BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF010G02

Length=762
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009794469.1|  PREDICTED: catalase isozyme 3                      424   9e-144   Nicotiana sylvestris
ref|XP_009624788.1|  PREDICTED: catalase isozyme 3                      419   1e-141   Nicotiana tomentosiformis
gb|KJB14249.1|  hypothetical protein B456_002G115900                    410   2e-140   Gossypium raimondii
emb|CDP07287.1|  unnamed protein product                                414   1e-139   Coffea canephora [robusta coffee]
ref|XP_009600533.1|  PREDICTED: catalase isozyme 3-like                 413   2e-139   Nicotiana tomentosiformis
gb|ACJ11733.1|  catalase                                                412   4e-139   Gossypium hirsutum [American cotton]
ref|XP_002301920.1|  catalase family protein                            412   7e-139   Populus trichocarpa [western balsam poplar]
ref|XP_009773579.1|  PREDICTED: catalase isozyme 3-like                 411   1e-138   Nicotiana sylvestris
ref|XP_008237987.1|  PREDICTED: catalase isozyme 1                      411   1e-138   Prunus mume [ume]
emb|CAI43948.1|  catalase                                               411   1e-138   Populus deltoides
gb|KHG25152.1|  Catalase isozyme 1                                      411   2e-138   Gossypium arboreum [tree cotton]
gb|AJE26131.1|  catalase                                                411   2e-138   Salix matsudana [tortured willow]
gb|KJB14250.1|  hypothetical protein B456_002G115900                    410   2e-138   Gossypium raimondii
ref|XP_011034872.1|  PREDICTED: catalase isozyme 1-like                 410   2e-138   Populus euphratica
ref|XP_007209948.1|  hypothetical protein PRUPE_ppa004776mg             409   6e-138   Prunus persica
emb|CAD42908.1|  catalase                                               409   6e-138   Prunus persica
gb|AET97564.1|  catalase                                                409   1e-137   Ziziphus jujuba [Chinese jujube]
sp|P17598.2|CATA1_GOSHI  RecName: Full=Catalase isozyme 1               408   2e-137   Gossypium hirsutum [American cotton]
sp|P49317.1|CATA3_NICPL  RecName: Full=Catalase isozyme 3               408   2e-137   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
sp|O24339.1|CATA_SOLAP  RecName: Full=Catalase                          407   4e-137   Soldanella alpina
gb|AFU90823.1|  catalase                                                404   2e-136   Populus x beijingensis
gb|AFU90822.1|  catalase                                                405   2e-136   Populus tomentosa [Chinese white poplar]
gb|KJB57963.1|  hypothetical protein B456_009G187600                    405   3e-136   Gossypium raimondii
gb|AAM97542.1|  catalase 3                                              405   4e-136   Capsicum annuum
ref|XP_004238430.1|  PREDICTED: catalase isozyme 3                      404   6e-136   Solanum lycopersicum
ref|XP_006342134.1|  PREDICTED: catalase isozyme 3-like                 404   6e-136   Solanum tuberosum [potatoes]
ref|NP_001291326.1|  catalase isozyme 1                                 404   1e-135   Sesamum indicum [beniseed]
ref|XP_011074091.1|  PREDICTED: catalase isozyme 3 isoform X2           403   2e-135   
ref|XP_011041225.1|  PREDICTED: catalase isozyme 1                      403   2e-135   Populus euphratica
gb|EYU30275.1|  hypothetical protein MIMGU_mgv1a005250mg                403   2e-135   Erythranthe guttata [common monkey flower]
ref|XP_011074092.1|  PREDICTED: catalase isozyme 3 isoform X3           403   2e-135   Sesamum indicum [beniseed]
ref|XP_010530333.1|  PREDICTED: catalase-2                              402   3e-135   Tarenaya hassleriana [spider flower]
ref|XP_010663966.1|  PREDICTED: catalase isozyme 1                      402   5e-135   Vitis vinifera
gb|KHG12976.1|  Catalase isozyme 2                                      401   8e-135   Gossypium arboreum [tree cotton]
ref|XP_007018034.1|  Catalase 2                                         401   8e-135   
ref|NP_001237556.1|  catalase-1/2                                       401   1e-134   Glycine max [soybeans]
emb|CAC04509.1|  catalase                                               393   1e-134   Digitalis lanata [Grecian foxglove]
ref|XP_010907090.1|  PREDICTED: catalase isozyme 1-like                 401   1e-134   Elaeis guineensis
ref|NP_001289779.1|  catalase isozyme 1                                 400   2e-134   Nelumbo nucifera [Indian lotus]
ref|XP_002521709.1|  catalase, putative                                 400   2e-134   Ricinus communis
sp|P30567.1|CATA2_GOSHI  RecName: Full=Catalase isozyme 2               400   2e-134   Gossypium hirsutum [American cotton]
ref|XP_010242894.1|  PREDICTED: catalase isozyme 1-like isoform X1      399   5e-134   Nelumbo nucifera [Indian lotus]
ref|XP_008373403.1|  PREDICTED: catalase isozyme 1                      399   6e-134   
dbj|BAJ33995.1|  unnamed protein product                                399   7e-134   Eutrema halophilum
ref|XP_006412153.1|  hypothetical protein EUTSA_v10024932mg             399   7e-134   Eutrema salsugineum [saltwater cress]
gb|AIS20825.1|  CAT                                                     398   1e-133   Pyrus x bretschneideri [bai li]
ref|NP_001235974.1|  catalase-3                                         398   1e-133   Glycine max [soybeans]
ref|XP_008365915.1|  PREDICTED: catalase isozyme 1                      398   1e-133   
ref|XP_008348924.1|  PREDICTED: catalase isozyme 1                      398   1e-133   
gb|AHA50082.1|  catalase                                                398   2e-133   Eleutherococcus senticosus
gb|AAF71742.1|AF248491_1  catalase                                      398   2e-133   Raphanus sativus
ref|XP_002867092.1|  hypothetical protein ARALYDRAFT_491144             398   2e-133   
gb|AAB86582.2|  catalase                                                398   2e-133   Raphanus sativus
gb|ACV92695.1|  catalase                                                398   2e-133   Brassica oleracea
gb|AHF27428.1|  catalase                                                392   2e-133   Cucurbita moschata [ayote]
emb|CDP01803.1|  unnamed protein product                                397   3e-133   Coffea canephora [robusta coffee]
gb|ACA50528.1|  putative catalase 2                                     397   4e-133   Brassica napus [oilseed rape]
gb|KJB17473.1|  hypothetical protein B456_003G002800                    397   4e-133   Gossypium raimondii
gb|AAO17721.1|  catalase                                                397   6e-133   Hypericum perforatum
ref|XP_009138342.1|  PREDICTED: catalase-2                              396   7e-133   Brassica rapa
emb|CDX76313.1|  BnaA08g10870D                                          396   7e-133   
gb|EYU36566.1|  hypothetical protein MIMGU_mgv1a005245mg                396   7e-133   Erythranthe guttata [common monkey flower]
ref|XP_010918244.1|  PREDICTED: catalase isozyme 1                      396   8e-133   Elaeis guineensis
dbj|BAQ21275.1|  catalase                                               395   9e-133   Citrus tamurana
ref|XP_010536470.1|  PREDICTED: catalase-2-like                         396   9e-133   Tarenaya hassleriana [spider flower]
emb|CDY40645.1|  BnaA03g53180D                                          396   9e-133   Brassica napus [oilseed rape]
ref|XP_010446982.1|  PREDICTED: catalase-2-like                         396   1e-132   Camelina sativa [gold-of-pleasure]
gb|ADC95629.1|  catalase                                                396   1e-132   Bruguiera gymnorhiza [Burma mangrove]
emb|CAB56850.1|  catalase                                               393   1e-132   Prunus persica
ref|XP_008802866.1|  PREDICTED: catalase isozyme 1                      396   1e-132   Phoenix dactylifera
ref|XP_006283612.1|  hypothetical protein CARUB_v10004668mg             395   1e-132   Capsella rubella
gb|AAD17935.1|  catalase                                                395   2e-132   Brassica juncea [brown mustard]
gb|KGN55499.1|  hypothetical protein Csa_4G658590                       395   2e-132   Cucumis sativus [cucumbers]
ref|XP_002306976.2|  catalase family protein                            395   2e-132   
ref|XP_006435363.1|  hypothetical protein CICLE_v10000951mg             395   2e-132   Citrus clementina [clementine]
gb|AAC19397.1|  leaf catalase                                           395   2e-132   Mesembryanthemum crystallinum
ref|XP_008237989.1|  PREDICTED: catalase isozyme 1-like                 395   2e-132   Prunus mume [ume]
ref|XP_006473794.1|  PREDICTED: catalase isozyme 1-like isoform X4      395   2e-132   Citrus sinensis [apfelsine]
ref|XP_010437527.1|  PREDICTED: catalase-2                              395   3e-132   Camelina sativa [gold-of-pleasure]
ref|XP_010061175.1|  PREDICTED: catalase-like                           395   3e-132   Eucalyptus grandis [rose gum]
ref|XP_010432341.1|  PREDICTED: catalase-2-like                         395   3e-132   Camelina sativa [gold-of-pleasure]
gb|AIA61608.1|  catalase                                                395   3e-132   Gynostemma pentaphyllum [jiaogulan]
ref|XP_008452956.1|  PREDICTED: catalase isozyme 1                      395   3e-132   Cucumis melo [Oriental melon]
gb|AAD17936.1|  catalase                                                395   3e-132   Brassica juncea [brown mustard]
gb|AAF19965.1|AF207906_1  catalase 1                                    395   4e-132   Zantedeschia aethiopica [arum-lily]
ref|XP_006473791.1|  PREDICTED: catalase isozyme 1-like isoform X1      395   4e-132   
ref|XP_007160597.1|  hypothetical protein PHAVU_001G001000g             394   5e-132   Phaseolus vulgaris [French bean]
emb|CDY17510.1|  BnaC03g65530D                                          394   6e-132   Brassica napus [oilseed rape]
emb|CDX72514.1|  BnaC07g45360D                                          394   7e-132   
sp|P45739.1|CATA_HELAN  RecName: Full=Catalase                          394   7e-132   Helianthus annuus
prf||2104177A  catalase                                                 394   8e-132
gb|AAB88173.1|  catalase                                                387   8e-132   Glycine max [soybeans]
ref|XP_008452957.1|  PREDICTED: catalase isozyme 1-like                 394   1e-131   Cucumis melo [Oriental melon]
gb|KDP43757.1|  hypothetical protein JCGZ_22384                         393   1e-131   Jatropha curcas
sp|P48350.1|CATA1_CUCPE  RecName: Full=Catalase isozyme 1               393   2e-131   Cucurbita pepo
ref|XP_010094556.1|  Catalase isozyme 1                                 393   2e-131   Morus notabilis
emb|CAA45564.1|  catalase                                               393   2e-131   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009106100.1|  PREDICTED: catalase-2                              392   2e-131   Brassica rapa
ref|XP_009400996.1|  PREDICTED: catalase isozyme 2                      392   2e-131   Musa acuminata subsp. malaccensis [pisang utan]
gb|KFK30147.1|  catalase                                                392   3e-131   Arabis alpina [alpine rockcress]
prf||1906388A  catalase                                                 392   3e-131
gb|AAK96854.1|  catalase                                                392   3e-131   Arabidopsis thaliana [mouse-ear cress]
ref|NP_195235.1|  catalase 2                                            392   3e-131   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009413057.1|  PREDICTED: catalase isozyme 2-like                 392   3e-131   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007210576.1|  hypothetical protein PRUPE_ppa004763mg             392   5e-131   Prunus persica
gb|ADU56199.1|  catalase                                                392   6e-131   Hevea brasiliensis [jebe]
gb|KCW68095.1|  hypothetical protein EUGRSUZ_F01777                     394   6e-131   Eucalyptus grandis [rose gum]
emb|CAA64220.1|  catalase                                               391   6e-131   Arabidopsis thaliana [mouse-ear cress]
emb|CAD42909.1|  catalase                                               391   8e-131   Prunus persica
ref|XP_010063132.1|  PREDICTED: LOW QUALITY PROTEIN: catalase iso...    391   1e-130   
ref|XP_002306427.1|  hypothetical protein POPTR_0005s10340g             390   1e-130   Populus trichocarpa [western balsam poplar]
ref|XP_006382992.1|  hypothetical protein POPTR_0005s10340g             390   1e-130   
ref|XP_007046520.1|  Catalase 2                                         390   2e-130   Theobroma cacao [chocolate]
gb|AGE15298.2|  catalase 1                                              390   2e-130   Eriobotrya japonica [loquat]
emb|CDP01802.1|  unnamed protein product                                389   2e-130   Coffea canephora [robusta coffee]
gb|AAB62892.1|  catalase-1                                              390   3e-130   Nicotiana glutinosa
gb|AAF61732.1|AF243517_1  catalase 2                                    390   3e-130   Helianthus annuus
ref|XP_011022275.1|  PREDICTED: catalase-like                           389   4e-130   Populus euphratica
gb|AAD17933.1|  catalase                                                389   4e-130   Brassica juncea [brown mustard]
ref|XP_008789355.1|  PREDICTED: catalase isozyme 1-like                 389   5e-130   Phoenix dactylifera
ref|XP_011022153.1|  PREDICTED: catalase-2-like isoform X2              389   5e-130   Populus euphratica
gb|AFN81243.1|  catalase 1                                              389   5e-130   Brassica rapa subsp. pekinensis [bai cai]
ref|XP_010523643.1|  PREDICTED: catalase-2-like                         389   5e-130   Tarenaya hassleriana [spider flower]
emb|CDX69111.1|  BnaC01g03420D                                          388   7e-130   
ref|XP_009108683.1|  PREDICTED: catalase-2-like isoform X2              389   1e-129   
gb|ACL27272.1|  catalase                                                388   1e-129   Nicotiana benthamiana
ref|XP_010941422.1|  PREDICTED: catalase isozyme B                      388   1e-129   Elaeis guineensis
gb|AFU48609.1|  catalase 1                                              388   1e-129   Nicotiana benthamiana
emb|CCP37650.1|  catalase-1                                             388   1e-129   Nicotiana tabacum [American tobacco]
ref|XP_011022152.1|  PREDICTED: catalase-2-like isoform X1              389   2e-129   Populus euphratica
gb|AAM97541.1|  catalase 2                                              387   2e-129   Capsicum annuum
ref|XP_009597278.1|  PREDICTED: catalase isozyme 1                      388   2e-129   Nicotiana tomentosiformis
ref|NP_001240021.1|  catalase                                           387   2e-129   Glycine max [soybeans]
gb|AAB71764.1|  catalase 1                                              387   3e-129   Nicotiana tabacum [American tobacco]
gb|EPS69543.1|  catalase                                                387   3e-129   Genlisea aurea
ref|XP_010692546.1|  PREDICTED: catalase                                386   6e-129   Beta vulgaris subsp. vulgaris [field beet]
ref|NP_001237571.1|  catalase-4                                         386   7e-129   Glycine max [soybeans]
ref|XP_009794245.1|  PREDICTED: catalase isozyme 1                      385   1e-128   Nicotiana sylvestris
gb|AAD37788.1|AF149283_1  catalase 1                                    383   1e-128   Phaseolus vulgaris [French bean]
sp|P49315.1|CATA1_NICPL  RecName: Full=Catalase isozyme 1               385   2e-128   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
gb|AAR14052.2|  catalase                                                384   2e-128   Solanum tuberosum [potatoes]
gb|AGV54297.1|  peroxisomal catalase                                    385   2e-128   Phaseolus vulgaris [French bean]
ref|XP_006412154.1|  hypothetical protein EUTSA_v10024932mg             385   2e-128   Eutrema salsugineum [saltwater cress]
gb|AFW69584.1|  catalase1                                               380   3e-128   
ref|XP_007136018.1|  hypothetical protein PHAVU_009G011100g             384   4e-128   Phaseolus vulgaris [French bean]
gb|AAR84578.1|  catalase 1a                                             384   5e-128   Lotus japonicus
gb|KGN55500.1|  hypothetical protein Csa_4G658600                       381   5e-128   Cucumis sativus [cucumbers]
gb|AAK67359.2|AF390210_1  catalase                                      384   6e-128   Suaeda salsa
ref|XP_006340832.1|  PREDICTED: catalase isozyme 2                      383   9e-128   Solanum tuberosum [potatoes]
ref|XP_004300681.1|  PREDICTED: catalase isozyme 1                      383   1e-127   Fragaria vesca subsp. vesca
emb|CDP07288.1|  unnamed protein product                                383   1e-127   Coffea canephora [robusta coffee]
gb|ABM47415.1|  catalase                                                383   1e-127   Prunus avium [gean]
ref|XP_004500877.1|  PREDICTED: catalase-4-like isoform X2              383   1e-127   Cicer arietinum [garbanzo]
ref|XP_004500876.1|  PREDICTED: catalase-4-like isoform X1              383   1e-127   
gb|AAC17731.1|  catalase 1                                              382   2e-127   Arabidopsis thaliana [mouse-ear cress]
gb|AHB72694.1|  catalase                                                382   2e-127   Beta vulgaris subsp. maritima [sea beet]
gb|AGC65520.1|  catalase                                                382   2e-127   Eriobotrya japonica [loquat]
ref|NP_564121.1|  catalase 1                                            382   3e-127   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001241808.1|  catalase isozyme B                                 381   5e-127   Zea mays [maize]
emb|CAA42720.1|  catalase-1                                             381   7e-127   Zea mays [maize]
gb|AIP93616.1|  CAT1                                                    381   8e-127   Bassia scoparia [burning bush]
dbj|BAJ87148.1|  predicted protein                                      373   1e-126   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001234186.1|  catalase isozyme 2                                 380   2e-126   
gb|AAG43363.1|AF151368_1  catalase                                      379   3e-126   Hevea brasiliensis [jebe]
sp|P32290.1|CATA_VIGRR  RecName: Full=Catalase                          379   4e-126   Vigna radiata var. radiata [golden gram]
ref|XP_009103333.1|  PREDICTED: catalase-1                              379   4e-126   Brassica rapa
emb|CDY31877.1|  BnaC07g15270D                                          379   5e-126   Brassica napus [oilseed rape]
emb|CDY01363.1|  BnaA07g11360D                                          379   6e-126   
ref|XP_010061172.1|  PREDICTED: catalase isozyme 3-like                 379   6e-126   Eucalyptus grandis [rose gum]
sp|Q01297.2|CATA1_RICCO  RecName: Full=Catalase isozyme 1               379   7e-126   Ricinus communis
gb|ABY21704.1|  catalase-1 precursor                                    378   9e-126   Panax ginseng [Asiatic ginseng]
ref|XP_006828715.1|  hypothetical protein AMTR_s00001p00024160          378   1e-125   Amborella trichopoda
gb|AIX10947.1|  putative catalase                                       378   1e-125   Gardenia jasminoides
gb|ACH63223.1|  catalase                                                377   2e-125   Rheum australe [Himalayan rhubarb]
ref|NP_001105415.1|  catalase isozyme 1                                 377   2e-125   
gb|AIU99481.1|  catalase                                                377   3e-125   Saccharum spontaneum [fodder cane]
gb|AAC17729.1|  catalase 1                                              373   4e-125   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004966515.1|  PREDICTED: catalase isozyme 1-like                 378   5e-125   
ref|XP_006416378.1|  hypothetical protein EUTSA_v10007472mg             376   5e-125   Eutrema salsugineum [saltwater cress]
gb|AIM43584.1|  catalase                                                376   6e-125   Saccharum hybrid cultivar Yacheng05-179
gb|AIU99485.1|  catalase                                                376   6e-125   Saccharum spontaneum [fodder cane]
gb|AIU99479.1|  catalase                                                376   7e-125   Saccharum arundinaceum
gb|AIU99484.1|  catalase                                                376   8e-125   Saccharum arundinaceum
gb|AIU99488.1|  catalase                                                375   1e-124   Saccharum hybrid cultivar ROC22
gb|AAY59707.1|  catalase                                                375   1e-124   Oryza sativa Indica Group [Indian rice]
sp|A2YH64.2|CATA2_ORYSI  RecName: Full=Catalase isozyme B; Short=...    375   1e-124   Oryza sativa Indica Group [Indian rice]
ref|XP_002437631.1|  hypothetical protein SORBIDRAFT_10g030840          375   2e-124   
gb|KEH36312.1|  catalase heme-binding enzyme                            375   2e-124   Medicago truncatula
ref|XP_006656514.1|  PREDICTED: catalase isozyme B-like                 374   3e-124   Oryza brachyantha
gb|AIU99480.1|  catalase                                                374   3e-124   Saccharum spontaneum [fodder cane]
ref|XP_011074090.1|  PREDICTED: catalase isoform X1                     375   3e-124   Sesamum indicum [beniseed]
ref|XP_004145541.1|  PREDICTED: catalase isozyme 1-like                 388   3e-124   
dbj|BAA05494.1|  catalase                                               374   4e-124   Oryza sativa Japonica Group [Japonica rice]
gb|ADZ45555.1|  catalase                                                374   4e-124   Vigna radiata [mung bean]
dbj|BAA34204.1|  catalase                                               374   5e-124   Oryza sativa Japonica Group [Japonica rice]
sp|P55307.1|CATA1_HORVU  RecName: Full=Catalase isozyme 1               374   5e-124   Hordeum vulgare [barley]
ref|XP_006649332.1|  PREDICTED: catalase-1-like                         374   5e-124   Oryza brachyantha
ref|NP_001058635.1|  Os06g0727200                                       374   5e-124   
ref|XP_003563243.1|  PREDICTED: catalase isozyme 1                      374   6e-124   Brachypodium distachyon [annual false brome]
dbj|BAA34205.1|  catalase                                               373   7e-124   Oryza sativa Japonica Group [Japonica rice]
gb|KHG21219.1|  Catalase isozyme 1                                      371   7e-124   Gossypium arboreum [tree cotton]
ref|NP_001048861.1|  Os03g0131200                                       373   7e-124   
gb|AIU99486.1|  catalase                                                373   9e-124   Saccharum spontaneum [fodder cane]
gb|KFK44176.1|  hypothetical protein AALP_AA1G224400                    373   1e-123   Arabis alpina [alpine rockcress]
ref|XP_010061174.1|  PREDICTED: catalase isozyme 3-like isoform X2      373   1e-123   Eucalyptus grandis [rose gum]
gb|ACB11496.1|  catalase                                                373   1e-123   Pinus sylvestris [Scotch pine]
gb|ABK24453.1|  unknown                                                 373   1e-123   Picea sitchensis
gb|ADZ45556.1|  catalase                                                373   1e-123   Vigna radiata [mung bean]
gb|AAB07026.1|  catalase 1                                              372   2e-123   Arabidopsis thaliana [mouse-ear cress]
gb|AIU99482.1|  catalase                                                372   2e-123   Saccharum hybrid cultivar ROC22
gb|AIU99487.1|  catalase                                                372   3e-123   Saccharum hybrid cultivar ROC22
sp|P55313.1|CATA2_WHEAT  RecName: Full=Catalase                         372   3e-123   Triticum aestivum [Canadian hard winter wheat]
ref|XP_003631925.1|  PREDICTED: catalase isozyme 1-like                 371   5e-123   Vitis vinifera
ref|NP_001268098.1|  catalase                                           371   6e-123   Vitis vinifera
ref|XP_002963086.1|  hypothetical protein SELMODRAFT_438313             370   8e-123   
gb|AIU99483.1|  catalase                                                370   9e-123   Saccharum hybrid cultivar ROC22
gb|EMT05040.1|  Catalase-1                                              371   1e-122   
gb|ACL35349.1|  catalase                                                370   1e-122   Picea glauca
gb|ABQ44283.1|  catalase                                                365   2e-122   Saccharum hybrid cultivar NCo 376
gb|ADN94253.1|  catalase                                                369   3e-122   Puccinellia chinampoensis
sp|Q43206.1|CATA1_WHEAT  RecName: Full=Catalase-1                       369   3e-122   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006473789.1|  PREDICTED: catalase-like isoform X1                369   3e-122   Citrus sinensis [apfelsine]
sp|P18122.1|CATA1_MAIZE  RecName: Full=Catalase isozyme 1               369   4e-122   Zea mays [maize]
dbj|BAJ90861.1|  predicted protein                                      369   5e-122   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002980247.1|  hypothetical protein SELMODRAFT_178171             369   5e-122   Selaginella moellendorffii
ref|XP_006435361.1|  hypothetical protein CICLE_v10000948mg             369   6e-122   Citrus clementina [clementine]
gb|AAF79625.1|AC027665_26  F5M15.5                                      382   1e-121   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009590727.1|  PREDICTED: catalase isozyme 1                      367   2e-121   Nicotiana tomentosiformis
gb|AAA57551.1|  catalase                                                363   2e-121   Nicotiana sylvestris
dbj|BAJ88747.1|  predicted protein                                      368   3e-121   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AIZ77475.1|  catalase                                                366   4e-121   Triticum aestivum [Canadian hard winter wheat]
emb|CAG23920.1|  catalase                                               365   8e-121   Festuca arundinacea [tall fescue]
ref|XP_010498496.1|  PREDICTED: catalase-3                              365   9e-121   Camelina sativa [gold-of-pleasure]
ref|XP_009110221.1|  PREDICTED: catalase-3                              365   1e-120   Brassica rapa
ref|XP_003558892.1|  PREDICTED: catalase-1                              365   1e-120   Brachypodium distachyon [annual false brome]
ref|XP_002890395.1|  F5M15.5                                            379   1e-120   
emb|CDY31490.1|  BnaC05g15990D                                          365   2e-120   Brassica napus [oilseed rape]
ref|XP_009792372.1|  PREDICTED: catalase isozyme 1                      365   2e-120   Nicotiana sylvestris
sp|P49319.2|CATA1_TOBAC  RecName: Full=Catalase isozyme 1; AltNam...    365   2e-120   Nicotiana tabacum [American tobacco]
emb|CDY29518.1|  BnaA06g14520D                                          365   2e-120   Brassica napus [oilseed rape]
emb|CDY29519.1|  BnaA06g14510D                                          365   2e-120   Brassica napus [oilseed rape]
emb|CDY31488.1|  BnaC05g15970D                                          365   2e-120   Brassica napus [oilseed rape]
ref|XP_009103334.1|  PREDICTED: catalase-3-like                         365   2e-120   Brassica rapa
ref|XP_009149540.1|  PREDICTED: catalase-1                              365   2e-120   Brassica rapa
ref|XP_002510677.1|  catalase, putative                                 378   2e-120   
ref|XP_009149539.1|  PREDICTED: catalase-3                              366   3e-120   Brassica rapa
emb|CDY33636.1|  BnaC08g19360D                                          364   3e-120   Brassica napus [oilseed rape]
emb|CDY31878.1|  BnaC07g15280D                                          364   4e-120   Brassica napus [oilseed rape]
dbj|BAF91369.1|  catalase                                               363   4e-120   Capsicum annuum
ref|XP_002961779.1|  hypothetical protein SELMODRAFT_140901             363   5e-120   
ref|XP_010459749.1|  PREDICTED: catalase-1-like                         363   5e-120   Camelina sativa [gold-of-pleasure]
emb|CDY01364.1|  BnaA07g11370D                                          365   6e-120   
gb|AFD29285.1|  catalase                                                363   1e-119   Vicia faba [broad bean]
dbj|BAH37035.1|  catalase 1                                             362   1e-119   Pisum sativum [garden pea]
sp|Q9M5L6.1|CATA_CAPAN  RecName: Full=Catalase; AltName: Full=CaCat1    362   1e-119   Capsicum annuum
ref|XP_010498497.1|  PREDICTED: catalase-1-like                         362   2e-119   Camelina sativa [gold-of-pleasure]
ref|XP_010477308.1|  PREDICTED: catalase-1                              362   2e-119   Camelina sativa [gold-of-pleasure]
ref|XP_004985840.1|  PREDICTED: catalase-1-like                         362   2e-119   Setaria italica
ref|XP_010105996.1|  Catalase isozyme 1                                 357   3e-119   
gb|AAD30292.1|AF139539_1  catalase 3                                    361   3e-119   Raphanus sativus
ref|XP_010534184.1|  PREDICTED: catalase isozyme 3-like                 361   4e-119   Tarenaya hassleriana [spider flower]
sp|P55311.1|CATA_SOLME  RecName: Full=Catalase                          360   7e-119   Solanum melongena [aubergine]
gb|KFK44175.1|  hypothetical protein AALP_AA1G224300                    360   9e-119   Arabis alpina [alpine rockcress]
sp|P49316.1|CATA2_NICPL  RecName: Full=Catalase isozyme 2               360   9e-119   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
ref|NP_001031072.3|  catalase 3                                         356   9e-119   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009108684.1|  PREDICTED: catalase-2-like isoform X3              360   9e-119   
ref|XP_006306495.1|  hypothetical protein CARUB_v10012481mg             360   1e-118   Capsella rubella
gb|AAC48918.1|  salicylic acid binding catalase                         360   1e-118   Nicotiana tabacum [American tobacco]
ref|XP_010536468.1|  PREDICTED: catalase-3-like                         360   1e-118   Tarenaya hassleriana [spider flower]
sp|Q9AXH0.1|CATA_AVIMR  RecName: Full=Catalase                          360   2e-118   Avicennia marina
ref|XP_006828714.1|  hypothetical protein AMTR_s00001p00022550          359   2e-118   Amborella trichopoda
gb|AAD30291.2|AF139538_1  catalase 2                                    359   4e-118   Raphanus sativus
dbj|BAC79443.1|  catalase                                               358   5e-118   Acacia ampliceps
dbj|BAH20307.1|  AT1G20620                                              357   6e-118   Arabidopsis thaliana [mouse-ear cress]
gb|ABY19573.1|  catalase                                                350   6e-118   Manihot esculenta [manioc]
gb|AAM65021.1|  unknown                                                 358   9e-118   Arabidopsis thaliana [mouse-ear cress]
ref|NP_564120.1|  catalase 3                                            358   1e-117   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006382986.1|  hypothetical protein POPTR_0005s10340g             358   1e-117   
ref|NP_001031791.1|  catalase 2                                         357   1e-117   Arabidopsis thaliana [mouse-ear cress]
dbj|BAH19523.1|  AT4G35090                                              357   1e-117   
gb|ACJ22771.1|  catalase 1                                              357   1e-117   
gb|AAX84671.1|  catalase CAT2                                           349   2e-117   
gb|ABR15776.1|  catalase                                                349   3e-117   
sp|P25890.1|CATA_PEA  RecName: Full=Catalase                            356   5e-117   
gb|AGI65617.1|  catalase                                                354   2e-116   
gb|AHF27430.1|  catalase                                                355   2e-116   
gb|AHF27433.1|  catalase                                                354   2e-116   
gb|AAR97905.1|  catalase                                                354   2e-116   
emb|CAA85470.1|  catalase                                               354   2e-116   
sp|P55312.1|CATA2_SOLTU  RecName: Full=Catalase isozyme 2               354   2e-116   
gb|AAC49807.1|  catalase 3                                              353   5e-116   
gb|AAF61734.1|AF243519_1  catalase 4                                    353   6e-116   
gb|ABC01913.1|  catalase isozyme 1-like protein                         353   6e-116   
ref|XP_008464839.1|  PREDICTED: catalase isozyme 3                      353   8e-116   
gb|AFR53082.1|  CAT                                                     352   1e-115   
sp|P49318.1|CATA2_RICCO  RecName: Full=Catalase isozyme 2               352   1e-115   
ref|XP_004144240.1|  PREDICTED: catalase isozyme 3-like                 352   1e-115   
ref|NP_001274863.1|  catalase isozyme 1                                 352   1e-115   
pir||S40265  catalase (EC 1.11.1.6) - eggplant                          352   2e-115
emb|CAE82295.1|  catalase                                               352   2e-115   
sp|P49284.1|CATA1_SOLTU  RecName: Full=Catalase isozyme 1               352   2e-115   
ref|XP_004158284.1|  PREDICTED: catalase isozyme 3-like                 352   2e-115   
gb|ADM96039.1|  catalase                                                352   2e-115   
sp|P07145.1|CATA_IPOBA  RecName: Full=Catalase                          352   2e-115   
gb|ADB03784.1|  catalase                                                352   2e-115   
sp|P48352.1|CATA3_CUCPE  RecName: Full=Catalase isozyme 3               352   3e-115   
ref|NP_001234827.1|  catalase isozyme 1                                 351   3e-115   
gb|AAF61733.1|AF243518_1  catalase 3                                    351   3e-115   
gb|ACN36234.1|  unknown                                                 346   3e-115   
gb|ACJ73906.1|  CAT2                                                    344   8e-115   
gb|ACJ76836.3|  catalase                                                349   2e-114   
gb|AHF27432.1|  catalase                                                348   3e-114   
gb|AEQ30070.1|  catalase                                                348   3e-114   
gb|AHF27429.1|  catalase                                                348   3e-114   
sp|P48351.1|CATA2_CUCPE  RecName: Full=Catalase isozyme 2               347   1e-113   
gb|AAD50974.1|AF170272_1  catalase CAT1                                 347   1e-113   
gb|EMS61345.1|  Catalase isozyme 1                                      351   1e-113   
gb|AII23739.1|  catalase                                                346   3e-113   
tpg|DAA43177.1|  TPA: catalase2                                         346   5e-113   
ref|XP_008812256.1|  PREDICTED: catalase isozyme B                      345   9e-113   
sp|P12365.3|CATA2_MAIZE  RecName: Full=Catalase isozyme 2               345   1e-112   
prf||1803522A  catalase                                                 344   2e-112
ref|XP_008791900.1|  PREDICTED: catalase isozyme 2                      344   2e-112   
emb|CDY52649.1|  BnaAnng11640D                                          342   3e-112   
ref|NP_001105310.1|  catalase isozyme 2                                 344   3e-112   
ref|XP_010934843.1|  PREDICTED: catalase isozyme 2                      343   4e-112   
tpg|DAA43178.1|  TPA: catalase2                                         343   9e-112   
ref|XP_010061173.1|  PREDICTED: catalase isozyme 2-like isoform X1      342   1e-111   
ref|XP_001752315.1|  predicted protein                                  341   4e-111   
gb|AHF21552.1|  catalase                                                340   6e-111   
gb|ABB72796.1|  catalase isozyme 1-like protein                         340   1e-110   
ref|NP_001031073.1|  catalase 3                                         338   3e-110   
gb|KCW70315.1|  hypothetical protein EUGRSUZ_F03557                     337   1e-109   
gb|AAG61140.2|AF332973_1  catalase 2                                    337   2e-109   
ref|XP_001784759.1|  predicted protein                                  336   2e-109   
gb|AAL00886.1|  catalase                                                328   4e-109   
ref|XP_009392261.1|  PREDICTED: catalase isozyme A-like isoform X2      335   9e-109   
gb|ADU56198.1|  catalase                                                334   1e-108   
gb|ABV55108.1|  catalase 2                                              334   2e-108   
gb|AAC19398.1|  root catalase                                           333   3e-108   
gb|KDO85095.1|  hypothetical protein CISIN_1g044386mg                   337   3e-108   
ref|XP_009398521.1|  PREDICTED: catalase isozyme A                      332   7e-108   
gb|ADK25939.1|  catalase                                                323   1e-107   
gb|EMS35721.1|  Catalase isozyme 1                                      321   3e-106   
ref|XP_010692544.1|  PREDICTED: catalase-like                           328   5e-106   
gb|KIY96954.1|  catalase                                                322   9e-106   
gb|ACL81498.1|  catalase                                                327   1e-105   
gb|AJF34884.1|  catalase                                                324   8e-105   
ref|XP_005847557.1|  hypothetical protein CHLNCDRAFT_57817              322   4e-104   
dbj|BAH56915.1|  AT1G20620                                              322   8e-104   
ref|XP_008778560.1|  PREDICTED: catalase isozyme 2-like                 322   1e-103   
gb|ABK24449.1|  unknown                                                 320   5e-103   
gb|ABN71233.2|  catalase                                                317   7e-102   
ref|NP_001045673.1|  Os02g0115700                                       317   8e-102   
gb|AAZ29552.1|  catalase-C                                              317   1e-101   
gb|EAZ21490.1|  hypothetical protein OsJ_05114                          317   1e-101   
ref|XP_004952158.1|  PREDICTED: catalase isozyme 3-like isoform X2      317   1e-101   
ref|XP_001779509.1|  predicted protein                                  316   2e-101   
gb|ABK41476.1|  catalase                                                316   2e-101   
ref|XP_002453177.1|  hypothetical protein SORBIDRAFT_04g001130          315   2e-101   
ref|XP_005645077.1|  catalase                                           316   2e-101   
gb|ADQ28492.1|  catalase                                                315   3e-101   
gb|AAX88799.1|  catalase                                                315   4e-101   
gb|AGT16203.1|  catalase                                                314   9e-101   
gb|AAC17730.1|  catalase 2                                              310   2e-100   
gb|ACJ73905.1|  CAT1                                                    301   6e-100   
gb|ADY02963.1|  catalase                                                311   1e-99    
sp|P55308.1|CATA2_HORVU  RecName: Full=Catalase isozyme 2               310   3e-99    
ref|XP_001696763.1|  catalase/peroxidase                                310   3e-99    
gb|KJB10391.1|  hypothetical protein B456_001G198700                    308   4e-99    
gb|ABR16304.1|  unknown                                                 309   6e-99    
gb|EMS51034.1|  Catalase isozyme 2                                      310   8e-99    
gb|ABK24543.1|  unknown                                                 309   8e-99    
emb|CAH61266.1|  catalase                                               309   1e-98    
emb|CAA43814.1|  catalase                                               308   2e-98    
dbj|BAJ92414.1|  predicted protein                                      308   3e-98    
ref|XP_002950455.1|  catalase                                           308   4e-98    
gb|KJB17474.1|  hypothetical protein B456_003G002800                    306   5e-98    
pir||CSRZ  catalase (EC 1.11.1.6) catA - rice                           307   5e-98 
gb|AAB70006.1|  catalase                                                307   6e-98    
ref|XP_003573241.1|  PREDICTED: catalase isozyme 2                      306   1e-97    
emb|CAA73663.1|  catalase                                               306   1e-97    
gb|AGT15888.1|  catalase                                                306   1e-97    
gb|AGT16310.1|  catalase                                                306   2e-97    
gb|AGT16188.1|  catalase                                                306   2e-97    
gb|AGT16054.1|  catalase                                                306   2e-97    
gb|EMT06167.1|  Catalase isozyme 2                                      310   5e-97    
gb|AHZ13843.1|  catalase                                                304   6e-97    
ref|XP_006382990.1|  hypothetical protein POPTR_0005s10340g             302   1e-96    
ref|XP_009108682.1|  PREDICTED: catalase-2-like isoform X1              302   7e-96    
gb|AAR84577.1|  catalase 1b                                             299   2e-95    
dbj|BAA34714.1|  catalase                                               300   2e-95    
ref|XP_006646781.1|  PREDICTED: LOW QUALITY PROTEIN: catalase iso...    300   3e-95    
gb|AFY26882.1|  catalase                                                288   7e-95    
sp|P55310.1|CATA_SECCE  RecName: Full=Catalase                          298   2e-94    
sp|P18123.2|CATA3_MAIZE  RecName: Full=Catalase isozyme 3               297   4e-94    
gb|AFW66787.1|  catalase3                                               297   5e-94    
gb|AEY70510.1|  catalase                                                290   6e-94    
ref|XP_004952157.1|  PREDICTED: catalase isozyme 3-like isoform X1      291   1e-91    
gb|AFW66785.1|  catalase3 isoform 1                                     295   3e-91    
ref|XP_011396830.1|  Catalase isozyme 2                                 289   4e-91    
ref|XP_005708279.1|  catalase                                           286   6e-90    
gb|AFW66789.1|  catalase3                                               275   4e-88    
ref|NP_001105416.1|  catalase isozyme 3                                 280   3e-87    
gb|AAA33441.1|  catalase isozyme 3 (EC 1.11.1.6)                        279   3e-87    
gb|ABB88582.1|  catalase                                                275   1e-85    
pir||A55092  catalase (EC 1.11.1.6) CAT-2 - maize (fragment)            275   1e-85 
gb|ACV30589.1|  catalase                                                264   1e-85    
gb|AFW66788.1|  catalase3                                               274   3e-85    
gb|ACU23083.1|  unknown                                                 264   9e-85    
ref|XP_010242895.1|  PREDICTED: catalase isozyme 1-like isoform X2      266   1e-82    
ref|XP_009392260.1|  PREDICTED: catalase isozyme A-like isoform X1      266   7e-82    
gb|KDD77132.1|  catalase                                                265   8e-82    
gb|AFH53190.1|  catalase                                                256   1e-81    
gb|AFH53189.1|  catalase                                                256   1e-81    
gb|AFH53187.1|  catalase                                                256   3e-81    
ref|XP_006382987.1|  hypothetical protein POPTR_0005s10340g             260   2e-80    
dbj|BAH20283.1|  AT1G20620                                              247   3e-79    
gb|AAP57673.1|  catalase                                                246   1e-77    
gb|KEH36313.1|  catalase heme-binding enzyme                            253   1e-77    
ref|XP_008348922.1|  PREDICTED: catalase isozyme 1-like                 248   7e-76    
ref|XP_008382478.1|  PREDICTED: catalase isozyme 1-like                 248   1e-75    
gb|AID50071.1|  catalase                                                237   1e-75    
gb|AFR42410.1|  catalase                                                237   1e-75    
gb|AFR42412.1|  catalase                                                233   9e-74    
gb|AGS17821.1|  catalase 2                                              241   9e-74    
ref|XP_006435362.1|  hypothetical protein CICLE_v10000948mg             240   8e-73    
ref|XP_005536240.1|  catalase                                           242   1e-72    
gb|ABB51561.1|  truncated catalase 2                                    235   7e-71    
dbj|BAD07937.1|  catalase catA-like protein                             224   7e-70    
gb|ABS89000.1|  catalase                                                223   2e-69    
ref|NP_973873.1|  catalase 3                                            231   2e-69    
gb|AAO16182.1|  catalase-1                                              220   4e-69    
emb|CAA10286.1|  catalase                                               217   1e-67    
gb|ACJ71244.1|  catalase 2                                              224   3e-67    
gb|AAZ03546.1|  Catalase                                                217   5e-67    
gb|AEA86295.1|  putative catalase                                       216   1e-66    
gb|ACJ71245.1|  catalase 2                                              222   2e-66    
gb|ABY68158.1|  catalase                                                211   2e-65    
gb|ABY68162.1|  catalase                                                211   3e-65    
gb|ABY68159.1|  catalase                                                210   4e-65    
gb|AFI48054.1|  catalase isozyme B                                      209   7e-65    
gb|AFA36510.1|  catalase                                                213   8e-65    
gb|ABY68160.1|  catalase                                                209   8e-65    
gb|ABY68161.1|  catalase                                                209   1e-64    
gb|AFI48111.1|  catalase isozyme B                                      209   1e-64    
gb|AFI48131.1|  catalase isozyme B                                      209   1e-64    
gb|AAY22485.1|  catalase                                                211   3e-64    
gb|AFI48101.1|  catalase isozyme B                                      208   3e-64    
gb|AFI48068.1|  catalase isozyme B                                      207   5e-64    
gb|ABY68164.1|  catalase                                                207   6e-64    
gb|ADR01107.1|  catalase 3                                              215   6e-64    
emb|CDP22058.1|  unnamed protein product                                208   1e-63    
gb|AFI48130.1|  catalase isozyme B                                      206   3e-63    
gb|AAT68776.1|  catalase                                                209   5e-63    
gb|AFI48098.1|  catalase isozyme B                                      204   2e-62    
gb|AFV96158.1|  catalase                                                203   2e-61    
ref|XP_005712277.1|  unnamed protein product                            212   2e-61    
gb|ACY30463.1|  catalase                                                204   6e-60    
gb|ABN79860.2|  catalase                                                201   1e-59    
gb|KCW68093.1|  hypothetical protein EUGRSUZ_F01775                     204   2e-59    
emb|CAC16850.1|  catalase                                               196   4e-59    
ref|XP_006416379.1|  hypothetical protein EUTSA_v10007795mg             202   1e-58    
emb|CAC17121.1|  catalase                                               194   2e-58    
emb|CBI29556.3|  unnamed protein product                                189   8e-57    
dbj|BAD94702.1|  catalase                                               187   3e-56    
gb|ABY68163.1|  catalase                                                187   4e-56    
gb|AFK46618.1|  unknown                                                 184   3e-55    
ref|XP_005642928.1|  catalase                                           193   3e-54    
gb|AAG23803.1|  catalase                                                184   3e-54    
gb|AAR25790.1|  catalase                                                179   2e-53    
gb|KCW70319.1|  hypothetical protein EUGRSUZ_F03561                     185   7e-53    
ref|XP_005644653.1|  catalase-domain-containing protein                 187   1e-51    
ref|WP_032122311.1|  catalase                                           185   3e-51    
gb|AFC35182.1|  catalase dismutase                                      179   4e-51    
gb|AII80275.1|  catalase                                                180   7e-51    
ref|WP_015881004.1|  catalase                                           183   2e-50    
ref|XP_005647994.1|  catalase-domain-containing protein                 182   3e-50    
ref|WP_026826608.1|  catalase                                           182   4e-50    
gb|AHB35639.1|  catalase                                                173   9e-50    
gb|KGS11078.1|  catalase                                                175   2e-49    
ref|WP_031421259.1|  catalase                                           180   2e-49    
gb|EGH29791.1|  catalase                                                174   3e-49    
ref|WP_004077443.1|  catalase                                           179   3e-49    
gb|KJE89728.1|  catalase isozyme 2                                      181   4e-49    
ref|WP_007497088.1|  catalase                                           179   4e-49    
ref|WP_039169268.1|  catalase                                           179   4e-49    
ref|XP_004366029.2|  catalase isozyme 2                                 180   5e-49    
ref|WP_024719958.1|  MULTISPECIES: catalase                             179   6e-49    
ref|WP_041089594.1|  catalase                                           179   6e-49    
ref|WP_008359888.1|  catalase                                           179   6e-49    
ref|WP_041091807.1|  catalase                                           179   6e-49    
ref|WP_039177466.1|  catalase                                           179   9e-49    
gb|KJF46757.1|  catalase                                                178   1e-48    
ref|WP_035703421.1|  catalase                                           178   1e-48    
ref|WP_034282264.1|  catalase                                           178   2e-48    
gb|AEQ94083.1|  putative catalase                                       172   3e-48    
ref|WP_034321610.1|  catalase                                           177   4e-48    
ref|WP_008348997.1|  MULTISPECIES: catalase                             177   5e-48    
ref|WP_035435964.1|  catalase                                           176   6e-48    



