPLIPNRIKECRSYPLYKFVREELGTELLTGEKVRSPGEE  676

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
             DKVFTA+C G +IDPLL C+  W G+PLPIC
Sbjct  677  IDKVFTAICQGKLIDPLLACVSEWYGSPLPIC  708



>gb|ACS71953.1| phenylalanine ammonia-lyase [Euphorbia pulcherrima]
Length=721

 Score =   259 bits (662),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 119/152 (78%), Positives = 135/152 (89%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            +LL+VVDREYVFAYADDPCS+ YPLMQKLRQV+VDHAL NG++EKN +TSIFQKI+AFE 
Sbjct  570  ELLKVVDREYVFAYADDPCSSTYPLMQKLRQVIVDHALLNGDNEKNANTSIFQKISAFEA  629

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELK LLPKEVE AR+A E+GN  IPNRI ECRSYPLYKF+REE GT ILTG+KV+SPGE 
Sbjct  630  ELKTLLPKEVEAARAAYESGNAPIPNRIMECRSYPLYKFVREEQGTGILTGDKVRSPGEE  689

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
             DKVFTA+C G IIDPL++CLK WNGAPLPIC
Sbjct  690  FDKVFTAMCQGKIIDPLMDCLKEWNGAPLPIC  721



>ref|XP_008449240.1| PREDICTED: phenylalanine ammonia-lyase 1-like [Cucumis melo]
Length=714

 Score =   259 bits (661),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 116/152 (76%), Positives = 133/152 (88%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLL+VVDREY FAY DDPCSA YPLMQK RQVLV+HAL NGE EKN ++SIFQKI  FE+
Sbjct  563  DLLKVVDREYTFAYIDDPCSATYPLMQKFRQVLVEHALANGEDEKNTNSSIFQKIHVFEE  622

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELK +LPKEVE ARSA ENGNP + N+I +CRSYPLYKFIR+ELGTE+LTGEK +SPGEV
Sbjct  623  ELKVVLPKEVESARSAYENGNPTVQNQIKKCRSYPLYKFIRKELGTELLTGEKAKSPGEV  682

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
            C+KVFTA+C G +IDP+LECLK WNGAP+PIC
Sbjct  683  CEKVFTALCQGKMIDPILECLKEWNGAPIPIC  714



>ref|XP_006428758.1| hypothetical protein CICLE_v10011134mg [Citrus clementina]
 gb|ESR41998.1| hypothetical protein CICLE_v10011134mg [Citrus clementina]
Length=757

 Score =   259 bits (663),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 118/152 (78%), Positives = 132/152 (87%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLL+  DRE+VFAY DDPCSA YPLMQKLRQVLV+HAL NGE+EKN ++SIFQKIAAFE+
Sbjct  606  DLLKAADREHVFAYIDDPCSATYPLMQKLRQVLVEHALNNGENEKNANSSIFQKIAAFEE  665

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELKA+LPKEVE AR  +ENGNP IPNRI ECRSYPLY+ +REELGT  LTGEKV SPGE 
Sbjct  666  ELKAVLPKEVENARQTVENGNPTIPNRIKECRSYPLYRLVREELGTNFLTGEKVTSPGEK  725

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
             DKVFTA+C G IIDP+LECL+ WNGAPLPIC
Sbjct  726  FDKVFTAMCQGKIIDPMLECLREWNGAPLPIC  757



>ref|XP_003542541.1| PREDICTED: phenylalanine ammonia-lyase class 2-like [Glycine 
max]
Length=716

 Score =   259 bits (661),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 121/152 (80%), Positives = 131/152 (86%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLL+VVDREY FAY DDPCS  YPLMQKLRQVLVD+AL NGE+EKN +TSIFQKIA FE+
Sbjct  565  DLLKVVDREYTFAYIDDPCSGTYPLMQKLRQVLVDYALANGENEKNTNTSIFQKIATFEE  624

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELK LLPKEVEGAR A EN   AIPN+I ECRSYPLYKF+REELGT +LTGE+V SPGE 
Sbjct  625  ELKTLLPKEVEGARVAYENDQCAIPNKIKECRSYPLYKFVREELGTALLTGERVVSPGEE  684

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
            CDKVFTA+C G IIDPLLECL  WNGAPLPIC
Sbjct  685  CDKVFTAMCQGKIIDPLLECLGEWNGAPLPIC  716



>ref|XP_010515816.1| PREDICTED: phenylalanine ammonia-lyase 2 [Camelina sativa]
Length=718

 Score =   259 bits (661),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 117/152 (77%), Positives = 132/152 (87%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLL+VVDRE VF Y DDPCSA YPLMQKLRQV+VDHAL NGE EKN  TSIFQKI AFE+
Sbjct  567  DLLKVVDREQVFTYVDDPCSATYPLMQKLRQVIVDHALSNGETEKNAGTSIFQKIGAFEE  626

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELKA+LPKEVE  R+A  NG  AIPNRITECRSYPLY+F+REELGT++LTGEKV SPGE 
Sbjct  627  ELKAVLPKEVEATRAAYGNGTAAIPNRITECRSYPLYRFVREELGTKLLTGEKVVSPGEE  686

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
             DKVFTA+C+G +IDPL++CLK WNGAP+PIC
Sbjct  687  FDKVFTAMCEGKLIDPLMDCLKEWNGAPIPIC  718



>ref|XP_004304440.1| PREDICTED: phenylalanine ammonia-lyase 1 [Fragaria vesca subsp. 
vesca]
Length=724

 Score =   259 bits (661),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 118/152 (78%), Positives = 134/152 (88%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLL VV+REY+FAY DDPCSA YPLMQ+LRQVLV+HAL NGE+EKN +TSIFQKI+AFE+
Sbjct  573  DLLMVVEREYLFAYIDDPCSATYPLMQRLRQVLVEHALTNGENEKNANTSIFQKISAFEE  632

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELK +LPKEVE AR+A E+GN AIPNRI ECRSYPLYKF+REELG E LTGEKV+SPGE 
Sbjct  633  ELKTILPKEVESARAACESGNAAIPNRIIECRSYPLYKFVREELGGEFLTGEKVRSPGEE  692

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
            CDKVFTA+C G IIDP+L+CL  WNG PLPIC
Sbjct  693  CDKVFTAMCQGKIIDPILDCLSGWNGEPLPIC  724



>gb|AIY26016.1| PAL [Jasminum sambac]
Length=712

 Score =   258 bits (660),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 120/152 (79%), Positives = 134/152 (88%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLLRVVDREY+FAY DDPCS  YPLMQKLRQVLV+HAL N E+EK+ STSIFQKI AFED
Sbjct  561  DLLRVVDREYLFAYIDDPCSTTYPLMQKLRQVLVEHALNNTENEKSGSTSIFQKIEAFED  620

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELKA+LPKEVE +R ALE+GNPAIPNRI +CRSYPLYKF+R+EL TE LTGE+V SPGEV
Sbjct  621  ELKAVLPKEVESSRVALESGNPAIPNRIKDCRSYPLYKFVRDELKTEFLTGERVTSPGEV  680

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
             DKVFTA+  G +IDP+LECLK WNGAPLPIC
Sbjct  681  LDKVFTAMSKGLMIDPMLECLKGWNGAPLPIC  712



>ref|XP_006436446.1| hypothetical protein CICLE_v10030821mg [Citrus clementina]
 ref|XP_006485648.1| PREDICTED: phenylalanine ammonia-lyase-like [Citrus sinensis]
 gb|ESR49686.1| hypothetical protein CICLE_v10030821mg [Citrus clementina]
Length=722

 Score =   259 bits (661),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 119/152 (78%), Positives = 134/152 (88%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DL++VVDREYVFAY DDPCSA+YPLMQKLRQVLVDHAL NG+ EKN +TSIFQKI AFED
Sbjct  569  DLIKVVDREYVFAYIDDPCSASYPLMQKLRQVLVDHALDNGDREKNSTTSIFQKIGAFED  628

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELK LLPKEVE AR+ LE+GN AI NRI ECRSYPLYK +REE+GT +LTGEKV+SPGE 
Sbjct  629  ELKTLLPKEVEIARTELESGNAAIANRIKECRSYPLYKIVREEIGTSLLTGEKVRSPGEE  688

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
             DKVF A+C+G +IDP+LECLK WNGAPLPIC
Sbjct  689  FDKVFAAMCEGKLIDPMLECLKEWNGAPLPIC  720



>gb|AEW43005.1| phenylalanine ammonia lyase, partial [Leucaena leucocephala]
Length=365

 Score =   249 bits (637),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 117/152 (77%), Positives = 130/152 (86%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLL VVDRE+VF Y DDPCSA YPLMQKLRQVLVDHALQNG  E + +TSIF KIAAFE 
Sbjct  214  DLLTVVDREHVFDYIDDPCSATYPLMQKLRQVLVDHALQNGNRENDANTSIFLKIAAFEK  273

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELK LLPKEVE AR  +ENG  AIPNRI ECRSYPLY+F+REELGT +LTGEKV+SPGE 
Sbjct  274  ELKTLLPKEVESARIEVENGKSAIPNRIKECRSYPLYRFVREELGTGLLTGEKVRSPGEE  333

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
             DKVFTA+C+G +IDPLL+CLK WNGAPLP+C
Sbjct  334  FDKVFTAMCEGKLIDPLLDCLKGWNGAPLPLC  365



>gb|KDO46246.1| hypothetical protein CISIN_1g004955mg [Citrus sinensis]
Length=722

 Score =   259 bits (661),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 119/152 (78%), Positives = 134/152 (88%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DL++VVDREYVFAY DDPCSA+YPLMQKLRQVLVDHAL NG+ EKN +TSIFQKI AFED
Sbjct  569  DLIKVVDREYVFAYIDDPCSASYPLMQKLRQVLVDHALDNGDREKNSTTSIFQKIGAFED  628

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELK LLPKEVE AR+ LE+GN AI NRI ECRSYPLYK +REE+GT +LTGEKV+SPGE 
Sbjct  629  ELKTLLPKEVEIARTELESGNAAIANRIKECRSYPLYKIVREEIGTSLLTGEKVRSPGEE  688

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
             DKVF A+C+G +IDP+LECLK WNGAPLPIC
Sbjct  689  FDKVFAAMCEGKLIDPMLECLKEWNGAPLPIC  720



>ref|XP_003590471.1| Phenylalanine ammonia-lyase [Medicago truncatula]
 gb|AES60722.1| phenylalanine ammonia-lyase-like protein [Medicago truncatula]
Length=712

 Score =   258 bits (660),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 120/152 (79%), Positives = 131/152 (86%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLL+VVDREYVFAYADDPC A YPLMQKLRQVLVDHAL N E EKN +TSIFQKIA FED
Sbjct  561  DLLKVVDREYVFAYADDPCLATYPLMQKLRQVLVDHALVNTEGEKNSNTSIFQKIATFED  620

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELKA+LPKEVE AR+A ENG   I N+I ECRSYPLYKF+REELGT +LTGEKV SPGE 
Sbjct  621  ELKAILPKEVESARTAYENGQSGISNKIKECRSYPLYKFVREELGTALLTGEKVISPGEE  680

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
            CDK+FTA+C G I+DPL+ECL  WNGAPLPIC
Sbjct  681  CDKLFTAMCQGKIVDPLMECLGEWNGAPLPIC  712



>sp|O49835.1|PAL1_LITER RecName: Full=Phenylalanine ammonia-lyase 1; Short=PAL-1 [Lithospermum 
erythrorhizon]
 dbj|BAA24928.1| phenylalanine ammonia-lyase [Lithospermum erythrorhizon]
Length=710

 Score =   258 bits (659),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 118/152 (78%), Positives = 136/152 (89%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLLRVVDREYVFAYADDPC   YPLMQKLR+ LV HAL NGE+EK+V+TSIF KIA FE+
Sbjct  559  DLLRVVDREYVFAYADDPCLTTYPLMQKLRETLVGHALDNGENEKDVNTSIFHKIAIFEE  618

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELKA+LPKEVE AR+++ENG PAI NRI ECRSYPLYKF+REELGTE+LTGEKV+SPGE 
Sbjct  619  ELKAILPKEVENARASVENGIPAISNRIEECRSYPLYKFVREELGTELLTGEKVRSPGEE  678

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
             DKVFTA+C+G ++DPLL CL++WNGAPLPIC
Sbjct  679  LDKVFTAMCEGKLVDPLLACLEAWNGAPLPIC  710



>ref|XP_009606373.1| PREDICTED: phenylalanine ammonia-lyase G4-like [Nicotiana tomentosiformis]
Length=717

 Score =   258 bits (659),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 121/152 (80%), Positives = 132/152 (87%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLL VVDREYVFAYADDPCS NYPL+QKLRQVLVDHAL NGE E N STSIFQKI AFE+
Sbjct  566  DLLNVVDREYVFAYADDPCSCNYPLIQKLRQVLVDHALLNGEGEMNSSTSIFQKIGAFEE  625

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELKA+LPKEVE AR  LEN  P IPNRI ECRSYPLYKF+R+ELGT +LTGE VQSPGEV
Sbjct  626  ELKAILPKEVESARCDLENSKPTIPNRIQECRSYPLYKFVRKELGTNLLTGENVQSPGEV  685

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
             DKVFTA+ +G +IDPLL+CLK WNGAPLP+C
Sbjct  686  FDKVFTAINEGKLIDPLLDCLKEWNGAPLPLC  717



>ref|XP_002315309.2| hypothetical protein POPTR_0010s23110g [Populus trichocarpa]
 gb|EEF01480.2| hypothetical protein POPTR_0010s23110g [Populus trichocarpa]
Length=707