>ref|XP_009794469.1| PREDICTED: catalase isozyme 3 [Nicotiana sylvestris]
 emb|CCP37652.1| catalase-3 [Nicotiana tabacum]
Length=492

 Score =   424 bits (1090),  Expect = 9e-144, Method: Compositional matrix adjust.
 Identities = 197/209 (94%), Positives = 205/209 (98%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPED+LPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT
Sbjct  284  FDPLDVTKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIFSYSDTQRHRLGPNYLQLP NAPKCAHHNNHH+GFMNFMHRDEEVNYFPSR+DP RHA
Sbjct  344  RIFSYSDTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPCRHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSW+ DRQERFICRWV+ALSDPRVTHEI
Sbjct  404  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWAPDRQERFICRWVDALSDPRVTHEI  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            RSIWISYW+QADK+LGQK+ASRLNVRPTM
Sbjct  464  RSIWISYWSQADKTLGQKIASRLNVRPTM  492



>ref|XP_009624788.1| PREDICTED: catalase isozyme 3 [Nicotiana tomentosiformis]
Length=492

 Score =   419 bits (1076),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 194/209 (93%), Positives = 204/209 (98%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPED+LPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT
Sbjct  284  FDPLDVTKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIFSYSDTQRHRLGPNYLQLP NAPKCAHHNNHH+GFMNFMHRDEEVNYFPSR+DP RHA
Sbjct  344  RIFSYSDTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPCRHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            EQ+PIP RVLTGKRDKCI+EKENNFKQPGERYRSW+ DRQERFICRWV+ALSDPRVTHEI
Sbjct  404  EQYPIPLRVLTGKRDKCIVEKENNFKQPGERYRSWAPDRQERFICRWVDALSDPRVTHEI  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            RSIWISYW+QADKSLGQK+ASRLN+RPTM
Sbjct  464  RSIWISYWSQADKSLGQKIASRLNIRPTM  492



>gb|KJB14249.1| hypothetical protein B456_002G115900 [Gossypium raimondii]
Length=344

 Score =   410 bits (1054),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 189/209 (90%), Positives = 201/209 (96%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPED+LPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPG+YYSDDKLLQT
Sbjct  136  FDPLDVTKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGIYYSDDKLLQT  195

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIFSYSDTQRHRLGPNYLQLP NAPKCAHHNNHH+GFMNFMHRDEE+NYFPSRYDP RHA
Sbjct  196  RIFSYSDTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEINYFPSRYDPVRHA  255

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E  PIPP V TG+R+KCIIEKENNFKQPGERYRSW+ DRQERFICRWV+ALSDPRVTHEI
Sbjct  256  EMFPIPPAVCTGRREKCIIEKENNFKQPGERYRSWAADRQERFICRWVDALSDPRVTHEI  315

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            RSIWISYW+QADKS+GQKLASRLNVRP++
Sbjct  316  RSIWISYWSQADKSVGQKLASRLNVRPSI  344



>emb|CDP07287.1| unnamed protein product [Coffea canephora]
Length=492

 Score =   414 bits (1064),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 189/209 (90%), Positives = 203/209 (97%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDV+KTWPED+LPLQPVGRLVLNKNIDNFFAENEQLAFCPAI+VPG+YYSDDKLLQT
Sbjct  284  FDPLDVSKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIIVPGIYYSDDKLLQT  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIFSY+DTQRHRLGPNYLQLP NAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDP RHA
Sbjct  344  RIFSYADTQRHRLGPNYLQLPANAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPVRHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E+HPIPP VL+GKRDKC+I+KENNFKQPGERYRSW+ DRQERFICRWV+ALSD RVTHEI
Sbjct  404  ERHPIPPPVLSGKRDKCVIQKENNFKQPGERYRSWAPDRQERFICRWVDALSDARVTHEI  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            RSIWISYW+QADKSLGQK+A+RLNVRPTM
Sbjct  464  RSIWISYWSQADKSLGQKIATRLNVRPTM  492



>ref|XP_009600533.1| PREDICTED: catalase isozyme 3-like [Nicotiana tomentosiformis]
Length=492

 Score =   413 bits (1061),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 189/209 (90%), Positives = 203/209 (97%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPED+LPLQPVGRLVLNKNIDNFFAENEQLAFCPAI+VPG++YSDDKLLQT
Sbjct  284  FDPLDVTKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQT  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHH+G MNFMHRDEEVNYFPSR+DP RHA
Sbjct  344  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHEGVMNFMHRDEEVNYFPSRFDPCRHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            EQ+PIPPR+LTGKRD+CIIEKENNFKQPGERYRSWS DRQERFICRW+ ALSDPRVTHEI
Sbjct  404  EQYPIPPRILTGKRDRCIIEKENNFKQPGERYRSWSPDRQERFICRWINALSDPRVTHEI  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
             +IWISYW+QADKSLG+K+ASRLNVRPTM
Sbjct  464  HTIWISYWSQADKSLGEKIASRLNVRPTM  492



>gb|ACJ11733.1| catalase [Gossypium hirsutum]
Length=492

 Score =   412 bits (1059),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 190/209 (91%), Positives = 201/209 (96%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPED+LPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPG+YYSDDKLLQT
Sbjct  284  FDPLDVTKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGIYYSDDKLLQT  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIFSY+DTQRHRLGPNYLQLP NAPKCAHHNNHH+GFMNFMHRDEE+NYFPSRYDP RHA
Sbjct  344  RIFSYADTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEINYFPSRYDPVRHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E  PIPP V TG+R+KCIIEKENNFKQPGERYRSW+ DRQERFICRWVEALSDPRVTHEI
Sbjct  404  EMFPIPPAVCTGRREKCIIEKENNFKQPGERYRSWAADRQERFICRWVEALSDPRVTHEI  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            RSIWISYW+QADKSLGQKLASRLNVRP++
Sbjct  464  RSIWISYWSQADKSLGQKLASRLNVRPSI  492



>ref|XP_002301920.1| catalase family protein [Populus trichocarpa]
 gb|ABK96479.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|EEE81193.1| catalase family protein [Populus trichocarpa]
Length=492

 Score =   412 bits (1058),  Expect = 7e-139, Method: Compositional matrix adjust.
 Identities = 191/209 (91%), Positives = 201/209 (96%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPED+LPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT
Sbjct  284  FDPLDVTKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIFSY+DTQRHRLGPNYLQLP NAPKCAHHNNHH+GFMNFMHRDEEVNYFPSRYDP RHA
Sbjct  344  RIFSYADTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E  PIPP V +GKR+KCIIEKENNFKQPGERYRSW+ DRQERFICRWV+ALSDPRVTHEI
Sbjct  404  ESFPIPPAVCSGKREKCIIEKENNFKQPGERYRSWAPDRQERFICRWVDALSDPRVTHEI  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            RSIWISYW+QADKSLGQKLASRLNVRP++
Sbjct  464  RSIWISYWSQADKSLGQKLASRLNVRPSI  492



>ref|XP_009773579.1| PREDICTED: catalase isozyme 3-like [Nicotiana sylvestris]
Length=492

 Score =   411 bits (1057),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 189/209 (90%), Positives = 203/209 (97%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPED+LPLQPVGRLVLNKNIDNFFAENEQLAFCPAI+VPG++YSDDKLLQT
Sbjct  284  FDPLDVTKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQT  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHH+G MNFM+RDEEVNYFPSR+DP RHA
Sbjct  344  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHEGVMNFMYRDEEVNYFPSRFDPCRHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            EQ+PIPPR+LTGKRD+CIIEKENNFKQPGERYRSWS DRQERFICRW+ ALSDPRVTHEI
Sbjct  404  EQYPIPPRILTGKRDRCIIEKENNFKQPGERYRSWSPDRQERFICRWINALSDPRVTHEI  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            R IWISYW+QADKSLG+K+ASRLNVRPTM
Sbjct  464  RIIWISYWSQADKSLGEKIASRLNVRPTM  492



>ref|XP_008237987.1| PREDICTED: catalase isozyme 1 [Prunus mume]
Length=492

 Score =   411 bits (1057),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 191/209 (91%), Positives = 204/209 (98%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPED+LPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT
Sbjct  284  FDPLDVTKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIFSYSDTQRHRLGPNYLQLPVNAPKC+HHNNHH+GFMNFMHRDEEVNYFPSRYDP R+A
Sbjct  344  RIFSYSDTQRHRLGPNYLQLPVNAPKCSHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRNA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E+ PIPP +L+GKR+KCIIEKENNFKQPGERYRSW+ DRQERFICRWV+ALSDPRVTHEI
Sbjct  404  ERFPIPPNILSGKREKCIIEKENNFKQPGERYRSWAPDRQERFICRWVDALSDPRVTHEI  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            RSIWISYW+QADKSLGQKLASRLNVRP++
Sbjct  464  RSIWISYWSQADKSLGQKLASRLNVRPSI  492



>emb|CAI43948.1| catalase [Populus deltoides]
 gb|ABK96317.1| unknown [Populus trichocarpa x Populus deltoides]
Length=492

 Score =   411 bits (1057),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 190/209 (91%), Positives = 201/209 (96%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPED+LPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPG+YYSDDKLLQT
Sbjct  284  FDPLDVTKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGIYYSDDKLLQT  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIFSY+DTQRHRLGPNYLQLP NAPKCAHHNNHH+GFMNFMHRDEEVNYFPSRYDP RHA
Sbjct  344  RIFSYADTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E  PIPP V +GKR+KCIIEKENNFKQPGERYRSW+ DRQERFICRWV+ALSDPRVTHEI
Sbjct  404  ESFPIPPAVCSGKREKCIIEKENNFKQPGERYRSWAPDRQERFICRWVDALSDPRVTHEI  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            RSIWISYW+QADKSLGQKLASRLNVRP++
Sbjct  464  RSIWISYWSQADKSLGQKLASRLNVRPSI  492



>gb|KHG25152.1| Catalase isozyme 1 [Gossypium arboreum]
Length=492

 Score =   411 bits (1056),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 189/209 (90%), Positives = 200/209 (96%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPED+LPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPG+YYSDDKLLQT
Sbjct  284  FDPLDVTKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGIYYSDDKLLQT  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIFSY+DTQRHRLGPNYLQLP NAPKCAHHNNHH+GFMNFMHRDEE+NYFPSRYDP RHA
Sbjct  344  RIFSYADTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEINYFPSRYDPVRHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E  PIPP V TG+R+KCIIEKENNFKQPGERYRSW+ DRQERFICRWVEA SDPRVTHEI
Sbjct  404  EMFPIPPAVCTGRREKCIIEKENNFKQPGERYRSWAADRQERFICRWVEAFSDPRVTHEI  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            RSIWISYW+QADKSLGQKLASRLNVRP++
Sbjct  464  RSIWISYWSQADKSLGQKLASRLNVRPSI  492



>gb|AJE26131.1| catalase [Salix matsudana]
Length=492

 Score =   411 bits (1056),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 190/209 (91%), Positives = 200/209 (96%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPED+LPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPG+YYSDDKLLQT
Sbjct  284  FDPLDVTKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGIYYSDDKLLQT  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIFSYSDTQRHRLGPNYLQLP NAPKCAHHNNHH+GFMNFMHRDEEVNYFPSRYDP RHA
Sbjct  344  RIFSYSDTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E  PIPP V +GKR+KCIIEKENNFKQPGERYRSW+ DRQERFICRWV+ALSDPR THEI
Sbjct  404  ESFPIPPAVCSGKREKCIIEKENNFKQPGERYRSWAPDRQERFICRWVDALSDPRATHEI  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            RSIWISYW+QADKSLGQKLASRLNVRP++
Sbjct  464  RSIWISYWSQADKSLGQKLASRLNVRPSI  492



>gb|KJB14250.1| hypothetical protein B456_002G115900 [Gossypium raimondii]
Length=492

 Score =   410 bits (1055),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 189/209 (90%), Positives = 201/209 (96%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPED+LPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPG+YYSDDKLLQT
Sbjct  284  FDPLDVTKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGIYYSDDKLLQT  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIFSYSDTQRHRLGPNYLQLP NAPKCAHHNNHH+GFMNFMHRDEE+NYFPSRYDP RHA
Sbjct  344  RIFSYSDTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEINYFPSRYDPVRHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E  PIPP V TG+R+KCIIEKENNFKQPGERYRSW+ DRQERFICRWV+ALSDPRVTHEI
Sbjct  404  EMFPIPPAVCTGRREKCIIEKENNFKQPGERYRSWAADRQERFICRWVDALSDPRVTHEI  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            RSIWISYW+QADKS+GQKLASRLNVRP++
Sbjct  464  RSIWISYWSQADKSVGQKLASRLNVRPSI  492



>ref|XP_011034872.1| PREDICTED: catalase isozyme 1-like [Populus euphratica]
Length=492

 Score =   410 bits (1055),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 189/209 (90%), Positives = 201/209 (96%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPED+LPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPG+YYSDDKLLQT
Sbjct  284  FDPLDVTKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGIYYSDDKLLQT  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIFSY+DTQRHRLGPNYLQLP NAPKCAHHNNHH+GFMNFMHRDEEVNYFPSRYDP RHA
Sbjct  344  RIFSYADTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E  PIPP V +GKR+KCIIEKENNFKQPGERYRSW+ DRQERF+CRWV+ALSDPRVTHEI
Sbjct  404  ESFPIPPAVCSGKREKCIIEKENNFKQPGERYRSWAPDRQERFVCRWVDALSDPRVTHEI  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            RSIWISYW+QADKSLGQKLASRLNVRP++
Sbjct  464  RSIWISYWSQADKSLGQKLASRLNVRPSI  492



>ref|XP_007209948.1| hypothetical protein PRUPE_ppa004776mg [Prunus persica]
 gb|EMJ11147.1| hypothetical protein PRUPE_ppa004776mg [Prunus persica]
Length=492

 Score =   409 bits (1052),  Expect = 6e-138, Method: Compositional matrix adjust.
 Identities = 190/209 (91%), Positives = 203/209 (97%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPED+LPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT
Sbjct  284  FDPLDVTKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIFSYSDTQRHRLGPNYLQLPVNAPKC+HHNNHH+GFMNFMHRDEEVNYFPSRYDP RHA
Sbjct  344  RIFSYSDTQRHRLGPNYLQLPVNAPKCSHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E+ PIPP +L+GKR+KCIIEKENNFKQPGERYRSW+ DRQERFI RWV+ALSDPRVTHEI
Sbjct  404  ERFPIPPNILSGKREKCIIEKENNFKQPGERYRSWAPDRQERFIHRWVDALSDPRVTHEI  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            RS+WISYW+QADKSLGQKLASRLNVRP++
Sbjct  464  RSVWISYWSQADKSLGQKLASRLNVRPSI  492



>emb|CAD42908.1| catalase [Prunus persica]
Length=492

 Score =   409 bits (1052),  Expect = 6e-138, Method: Compositional matrix adjust.
 Identities = 190/209 (91%), Positives = 203/209 (97%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPED+LPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT
Sbjct  284  FDPLDVTKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIFSYSDTQRHRLGPNYLQLPVNAPKC+HHNNHH+GFMNFMHRDEEVNYFPSRYDP RHA
Sbjct  344  RIFSYSDTQRHRLGPNYLQLPVNAPKCSHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E+ PIPP +L+GKR+KCIIEKENNFKQPGERYRSW+ DRQERFI RWV+ALSDPRVTHEI
Sbjct  404  ERFPIPPNILSGKREKCIIEKENNFKQPGERYRSWAPDRQERFIHRWVDALSDPRVTHEI  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            RS+WISYW+QADKSLGQKLASRLNVRP++
Sbjct  464  RSVWISYWSQADKSLGQKLASRLNVRPSI  492



>gb|AET97564.1| catalase [Ziziphus jujuba]
Length=492

 Score =   409 bits (1050),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 190/209 (91%), Positives = 200/209 (96%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPED+LPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT
Sbjct  284  FDPLDVTKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIFSYSDTQRHRLGPNYLQLP NAPKCAHHNNHH+GFMNFMHRDEEVNYFPSRYDP RHA
Sbjct  344  RIFSYSDTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            EQHPIP  +  GKR+KCIIEKENNFKQPGERYRSW+ DRQERFI RW++ALSDPRVTHEI
Sbjct  404  EQHPIPSAIFNGKREKCIIEKENNFKQPGERYRSWAPDRQERFIRRWIDALSDPRVTHEI  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            RSIWISYW+QADKSLGQKLASRLNVRP++
Sbjct  464  RSIWISYWSQADKSLGQKLASRLNVRPSI  492



>sp|P17598.2|CATA1_GOSHI RecName: Full=Catalase isozyme 1 [Gossypium hirsutum]
 emb|CAA36380.1| unnamed protein product [Gossypium hirsutum]
Length=492

 Score =   408 bits (1049),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 188/209 (90%), Positives = 200/209 (96%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPED+LPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPG+YYSDDKLLQT
Sbjct  284  FDPLDVTKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGIYYSDDKLLQT  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIFSYSDTQRHRLGPNYLQLP NAPKCAHHNNHH+GFMNFMHRDEE+NYFPSRYDP RHA
Sbjct  344  RIFSYSDTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEINYFPSRYDPVRHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E  PIPP V TG+R+KCIIEKENNFKQPGERYRSW+ DRQERFICRWV+ALSDPRVTHEI
Sbjct  404  EMFPIPPAVCTGRREKCIIEKENNFKQPGERYRSWAADRQERFICRWVDALSDPRVTHEI  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            RSIWISYW+QADKS+GQKLAS LNVRP++
Sbjct  464  RSIWISYWSQADKSVGQKLASLLNVRPSI  492



>sp|P49317.1|CATA3_NICPL RecName: Full=Catalase isozyme 3 [Nicotiana plumbaginifolia]
 emb|CAA85426.1| catalase [Nicotiana plumbaginifolia]
Length=492

 Score =   408 bits (1048),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 192/209 (92%), Positives = 201/209 (96%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPED+LPLQPVGRLVLNKNIDNFFAENEQLAF PAIVVPGVY SDDKLLQT
Sbjct  284  FDPLDVTKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFWPAIVVPGVYCSDDKLLQT  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIFSYSD QRHRLGPNYLQLPVNAPKCAHHNNHH+GFMNFMHRDEEVNYFPSR+DP RHA
Sbjct  344  RIFSYSDAQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPCRHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            EQ+PIPP VLTGKRDKCIIEKENNFKQPGERYRSW+ DRQERFICRWV+ALSDPRVTHEI
Sbjct  404  EQYPIPPCVLTGKRDKCIIEKENNFKQPGERYRSWAPDRQERFICRWVDALSDPRVTHEI  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            RSIW SYW+QADK+LGQK+ASRLNVRPTM
Sbjct  464  RSIWFSYWSQADKTLGQKIASRLNVRPTM  492



>sp|O24339.1|CATA_SOLAP RecName: Full=Catalase [Soldanella alpina]
 emb|CAB16749.1| catalase [Soldanella alpina]
Length=492

 Score =   407 bits (1046),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 187/209 (89%), Positives = 202/209 (97%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPED++PL PVGRLVLNKNIDNFFAENEQLAFCPA++VPGVYYSDDKLLQT
Sbjct  284  FDPLDVTKTWPEDIIPLMPVGRLVLNKNIDNFFAENEQLAFCPALIVPGVYYSDDKLLQT  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIFSY+DTQRHRLGPNYLQLP NAPKCAHHNNHH+G MNFMHRDEEVNYFPSR+DP RHA
Sbjct  344  RIFSYADTQRHRLGPNYLQLPPNAPKCAHHNNHHEGLMNFMHRDEEVNYFPSRFDPVRHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E+HPIPP VLTGKRD+C+IEKENNFKQPGERYR+++ DRQERF+CRWV+ALSDPRVTHEI
Sbjct  404  ERHPIPPPVLTGKRDRCMIEKENNFKQPGERYRTFAPDRQERFVCRWVDALSDPRVTHEI  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            RSIWISYWTQADKSLGQKLASRLNVRPTM
Sbjct  464  RSIWISYWTQADKSLGQKLASRLNVRPTM  492



>gb|AFU90823.1| catalase, partial [Populus x beijingensis]
Length=446

 Score =   404 bits (1038),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 188/205 (92%), Positives = 197/205 (96%), Gaps = 0/205 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPED+LPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT
Sbjct  242  FDPLDVTKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  301

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIFSY+DTQRHRLGPNYLQLP NAPKCAHHNNHH+GFMNFMHRDEEVNYFPSRYDP RHA
Sbjct  302  RIFSYADTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHA  361

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E  PIPP V +GKR++CIIEKENNFKQPGERYRSW+ DRQERFICRWV+ALSDPRVTHEI
Sbjct  362  ESFPIPPAVCSGKRERCIIEKENNFKQPGERYRSWAPDRQERFICRWVDALSDPRVTHEI  421

Query  204  RSIWISYWTQADKSLGQKLASRLNV  130
            RSIWISYW+QADKSLGQKLASRLNV
Sbjct  422  RSIWISYWSQADKSLGQKLASRLNV  446



>gb|AFU90822.1| catalase, partial [Populus tomentosa]
Length=487

 Score =   405 bits (1041),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 189/205 (92%), Positives = 197/205 (96%), Gaps = 0/205 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPED+LPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT
Sbjct  283  FDPLDVTKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  342

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIFSY+DTQRHRLGPNYLQLP NAPKCAHHNNHH+GFMNFMHRDEEVNYFPSRYDP RHA
Sbjct  343  RIFSYADTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHA  402

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E  PIPP V +GKR+KCIIEKENNFKQPGERYRSW+ DRQERFICRWV+ALSDPRVTHEI
Sbjct  403  ESFPIPPAVCSGKREKCIIEKENNFKQPGERYRSWAPDRQERFICRWVDALSDPRVTHEI  462

Query  204  RSIWISYWTQADKSLGQKLASRLNV  130
            RSIWISYW+QADKSLGQKLASRLNV
Sbjct  463  RSIWISYWSQADKSLGQKLASRLNV  487



>gb|KJB57963.1| hypothetical protein B456_009G187600 [Gossypium raimondii]
Length=492

 Score =   405 bits (1040),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 186/209 (89%), Positives = 201/209 (96%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPED+LPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPG+YYSDDKLLQT
Sbjct  284  FDPLDVTKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGIYYSDDKLLQT  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            R+FSYSDTQRHRLGPNYLQLP NAPKCAHHNNHH+GFMNFMHRDEE+NYFPSRYDP RHA
Sbjct  344  RVFSYSDTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEINYFPSRYDPSRHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E+ PIPP + TGKR+KCIIEKENNFKQPGERYRSW+ DRQERFI RWV+A+SDPRVTHEI
Sbjct  404  ERFPIPPALCTGKREKCIIEKENNFKQPGERYRSWAPDRQERFINRWVDAMSDPRVTHEI  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            RSIWI+YW+QADKSLGQKLASRLNVRP++
Sbjct  464  RSIWITYWSQADKSLGQKLASRLNVRPSI  492



>gb|AAM97542.1| catalase 3 [Capsicum annuum]
Length=492

 Score =   405 bits (1040),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 184/209 (88%), Positives = 202/209 (97%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTK WPED+LPLQPVGRLVLNKNIDNFF ENEQLAFCPAI+VPG++YSDDKLLQT
Sbjct  284  FDPLDVTKIWPEDILPLQPVGRLVLNKNIDNFFVENEQLAFCPAIIVPGIHYSDDKLLQT  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            R+FSY+DTQRHRLGPNYLQLP NAPKCAHHNNHH+GFMNFMHRDEEVNYFPSR+DP RHA
Sbjct  344  RVFSYADTQRHRLGPNYLQLPPNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPCRHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            EQ+PIPPRVL GKRD+CII+KENNFKQPGERYRSW+ DRQERFICRWV+ALS+PRVTHEI
Sbjct  404  EQYPIPPRVLNGKRDRCIIQKENNFKQPGERYRSWAPDRQERFICRWVDALSEPRVTHEI  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            R+IW+SYW+QADKSLGQKLASRLNV+PTM
Sbjct  464  RTIWLSYWSQADKSLGQKLASRLNVKPTM  492



>ref|XP_004238430.1| PREDICTED: catalase isozyme 3 [Solanum lycopersicum]
Length=492

 Score =   404 bits (1039),  Expect = 6e-136, Method: Compositional matrix adjust.
 Identities = 186/209 (89%), Positives = 199/209 (95%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTK WPED+LPLQPVGRLVLN+NIDNFFAENEQLAFCPAI+VPGVYYSDDKLLQT
Sbjct  284  FDPLDVTKIWPEDILPLQPVGRLVLNRNIDNFFAENEQLAFCPAIIVPGVYYSDDKLLQT  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            R+FSY+DTQRHRLGPNYLQLPVNAPKCAHHNNHH+G MNFMHRDEEVNY PSR DP RHA
Sbjct  344  RVFSYADTQRHRLGPNYLQLPVNAPKCAHHNNHHEGLMNFMHRDEEVNYLPSRLDPCRHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            EQ+PIPPRVLTGKR+K IIEKENNFKQPGE YRSW+ DRQERF+CRWV+ALSDPR THEI
Sbjct  404  EQYPIPPRVLTGKREKVIIEKENNFKQPGEHYRSWAPDRQERFLCRWVDALSDPRATHEI  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            RSIWISYW+QADKSLGQKLASRLN+RPTM
Sbjct  464  RSIWISYWSQADKSLGQKLASRLNIRPTM  492



>ref|XP_006342134.1| PREDICTED: catalase isozyme 3-like [Solanum tuberosum]
Length=492

 Score =   404 bits (1039),  Expect = 6e-136, Method: Compositional matrix adjust.
 Identities = 187/209 (89%), Positives = 199/209 (95%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTK WPED+LPLQPVGRLVLNKNIDNFFAENEQLAFCPAI+VPGVYYSDDKLLQT
Sbjct  284  FDPLDVTKIWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIIVPGVYYSDDKLLQT  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            R+FSY+DTQRHRLGPNYLQLPVNAPKCAHHNNHH+GFMNFMHRDEEVNYFPSR DP RHA
Sbjct  344  RVFSYADTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRLDPCRHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            EQ+PIPPRVLTGKR+K IIEKENNFKQPGE YRSW+  RQERF+CRWV+ALSD R THEI
Sbjct  404  EQYPIPPRVLTGKREKVIIEKENNFKQPGEHYRSWAPGRQERFVCRWVDALSDLRATHEI  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            RSIWISYW+QADKSLGQKLASRLN+RPTM
Sbjct  464  RSIWISYWSQADKSLGQKLASRLNIRPTM  492



>ref|NP_001291326.1| catalase isozyme 1 [Sesamum indicum]
 gb|AFJ42575.1| catalase [Sesamum indicum]
Length=492

 Score =   404 bits (1037),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 187/209 (89%), Positives = 200/209 (96%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPED+LPLQPVGR+VLNKNIDNFFAENEQLAFCPAI+VPG+YYSDDKLLQT
Sbjct  284  FDPLDVTKTWPEDILPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIYYSDDKLLQT  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIFSY+DTQRHRLGPNYLQLP NAPKCAHHNNHH+GFMNFMHRDEEVNYFPSRYDP RH+
Sbjct  344  RIFSYADTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPTRHS  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E +PIPP VL+GKR+K  IEKENNFKQPGERYRSW+ DRQERFI RWVEALSDPR+THEI
Sbjct  404  EMYPIPPVVLSGKREKRCIEKENNFKQPGERYRSWAPDRQERFIRRWVEALSDPRLTHEI  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            RSIWISYW+QADKSLGQKLASRLNVRPTM
Sbjct  464  RSIWISYWSQADKSLGQKLASRLNVRPTM  492



>ref|XP_011074091.1| PREDICTED: catalase isozyme 3 isoform X2 [Sesamum indicum]
Length=492

 Score =   403 bits (1036),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 187/209 (89%), Positives = 200/209 (96%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPED+LPLQPVGRLVLNKNIDNFFAENEQLAFCPAI+VPG+YYSDDKLLQT
Sbjct  284  FDPLDVTKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIIVPGIYYSDDKLLQT  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIFSY+DTQRHRLGPNYLQLPVNAPKCAHHNNHH+GFMNFMHRDEEVNYFPSRYDP RHA
Sbjct  344  RIFSYADTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPSRHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E++PIPP VL+GKR K  IEKENNFKQPG+RYRSW+ DRQERFI RWVEALSDPR+THEI
Sbjct  404  ERYPIPPVVLSGKRGKICIEKENNFKQPGDRYRSWAPDRQERFIRRWVEALSDPRLTHEI  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            RSIW+SYW+QADKSLGQKLASRLNVRP M
Sbjct  464  RSIWVSYWSQADKSLGQKLASRLNVRPAM  492



>ref|XP_011041225.1| PREDICTED: catalase isozyme 1 [Populus euphratica]
Length=492

 Score =   403 bits (1035),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 185/209 (89%), Positives = 201/209 (96%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPED+LPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPG+YYSDDKLLQT
Sbjct  284  FDPLDVTKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGIYYSDDKLLQT  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHH+GFMNFMHRDEEVNYFPSR+DP RHA
Sbjct  344  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRHDPSRHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E+ PIP  V +G+R+KCIIEKENNFKQPGERYRSW+ DRQERF+CRWV+ALS+PRVTHE+
Sbjct  404  ERFPIPSAVCSGRREKCIIEKENNFKQPGERYRSWAPDRQERFVCRWVDALSEPRVTHEV  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            RSIWISYW+QADKSLGQKLAS LNVRP++
Sbjct  464  RSIWISYWSQADKSLGQKLASHLNVRPSI  492



>gb|EYU30275.1| hypothetical protein MIMGU_mgv1a005250mg [Erythranthe guttata]
Length=492

 Score =   403 bits (1035),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 187/209 (89%), Positives = 201/209 (96%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPED+LPLQPVGRLVLNKNIDNFFAENEQLAFCP +VVPGV+YSDDK+LQT
Sbjct  284  FDPLDVTKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPGLVVPGVHYSDDKMLQT  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIFSYSD+QRHRLGPNYLQLP NAPKCAHHNNHH+GFMNFMHRDEEVNYFPSRYDP RHA
Sbjct  344  RIFSYSDSQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPCRHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E+HPIPP VL+GKRD+C IEKENNFKQPGERYR++S DRQERFI RWV+ALSDPR+THEI
Sbjct  404  EKHPIPPVVLSGKRDRCCIEKENNFKQPGERYRTFSPDRQERFIRRWVDALSDPRLTHEI  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            RSIWISYW+QADKSLGQKLASRLNVRPTM
Sbjct  464  RSIWISYWSQADKSLGQKLASRLNVRPTM  492



>ref|XP_011074092.1| PREDICTED: catalase isozyme 3 isoform X3 [Sesamum indicum]
Length=492

 Score =   403 bits (1035),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 187/209 (89%), Positives = 200/209 (96%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPED+LPLQPVGRLVLNKNIDNFFAENEQLAFCPAI+VPG+YYSDDKLLQT
Sbjct  284  FDPLDVTKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIIVPGIYYSDDKLLQT  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIFSY+DTQRHRLGPNYLQLPVNAPKCAHHNNHH+GFMNFMHRDEEVNYFPSRYDP RHA
Sbjct  344  RIFSYADTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPSRHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E++PIPP VL+GKR K  IEKENNFKQPG+RYRSW+ DRQERFI RWVEALSDPR+THEI
Sbjct  404  ERYPIPPVVLSGKRGKICIEKENNFKQPGDRYRSWAPDRQERFIRRWVEALSDPRLTHEI  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            RSIW+SYW+QADKSLGQKLAS LNVRPTM
Sbjct  464  RSIWVSYWSQADKSLGQKLASHLNVRPTM  492



>ref|XP_010530333.1| PREDICTED: catalase-2 [Tarenaya hassleriana]
Length=492

 Score =   402 bits (1034),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 185/209 (89%), Positives = 203/209 (97%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DP+DVTKTWPED+LPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT
Sbjct  284  FDPVDVTKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHH+GFMNFMHRDEEVNYFPSRYDP RHA
Sbjct  344  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E++PIPP + +G+R++CIIEKENNFKQPGERYRS++ DRQERFI RW+EALSDPR+THEI
Sbjct  404  ERYPIPPVICSGRRERCIIEKENNFKQPGERYRSFTPDRQERFIRRWIEALSDPRITHEI  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            RSIWISYW+QAD+SLGQKLASRLNVRP++
Sbjct  464  RSIWISYWSQADQSLGQKLASRLNVRPSI  492



>ref|XP_010663966.1| PREDICTED: catalase isozyme 1 [Vitis vinifera]
 emb|CBI40714.3| unnamed protein product [Vitis vinifera]
Length=492

 Score =   402 bits (1032),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 187/209 (89%), Positives = 202/209 (97%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPED+LPLQPVGRLVLN+NIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT
Sbjct  284  FDPLDVTKTWPEDILPLQPVGRLVLNRNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIFSYSDTQRHRLGPNYLQLP NAPKCAHHNNHH+GFMNFMHRDEEVNYFPSRYDP RHA
Sbjct  344  RIFSYSDTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E++PIPP +LTG+R+KCII KENNFKQPGERYRS++ DRQERFI RWV+ALSDPRVT+EI
Sbjct  404  ERYPIPPAILTGRREKCIIPKENNFKQPGERYRSFAPDRQERFIQRWVDALSDPRVTYEI  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            RSIWISYW+QADKSLGQKLASRLNVRP++
Sbjct  464  RSIWISYWSQADKSLGQKLASRLNVRPSI  492