 Score =   258 bits (659),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 118/152 (78%), Positives = 134/152 (88%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLL+VVDRE+VF+Y DDPCSA YPLMQKLRQVLV+HAL NGE E+N +T+I QKI +FE+
Sbjct  556  DLLKVVDREHVFSYIDDPCSATYPLMQKLRQVLVEHALVNGERERNSTTTILQKIGSFEE  615

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELK LLPKEVE AR  +ENGNPAIPNRI ECRSYPLYKF+REELGT +LTGEKV+SPGE 
Sbjct  616  ELKTLLPKEVESARLEVENGNPAIPNRIKECRSYPLYKFVREELGTSLLTGEKVKSPGEE  675

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
             DKVFTA+C G +IDPLLECLK W+GAPLPIC
Sbjct  676  FDKVFTAICAGKLIDPLLECLKEWDGAPLPIC  707



>gb|AGE10589.1| phenylalanine amononia-lyase [Lonicera japonica]
Length=714

 Score =   258 bits (659),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 120/152 (79%), Positives = 135/152 (89%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLLRVVDREYVFAY DDPCSA YPLM+KLRQVLV+HAL+N   EKNVSTSIFQKI AFE+
Sbjct  563  DLLRVVDREYVFAYIDDPCSATYPLMEKLRQVLVEHALKNEVSEKNVSTSIFQKIGAFEE  622

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELKALLPKEVE  R+ +E+GN  I NRI +CRSYPLYKF+REELGTE+LTGEKV+SPGE 
Sbjct  623  ELKALLPKEVESTRALIESGNGGIANRIKDCRSYPLYKFVREELGTELLTGEKVRSPGEE  682

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
             DKVFTA+C+G IIDPLL+CL SWNG+PLPIC
Sbjct  683  FDKVFTAMCEGKIIDPLLDCLTSWNGSPLPIC  714



>sp|Q43052.1|PAL2_POPKI RecName: Full=Phenylalanine ammonia-lyase G2B [Populus sieboldii 
x Populus grandidentata]
 pir||S60042 phenylalanine ammonia-lyase (EC 4.3.1.5) 2b - Japanese aspen 
x large-toothed aspen
 dbj|BAA07860.1| phenylalanine ammonia-lyase [Populus sieboldii x Populus grandidentata]
Length=710

 Score =   258 bits (659),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 119/152 (78%), Positives = 134/152 (88%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLL+VVDRE+VF+Y DDPCSA YPLMQKLRQVLV+HAL NGE  +N +TSIFQKI +FE+
Sbjct  559  DLLKVVDREHVFSYIDDPCSATYPLMQKLRQVLVEHALVNGEKVRNSTTSIFQKIGSFEE  618

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELK LLPKEVE AR  +ENGNPAIPNRI ECRSYPLYKF+REELGT +LTGEKV+SPGE 
Sbjct  619  ELKTLLPKEVESARLEVENGNPAIPNRIKECRSYPLYKFVREELGTSLLTGEKVKSPGEE  678

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
             DKVFTA+C G +IDPLLECLK W+GAPLPIC
Sbjct  679  FDKVFTAICAGKLIDPLLECLKEWDGAPLPIC  710



>ref|XP_006403711.1| hypothetical protein EUTSA_v10010153mg [Eutrema salsugineum]
 dbj|BAJ33750.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ45164.1| hypothetical protein EUTSA_v10010153mg [Eutrema salsugineum]
Length=725

 Score =   258 bits (659),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 119/152 (78%), Positives = 132/152 (87%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLL+VVDRE VF Y DDPCSA YPLMQKLRQV+VDHAL NGE EKNV+TSIFQKI AFE+
Sbjct  574  DLLKVVDREQVFTYVDDPCSATYPLMQKLRQVIVDHALCNGETEKNVATSIFQKIGAFEE  633

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELKA LPKEVE  R+A  NG  AIPNRI ECRSYPLYKF+REELGT++LTGEKV SPGE 
Sbjct  634  ELKATLPKEVEATRAAFGNGTAAIPNRIKECRSYPLYKFVREELGTKLLTGEKVVSPGEE  693

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
             DKVFTA+C+G IIDPL++CLK WNGAP+PIC
Sbjct  694  FDKVFTAMCEGKIIDPLMDCLKEWNGAPIPIC  725



>ref|XP_010107518.1| Phenylalanine ammonia-lyase [Morus notabilis]
 gb|EXC16200.1| Phenylalanine ammonia-lyase [Morus notabilis]
Length=769

 Score =   259 bits (661),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 119/152 (78%), Positives = 132/152 (87%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLL+VVDREYV+ Y DDPCSA YPLMQ LRQVLV+HAL NGE EKN STSIFQKIAAFE+
Sbjct  618  DLLKVVDREYVYTYIDDPCSATYPLMQTLRQVLVEHALTNGESEKNTSTSIFQKIAAFEE  677

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELK+LLPKEVE AR A ENGN AI N+ITECRSYPLYKF+REELGT +LTGEKV+SPGE 
Sbjct  678  ELKSLLPKEVESARIAYENGNAAISNKITECRSYPLYKFVREELGTSLLTGEKVRSPGEE  737

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
             DKV+TA+C G +IDP+LECL  WNG PLPIC
Sbjct  738  FDKVYTAMCQGKLIDPMLECLSGWNGEPLPIC  769



>sp|P45731.1|PAL1_POPKI RecName: Full=Phenylalanine ammonia-lyase G1 [Populus sieboldii 
x Populus grandidentata]
 dbj|BAA06337.1| phenylalanine ammonia-lyase [Populus sieboldii x Populus grandidentata]
Length=682

 Score =   257 bits (657),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 117/152 (77%), Positives = 133/152 (88%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLL++VD+E+VFAY DDPCSA YPLMQKLRQVLV+HAL NGE E N +TSIFQKI +FE+
Sbjct  531  DLLKLVDKEHVFAYIDDPCSATYPLMQKLRQVLVEHALVNGERETNSTTSIFQKIRSFEE  590

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELK LLPKEVE AR  +ENGNP +PNRI ECRSYPLYKF+REELGT +LTGEKV+SPGE 
Sbjct  591  ELKTLLPKEVESARLEVENGNPVVPNRIKECRSYPLYKFVREELGTSLLTGEKVKSPGED  650

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
             DKVFTA+C G ++DPLLECLK WNGAPLPIC
Sbjct  651  FDKVFTAICAGKLMDPLLECLKEWNGAPLPIC  682



>ref|XP_010684079.1| PREDICTED: phenylalanine ammonia-lyase [Beta vulgaris subsp. 
vulgaris]
 emb|CAH17686.1| phenylalanine ammonia lyase [Beta vulgaris]
Length=719

 Score =   258 bits (658),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 121/152 (80%), Positives = 132/152 (87%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            +L+RVV+REYVFAYADDPCS  YPLMQKLRQVLVD AL NG+ EKNVSTSIFQKI AFE+
Sbjct  568  ELIRVVEREYVFAYADDPCSVTYPLMQKLRQVLVDQALANGDSEKNVSTSIFQKIGAFEE  627

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELKA LPKEVE AR+A E+GN  IPNRI ECRSYP+YKFIREEL T +LTGEKV SPGE 
Sbjct  628  ELKARLPKEVEAARAAYESGNSVIPNRIKECRSYPVYKFIREELNTNLLTGEKVISPGEE  687

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
             DKVFTA+C G IIDPLL+CLK WNGAPLPIC
Sbjct  688  IDKVFTAICQGKIIDPLLDCLKEWNGAPLPIC  719



>gb|KHG30005.1| Phenylalanine ammonia-lyase [Gossypium arboreum]
Length=718

 Score =   258 bits (658),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 117/152 (77%), Positives = 132/152 (87%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLL+ VD EYVF+Y DDPCSA YPLMQKLRQVLV+HAL NG +E N STSIFQKIAAFE+
Sbjct  567  DLLKAVDHEYVFSYIDDPCSATYPLMQKLRQVLVEHALSNGNNENNASTSIFQKIAAFEE  626

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELK LLPKEVE +R ++ENGN AIPN+I ECRSYPLYKF+REELGT +LTGEKV+SPGE 
Sbjct  627  ELKTLLPKEVENSRVSVENGNAAIPNKIMECRSYPLYKFVREELGTGLLTGEKVKSPGEE  686

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
             DKVF A+C G +IDP+LECLK WNGAPLPIC
Sbjct  687  FDKVFIAICQGKVIDPMLECLKEWNGAPLPIC  718



>ref|XP_003556238.1| PREDICTED: phenylalanine ammonia-lyase 2-like [Glycine max]
Length=717

 Score =   258 bits (658),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 119/152 (78%), Positives = 133/152 (88%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLL++VDREYV+AY DDPCSA YPLMQKLR VLVDHALQNG+ E N STSIFQKI AFE+
Sbjct  566  DLLKIVDREYVYAYIDDPCSATYPLMQKLRLVLVDHALQNGDKEVNSSTSIFQKIGAFEE  625

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            EL ALLPKEVE +R  +ENGNPAIPNRI ECRSYPLYKF+RE LGT +LTGEKV+SPGE 
Sbjct  626  ELNALLPKEVESSRIEVENGNPAIPNRIKECRSYPLYKFVRENLGTTLLTGEKVKSPGEE  685

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
             DKVFTA+C+G +IDPLL+CLK W GAPLPIC
Sbjct  686  FDKVFTALCEGKLIDPLLDCLKEWKGAPLPIC  717



>gb|ACR15762.1| phenylalanine ammonia-lyase [Litchi chinensis]
Length=723

 Score =   258 bits (658),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 121/152 (80%), Positives = 131/152 (86%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLL+VVDREYVFAY DDPCSA YPLMQKLRQVLV+HAL NGE+EKNV++SIFQKI AFE+
Sbjct  572  DLLKVVDREYVFAYIDDPCSATYPLMQKLRQVLVEHALFNGENEKNVTSSIFQKIGAFEE  631

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELKA+LPKEVE AR   ENGN AIPN+I ECRSYPLYKF+REELG   LTGEK  SPGE 
Sbjct  632  ELKAVLPKEVENARQVYENGNAAIPNKIEECRSYPLYKFVREELGAGFLTGEKAVSPGEE  691

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
             DKVFTA+C G IIDPLLECL  WNGAPLPIC
Sbjct  692  FDKVFTAMCQGKIIDPLLECLGEWNGAPLPIC  723



>gb|ADR78835.1| phenylalanine ammonia lyase [Ziziphus jujuba]
Length=559

 Score =   254 bits (648),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 117/152 (77%), Positives = 134/152 (88%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            +LL+VVDREYVFAY DDPCSA YPLMQKLRQV+V+HAL+NGE+E+N STSIFQKIAAFE+
Sbjct  408  ELLQVVDREYVFAYIDDPCSATYPLMQKLRQVIVEHALKNGENERNASTSIFQKIAAFEE  467

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELK LLPKEVE AR+  ENGNPAIPN+I E RSYPLYKF+REELG  +LTGEK +SPGE 
Sbjct  468  ELKTLLPKEVESARAEYENGNPAIPNKIKERRSYPLYKFVREELGAGLLTGEKARSPGEE  527

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
            CDKVF+A+  G +IDP+LECLK WNGAPLPI 
Sbjct  528  CDKVFSAIYAGKLIDPMLECLKEWNGAPLPIS  559



>emb|CDY18464.1| BnaA04g21230D [Brassica napus]
Length=423

 Score =   250 bits (638),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 115/152 (76%), Positives = 129/152 (85%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLL+VVDRE V+ YADDPCSA YPL+QKLRQV+VDHAL NGE EKN  TSIF KI AFE+
Sbjct  272  DLLKVVDREQVYTYADDPCSATYPLIQKLRQVIVDHALVNGESEKNAMTSIFHKIGAFEE  331

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELKA+LP EVE AR A +NG  AIPNRI ECRSYPLY+F+REELGTE+LTGEK  SPGE 
Sbjct  332  ELKAVLPDEVEAARVAYDNGTSAIPNRIKECRSYPLYRFVREELGTELLTGEKATSPGEE  391

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
             DKVFTA+C+G IIDPL+ECL  WNGAP+PIC
Sbjct  392  FDKVFTAICEGKIIDPLMECLDEWNGAPIPIC  423



>ref|XP_006293761.1| hypothetical protein CARUB_v10022721mg [Capsella rubella]
 gb|EOA26659.1| hypothetical protein CARUB_v10022721mg [Capsella rubella]
Length=726

 Score =   258 bits (658),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 117/152 (77%), Positives = 132/152 (87%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLL+VVDRE V+ YADDPCSA YPL+QKLRQV+VDHAL NGE EKN  TSIF KI AFE+
Sbjct  575  DLLKVVDREQVYTYADDPCSATYPLIQKLRQVIVDHALINGESEKNAVTSIFHKIGAFEE  634

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELKA+LPKEVE AR+A +NG  AIPNRI ECRSYPLY+F+REELGTE+LTGEKV SPGE 
Sbjct  635  ELKAVLPKEVEAARAAYDNGTSAIPNRIKECRSYPLYRFVREELGTELLTGEKVTSPGEE  694

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
             DKVFTA+C+G IIDP++ECL  WNGAPLPIC
Sbjct  695  FDKVFTAICEGKIIDPMMECLNEWNGAPLPIC  726



>gb|KJB73539.1| hypothetical protein B456_011G238400 [Gossypium raimondii]
Length=710

 Score =   257 bits (657),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 118/152 (78%), Positives = 133/152 (88%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLLRVVDREY++AYADDPCSANYPL+QKLRQVLVDHAL NG+ EK+ +TSIFQKI  FE+
Sbjct  559  DLLRVVDREYLYAYADDPCSANYPLIQKLRQVLVDHALMNGDREKDSTTSIFQKIGVFEE  618