>gb|KHG12976.1| Catalase isozyme 2 [Gossypium arboreum]
Length=492

 Score =   401 bits (1031),  Expect = 8e-135, Method: Compositional matrix adjust.
 Identities = 183/209 (88%), Positives = 200/209 (96%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPED+ PLQPVGR+VLNKNIDNFFAENEQLAFCP+++VPG+YYSDDKLLQT
Sbjct  284  FDPLDVTKTWPEDIFPLQPVGRMVLNKNIDNFFAENEQLAFCPSLIVPGIYYSDDKLLQT  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIFSYSDTQRHRLGPNYLQLP NAPKCAHHNNHH+GFMNFMHRDEEVNYFPSRYDP RHA
Sbjct  344  RIFSYSDTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E+HPIP  VL+GKR+KCII KENNFKQPGERYRS+S DRQERFI RW++ALSDPRVTHEI
Sbjct  404  EKHPIPSTVLSGKREKCIIGKENNFKQPGERYRSFSADRQERFINRWIDALSDPRVTHEI  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            RSIWISYW+QADKSLGQK+ASRLNVRP++
Sbjct  464  RSIWISYWSQADKSLGQKIASRLNVRPSI  492



>ref|XP_007018034.1| Catalase 2 [Theobroma cacao]
 gb|EOY15259.1| Catalase 2 [Theobroma cacao]
Length=492

 Score =   401 bits (1031),  Expect = 8e-135, Method: Compositional matrix adjust.
 Identities = 185/209 (89%), Positives = 200/209 (96%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPED+LPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPG+YYSDDKLLQT
Sbjct  284  FDPLDVTKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGIYYSDDKLLQT  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIFSY+DTQRHRLGPNYLQLP NAPKCAHHNNHH+GFMNFMHRDEE+NYFPSRYDP RHA
Sbjct  344  RIFSYADTQRHRLGPNYLQLPPNAPKCAHHNNHHEGFMNFMHRDEEINYFPSRYDPVRHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E+ PIPP V +G+R+KCIIEKENNFKQPGERYRSW+ DRQERFICRWV+ALSDPRVTHEI
Sbjct  404  ERFPIPPAVCSGRREKCIIEKENNFKQPGERYRSWAPDRQERFICRWVDALSDPRVTHEI  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            RSIWI+YW+QA KSLGQKLASRLNV+P +
Sbjct  464  RSIWITYWSQACKSLGQKLASRLNVKPNI  492



>ref|NP_001237556.1| catalase-1/2 [Glycine max]
 sp|P29756.1|CATA1_SOYBN RecName: Full=Catalase-1/2 [Glycine max]
 emb|CAA78056.1| catalase [Glycine max]
 gb|AAB88169.1| catalase [Glycine max]
 gb|AAB88170.1| catalase [Glycine max]
 gb|KHN48523.1| Catalase-1/2 [Glycine soja]
Length=492

 Score =   401 bits (1031),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 181/209 (87%), Positives = 201/209 (96%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPED+LPLQPVGR+VLNKNIDNFFAENEQLAFCPAI+VPGVYYSDDKLLQT
Sbjct  284  FDPLDVTKTWPEDVLPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGVYYSDDKLLQT  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            R+FSY+DTQRHRLGPNYLQLP NAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDP RHA
Sbjct  344  RVFSYADTQRHRLGPNYLQLPANAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPVRHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E+ P+PPR+L GKR+KC+IEKENNFKQPGERYRSW +DRQERF+ RWV+ALSDPRVTHEI
Sbjct  404  EKVPVPPRILGGKREKCMIEKENNFKQPGERYRSWPSDRQERFVRRWVDALSDPRVTHEI  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            RSIWISYW+QAD+SLGQK+AS LN++P++
Sbjct  464  RSIWISYWSQADRSLGQKIASHLNLKPSI  492



>emb|CAC04509.1| catalase [Digitalis lanata]
Length=265

 Score =   393 bits (1009),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 185/209 (89%), Positives = 196/209 (94%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPED+LPLQPVGR+VLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT
Sbjct  57   FDPLDVTKTWPEDILPLQPVGRMVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  116

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIFSYSDTQRHRLGPNYLQLP NAPKCAHHNNHH+GFMNFMHRDEEVNYFPSRYDP RHA
Sbjct  117  RIFSYSDTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPCRHA  176

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E+ P PP  L GKRD+  IEKENNFKQPGE+YRS+  DRQERFI RWV+ALSDPR+THEI
Sbjct  177  ERFPHPPVALNGKRDRICIEKENNFKQPGEKYRSFPPDRQERFIKRWVDALSDPRLTHEI  236

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            RSIW+SYWTQADKSLGQKLASRLN+RPTM
Sbjct  237  RSIWVSYWTQADKSLGQKLASRLNIRPTM  265



>ref|XP_010907090.1| PREDICTED: catalase isozyme 1-like [Elaeis guineensis]
Length=492

 Score =   401 bits (1030),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 182/209 (87%), Positives = 200/209 (96%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPED+LPLQPVGR+VLNKNIDNFFAENEQLAFCPAIVVPG+YYSDDKLLQT
Sbjct  284  FDPLDVTKTWPEDILPLQPVGRMVLNKNIDNFFAENEQLAFCPAIVVPGIYYSDDKLLQT  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIFSY+DTQRHRLGPNYL LP NAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDP RHA
Sbjct  344  RIFSYADTQRHRLGPNYLMLPANAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPVRHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E+ PIP R+LTG+R+KC+I KENNFKQPGERYRSW+ DRQERFICRWVEALSDPRVT+EI
Sbjct  404  ERFPIPFRILTGRREKCVIHKENNFKQPGERYRSWAPDRQERFICRWVEALSDPRVTYEI  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            R+IWISYW+Q D+SLGQK+A+RLNV+P+M
Sbjct  464  RTIWISYWSQCDRSLGQKIATRLNVKPSM  492



>ref|NP_001289779.1| catalase isozyme 1 [Nelumbo nucifera]
 gb|ADY11209.1| catalase [Nelumbo nucifera]
Length=492

 Score =   400 bits (1029),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 183/209 (88%), Positives = 201/209 (96%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDV+KTWPED++PLQPVGRLVLNKNIDNFFAENEQLAFCP IVVPGVYYSDDKLLQT
Sbjct  284  FDPLDVSKTWPEDIIPLQPVGRLVLNKNIDNFFAENEQLAFCPGIVVPGVYYSDDKLLQT  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIFSYSDTQRHRLGPNYL LP NAPKCAHHNNHH+GFMNF+HR+EEVNYFPSRYDP RHA
Sbjct  344  RIFSYSDTQRHRLGPNYLLLPANAPKCAHHNNHHEGFMNFLHREEEVNYFPSRYDPVRHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E++PIPP++ TGKR+KC+IEKENNFKQPGERYRSW+ DRQERFI RW++ALSDPRVTHEI
Sbjct  404  ERYPIPPQICTGKREKCVIEKENNFKQPGERYRSWAPDRQERFIKRWIDALSDPRVTHEI  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            RSIWISYW+QADKSLGQKLASRLNV+P+M
Sbjct  464  RSIWISYWSQADKSLGQKLASRLNVKPSM  492



>ref|XP_002521709.1| catalase, putative [Ricinus communis]
 gb|EEF40696.1| catalase, putative [Ricinus communis]
Length=492

 Score =   400 bits (1028),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 185/209 (89%), Positives = 200/209 (96%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPED++PLQPVGRLVLNKNIDNFFAENEQLAFCP+IVVPGVYYSDDKLLQT
Sbjct  284  FDPLDVTKTWPEDIIPLQPVGRLVLNKNIDNFFAENEQLAFCPSIVVPGVYYSDDKLLQT  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIFSYSDTQRHRLGPNYLQLP NAPKCAHHNNHH+GFMN MHRDEEVNYFPSRYDP RHA
Sbjct  344  RIFSYSDTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNIMHRDEEVNYFPSRYDPARHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            EQHPIPPR+L+GKR+KCII KENNFKQPGERYRS++ DR+ERFI RWVEAL+D R+T+EI
Sbjct  404  EQHPIPPRILSGKREKCIILKENNFKQPGERYRSFTPDRKERFIRRWVEALTDTRITYEI  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            RSIWISYW+QADKSLGQKLAS LN+RPTM
Sbjct  464  RSIWISYWSQADKSLGQKLASHLNMRPTM  492



>sp|P30567.1|CATA2_GOSHI RecName: Full=Catalase isozyme 2 [Gossypium hirsutum]
 emb|CAA39998.1| subunit 2 of cotton catalase [Gossypium hirsutum]
Length=492

 Score =   400 bits (1028),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 182/209 (87%), Positives = 200/209 (96%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPED+ PLQP+GR+VLNKNIDNFFAENEQLAFCP+++VPG+YYSDDKLLQT
Sbjct  284  FDPLDVTKTWPEDIFPLQPMGRMVLNKNIDNFFAENEQLAFCPSLIVPGIYYSDDKLLQT  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIFSYSDTQRHRLGPNYLQLP NAPKCAHHNNHH+GFMNFMHRDEEVNYFPSRYDP RHA
Sbjct  344  RIFSYSDTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E+HPIP  VL+GKR+KCII KENNFKQPGERYRS+S DRQERFI RW++ALSDPRVTHEI
Sbjct  404  EKHPIPSTVLSGKREKCIIGKENNFKQPGERYRSFSADRQERFINRWIDALSDPRVTHEI  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            RSIWISYW+QADKSLGQK+ASRLNVRP++
Sbjct  464  RSIWISYWSQADKSLGQKIASRLNVRPSI  492



>ref|XP_010242894.1| PREDICTED: catalase isozyme 1-like isoform X1 [Nelumbo nucifera]
Length=492

 Score =   399 bits (1026),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 183/209 (88%), Positives = 198/209 (95%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPED++PLQPVGRLVLNKNIDNFFAENEQLAFCP +VVPG+YYSDDKLLQT
Sbjct  284  FDPLDVTKTWPEDIIPLQPVGRLVLNKNIDNFFAENEQLAFCPGVVVPGIYYSDDKLLQT  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIFSYSDTQRHRLGPNYL LP NAPKCAHHNNHHDGFMNF+HRDEEVNYFPSRYDP RHA
Sbjct  344  RIFSYSDTQRHRLGPNYLMLPANAPKCAHHNNHHDGFMNFLHRDEEVNYFPSRYDPVRHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E+ PIPPR+ TGKR+KC+IEKENNFKQPGERYRS+  DRQERFI RW +ALSDPRVTHEI
Sbjct  404  ERFPIPPRICTGKREKCVIEKENNFKQPGERYRSFDPDRQERFIKRWFDALSDPRVTHEI  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            RSIWISYW+QADKSLGQKLA+RLNV+P+M
Sbjct  464  RSIWISYWSQADKSLGQKLATRLNVKPSM  492



>ref|XP_008373403.1| PREDICTED: catalase isozyme 1 [Malus domestica]
Length=492

 Score =   399 bits (1025),  Expect = 6e-134, Method: Compositional matrix adjust.
 Identities = 185/209 (89%), Positives = 199/209 (95%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPED+LPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT
Sbjct  284  FDPLDVTKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIFSYSDTQRHRLGPNYLQLPVNAPKC+HHNNHH+GFMNFMHRDEEVNYFPSRYDP RHA
Sbjct  344  RIFSYSDTQRHRLGPNYLQLPVNAPKCSHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E  PIP  + TGKR+KC+IEKENNFKQPGERYRSW+ DRQERF+ RWV+ALSDPRVT+EI
Sbjct  404  ETFPIPSNICTGKREKCVIEKENNFKQPGERYRSWAPDRQERFLHRWVDALSDPRVTYEI  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            RSIWISYW+QAD+S GQKLASRLNVRP++
Sbjct  464  RSIWISYWSQADRSFGQKLASRLNVRPSI  492



>dbj|BAJ33995.1| unnamed protein product [Thellungiella halophila]
Length=492

 Score =   399 bits (1025),  Expect = 7e-134, Method: Compositional matrix adjust.
 Identities = 181/209 (87%), Positives = 202/209 (97%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPED+LPLQPVGR+VLNKNIDNFFAENEQLAFCPAI+VPG++YSDDKLLQT
Sbjct  284  FDPLDVTKTWPEDILPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQT  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            R+FSY+DTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDP RHA
Sbjct  344  RVFSYADTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPVRHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E++P PP V +GKR++CIIEKENNFK+PGERYRS++ +RQERFI RW+EALSDPR+THEI
Sbjct  404  EKYPTPPAVCSGKRERCIIEKENNFKEPGERYRSFAPERQERFIRRWIEALSDPRITHEI  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            RSIWISYW+QADKSLGQKLASRLNVRP++
Sbjct  464  RSIWISYWSQADKSLGQKLASRLNVRPSI  492



>ref|XP_006412153.1| hypothetical protein EUTSA_v10024932mg [Eutrema salsugineum]
 gb|ESQ53606.1| hypothetical protein EUTSA_v10024932mg [Eutrema salsugineum]
Length=492

 Score =   399 bits (1025),  Expect = 7e-134, Method: Compositional matrix adjust.
 Identities = 181/209 (87%), Positives = 202/209 (97%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPED+LPLQPVGR+VLNKNIDNFFAENEQLAFCPAI+VPG++YSDDKLLQT
Sbjct  284  FDPLDVTKTWPEDILPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQT  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            R+FSY+DTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDP RHA
Sbjct  344  RVFSYADTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPVRHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E++P PP V +GKR++CIIEKENNFK+PGERYRS++ +RQERFI RW+EALSDPR+THEI
Sbjct  404  EKYPTPPAVCSGKRERCIIEKENNFKEPGERYRSFAPERQERFIRRWIEALSDPRITHEI  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            RSIWISYW+QADKSLGQKLASRLNVRP++
Sbjct  464  RSIWISYWSQADKSLGQKLASRLNVRPSI  492



>gb|AIS20825.1| CAT [Pyrus x bretschneideri]
Length=492

 Score =   398 bits (1023),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 184/209 (88%), Positives = 198/209 (95%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTK WPED+LPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT
Sbjct  284  FDPLDVTKIWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIFSYSDTQRHRLGPNYLQLPVNAPKC+HHNNHH+GFMNFMHRDEEVNYFPSRYDP RHA
Sbjct  344  RIFSYSDTQRHRLGPNYLQLPVNAPKCSHHNNHHEGFMNFMHRDEEVNYFPSRYDPARHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E  PIP  + TGKR+KC+IEKENNFKQPGERYRSW+ DRQERF+ RWV+ALSDPRVT+EI
Sbjct  404  ETFPIPSNICTGKREKCVIEKENNFKQPGERYRSWAPDRQERFLHRWVDALSDPRVTYEI  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            RSIWISYW+QAD+S GQKLASRLNVRP++
Sbjct  464  RSIWISYWSQADRSFGQKLASRLNVRPSI  492



>ref|NP_001235974.1| catalase-3 [Glycine max]
 sp|O48560.1|CATA3_SOYBN RecName: Full=Catalase-3 [Glycine max]
 gb|AAB88171.1| catalase [Glycine max]
 gb|KHN12602.1| Catalase-3 [Glycine soja]
Length=492

 Score =   398 bits (1023),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 181/209 (87%), Positives = 200/209 (96%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPED+LPLQPVGR+VLNKNIDNFFAENEQLAFCPAI+VPGVYYSDDKLLQT
Sbjct  284  FDPLDVTKTWPEDVLPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGVYYSDDKLLQT  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIFSY+DTQRHRLGPNYLQLP N+PKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDP RHA
Sbjct  344  RIFSYADTQRHRLGPNYLQLPANSPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPVRHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E+ P+PPR L GKR+KC+IEKENNFKQPGERYRSW +DRQERF+ RWV+ALSDPRVTHEI
Sbjct  404  ERVPVPPRTLGGKREKCMIEKENNFKQPGERYRSWPSDRQERFVRRWVDALSDPRVTHEI  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            RSIWISYW+QAD+SLGQK+AS LN++P++
Sbjct  464  RSIWISYWSQADRSLGQKIASHLNLKPSI  492



>ref|XP_008365915.1| PREDICTED: catalase isozyme 1 [Malus domestica]
Length=492

 Score =   398 bits (1023),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 184/209 (88%), Positives = 198/209 (95%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPED+LPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT
Sbjct  284  FDPLDVTKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIFSYSDTQRHRLGPNYLQLPVNAPKC+HHNNHH+GFMNFMHRDEEVNYFPSRYDP RHA
Sbjct  344  RIFSYSDTQRHRLGPNYLQLPVNAPKCSHHNNHHEGFMNFMHRDEEVNYFPSRYDPARHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E  PIP  + TGKR+KC+IEKENNFKQPGERYRSW+ DRQERF+ RWV+ LS+PRVTHEI
Sbjct  404  ETFPIPSNICTGKREKCVIEKENNFKQPGERYRSWAPDRQERFLHRWVDVLSEPRVTHEI  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            RSIWISYW+QAD+S GQKLASRLNVRP++
Sbjct  464  RSIWISYWSQADRSFGQKLASRLNVRPSI  492



>ref|XP_008348924.1| PREDICTED: catalase isozyme 1 [Malus domestica]
Length=492

 Score =   398 bits (1023),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 184/209 (88%), Positives = 198/209 (95%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPED+LPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT
Sbjct  284  FDPLDVTKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIFSYSDTQRHRLGPNYLQLPVNAPKC+HHNNHH+GFMNFMHRDEEVNYFPSRYDP RHA
Sbjct  344  RIFSYSDTQRHRLGPNYLQLPVNAPKCSHHNNHHEGFMNFMHRDEEVNYFPSRYDPARHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E  PIP  + TGKR+KC+IEKENNFKQPGERYRSW+ DRQERF+ RWV+ LS+PRVTHEI
Sbjct  404  ETFPIPSNICTGKREKCVIEKENNFKQPGERYRSWAPDRQERFLHRWVDVLSEPRVTHEI  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            RSIWISYW+QAD+S GQKLASRLNVRP++
Sbjct  464  RSIWISYWSQADRSFGQKLASRLNVRPSI  492



>gb|AHA50082.1| catalase [Eleutherococcus senticosus]
Length=492

 Score =   398 bits (1022),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 183/209 (88%), Positives = 201/209 (96%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPED+LPLQPVGRLVLNKNIDNFFAENEQLAFCPAI+VPGVYYSDDKLLQT
Sbjct  284  FDPLDVTKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIIVPGVYYSDDKLLQT  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIFSY+DTQRHRLGPNYLQLP NAPKCAHHNNHH+G MNFMHRDEEVNYFPSR+DP RHA
Sbjct  344  RIFSYADTQRHRLGPNYLQLPANAPKCAHHNNHHEGLMNFMHRDEEVNYFPSRFDPVRHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E+HP+PP +LTG+RD+C+++KENNFKQPGERYRS+STDRQERFI R V+ALSDPRVTHEI
Sbjct  404  ERHPLPPPMLTGRRDRCMVQKENNFKQPGERYRSFSTDRQERFISRLVDALSDPRVTHEI  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            RSIWISYWTQA KSLGQKLASRLNV+P++
Sbjct  464  RSIWISYWTQACKSLGQKLASRLNVKPSI  492



>gb|AAF71742.1|AF248491_1 catalase [Raphanus sativus]
Length=492

 Score =   398 bits (1022),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 180/209 (86%), Positives = 202/209 (97%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPEDLLPLQPVGR+VLNKNIDNFFAENEQLAFCPAI+VPG++YSDDKLLQT
Sbjct  284  FDPLDVTKTWPEDLLPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQT  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            R+FSY+DTQRHRLGPNYLQLPVNAPKCAHHNNHH+GFMNFMHRDEEVNYFPSRYDP RHA
Sbjct  344  RVFSYADTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E++P PP V +GKR++CIIEKENNFK+PGERYRS++ +RQERFI RW++ALSDPR+THEI
Sbjct  404  EKYPTPPAVCSGKRERCIIEKENNFKEPGERYRSFTPERQERFIGRWIDALSDPRITHEI  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            RSIWISYW+QADKSLGQKLASRLNVRP++
Sbjct  464  RSIWISYWSQADKSLGQKLASRLNVRPSI  492



>ref|XP_002867092.1| hypothetical protein ARALYDRAFT_491144 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43351.1| hypothetical protein ARALYDRAFT_491144 [Arabidopsis lyrata subsp. 
lyrata]
Length=492

 Score =   398 bits (1022),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 180/209 (86%), Positives = 202/209 (97%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPED+LPLQPVGR+VLNKNIDNFFAENEQLAFCPAI+VPG++YSDDKLLQT
Sbjct  284  FDPLDVTKTWPEDILPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQT  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            R+FSY+DTQRHRLGPNYLQLPVNAPKCAHHNNHH+GFMNFMHRDEEVNYFPSRYDP RHA
Sbjct  344  RVFSYADTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E++P PP V +GKR++CIIEKENNFK+PGERYRS++ +RQERFI RW+EALSDPR+THEI
Sbjct  404  EKYPTPPAVCSGKRERCIIEKENNFKEPGERYRSFTPERQERFIQRWIEALSDPRITHEI  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            RSIWISYW+QADKSLGQKLASRLNVRP++
Sbjct  464  RSIWISYWSQADKSLGQKLASRLNVRPSI  492



>gb|AAB86582.2| catalase [Raphanus sativus]
Length=491

 Score =   398 bits (1022),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 180/209 (86%), Positives = 202/209 (97%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPEDLLPLQPVGR+VLNKNIDNFFAENEQLAFCPAI+VPG++YSDDKLLQT
Sbjct  283  FDPLDVTKTWPEDLLPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQT  342

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            R+FSY+DTQRHRLGPNYLQLPVNAPKCAHHNNHH+GFMNFMHRDEEVNYFPSRYDP RHA
Sbjct  343  RVFSYADTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHA  402

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E++P PP V +GKR++CIIEKENNFK+PGERYRS++ +RQERFI RW++ALSDPR+THEI
Sbjct  403  EKYPTPPAVCSGKRERCIIEKENNFKEPGERYRSFTPERQERFIGRWIDALSDPRITHEI  462

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            RSIWISYW+QADKSLGQKLASRLNVRP++
Sbjct  463  RSIWISYWSQADKSLGQKLASRLNVRPSI  491



>gb|ACV92695.1| catalase [Brassica oleracea]
Length=492

 Score =   398 bits (1022),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 179/209 (86%), Positives = 202/209 (97%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPEDLLPLQPVGR+VLNKNIDNFFAENEQLAFCPAI+VPG++YSDDKLLQT
Sbjct  284  FDPLDVTKTWPEDLLPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQT  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            R+FSY+DTQRHRLGPNYLQLPVNAPKCAHHNNHH+GFMNFMHRDEEVNYFPSRYDP RHA
Sbjct  344  RVFSYADTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E++P PP V +GKR++C+IEKENNFK+PGERYRS++ +RQERFI RW++ALSDPR+THEI
Sbjct  404  EKYPTPPAVCSGKRERCVIEKENNFKEPGERYRSFTPERQERFIGRWIDALSDPRITHEI  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            RSIWISYW+QADKSLGQKLASRLNVRP++
Sbjct  464  RSIWISYWSQADKSLGQKLASRLNVRPSI  492



>gb|AHF27428.1| catalase, partial [Cucurbita moschata]
 gb|AHF27431.1| catalase, partial [Cucurbita maxima]
Length=344

 Score =   392 bits (1007),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 180/209 (86%), Positives = 199/209 (95%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPED+LPLQPVGR+VLNKNIDNFFAENEQLAFCPAI+VPGVYYSDDKLLQT
Sbjct  136  FDPLDVTKTWPEDILPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGVYYSDDKLLQT  195

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIFSY+DTQRHRLGPNYLQLP NAPKCAHHNNHH+GFMNFMHRDEEVNYFPSR+DP RHA
Sbjct  196  RIFSYADTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPSRHA  255

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E++P PP V +GKR++CIIEKENNFK+PGERYRSW+ DRQERF+ RWV+ALSD RVTHEI
Sbjct  256  ERYPHPPAVCSGKRERCIIEKENNFKEPGERYRSWTPDRQERFVRRWVDALSDTRVTHEI  315

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            RSIWISYW+QAD+SLGQKLAS LNVRP++
Sbjct  316  RSIWISYWSQADRSLGQKLASHLNVRPSI  344



>emb|CDP01803.1| unnamed protein product [Coffea canephora]
Length=492

 Score =   397 bits (1020),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 183/209 (88%), Positives = 199/209 (95%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPED+LPLQPVGRLVLN+NIDNFF ENEQLAFCPAIVVPG++YSDDKLLQT
Sbjct  284  FDPLDVTKTWPEDILPLQPVGRLVLNRNIDNFFNENEQLAFCPAIVVPGIHYSDDKLLQT  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIFSY+DTQRHRLGPNYLQLP NAPKCAHHNNHHDGFMNFMHRDEEV+YFPSRYDP RHA
Sbjct  344  RIFSYADTQRHRLGPNYLQLPANAPKCAHHNNHHDGFMNFMHRDEEVDYFPSRYDPVRHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E HPIP  VLTG+R+K II KENNFKQPGERYRS++ DRQERFICRWV+ALSDPRVT+EI
Sbjct  404  EMHPIPSAVLTGRREKTIIPKENNFKQPGERYRSFAPDRQERFICRWVDALSDPRVTYEI  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            RSIWISYW+QADKSLGQKLASRLN+RP++
Sbjct  464  RSIWISYWSQADKSLGQKLASRLNIRPSI  492



>gb|ACA50528.1| putative catalase 2 [Brassica napus]
Length=492

 Score =   397 bits (1020),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 181/207 (87%), Positives = 199/207 (96%), Gaps = 0/207 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPED+LPLQPVGR+VLNKNIDNFFAENEQLAFCPAI+VPG++YSDDKLLQT
Sbjct  284  FDPLDVTKTWPEDILPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQT  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            R+FSY+DTQRHRLGPNYLQLPVNAPKCAHHNNHH+GFMNFMHRDEEVNYFPSRYDP RHA
Sbjct  344  RVFSYADTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E++P PP V +GKR++CIIEKENNF+QPGERYRSW  DRQERF+ R+VEAL++PRVTHEI
Sbjct  404  EKYPTPPAVCSGKRERCIIEKENNFQQPGERYRSWDADRQERFVKRFVEALAEPRVTHEI  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRP  124
            RSIWISYWTQADKSLGQKLASRLNVRP
Sbjct  464  RSIWISYWTQADKSLGQKLASRLNVRP  490



>gb|KJB17473.1| hypothetical protein B456_003G002800 [Gossypium raimondii]
Length=492

 Score =   397 bits (1020),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 181/209 (87%), Positives = 198/209 (95%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPED+ PLQPVGR+VLNKNIDNFFAENEQLAFCP+++VPG+YYSDDKLLQT
Sbjct  284  FDPLDVTKTWPEDIFPLQPVGRMVLNKNIDNFFAENEQLAFCPSLIVPGIYYSDDKLLQT  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIFSYSDTQRHRLGPNYLQLP NAPKCAHHNNHH+GFMNFMHRDEEVNYFPSRYDP RHA
Sbjct  344  RIFSYSDTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E+HPIP  V +GKR+KCII KENNFKQPGERYRS+S DRQERFI RW++ALSD RVTHEI
Sbjct  404  EKHPIPSTVYSGKREKCIIGKENNFKQPGERYRSFSADRQERFINRWIDALSDSRVTHEI  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            RSIWISYW+QADKSLGQK+ASRLNVRP++
Sbjct  464  RSIWISYWSQADKSLGQKIASRLNVRPSI  492



>gb|AAO17721.1| catalase [Hypericum perforatum]
Length=492

 Score =   397 bits (1019),  Expect = 6e-133, Method: Compositional matrix adjust.
 Identities = 183/209 (88%), Positives = 198/209 (95%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPED+LPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPG+YYSDDKLLQT
Sbjct  284  FDPLDVTKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGIYYSDDKLLQT  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIFSYSDTQRHRLGPNYLQLPVNAPK AHHNNHH+GFMNFMHRDEEVNYFPSRYDP RHA
Sbjct  344  RIFSYSDTQRHRLGPNYLQLPVNAPKSAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E++PIPP VL G+R+KC+I KENNFKQPGERYRS+S DRQERF+ RW+ +LSDPRVTHEI
Sbjct  404  EKYPIPPVVLNGRREKCMIAKENNFKQPGERYRSFSPDRQERFLNRWISSLSDPRVTHEI  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            R+IW++YW QADKSLGQKLASRLNVRP M
Sbjct  464  RAIWVTYWYQADKSLGQKLASRLNVRPNM  492



>ref|XP_009138342.1| PREDICTED: catalase-2 [Brassica rapa]
 gb|AAD17934.1| catalase [Brassica juncea]
Length=492

 Score =   396 bits (1018),  Expect = 7e-133, Method: Compositional matrix adjust.
 Identities = 179/209 (86%), Positives = 201/209 (96%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPED+LPLQPVGR+VLNKNIDNFFAENEQLAFCPAI+VPG++YSDDKLLQT
Sbjct  284  FDPLDVTKTWPEDILPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQT  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            R+FSY+DTQRHRLGPNYLQLPVNAPKCAHHNNHH+GFMNFMHRDEEVNYFPSRYDP RHA
Sbjct  344  RVFSYADTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E++P PP V +GKR++CIIEKENNFK+PGERYRS++ +RQERFI RW++ALSDPR+THEI
Sbjct  404  EKYPTPPAVCSGKRERCIIEKENNFKEPGERYRSFTPERQERFIGRWIDALSDPRITHEI  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            RSIWISYW+QADKSLGQKLASRLNVRP +
Sbjct  464  RSIWISYWSQADKSLGQKLASRLNVRPNI  492



>emb|CDX76313.1| BnaA08g10870D [Brassica napus]
Length=477

 Score =   396 bits (1017),  Expect = 7e-133, Method: Compositional matrix adjust.
 Identities = 178/209 (85%), Positives = 202/209 (97%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPE+LLPLQPVGR+VLNKNIDNFFAENEQLAFCPAI+VPG++YSDDKLLQT
Sbjct  269  FDPLDVTKTWPENLLPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQT  328

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            R+FSY+DTQRHRLGPNYLQLPVNAPKCAHHNNHH+GFMNFMHRDEEVNYFPSRYDP RHA
Sbjct  329  RVFSYADTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHA  388

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E++P PP V +GKR++C+IEKENNFK+PGERYRS++ +RQERFI RW+EALSDPR+THEI
Sbjct  389  EKYPTPPAVCSGKRERCVIEKENNFKEPGERYRSFTPERQERFIRRWIEALSDPRITHEI  448

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            RSIWISYW+QADK+LGQKLASRLNVRP++
Sbjct  449  RSIWISYWSQADKTLGQKLASRLNVRPSI  477



>gb|EYU36566.1| hypothetical protein MIMGU_mgv1a005245mg [Erythranthe guttata]
Length=492

 Score =   396 bits (1018),  Expect = 7e-133, Method: Compositional matrix adjust.
 Identities = 184/209 (88%), Positives = 199/209 (95%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPED+LPLQPVGRLVLN+NIDNFFAENEQLAFCPA++VPGV+YSDDKLLQT
Sbjct  284  FDPLDVTKTWPEDILPLQPVGRLVLNRNIDNFFAENEQLAFCPALIVPGVHYSDDKLLQT  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIFSY+DTQRHRLGPNYLQLPVNAPK  HHNNHH+GFMNFMHRDEEVNYFPSRYDP RHA
Sbjct  344  RIFSYADTQRHRLGPNYLQLPVNAPKNGHHNNHHEGFMNFMHRDEEVNYFPSRYDPCRHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E+HPIPP VL+GKRD+  IEKENNFK+PG R+RSW+TDRQERFI RWV+ALSDPR+THEI
Sbjct  404  ERHPIPPVVLSGKRDRICIEKENNFKEPGVRFRSWATDRQERFIRRWVDALSDPRLTHEI  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            R IWISYWTQADKSLGQKLASRLNVRPTM
Sbjct  464  RGIWISYWTQADKSLGQKLASRLNVRPTM  492



>ref|XP_010918244.1| PREDICTED: catalase isozyme 1 [Elaeis guineensis]
Length=492

 Score =   396 bits (1018),  Expect = 8e-133, Method: Compositional matrix adjust.
 Identities = 182/209 (87%), Positives = 197/209 (94%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPED+LPLQPVGR+VLNKNIDNFFAENEQLAFCPAIVVPG+YYSDDKLLQT
Sbjct  284  FDPLDVTKTWPEDILPLQPVGRMVLNKNIDNFFAENEQLAFCPAIVVPGIYYSDDKLLQT  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIFSY+DTQRHRLGPNYL LP NAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDP RHA
Sbjct  344  RIFSYADTQRHRLGPNYLMLPANAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPVRHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E+ PIP R+LTG+R+KC+I KENNFKQPGERYRSW  +RQERFI RWVEALSDPRVTHEI
Sbjct  404  ERFPIPSRILTGRREKCVIHKENNFKQPGERYRSWDPNRQERFIRRWVEALSDPRVTHEI  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            +SIWISYW+Q DKSLGQK+A+RLNV+P M
Sbjct  464  QSIWISYWSQCDKSLGQKIATRLNVKPCM  492



>dbj|BAQ21275.1| catalase [Citrus tamurana]
Length=476

 Score =   395 bits (1016),  Expect = 9e-133, Method: Compositional matrix adjust.
 Identities = 180/209 (86%), Positives = 197/209 (94%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPED+LPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPG+YYS+DKLLQT
Sbjct  268  FDPLDVTKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGIYYSNDKLLQT  327

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIFSY+DTQRHRLGPNYLQLPVNAPKCAHHNNH+DGFMNFMHRDEE++YFPSRYDP RHA
Sbjct  328  RIFSYADTQRHRLGPNYLQLPVNAPKCAHHNNHYDGFMNFMHRDEEIDYFPSRYDPVRHA  387

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E HP PP +  G+R+KCII KENNFKQPGERYRSW+ DRQERF+CRWV+ALSDPRVTHEI
Sbjct  388  EMHPTPPEICGGRREKCIIPKENNFKQPGERYRSWAPDRQERFVCRWVDALSDPRVTHEI  447

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            R IWISYW+QA KSLGQKL +RLNVRP++
Sbjct  448  RHIWISYWSQACKSLGQKLTARLNVRPSI  476



>ref|XP_010536470.1| PREDICTED: catalase-2-like [Tarenaya hassleriana]
Length=492

 Score =   396 bits (1018),  Expect = 9e-133, Method: Compositional matrix adjust.
 Identities = 183/209 (88%), Positives = 197/209 (94%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPED+LPLQPVGRLVLNKNIDNFFAENEQ+AFCPA+VVPGVYYSDDKLLQT
Sbjct  284  FDPLDVTKTWPEDILPLQPVGRLVLNKNIDNFFAENEQVAFCPALVVPGVYYSDDKLLQT  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIFSY+DTQRHRLGPNYLQLPVNAPKC HHNNHHDGFMNFMHRDEEVNYFPSR+DP RHA
Sbjct  344  RIFSYADTQRHRLGPNYLQLPVNAPKCVHHNNHHDGFMNFMHRDEEVNYFPSRFDPVRHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E+ P PP + +G+R+KCIIEKENNFKQPGERYRSW+ DRQERF+ RWVEALSD R THEI
Sbjct  404  ERFPSPPAICSGRREKCIIEKENNFKQPGERYRSWAPDRQERFLKRWVEALSDKRCTHEI  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            RSIWISYW+QADKSLGQKLASRLNVRP+ 
Sbjct  464  RSIWISYWSQADKSLGQKLASRLNVRPSF  492



>emb|CDY40645.1| BnaA03g53180D [Brassica napus]
Length=485

 Score =   396 bits (1017),  Expect = 9e-133, Method: Compositional matrix adjust.
 Identities = 179/209 (86%), Positives = 201/209 (96%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPED+LPLQPVGR+VLNKNIDNFFAENEQLAFCPAI+VPG++YSDDKLLQT
Sbjct  277  FDPLDVTKTWPEDILPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQT  336

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            R+FSY+DTQRHRLGPNYLQLPVNAPKCAHHNNHH+GFMNFMHRDEEVNYFPSRYDP RHA
Sbjct  337  RVFSYADTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHA  396

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E++P PP V +GKR++CIIEKENNFK+PGERYRS++ +RQERFI RW++ALSDPR+THEI
Sbjct  397  EKYPTPPAVCSGKRERCIIEKENNFKEPGERYRSFTPERQERFIGRWIDALSDPRITHEI  456

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            RSIWISYW+QADKSLGQKLASRLNVRP +
Sbjct  457  RSIWISYWSQADKSLGQKLASRLNVRPNI  485



>ref|XP_010446982.1| PREDICTED: catalase-2-like [Camelina sativa]
Length=492

 Score =   396 bits (1017),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 178/209 (85%), Positives = 200/209 (96%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPED+LPLQPVGR+VLNKNIDNFFAENEQLAFCPAI+VPG++YSDDKLLQT
Sbjct  284  FDPLDVTKTWPEDILPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQT  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            R+FSY+DTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDP RHA
Sbjct  344  RVFSYADTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPVRHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E++P PP V +G R++C+I KENNFK+PGERYRS+  +RQERFICRW++ALSDPR+THEI
Sbjct  404  EKYPAPPAVCSGTRERCVIAKENNFKEPGERYRSFPPERQERFICRWIDALSDPRITHEI  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            RSIWISYW+QADKSLGQKLASRLNVRP++
Sbjct  464  RSIWISYWSQADKSLGQKLASRLNVRPSI  492



>gb|ADC95629.1| catalase [Bruguiera gymnorhiza]
Length=492

 Score =   396 bits (1017),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 184/209 (88%), Positives = 196/209 (94%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPED+LPLQPVGRLVLNKNIDNFFAENEQLAFCPAI+VPG+YYSDDKLLQT
Sbjct  284  FDPLDVTKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIIVPGIYYSDDKLLQT  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIFSY+DTQRHRLGPNYLQLP NAPKCAHHNNHHDGFMNFMHRDEEVNY PSR+DP RHA
Sbjct  344  RIFSYADTQRHRLGPNYLQLPANAPKCAHHNNHHDGFMNFMHRDEEVNYLPSRFDPVRHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E+ PIPP V TG+R+KCIIEKENNFKQPGERYRSW+ DRQERF  RWVEALSDPRVTHEI
Sbjct  404  ERFPIPPAVCTGRREKCIIEKENNFKQPGERYRSWAPDRQERFTHRWVEALSDPRVTHEI  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
             SIWISYWTQ DK LGQKLA+RLNVRP++
Sbjct  464  CSIWISYWTQCDKFLGQKLATRLNVRPSI  492



>emb|CAB56850.1| catalase [Prunus persica]
Length=423

 Score =   393 bits (1010),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 181/209 (87%), Positives = 200/209 (96%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLD+TKTWPED+LPLQPVGRLVLNKNIDNFFAENEQLAF PA VVPG+YYSDDK+LQT
Sbjct  215  FDPLDLTKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFNPAHVVPGIYYSDDKMLQT  274

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIF+YSDTQRHRLGPNYLQLPVNAPKC HHNNHH+GFMNFMHRDEEVNYFPSR+DP RHA
Sbjct  275  RIFAYSDTQRHRLGPNYLQLPVNAPKCPHHNNHHEGFMNFMHRDEEVNYFPSRHDPVRHA  334

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E++PIP  +L+GKR+KC+IEKENNFKQPGERYRSW+ DRQERFI RWV+ALSDPRVTHEI
Sbjct  335  ERYPIPSNILSGKREKCVIEKENNFKQPGERYRSWAPDRQERFIHRWVDALSDPRVTHEI  394

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            RS+WISYW+QADKSLGQKLASRLNVRP++
Sbjct  395  RSVWISYWSQADKSLGQKLASRLNVRPSI  423