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELK  LPKEVE AR+  ENG+PAI N+I ECRSYPLYKF+RE LGT +LTGEKV SPGE 
Sbjct  619  ELKTQLPKEVESARTEFENGSPAIANKIEECRSYPLYKFVREVLGTHLLTGEKVISPGEE  678

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
            CDKVFTA+C G +IDPLL+CLK WNGAPLPIC
Sbjct  679  CDKVFTAMCAGKLIDPLLDCLKDWNGAPLPIC  710



>ref|XP_010262867.1| PREDICTED: phenylalanine ammonia-lyase [Nelumbo nucifera]
Length=715

 Score =   257 bits (657),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 118/152 (78%), Positives = 136/152 (89%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLL+VVDREYVFAY DDPCSA YPLMQ LRQVLV HAL NGE+EKN +TSIFQKI AFE+
Sbjct  564  DLLKVVDREYVFAYIDDPCSATYPLMQNLRQVLVQHALLNGENEKNSNTSIFQKITAFEE  623

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELKALLPKEVEGAR A E+G+PA+PNRI ECRSYP+YKF+RE+L T +LTGEKV+SPGE 
Sbjct  624  ELKALLPKEVEGARIAYESGSPAVPNRIKECRSYPIYKFVREQLHTGLLTGEKVRSPGEE  683

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
             DKVF+A+C+G +IDPLL+CL+ WNGAPLPIC
Sbjct  684  FDKVFSAMCEGKMIDPLLDCLRDWNGAPLPIC  715



>gb|KDO36715.1| hypothetical protein CISIN_1g016039mg [Citrus sinensis]
Length=396

 Score =   249 bits (636),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 117/152 (77%), Positives = 128/152 (84%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLL+VVDREYVF+YADDPCSA YPLM+KLRQVLVDHAL N E  KN + SIF KI AFE+
Sbjct  245  DLLKVVDREYVFSYADDPCSATYPLMRKLRQVLVDHALTNNEDLKNANASIFLKIGAFEE  304

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELK LLPKEVE ARSA E+GN  IPNRI ECRSYPLY+F+REELG   LTGEK  SPGE 
Sbjct  305  ELKTLLPKEVESARSAFESGNLEIPNRIKECRSYPLYRFVREELGARYLTGEKAISPGEE  364

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
            CDKVFTA+C G IIDPLLECLK W+G+PLPIC
Sbjct  365  CDKVFTAICQGKIIDPLLECLKEWDGSPLPIC  396



>gb|ABD73282.1| phenylalanine ammonia-lyase [Salvia miltiorrhiza]
Length=711

 Score =   257 bits (657),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 120/152 (79%), Positives = 132/152 (87%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DL+RVVDREYVFAY DDPCSA YPLMQKLRQVLVDHAL+NG+ EKN STSIFQKI AFE+
Sbjct  560  DLIRVVDREYVFAYIDDPCSATYPLMQKLRQVLVDHALKNGDLEKNASTSIFQKIEAFEE  619

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELKALLPKEVE AR ALE+G+P + NRI ECRSYPLYKFIRE+LG   LTGEK  SPGE 
Sbjct  620  ELKALLPKEVESARMALESGSPTVANRIAECRSYPLYKFIREQLGAGFLTGEKAVSPGEE  679

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
            C+KVFTA+ +G IIDPLLECL+ WNG PLPIC
Sbjct  680  CEKVFTALSNGLIIDPLLECLQGWNGQPLPIC  711



>ref|XP_009794410.1| PREDICTED: phenylalanine ammonia-lyase-like [Nicotiana sylvestris]
Length=717

 Score =   257 bits (657),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 120/152 (79%), Positives = 135/152 (89%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLL+VVDREYVFAYADDPC+ NYPL+QKLRQVLVDHAL NGE EKN STSIF+KI+AFE+
Sbjct  566  DLLKVVDREYVFAYADDPCNCNYPLIQKLRQVLVDHALLNGEGEKNSSTSIFEKISAFEE  625

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELKA+LPKEVE AR  LEN  P IPNRI ECRSYPLYKF+R+ELGT +LTGE VQSPGEV
Sbjct  626  ELKAILPKEVESARCDLENCKPTIPNRIQECRSYPLYKFVRKELGTNLLTGENVQSPGEV  685

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
             DKVFTA+ +G +IDPLL+CLK WNGAPLP+C
Sbjct  686  FDKVFTAINEGKLIDPLLDCLKEWNGAPLPLC  717



>sp|P27990.1|PALY_MEDSA RecName: Full=Phenylalanine ammonia-lyase [Medicago sativa]
 emb|CAA41169.1| phenylalanine ammonia-lyase [Medicago sativa]
Length=725

 Score =   257 bits (657),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 119/152 (78%), Positives = 131/152 (86%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLL+VVDRE+VFAY DDPCSA YPL QKLRQVLVDHAL NGE EKN +TSIFQKIA FE+
Sbjct  574  DLLKVVDREHVFAYIDDPCSATYPLSQKLRQVLVDHALVNGESEKNFNTSIFQKIATFEE  633

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELK LLPKEVE AR+A E+GNP IPN+I  CRSYPLYKF+REELGT +LTGE V SPGE 
Sbjct  634  ELKTLLPKEVESARTAYESGNPTIPNKINGCRSYPLYKFVREELGTGLLTGENVISPGEE  693

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
            CDK+F+A+C G IIDPLLECL  WNGAPLPIC
Sbjct  694  CDKLFSAMCQGKIIDPLLECLGEWNGAPLPIC  725



>gb|AGY49231.1| phenylalanine ammonia lyase [Ricinus communis]
Length=714

 Score =   257 bits (656),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 117/152 (77%), Positives = 132/152 (87%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLL+VVDREYVFAYADDPCSA YPLMQKLRQ+LV+HAL NGE+EKN  TS+FQKI+AFE+
Sbjct  563  DLLKVVDREYVFAYADDPCSATYPLMQKLRQILVEHALANGENEKNAGTSVFQKISAFEE  622

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELK LLPKEVE  R A E+GNPA  NRI ECRSYPLYKF+REELGT +LTG+KV S GE 
Sbjct  623  ELKTLLPKEVESVRIAYESGNPATANRIKECRSYPLYKFVREELGTGLLTGDKVMSSGEE  682

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
             DKVFTA+C G IIDP+++CLK WNGAPLPIC
Sbjct  683  FDKVFTAMCQGKIIDPMMDCLKEWNGAPLPIC  714



>ref|XP_011010447.1| PREDICTED: phenylalanine ammonia-lyase [Populus euphratica]
Length=715

 Score =   257 bits (656),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 118/152 (78%), Positives = 134/152 (88%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            +LL+VVDREYVFAY DDPCSA YPLMQKLRQVLVDHAL+NGE+EKN+STS+FQKI AFE+
Sbjct  564  ELLKVVDREYVFAYVDDPCSATYPLMQKLRQVLVDHALENGENEKNLSTSVFQKIGAFEE  623

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELKALLPKEVE AR+A ++GN AI N+I ECRSYPLYKF+REELG  +LTGEKVQSPGE 
Sbjct  624  ELKALLPKEVESARAAYDSGNSAIDNKIKECRSYPLYKFVREELGAVLLTGEKVQSPGEE  683

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
             DKVF A+C G IIDP+LECL  WNG+PLPI 
Sbjct  684  FDKVFAAMCQGKIIDPMLECLGEWNGSPLPIS  715



>gb|KGN52971.1| hypothetical protein Csa_4G008250 [Cucumis sativus]
Length=255

 Score =   244 bits (623),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 112/152 (74%), Positives = 128/152 (84%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLL+VVDREY FAY DDPCSA YPLMQKLRQ+LV+HAL+NG+ E N +TSIFQKI AFE+
Sbjct  104  DLLKVVDREYTFAYIDDPCSATYPLMQKLRQILVEHALKNGDSETNENTSIFQKIGAFEE  163

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELKA+LPKEVE  R A ENGN  I N+I +CRSYPLYKF+REELGT +LTGEKV SPGE 
Sbjct  164  ELKAILPKEVENVRLAYENGNSEIENQIKDCRSYPLYKFVREELGTRLLTGEKVISPGEE  223

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
            C+KVFTA+  G +ID + ECLK WNGAPLPIC
Sbjct  224  CEKVFTALSQGKMIDSIFECLKEWNGAPLPIC  255



>gb|AAC18870.1| phenylalanine ammonia lyase [Arabidopsis thaliana]
Length=725

 Score =   257 bits (656),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 116/152 (76%), Positives = 132/152 (87%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLL+VVDRE V+ YADDPCSA YPL+QKLRQV+VDHAL NGE EKN  TSIF KI AFE+
Sbjct  574  DLLKVVDREQVYTYADDPCSATYPLIQKLRQVIVDHALVNGESEKNAVTSIFHKIGAFEE  633

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELKA+LPKEVE AR+A +NG  AIPNRI ECRSYPLY+F+REELGTE+LTGEKV SPGE 
Sbjct  634  ELKAVLPKEVEAARAAYDNGTSAIPNRIKECRSYPLYRFVREELGTELLTGEKVTSPGEE  693

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
             DKVFTA+C+G IIDP++ECL  WNGAP+PIC
Sbjct  694  FDKVFTAICEGKIIDPMMECLNEWNGAPIPIC  725



>ref|NP_181241.1| phenylalanine ammonia-lyase 1 [Arabidopsis thaliana]
 sp|P35510.3|PAL1_ARATH RecName: Full=Phenylalanine ammonia-lyase 1 [Arabidopsis thaliana]
 gb|AAK76593.1| putative phenylalanine ammonia lyase PAL1 [Arabidopsis thaliana]
 gb|AAL85094.1| putative phenylalanine ammonia lyase PAL1 [Arabidopsis thaliana]
 gb|AAM15324.1| phenylalanine ammonia lyase (PAL1) [Arabidopsis thaliana]
 gb|AAO29949.1| Unknown protein [Arabidopsis thaliana]
 gb|AAP59438.1| phenylalanine ammonia lyase [Arabidopsis thaliana]
 gb|AEC09341.1| phenylalanine ammonia-lyase 1 [Arabidopsis thaliana]
 gb|AGA15805.1| PAL1 [Expression vector pUDE172]
Length=725

 Score =   257 bits (656),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 116/152 (76%), Positives = 132/152 (87%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLL+VVDRE V+ YADDPCSA YPL+QKLRQV+VDHAL NGE EKN  TSIF KI AFE+
Sbjct  574  DLLKVVDREQVYTYADDPCSATYPLIQKLRQVIVDHALINGESEKNAVTSIFHKIGAFEE  633

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELKA+LPKEVE AR+A +NG  AIPNRI ECRSYPLY+F+REELGTE+LTGEKV SPGE 
Sbjct  634  ELKAVLPKEVEAARAAYDNGTSAIPNRIKECRSYPLYRFVREELGTELLTGEKVTSPGEE  693

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
             DKVFTA+C+G IIDP++ECL  WNGAP+PIC
Sbjct  694  FDKVFTAICEGKIIDPMMECLNEWNGAPIPIC  725



>ref|XP_010658395.1| PREDICTED: phenylalanine ammonia-lyase G1 [Vitis vinifera]
Length=723

 Score =   257 bits (656),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 119/152 (78%), Positives = 129/152 (85%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLL++VDRE+VFAY DDPCS+ YPLMQKLRQVLV+HAL NGE EKN STSIFQKI AFED
Sbjct  572  DLLKIVDREHVFAYIDDPCSSTYPLMQKLRQVLVEHALINGEREKNSSTSIFQKIVAFED  631

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELKALLPKEVE  R   ENGN AI NRI +CRSYPLYKF+REELG   LTGEK  SPGE 
Sbjct  632  ELKALLPKEVESTRIDYENGNSAISNRIKDCRSYPLYKFVREELGASFLTGEKTTSPGEE  691

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
            CDKVFTA+C G +IDPLL+CLK WNGAPLPIC
Sbjct  692  CDKVFTAMCAGKLIDPLLDCLKEWNGAPLPIC  723



>ref|XP_002881488.1| hypothetical protein ARALYDRAFT_482690 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57747.1| hypothetical protein ARALYDRAFT_482690 [Arabidopsis lyrata subsp. 
lyrata]
Length=725

 Score =   257 bits (656),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 116/152 (76%), Positives = 132/152 (87%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLL+VVDRE V+ YADDPCSA YPL+QKLRQV+VDHAL NGE EKN  TSIF KI AFE+
Sbjct  574  DLLKVVDREQVYTYADDPCSATYPLIQKLRQVIVDHALINGESEKNAVTSIFHKIGAFEE  633

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELKA+LPKEVE AR+A +NG  AIPNRI ECRSYPLY+F+REELGTE+LTGEKV SPGE 
Sbjct  634  ELKAVLPKEVEAARAAYDNGTSAIPNRIKECRSYPLYRFVREELGTELLTGEKVTSPGEE  693

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
             DKVFTA+C+G IIDP++ECL  WNGAP+PIC
Sbjct  694  FDKVFTAICEGKIIDPMMECLNEWNGAPIPIC  725



>ref|XP_010504083.1| PREDICTED: phenylalanine ammonia-lyase 2-like [Camelina sativa]
Length=718

 Score =   256 bits (655),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 116/152 (76%), Positives = 131/152 (86%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLL+VVDRE VF Y DDPCSA YPLMQKLRQV+VDHAL NGE EKN  TSIFQKI AFE+
Sbjct  567  DLLKVVDREQVFTYVDDPCSATYPLMQKLRQVIVDHALSNGETEKNAGTSIFQKIGAFEE  626