>ref|XP_008802866.1| PREDICTED: catalase isozyme 1 [Phoenix dactylifera]
Length=492

 Score =   396 bits (1017),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 180/209 (86%), Positives = 197/209 (94%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPED+LPLQPVGR++LNKNIDNFF+ENEQLAFCPAIVVPG+YYSDDKLLQT
Sbjct  284  FDPLDVTKTWPEDILPLQPVGRMILNKNIDNFFSENEQLAFCPAIVVPGIYYSDDKLLQT  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIFSY+DTQRHRLGPNYL LP NAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDP RHA
Sbjct  344  RIFSYADTQRHRLGPNYLMLPANAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPVRHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E  PIP  VLTG+R+KC+I KENNFKQPGERYRSW+ DRQ RFICRWVEALSDPRVT+EI
Sbjct  404  ETFPIPSCVLTGRREKCVIHKENNFKQPGERYRSWAPDRQGRFICRWVEALSDPRVTYEI  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            RSIWISYW+Q D+SLGQK+A+RLNV+P+M
Sbjct  464  RSIWISYWSQCDRSLGQKIATRLNVKPSM  492



>ref|XP_006283612.1| hypothetical protein CARUB_v10004668mg [Capsella rubella]
 gb|EOA16510.1| hypothetical protein CARUB_v10004668mg [Capsella rubella]
Length=492

 Score =   395 bits (1016),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 179/209 (86%), Positives = 201/209 (96%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPED+LPLQPVGR+VLNKNIDNFFAENEQLAFCPAI+VPG++YSDDKLLQT
Sbjct  284  FDPLDVTKTWPEDILPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQT  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            R+FSY+DTQRHRLGPNYLQLPVNAPKCAHHNNHH+GFMNFMHRDEEVNYFPSRYDP RHA
Sbjct  344  RVFSYADTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E++P PP V +GKR++C+IEKENNFK+PGERYRS+  +RQERFI RW+EALSDPR+THEI
Sbjct  404  EKYPTPPAVCSGKRERCVIEKENNFKEPGERYRSFPPERQERFIRRWIEALSDPRITHEI  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            RSIWISYW+QADKSLGQKLASRLNVRP++
Sbjct  464  RSIWISYWSQADKSLGQKLASRLNVRPSI  492



>gb|AAD17935.1| catalase [Brassica juncea]
Length=492

 Score =   395 bits (1016),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 178/209 (85%), Positives = 202/209 (97%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPE+LLPLQPVGR+VLNKNIDNFFAENEQLAFCPAI+VPG++YSDDKLLQT
Sbjct  284  FDPLDVTKTWPENLLPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQT  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            R+FSY+DTQRHRLGPNYLQLPVNAPKCAHHNNHH+GFMNFMHRDEEVNYFPSRYDP RHA
Sbjct  344  RVFSYADTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E++P PP V +GKR++C+IEKENNFK+PGERYRS++ +RQERFI RW+EALSDPR+THEI
Sbjct  404  EKYPTPPAVCSGKRERCVIEKENNFKEPGERYRSFTPERQERFIRRWIEALSDPRITHEI  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            RSIWISYW+QADK+LGQKLASRLNVRP++
Sbjct  464  RSIWISYWSQADKTLGQKLASRLNVRPSI  492



>gb|KGN55499.1| hypothetical protein Csa_4G658590 [Cucumis sativus]
Length=492

 Score =   395 bits (1015),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 180/209 (86%), Positives = 200/209 (96%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPED+LPLQPVGR+VLNKNIDNFFAENEQLAFCPAI+VPG+YYSDDKLLQT
Sbjct  284  FDPLDVTKTWPEDILPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIYYSDDKLLQT  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIFSYSDTQRHRLGPNYLQLP NAPKCAHHNNHH+GFMNFMHRDEEVNYFPSRYDP RHA
Sbjct  344  RIFSYSDTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPARHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E++P PP V TGKR++C+I+KENNFK+PGERYRSW+ DRQERFI RWV+ALSDPRVTHEI
Sbjct  404  ERYPHPPAVCTGKRERCVIQKENNFKEPGERYRSWTPDRQERFIRRWVDALSDPRVTHEI  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            RSIWI+YW+QAD+S+GQKLAS LNVRP++
Sbjct  464  RSIWITYWSQADRSVGQKLASHLNVRPSI  492



>ref|XP_002306976.2| catalase family protein [Populus trichocarpa]
 gb|EEE93972.2| catalase family protein [Populus trichocarpa]
Length=492

 Score =   395 bits (1015),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 182/209 (87%), Positives = 199/209 (95%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTK WPED+LPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPG+YYSDDKLLQT
Sbjct  284  FDPLDVTKIWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGIYYSDDKLLQT  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIFSY+DTQRHRLGPNYLQLPVNAPKCAHHNNHH+GFMNFMHRDEEVNYFPSR+DP RHA
Sbjct  344  RIFSYADTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRHDPSRHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E+ PIP  V +G+R+KCIIEKENNFKQPGERYRSW+ DRQERF+ RWV+ALS+PRVTHE+
Sbjct  404  ERFPIPSAVCSGRREKCIIEKENNFKQPGERYRSWAPDRQERFVRRWVDALSEPRVTHEV  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            RSIWISYW+QADKSLGQKLAS LNVRP++
Sbjct  464  RSIWISYWSQADKSLGQKLASHLNVRPSV  492



>ref|XP_006435363.1| hypothetical protein CICLE_v10000951mg [Citrus clementina]
 gb|ESR48603.1| hypothetical protein CICLE_v10000951mg [Citrus clementina]
 gb|KDO85096.1| hypothetical protein CISIN_1g042356mg [Citrus sinensis]
Length=492

 Score =   395 bits (1015),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 182/209 (87%), Positives = 196/209 (94%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPED+LPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPG+YYS+DKLLQT
Sbjct  284  FDPLDVTKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGIYYSNDKLLQT  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIFSY+DTQRHRLGPNYLQLPVNAPKCA HNNH+DGFMNFMHRDEE++YFPSRYDP RHA
Sbjct  344  RIFSYADTQRHRLGPNYLQLPVNAPKCAQHNNHYDGFMNFMHRDEEIDYFPSRYDPVRHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E HP PP +  G+R+KCII KENNFKQPGERYRSW+ DRQERFICRWV+ALSDPRVTHEI
Sbjct  404  EMHPTPPEICGGRREKCIIPKENNFKQPGERYRSWAPDRQERFICRWVDALSDPRVTHEI  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            R IWISYW+QA KSLGQKLASRLNVRP +
Sbjct  464  RHIWISYWSQACKSLGQKLASRLNVRPNI  492



>gb|AAC19397.1| leaf catalase [Mesembryanthemum crystallinum]
Length=492

 Score =   395 bits (1015),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 183/209 (88%), Positives = 197/209 (94%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPED+LPLQPVGRLVLNKNIDNFFAENEQLAFCP IVVPGVYYSDDKLLQT
Sbjct  284  FDPLDVTKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPGIVVPGVYYSDDKLLQT  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIFSY+DTQRHRLGPNYLQLPVNAPKCAHHNNH+DG MNFMHRD+EV+YFPSRYDP RHA
Sbjct  344  RIFSYADTQRHRLGPNYLQLPVNAPKCAHHNNHYDGQMNFMHRDDEVDYFPSRYDPVRHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E++PIPP VL G RD+ II+KENNFKQPGERYRSW   RQERFICRWV+ALSDPR+THEI
Sbjct  404  ERYPIPPNVLNGNRDRQIIQKENNFKQPGERYRSWDPARQERFICRWVDALSDPRITHEI  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            R+IWISYW+QADKS+G KLASRLNVRPTM
Sbjct  464  RNIWISYWSQADKSVGMKLASRLNVRPTM  492



>ref|XP_008237989.1| PREDICTED: catalase isozyme 1-like [Prunus mume]
Length=492

 Score =   395 bits (1015),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 184/209 (88%), Positives = 199/209 (95%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLD+TKTWPED+LPLQPVGRLVLNKNIDNFFAENEQLAF PA VVPGVYYSDDK+LQT
Sbjct  284  FDPLDLTKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFNPAHVVPGVYYSDDKMLQT  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIF+YSDTQRHRLGPNYLQLPVNAPKC HHNNHH+GFMNFMHRDEEVNYFPSRYDP RHA
Sbjct  344  RIFAYSDTQRHRLGPNYLQLPVNAPKCPHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E++PIP  +L GKR+KC+IEKENNFKQPGERYRSW+ DRQERFI RWV+ALSDPRVTHEI
Sbjct  404  ERYPIPSNILYGKREKCVIEKENNFKQPGERYRSWAPDRQERFIRRWVDALSDPRVTHEI  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            RSIWISYW+QADKSLGQKLASRLNVRP++
Sbjct  464  RSIWISYWSQADKSLGQKLASRLNVRPSI  492



>ref|XP_006473794.1| PREDICTED: catalase isozyme 1-like isoform X4 [Citrus sinensis]
Length=492

 Score =   395 bits (1015),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 182/209 (87%), Positives = 196/209 (94%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPED+LPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPG+YYS+DKLLQT
Sbjct  284  FDPLDVTKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGIYYSNDKLLQT  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIFSY+DTQRHRLGPNYLQLPVNAPKCA HNNH+DGFMNFMHRDEE++YFPSRYDP RHA
Sbjct  344  RIFSYADTQRHRLGPNYLQLPVNAPKCAQHNNHYDGFMNFMHRDEEIDYFPSRYDPVRHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E HP PP +  G+R+KCII KENNFKQPGERYRSW+ DRQERFICRWV+ALSDPRVTHEI
Sbjct  404  EMHPTPPEICGGRREKCIIPKENNFKQPGERYRSWAPDRQERFICRWVDALSDPRVTHEI  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            R IWISYW+QA KSLGQKLASRLNVRP +
Sbjct  464  RHIWISYWSQACKSLGQKLASRLNVRPNI  492



>ref|XP_010437527.1| PREDICTED: catalase-2 [Camelina sativa]
Length=492

 Score =   395 bits (1015),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 178/209 (85%), Positives = 200/209 (96%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPED+LPLQPVGR+VLNKNIDNFFAENEQLAFCPAI+VPG++YSDDKLLQT
Sbjct  284  FDPLDVTKTWPEDILPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQT  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            R+FSY+DTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYD  RHA
Sbjct  344  RVFSYADTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDQVRHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E++P PP V +GKR++C+I KENNFK+PGERYRS+  +RQERFICRW++ALSDPR+THEI
Sbjct  404  EKYPAPPAVCSGKRERCVIAKENNFKEPGERYRSFPPERQERFICRWIDALSDPRITHEI  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            RSIWISYW+QADKSLGQKLASRLNVRP++
Sbjct  464  RSIWISYWSQADKSLGQKLASRLNVRPSI  492



>ref|XP_010061175.1| PREDICTED: catalase-like [Eucalyptus grandis]
Length=492

 Score =   395 bits (1015),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 184/209 (88%), Positives = 196/209 (94%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTK WPED++PLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQ+
Sbjct  284  FDPLDVTKIWPEDIVPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQS  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIFSY+DTQRHRLGPNYLQLPVNAPKC HHNNHH+G MNFMHRDEEVNYFPSR+D  RHA
Sbjct  344  RIFSYADTQRHRLGPNYLQLPVNAPKCTHHNNHHEGLMNFMHRDEEVNYFPSRFDSVRHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E+ PIPP VL GKRD+C+IEKENNFKQPGERYRSW+ DRQERFI RWVEALSDPRVT EI
Sbjct  404  EKFPIPPPVLNGKRDRCMIEKENNFKQPGERYRSWAPDRQERFIGRWVEALSDPRVTQEI  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            RSIWISYWTQADKSLGQK+AS LNVRP+M
Sbjct  464  RSIWISYWTQADKSLGQKIASCLNVRPSM  492



>ref|XP_010432341.1| PREDICTED: catalase-2-like [Camelina sativa]
Length=492

 Score =   395 bits (1014),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 178/209 (85%), Positives = 200/209 (96%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPED+LPLQPVGR+VLNKNIDNFFAENEQLAFCPAI+VPG++YSDDKLLQT
Sbjct  284  FDPLDVTKTWPEDILPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQT  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            R+FSY+DTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYD  RHA
Sbjct  344  RVFSYADTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDQVRHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E++P PP V +GKR++C+I KENNFK+PGERYRS+  +RQERFICRW++ALSDPR+THEI
Sbjct  404  EKYPAPPAVCSGKRERCVIAKENNFKEPGERYRSFPPERQERFICRWIDALSDPRITHEI  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            RSIWISYW+QADKSLGQKLASRLNVRP++
Sbjct  464  RSIWISYWSQADKSLGQKLASRLNVRPSI  492



>gb|AIA61608.1| catalase [Gynostemma pentaphyllum]
Length=492

 Score =   395 bits (1014),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 181/209 (87%), Positives = 199/209 (95%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPED+LPLQPVGRLVLNKNIDNFFAENEQLAFCPAI+VPGVYYSDDKLLQT
Sbjct  284  FDPLDVTKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIIVPGVYYSDDKLLQT  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            R+FSYSDTQRHRLGPNYLQLP NAPKC+HHNNHH+GFMNFMHRDEEVNYFPSRYDP RHA
Sbjct  344  RVFSYSDTQRHRLGPNYLQLPANAPKCSHHNNHHEGFMNFMHRDEEVNYFPSRYDPARHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E++P PP V TGKR++C+I+KENNFKQPGERYRSW+ DRQERFI RWV ALSDPRVTHEI
Sbjct  404  ERYPHPPAVCTGKRERCVIDKENNFKQPGERYRSWAPDRQERFIRRWVNALSDPRVTHEI  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            RSIWISYW+QAD+S+GQKLAS LN+RP++
Sbjct  464  RSIWISYWSQADRSVGQKLASHLNMRPSI  492



>ref|XP_008452956.1| PREDICTED: catalase isozyme 1 [Cucumis melo]
Length=492

 Score =   395 bits (1014),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 180/209 (86%), Positives = 200/209 (96%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPED+LPLQPVGR+VLNKNIDNFFAENEQLAFCPAI+VPG+YYSDDKLLQT
Sbjct  284  FDPLDVTKTWPEDILPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIYYSDDKLLQT  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIFSYSDTQRHRLGPNYLQLP NAPKCAHHNNHH+GFMNFMHRDEEVNYFPSR+DP RHA
Sbjct  344  RIFSYSDTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPARHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E++P PP V TGKR++C+I+KENNFK+PGERYRSW+ DRQERFI RWV+ALSDPRVTHEI
Sbjct  404  ERYPHPPAVCTGKRERCVIQKENNFKEPGERYRSWTPDRQERFIRRWVDALSDPRVTHEI  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            RSIWISYW+QAD+S+GQKLAS LNVRP++
Sbjct  464  RSIWISYWSQADRSVGQKLASHLNVRPSI  492



>gb|AAD17936.1| catalase [Brassica juncea]
Length=492

 Score =   395 bits (1014),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 177/209 (85%), Positives = 202/209 (97%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPED+LPLQPVGR+VLNKNIDNFFAENEQLAFCPAI+VPG++YSDDKLLQT
Sbjct  284  FDPLDVTKTWPEDILPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQT  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            R+FSY+DTQRHRLGPNYLQLPVNAPKCAHHNNHH+GFMNFMHRDEEVNYFPSRYDP RHA
Sbjct  344  RVFSYADTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E++P PP + +GKR++CIIEKENNFK+PGERYRS++ +RQERFI RW++ALSDPR+THEI
Sbjct  404  EKYPTPPAICSGKRERCIIEKENNFKEPGERYRSFTPERQERFIGRWIDALSDPRITHEI  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            RSIWISYW+QADKSLGQKLA+RLNVRP++
Sbjct  464  RSIWISYWSQADKSLGQKLANRLNVRPSI  492



>gb|AAF19965.1|AF207906_1 catalase 1 [Zantedeschia aethiopica]
Length=492

 Score =   395 bits (1014),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 178/209 (85%), Positives = 197/209 (94%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPED+LPLQPVGR+VLNKNIDNFFAENEQLAFCPAI+VPG+YYSDDKLLQT
Sbjct  284  FDPLDVTKTWPEDILPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIYYSDDKLLQT  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIFSY+DTQRHRLGPNYL LP NAPKCAHHNNHH+GFMNFMHRDEEVNYFPSRYDP RHA
Sbjct  344  RIFSYADTQRHRLGPNYLMLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            EQ PIPPR+L G R+KC I+KENNFKQPGE+YRSW+ DRQERFI RW++ALSDPRVTHEI
Sbjct  404  EQFPIPPRILNGGREKCCIQKENNFKQPGEKYRSWAPDRQERFIKRWIDALSDPRVTHEI  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            R+IWI+YW+Q DK LGQKLASRLN++PT+
Sbjct  464  RTIWITYWSQCDKFLGQKLASRLNIKPTL  492



>ref|XP_006473791.1| PREDICTED: catalase isozyme 1-like isoform X1 [Citrus sinensis]
 ref|XP_006473792.1| PREDICTED: catalase isozyme 1-like isoform X2 [Citrus sinensis]
 ref|XP_006473793.1| PREDICTED: catalase isozyme 1-like isoform X3 [Citrus sinensis]
Length=512

 Score =   395 bits (1015),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 182/209 (87%), Positives = 196/209 (94%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPED+LPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPG+YYS+DKLLQT
Sbjct  304  FDPLDVTKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGIYYSNDKLLQT  363

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIFSY+DTQRHRLGPNYLQLPVNAPKCA HNNH+DGFMNFMHRDEE++YFPSRYDP RHA
Sbjct  364  RIFSYADTQRHRLGPNYLQLPVNAPKCAQHNNHYDGFMNFMHRDEEIDYFPSRYDPVRHA  423

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E HP PP +  G+R+KCII KENNFKQPGERYRSW+ DRQERFICRWV+ALSDPRVTHEI
Sbjct  424  EMHPTPPEICGGRREKCIIPKENNFKQPGERYRSWAPDRQERFICRWVDALSDPRVTHEI  483

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            R IWISYW+QA KSLGQKLASRLNVRP +
Sbjct  484  RHIWISYWSQACKSLGQKLASRLNVRPNI  512



>ref|XP_007160597.1| hypothetical protein PHAVU_001G001000g [Phaseolus vulgaris]
 gb|ESW32591.1| hypothetical protein PHAVU_001G001000g [Phaseolus vulgaris]
Length=492

 Score =   394 bits (1012),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 177/209 (85%), Positives = 201/209 (96%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTK WPED+LPLQPVGR+VLNKNIDNFFAENEQLAFCPAI+VPGVYYSDDKLLQT
Sbjct  284  FDPLDVTKIWPEDVLPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGVYYSDDKLLQT  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIFSY+D+QRHRLGPNYLQ+P NAPKCAHHNNHH+GFMNFMHRDEEVNYFPSRYDP RHA
Sbjct  344  RIFSYADSQRHRLGPNYLQIPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E+ P+PPR+L GKR+KC+IEKENNFKQPGERYRSW++DRQERF+ RWV+ALS+PRVTHEI
Sbjct  404  ERIPVPPRILDGKREKCMIEKENNFKQPGERYRSWASDRQERFLRRWVDALSEPRVTHEI  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            RSIWISYW+QAD+SLGQK+AS LN++P++
Sbjct  464  RSIWISYWSQADRSLGQKIASHLNLKPSI  492



>emb|CDY17510.1| BnaC03g65530D [Brassica napus]
Length=477

 Score =   394 bits (1011),  Expect = 6e-132, Method: Compositional matrix adjust.
 Identities = 177/209 (85%), Positives = 201/209 (96%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPE+LLPLQPVGR+VLNKNIDNFFAENEQLAFCPAI+VPG++YSDDKLLQT
Sbjct  269  FDPLDVTKTWPENLLPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQT  328

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            R+FSY+DTQRHRLGPNYLQLPVNAPKCAHHNNHH+GFMNFMHRDEEVNYFPSRYDP RHA
Sbjct  329  RVFSYADTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHA  388

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E++P PP V +GKR++C+IEKENNFK+PGERYRS++ +RQERFI RW+EALSDPR+THEI
Sbjct  389  EKYPTPPAVCSGKRERCVIEKENNFKEPGERYRSFTPERQERFIRRWIEALSDPRITHEI  448

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            RSIWISYW+QADK+LGQKLAS LNVRP++
Sbjct  449  RSIWISYWSQADKTLGQKLASHLNVRPSI  477



>emb|CDX72514.1| BnaC07g45360D [Brassica napus]
Length=480

 Score =   394 bits (1011),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 177/209 (85%), Positives = 200/209 (96%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPEDLLPLQPVGR+VLNKNIDNFF ENEQLAFCPAI+VPG++YSDDKLLQT
Sbjct  272  FDPLDVTKTWPEDLLPLQPVGRMVLNKNIDNFFTENEQLAFCPAIIVPGIHYSDDKLLQT  331

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            R+FSY+DTQRHRLGPNYLQLPVNAPKCAHHNNHH+GFMN MHRDEEVNYFPSRYDP RHA
Sbjct  332  RVFSYADTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNVMHRDEEVNYFPSRYDPVRHA  391

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E++P PP V +GKR++C+IEKENNFK+PGERYRS++ +RQERFI RW++ALSDPR+THEI
Sbjct  392  EKYPTPPAVCSGKRERCVIEKENNFKEPGERYRSFTPERQERFIGRWIDALSDPRITHEI  451

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            RSIWISYW+QADKSLGQKLASRLNVRP++
Sbjct  452  RSIWISYWSQADKSLGQKLASRLNVRPSI  480



>sp|P45739.1|CATA_HELAN RecName: Full=Catalase [Helianthus annuus]
 gb|AAA69866.1| catalase [Helianthus annuus]
Length=492

 Score =   394 bits (1012),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 181/207 (87%), Positives = 196/207 (95%), Gaps = 0/207 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPED+ PLQPVGRLVLNKNIDNFFAENEQLAFCPAI+VPG+YYSDDKLLQT
Sbjct  284  FDPLDVTKTWPEDIFPLQPVGRLVLNKNIDNFFAENEQLAFCPAIIVPGIYYSDDKLLQT  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIFSYSDTQRHRLGPNYLQLP NAPKCAHHNNH+DGFMNFMHRDEE++YFPSRYDP RHA
Sbjct  344  RIFSYSDTQRHRLGPNYLQLPANAPKCAHHNNHYDGFMNFMHRDEEIDYFPSRYDPARHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            EQ+PIPP  L+GKRDKC+IEKENNFKQPGERYRS+S DRQERFI R V  LSDPRVTHE+
Sbjct  404  EQYPIPPVRLSGKRDKCVIEKENNFKQPGERYRSFSPDRQERFINRVVGGLSDPRVTHEV  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRP  124
            RSIW+SYW+QADKSLGQK+ASRLNV+P
Sbjct  464  RSIWVSYWSQADKSLGQKIASRLNVKP  490



>prf||2104177A catalase
Length=492

 Score =   394 bits (1011),  Expect = 8e-132, Method: Compositional matrix adjust.
 Identities = 181/207 (87%), Positives = 196/207 (95%), Gaps = 0/207 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPED+ PLQPVGRLVLNKNIDNFFAENEQLAFCPAI+VPG+YYSDDKLLQT
Sbjct  284  FDPLDVTKTWPEDIFPLQPVGRLVLNKNIDNFFAENEQLAFCPAIIVPGIYYSDDKLLQT  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIFSYSDTQRHRLGPNYLQLP NAPKCAHHNNH+DGFMNFMHRDEE++YFPSRYDP RHA
Sbjct  344  RIFSYSDTQRHRLGPNYLQLPANAPKCAHHNNHYDGFMNFMHRDEEIDYFPSRYDPARHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            EQ+PIPP  L+GKRDKC+IEKENNFKQPGERYRS+S DRQERFI R V  LSDPRVTHE+
Sbjct  404  EQYPIPPVRLSGKRDKCVIEKENNFKQPGERYRSFSPDRQERFINRVVGGLSDPRVTHEV  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRP  124
            RSIW+SYW+QADKSLGQK+ASRLNV+P
Sbjct  464  RSIWVSYWSQADKSLGQKIASRLNVKP  490



>gb|AAB88173.1| catalase, partial [Glycine max]
Length=308

 Score =   387 bits (994),  Expect = 8e-132, Method: Compositional matrix adjust.
 Identities = 176/209 (84%), Positives = 197/209 (94%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPED++PLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDK+LQT
Sbjct  100  FDPLDVTKTWPEDIIPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKMLQT  159

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIFSY+D+QRHRLGPNYLQLP NAPKCAHHNNHH+GFMNF+HRDEEVNYFPSRYDP RHA
Sbjct  160  RIFSYADSQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFIHRDEEVNYFPSRYDPVRHA  219

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E  PIPP + +G+R+KC IEKENNFKQPGERYRSW+ DRQ+RF  RWV+ALSDPRVTHEI
Sbjct  220  ETFPIPPAICSGRREKCGIEKENNFKQPGERYRSWAPDRQDRFNRRWVDALSDPRVTHEI  279

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            RS+WISYW+QAD+SLGQK+ASRL++RP +
Sbjct  280  RSVWISYWSQADRSLGQKIASRLSMRPNI  308



>ref|XP_008452957.1| PREDICTED: catalase isozyme 1-like [Cucumis melo]
Length=492

 Score =   394 bits (1011),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 181/206 (88%), Positives = 196/206 (95%), Gaps = 0/206 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DP+DVTKTWPED+LPLQPVGRLVLNKNIDNFFAENEQLAFCPAI+VPG+YYSDDKLLQT
Sbjct  284  FDPVDVTKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIIVPGIYYSDDKLLQT  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIFSY+DTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSR DP  HA
Sbjct  344  RIFSYADTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRIDPAHHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E++P PP V TGKR++C+IEKENNFKQPGERYRSW  DRQERF+ RWV+ALSDPRVTHEI
Sbjct  404  ERYPQPPAVYTGKRERCVIEKENNFKQPGERYRSWPADRQERFVGRWVDALSDPRVTHEI  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVR  127
            R+IWISYW+QADKSLGQKLASRLNV+
Sbjct  464  RNIWISYWSQADKSLGQKLASRLNVK  489



>gb|KDP43757.1| hypothetical protein JCGZ_22384 [Jatropha curcas]
Length=492

 Score =   393 bits (1010),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 182/209 (87%), Positives = 200/209 (96%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPED+LPLQPVGR+VLN+NIDNFFAENEQLAFCPAI+VPGVYYSDDKLLQT
Sbjct  284  FDPLDVTKTWPEDILPLQPVGRMVLNRNIDNFFAENEQLAFCPAIIVPGVYYSDDKLLQT  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIFSYSDTQRHRLGPNYLQLP NAPKCAHHNNHH+GFMNFMHRDEEVNYFPSRYDP RHA
Sbjct  344  RIFSYSDTQRHRLGPNYLQLPPNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E++PIPP VLTG+R+K +I KENNFKQPGERYRS++ DR++RFI RWVEALSDPRVT+EI
Sbjct  404  EKYPIPPPVLTGRREKTVIPKENNFKQPGERYRSFTPDRKDRFIRRWVEALSDPRVTYEI  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            RSIWISYW+QADKSLGQK+AS LN+RPTM
Sbjct  464  RSIWISYWSQADKSLGQKIASHLNMRPTM  492



>sp|P48350.1|CATA1_CUCPE RecName: Full=Catalase isozyme 1 [Cucurbita pepo]
 dbj|BAA09506.1| catalase [Cucurbita pepo]
Length=492

 Score =   393 bits (1009),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 180/209 (86%), Positives = 199/209 (95%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPED+LPLQPVGR+VLNKNIDNFFAENEQLAFCPAI+VPGVYYSDDKLLQT
Sbjct  284  FDPLDVTKTWPEDILPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGVYYSDDKLLQT  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIFSY+DTQRHRLGPNYLQLP NAPKCAHHNNHH+GFMNFMHRDEEVNYFPSR+DP RHA
Sbjct  344  RIFSYADTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPSRHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E++P PP V +GKR++CIIEKENNFK+PGERYRSW+ DRQERF+ RWV+ALSD RVTHEI
Sbjct  404  ERYPHPPAVCSGKRERCIIEKENNFKEPGERYRSWTPDRQERFVRRWVDALSDTRVTHEI  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            RSIWISYW+QAD+SLGQKLAS LNVRP++
Sbjct  464  RSIWISYWSQADRSLGQKLASHLNVRPSI  492



>ref|XP_010094556.1| Catalase isozyme 1 [Morus notabilis]
 gb|EXB56310.1| Catalase isozyme 1 [Morus notabilis]
Length=492

 Score =   393 bits (1009),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 181/209 (87%), Positives = 198/209 (95%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPED+LPLQPVGR+VLNKNIDNFFAENEQLAFCP IVVPGVYYSDDKLLQT
Sbjct  284  FDPLDVTKTWPEDILPLQPVGRMVLNKNIDNFFAENEQLAFCPGIVVPGVYYSDDKLLQT  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIFSYSDTQRHRLGPNYLQLP NAPKCAHHNNHH+GFMNFMHR+EEVNYFPSRYDP RHA
Sbjct  344  RIFSYSDTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHREEEVNYFPSRYDPVRHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E++PIP  + TG+R++ +I+KENNFKQPGERYRS+S DRQERFI RWV ALSDPRVTHEI
Sbjct  404  ERYPIPSAICTGRRERTVIDKENNFKQPGERYRSFSPDRQERFIKRWVNALSDPRVTHEI  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            RSIWISYW+QAD+SLGQKLASRLNVRP++
Sbjct  464  RSIWISYWSQADRSLGQKLASRLNVRPSI  492



>emb|CAA45564.1| catalase [Arabidopsis thaliana]
Length=492

 Score =   393 bits (1009),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 177/209 (85%), Positives = 201/209 (96%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPED+LPLQPVGR+VLNKNIDNFFAENEQLAFCPAI+VPG++YSDDKLLQT
Sbjct  284  FDPLDVTKTWPEDILPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQT  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            R+FSY+DTQRHRLGPNYLQLPVNAPKCAHHNNHH+GFMNFMHRDEEVNYFPSRYD  RHA
Sbjct  344  RVFSYADTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDQVRHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E++P PP V +GKR++CIIEKENNFK+PGERYR+++ +RQERFI RW++ALSDPR+THEI
Sbjct  404  EKYPTPPAVCSGKRERCIIEKENNFKEPGERYRTFTPERQERFIQRWIDALSDPRITHEI  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            RSIWISYW+QADKSLGQKLASRLNVRP++
Sbjct  464  RSIWISYWSQADKSLGQKLASRLNVRPSI  492



>ref|XP_009106100.1| PREDICTED: catalase-2 [Brassica rapa]
Length=492

 Score =   392 bits (1008),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 176/209 (84%), Positives = 200/209 (96%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPE+LLPLQPVGR+VLNKNIDNF AENEQLAFCPAI+VPG+YYSDDKLLQT
Sbjct  284  FDPLDVTKTWPEELLPLQPVGRMVLNKNIDNFLAENEQLAFCPAIIVPGIYYSDDKLLQT  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            R+FSY+DTQRHRLGPNYLQLPVN+PKC+HHNNHH+GFMNFMHRDEEVNYFPSRYDP RHA
Sbjct  344  RVFSYADTQRHRLGPNYLQLPVNSPKCSHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E++P PP V +GKR++C+IEKENNFK+PGERYRS++ +RQERFI RW++ALSDPR+THEI
Sbjct  404  EKYPTPPAVCSGKRERCVIEKENNFKEPGERYRSFTPERQERFIGRWIDALSDPRITHEI  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            RSIWISYW+QADKSLGQKLASRLNVRP +
Sbjct  464  RSIWISYWSQADKSLGQKLASRLNVRPNI  492



>ref|XP_009400996.1| PREDICTED: catalase isozyme 2 [Musa acuminata subsp. malaccensis]
Length=492

 Score =   392 bits (1008),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 182/209 (87%), Positives = 197/209 (94%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPED+ PLQPVGR+VLNKNIDNFF ENEQLAFCPA+VVPGVYYSDDKLLQT
Sbjct  284  FDPLDVTKTWPEDIFPLQPVGRMVLNKNIDNFFGENEQLAFCPALVVPGVYYSDDKLLQT  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIFSYSDTQRHRLGPNYL LPVNAPKCAHHNNH+DGFMNFMHRDEEV+YFPSRYDP RHA
Sbjct  344  RIFSYSDTQRHRLGPNYLMLPVNAPKCAHHNNHYDGFMNFMHRDEEVDYFPSRYDPVRHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E+ PIP RVLTGKR+KC+I KENNFKQPGERYRS+S DRQERFI RWVEALSDP+VTHEI
Sbjct  404  ERFPIPTRVLTGKREKCMISKENNFKQPGERYRSFSPDRQERFIRRWVEALSDPKVTHEI  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            RSIWISYW+Q DKSL QKLA+RL+V+P+M
Sbjct  464  RSIWISYWSQCDKSLSQKLATRLSVKPSM  492



>gb|KFK30147.1| catalase [Arabis alpina]
Length=492

 Score =   392 bits (1008),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 178/209 (85%), Positives = 200/209 (96%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPED+LPLQPVGR+VLNKNIDNFFAENEQLAFCPAI+VPG++YSDDKLLQT
Sbjct  284  FDPLDVTKTWPEDILPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQT  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            R+FSY+DTQRHRLGPNYLQLPVNAPKCAHHNNHH+GFMNFMHRDEEVNYFPSRYD  RHA
Sbjct  344  RVFSYADTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDTVRHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E++P PP V +GKR++C+IEKENNFK+PGERYRS+  +RQERFI RW+EALSDPR+THEI
Sbjct  404  EKYPAPPAVCSGKRERCVIEKENNFKEPGERYRSFPPERQERFIRRWIEALSDPRITHEI  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            RSIWISYW+QADKSLGQKLASRLNVRP++
Sbjct  464  RSIWISYWSQADKSLGQKLASRLNVRPSI  492



>prf||1906388A catalase
Length=492

 Score =   392 bits (1008),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 177/209 (85%), Positives = 201/209 (96%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPED+LPLQPVGR+VLNKNIDNFFAENEQLAFCPAI+VPG++YSDDKLLQT
Sbjct  284  FDPLDVTKTWPEDILPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQT  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            R+FSY+DTQRHRLGPNYLQLPVNAPKCAHHNNHH+GFMNFMHRDEEVNYFPSRYD  RHA
Sbjct  344  RVFSYADTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDQVRHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E++P PP V +GKR++CIIEKENNFK+PGERYR+++ +RQERFI RW++ALSDPR+THEI
Sbjct  404  EKYPTPPAVCSGKRERCIIEKENNFKEPGERYRTFTPERQERFIQRWIDALSDPRITHEI  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            RSIWISYW+QADKSLGQKLASRLNVRP++
Sbjct  464  RSIWISYWSQADKSLGQKLASRLNVRPSI  492



>gb|AAK96854.1| catalase [Arabidopsis thaliana]
Length=492

 Score =   392 bits (1008),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 177/209 (85%), Positives = 201/209 (96%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPED+LPLQPVGR+VLNKNIDNFFAENEQLAFCPAI+VPG++YSDDKLLQT
Sbjct  284  FDPLDVTKTWPEDILPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQT  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            R+FSY+DTQRHRLGPNYLQLPVNAPKCAHHNNHH+GFMNFMHRDEEVNYFPSRYD  RHA
Sbjct  344  RVFSYADTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDQVRHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E++P PP V +GKR++CIIEKENNFK+PGERYR+++ +RQERFI RW++ALSDPR+THEI
Sbjct  404  EKYPTPPAVCSGKRERCIIEKENNFKEPGERYRTFTPERQERFIQRWIDALSDPRITHEI  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            RSIWISYW+QADKSLGQKLASRLNVRP++
Sbjct  464  RSIWISYWSQADKSLGQKLASRLNVRPSI  492



>ref|NP_195235.1| catalase 2 [Arabidopsis thaliana]
 sp|P25819.3|CATA2_ARATH RecName: Full=Catalase-2 [Arabidopsis thaliana]
 emb|CAA17773.1| catalase [Arabidopsis thaliana]
 emb|CAB80226.1| catalase [Arabidopsis thaliana]
 gb|AAL66998.1| putative catalase [Arabidopsis thaliana]
 gb|AAM44902.1| putative catalase [Arabidopsis thaliana]
 gb|AEE86462.1| catalase 2 [Arabidopsis thaliana]
Length=492

 Score =   392 bits (1007),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 177/209 (85%), Positives = 201/209 (96%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPED+LPLQPVGR+VLNKNIDNFFAENEQLAFCPAI+VPG++YSDDKLLQT
Sbjct  284  FDPLDVTKTWPEDILPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQT  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            R+FSY+DTQRHRLGPNYLQLPVNAPKCAHHNNHH+GFMNFMHRDEEVNYFPSRYD  RHA
Sbjct  344  RVFSYADTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDQVRHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E++P PP V +GKR++CIIEKENNFK+PGERYR+++ +RQERFI RW++ALSDPR+THEI
Sbjct  404  EKYPTPPAVCSGKRERCIIEKENNFKEPGERYRTFTPERQERFIQRWIDALSDPRITHEI  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            RSIWISYW+QADKSLGQKLASRLNVRP++
Sbjct  464  RSIWISYWSQADKSLGQKLASRLNVRPSI  492



>ref|XP_009413057.1| PREDICTED: catalase isozyme 2-like [Musa acuminata subsp. malaccensis]
Length=492

 Score =   392 bits (1007),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 180/209 (86%), Positives = 195/209 (93%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPED+ PLQPVGR+VLNKNIDNFF ENEQLAFCPAI+VPG+YYSDDKLLQT
Sbjct  284  FDPLDVTKTWPEDIFPLQPVGRMVLNKNIDNFFNENEQLAFCPAIIVPGIYYSDDKLLQT  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIFSYSDTQRHRLGPNYL LPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDP RHA
Sbjct  344  RIFSYSDTQRHRLGPNYLMLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPVRHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E+ PIP  V+TG+R+K II KENNFKQPGERYRSW+ DRQERF+ RWV+ALSDPRVTHEI
Sbjct  404  ERFPIPSSVVTGRREKSIINKENNFKQPGERYRSWAPDRQERFVHRWVDALSDPRVTHEI  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            R IWISYW+Q DKSLGQK+A+RLNV+PTM
Sbjct  464  RDIWISYWSQCDKSLGQKIATRLNVKPTM  492



>ref|XP_007210576.1| hypothetical protein PRUPE_ppa004763mg [Prunus persica]
 gb|EMJ11775.1| hypothetical protein PRUPE_ppa004763mg [Prunus persica]
Length=492

 Score =   392 bits (1006),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 181/209 (87%), Positives = 199/209 (95%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLD+TKTWPED+LPLQPVGRLVLNKNIDNFFAENEQLAF PA VVPG+YYSDDK+LQT
Sbjct  284  FDPLDLTKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFNPAHVVPGIYYSDDKMLQT  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIF+YSDTQRHRLGPNYLQLPVNAPKC HHNNHH+GFMNFMHRDEEVNYFPSR+DP RHA
Sbjct  344  RIFAYSDTQRHRLGPNYLQLPVNAPKCPHHNNHHEGFMNFMHRDEEVNYFPSRHDPVRHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E++PIP  +L+GKR+KC+IEKENNFKQPGERYRSW+ DRQERFI RWV+ALSDPRVTHEI
Sbjct  404  ERYPIPSNILSGKREKCVIEKENNFKQPGERYRSWAPDRQERFIRRWVDALSDPRVTHEI  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            RSIWISYW+QADKSLGQKL SRLNVRP++
Sbjct  464  RSIWISYWSQADKSLGQKLLSRLNVRPSI  492