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELKA+LPKEVE  R+A  NG  AIPNRI ECRSYPLY+F+REELGT++LTGEKV SPGE 
Sbjct  627  ELKAVLPKEVEATRAAYGNGTAAIPNRIAECRSYPLYRFVREELGTKLLTGEKVVSPGEE  686

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
             DKVFTA+C+G +IDPL++CLK WNGAP+PIC
Sbjct  687  FDKVFTAMCEGKLIDPLMDCLKEWNGAPIPIC  718



>gb|AFU82540.1| phenylalanine ammonia-lyase, partial [Artemisia tridentata]
Length=159

 Score =   240 bits (613),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 115/150 (77%), Positives = 125/150 (83%), Gaps = 0/150 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLLRVVDREYVFAY DDPC A YPLMQKLRQVLVDHAL NGE EKN +TSIFQKIA FE+
Sbjct  10   DLLRVVDREYVFAYIDDPCLATYPLMQKLRQVLVDHALTNGETEKNTNTSIFQKIATFEE  69

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            E+KA+LPKEVE  R A ENG  AIPNRI  CRSYPLY+F+REE+    LTGEKV SPGE 
Sbjct  70   EIKAILPKEVEAVRVAFENGTLAIPNRIKACRSYPLYRFVREEIDGVYLTGEKVTSPGEE  129

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLP  167
             DKVFTA+C G IIDPLLEC++ WNGAPLP
Sbjct  130  FDKVFTAMCQGQIIDPLLECVEGWNGAPLP  159



>gb|ACM62741.1| phenylalanine ammonia-lyase [Garcinia mangostana]
Length=718

 Score =   256 bits (654),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 118/152 (78%), Positives = 132/152 (87%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLL+VVDREYVFAYADDPCSA YPLMQKLRQVLVDHAL NGE E+N +TS+FQKIAAFE+
Sbjct  567  DLLKVVDREYVFAYADDPCSATYPLMQKLRQVLVDHALANGEGERNPNTSVFQKIAAFEE  626

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELK LLPKE+EG R A E+GN AIPNRI ECRSYPLYKF+RE  GT +LTGEKV SPGE 
Sbjct  627  ELKDLLPKEIEGVRLAYESGNTAIPNRIKECRSYPLYKFVREVAGTSLLTGEKVTSPGEE  686

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
             DKVFTA+C G IIDP+L+CL+ W+G PLPIC
Sbjct  687  LDKVFTAICQGKIIDPILDCLEEWDGTPLPIC  718



>gb|ADF59062.1| phenylalanine ammonia-lyase 2 precursor [Pyrus x bretschneideri]
Length=720

 Score =   256 bits (655),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 117/152 (77%), Positives = 132/152 (87%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLL+VVDREYVFAY DDPCSA YPLMQKLR VLV+HAL NG+ E++ STSIFQKIA FE+
Sbjct  569  DLLKVVDREYVFAYIDDPCSATYPLMQKLRHVLVEHALSNGDKERSTSTSIFQKIATFEE  628

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELK LLPKEVE  R+  ENG  AIPNRI ECRSYPLYKF+REELGT++LTGEKV+SPGE 
Sbjct  629  ELKTLLPKEVETTRAEYENGKTAIPNRIKECRSYPLYKFVREELGTDLLTGEKVRSPGEE  688

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
            CDKVF+A+C G +IDPLL+CLK WNGAPLPI 
Sbjct  689  CDKVFSAMCAGKLIDPLLDCLKEWNGAPLPIS  720



>gb|AFU90757.1| phenylalanine ammonia-lyase [Epimedium sagittatum]
Length=716

 Score =   256 bits (654),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 120/152 (79%), Positives = 135/152 (89%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLL+VVDREYV+AY DDPCSA YPLMQKLRQVLV+HAL NGE+EKN STSIFQKI+ FE+
Sbjct  565  DLLQVVDREYVYAYIDDPCSAVYPLMQKLRQVLVEHALSNGENEKNSSTSIFQKISLFEE  624

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELK LLPKEVE ARSA+E+ N AIPN+I +CRSYPLY+FIR ELGT +LTGEKV SPGE 
Sbjct  625  ELKVLLPKEVESARSAVESDNAAIPNQIKDCRSYPLYRFIRGELGTALLTGEKVVSPGEE  684

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
             DKVFTA+C+G +IDPLLECLK WNGAPLPIC
Sbjct  685  IDKVFTAMCEGKLIDPLLECLKEWNGAPLPIC  716



>gb|ADL09136.1| phenylanlanine ammonia-lyase [Brassica oleracea var. botrytis]
Length=723

 Score =   256 bits (655),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 118/152 (78%), Positives = 130/152 (86%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLL+VVDRE VF Y DDPCSA YPLMQKLRQV+VDHAL NGE EKN  TSIFQKI AFE+
Sbjct  572  DLLKVVDREQVFTYVDDPCSATYPLMQKLRQVIVDHALSNGETEKNAVTSIFQKIGAFEE  631

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELK +LPKEV+ AR A  NG  AIPNRI ECRSYPLYKF+REELGT++LTGEKV SPGE 
Sbjct  632  ELKMVLPKEVDAAREAYGNGTAAIPNRIKECRSYPLYKFVREELGTKLLTGEKVVSPGEE  691

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
             DKVFTA+C+G IIDPL+ECLK WNGAP+PIC
Sbjct  692  FDKVFTAMCEGKIIDPLMECLKEWNGAPIPIC  723



>gb|AJO53274.1| phenylalanine ammonia-lyase [Pogostemon cablin]
Length=715

 Score =   256 bits (654),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 119/152 (78%), Positives = 133/152 (88%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DL+RVVDREYVFAY DDPCSA YPLMQKLRQVLV+HAL+NG+ EK VSTSIFQKI +FE+
Sbjct  564  DLIRVVDREYVFAYIDDPCSATYPLMQKLRQVLVEHALKNGDGEKTVSTSIFQKIESFEE  623

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELKALLPKEVE AR A+E GN AI NRI ECRSYPLYKFIREELG+E LTGEK  SPGE 
Sbjct  624  ELKALLPKEVESARMAVEGGNLAISNRIAECRSYPLYKFIREELGSEFLTGEKTTSPGEE  683

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
            C+KVFTA+  G ++DPLL+C+K WNGAPLPIC
Sbjct  684  CEKVFTALSKGLMVDPLLKCVKGWNGAPLPIC  715



>gb|AAX22055.1| phenylalanine ammonia-lyase [Brassica napus]
 gb|AAX22056.1| phenylalanine ammonia-lyase [Brassica napus]
Length=723

 Score =   256 bits (654),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 118/152 (78%), Positives = 130/152 (86%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLL+VVDRE VF Y DDPCSA YPLMQKLRQV+VDHAL NGE EKN  TSIFQKI AFE+
Sbjct  572  DLLKVVDREQVFTYVDDPCSATYPLMQKLRQVIVDHALSNGETEKNAVTSIFQKIGAFEE  631