>gb|ADU56199.1| catalase [Hevea brasiliensis]
Length=492

 Score =   392 bits (1006),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 181/209 (87%), Positives = 198/209 (95%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPED+LPLQPVGRLVLN+NIDNFFAENEQLAFCP+IVVPGVYYSDDKLLQT
Sbjct  284  FDPLDVTKTWPEDILPLQPVGRLVLNRNIDNFFAENEQLAFCPSIVVPGVYYSDDKLLQT  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIFSYSDTQR+RLGPNYLQLP NAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDP RHA
Sbjct  344  RIFSYSDTQRYRLGPNYLQLPANAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPVRHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E++PIP  +L+G  +KC+I KENNFKQPGERYRS+S+DR+ERFI RWVEA+SDPRVT+EI
Sbjct  404  EKYPIPSAILSGNCEKCVIPKENNFKQPGERYRSFSSDRKERFIRRWVEAMSDPRVTYEI  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            RSIWISYW QADKSLGQK+AS LN+RPTM
Sbjct  464  RSIWISYWYQADKSLGQKIASHLNMRPTM  492



>gb|KCW68095.1| hypothetical protein EUGRSUZ_F01777 [Eucalyptus grandis]
Length=584

 Score =   394 bits (1013),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 184/209 (88%), Positives = 196/209 (94%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTK WPED++PLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQ+
Sbjct  376  FDPLDVTKIWPEDIVPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQS  435

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIFSY+DTQRHRLGPNYLQLPVNAPKC HHNNHH+G MNFMHRDEEVNYFPSR+D  RHA
Sbjct  436  RIFSYADTQRHRLGPNYLQLPVNAPKCTHHNNHHEGLMNFMHRDEEVNYFPSRFDSVRHA  495

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E+ PIPP VL GKRD+C+IEKENNFKQPGERYRSW+ DRQERFI RWVEALSDPRVT EI
Sbjct  496  EKFPIPPPVLNGKRDRCMIEKENNFKQPGERYRSWAPDRQERFIGRWVEALSDPRVTQEI  555

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            RSIWISYWTQADKSLGQK+AS LNVRP+M
Sbjct  556  RSIWISYWTQADKSLGQKIASCLNVRPSM  584



>emb|CAA64220.1| catalase [Arabidopsis thaliana]
Length=492

 Score =   391 bits (1005),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 176/209 (84%), Positives = 201/209 (96%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPED+LPLQPVGR+VLNKNIDNFFAENEQLAFCPAI+VPG++YSDDKLLQT
Sbjct  284  FDPLDVTKTWPEDILPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQT  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            R+FSY+DTQRHRLGPNYLQLPVNAPKCAHHNNHH+GFMNFMHRDEEVNYFPSRYD  RHA
Sbjct  344  RVFSYADTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDQVRHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E++P PP V +GKR++C+IEKENNFK+PGERYR+++ +RQERFI RW++ALSDPR+THEI
Sbjct  404  EKYPTPPAVCSGKRERCVIEKENNFKEPGERYRTFTPERQERFIQRWIDALSDPRITHEI  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            RSIWISYW+QADKSLGQKLASRLNVRP++
Sbjct  464  RSIWISYWSQADKSLGQKLASRLNVRPSI  492



>emb|CAD42909.1| catalase [Prunus persica]
Length=492

 Score =   391 bits (1005),  Expect = 8e-131, Method: Compositional matrix adjust.
 Identities = 181/209 (87%), Positives = 199/209 (95%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLD+TKTWPED+LPLQPVGRLVLNKNIDNFFAENEQLAF PA VVPG+YYSDDK+LQT
Sbjct  284  FDPLDLTKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFNPAHVVPGIYYSDDKVLQT  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIF+YSDTQRHRLGPNYLQLPVNAPKC HHNNHH+GFMNFMHRDEEVNYFPSR+DP RHA
Sbjct  344  RIFAYSDTQRHRLGPNYLQLPVNAPKCPHHNNHHEGFMNFMHRDEEVNYFPSRHDPVRHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E++PIP  +L+GKR+KC+IEKENNFKQPGERYRSW+ DRQERFI RWV+ALSDPRVTHEI
Sbjct  404  ERYPIPSNILSGKREKCVIEKENNFKQPGERYRSWAPDRQERFIRRWVDALSDPRVTHEI  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            RSIWISYW+QADKSLGQKL SRLNVRP++
Sbjct  464  RSIWISYWSQADKSLGQKLLSRLNVRPSI  492



>ref|XP_010063132.1| PREDICTED: LOW QUALITY PROTEIN: catalase isozyme 1-like [Eucalyptus 
grandis]
Length=490

 Score =   391 bits (1004),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 182/209 (87%), Positives = 198/209 (95%), Gaps = 2/209 (1%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPED+LPL PVGRLVLN+NIDNFFAENEQLAFCP+IVVPGV+YSDDKLLQT
Sbjct  284  FDPLDVTKTWPEDILPLMPVGRLVLNRNIDNFFAENEQLAFCPSIVVPGVFYSDDKLLQT  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIFSYSDTQRHRLGPNYLQLP NAPKCAHHNNHH+GFMNFMHRDEE+NYFPSRYDP RHA
Sbjct  344  RIFSYSDTQRHRLGPNYLQLPPNAPKCAHHNNHHEGFMNFMHRDEEINYFPSRYDPVRHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E++PIP  +LTGKR+K IIEKENNFKQPGERYRSW+ DRQERFICRWV+ALSD   THEI
Sbjct  404  ERYPIPTAMLTGKREKTIIEKENNFKQPGERYRSWTPDRQERFICRWVDALSD--XTHEI  461

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            RS+WISYW+QADKSLGQKLASRLNVRP++
Sbjct  462  RSVWISYWSQADKSLGQKLASRLNVRPSI  490



>ref|XP_002306427.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 ref|XP_006382993.1| catalase family protein [Populus trichocarpa]
 emb|CAI43950.1| catalase [Populus deltoides]
 gb|EEE93423.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 gb|ERP60790.1| catalase family protein [Populus trichocarpa]
Length=492

 Score =   390 bits (1003),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 180/209 (86%), Positives = 198/209 (95%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPED+LPL PVGRLVLNKNIDNFFAENEQLAFCPAI+VPG+YYSDDKLLQT
Sbjct  284  FDPLDVTKTWPEDILPLMPVGRLVLNKNIDNFFAENEQLAFCPAIIVPGIYYSDDKLLQT  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIFSY+DTQRHRLGPNYLQLP NAPKCAHHNNHH+GFMNFMHRDEEVNYFPSR+DP RHA
Sbjct  344  RIFSYADTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPVRHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E++P P  + TGKR+KCIIEKENNFKQPGERYRS+S DR+ERF+ RWVEALSDPRVT+EI
Sbjct  404  ERYPNPSVIHTGKREKCIIEKENNFKQPGERYRSFSPDRKERFVRRWVEALSDPRVTYEI  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            RSIWISYW+QADKSLGQKLAS LN+RP++
Sbjct  464  RSIWISYWSQADKSLGQKLASHLNMRPSI  492



>ref|XP_006382992.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 gb|ERP60789.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
Length=490

 Score =   390 bits (1003),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 180/209 (86%), Positives = 198/209 (95%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPED+LPL PVGRLVLNKNIDNFFAENEQLAFCPAI+VPG+YYSDDKLLQT
Sbjct  282  FDPLDVTKTWPEDILPLMPVGRLVLNKNIDNFFAENEQLAFCPAIIVPGIYYSDDKLLQT  341

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIFSY+DTQRHRLGPNYLQLP NAPKCAHHNNHH+GFMNFMHRDEEVNYFPSR+DP RHA
Sbjct  342  RIFSYADTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPVRHA  401

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E++P P  + TGKR+KCIIEKENNFKQPGERYRS+S DR+ERF+ RWVEALSDPRVT+EI
Sbjct  402  ERYPNPSVIHTGKREKCIIEKENNFKQPGERYRSFSPDRKERFVRRWVEALSDPRVTYEI  461

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            RSIWISYW+QADKSLGQKLAS LN+RP++
Sbjct  462  RSIWISYWSQADKSLGQKLASHLNMRPSI  490



>ref|XP_007046520.1| Catalase 2 [Theobroma cacao]
 gb|EOX90677.1| Catalase 2 [Theobroma cacao]
Length=492

 Score =   390 bits (1002),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 178/209 (85%), Positives = 200/209 (96%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPED+ PLQPVGRLVLNKNIDNFFAENEQLAFCP+I+VPG+YYSDDKLLQT
Sbjct  284  FDPLDVTKTWPEDIFPLQPVGRLVLNKNIDNFFAENEQLAFCPSIIVPGLYYSDDKLLQT  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIFSYSDTQRHRLGPNYLQLP NAPKCAHHNNHH+GFMNFMHRDEEVNYFPSR+DP RHA
Sbjct  344  RIFSYSDTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPVRHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E++PIP  + +GKR+KCII+KENNF+QPGERYRS++ DRQERFI RWV+ALSDPRVT+EI
Sbjct  404  EKYPIPTAICSGKREKCIIDKENNFQQPGERYRSFAPDRQERFIYRWVDALSDPRVTYEI  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            RSIWISYW++ADKSLGQKLASRL+VRP++
Sbjct  464  RSIWISYWSKADKSLGQKLASRLSVRPSI  492



>gb|AGE15298.2| catalase 1 [Eriobotrya japonica]
Length=492

 Score =   390 bits (1002),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 179/209 (86%), Positives = 196/209 (94%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLD TKTWPED+LPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT
Sbjct  284  FDPLDDTKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIFSY+DTQRHRLGPNYLQLPVNAPKC+HHNNHH+GFMNFMHRDEEVNYFPSRY P RHA
Sbjct  344  RIFSYADTQRHRLGPNYLQLPVNAPKCSHHNNHHEGFMNFMHRDEEVNYFPSRYQPARHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E  PIP  ++TGKRDKC+IEKENNFKQPGERYRSW+ DRQERF+ RWV+ LS+ RVT+EI
Sbjct  404  ETFPIPSSIITGKRDKCVIEKENNFKQPGERYRSWAPDRQERFLHRWVDVLSESRVTYEI  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            RSIWISYW+QAD+S GQKLA+RLNVRP++
Sbjct  464  RSIWISYWSQADRSFGQKLATRLNVRPSI  492



>emb|CDP01802.1| unnamed protein product [Coffea canephora]
Length=469

 Score =   389 bits (1000),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 183/216 (85%), Positives = 199/216 (92%), Gaps = 7/216 (3%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPED+LPLQPVGRLVLN+NIDNFF ENEQLAFCPAIVVPG++YSDDKLLQT
Sbjct  254  FDPLDVTKTWPEDILPLQPVGRLVLNRNIDNFFNENEQLAFCPAIVVPGIHYSDDKLLQT  313

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEE-------VNYFPSR  406
            RIFSY+DTQRHRLGPNYLQLP NAPKCAHHNNHHDGFMNFMHRDEE       V+YFPSR
Sbjct  314  RIFSYADTQRHRLGPNYLQLPANAPKCAHHNNHHDGFMNFMHRDEEHCTFCPCVDYFPSR  373

Query  405  YDPXRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSD  226
            YDP RHAE HPIP  VLTG+R+K II KENNFKQPGERYRS++ DRQERFICRWV+ALSD
Sbjct  374  YDPVRHAEMHPIPSAVLTGRREKTIIPKENNFKQPGERYRSFAPDRQERFICRWVDALSD  433

Query  225  PRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  118
            PRVT+EIRSIWISYW+QADKSLGQKLASRLN+RP++
Sbjct  434  PRVTYEIRSIWISYWSQADKSLGQKLASRLNIRPSI  469



>gb|AAB62892.1| catalase-1 [Nicotiana glutinosa]
Length=492

 Score =   390 bits (1001),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 180/209 (86%), Positives = 198/209 (95%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPED+LPLQPVGRLVLNKNIDNFF ENEQLAFCP+IVVPGVYYSDDK+LQT
Sbjct  284  FDPLDVTKTWPEDILPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGVYYSDDKMLQT  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIFSYSDTQR+RLGPNYLQLP NAPKCAHHNNH+DG MNFMHRDEE++YFPSRYDP RHA
Sbjct  344  RIFSYSDTQRYRLGPNYLQLPANAPKCAHHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E++PIP  + TGKR+KC+I KENNFKQPGERYRS++ DRQERFI RWVEALSDPR+THEI
Sbjct  404  EKYPIPSTMCTGKREKCVILKENNFKQPGERYRSFTPDRQERFIRRWVEALSDPRITHEI  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            RSIWISYW+QADKSLGQKLASRLNVRP++
Sbjct  464  RSIWISYWSQADKSLGQKLASRLNVRPSI  492



>gb|AAF61732.1|AF243517_1 catalase 2 [Helianthus annuus]
Length=492

 Score =   390 bits (1001),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 179/208 (86%), Positives = 196/208 (94%), Gaps = 0/208 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPED+LPLQPVGR+VLNKNIDNFFAENEQLAFCPAI+VPG+YYSDDKLLQT
Sbjct  284  FDPLDVTKTWPEDILPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIYYSDDKLLQT  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIFSY+DTQRHRLGPNYLQLP NAPKCAHHNNHHDGFMNFMHRDEEV YFPSRYDP RHA
Sbjct  344  RIFSYADTQRHRLGPNYLQLPANAPKCAHHNNHHDGFMNFMHRDEEVIYFPSRYDPVRHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            EQ PIPP +L+GKR+KC+IEKENNFKQPGER+RSW  DRQERFI R V ALSDPRVTHE+
Sbjct  404  EQSPIPPVMLSGKRNKCVIEKENNFKQPGERFRSWDPDRQERFIRRIVGALSDPRVTHEV  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPT  121
             +IW+SYW+QADKSLGQK+ASRLNV+P+
Sbjct  464  CTIWVSYWSQADKSLGQKIASRLNVKPS  491



>ref|XP_011022275.1| PREDICTED: catalase-like [Populus euphratica]
Length=476

 Score =   389 bits (998),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 180/209 (86%), Positives = 197/209 (94%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPED+LPL PVGRLVLNKNIDNFFAENEQLAFCPAI+VPG+YYSDDKLLQT
Sbjct  268  FDPLDVTKTWPEDILPLMPVGRLVLNKNIDNFFAENEQLAFCPAIIVPGIYYSDDKLLQT  327

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIFSY+DTQRHRLGPNYLQLP NAPKCAHHNNHH+GFMNFMHRDEEVNYFPSR+DP RHA
Sbjct  328  RIFSYADTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPVRHA  387

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E++P P  + TGKR+KCIIEKENNFKQPGERYRS+S DR+ERF+ RWVEALSDPRVT+EI
Sbjct  388  ERYPNPSVIHTGKREKCIIEKENNFKQPGERYRSFSPDRKERFVRRWVEALSDPRVTYEI  447

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            RSIWISYW+QADKSLGQKLAS LN+RP +
Sbjct  448  RSIWISYWSQADKSLGQKLASHLNMRPGI  476



>gb|AAD17933.1| catalase [Brassica juncea]
Length=496

 Score =   389 bits (1000),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 178/213 (84%), Positives = 202/213 (95%), Gaps = 4/213 (2%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPE+LLPLQPVGR+VLNKNIDNFFAENEQLAFCPAI+VPG++YSDDKLLQT
Sbjct  284  FDPLDVTKTWPENLLPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQT  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            R+FSY+DTQRHRLGPNYLQLPVNAPKCAHHNNHH+GFMNFMHRDEEVNYFPSRYDP RHA
Sbjct  344  RVFSYADTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTD----RQERFICRWVEALSDPRV  217
            E++P PP V +GKR++C+IEKENNFK+PGERYRS++ +    RQERFI RW+EALSDPR+
Sbjct  404  EKYPTPPAVCSGKRERCVIEKENNFKEPGERYRSFTPESFDFRQERFIRRWIEALSDPRI  463

Query  216  THEIRSIWISYWTQADKSLGQKLASRLNVRPTM  118
            THEIRSIWISYW+QADK+LGQKLASRLNVRP++
Sbjct  464  THEIRSIWISYWSQADKTLGQKLASRLNVRPSI  496



>ref|XP_008789355.1| PREDICTED: catalase isozyme 1-like [Phoenix dactylifera]
Length=492

 Score =   389 bits (1000),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 178/209 (85%), Positives = 197/209 (94%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPED+LPLQ VGR+VLNKNIDNFFAENEQLAFCPAIVVPG++YSDDKLLQT
Sbjct  284  FDPLDVTKTWPEDILPLQAVGRMVLNKNIDNFFAENEQLAFCPAIVVPGIHYSDDKLLQT  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIFSY+DTQRHRLGPNYL LP NAPKCAHHNNHHDGFMNF+HRDEEVNYFPSRYDP RHA
Sbjct  344  RIFSYADTQRHRLGPNYLMLPANAPKCAHHNNHHDGFMNFLHRDEEVNYFPSRYDPVRHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E+ PIP R+LTG+R+KC+I+KENNFKQPGERYRSW  DRQ RFI RWVEALSDPRVTHEI
Sbjct  404  ERCPIPSRILTGRREKCVIQKENNFKQPGERYRSWDPDRQGRFIRRWVEALSDPRVTHEI  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            +SIWISYW+Q DKSLG+K+A+RLNV+P+M
Sbjct  464  QSIWISYWSQCDKSLGRKIATRLNVKPSM  492



>ref|XP_011022153.1| PREDICTED: catalase-2-like isoform X2 [Populus euphratica]
Length=492

 Score =   389 bits (999),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 180/209 (86%), Positives = 197/209 (94%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPED+LPL PVGRLVLNKNIDNFFAENEQLAFCPAI+VPG+YYSDDKLLQT
Sbjct  284  FDPLDVTKTWPEDILPLMPVGRLVLNKNIDNFFAENEQLAFCPAIIVPGIYYSDDKLLQT  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIFSY+DTQRHRLGPNYLQLP NAPKCAHHNNHH+GFMNFMHRDEEVNYFPSR+DP RHA
Sbjct  344  RIFSYADTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPVRHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E++P P  + TGKR+KCIIEKENNFKQPGERYRS+S DR+ERF+ RWVEALSDPRVT+EI
Sbjct  404  ERYPNPSVIHTGKREKCIIEKENNFKQPGERYRSFSPDRKERFVRRWVEALSDPRVTYEI  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            RSIWISYW+QADKSLGQKLAS LN+RP +
Sbjct  464  RSIWISYWSQADKSLGQKLASHLNMRPGI  492



>gb|AFN81243.1| catalase 1 [Brassica rapa subsp. pekinensis]
Length=492

 Score =   389 bits (999),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 175/209 (84%), Positives = 199/209 (95%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPE+LLPLQPVGR+VLNKNIDNFFAENEQLAFCPAI+VPG++YSDDKLLQT
Sbjct  284  FDPLDVTKTWPENLLPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQT  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            R+FSY+DTQRHRLGPNYLQLPVNAPKCAHHNNHH+GFMNFMHRDEEVNYFPSRYDP RHA
Sbjct  344  RVFSYADTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E++P PP V +GKR++C+IEKENNFK+PGERYRS++ +RQERFI RW+EAL DPR+THEI
Sbjct  404  EKYPTPPAVCSGKRERCVIEKENNFKEPGERYRSFTPERQERFIRRWIEALFDPRITHEI  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            RSIWI YW+QADK+ GQKLASRLNVRP++
Sbjct  464  RSIWIFYWSQADKTFGQKLASRLNVRPSI  492



>ref|XP_010523643.1| PREDICTED: catalase-2-like [Tarenaya hassleriana]
Length=492

 Score =   389 bits (999),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 175/209 (84%), Positives = 200/209 (96%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DP+DVTKTWPED++PLQPVGRLVLNKNID+FFAENEQLAFCP I+VPG++YSDDKLLQT
Sbjct  284  FDPVDVTKTWPEDIVPLQPVGRLVLNKNIDSFFAENEQLAFCPGIIVPGIHYSDDKLLQT  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            R+FSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHH+GFMNFMHRDEEVNYFPSRYDP RHA
Sbjct  344  RVFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E++P+P  V +G+R++CIIEKENNFKQPGERYRS++ DR+ERFI RW+EALSDPR+THEI
Sbjct  404  ERYPVPSVVCSGRRERCIIEKENNFKQPGERYRSFTPDRKERFIRRWIEALSDPRITHEI  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            RSIWISYW+QAD+SLGQKLASR+NVRP +
Sbjct  464  RSIWISYWSQADQSLGQKLASRMNVRPNI  492



>emb|CDX69111.1| BnaC01g03420D [Brassica napus]
Length=480

 Score =   388 bits (997),  Expect = 7e-130, Method: Compositional matrix adjust.
 Identities = 176/209 (84%), Positives = 196/209 (94%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPEDLLPLQPVGR+VLNKNIDNFFAENEQLAFCPAI+VPG++YSDDKLLQT
Sbjct  272  FDPLDVTKTWPEDLLPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQT  331

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            R+FSY+DTQRHRLGPNYLQLPVNAPKC HHNNHH+GFMNFMHRDEEVNYFPSRY+P RHA
Sbjct  332  RVFSYADTQRHRLGPNYLQLPVNAPKCGHHNNHHEGFMNFMHRDEEVNYFPSRYNPVRHA  391

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E++P PP V  GKR++C+IEKENNFK+PGERYR +  +RQERFI RW+EALSDPR+THEI
Sbjct  392  EKYPTPPAVCAGKRERCVIEKENNFKEPGERYRYFPPERQERFIRRWIEALSDPRITHEI  451

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            RSIWISYW+QADKSLGQKLAS LNVRP +
Sbjct  452  RSIWISYWSQADKSLGQKLASHLNVRPNI  480



>ref|XP_009108683.1| PREDICTED: catalase-2-like isoform X2 [Brassica rapa]
Length=496

 Score =   389 bits (998),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 178/213 (84%), Positives = 201/213 (94%), Gaps = 4/213 (2%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPE+LLPLQPVGR+VLNKNIDNFFAENEQLAFCPAI+VPG++YSDDKLLQT
Sbjct  284  FDPLDVTKTWPENLLPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQT  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            R+FSY+DTQRHRLGPNYLQLPVNAPKCAHHNNHH+GFMNFMHRDEEVNYFPSRYDP RHA
Sbjct  344  RVFSYADTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTD----RQERFICRWVEALSDPRV  217
            E++P PP V +GKR++C+IEKENNFK+PG RYRS++ D    RQERFI RW+EALSDPR+
Sbjct  404  EKYPTPPAVCSGKRERCVIEKENNFKEPGGRYRSFTPDSFDFRQERFIRRWIEALSDPRI  463

Query  216  THEIRSIWISYWTQADKSLGQKLASRLNVRPTM  118
            THEIRSIWISYW+QADK+LGQKLASRLNVRP++
Sbjct  464  THEIRSIWISYWSQADKTLGQKLASRLNVRPSI  496



>gb|ACL27272.1| catalase [Nicotiana benthamiana]
Length=492

 Score =   388 bits (997),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 178/209 (85%), Positives = 199/209 (95%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPED+LPLQPVGRLVLNKNIDNFF ENEQLAFCP+IVVPGVYYSDDK+LQT
Sbjct  284  FDPLDVTKTWPEDILPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGVYYSDDKMLQT  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIFSYSDTQR+RLGPNYLQLP NAPKCAHHNNH+DG MNFMHRDEE++YFPSRYDP RHA
Sbjct  344  RIFSYSDTQRYRLGPNYLQLPANAPKCAHHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E++PIP  + TGKR+KC+I+KENNFKQPG+RYRS++ DRQERFI RWVEALSDPR+T+EI
Sbjct  404  EKYPIPSTMCTGKREKCVIQKENNFKQPGDRYRSFTPDRQERFIRRWVEALSDPRITYEI  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            RSIWISYW+QADKSLGQKLASRLNVRP++
Sbjct  464  RSIWISYWSQADKSLGQKLASRLNVRPSI  492



>ref|XP_010941422.1| PREDICTED: catalase isozyme B [Elaeis guineensis]
Length=492

 Score =   388 bits (997),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 177/209 (85%), Positives = 196/209 (94%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDV+K WPED++PLQPVGR+VLNKNIDNFFAENEQLAFCPAIVVPG++YSDDKLLQT
Sbjct  284  FDPLDVSKIWPEDIVPLQPVGRMVLNKNIDNFFAENEQLAFCPAIVVPGIHYSDDKLLQT  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            R+FSY+DTQRHRLGPNYL LPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDP RHA
Sbjct  344  RVFSYADTQRHRLGPNYLMLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPVRHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E+ P+PPRVLTGKR+KC+I KENNFKQPGERYRS+   RQERF+ RWVEALSD RVTHEI
Sbjct  404  ERFPLPPRVLTGKREKCVIGKENNFKQPGERYRSFDPARQERFVHRWVEALSDTRVTHEI  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            R IWI+YW+Q DKSLGQKLA+RLN+RP+M
Sbjct  464  RGIWITYWSQCDKSLGQKLATRLNMRPSM  492



>gb|AFU48609.1| catalase 1, partial [Nicotiana benthamiana]
Length=491

 Score =   388 bits (996),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 178/209 (85%), Positives = 199/209 (95%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPED+LPLQPVGRLVLNKNIDNFF ENEQLAFCP+IVVPGVYYSDDK+LQT
Sbjct  283  FDPLDVTKTWPEDILPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGVYYSDDKMLQT  342

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIFSYSDTQR+RLGPNYLQLP NAPKCAHHNNH+DG MNFMHRDEE++YFPSRYDP RHA
Sbjct  343  RIFSYSDTQRYRLGPNYLQLPANAPKCAHHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHA  402

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E++PIP  + TGKR+KC+I+KENNFKQPG+RYRS++ DRQERFI RWVEALSDPR+T+EI
Sbjct  403  EKYPIPSTMCTGKREKCVIQKENNFKQPGDRYRSFTPDRQERFIRRWVEALSDPRITYEI  462

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            RSIWISYW+QADKSLGQKLASRLNVRP++
Sbjct  463  RSIWISYWSQADKSLGQKLASRLNVRPSI  491



>emb|CCP37650.1| catalase-1 [Nicotiana tabacum]
Length=492

 Score =   388 bits (996),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 178/209 (85%), Positives = 199/209 (95%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPED+LPLQPVGRLVLNKNIDNFF ENEQLAFCP+IVVPGVYYSDDK+LQT
Sbjct  284  FDPLDVTKTWPEDILPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGVYYSDDKMLQT  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIFSYSDTQR+RLGPNYLQLP NAPKCAHHNNH+DG MNFMHRDEE++YFPSRYDP RHA
Sbjct  344  RIFSYSDTQRYRLGPNYLQLPANAPKCAHHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E++PIP  + TGKR+KC+I+KENNFKQPG+RYRS++ DRQERFI RWVEALSDPR+T+EI
Sbjct  404  EKYPIPSTMCTGKREKCVIQKENNFKQPGDRYRSFTPDRQERFIRRWVEALSDPRITYEI  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            RSIWISYW+QADKSLGQKLASRLNVRP++
Sbjct  464  RSIWISYWSQADKSLGQKLASRLNVRPSI  492



>ref|XP_011022152.1| PREDICTED: catalase-2-like isoform X1 [Populus euphratica]
Length=511

 Score =   389 bits (998),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 180/209 (86%), Positives = 197/209 (94%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPED+LPL PVGRLVLNKNIDNFFAENEQLAFCPAI+VPG+YYSDDKLLQT
Sbjct  303  FDPLDVTKTWPEDILPLMPVGRLVLNKNIDNFFAENEQLAFCPAIIVPGIYYSDDKLLQT  362

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIFSY+DTQRHRLGPNYLQLP NAPKCAHHNNHH+GFMNFMHRDEEVNYFPSR+DP RHA
Sbjct  363  RIFSYADTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPVRHA  422

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E++P P  + TGKR+KCIIEKENNFKQPGERYRS+S DR+ERF+ RWVEALSDPRVT+EI
Sbjct  423  ERYPNPSVIHTGKREKCIIEKENNFKQPGERYRSFSPDRKERFVRRWVEALSDPRVTYEI  482

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            RSIWISYW+QADKSLGQKLAS LN+RP +
Sbjct  483  RSIWISYWSQADKSLGQKLASHLNMRPGI  511



>gb|AAM97541.1| catalase 2, partial [Capsicum annuum]
Length=484

 Score =   387 bits (995),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 178/209 (85%), Positives = 197/209 (94%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPED+ PLQP+GRLVLNKNIDNFF ENEQLAFCP+IVVPGVYYSDDK+LQT
Sbjct  276  FDPLDVTKTWPEDIFPLQPLGRLVLNKNIDNFFNENEQLAFCPSIVVPGVYYSDDKMLQT  335

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIFSYSDTQR+RLGPNYLQLP NAPKCAHHNNH+DG MNFMHRDEE++YFPSRYDP RHA
Sbjct  336  RIFSYSDTQRYRLGPNYLQLPANAPKCAHHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHA  395

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E +PIP  V +GKR+KCII+KENNF+QPGERYRS+S DRQERFI RWVEALSDPR+T+EI
Sbjct  396  ENYPIPTTVCSGKREKCIIQKENNFQQPGERYRSFSADRQERFIRRWVEALSDPRITYEI  455

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            RSIWISYW+QADKSLGQKLASRLNVRP++
Sbjct  456  RSIWISYWSQADKSLGQKLASRLNVRPSI  484



>ref|XP_009597278.1| PREDICTED: catalase isozyme 1 [Nicotiana tomentosiformis]
 emb|CCP37651.1| catalase-1 [Nicotiana tabacum]
Length=492

 Score =   388 bits (996),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 178/209 (85%), Positives = 198/209 (95%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPED+LPLQPVGRLVLNKNIDNFF ENEQLAFCP+IVVPGVYYSDDK+LQT
Sbjct  284  FDPLDVTKTWPEDILPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGVYYSDDKMLQT  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIFSYSDTQR+RLGPNYLQLP NAPKCAHHNNH+DG MNFMHRDEE++YFPSRYDP RHA
Sbjct  344  RIFSYSDTQRYRLGPNYLQLPANAPKCAHHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E++PIP  + TGKR+KC+I+KENNF QPGERYRS++ DRQERFI RWVEALSDPR+T+EI
Sbjct  404  EKYPIPSTMCTGKREKCVIQKENNFNQPGERYRSFTPDRQERFIRRWVEALSDPRITYEI  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            RSIWISYW+QADKSLGQKLASRLNVRP++
Sbjct  464  RSIWISYWSQADKSLGQKLASRLNVRPSI  492



>ref|NP_001240021.1| catalase [Glycine max]
 dbj|BAG09375.1| peroxisomal catalase [Glycine max]
 gb|KHN20113.1| Catalase-4 [Glycine soja]
Length=492

 Score =   387 bits (995),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 176/209 (84%), Positives = 197/209 (94%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPED++PLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDK+LQT
Sbjct  284  FDPLDVTKTWPEDIIPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKMLQT  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIFSY+D+QRHRLGPNYLQLP NAPKCAHHNNHH+GFMNF+HRDEEVNYFPSRYDP RHA
Sbjct  344  RIFSYADSQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFIHRDEEVNYFPSRYDPVRHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E  PIPP + +G+R+KC IEKENNFKQPGERYRSW+ DRQ+RF  RWV+ALSDPRVTHEI
Sbjct  404  ETFPIPPAICSGRREKCGIEKENNFKQPGERYRSWAPDRQDRFNRRWVDALSDPRVTHEI  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            RS+WISYW+QAD+SLGQK+ASRL++RP +
Sbjct  464  RSVWISYWSQADRSLGQKIASRLSMRPNI  492



>gb|AAB71764.1| catalase 1 [Nicotiana tabacum]
Length=492

 Score =   387 bits (994),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 177/209 (85%), Positives = 199/209 (95%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPED+LPLQPVGRLVLNKNIDNFF ENEQLAFCP+IVVPGVYYSDDK+LQT
Sbjct  284  FDPLDVTKTWPEDILPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGVYYSDDKMLQT  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIFSYSDTQR+RLGPNYLQLP NAPKCAHHNNH+DG MNFMHRDEE++YFPSRYDP RHA
Sbjct  344  RIFSYSDTQRYRLGPNYLQLPANAPKCAHHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E++PIP  + TGKR+KC+I+KENNFKQPG+RYRS++ DRQERFI RWVEALSDPR+T+EI
Sbjct  404  EKYPIPSTMCTGKREKCVIQKENNFKQPGDRYRSFTPDRQERFIRRWVEALSDPRITYEI  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            R+IWISYW+QADKSLGQKLASRLNVRP++
Sbjct  464  RTIWISYWSQADKSLGQKLASRLNVRPSI  492



>gb|EPS69543.1| catalase [Genlisea aurea]
Length=492

 Score =   387 bits (994),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 182/209 (87%), Positives = 195/209 (93%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPED+LPLQPVGRLVLN+NIDNFFAENEQLAFCPAI+VPG+YYSDDKLLQT
Sbjct  284  FDPLDVTKTWPEDVLPLQPVGRLVLNRNIDNFFAENEQLAFCPAIIVPGIYYSDDKLLQT  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIFSY+DTQRHRLGPNYLQLPVNAPK AHHNNHH+GFMNFMHRDEEVNYFPSRYDP RHA
Sbjct  344  RIFSYADTQRHRLGPNYLQLPVNAPKNAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            ++ PIP    +G+R+K  IEKENNFKQPGERYRSW  DRQERFI RWV+ALSDPR+T EI
Sbjct  404  DKVPIPSVPFSGRREKVSIEKENNFKQPGERYRSWDPDRQERFIRRWVDALSDPRLTQEI  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            RSIWISYWTQADKSLGQKLASRLNVRPTM
Sbjct  464  RSIWISYWTQADKSLGQKLASRLNVRPTM  492



>ref|XP_010692546.1| PREDICTED: catalase [Beta vulgaris subsp. vulgaris]
Length=492

 Score =   386 bits (992),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 180/209 (86%), Positives = 194/209 (93%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPED+LPL PVGR+VLNKNIDNFFAENEQLAFCPAIVVPGV YSDDKLLQT
Sbjct  284  FDPLDVTKTWPEDILPLLPVGRMVLNKNIDNFFAENEQLAFCPAIVVPGVSYSDDKLLQT  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIFSYSDTQRHRLGPNYLQLPVNAPKC+HHNNH+DGFMNFMHRDEEV+YFPSRYDP RHA
Sbjct  344  RIFSYSDTQRHRLGPNYLQLPVNAPKCSHHNNHYDGFMNFMHRDEEVDYFPSRYDPVRHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E+HPIP  V+ GKR++ II KENNFKQPGERYRS    RQERFICR V+ALSDPR+THEI
Sbjct  404  ERHPIPSNVINGKRERQIIAKENNFKQPGERYRSMDPARQERFICRVVDALSDPRITHEI  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            RSIW+SYW+QADKSLG K+ASRLNVRPTM
Sbjct  464  RSIWVSYWSQADKSLGMKVASRLNVRPTM  492



>ref|NP_001237571.1| catalase-4 [Glycine max]
 sp|O48561.1|CATA4_SOYBN RecName: Full=Catalase-4 [Glycine max]
 gb|AAB88172.1| catalase [Glycine max]
 gb|KHN33801.1| Catalase-4 [Glycine soja]
Length=492

 Score =   386 bits (992),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 175/209 (84%), Positives = 196/209 (94%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPED++PLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDK+LQT
Sbjct  284  FDPLDVTKTWPEDIIPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKMLQT  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIFSY+D+QRHRLGPNYLQLP NAPKCAHHNNHH+GFMNF+HRDEEVNYFPSRYDP RHA
Sbjct  344  RIFSYADSQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFIHRDEEVNYFPSRYDPVRHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E+ PIPP + +G+R+KC IEKENNFKQPGERYRSW+ DRQ+RF  RWV+ALSDPRVTHEI
Sbjct  404  ERFPIPPAICSGRREKCGIEKENNFKQPGERYRSWAPDRQDRFARRWVDALSDPRVTHEI  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            RS+WISYW+QAD+SLGQK+AS L+ RP +
Sbjct  464  RSVWISYWSQADRSLGQKIASHLSTRPNI  492



>ref|XP_009794245.1| PREDICTED: catalase isozyme 1 [Nicotiana sylvestris]
Length=492

 Score =   385 bits (990),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 177/209 (85%), Positives = 198/209 (95%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPED+LPLQPVGRLVLNKNIDNFF ENEQLAFCP+IVVPGVYYSDDK+LQT
Sbjct  284  FDPLDVTKTWPEDILPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGVYYSDDKMLQT  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIFSYSDTQR+RLGPNYLQLP NAPKCAHHNNH+DG MNFMHRDEE++YFPSRYDP RHA
Sbjct  344  RIFSYSDTQRYRLGPNYLQLPANAPKCAHHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E++PIP  + TGKR+KC+I+KENNFKQ G+RYRS++ DRQERFI RWVEALSDPR+T+EI
Sbjct  404  EKYPIPSTMCTGKREKCVIQKENNFKQAGDRYRSFTPDRQERFIRRWVEALSDPRITYEI  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            RSIWISYW+QADKSLGQKLASRLNVRP++
Sbjct  464  RSIWISYWSQADKSLGQKLASRLNVRPSI  492



>gb|AAD37788.1|AF149283_1 catalase 1 [Phaseolus vulgaris]
Length=428

 Score =   383 bits (984),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 174/204 (85%), Positives = 195/204 (96%), Gaps = 0/204 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVT+  PED+LPLQPVGR+VLNKNIDNFFAENEQLAFCPAI+VPGVYYSDDKLLQT
Sbjct  225  FDPLDVTRICPEDVLPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGVYYSDDKLLQT  284

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIFSY+D+QRHRLGPNYLQ+P NAPKCAHHNNHH+GFMNFMHRDEEVNYFPSRYDP RHA
Sbjct  285  RIFSYADSQRHRLGPNYLQIPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHA  344

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E+ P+PPR+L GKR+KC+IEKENNFKQPGERYRSW++DRQERF+ RWV+ALS+PRVTHEI
Sbjct  345  ERIPVPPRILDGKREKCMIEKENNFKQPGERYRSWASDRQERFLRRWVDALSEPRVTHEI  404

Query  204  RSIWISYWTQADKSLGQKLASRLN  133
            RSIWISYW+QAD+SLGQK+AS LN
Sbjct  405  RSIWISYWSQADRSLGQKIASHLN  428



>sp|P49315.1|CATA1_NICPL RecName: Full=Catalase isozyme 1, partial [Nicotiana plumbaginifolia]
 emb|CAA85424.1| catalase [Nicotiana plumbaginifolia]
Length=485

 Score =   385 bits (988),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 177/209 (85%), Positives = 197/209 (94%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPED+LPLQPVGRLVLNKNIDNF  ENEQLAFCP+IVVPGVYYSDDK+LQT
Sbjct  277  FDPLDVTKTWPEDILPLQPVGRLVLNKNIDNFSNENEQLAFCPSIVVPGVYYSDDKMLQT  336

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIFSYSDTQR+RLGPNYLQLP NAPKCAHHNNH+DG MNFMHRDEE++YFPSRYDP RHA
Sbjct  337  RIFSYSDTQRYRLGPNYLQLPANAPKCAHHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHA  396

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E++PIP  + TGKR+KC+I+KENNFKQPGERYRS++ DRQERFI RWVE LSDPR+T+EI
Sbjct  397  EKYPIPSTMCTGKREKCVIQKENNFKQPGERYRSFTPDRQERFIRRWVETLSDPRITYEI  456

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            RSIWISYW+QADKSLGQKLASRLNVRP++
Sbjct  457  RSIWISYWSQADKSLGQKLASRLNVRPSI  485



>gb|AAR14052.2| catalase [Solanum tuberosum]
Length=475

 Score =   384 bits (987),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 178/209 (85%), Positives = 197/209 (94%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPED+LPLQPVGRLVLNKNIDNFF ENEQLAFCP+IVVPGVYYSDDK+LQT
Sbjct  267  FDPLDVTKTWPEDILPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGVYYSDDKMLQT  326

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIFSYSDTQR+RLGPNYLQLP NAPKCAHHNNH+DG MNFMHRDEE++YFPSRYD  RHA
Sbjct  327  RIFSYSDTQRYRLGPNYLQLPANAPKCAHHNNHYDGSMNFMHRDEEIDYFPSRYDQVRHA  386

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E +PIP  V +GKR+KCII+KENNFKQPGERYR+++ DRQERFI RWVEALSDPR+T+EI
Sbjct  387  EVYPIPSTVCSGKREKCIIQKENNFKQPGERYRTFTPDRQERFIRRWVEALSDPRITYEI  446

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            RSIWISYW+QADKSLGQKLASRLNVRP++
Sbjct  447  RSIWISYWSQADKSLGQKLASRLNVRPSI  475



>gb|AGV54297.1| peroxisomal catalase [Phaseolus vulgaris]
Length=492

 Score =   385 bits (989),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 174/209 (83%), Positives = 195/209 (93%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPED++PLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDK+LQT
Sbjct  284  FDPLDVTKTWPEDIIPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKMLQT  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIFSY+D+QRHRLGPNYLQLP NAPKCAHHNNHH+GFMNF+HRDEEVNYFPSRYD  RHA
Sbjct  344  RIFSYADSQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFIHRDEEVNYFPSRYDSVRHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E  PIPP + +G+R+KC IEKENNFKQ GER+RSW+ DRQ+RFI RWV+ALSDPRVTHEI
Sbjct  404  ESFPIPPAICSGRREKCGIEKENNFKQAGERFRSWAPDRQDRFIRRWVDALSDPRVTHEI  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            RS+WISYW+QAD+SLGQK+AS LN+RP +
Sbjct  464  RSVWISYWSQADRSLGQKIASHLNMRPNI  492



>ref|XP_006412154.1| hypothetical protein EUTSA_v10024932mg [Eutrema salsugineum]
 gb|ESQ53607.1| hypothetical protein EUTSA_v10024932mg [Eutrema salsugineum]
Length=518

 Score =   385 bits (990),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 181/235 (77%), Positives = 202/235 (86%), Gaps = 26/235 (11%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPED+LPLQPVGR+VLNKNIDNFFAENEQLAFCPAI+VPG++YSDDKLLQT
Sbjct  284  FDPLDVTKTWPEDILPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQT  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            R+FSY+DTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDP RHA
Sbjct  344  RVFSYADTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPVRHA  403

Query  384  EQHPIPPRVLTGKRDK--------------------------CIIEKENNFKQPGERYRS  283
            E++P PP V +GKR++                          CIIEKENNFK+PGERYRS
Sbjct  404  EKYPTPPAVCSGKRERVSNQIKPIFFSVSVSYGSESLKFVLQCIIEKENNFKEPGERYRS  463

Query  282  WSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  118
            ++ +RQERFI RW+EALSDPR+THEIRSIWISYW+QADKSLGQKLASRLNVRP++
Sbjct  464  FAPERQERFIRRWIEALSDPRITHEIRSIWISYWSQADKSLGQKLASRLNVRPSI  518



>gb|AFW69584.1| catalase1 [Zea mays]
Length=353

 Score =   380 bits (975),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 173/209 (83%), Positives = 196/209 (94%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPED++PLQPVGR+VLNKN+DNFFAENEQ+AFCPAI+VPG++YSDDKLLQT
Sbjct  145  FDPLDVTKTWPEDIIPLQPVGRMVLNKNVDNFFAENEQIAFCPAIIVPGIHYSDDKLLQT  204

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIFSY+DTQRHRLGPNYL LPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSR+DP RHA
Sbjct  205  RIFSYADTQRHRLGPNYLMLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRFDPARHA  264

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E+ PIPPRVLTG R+KCII+KENNFKQ GERYRS+   RQ+RFI RWV+AL+DPRVTHE 
Sbjct  265  EKVPIPPRVLTGCREKCIIQKENNFKQAGERYRSFDPARQDRFIQRWVDALTDPRVTHEH  324

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            R+IWISYW+Q D +LGQKLASRLN++P+M
Sbjct  325  RTIWISYWSQCDAALGQKLASRLNLKPSM  353



>ref|XP_007136018.1| hypothetical protein PHAVU_009G011100g [Phaseolus vulgaris]
 gb|ESW08012.1| hypothetical protein PHAVU_009G011100g [Phaseolus vulgaris]
Length=492

 Score =   384 bits (986),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 174/209 (83%), Positives = 195/209 (93%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPED++PLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDK+LQT
Sbjct  284  FDPLDVTKTWPEDIIPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKMLQT  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIFSY+D+QRHRLGPNYLQLP NAPKCAHHNNHH+GFMNF+HRDEEVNYFPSRYD  RHA
Sbjct  344  RIFSYADSQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFIHRDEEVNYFPSRYDSVRHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E  PIPP + +G+R+KC IEKENNFKQ GER+RSW+ DRQ+RFI RWV+ALSDPRVTHEI
Sbjct  404  ESFPIPPAICSGRREKCGIEKENNFKQAGERFRSWAPDRQDRFIRRWVDALSDPRVTHEI  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            RS+WISYW+QAD+SLGQK+AS LN+RP +
Sbjct  464  RSVWISYWSQADRSLGQKIASHLNMRPNI  492



>gb|AAR84578.1| catalase 1a [Lotus japonicus]
Length=492

 Score =   384 bits (986),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 173/209 (83%), Positives = 197/209 (94%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPED++PLQPVGR+VLNKNIDNFFAENEQLAFCPAIVVPG+ YSDDK+LQT
Sbjct  284  FDPLDVTKTWPEDIIPLQPVGRMVLNKNIDNFFAENEQLAFCPAIVVPGISYSDDKMLQT  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIFSY+D+QRHRLGPNYLQLP NAPKCAHHNNHH+GFMNFMHRDEEVNYFPSRYDP RHA
Sbjct  344  RIFSYADSQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E++PIPP + TG R++C IEKENNFKQPGERYRS++ DRQ+RF+ RWV+ALSDPRVTHEI
Sbjct  404  ERYPIPPAICTGSRERCAIEKENNFKQPGERYRSFAPDRQDRFVRRWVDALSDPRVTHEI  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            RS WISYW+QAD+SLGQK+AS LN+RP++
Sbjct  464  RSTWISYWSQADRSLGQKIASHLNLRPSI  492



>gb|KGN55500.1| hypothetical protein Csa_4G658600 [Cucumis sativus]
Length=405

 Score =   381 bits (978),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 174/206 (84%), Positives = 193/206 (94%), Gaps = 0/206 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPED+LPLQPVGRLVLNKNIDNFFAENEQLAFCPAI+VPG+YYSDDKLLQT
Sbjct  197  FDPLDVTKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIIVPGIYYSDDKLLQT  256

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIFSY+DTQR+RLGPNYLQLPVNAPKCA+HNNHHDGFMNFM RDEE+NYFPSR DP RHA
Sbjct  257  RIFSYADTQRYRLGPNYLQLPVNAPKCAYHNNHHDGFMNFMDRDEEINYFPSRIDPTRHA  316

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E++P P  V TGKR++C+IEKENNFKQPGERYRSW +DRQERF+ RWV+ALSDPRVTHEI
Sbjct  317  ERYPQPSAVYTGKRERCVIEKENNFKQPGERYRSWPSDRQERFVGRWVDALSDPRVTHEI  376

Query  204  RSIWISYWTQADKSLGQKLASRLNVR  127
            R+IWISYW+QADKSLG KLAS  N++
Sbjct  377  RNIWISYWSQADKSLGHKLASHFNLK  402



>gb|AAK67359.2|AF390210_1 catalase [Suaeda salsa]
Length=492

 Score =   384 bits (985),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 182/209 (87%), Positives = 194/209 (93%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPED+LPLQPVGRLVLNKNIDNFFAENEQLAFCP+IVVPGV+YSDDKLLQT
Sbjct  284  FDPLDVTKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPSIVVPGVHYSDDKLLQT  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIFSYSDTQRHRLGPNYLQLPVNAPKC+HHNNH+DGFMNFMHRDEEV+YFPSRYDP RHA
Sbjct  344  RIFSYSDTQRHRLGPNYLQLPVNAPKCSHHNNHYDGFMNFMHRDEEVDYFPSRYDPVRHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E++PIP  VL G R+K  I KENNFKQPGERYRS    RQERFICR V+ALSDPRVTHEI
Sbjct  404  ERYPIPSNVLNGCREKQCIPKENNFKQPGERYRSMDPARQERFICRVVDALSDPRVTHEI  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            RSIWISYW+QADKSLG K+ASRLNVRPTM
Sbjct  464  RSIWISYWSQADKSLGMKVASRLNVRPTM  492



>ref|XP_006340832.1| PREDICTED: catalase isozyme 2 [Solanum tuberosum]
Length=492

 Score =   383 bits (984),  Expect = 9e-128, Method: Compositional matrix adjust.
 Identities = 177/209 (85%), Positives = 197/209 (94%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPED+LPLQPVGRLVLNKNIDNFF ENEQLAFCP+IVVPGVYYSDDK+LQT
Sbjct  284  FDPLDVTKTWPEDILPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGVYYSDDKMLQT  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIFSYSDTQR+RLGPNYLQLP NAPKCAHHNNH+DG MNFMHRDEE++YFPSRYD  RHA
Sbjct  344  RIFSYSDTQRYRLGPNYLQLPANAPKCAHHNNHYDGSMNFMHRDEEIDYFPSRYDQVRHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E +PIP  V +GKR+KCII+KENNFKQPGERYR+++ DRQERFI RWVEALSDPR+T+EI
Sbjct  404  EVYPIPSTVCSGKREKCIIQKENNFKQPGERYRTFTPDRQERFIRRWVEALSDPRITYEI  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            RSIWI+YW+QADKSLGQKLASRLNVRP++
Sbjct  464  RSIWITYWSQADKSLGQKLASRLNVRPSI  492



>ref|XP_004300681.1| PREDICTED: catalase isozyme 1 [Fragaria vesca subsp. vesca]
Length=492

 Score =   383 bits (984),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 179/209 (86%), Positives = 193/209 (92%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPED+LPLQPVGRLVLN+NIDNFFAENEQLAFCPA++VPGVYYSDDKLLQT
Sbjct  284  FDPLDVTKTWPEDILPLQPVGRLVLNRNIDNFFAENEQLAFCPALIVPGVYYSDDKLLQT  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIFSY+DTQRHRLGPNYLQLPVNAPK AHHNNHH+G MNFMHRDEEVNYFPSR+DP RHA
Sbjct  344  RIFSYADTQRHRLGPNYLQLPVNAPKSAHHNNHHEGLMNFMHRDEEVNYFPSRFDPVRHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E HPIP  V TG+R+K IIEKENNFKQ GERYRS++ DRQER+I RWV+ALSDPR THEI
Sbjct  404  ESHPIPSAVYTGRREKSIIEKENNFKQAGERYRSFAPDRQERYIRRWVDALSDPRCTHEI  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            RSIWISYW+QADKSLGQKLAS LNVRP  
Sbjct  464  RSIWISYWSQADKSLGQKLASHLNVRPNF  492



>emb|CDP07288.1| unnamed protein product [Coffea canephora]
Length=492

 Score =   383 bits (984),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 174/209 (83%), Positives = 193/209 (92%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDV+K WPED+LPLQPVGRLVLNKNIDN+FAE EQLAF PA VVPG+YY++DKLLQT
Sbjct  284  FDPLDVSKIWPEDILPLQPVGRLVLNKNIDNYFAETEQLAFNPAFVVPGIYYTEDKLLQT  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIF+Y DTQRHRLGPNY+QLPVNAPKCAHHNNH+DGFMNFMHRDEEV+YFPSR+DP RHA
Sbjct  344  RIFAYGDTQRHRLGPNYMQLPVNAPKCAHHNNHYDGFMNFMHRDEEVDYFPSRFDPVRHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
             +HPIP  VL GKRD+C+I KENNFKQ GERYRSW+ DRQERFICRWV+ LSD RVTHEI
Sbjct  404  ARHPIPSTVLRGKRDRCVIPKENNFKQAGERYRSWAPDRQERFICRWVDILSDARVTHEI  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            RSIWISYW+QADKSLGQK+A+RLNVRPTM
Sbjct  464  RSIWISYWSQADKSLGQKMATRLNVRPTM  492



>gb|ABM47415.1| catalase [Prunus avium]
Length=492

 Score =   383 bits (984),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 178/209 (85%), Positives = 196/209 (94%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLD+TKTWPED+LPLQPVGRLVLNKNIDNFFAENEQLAF PA VVPG+YYSDDKLLQT
Sbjct  284  FDPLDLTKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFNPAFVVPGIYYSDDKLLQT  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIF+YSDTQRHRLGPNY+QLPVNAPKC HHNNH DGFMNFMHRDEEVNYFPSRYDP RHA
Sbjct  344  RIFAYSDTQRHRLGPNYMQLPVNAPKCPHHNNHQDGFMNFMHRDEEVNYFPSRYDPVRHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E+ PIP  +LTGKR++ +IEKENNFKQPGERYRSW+ DRQERFI R V+ALSDPRV+HEI
Sbjct  404  ERFPIPSNILTGKRERRVIEKENNFKQPGERYRSWAPDRQERFIRRCVDALSDPRVSHEI  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            RSIWISYW+QADKSLGQK+A+RLNVRP++
Sbjct  464  RSIWISYWSQADKSLGQKIATRLNVRPSI  492



>ref|XP_004500877.1| PREDICTED: catalase-4-like isoform X2 [Cicer arietinum]
Length=492

 Score =   383 bits (983),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 172/209 (82%), Positives = 196/209 (94%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPED++PLQPVGRLVLNKNIDNFFAENEQLAFCPAI+VPGVYYSDDK+LQT
Sbjct  284  FDPLDVTKTWPEDIIPLQPVGRLVLNKNIDNFFAENEQLAFCPAIIVPGVYYSDDKMLQT  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIFSY+D+QRHRLGPNYLQLP NAPKCAHHNNHH+GFMNF+HRDEEVNYFPSR+DP RHA
Sbjct  344  RIFSYADSQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFIHRDEEVNYFPSRHDPVRHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E+ P PP  L+GKR++CI  KENNFKQPGERYR+W+ DRQ+RF  RW+EALSDPRVTHE+
Sbjct  404  ERFPTPPAALSGKRERCIRPKENNFKQPGERYRTWAPDRQDRFARRWIEALSDPRVTHEV  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            RSIWISYW+QAD+SLGQK+AS LN+RP++
Sbjct  464  RSIWISYWSQADRSLGQKIASHLNMRPSI  492



>ref|XP_004500876.1| PREDICTED: catalase-4-like isoform X1 [Cicer arietinum]
Length=493

 Score =   383 bits (983),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 172/209 (82%), Positives = 196/209 (94%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPED++PLQPVGRLVLNKNIDNFFAENEQLAFCPAI+VPGVYYSDDK+LQT
Sbjct  285  FDPLDVTKTWPEDIIPLQPVGRLVLNKNIDNFFAENEQLAFCPAIIVPGVYYSDDKMLQT  344

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIFSY+D+QRHRLGPNYLQLP NAPKCAHHNNHH+GFMNF+HRDEEVNYFPSR+DP RHA
Sbjct  345  RIFSYADSQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFIHRDEEVNYFPSRHDPVRHA  404

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E+ P PP  L+GKR++CI  KENNFKQPGERYR+W+ DRQ+RF  RW+EALSDPRVTHE+
Sbjct  405  ERFPTPPAALSGKRERCIRPKENNFKQPGERYRTWAPDRQDRFARRWIEALSDPRVTHEV  464

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            RSIWISYW+QAD+SLGQK+AS LN+RP++
Sbjct  465  RSIWISYWSQADRSLGQKIASHLNMRPSI  493



>gb|AAC17731.1| catalase 1 [Arabidopsis thaliana]
Length=492

 Score =   382 bits (982),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 176/209 (84%), Positives = 193/209 (92%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTK WPED+LPLQPVGRLVLNKNIDNFF ENEQ+AFCPA+VVPG++YSDDKLLQT
Sbjct  284  FDPLDVTKIWPEDILPLQPVGRLVLNKNIDNFFNENEQIAFCPALVVPGIHYSDDKLLQT  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIFSY+D+QRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSR DP RHA
Sbjct  344  RIFSYADSQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRLDPVRHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E++P  P V +G R+KC I KENNFKQPGERYRSW +DRQERF+ R+VEALS+PRVTHEI
Sbjct  404  EKYPTTPIVCSGNREKCFIRKENNFKQPGERYRSWDSDRQERFVKRFVEALSEPRVTHEI  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            RSIWISYW+QADKSLGQKLA+RLNVRP  
Sbjct  464  RSIWISYWSQADKSLGQKLATRLNVRPNF  492



>gb|AHB72694.1| catalase [Beta vulgaris subsp. maritima]
Length=492

 Score =   382 bits (982),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 179/209 (86%), Positives = 192/209 (92%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPED+LPL PVGR+VLNKNIDNFFAENEQLAFCPAIVVPGV YSDDKLLQT
Sbjct  284  FDPLDVTKTWPEDILPLLPVGRMVLNKNIDNFFAENEQLAFCPAIVVPGVSYSDDKLLQT  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIFSYSDTQRHRLGPNYLQLPVNAPKC+HHNNH+DGFMNFMHRDEEV+YFPSRYDP RHA
Sbjct  344  RIFSYSDTQRHRLGPNYLQLPVNAPKCSHHNNHYDGFMNFMHRDEEVDYFPSRYDPVRHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E+HPIP  V+ GKR++ II KENNFKQPGERYRS    RQERFICR V+AL DPR+THEI
Sbjct  404  ERHPIPSNVINGKRERQIIAKENNFKQPGERYRSMDPARQERFICRVVDALFDPRITHEI  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            RSIW+SYW QADKSLG K+ASRLNVRPTM
Sbjct  464  RSIWVSYWFQADKSLGMKVASRLNVRPTM  492



>gb|AGC65520.1| catalase [Eriobotrya japonica]
 gb|AGC65522.1| catalase [Eriobotrya japonica]
 gb|AGC65523.1| catalase [Eriobotrya japonica]
 gb|AGC65524.1| catalase [Eriobotrya japonica]
 gb|AGE15297.2| catalase 2 [Eriobotrya japonica]
Length=492

 Score =   382 bits (982),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 175/209 (84%), Positives = 195/209 (93%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLD TKTWPED+LPLQPVGRLVLNKNIDNFFAENEQLAF PA VVPGVYYS+DK+LQT
Sbjct  284  FDPLDDTKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFNPAFVVPGVYYSNDKMLQT  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            R+F+YSDTQRHRLGPNYLQLPVNAPKCAHHNNH+DGFMNFMHRDEEV+YFPSRY P RHA
Sbjct  344  RLFAYSDTQRHRLGPNYLQLPVNAPKCAHHNNHYDGFMNFMHRDEEVDYFPSRYQPARHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E  PIP  ++TGKRDKC+IEKENNFKQPGERYRSW+ DRQERF+ RWV+ LS+PRVT+EI
Sbjct  404  ETFPIPSNIITGKRDKCVIEKENNFKQPGERYRSWAPDRQERFLHRWVDVLSEPRVTYEI  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            RSIWISYW+QAD+S GQKLA+RLNVRP++
Sbjct  464  RSIWISYWSQADRSFGQKLATRLNVRPSI  492



>ref|NP_564121.1| catalase 1 [Arabidopsis thaliana]
 sp|Q96528.3|CATA1_ARATH RecName: Full=Catalase-1 [Arabidopsis thaliana]
 gb|AAM97090.1| expressed protein [Arabidopsis thaliana]
 gb|AAQ56816.1| At1g20630 [Arabidopsis thaliana]
 dbj|BAE99222.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE29998.1| catalase 1 [Arabidopsis thaliana]
Length=492

 Score =   382 bits (981),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 176/209 (84%), Positives = 193/209 (92%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTK WPED+LPLQPVGRLVLNKNIDNFF ENEQ+AFCPA+VVPG++YSDDKLLQT
Sbjct  284  FDPLDVTKIWPEDILPLQPVGRLVLNKNIDNFFNENEQIAFCPALVVPGIHYSDDKLLQT  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIFSY+D+QRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSR DP RHA
Sbjct  344  RIFSYADSQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRLDPVRHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E++P  P V +G R+KC I KENNFKQPGERYRSW +DRQERF+ R+VEALS+PRVTHEI
Sbjct  404  EKYPTTPIVCSGNREKCFIGKENNFKQPGERYRSWDSDRQERFVKRFVEALSEPRVTHEI  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            RSIWISYW+QADKSLGQKLA+RLNVRP  
Sbjct  464  RSIWISYWSQADKSLGQKLATRLNVRPNF  492



>ref|NP_001241808.1| catalase isozyme B [Zea mays]
 gb|ACG48924.1| catalase isozyme B [Zea mays]
 gb|ACN25578.1| unknown [Zea mays]
 gb|AFW69583.1| catalase1 [Zea mays]
Length=492

 Score =   381 bits (979),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 173/209 (83%), Positives = 196/209 (94%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPED++PLQPVGR+VLNKN+DNFFAENEQ+AFCPAI+VPG++YSDDKLLQT
Sbjct  284  FDPLDVTKTWPEDIIPLQPVGRMVLNKNVDNFFAENEQIAFCPAIIVPGIHYSDDKLLQT  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIFSY+DTQRHRLGPNYL LPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSR+DP RHA
Sbjct  344  RIFSYADTQRHRLGPNYLMLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRFDPARHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E+ PIPPRVLTG R+KCII+KENNFKQ GERYRS+   RQ+RFI RWV+AL+DPRVTHE 
Sbjct  404  EKVPIPPRVLTGCREKCIIQKENNFKQAGERYRSFDPARQDRFIQRWVDALTDPRVTHEH  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            R+IWISYW+Q D +LGQKLASRLN++P+M
Sbjct  464  RTIWISYWSQCDAALGQKLASRLNLKPSM  492



>emb|CAA42720.1| catalase-1 [Zea mays]
Length=492

 Score =   381 bits (978),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 173/209 (83%), Positives = 196/209 (94%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPED++PLQPVGR+VLNKN+DNFFAENEQ+AFCPAI+VPG++YSDDKLLQT
Sbjct  284  FDPLDVTKTWPEDIIPLQPVGRMVLNKNVDNFFAENEQIAFCPAIIVPGIHYSDDKLLQT  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIFSY+DTQRHRLGPNYL LPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSR+DP RHA
Sbjct  344  RIFSYADTQRHRLGPNYLMLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRFDPARHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E+ PIPPRVLTG R+KCII+KENNFKQ GERYRS+   RQ+RFI RWV+AL+DPRVTHE 
Sbjct  404  EKVPIPPRVLTGCREKCIIQKENNFKQAGERYRSFDPARQDRFIQRWVDALTDPRVTHEH  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            R+IWISYW+Q D +LGQKLASRLN++P+M
Sbjct  464  RTIWISYWSQCDAALGQKLASRLNLKPSM  492



>gb|AIP93616.1| CAT1 [Bassia scoparia]
Length=492

 Score =   381 bits (978),  Expect = 8e-127, Method: Compositional matrix adjust.
 Identities = 178/209 (85%), Positives = 193/209 (92%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPED+LPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPG++YSDDKLLQT
Sbjct  284  FDPLDVTKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGIHYSDDKLLQT  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIFSYSDTQRHRLGPNYLQLPVNAPKC+HHNNH+DGFMNFMHR EEV+YFPSRYDP RHA
Sbjct  344  RIFSYSDTQRHRLGPNYLQLPVNAPKCSHHNNHYDGFMNFMHRGEEVDYFPSRYDPVRHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E+ PIP  + TG+R++ II KENNFKQPGERYRS    RQERFICR V+ALSDPR+THEI
Sbjct  404  EKFPIPSNICTGRRERQIIPKENNFKQPGERYRSMDPARQERFICRVVDALSDPRITHEI  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            RSIWISYWTQADKSLG K+ASRLNV+ TM
Sbjct  464  RSIWISYWTQADKSLGMKVASRLNVKATM  492



>dbj|BAJ87148.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=302

 Score =   373 bits (958),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 168/209 (80%), Positives = 193/209 (92%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPED++PLQPVGR+VLNKNIDNFFAENEQLAFCPA+ VPG++YSDDKLLQT
Sbjct  94   FDPLDVTKTWPEDIIPLQPVGRMVLNKNIDNFFAENEQLAFCPAVTVPGIHYSDDKLLQT  153

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIFSY+DTQRHRLGPNYL LPVNAPKCAHHNNHHDG MNF+HRDEEVNYFPSR+DP RHA
Sbjct  154  RIFSYADTQRHRLGPNYLMLPVNAPKCAHHNNHHDGLMNFIHRDEEVNYFPSRFDPTRHA  213

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E++P+PPRVL+G R+KCII+KENNFKQ GERYRS+   RQ+RF+ RWV+AL+D RVTHEI
Sbjct  214  EKYPMPPRVLSGCREKCIIDKENNFKQAGERYRSFDPARQDRFLQRWVDALTDARVTHEI  273

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            +SIW+SYW+Q D SLGQKLASRL ++P M
Sbjct  274  QSIWVSYWSQCDASLGQKLASRLKIKPNM  302



>ref|NP_001234186.1| catalase isozyme 2 [Solanum lycopersicum]
 sp|Q9XHH3.1|CATA2_SOLLC RecName: Full=Catalase isozyme 2 [Solanum lycopersicum]
 gb|AAD41256.1| catalase 2 [Solanum lycopersicum]
Length=492

 Score =   380 bits (976),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 176/209 (84%), Positives = 195/209 (93%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPED+LPLQPVGRLVLNKNIDNF   NEQLAFCP+IVVPGVYYSDDK+LQT
Sbjct  284  FDPLDVTKTWPEDILPLQPVGRLVLNKNIDNFLYMNEQLAFCPSIVVPGVYYSDDKMLQT  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIFSYSDTQR+RLGPNYLQLP NAPKCAHHNNH+DG MNFMHRDEE++YFPSRYD  RHA
Sbjct  344  RIFSYSDTQRYRLGPNYLQLPANAPKCAHHNNHYDGSMNFMHRDEEIDYFPSRYDQVRHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E +PIP  V +GKR+KCII+KENNFKQPGERYRS++ DRQERFI RWVEALSDPR+T+EI
Sbjct  404  EVYPIPSTVCSGKREKCIIQKENNFKQPGERYRSFTPDRQERFIRRWVEALSDPRITYEI  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            RSIWI+YW+QADKSLGQKLASRLNVRP++
Sbjct  464  RSIWITYWSQADKSLGQKLASRLNVRPSI  492



>gb|AAG43363.1|AF151368_1 catalase [Hevea brasiliensis]
Length=492

 Score =   379 bits (974),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 175/209 (84%), Positives = 192/209 (92%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPED+LPLQPVGRLVLNKNIDNFFAENEQLAFCP IVVPG+ YS+DKLLQT
Sbjct  284  FDPLDVTKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPGIVVPGISYSEDKLLQT  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIFSYSDTQRHRLG NYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSR DP RH+
Sbjct  344  RIFSYSDTQRHRLGSNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRCDPVRHS  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E+ PIP  + +G+RDKC+IEKENNF+QPGERYRSW+ DRQERF+ R V  LSDPR+THE+
Sbjct  404  ERFPIPSTICSGRRDKCVIEKENNFEQPGERYRSWAPDRQERFLNRMVGCLSDPRITHEL  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            RSIWISYWTQ D+SLGQKLA RLNVRP++
Sbjct  464  RSIWISYWTQCDRSLGQKLAFRLNVRPSI  492



>sp|P32290.1|CATA_VIGRR RecName: Full=Catalase [Vigna radiata var. radiata]
 dbj|BAA02755.1| catalase [Vigna radiata var. radiata]
Length=492

 Score =   379 bits (974),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 172/209 (82%), Positives = 194/209 (93%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPED++PLQPVGRLVLNKNIDNFFAENEQLAFCPAI+VPGVYYSDDK+LQT
Sbjct  284  FDPLDVTKTWPEDIIPLQPVGRLVLNKNIDNFFAENEQLAFCPAIIVPGVYYSDDKMLQT  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIFSY+D+QRHRLGPNYL LP NAPK AHHNNHH+GFMNF+HRDEEVNYFPSRYDP RHA
Sbjct  344  RIFSYADSQRHRLGPNYLLLPANAPKSAHHNNHHEGFMNFIHRDEEVNYFPSRYDPVRHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E+ PIPP V +G+R+K  IEKENNFKQ GER+RSW+ DRQ+RFI RWV+ALSDPRVTHEI
Sbjct  404  EKFPIPPAVFSGRREKIAIEKENNFKQAGERFRSWAPDRQDRFIRRWVDALSDPRVTHEI  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            RS+WISYW+QAD+SLGQK+AS LN+RP +
Sbjct  464  RSVWISYWSQADRSLGQKIASHLNMRPNI  492



>ref|XP_009103333.1| PREDICTED: catalase-1 [Brassica rapa]
Length=492

 Score =   379 bits (973),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 175/207 (85%), Positives = 193/207 (93%), Gaps = 0/207 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTK WPED+LPLQPVGRLVLNKNIDNFF ENEQ+AFCPAIVVPGV+YSDDKLLQT
Sbjct  284  FDPLDVTKIWPEDILPLQPVGRLVLNKNIDNFFNENEQIAFCPAIVVPGVHYSDDKLLQT  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIFSY+D+QRHRLGPNYLQLPVNAPKCAHHNNHH+GFMNFMHRDEEVNYFPSR +P RHA
Sbjct  344  RIFSYADSQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRLNPVRHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            +++P  P   +G R+KC+IEKENNF+QPGERYRSW  DRQERF+ R+VEAL++PRVTHEI
Sbjct  404  DKYPTTPVFCSGNREKCMIEKENNFQQPGERYRSWDADRQERFVKRFVEALAEPRVTHEI  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRP  124
            RSIWISYWTQADKSLGQKLASRLNVRP
Sbjct  464  RSIWISYWTQADKSLGQKLASRLNVRP  490



>emb|CDY31877.1| BnaC07g15270D [Brassica napus]
Length=492

 Score =   379 bits (973),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 175/207 (85%), Positives = 193/207 (93%), Gaps = 0/207 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTK WPED+LPLQPVGRLVLNKNIDNFF ENEQ+AFCPAIVVPGV+YSDDKLLQT
Sbjct  284  FDPLDVTKIWPEDILPLQPVGRLVLNKNIDNFFNENEQIAFCPAIVVPGVHYSDDKLLQT  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIFSY+D+QRHRLGPNYLQLPVNAPKCAHHNNHH+GFMNFMHRDEEVNYFPSR +P RHA
Sbjct  344  RIFSYADSQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRLNPVRHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            +++P  P   +G R+KC+IEKENNF+QPGERYRSW  DRQERF+ R+VEAL++PRVTHEI
Sbjct  404  DKYPTTPVFCSGNREKCMIEKENNFQQPGERYRSWDADRQERFVKRFVEALAEPRVTHEI  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRP  124
            RSIWISYWTQADKSLGQKLASRLNVRP
Sbjct  464  RSIWISYWTQADKSLGQKLASRLNVRP  490



>emb|CDY01363.1| BnaA07g11360D [Brassica napus]
Length=492

 Score =   379 bits (972),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 175/207 (85%), Positives = 193/207 (93%), Gaps = 0/207 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTK WPED+LPLQPVGRLVLNKNIDNFF ENEQ+AFCPAIVVPGV+YSDDKLLQT
Sbjct  284  FDPLDVTKIWPEDVLPLQPVGRLVLNKNIDNFFNENEQIAFCPAIVVPGVHYSDDKLLQT  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIFSY+D+QRHRLGPNYLQLPVNAPKCAHHNNHH+GFMNFMHRDEEVNYFPSR +P RHA
Sbjct  344  RIFSYADSQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRLNPVRHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            +++P  P   +G R+KC+IEKENNF+QPGERYRSW  DRQERF+ R+VEAL++PRVTHEI
Sbjct  404  DKYPTTPVFCSGNREKCMIEKENNFQQPGERYRSWDADRQERFVKRFVEALAEPRVTHEI  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRP  124
            RSIWISYWTQADKSLGQKLASRLNVRP
Sbjct  464  RSIWISYWTQADKSLGQKLASRLNVRP  490



>ref|XP_010061172.1| PREDICTED: catalase isozyme 3-like [Eucalyptus grandis]
 gb|KCW68094.1| hypothetical protein EUGRSUZ_F01776 [Eucalyptus grandis]
Length=492

 Score =   379 bits (972),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 172/209 (82%), Positives = 195/209 (93%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLD+TK WPED+LPLQPVGRLVLNKN+DNFFAENEQLAF PA VVPG+YYS+DKLLQ 
Sbjct  284  FDPLDMTKEWPEDILPLQPVGRLVLNKNVDNFFAENEQLAFNPAFVVPGIYYSNDKLLQA  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIF+YSDT R+RLGPNYLQLPVNAPKCAHHNNHHDGFMN MHRDEE+NYFPS++DP RHA
Sbjct  344  RIFAYSDTHRYRLGPNYLQLPVNAPKCAHHNNHHDGFMNIMHRDEEINYFPSKFDPVRHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E++PIP +++TGKR+K IIEKENNFKQPGERYRSW+ DRQERFI RW++AL++PRVTHE 
Sbjct  404  ERYPIPSQIVTGKREKVIIEKENNFKQPGERYRSWAPDRQERFINRWIKALTEPRVTHEH  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            RSIWISYWTQADKSLGQKLASRL+ RP+M
Sbjct  464  RSIWISYWTQADKSLGQKLASRLSARPSM  492



>sp|Q01297.2|CATA1_RICCO RecName: Full=Catalase isozyme 1 [Ricinus communis]
 gb|AAB31537.1| catalase 1 [Ricinus communis=castor beans, hypocotyls, Peptide, 
492 aa]
 dbj|BAA04697.1| catalase CAT1 [Ricinus communis]
Length=492

 Score =   379 bits (972),  Expect = 7e-126, Method: Compositional matrix adjust.
 Identities = 174/209 (83%), Positives = 192/209 (92%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPED+LPLQPVGRLVLNKNIDNFFAENEQLAFCP IVVPGV YS+DKLLQT
Sbjct  284  FDPLDVTKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPGIVVPGVSYSEDKLLQT  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHH+GFMNFMHRDEEVNYFPSR DP R+A
Sbjct  344  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRCDPARNA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E  P+P  + +GKR+KC+IEKENNFKQPGERYRSW+ DRQERF+ R V  LSDPR+THE+
Sbjct  404  ESFPVPSAICSGKREKCVIEKENNFKQPGERYRSWAPDRQERFLNRLVGGLSDPRITHEL  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            R+IWISYW Q DKSLGQKLA+RLNV+P++
Sbjct  464  RTIWISYWIQCDKSLGQKLATRLNVKPSI  492



>gb|ABY21704.1| catalase-1 precursor [Panax ginseng]
Length=492

 Score =   378 bits (971),  Expect = 9e-126, Method: Compositional matrix adjust.
 Identities = 177/209 (85%), Positives = 195/209 (93%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPED+LPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQ+
Sbjct  284  FDPLDVTKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQS  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIFSY+DTQRHRLGPNYLQLP NAPK AHHNNHH+G MNFMHRDEEVNYFPSR+D  RH+
Sbjct  344  RIFSYADTQRHRLGPNYLQLPANAPKSAHHNNHHEGLMNFMHRDEEVNYFPSRFDSVRHS  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E+HP+PP VLTG+  + +IEKENNFKQPGERYRS+  DRQERFI R V+ALSDPRVTHEI
Sbjct  404  EKHPLPPPVLTGRCTRAMIEKENNFKQPGERYRSFPPDRQERFIRRVVDALSDPRVTHEI  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            RSIWISYW+QADKSLG+K+ASRLNVRP++
Sbjct  464  RSIWISYWSQADKSLGEKIASRLNVRPSI  492



>ref|XP_006828715.1| hypothetical protein AMTR_s00001p00024160 [Amborella trichopoda]
 gb|ERM96131.1| hypothetical protein AMTR_s00001p00024160 [Amborella trichopoda]
Length=492

 Score =   378 bits (971),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 173/209 (83%), Positives = 193/209 (92%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPED+LPL  VGR+VLN+NIDNFF ENEQLAFCPAIVVPGVYYSDDKLLQT
Sbjct  284  FDPLDVTKTWPEDILPLLLVGRMVLNRNIDNFFTENEQLAFCPAIVVPGVYYSDDKLLQT  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIFSYSDTQRHRLGPNYL LP NAPKCAHHNNH+DGFMNF HRDEEV+YFPSR+DP RHA
Sbjct  344  RIFSYSDTQRHRLGPNYLMLPANAPKCAHHNNHYDGFMNFAHRDEEVDYFPSRFDPVRHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E+ P+PP++ +GKR+KC+IEKENNFKQPGERYRS++ DRQERFI RWV+ALSDPRVTHEI
Sbjct  404  EKFPMPPQICSGKREKCMIEKENNFKQPGERYRSFAIDRQERFIKRWVDALSDPRVTHEI  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
             SIWISYW+Q DKSLGQKLA+ LN++P M
Sbjct  464  LSIWISYWSQCDKSLGQKLATHLNLKPNM  492



>gb|AIX10947.1| putative catalase [Gardenia jasminoides]
Length=492

 Score =   378 bits (970),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 176/212 (83%), Positives = 195/212 (92%), Gaps = 0/212 (0%)
 Frame = -1

Query  753  QI*LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKL  574
            Q   DPLDVTK WPED+LPLQPVGRLVLNKNIDNFF ENEQLAF PA VVPG+YYS+DKL
Sbjct  281  QFDFDPLDVTKIWPEDILPLQPVGRLVLNKNIDNFFNENEQLAFNPAHVVPGIYYSEDKL  340

Query  573  LQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPX  394
            LQ RIF+YSDT RHRLGPNYLQLPVNAPKCAHHNNH+DG+MN MHRDEE++YFPSRYDP 
Sbjct  341  LQGRIFAYSDTHRHRLGPNYLQLPVNAPKCAHHNNHYDGYMNIMHRDEEIDYFPSRYDPV  400

Query  393  RHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVT  214
            RHAE+HPIP RVLTG+R++ +IEKENNFKQP ERYRSW+ DRQERF+ RWV+ALSDPR+T
Sbjct  401  RHAERHPIPTRVLTGRRERRVIEKENNFKQPVERYRSWAPDRQERFVRRWVDALSDPRLT  460

Query  213  HEIRSIWISYWTQADKSLGQKLASRLNVRPTM  118
            HEIRSIWISYW+QADKSLGQK+A RLNVRPTM
Sbjct  461  HEIRSIWISYWSQADKSLGQKIAFRLNVRPTM  492



>gb|ACH63223.1| catalase [Rheum australe]
Length=492

 Score =   377 bits (969),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 175/209 (84%), Positives = 192/209 (92%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVT+TWPED+LPL PVGR+VLNKNIDNFFAENEQLAFCP IVVPG+YYSDDKLLQT
Sbjct  284  FDPLDVTRTWPEDILPLIPVGRMVLNKNIDNFFAENEQLAFCPGIVVPGIYYSDDKLLQT  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHH+G MNFMHRDEEVNYFPSR+DP RHA
Sbjct  344  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHEGLMNFMHRDEEVNYFPSRFDPARHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E++PIP  VL G+R+K II KENNF++PG RYRS+   RQERFICRW+ ALSDPRVT EI
Sbjct  404  EKYPIPQNVLNGRREKQIIAKENNFEEPGVRYRSFDPARQERFICRWIGALSDPRVTPEI  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            RSIWISYW+QADKSLG KLA+RLNV+PTM
Sbjct  464  RSIWISYWSQADKSLGMKLANRLNVKPTM  492



>ref|NP_001105415.1| catalase isozyme 1 [Zea mays]
 emb|CAA31056.1| unnamed protein product [Zea mays]
Length=492