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELK +LPKEV+ AR A  NG  AIPNRI ECRSYPLYKF+REELGT++LTGEKV SPGE 
Sbjct  632  ELKMVLPKEVDAAREAYGNGTAAIPNRIKECRSYPLYKFVREELGTKLLTGEKVVSPGEE  691

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
             DKVFTA+C+G IIDPL+ECLK WNGAP+PIC
Sbjct  692  FDKVFTAMCEGKIIDPLMECLKEWNGAPIPIC  723



>sp|Q40910.1|PAL4_POPKI RecName: Full=Phenylalanine ammonia-lyase G4, partial [Populus 
sieboldii x Populus grandidentata]
 dbj|BAA07861.1| phenylalanine ammonia-lyase [Populus sieboldii x Populus grandidentata]
Length=571

 Score =   253 bits (645),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 120/152 (79%), Positives = 129/152 (85%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLL+VVDREYVF Y DDPCSA YPLMQKLRQVLVDHAL NGE E+N STSIFQKI AFE+
Sbjct  420  DLLKVVDREYVFTYIDDPCSATYPLMQKLRQVLVDHALMNGEKEQNSSTSIFQKIGAFEE  479

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELK LLPKEVE AR  LENGNPAIPNRIT+ RSYPLYKF+REELGT +LTGEKV SPGE 
Sbjct  480  ELKILLPKEVESARLELENGNPAIPNRITDRRSYPLYKFVREELGTVLLTGEKVGSPGEE  539

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
             DKVFTA+C G +IDP    LK WNGAPLP+C
Sbjct  540  FDKVFTAICAGKLIDPCWSVLKEWNGAPLPLC  571



>gb|ABI33979.1| phenylalanine ammonia lyase [Jatropha curcas]
Length=713

 Score =   256 bits (653),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 118/152 (78%), Positives = 134/152 (88%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLL+VVDRE VFAY DDPCSA YPLMQKLRQVLV+HAL NGE+EKN STS+FQKI AFE+
Sbjct  562  DLLKVVDREQVFAYIDDPCSATYPLMQKLRQVLVEHALANGENEKNASTSVFQKIGAFEE  621

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELK LLPKEVE AR A E+G+ AI N+I ECRSYPLYKF+REELG+ +LTGEKV+SPGE 
Sbjct  622  ELKTLLPKEVESAREAYESGSAAIGNKIKECRSYPLYKFVREELGSGLLTGEKVRSPGEE  681

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
             DKVFTA+C+G IIDP++ECLK WNGAPLPIC
Sbjct  682  FDKVFTAMCEGKIIDPMMECLKEWNGAPLPIC  713



>gb|AHZ30594.1| phenylalanine ammonia lyase-2, partial [Prunus domestica]
Length=701

 Score =   256 bits (653),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 116/149 (78%), Positives = 133/149 (89%), Gaps = 0/149 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLL+VVDREYVFAY DDPCSA YPLMQKLRQVLV+HAL NGE+EKN STSIFQKI AFE+
Sbjct  553  DLLKVVDREYVFAYIDDPCSATYPLMQKLRQVLVEHALTNGENEKNASTSIFQKIVAFEE  612

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELK LLPKEV+  R+AL++G+  +PNRITECR YPLYKF+REELG E LTGEKV+SPGE 
Sbjct  613  ELKVLLPKEVDSXRAALDSGSAGVPNRITECRFYPLYKFVREELGAEYLTGEKVRSPGEE  672

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPL  170
            CDKVF+A+C+G IIDP+LECL+ WNGAPL
Sbjct  673  CDKVFSAICEGKIIDPILECLEGWNGAPL  701



>gb|ABC69916.1| phenylalanine ammonia-lyase [Brassica napus]
Length=722

 Score =   256 bits (654),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 116/152 (76%), Positives = 131/152 (86%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLL+VVDRE V+ YADDPCSA YPL+QKLRQV+VDHAL NGE EKN  TSIF KI AFE+
Sbjct  571  DLLKVVDREQVYTYADDPCSATYPLIQKLRQVIVDHALVNGESEKNAMTSIFHKIGAFEE  630

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELKA+LPKEVE AR+A +NG  AIPNRI ECRSYPLY+F+REELGTE+LTGEK  SPGE 
Sbjct  631  ELKAVLPKEVEAARAAYDNGTAAIPNRIKECRSYPLYRFVREELGTELLTGEKATSPGEE  690

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
             DKVFTA+C+G IIDPL+ECL  WNGAP+PIC
Sbjct  691  FDKVFTAICEGKIIDPLMECLDEWNGAPIPIC  722



>pir||S60043 phenylalanine ammonia-lyase (EC 4.3.1.5) 4 - Japanese aspen x 
large-toothed aspen (fragment)
Length=582

 Score =   253 bits (645),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 120/152 (79%), Positives = 129/152 (85%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLL+VVDREYVF Y DDPCSA YPLMQKLRQVLVDHAL NGE E+N STSIFQKI AFE+
Sbjct  431  DLLKVVDREYVFTYIDDPCSATYPLMQKLRQVLVDHALMNGEKEQNSSTSIFQKIGAFEE  490

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELK LLPKEVE AR  LENGNPAIPNRIT+ RSYPLYKF+REELGT +LTGEKV SPGE 
Sbjct  491  ELKILLPKEVESARLELENGNPAIPNRITDRRSYPLYKFVREELGTVLLTGEKVGSPGEE  550

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
             DKVFTA+C G +IDP    LK WNGAPLP+C
Sbjct  551  FDKVFTAICAGKLIDPCWSVLKEWNGAPLPLC  582



>ref|XP_009103852.1| PREDICTED: phenylalanine ammonia-lyase 2-like [Brassica rapa]
Length=718

 Score =   256 bits (653),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 117/152 (77%), Positives = 132/152 (87%), Gaps = 0/152 (0%)
 Frame = -1

Query  616  DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  437
            DLL+VVDRE VF Y DDPCSA+YPLMQKLRQV+VDHAL NGE EKNV TSIFQKI AFE+
Sbjct  567  DLLKVVDREQVFTYVDDPCSASYPLMQKLRQVIVDHALANGETEKNVETSIFQKIGAFEE  626

Query  436  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEV  257
            ELK +LPKEV+ AR A  NGN AIPNRI ECRSYPLYKF+R ELGT++LTGEKV SPGE 
Sbjct  627  ELKTVLPKEVDAAREAYGNGNAAIPNRIKECRSYPLYKFVRGELGTKLLTGEKVVSPGEE  686

Query  256  CDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  161
             DKVFTA+C+G IIDPL++CLK WNGAP+P+C
Sbjct  687  FDKVFTAMCEGKIIDPLMDCLKEWNGAPIPLC  718



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 870155291520