 Score =   377 bits (969),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 172/209 (82%), Positives = 194/209 (93%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPED++PLQPVGR+VLNKN+DNFFAENEQ+AFCPAI VPG++YSDDKLLQT
Sbjct  284  FDPLDVTKTWPEDIIPLQPVGRMVLNKNVDNFFAENEQIAFCPAISVPGIHYSDDKLLQT  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIFSY+DTQRHRLGPNYL LPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSR+DP RHA
Sbjct  344  RIFSYADTQRHRLGPNYLMLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRFDPARHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E+ PIPPRVLTG R+KCII+KENNFKQ GERYRS+   RQ+RFI RWV+AL+DPRVTHE 
Sbjct  404  EKVPIPPRVLTGCREKCIIQKENNFKQAGERYRSFDPARQDRFIQRWVDALTDPRVTHEH  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            R+IWISYW+Q D +LGQKL SRLN++P+M
Sbjct  464  RTIWISYWSQCDAALGQKLPSRLNLKPSM  492



>gb|AIU99481.1| catalase [Saccharum spontaneum]
Length=492

 Score =   377 bits (967),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 173/209 (83%), Positives = 193/209 (92%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPED++PLQPVGR+VLNKNIDNFFAENEQ+AFCPAI+VPG++YSDDKLLQT
Sbjct  284  FDPLDVTKTWPEDIIPLQPVGRMVLNKNIDNFFAENEQIAFCPAIIVPGIHYSDDKLLQT  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIFSY+DTQRHRLGPNYL LPVNAPKCAHHNNHH+GFMNFMHRDEEVNYFPSR+DP RHA
Sbjct  344  RIFSYADTQRHRLGPNYLMLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPARHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E+ PIP RVLTG R+KCII+KENNFKQ GERYRS+   RQ+RFI RWV+ALSDPRVTHE 
Sbjct  404  EKVPIPTRVLTGCREKCIIQKENNFKQAGERYRSFDPARQDRFIQRWVDALSDPRVTHEH  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
             +IWISYW+Q D SLGQKLASRLN++P M
Sbjct  464  HTIWISYWSQCDASLGQKLASRLNLKPNM  492



>gb|AAC17729.1| catalase 1, partial [Hordeum vulgare subsp. vulgare]
Length=398

 Score =   373 bits (958),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 168/209 (80%), Positives = 193/209 (92%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPED++PLQPVGR+VLNKNIDNFFAENEQLAFCPA+ VPG++YSDDKLLQT
Sbjct  190  FDPLDVTKTWPEDIIPLQPVGRMVLNKNIDNFFAENEQLAFCPAVTVPGIHYSDDKLLQT  249

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIFSY+DTQRHRLGPNYL LPVNAPKCAHHNNHHDG MNF+HRDEEVNYFPSR+DP RHA
Sbjct  250  RIFSYADTQRHRLGPNYLMLPVNAPKCAHHNNHHDGLMNFIHRDEEVNYFPSRFDPTRHA  309

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E++P+PPRVL+G R+KCII+KENNFKQ GERYRS+   RQ+RF+ RWV+AL+D RVTHEI
Sbjct  310  EKYPMPPRVLSGCREKCIIDKENNFKQAGERYRSFDPARQDRFLQRWVDALTDARVTHEI  369

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            +SIW+SYW+Q D SLGQKLASRL ++P M
Sbjct  370  QSIWVSYWSQCDASLGQKLASRLKIKPNM  398



>ref|XP_004966515.1| PREDICTED: catalase isozyme 1-like [Setaria italica]
Length=547

 Score =   378 bits (971),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 176/209 (84%), Positives = 193/209 (92%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPED++PLQPVGR+VLNKNIDNFFAENEQ+AFCPAI+VPG++YSDDKLLQT
Sbjct  339  FDPLDVTKTWPEDIIPLQPVGRMVLNKNIDNFFAENEQIAFCPAIIVPGIHYSDDKLLQT  398

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIFSY+DTQRHRLGPNYL LPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSR+DP RHA
Sbjct  399  RIFSYADTQRHRLGPNYLMLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRFDPARHA  458

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E+ PIPPRVLTG R+KCII KENNFKQ GERYRS+   RQ+RFI R V+ALSDPRVTHE 
Sbjct  459  EKVPIPPRVLTGCREKCIIHKENNFKQAGERYRSFDPARQDRFIQRVVDALSDPRVTHEH  518

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            RSIWISYW+Q D SLGQKLASRLN++P M
Sbjct  519  RSIWISYWSQCDASLGQKLASRLNLKPNM  547



>ref|XP_006416378.1| hypothetical protein EUTSA_v10007472mg [Eutrema salsugineum]
 gb|ESQ34731.1| hypothetical protein EUTSA_v10007472mg [Eutrema salsugineum]
Length=492

 Score =   376 bits (966),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 172/209 (82%), Positives = 195/209 (93%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTK WPED+LPLQPVGRLVLNKNIDNFF ENEQ+AFCPAIVVPGV+YSDDKLLQ+
Sbjct  284  FDPLDVTKIWPEDILPLQPVGRLVLNKNIDNFFNENEQIAFCPAIVVPGVHYSDDKLLQS  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIFSY+D+QRHRLGPNYLQLPVNAPKCAHHNNHH+GFMNFMHR+EEVNYFPSR +P RHA
Sbjct  344  RIFSYADSQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHREEEVNYFPSRLNPVRHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E++P  P V +G R+KCII+KENNF+QPGERYRSW +DRQERF+ R+VEAL++PRVTHEI
Sbjct  404  EKYPTSPIVCSGNREKCIIKKENNFQQPGERYRSWDSDRQERFVKRFVEALAEPRVTHEI  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            RSIWISYW+QADKSLGQKLA+RLNV+P  
Sbjct  464  RSIWISYWSQADKSLGQKLATRLNVKPNF  492



>gb|AIM43584.1| catalase [Saccharum hybrid cultivar Yacheng05-179]
Length=492

 Score =   376 bits (966),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 173/209 (83%), Positives = 193/209 (92%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPED++PLQPVGR+VLNKNIDNFFAENEQ+AFCPAI+VPG++YSDDKLLQT
Sbjct  284  FDPLDVTKTWPEDIIPLQPVGRMVLNKNIDNFFAENEQVAFCPAIIVPGIHYSDDKLLQT  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIFSY+DTQRHRLGPNYL LPVNAPKCAHHNNHH+GFMNFMHRDEEVNYFPSR+DP RHA
Sbjct  344  RIFSYADTQRHRLGPNYLMLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPARHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E+ PIP RVLTG R+KCII+KENNFKQ GERYRS+   RQ+RFI RWV+ALSDPRVTHE 
Sbjct  404  EKVPIPTRVLTGCREKCIIQKENNFKQAGERYRSFDPARQDRFIQRWVDALSDPRVTHEH  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
             +IWISYW+Q D SLGQKLASRLN++P M
Sbjct  464  HTIWISYWSQCDASLGQKLASRLNLKPNM  492



>gb|AIU99485.1| catalase [Saccharum spontaneum]
Length=492

 Score =   376 bits (965),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 173/209 (83%), Positives = 193/209 (92%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPED++PLQPVGR+VLNKNIDNFFAENEQ+AFCPAI+VPG++YSDDKLLQT
Sbjct  284  FDPLDVTKTWPEDIIPLQPVGRMVLNKNIDNFFAENEQVAFCPAIIVPGIHYSDDKLLQT  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIFSY+DTQRHRLGPNYL LPVNAPKCAHHNNHH+GFMNFMHRDEEVNYFPSR+DP RHA
Sbjct  344  RIFSYADTQRHRLGPNYLMLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPARHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E+ PIP RVLTG R+KCII+KENNFKQ GERYRS+   RQ+RFI RWV+ALSDPRVTHE 
Sbjct  404  EKVPIPTRVLTGCREKCIIQKENNFKQAGERYRSFDPARQDRFIQRWVDALSDPRVTHEH  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
             +IWISYW+Q D SLGQKLASRLN++P M
Sbjct  464  HTIWISYWSQCDASLGQKLASRLNLKPNM  492



>gb|AIU99479.1| catalase [Saccharum arundinaceum]
Length=492

 Score =   376 bits (965),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 173/209 (83%), Positives = 192/209 (92%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPED++PLQPVGR+VLNKNIDNFFAENEQ+A CPAI+VPG++YSDDKLLQT
Sbjct  284  FDPLDVTKTWPEDIIPLQPVGRMVLNKNIDNFFAENEQIALCPAIIVPGIHYSDDKLLQT  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIFSY+DTQRHRLGPNYL LPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSR+DP RHA
Sbjct  344  RIFSYADTQRHRLGPNYLMLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRFDPARHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E+ PIP RVLTG R+KCII+KENNFKQ GERYRS+   RQ+RFI RWV+ALSDPRVTHE 
Sbjct  404  EKVPIPSRVLTGCREKCIIQKENNFKQAGERYRSFDPARQDRFIQRWVDALSDPRVTHEH  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
             +IWISYW+Q D SLGQKLASRLN++P M
Sbjct  464  HTIWISYWSQCDASLGQKLASRLNLKPNM  492



>gb|AIU99484.1| catalase [Saccharum arundinaceum]
Length=492

 Score =   376 bits (965),  Expect = 8e-125, Method: Compositional matrix adjust.
 Identities = 173/209 (83%), Positives = 193/209 (92%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPED++PLQPVGR+VLNKNIDNFFAENEQ+AFCPAI+VPG++YSDDKLLQT
Sbjct  284  FDPLDVTKTWPEDIIPLQPVGRMVLNKNIDNFFAENEQVAFCPAIIVPGIHYSDDKLLQT  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIFSY+DTQRHRLGPNYL LPVNAPKCAHHNNHH+GFMNFMHRDEEVNYFPSR+DP RHA
Sbjct  344  RIFSYADTQRHRLGPNYLMLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPARHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E+ PIP RVLTG R+KCII+KENNFKQ GERYRS+   RQ+RFI RWV+ALSDPRVTHE 
Sbjct  404  EKVPIPTRVLTGCREKCIIQKENNFKQAGERYRSFDPARQDRFIQRWVDALSDPRVTHEH  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
             +IWISYW+Q D SLGQKLASRLN++P M
Sbjct  464  HTIWISYWSQCDASLGQKLASRLNLKPNM  492



>gb|AIU99488.1| catalase [Saccharum hybrid cultivar ROC22]
Length=492

 Score =   375 bits (964),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 173/209 (83%), Positives = 192/209 (92%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPED++PLQPVGR+VLNKNIDNFFAENEQ+AFCPAI+VPG++YSDDKLLQT
Sbjct  284  FDPLDVTKTWPEDIIPLQPVGRMVLNKNIDNFFAENEQIAFCPAIIVPGIHYSDDKLLQT  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIFSY+DTQRHRLGPNYL LPVNAPKCAHHNNHH+GFMNFMHRDEEVNYFPSR+DP RHA
Sbjct  344  RIFSYADTQRHRLGPNYLMLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPARHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E+ PIP RVLTG R+KCII+KENNFKQ GERYRS+   RQ+RFI RWV ALSDPRVTHE 
Sbjct  404  EKVPIPTRVLTGCREKCIIQKENNFKQAGERYRSFDPARQDRFIQRWVGALSDPRVTHEH  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
             +IWISYW+Q D SLGQKLASRLN++P M
Sbjct  464  HTIWISYWSQCDASLGQKLASRLNLKPNM  492



>gb|AAY59707.1| catalase [Oryza sativa Indica Group]
Length=492

 Score =   375 bits (964),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 171/209 (82%), Positives = 193/209 (92%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPED++PLQPVGR+VLNKNIDNFFAENEQLAFCPAI+VPG++YSDDKLLQT
Sbjct  284  FDPLDVTKTWPEDIIPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQT  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIFSY+DTQRHRLGPNYL LPVNAPKCA+HNNHHDG MNFMHRDEEVNYFPSR+D  RHA
Sbjct  344  RIFSYADTQRHRLGPNYLMLPVNAPKCAYHNNHHDGSMNFMHRDEEVNYFPSRFDAARHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E+ PIPPRVLTG R+KC+I+KENNFKQ GERYRS+   RQ+RF+ RWV+ALSDPR+THE+
Sbjct  404  EKVPIPPRVLTGCREKCVIDKENNFKQAGERYRSFDPARQDRFLQRWVDALSDPRITHEL  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            R IWISYW+Q D SLGQKLASRLN++P M
Sbjct  464  RGIWISYWSQCDASLGQKLASRLNLKPNM  492



>sp|A2YH64.2|CATA2_ORYSI RecName: Full=Catalase isozyme B; Short=CAT-B [Oryza sativa Indica 
Group]
 gb|EEC81340.1| hypothetical protein OsI_24526 [Oryza sativa Indica Group]
Length=492

 Score =   375 bits (963),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 171/209 (82%), Positives = 193/209 (92%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPED++PLQPVGR+VLNKNIDNFFAENEQLAFCPAI+VPG++YSDDKLLQT
Sbjct  284  FDPLDVTKTWPEDIIPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQT  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIFSY+DTQRHRLGPNYL LPVNAPKCA+HNNHHDG MNFMHRDEEVNYFPSR+D  RHA
Sbjct  344  RIFSYADTQRHRLGPNYLMLPVNAPKCAYHNNHHDGSMNFMHRDEEVNYFPSRFDAARHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E+ PIPPRVLTG R+KC+I+KENNFKQ GERYRS+   RQ+RF+ RWV+ALSDPR+THE+
Sbjct  404  EKVPIPPRVLTGCREKCVIDKENNFKQAGERYRSFDPARQDRFLQRWVDALSDPRITHEL  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            R IWISYW+Q D SLGQKLASRLN++P M
Sbjct  464  RGIWISYWSQCDASLGQKLASRLNLKPNM  492



>ref|XP_002437631.1| hypothetical protein SORBIDRAFT_10g030840 [Sorghum bicolor]
 gb|EER88998.1| hypothetical protein SORBIDRAFT_10g030840 [Sorghum bicolor]
Length=492

 Score =   375 bits (962),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 172/209 (82%), Positives = 193/209 (92%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPED++PLQPVGR+VLNKNIDNFFAENEQ+AFCPAI+VPG++YSDDKLLQT
Sbjct  284  FDPLDVTKTWPEDIIPLQPVGRMVLNKNIDNFFAENEQIAFCPAIIVPGIHYSDDKLLQT  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIFSY+DTQRHRLGPNYL LPVNAPKCAHHNNHH+GFMNFMHRDEEVNYFPSR+DP RHA
Sbjct  344  RIFSYADTQRHRLGPNYLMLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPTRHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E+ PIP RVLTG R+KCIIEKENNFKQ GER+RS+   RQ+RFI RWV+ALSDPRVTHE 
Sbjct  404  EKVPIPSRVLTGCREKCIIEKENNFKQAGERFRSFDPARQDRFIQRWVDALSDPRVTHEH  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
             +IWI+YW+Q D SLGQKLASRLN++P M
Sbjct  464  HTIWINYWSQCDASLGQKLASRLNLKPNM  492



>gb|KEH36312.1| catalase heme-binding enzyme [Medicago truncatula]
Length=492

 Score =   375 bits (962),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 171/209 (82%), Positives = 194/209 (93%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPED++PLQPVGRLVLNKNIDNFFAENEQLAFCPAI+VPGVYYSDDK+LQT
Sbjct  284  FDPLDVTKTWPEDIIPLQPVGRLVLNKNIDNFFAENEQLAFCPAIIVPGVYYSDDKMLQT  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIFSY+D+QRHRLGPNYLQLP NAPKCAHHNNHH+GFMNF+HRDEEVNYFPSR+DP RHA
Sbjct  344  RIFSYADSQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFIHRDEEVNYFPSRHDPVRHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E+ PIP    +  R+KC I K+NNFKQPGERYRSW+ DRQ+RF+ RWV+ALSDPRVTHEI
Sbjct  404  EKVPIPTANFSACREKCNIPKQNNFKQPGERYRSWAPDRQDRFLRRWVDALSDPRVTHEI  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            RSIWISYW+QAD+SLGQK+AS LN+RP++
Sbjct  464  RSIWISYWSQADRSLGQKIASHLNMRPSI  492



>ref|XP_006656514.1| PREDICTED: catalase isozyme B-like [Oryza brachyantha]
Length=492

 Score =   374 bits (961),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 170/209 (81%), Positives = 192/209 (92%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPED++PLQPVGR+VLNKNIDNFFAENEQLAFCPAI+VPG++YSDDKLLQT
Sbjct  284  FDPLDVTKTWPEDIIPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQT  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            R+FSY+DTQRHRLGPNYL LPVNAPKCA+HNNHHDG MNFMHRDEEVNYFPSR+D  RHA
Sbjct  344  RVFSYADTQRHRLGPNYLMLPVNAPKCAYHNNHHDGTMNFMHRDEEVNYFPSRFDAARHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E+ P+PPRVLTG R+KC+I KENNFKQ GERYRS+   RQ+RFI RWV+ALSDPR+THE+
Sbjct  404  EKVPVPPRVLTGCREKCVINKENNFKQAGERYRSFDPARQDRFIQRWVDALSDPRITHEL  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            R IWISYW+Q D SLGQKLASRLN++P M
Sbjct  464  RGIWISYWSQCDASLGQKLASRLNLKPNM  492



>gb|AIU99480.1| catalase [Saccharum spontaneum]
Length=492

 Score =   374 bits (961),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 172/209 (82%), Positives = 192/209 (92%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPED++PLQPVGR+VLNKNIDNFFAENEQ+AFCPAI+VPG++YSDDKLLQT
Sbjct  284  FDPLDVTKTWPEDIIPLQPVGRMVLNKNIDNFFAENEQIAFCPAIIVPGIHYSDDKLLQT  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIFSY+DTQRHRLGPNYL LPVNAPKCAHHNNHH+G MNFMHRDEEVNYFPSR+DP RHA
Sbjct  344  RIFSYADTQRHRLGPNYLMLPVNAPKCAHHNNHHEGLMNFMHRDEEVNYFPSRFDPARHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E+ PIP RVLTG R+KCII+KENNFKQ GERYRS+   RQ+RFI RWV+ALSDPRVTHE 
Sbjct  404  EKVPIPTRVLTGCREKCIIQKENNFKQAGERYRSFDPARQDRFIQRWVDALSDPRVTHEH  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
             +IWISYW+Q D SLGQKLASRLN++P M
Sbjct  464  HTIWISYWSQCDASLGQKLASRLNLKPNM  492



>ref|XP_011074090.1| PREDICTED: catalase isoform X1 [Sesamum indicum]
Length=513

 Score =   375 bits (963),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 170/209 (81%), Positives = 193/209 (92%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTK WPED+LPL PVGRLVLN+N+DNFFAENE LAF P+++VPG+Y+S+DK+LQT
Sbjct  305  FDPLDVTKIWPEDILPLMPVGRLVLNRNVDNFFAENEMLAFSPSMIVPGIYFSNDKMLQT  364

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIF+Y+DTQRHR+GPNYLQLPVNAPKC HHNNHHDG MNFMHRDEEVNYFPSRYDP RHA
Sbjct  365  RIFAYADTQRHRIGPNYLQLPVNAPKCPHHNNHHDGAMNFMHRDEEVNYFPSRYDPCRHA  424

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E+ PIPP VL+G+R K +IEKENNFKQPG+RYRSW+ DRQERFI RW++ALSDPR+T EI
Sbjct  425  EKFPIPPVVLSGQRVKTVIEKENNFKQPGDRYRSWAPDRQERFIRRWIDALSDPRLTAEI  484

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            RSIW+SYWTQADKSLGQKLASRLNVRP M
Sbjct  485  RSIWVSYWTQADKSLGQKLASRLNVRPAM  513



>ref|XP_004145541.1| PREDICTED: catalase isozyme 1-like [Cucumis sativus]
 ref|XP_004157075.1| PREDICTED: catalase isozyme 1-like [Cucumis sativus]
Length=973

 Score =   388 bits (997),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 179/208 (86%), Positives = 198/208 (95%), Gaps = 1/208 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPED+LPLQPVGR+VLNKNIDNFFAENEQLAFCPAI+VPG+YYSDDKLLQT
Sbjct  284  FDPLDVTKTWPEDILPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIYYSDDKLLQT  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIFSYSDTQRHRLGPNYLQLP NAPKCAHHNNHH+GFMNFMHRDEEVNYFPSRYDP RHA
Sbjct  344  RIFSYSDTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPARHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E++P PP V TGKR++C+I+KENNFK+PGERYRSW+ DRQERFI RWV+ALSDPRVTHEI
Sbjct  404  ERYPHPPAVCTGKRERCVIQKENNFKEPGERYRSWTPDRQERFIRRWVDALSDPRVTHEI  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPT  121
            RSIWI+YW+QAD+S+GQKLAS LN RP+
Sbjct  464  RSIWITYWSQADRSVGQKLASHLN-RPS  490


 Score =   380 bits (975),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 174/206 (84%), Positives = 193/206 (94%), Gaps = 0/206 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPED+LPLQPVGRLVLNKNIDNFFAENEQLAFCPAI+VPG+YYSDDKLLQT
Sbjct  765  FDPLDVTKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIIVPGIYYSDDKLLQT  824

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIFSY+DTQR+RLGPNYLQLPVNAPKCA+HNNHHDGFMNFM RDEE+NYFPSR DP RHA
Sbjct  825  RIFSYADTQRYRLGPNYLQLPVNAPKCAYHNNHHDGFMNFMDRDEEINYFPSRIDPTRHA  884

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E++P P  V TGKR++C+IEKENNFKQPGERYRSW +DRQERF+ RWV+ALSDPRVTHEI
Sbjct  885  ERYPQPSAVYTGKRERCVIEKENNFKQPGERYRSWPSDRQERFVGRWVDALSDPRVTHEI  944

Query  204  RSIWISYWTQADKSLGQKLASRLNVR  127
            R+IWISYW+QADKSLG KLAS  N++
Sbjct  945  RNIWISYWSQADKSLGHKLASHFNLK  970



>dbj|BAA05494.1| catalase [Oryza sativa Japonica Group]
Length=492

 Score =   374 bits (961),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 170/209 (81%), Positives = 193/209 (92%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPED++PLQPVGR+VLNKNIDNFFAENEQLAFCPAI+VPG++YSDDKLLQT
Sbjct  284  FDPLDVTKTWPEDIIPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQT  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIFSY+DTQRHRLGPNYL LPVNAPKCA+HNNHHDG MNFMHRDEEVNYFPSR+D  RHA
Sbjct  344  RIFSYADTQRHRLGPNYLMLPVNAPKCAYHNNHHDGSMNFMHRDEEVNYFPSRFDAARHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E+ PIPPRVLTG R+KC+I+KENNF+Q GERYRS+   RQ+RF+ RWV+ALSDPR+THE+
Sbjct  404  EKVPIPPRVLTGCREKCVIDKENNFQQAGERYRSFDPARQDRFLQRWVDALSDPRITHEL  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            R IWISYW+Q D SLGQKLASRLN++P M
Sbjct  464  RGIWISYWSQCDASLGQKLASRLNLKPNM  492



>gb|ADZ45555.1| catalase [Vigna radiata]
Length=492

 Score =   374 bits (960),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 169/209 (81%), Positives = 193/209 (92%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPED++PLQPVGRLVLNKNIDNFFAENEQLAFCPAI+VPGVYYSDDK+LQT
Sbjct  284  FDPLDVTKTWPEDIIPLQPVGRLVLNKNIDNFFAENEQLAFCPAIIVPGVYYSDDKMLQT  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIFSY+D+QRHRLGPNYL LP NAPK AHHNNHH+GFMNF+HRDEEVNYFPSRYDP RHA
Sbjct  344  RIFSYADSQRHRLGPNYLLLPANAPKSAHHNNHHEGFMNFIHRDEEVNYFPSRYDPVRHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E+ PIPP + +G+R+K  IEKENNFKQ GER+RSW+ DRQ+RF  RWV+ALSDPRVTHEI
Sbjct  404  EKFPIPPAICSGRREKIAIEKENNFKQAGERFRSWAPDRQDRFTRRWVDALSDPRVTHEI  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            RS+WISYW+QAD+SLGQK+AS L++RP +
Sbjct  464  RSVWISYWSQADRSLGQKIASHLSMRPNI  492



>dbj|BAA34204.1| catalase [Oryza sativa Japonica Group]
Length=492

 Score =   374 bits (960),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 170/209 (81%), Positives = 193/209 (92%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPED++PLQPVGR+VLNKNIDNFFAENEQLAFCPAI+VPG++YSDDKLLQT
Sbjct  284  FDPLDVTKTWPEDIIPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQT  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIFSY+DTQRHRLGPNYL LPVNAPKCA+HNNHHDG MNFMHRDEEVNYFPSR+D  RHA
Sbjct  344  RIFSYADTQRHRLGPNYLMLPVNAPKCAYHNNHHDGSMNFMHRDEEVNYFPSRFDAARHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E+ PIPPRVLTG R+KC+I+KENNF+Q GERYRS+   RQ+RF+ RWV+ALSDPR+THE+
Sbjct  404  EKVPIPPRVLTGCREKCVIDKENNFQQAGERYRSFDPARQDRFLQRWVDALSDPRITHEL  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            R IWISYW+Q D SLGQKLASRLN++P M
Sbjct  464  RGIWISYWSQCDASLGQKLASRLNLKPNM  492



>sp|P55307.1|CATA1_HORVU RecName: Full=Catalase isozyme 1 [Hordeum vulgare]
 gb|AAA96947.1| catalase [Hordeum vulgare subsp. vulgare]
 dbj|BAJ84783.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK08157.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ97380.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=492

 Score =   374 bits (960),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 168/209 (80%), Positives = 193/209 (92%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPED++PLQPVGR+VLNKNIDNFFAENEQLAFCPA+ VPG++YSDDKLLQT
Sbjct  284  FDPLDVTKTWPEDIIPLQPVGRMVLNKNIDNFFAENEQLAFCPAVTVPGIHYSDDKLLQT  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIFSY+DTQRHRLGPNYL LPVNAPKCAHHNNHHDG MNF+HRDEEVNYFPSR+DP RHA
Sbjct  344  RIFSYADTQRHRLGPNYLMLPVNAPKCAHHNNHHDGLMNFIHRDEEVNYFPSRFDPTRHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E++P+PPRVL+G R+KCII+KENNFKQ GERYRS+   RQ+RF+ RWV+AL+D RVTHEI
Sbjct  404  EKYPMPPRVLSGCREKCIIDKENNFKQAGERYRSFDPARQDRFLQRWVDALTDARVTHEI  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            +SIW+SYW+Q D SLGQKLASRL ++P M
Sbjct  464  QSIWVSYWSQCDASLGQKLASRLKIKPNM  492



>ref|XP_006649332.1| PREDICTED: catalase-1-like [Oryza brachyantha]
Length=492

 Score =   374 bits (960),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 169/209 (81%), Positives = 193/209 (92%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPED++PLQPVGR+VLN+NIDNFF+ENEQLAFCP I+VPG+YYSDDKLLQT
Sbjct  284  FDPLDVTKTWPEDIIPLQPVGRMVLNRNIDNFFSENEQLAFCPGIIVPGIYYSDDKLLQT  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIFSYSDTQRHRLGPNYL LP NAPKCAHHNNH+DGFMNFMHRDEEV+YFPSRYDP +HA
Sbjct  344  RIFSYSDTQRHRLGPNYLLLPANAPKCAHHNNHYDGFMNFMHRDEEVDYFPSRYDPAKHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
             ++PIP   LTG+R+K +I KENNFKQPGERYRSW   RQERFI RW++ALSDPR+THEI
Sbjct  404  PRYPIPSVNLTGRREKTVIPKENNFKQPGERYRSWDPARQERFIKRWIDALSDPRLTHEI  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            RSIW+SYW+QAD+SLGQKLASRL+ +P+M
Sbjct  464  RSIWLSYWSQADRSLGQKLASRLSAKPSM  492



>ref|NP_001058635.1| Os06g0727200 [Oryza sativa Japonica Group]
 sp|Q0D9C4.1|CATA2_ORYSJ RecName: Full=Catalase isozyme B; Short=CAT-B [Oryza sativa Japonica 
Group]
 dbj|BAD61813.1| catalase [Oryza sativa Japonica Group]
 dbj|BAF20549.1| Os06g0727200 [Oryza sativa Japonica Group]
 gb|EAZ38347.1| hypothetical protein OsJ_22721 [Oryza sativa Japonica Group]
 dbj|BAG91437.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG94401.1| unnamed protein product [Oryza sativa Japonica Group]
Length=492

 Score =   374 bits (959),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 170/209 (81%), Positives = 193/209 (92%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPED++PLQPVGR+VLNKNIDNFFAENEQLAFCPAI+VPG++YSDDKLLQT
Sbjct  284  FDPLDVTKTWPEDIIPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQT  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIFSY+DTQRHRLGPNYL LPVNAPKCA+HNNHHDG MNFMHRDEEVNYFPSR+D  RHA
Sbjct  344  RIFSYADTQRHRLGPNYLMLPVNAPKCAYHNNHHDGSMNFMHRDEEVNYFPSRFDAARHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E+ PIPPRVLTG R+KC+I+KENNF+Q GERYRS+   RQ+RF+ RWV+ALSDPR+THE+
Sbjct  404  EKVPIPPRVLTGCREKCVIDKENNFQQAGERYRSFDPARQDRFLQRWVDALSDPRITHEL  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            R IWISYW+Q D SLGQKLASRLN++P M
Sbjct  464  RGIWISYWSQCDASLGQKLASRLNLKPNM  492



>ref|XP_003563243.1| PREDICTED: catalase isozyme 1 [Brachypodium distachyon]
Length=492

 Score =   374 bits (959),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 169/209 (81%), Positives = 191/209 (91%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPED++PLQPVGR++LNKNIDNFFAENEQ+AFCPAI+VPG++YSDDKLLQT
Sbjct  284  FDPLDVTKTWPEDIIPLQPVGRMILNKNIDNFFAENEQIAFCPAIIVPGIHYSDDKLLQT  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIFSY+DTQRHRLGPNYL LPVNAPKCAHHNNHH+GFMNF+HRDEEVNYFPSR+DP RHA
Sbjct  344  RIFSYADTQRHRLGPNYLMLPVNAPKCAHHNNHHEGFMNFIHRDEEVNYFPSRFDPTRHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            +++PIP RVLTG R+KCIIEKENNFKQ GERYRS+   RQ+RFI RWV+ALSD RVTHEI
Sbjct  404  QKYPIPTRVLTGCREKCIIEKENNFKQAGERYRSFDPARQDRFIQRWVDALSDARVTHEI  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            + IWISYW+Q D SLGQKL SRL  +P M
Sbjct  464  QGIWISYWSQCDTSLGQKLGSRLKAKPNM  492



>dbj|BAA34205.1| catalase [Oryza sativa Japonica Group]
 gb|AAQ19030.1| catalase [Oryza sativa]
Length=492

 Score =   373 bits (958),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 168/209 (80%), Positives = 193/209 (92%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPED++PLQPVGR+VLN+NIDNFF+ENEQLAFCP I+VPG+YYSDDKLLQT
Sbjct  284  FDPLDVTKTWPEDIVPLQPVGRMVLNRNIDNFFSENEQLAFCPGIIVPGIYYSDDKLLQT  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIFSYSDTQRHRLGPNYL LP NAPKCAHHNNH+DGFMNFMHRDEEV+YFPSRYDP +HA
Sbjct  344  RIFSYSDTQRHRLGPNYLLLPPNAPKCAHHNNHYDGFMNFMHRDEEVDYFPSRYDPAKHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
             ++PIP   LTG+R+K +I KENNFKQPGERYRSW   RQ+RFI RW++ALSDPR+THEI
Sbjct  404  PRYPIPSATLTGRREKVVIAKENNFKQPGERYRSWDPARQDRFIKRWIDALSDPRLTHEI  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            RSIW+SYW+QAD+SLGQKLASRL+ +P+M
Sbjct  464  RSIWLSYWSQADRSLGQKLASRLSAKPSM  492



>gb|KHG21219.1| Catalase isozyme 1 [Gossypium arboreum]
Length=432

 Score =   371 bits (953),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 175/209 (84%), Positives = 190/209 (91%), Gaps = 6/209 (3%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPED+LPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVV G+YYSDDKLLQT
Sbjct  230  FDPLDVTKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVRGIYYSDDKLLQT  289

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            R+FSYSDTQRHRLGPNYLQLP NAPKCAHHNNHH+GFMNFMHRDE++NYFPSRYDP  HA
Sbjct  290  RVFSYSDTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEQINYFPSRYDPSHHA  349

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E+ PIPP + TGKR+K      NNFKQPGERYRSW+ DRQERFI  WV+ALSDPRVTHEI
Sbjct  350  ERFPIPPALCTGKREK------NNFKQPGERYRSWAPDRQERFINSWVDALSDPRVTHEI  403

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
             SIWI+YW+QADKSLGQKLA RLNVRP++
Sbjct  404  CSIWITYWSQADKSLGQKLACRLNVRPSI  432



>ref|NP_001048861.1| Os03g0131200 [Oryza sativa Japonica Group]
 gb|ABF93810.1| Catalase-1, putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF10775.1| Os03g0131200 [Oryza sativa Japonica Group]
 dbj|BAG88238.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG89941.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC74449.1| hypothetical protein OsI_09857 [Oryza sativa Indica Group]
 gb|EEE58275.1| hypothetical protein OsJ_09293 [Oryza sativa Japonica Group]
Length=492

 Score =   373 bits (958),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 168/209 (80%), Positives = 193/209 (92%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPED++PLQPVGR+VLN+NIDNFF+ENEQLAFCP I+VPG+YYSDDKLLQT
Sbjct  284  FDPLDVTKTWPEDIVPLQPVGRMVLNRNIDNFFSENEQLAFCPGIIVPGIYYSDDKLLQT  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIFSYSDTQRHRLGPNYL LP NAPKCAHHNNH+DGFMNFMHRDEEV+YFPSRYDP +HA
Sbjct  344  RIFSYSDTQRHRLGPNYLLLPPNAPKCAHHNNHYDGFMNFMHRDEEVDYFPSRYDPAKHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
             ++PIP   LTG+R+K +I KENNFKQPGERYRSW   RQ+RFI RW++ALSDPR+THEI
Sbjct  404  PRYPIPSATLTGRREKVVIAKENNFKQPGERYRSWDPARQDRFIKRWIDALSDPRLTHEI  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            RSIW+SYW+QAD+SLGQKLASRL+ +P+M
Sbjct  464  RSIWLSYWSQADRSLGQKLASRLSAKPSM  492



>gb|AIU99486.1| catalase [Saccharum spontaneum]
Length=492

 Score =   373 bits (958),  Expect = 9e-124, Method: Compositional matrix adjust.
 Identities = 172/209 (82%), Positives = 192/209 (92%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPED++PLQPVGR+VLNKNIDNFFAENEQ+AFCPAI+VPG++YSDDKLLQT
Sbjct  284  FDPLDVTKTWPEDIIPLQPVGRMVLNKNIDNFFAENEQVAFCPAIIVPGIHYSDDKLLQT  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIFSY+DTQRHRLGPNYL LPVNAPKCAHHNNHH+GFMNFMHRDEEVNYFPSR+DP RHA
Sbjct  344  RIFSYADTQRHRLGPNYLMLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPARHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E+ PIP RVLTG  +KCII+KENNFKQ GERYRS+   RQ+RFI RWV+ALSDPRVTHE 
Sbjct  404  EKVPIPTRVLTGCGEKCIIQKENNFKQAGERYRSFDPARQDRFIRRWVDALSDPRVTHEH  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
             +IWISYW+Q D SLGQKLASRLN++P M
Sbjct  464  HTIWISYWSQCDASLGQKLASRLNLKPNM  492



>gb|KFK44176.1| hypothetical protein AALP_AA1G224400 [Arabis alpina]
Length=492

 Score =   373 bits (957),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 169/209 (81%), Positives = 194/209 (93%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTK WPED+LP+QPVGRLVLNKNIDNFF ENEQ+AFCPA+VVPG++YSDDKLLQ+
Sbjct  284  FDPLDVTKIWPEDVLPMQPVGRLVLNKNIDNFFNENEQIAFCPALVVPGIHYSDDKLLQS  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIFSY+D+QRHRLGPNYLQLPVNAPKCAHHNNHH+GFMNFMHR+EEVNYFPSR+DP R+A
Sbjct  344  RIFSYADSQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRNEEVNYFPSRFDPVRNA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            +++P  P V +G R+KCII KENNFKQPGERYRSW + RQERF+ R+VEAL++PRVTHEI
Sbjct  404  QKYPTTPIVCSGNREKCIIGKENNFKQPGERYRSWDSARQERFVKRFVEALAEPRVTHEI  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            RSIWISYW+QADKSLGQKLASRLN RP+ 
Sbjct  464  RSIWISYWSQADKSLGQKLASRLNARPSF  492



>ref|XP_010061174.1| PREDICTED: catalase isozyme 3-like isoform X2 [Eucalyptus grandis]
 gb|KCW68092.1| hypothetical protein EUGRSUZ_F01775 [Eucalyptus grandis]
Length=492

 Score =   373 bits (957),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 168/209 (80%), Positives = 194/209 (93%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLD+TK WPED+LPLQPVGRLVLN+N+DNFFAENEQLAF PA VVPG+Y+S+DKLLQ 
Sbjct  284  FDPLDMTKIWPEDILPLQPVGRLVLNQNVDNFFAENEQLAFNPAFVVPGIYFSNDKLLQA  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIF+YSDT R+RLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEE+NYFPS++DP RHA
Sbjct  344  RIFAYSDTHRYRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEINYFPSKFDPVRHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E++PIP +++TGKR++ IIEKENNFKQ GERYRSW+ DRQERFI RW++ALS+PRVTHE 
Sbjct  404  ERYPIPSQIVTGKRERVIIEKENNFKQAGERYRSWAPDRQERFINRWIKALSEPRVTHEH  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            RSIWISYWTQADKS+GQKLAS L+ RP+M
Sbjct  464  RSIWISYWTQADKSIGQKLASSLSARPSM  492



>gb|ACB11496.1| catalase [Pinus sylvestris]
Length=492

 Score =   373 bits (957),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 170/209 (81%), Positives = 190/209 (91%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPED+ PLQPVGR+VLNKNIDNFFAENEQLAF P ++VPGVYY++DKLLQT
Sbjct  284  FDPLDVTKTWPEDIFPLQPVGRMVLNKNIDNFFAENEQLAFGPGLIVPGVYYTEDKLLQT  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIFSYSDTQRHRLGPNYL LP NAPKCAHHNNHH+GFMNFMHRDEEVNYFPSR+DP RHA
Sbjct  344  RIFSYSDTQRHRLGPNYLMLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPVRHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E+ PIP    TGKR+KC+IEKENNFKQPGERYRS++ +RQERF+ RWV ALSDPRVTHEI
Sbjct  404  ERFPIPSHTHTGKREKCVIEKENNFKQPGERYRSFAPERQERFVKRWVAALSDPRVTHEI  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
             SIWISYW+Q DKSLGQK+A+RLN++  M
Sbjct  464  CSIWISYWSQCDKSLGQKIAARLNMKANM  492



>gb|ABK24453.1| unknown [Picea sitchensis]
Length=492

 Score =   373 bits (957),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 170/209 (81%), Positives = 190/209 (91%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPED+ PLQPVGR+VLNKNIDNFFAENEQLAF PA+VVPG+YY++DKLLQT
Sbjct  284  FDPLDVTKTWPEDIFPLQPVGRMVLNKNIDNFFAENEQLAFSPALVVPGIYYTEDKLLQT  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIFSYSDTQRHRLGPNYL LP NAPKCAHHNNHH+GFMNFMHRDEEVNYFPSR+DP RHA
Sbjct  344  RIFSYSDTQRHRLGPNYLMLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPVRHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E+ PIP    +G R+KC+IEKENNFKQPGERYRS+  DRQERF+ RWV ALSDPRVTHEI
Sbjct  404  ERFPIPSHTHSGMREKCVIEKENNFKQPGERYRSFEPDRQERFVKRWVAALSDPRVTHEI  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
             SIWISYW+Q+DKSLGQK+A+RLN++  M
Sbjct  464  CSIWISYWSQSDKSLGQKIAARLNMKANM  492



>gb|ADZ45556.1| catalase [Vigna radiata]
Length=492

 Score =   373 bits (957),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 169/209 (81%), Positives = 192/209 (92%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPED++PLQPVGRLVLNKNIDNFFAENEQLAFCPAI+VPGVYYSDDK+LQT
Sbjct  284  FDPLDVTKTWPEDIIPLQPVGRLVLNKNIDNFFAENEQLAFCPAIIVPGVYYSDDKMLQT  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIFSY+D QRHRLGPNYL LP NAPK AHHNNHH+GFMNF+HRDEEVNYFPSRYDP RHA
Sbjct  344  RIFSYADPQRHRLGPNYLLLPANAPKSAHHNNHHEGFMNFIHRDEEVNYFPSRYDPVRHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E+ PIPP + +G+R+K  IEKENNFKQ GER+RSW+ DRQ+RF  RWV+ALSDPRVTHEI
Sbjct  404  EKFPIPPAICSGRREKIAIEKENNFKQAGERFRSWAPDRQDRFTRRWVDALSDPRVTHEI  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            RS+WISYW+QAD+SLGQK+AS L++RP +
Sbjct  464  RSVWISYWSQADRSLGQKIASHLSMRPNI  492



>gb|AAB07026.1| catalase 1 [Arabidopsis thaliana]
Length=492

 Score =   372 bits (956),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 172/209 (82%), Positives = 190/209 (91%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTK WPED+LPLQPVGRLVLNKNIDNFF ENEQ+AFCPA+VVP ++YSDD +LQT
Sbjct  284  FDPLDVTKIWPEDILPLQPVGRLVLNKNIDNFFNENEQIAFCPALVVPFIHYSDDNVLQT  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIFSY+D+QRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSR DP RHA
Sbjct  344  RIFSYADSQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRLDPVRHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E++P  P V +G R+KC I KENNFKQPGERYRSW +DRQERF+ R+VEAL +PRVTHEI
Sbjct  404  EKYPTTPIVCSGNREKCFIRKENNFKQPGERYRSWDSDRQERFVKRFVEALWEPRVTHEI  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            RSIWISYW+QADKSLGQKLA+RLNVRP  
Sbjct  464  RSIWISYWSQADKSLGQKLATRLNVRPNF  492



>gb|AIU99482.1| catalase [Saccharum hybrid cultivar ROC22]
Length=492

 Score =   372 bits (956),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 171/209 (82%), Positives = 192/209 (92%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPED++PLQPVGR+VLNKNIDNFFAENEQ+AFCPAI+VPG++YSDDKLLQT
Sbjct  284  FDPLDVTKTWPEDIIPLQPVGRMVLNKNIDNFFAENEQVAFCPAIIVPGIHYSDDKLLQT  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIFSY+DTQRHRLGPNYL LPV+APKCAHHNNHH+GFMNFMHRDEEVNYFPSR+DP RHA
Sbjct  344  RIFSYADTQRHRLGPNYLMLPVDAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPARHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E+ PIP RV TG R+KCII+KENNFKQ GERYRS+   RQ+RFI RWV+ALSDPRVTHE 
Sbjct  404  EKVPIPTRVQTGCREKCIIQKENNFKQAGERYRSFDPARQDRFIQRWVDALSDPRVTHEH  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
             +IWISYW+Q D SLGQKLASRLN++P M
Sbjct  464  HTIWISYWSQCDASLGQKLASRLNLKPNM  492



>gb|AIU99487.1| catalase [Saccharum hybrid cultivar ROC22]
Length=492

 Score =   372 bits (954),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 170/209 (81%), Positives = 191/209 (91%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DP DVTKTWPED++PLQPVGR+VLNKNIDNFFAENEQ+AFCPAI+VPG++YSDDKLLQT
Sbjct  284  FDPFDVTKTWPEDIIPLQPVGRMVLNKNIDNFFAENEQIAFCPAIIVPGIHYSDDKLLQT  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIFSY+DTQRHRLGPNYL LPVNAPKCAHHNNHH+GFMNFMHRDEEVNYFPSR+DP RHA
Sbjct  344  RIFSYADTQRHRLGPNYLMLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPARHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
             + PIP RVLTG R+KCII+KENNFKQ GERYRS+   RQ+RFI RWV+ALSDPRVTHE 
Sbjct  404  GKVPIPTRVLTGCREKCIIQKENNFKQAGERYRSFDPARQDRFIQRWVDALSDPRVTHEH  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
             +IW+SYW+Q D SLGQKLASRLN++P M
Sbjct  464  HTIWMSYWSQCDASLGQKLASRLNLKPNM  492



>sp|P55313.1|CATA2_WHEAT RecName: Full=Catalase [Triticum aestivum]
 emb|CAA64077.1| catalase [Triticum aestivum]
Length=492

 Score =   372 bits (954),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 168/209 (80%), Positives = 191/209 (91%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPED++PLQPVGR+VLNKNIDNFFAENEQLAFCPA+ VPG++YSDDKLLQT
Sbjct  284  FDPLDVTKTWPEDIIPLQPVGRMVLNKNIDNFFAENEQLAFCPAVTVPGIHYSDDKLLQT  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIFSY+DTQRHRLGPNYL LPVNAPKCAHHNNHHDG MNF+HRDEEVNYFPSR DP RHA
Sbjct  344  RIFSYADTQRHRLGPNYLMLPVNAPKCAHHNNHHDGLMNFIHRDEEVNYFPSRVDPTRHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E+ P+PPRVL+G R+KCII+KENNFKQ GERYRS+   RQ+RF+ RWV+AL+D RVTHEI
Sbjct  404  EKDPMPPRVLSGCREKCIIDKENNFKQAGERYRSFDPARQDRFLQRWVDALTDARVTHEI  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            +SIW+SYW+Q D SLGQKLASRL ++P M
Sbjct  464  QSIWVSYWSQCDASLGQKLASRLKIKPNM  492



>ref|XP_003631925.1| PREDICTED: catalase isozyme 1-like [Vitis vinifera]
Length=492

 Score =   371 bits (953),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 172/207 (83%), Positives = 190/207 (92%), Gaps = 0/207 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPED+LPLQPVGRLVLNKNIDNFFAENE LAF PA+VVPG+YY++DK+LQ 
Sbjct  284  FDPLDVTKTWPEDILPLQPVGRLVLNKNIDNFFAENEMLAFNPALVVPGIYYTNDKMLQG  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIF+YSDTQRHRLGPNYLQLPVNAPKCA HNNHHDG MNFMHRDEEV+YFPSR+DP RHA
Sbjct  344  RIFAYSDTQRHRLGPNYLQLPVNAPKCAFHNNHHDGSMNFMHRDEEVDYFPSRFDPVRHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E  PIP  +  GKR+K +IEKENNFKQPGERYRS++ DRQERFI RWVE LSDPRVT+EI
Sbjct  404  ETFPIPSTICHGKREKVVIEKENNFKQPGERYRSFAPDRQERFINRWVETLSDPRVTYEI  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRP  124
            RSIWISYW+QAD+SLGQKLASRLNV+P
Sbjct  464  RSIWISYWSQADRSLGQKLASRLNVKP  490



>ref|NP_001268098.1| catalase [Vitis vinifera]
 gb|AAL83720.1|AF236127_1 catalase [Vitis vinifera]
Length=492

 Score =   371 bits (952),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 172/207 (83%), Positives = 190/207 (92%), Gaps = 0/207 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPED+LPLQPVGRLVLNKNIDNFFAENE LAF PA+VVPG+YY++DK+LQ 
Sbjct  284  FDPLDVTKTWPEDILPLQPVGRLVLNKNIDNFFAENEMLAFNPALVVPGIYYTNDKMLQG  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIF+YSDTQRHRLGPNYLQLPVNAPKCA HNNHHDG MNFMHRDEEV+YFPSR+DP RHA
Sbjct  344  RIFAYSDTQRHRLGPNYLQLPVNAPKCAFHNNHHDGSMNFMHRDEEVDYFPSRFDPVRHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E  PIP  +  GKR+K +IEKENNFKQPGERYRS++ DRQERFI RWVE LSDPRVT+EI
Sbjct  404  ETFPIPSTICHGKREKVVIEKENNFKQPGERYRSFAPDRQERFINRWVETLSDPRVTYEI  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRP  124
            RSIWISYW+QAD+SLGQKLASRLNV+P
Sbjct  464  RSIWISYWSQADRSLGQKLASRLNVKP  490



>ref|XP_002963086.1| hypothetical protein SELMODRAFT_438313 [Selaginella moellendorffii]
 gb|EFJ36549.1| hypothetical protein SELMODRAFT_438313 [Selaginella moellendorffii]
Length=484

 Score =   370 bits (951),  Expect = 8e-123, Method: Compositional matrix adjust.
 Identities = 170/209 (81%), Positives = 188/209 (90%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPEDL PLQPVGRLVLNKNIDNFFAENEQLAFCPA+VVPGVYY+DDKLLQT
Sbjct  276  FDPLDVTKTWPEDLFPLQPVGRLVLNKNIDNFFAENEQLAFCPALVVPGVYYTDDKLLQT  335

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIFSY+DTQRHRLGPNYL LP NAPKCAHHNNHH+GFMNF HRDEEVNYFPSR+DP RHA
Sbjct  336  RIFSYADTQRHRLGPNYLLLPANAPKCAHHNNHHEGFMNFTHRDEEVNYFPSRFDPCRHA  395

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E+ PIP   L G+R+K +IEKENNF QPG R+RSW  DRQERFI R V+ALSDPRVTHEI
Sbjct  396  ERVPIPSHPLGGRREKVMIEKENNFAQPGARFRSWPADRQERFIARVVDALSDPRVTHEI  455

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            RSIW+SYW+QAD+ LGQK+A++LNV+  M
Sbjct  456  RSIWLSYWSQADRMLGQKIATKLNVKANM  484



>gb|AIU99483.1| catalase [Saccharum hybrid cultivar ROC22]
Length=492

 Score =   370 bits (951),  Expect = 9e-123, Method: Compositional matrix adjust.
 Identities = 170/209 (81%), Positives = 192/209 (92%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPED++PLQPVGR+VLNKNIDNFFAENEQ+AFCPAI+VPG++YSDDKLLQT
Sbjct  284  FDPLDVTKTWPEDIIPLQPVGRMVLNKNIDNFFAENEQVAFCPAIIVPGIHYSDDKLLQT  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIFSY+DTQRHRLGPNYL LPV+APKCAHHNNHH+GFMNFMHRDEEVNYFPSR+DP RHA
Sbjct  344  RIFSYADTQRHRLGPNYLMLPVDAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPARHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E+ PIP RVLTG R+KCII+KENNFKQ GERYRS+    Q+RFI RWV+ALSDPRVTHE 
Sbjct  404  EKVPIPTRVLTGCREKCIIQKENNFKQAGERYRSFDPAGQDRFIQRWVDALSDPRVTHEH  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
             +IWISYW+Q D SLGQ+LASRLN++P M
Sbjct  464  HTIWISYWSQCDASLGQELASRLNLKPNM  492



>gb|EMT05040.1| Catalase-1 [Aegilops tauschii]
Length=526

 Score =   371 bits (953),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 168/209 (80%), Positives = 192/209 (92%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPED++PLQPVGRLVLN+NIDNFFAENEQLAFCP I+VPGVYYSDDKLLQT
Sbjct  318  FDPLDVTKTWPEDVVPLQPVGRLVLNRNIDNFFAENEQLAFCPGIIVPGVYYSDDKLLQT  377

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIFSYSDTQRHRLGPNYL LP NAPKC+HHNNH+DG MNFMHRDEEV+YFPSR+DP +HA
Sbjct  378  RIFSYSDTQRHRLGPNYLLLPANAPKCSHHNNHYDGLMNFMHRDEEVDYFPSRFDPAKHA  437

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
             ++PIP R L G+R+K +IEKENNFKQPGERYRS    RQERFI RW++ALSDPR+THEI
Sbjct  438  PRYPIPSRTLNGRREKMVIEKENNFKQPGERYRSMDPARQERFINRWIDALSDPRLTHEI  497

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            ++IW+SYW+QADKSLGQKLASRL+ +P+M
Sbjct  498  KAIWLSYWSQADKSLGQKLASRLSSKPSM  526



>gb|ACL35349.1| catalase [Picea glauca]
Length=492

 Score =   370 bits (950),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 169/209 (81%), Positives = 189/209 (90%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPED+ PLQPVGR+VLNKNIDNFFAENEQLAF PA+VVPG+YY++DKLLQT
Sbjct  284  FDPLDVTKTWPEDIFPLQPVGRMVLNKNIDNFFAENEQLAFSPALVVPGIYYTEDKLLQT  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIFSYSDTQRHRLGPNYL LP NAPKCAHHNNHH+GFMNFMHRDEEVNYFPSR+DP RHA
Sbjct  344  RIFSYSDTQRHRLGPNYLMLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPVRHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E+ PIP    +G R+KC+IEKENNFKQPGERYRS+  DRQERF+ RWV ALSDPRVTHEI
Sbjct  404  ERFPIPSHTHSGMREKCVIEKENNFKQPGERYRSFEPDRQERFVKRWVAALSDPRVTHEI  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
             SIWI YW+Q+DKSLGQK+A+RLN++  M
Sbjct  464  CSIWIFYWSQSDKSLGQKIAARLNMKANM  492



>gb|ABQ44283.1| catalase [Saccharum hybrid cultivar NCo 376]
Length=339

 Score =   365 bits (936),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 166/209 (79%), Positives = 190/209 (91%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPED+ PLQPVGR+VLN+NIDNFFAENEQLAFCP ++VPG+YYSDDKLLQT
Sbjct  131  FDPLDVTKTWPEDVFPLQPVGRMVLNRNIDNFFAENEQLAFCPGLIVPGIYYSDDKLLQT  190

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIFSYSDTQRHRLGPNYL LP NAPKCAHHNNH+DGFMNFMHRDEEV+YFPSRYDP ++A
Sbjct  191  RIFSYSDTQRHRLGPNYLLLPANAPKCAHHNNHYDGFMNFMHRDEEVDYFPSRYDPAKNA  250

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
             ++PIP   +TG+RDK +I KENNFKQPGERYR+    RQERFI RWV+ALSDPR+THEI
Sbjct  251  PRYPIPTVHITGRRDKTVIAKENNFKQPGERYRAMDPARQERFIKRWVDALSDPRLTHEI  310

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            RSIW+S W+QAD+SLGQKLASRL+ +P+M
Sbjct  311  RSIWLSNWSQADRSLGQKLASRLSAKPSM  339



>gb|ADN94253.1| catalase [Puccinellia chinampoensis]
Length=492

 Score =   369 bits (948),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 170/209 (81%), Positives = 189/209 (90%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPED++PLQPVGR+VLNKNIDNFFAENEQLAFCPAI VPG++YSDDKLLQT
Sbjct  284  FDPLDVTKTWPEDIIPLQPVGRMVLNKNIDNFFAENEQLAFCPAITVPGIHYSDDKLLQT  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIFSY+DTQRHRLGPNYL LPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSR+DP RHA
Sbjct  344  RIFSYADTQRHRLGPNYLMLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRFDPVRHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E++PIP R LTG R+KCIIEKENNFKQ GER+RS+    Q+RFI  WV+AL+D RVTHEI
Sbjct  404  EKYPIPSRTLTGCREKCIIEKENNFKQAGERFRSFDPAGQDRFIQWWVDALTDTRVTHEI  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            + IWISYW+Q D SLGQKLASRL ++P M
Sbjct  464  QGIWISYWSQCDASLGQKLASRLKMKPNM  492



>sp|Q43206.1|CATA1_WHEAT RecName: Full=Catalase-1 [Triticum aestivum]
 dbj|BAA13068.1| catalase [Triticum aestivum]
 gb|ADF83496.1| catalase [Triticum aestivum]
Length=492

 Score =   369 bits (948),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 167/209 (80%), Positives = 192/209 (92%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPED++PLQPVGRLVLN+NIDNFF+ENEQLAFCP I+VPGVYYSDDKLLQT
Sbjct  284  FDPLDVTKTWPEDVVPLQPVGRLVLNRNIDNFFSENEQLAFCPGIIVPGVYYSDDKLLQT  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIFSYSDTQRHRLGPNYL LP NAPKC+HHNNH+DG MNFMHRDEEV+YFPSR+DP +HA
Sbjct  344  RIFSYSDTQRHRLGPNYLLLPANAPKCSHHNNHYDGLMNFMHRDEEVDYFPSRFDPAKHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
             ++PIP R L G+R+K +IEKENNFKQPGERYRS    RQERFI RW++ALSDPR+THEI
Sbjct  404  PRYPIPSRTLNGRREKMVIEKENNFKQPGERYRSMDPARQERFINRWIDALSDPRLTHEI  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            ++IW+SYW+QADKSLGQKLASRL+ +P+M
Sbjct  464  KAIWLSYWSQADKSLGQKLASRLSSKPSM  492



>ref|XP_006473789.1| PREDICTED: catalase-like isoform X1 [Citrus sinensis]
Length=477

 Score =   369 bits (946),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 169/212 (80%), Positives = 192/212 (91%), Gaps = 0/212 (0%)
 Frame = -1

Query  753  QI*LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKL  574
            Q   DPLDVTK WPED++PLQPVGRLVLNKNIDNFFAENE LAF P IVVPG+YYS+DK+
Sbjct  266  QFDFDPLDVTKWWPEDIIPLQPVGRLVLNKNIDNFFAENEMLAFNPGIVVPGIYYSNDKM  325

Query  573  LQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPX  394
            LQ RIF+Y DTQRHRLGPNYL LPVNAPKC H NNH+DGFMNFMHRDEEV+YFPSRYDP 
Sbjct  326  LQCRIFAYGDTQRHRLGPNYLMLPVNAPKCPHRNNHYDGFMNFMHRDEEVDYFPSRYDPT  385

Query  393  RHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVT  214
            RHAE++PIP  V+TG+R+K  IEKENNFKQPGERYRSW+ DRQERF+ RW++AL DPRVT
Sbjct  386  RHAERYPIPSDVITGRREKACIEKENNFKQPGERYRSWAPDRQERFLNRWIKALCDPRVT  445

Query  213  HEIRSIWISYWTQADKSLGQKLASRLNVRPTM  118
            HE+RSIW+SYW+QAD+SLGQKLASRLNVRP++
Sbjct  446  HEVRSIWVSYWSQADRSLGQKLASRLNVRPSI  477



>sp|P18122.1|CATA1_MAIZE RecName: Full=Catalase isozyme 1 [Zea mays]
Length=492

 Score =   369 bits (947),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 169/209 (81%), Positives = 191/209 (91%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPED++PLQPVGR+VLNKN+DNFFAENEQ+AFCPAI VP ++YSDDKLLQT
Sbjct  284  FDPLDVTKTWPEDIIPLQPVGRMVLNKNVDNFFAENEQIAFCPAISVPAIHYSDDKLLQT  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIFSY+DTQRHRLGPNYL LPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSR+DP RHA
Sbjct  344  RIFSYADTQRHRLGPNYLMLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRFDPARHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E+ PIPPRVLT  R+KCII+KENNFKQ GERYRS+   RQ+RFI RWV+AL+ PRVTHE 
Sbjct  404  EKVPIPPRVLTRCREKCIIQKENNFKQAGERYRSFDPARQDRFIQRWVDALTHPRVTHEH  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            R+IWISYW+Q D +LGQKL SRLN++P+M
Sbjct  464  RTIWISYWSQCDAALGQKLPSRLNLKPSM  492



>dbj|BAJ90861.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ86892.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=492

 Score =   369 bits (946),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 167/209 (80%), Positives = 191/209 (91%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPED++PLQPVGRLVLN+NIDNFFAENEQLAFCP I+VPGVYYSDDKLLQT
Sbjct  284  FDPLDVTKTWPEDVVPLQPVGRLVLNRNIDNFFAENEQLAFCPGIIVPGVYYSDDKLLQT  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIFSYSDTQRHRLGPNYL LP NAPKC+HHNNH+DG MNFMHRDEEV+YFPSR+DP +HA
Sbjct  344  RIFSYSDTQRHRLGPNYLLLPANAPKCSHHNNHYDGLMNFMHRDEEVDYFPSRFDPAKHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
             ++PIP R L G+R+K  I+KENNFKQPGERYRS    RQERFI RW++ALSDPR+THEI
Sbjct  404  PRYPIPARALNGRREKACIDKENNFKQPGERYRSMDPARQERFINRWIDALSDPRLTHEI  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            ++IW+SYW+QADKSLGQKLASRL+ +P+M
Sbjct  464  KAIWLSYWSQADKSLGQKLASRLSAKPSM  492



>ref|XP_002980247.1| hypothetical protein SELMODRAFT_178171 [Selaginella moellendorffii]
 gb|EFJ18507.1| hypothetical protein SELMODRAFT_178171 [Selaginella moellendorffii]
Length=492

 Score =   369 bits (946),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 169/209 (81%), Positives = 188/209 (90%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPEDL PLQPVGRLVLNKNIDNFFAENEQLAFCPA+VVPGVYY+DDKLLQT
Sbjct  284  FDPLDVTKTWPEDLFPLQPVGRLVLNKNIDNFFAENEQLAFCPALVVPGVYYTDDKLLQT  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIFSY+DTQRHRLGPNYL LP NAPKCAHHNNHH+GFMNF HRDEEVNYFPSR+DP RHA
Sbjct  344  RIFSYADTQRHRLGPNYLLLPANAPKCAHHNNHHEGFMNFTHRDEEVNYFPSRFDPCRHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E+ PIP   L G+R+K +IEKENNF QPG R+RSW  +RQERFI R V+ALSDPRVTHEI
Sbjct  404  ERVPIPSHPLGGRREKVMIEKENNFAQPGARFRSWPAERQERFIARVVDALSDPRVTHEI  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            RSIW+SYW+QAD+ LGQK+A++LNV+  M
Sbjct  464  RSIWLSYWSQADRMLGQKIATKLNVKANM  492



>ref|XP_006435361.1| hypothetical protein CICLE_v10000948mg [Citrus clementina]
 ref|XP_006473790.1| PREDICTED: catalase-like isoform X2 [Citrus sinensis]
 gb|ESR48601.1| hypothetical protein CICLE_v10000948mg [Citrus clementina]
Length=493

 Score =   369 bits (946),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 169/212 (80%), Positives = 192/212 (91%), Gaps = 0/212 (0%)
 Frame = -1

Query  753  QI*LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKL  574
            Q   DPLDVTK WPED++PLQPVGRLVLNKNIDNFFAENE LAF P IVVPG+YYS+DK+
Sbjct  282  QFDFDPLDVTKWWPEDIIPLQPVGRLVLNKNIDNFFAENEMLAFNPGIVVPGIYYSNDKM  341

Query  573  LQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPX  394
            LQ RIF+Y DTQRHRLGPNYL LPVNAPKC H NNH+DGFMNFMHRDEEV+YFPSRYDP 
Sbjct  342  LQCRIFAYGDTQRHRLGPNYLMLPVNAPKCPHRNNHYDGFMNFMHRDEEVDYFPSRYDPT  401

Query  393  RHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVT  214
            RHAE++PIP  V+TG+R+K  IEKENNFKQPGERYRSW+ DRQERF+ RW++AL DPRVT
Sbjct  402  RHAERYPIPSDVITGRREKACIEKENNFKQPGERYRSWAPDRQERFLNRWIKALCDPRVT  461

Query  213  HEIRSIWISYWTQADKSLGQKLASRLNVRPTM  118
            HE+RSIW+SYW+QAD+SLGQKLASRLNVRP++
Sbjct  462  HEVRSIWVSYWSQADRSLGQKLASRLNVRPSI  493



>gb|AAF79625.1|AC027665_26 F5M15.5 [Arabidopsis thaliana]
 gb|AAF80611.1|AC069251_4 F2D10.11 [Arabidopsis thaliana]
Length=1013

 Score =   382 bits (981),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 176/209 (84%), Positives = 193/209 (92%), Gaps = 0/209 (0%)
 Frame = -1

Query  744   LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
              DPLDVTK WPED+LPLQPVGRLVLNKNIDNFF ENEQ+AFCPA+VVPG++YSDDKLLQT
Sbjct  805   FDPLDVTKIWPEDILPLQPVGRLVLNKNIDNFFNENEQIAFCPALVVPGIHYSDDKLLQT  864

Query  564   RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
             RIFSY+D+QRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSR DP RHA
Sbjct  865   RIFSYADSQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRLDPVRHA  924

Query  384   EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
             E++P  P V +G R+KC I KENNFKQPGERYRSW +DRQERF+ R+VEALS+PRVTHEI
Sbjct  925   EKYPTTPIVCSGNREKCFIGKENNFKQPGERYRSWDSDRQERFVKRFVEALSEPRVTHEI  984

Query  204   RSIWISYWTQADKSLGQKLASRLNVRPTM  118
             RSIWISYW+QADKSLGQKLA+RLNVRP  
Sbjct  985   RSIWISYWSQADKSLGQKLATRLNVRPNF  1013


 Score =   357 bits (915),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 162/208 (78%), Positives = 184/208 (88%), Gaps = 0/208 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTK WPED+LPLQPVGRLVLN+ IDNFF E EQLAF P +VVPG+YYSDDKLLQ 
Sbjct  323  FDPLDVTKIWPEDILPLQPVGRLVLNRTIDNFFNETEQLAFNPGLVVPGIYYSDDKLLQC  382

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIF+Y DTQRHRLGPNYLQLPVNAPKCAHHNNHH+GFMNFMHRDEE+NY+PS++DP R A
Sbjct  383  RIFAYGDTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEINYYPSKFDPVRCA  442

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E+ P P    TG R KC+I+KENNFKQ G+RYRSW+ DRQ+RF+ RWVE LS+PR+THEI
Sbjct  443  EKVPTPTNSYTGIRTKCVIKKENNFKQAGDRYRSWAPDRQDRFVKRWVEILSEPRLTHEI  502

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPT  121
            R IWISYW+QAD+SLGQKLASRLNVRP+
Sbjct  503  RGIWISYWSQADRSLGQKLASRLNVRPS  530



>ref|XP_009590727.1| PREDICTED: catalase isozyme 1 [Nicotiana tomentosiformis]
Length=492

 Score =   367 bits (943),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 168/209 (80%), Positives = 190/209 (91%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPED+LPL PVGRLVLN+NIDNFFAENEQLAF P  +VPGVYYS+DKLLQT
Sbjct  284  FDPLDVTKTWPEDILPLMPVGRLVLNRNIDNFFAENEQLAFNPGHIVPGVYYSEDKLLQT  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIF+Y+DTQRHR+GPNY+QLPVNAPKCAHHNNH DG MNFMHRDEEV+Y PSR+DP RHA
Sbjct  344  RIFAYADTQRHRIGPNYMQLPVNAPKCAHHNNHRDGAMNFMHRDEEVDYLPSRFDPCRHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            EQ+PIP RVLTG+R+ C+IEKENNFKQ GERYRSW  DRQ+R++ +WVE LSDPRVT+EI
Sbjct  404  EQYPIPSRVLTGRREMCVIEKENNFKQAGERYRSWEPDRQDRYVSKWVEHLSDPRVTYEI  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            RSIWISY +QADKS GQK+ASRL V+PTM
Sbjct  464  RSIWISYLSQADKSCGQKVASRLTVKPTM  492



>gb|AAA57551.1| catalase, partial [Nicotiana sylvestris]
Length=383

 Score =   363 bits (932),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 166/209 (79%), Positives = 190/209 (91%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPED+LPL PVGRLVLN+NIDNFFAENEQLAF P  +VPG+YYS+DKLLQT
Sbjct  175  FDPLDVTKTWPEDILPLMPVGRLVLNRNIDNFFAENEQLAFNPGHIVPGLYYSEDKLLQT  234

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIF+Y+DTQRHR+GPNY+QLPVNAPKCAHHNNH DG MNFMHRDEEV+Y PSR+DP RHA
Sbjct  235  RIFAYADTQRHRIGPNYMQLPVNAPKCAHHNNHRDGAMNFMHRDEEVDYLPSRFDPCRHA  294

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            EQ+PIP RVLTG+R+ C+IEKENNFKQ GERYRSW  DRQ+R++ +WVE LSDPRVT+EI
Sbjct  295  EQYPIPSRVLTGRREMCVIEKENNFKQAGERYRSWEPDRQDRYVSKWVEHLSDPRVTYEI  354

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            RSIWISY +QADKS GQK+ASRL ++PTM
Sbjct  355  RSIWISYLSQADKSCGQKVASRLTLKPTM  383



>dbj|BAJ88747.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=533

 Score =   368 bits (945),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 167/209 (80%), Positives = 191/209 (91%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPED++PLQPVGRLVLN+NIDNFFAENEQLAFCP I+VPGVYYSDDKLLQT
Sbjct  325  FDPLDVTKTWPEDVVPLQPVGRLVLNRNIDNFFAENEQLAFCPGIIVPGVYYSDDKLLQT  384

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIFSYSDTQRHRLGPNYL LP NAPKC+HHNNH+DG MNFMHRDEEV+YFPSR+DP +HA
Sbjct  385  RIFSYSDTQRHRLGPNYLLLPANAPKCSHHNNHYDGLMNFMHRDEEVDYFPSRFDPAKHA  444

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
             ++PIP R L G+R+K  I+KENNFKQPGERYRS    RQERFI RW++ALSDPR+THEI
Sbjct  445  PRYPIPARALNGRREKACIDKENNFKQPGERYRSMDPARQERFINRWIDALSDPRLTHEI  504

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            ++IW+SYW+QADKSLGQKLASRL+ +P+M
Sbjct  505  KAIWLSYWSQADKSLGQKLASRLSAKPSM  533



>gb|AIZ77475.1| catalase, partial [Triticum aestivum]
Length=490

 Score =   366 bits (940),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 166/207 (80%), Positives = 190/207 (92%), Gaps = 0/207 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPED++PLQPVGRLVLN+NIDNFF+ENEQLAFCP I+VPGVYYSDDKLLQT
Sbjct  284  FDPLDVTKTWPEDVVPLQPVGRLVLNRNIDNFFSENEQLAFCPGIIVPGVYYSDDKLLQT  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIFSYSDTQRHRLGPNYL LP NAPKC+HHNNH+DG MNFMHRDEEV+YFPSR+DP +HA
Sbjct  344  RIFSYSDTQRHRLGPNYLLLPANAPKCSHHNNHYDGLMNFMHRDEEVDYFPSRFDPAKHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
             ++PIP R L G+R+K +IEKENNFKQPGERYRS    RQERFI RW++ALSDPR+THEI
Sbjct  404  PRYPIPSRTLNGRREKMVIEKENNFKQPGERYRSMDPARQERFINRWIDALSDPRLTHEI  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRP  124
            ++IW+SYW+QADKSLGQKLASRL+ +P
Sbjct  464  KAIWLSYWSQADKSLGQKLASRLSSKP  490



>emb|CAG23920.1| catalase [Festuca arundinacea]
Length=492

 Score =   365 bits (938),  Expect = 8e-121, Method: Compositional matrix adjust.
 Identities = 166/209 (79%), Positives = 190/209 (91%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPED++PLQPVGRLVLN+NIDNFFAENEQLAFCP I+VPGVYYSDDKLLQT
Sbjct  284  FDPLDVTKTWPEDVVPLQPVGRLVLNRNIDNFFAENEQLAFCPGIIVPGVYYSDDKLLQT  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIFSYSDTQRHRLGPNYL LP NAPKC+HHNNH+DG MNFMHRDEEV+YFPSR+DP   A
Sbjct  344  RIFSYSDTQRHRLGPNYLLLPANAPKCSHHNNHYDGLMNFMHRDEEVDYFPSRFDPATDA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
             ++PIP R L G+R+K +IEKENNFKQPGERYRS    RQERFI RW++ALSDPR+THEI
Sbjct  404  PRYPIPSRTLNGRREKMVIEKENNFKQPGERYRSMDPARQERFINRWIDALSDPRLTHEI  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            ++IW+SYW+QAD+SLGQKLA RL+V+P+M
Sbjct  464  KAIWLSYWSQADRSLGQKLAGRLSVKPSM  492



>ref|XP_010498496.1| PREDICTED: catalase-3 [Camelina sativa]
 ref|XP_010459748.1| PREDICTED: catalase-3 [Camelina sativa]
 ref|XP_010477307.1| PREDICTED: catalase-3 [Camelina sativa]
Length=492

 Score =   365 bits (938),  Expect = 9e-121, Method: Compositional matrix adjust.
 Identities = 166/209 (79%), Positives = 189/209 (90%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTK WPED+LPLQPVGRLVLN+ IDNFF E EQLAF P +VVPG+YYSDDKLLQ 
Sbjct  284  FDPLDVTKIWPEDILPLQPVGRLVLNRTIDNFFNETEQLAFNPGLVVPGIYYSDDKLLQC  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIF+Y DTQRHRLGPNYLQLPVNAPKCAHHNNHH+GFMNFMHRDEE+NY+PS++DP R A
Sbjct  344  RIFAYGDTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEINYYPSKFDPVRCA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E+ PIP +  TG R KCII+KENNFKQPG+RYRSW+ DRQ+RF+ RWVE LS+PR+THEI
Sbjct  404  EKVPIPTKSYTGIRTKCIIKKENNFKQPGDRYRSWAPDRQDRFVKRWVEILSEPRLTHEI  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            RSIWISYW+QAD+SLGQKLASRLNVRP++
Sbjct  464  RSIWISYWSQADRSLGQKLASRLNVRPSI  492



>ref|XP_009110221.1| PREDICTED: catalase-3 [Brassica rapa]
 gb|AFN81244.1| catalase 2 [Brassica rapa subsp. pekinensis]
 emb|CDX96630.1| BnaA08g21730D [Brassica napus]
Length=492

 Score =   365 bits (937),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 166/209 (79%), Positives = 189/209 (90%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTK WPED+LPLQPVGRLVLN+ IDNFF E EQLAF P +VVPG+YYSDDKLLQ 
Sbjct  284  FDPLDVTKIWPEDILPLQPVGRLVLNRTIDNFFNETEQLAFNPGLVVPGIYYSDDKLLQC  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIF+Y DTQRHRLGPNYLQLPVNAPKCAHHNNHH+GFMNFMHRDEE+NY+PS++DP R A
Sbjct  344  RIFAYGDTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEINYYPSKFDPVRCA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E+ PIP +  TG R KCII+KENNFKQPG+RYRSW+ DRQ+RF+ RWVE LS+PR+THEI
Sbjct  404  EKVPIPTKSYTGIRTKCIIKKENNFKQPGDRYRSWAPDRQDRFVKRWVEILSEPRLTHEI  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            RSIWISYW+QAD+SLGQKLASRLNVRP++
Sbjct  464  RSIWISYWSQADRSLGQKLASRLNVRPSI  492



>ref|XP_003558892.1| PREDICTED: catalase-1 [Brachypodium distachyon]
Length=492

 Score =   365 bits (937),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 165/209 (79%), Positives = 190/209 (91%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPED++PLQPVGRLVLN+NIDNFF+ENEQLAFCP I+VPG+YYSDDKLLQT
Sbjct  284  FDPLDVTKTWPEDIIPLQPVGRLVLNRNIDNFFSENEQLAFCPGIIVPGIYYSDDKLLQT  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIFSYSDTQRHRLGPNYL LP NAPKCAHHNNH+DG MNFMHRDEEV+YFPSR+DP +HA
Sbjct  344  RIFSYSDTQRHRLGPNYLLLPANAPKCAHHNNHYDGTMNFMHRDEEVDYFPSRFDPAKHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
             ++PIP     G+R+K +IEKENNFKQPGERYRS    RQERFI RW++ALSDPR+THEI
Sbjct  404  PRYPIPSSTCNGRREKMVIEKENNFKQPGERYRSMDPARQERFINRWIDALSDPRLTHEI  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            +SIW+SYW+QAD+SLGQKLASRL+ +P+M
Sbjct  464  KSIWLSYWSQADRSLGQKLASRLSAKPSM  492



>ref|XP_002890395.1| F5M15.5 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH66654.1| F5M15.5 [Arabidopsis lyrata subsp. lyrata]
Length=981

 Score =   379 bits (973),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 175/209 (84%), Positives = 192/209 (92%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTK WPED+LPLQPVGRLVLNKNIDNFF E EQ+AFCPA+VVPG++YSDDKLLQT
Sbjct  773  FDPLDVTKIWPEDILPLQPVGRLVLNKNIDNFFNEYEQIAFCPALVVPGIHYSDDKLLQT  832

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIFSY+D+QRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSR DP RHA
Sbjct  833  RIFSYADSQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRLDPVRHA  892

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E++P  P V TG R+KC I KENNF+QPGERYRSW +DRQERF+ R+VEALS+PRVTHEI
Sbjct  893  EKYPTTPIVCTGNREKCFIGKENNFQQPGERYRSWDSDRQERFVKRFVEALSEPRVTHEI  952

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            RSIWISYW+QADKSLGQKLA+RLNVRP  
Sbjct  953  RSIWISYWSQADKSLGQKLATRLNVRPNF  981


 Score =   358 bits (920),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 163/208 (78%), Positives = 185/208 (89%), Gaps = 0/208 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTK WPED+LPLQPVGRLVLN+ IDNFF E EQLAF P +VVPG+YYSDDKLLQ 
Sbjct  291  FDPLDVTKIWPEDILPLQPVGRLVLNRTIDNFFNETEQLAFNPGLVVPGIYYSDDKLLQC  350

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIF+Y DTQRHRLGPNYLQLPVNAPKCAHHNNHH+GFMNFMHRDEE+NY+PS++DP R A
Sbjct  351  RIFAYGDTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEINYYPSKFDPVRCA  410

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E+ PIP    TG R KC+I+KENNFKQ G+RYRSW+ DRQ+RF+ RWVE LS+PR+THEI
Sbjct  411  EKAPIPTNSYTGIRTKCVIKKENNFKQAGDRYRSWAPDRQDRFVKRWVEILSEPRLTHEI  470

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPT  121
            R IWISYW+QAD+SLGQKLASRLNVRP+
Sbjct  471  RGIWISYWSQADRSLGQKLASRLNVRPS  498



>emb|CDY31490.1| BnaC05g15990D [Brassica napus]
Length=492

 Score =   365 bits (936),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 169/209 (81%), Positives = 188/209 (90%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTK WPED+LPLQPVGRLVLNKNIDNFF ENEQLAFCPAIVVPG +YSDDKLLQ+
Sbjct  284  FDPLDVTKIWPEDILPLQPVGRLVLNKNIDNFFNENEQLAFCPAIVVPGFHYSDDKLLQS  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIFSY+D+QRHRLGPNYLQLPVNAPKCAHHNNHH+G MNFMHRDEEVNYFPSR +P RHA
Sbjct  344  RIFSYADSQRHRLGPNYLQLPVNAPKCAHHNNHHEGLMNFMHRDEEVNYFPSRLNPVRHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E++P  P    G R+KC+IEKENNFKQPGERYRSW  DRQERF+ R+V+AL++PRVTHEI
Sbjct  404  EKYPQNPIACAGNREKCMIEKENNFKQPGERYRSWDADRQERFVKRFVDALAEPRVTHEI  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            RSIWIS WT+AD+SLGQKLA+RLNV P  
Sbjct  464  RSIWISNWTKADESLGQKLATRLNVSPNF  492



>ref|XP_009792372.1| PREDICTED: catalase isozyme 1 [Nicotiana sylvestris]
Length=492

 Score =   365 bits (936),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 166/209 (79%), Positives = 190/209 (91%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPED+LPL PVGRLVLN+NIDNFFAENEQLAF P  +VPG+YYS+DKLLQT
Sbjct  284  FDPLDVTKTWPEDILPLMPVGRLVLNRNIDNFFAENEQLAFNPGHIVPGLYYSEDKLLQT  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIF+Y+DTQRHR+GPNY+QLPVNAPKCAHHNNH DG MNFMHRDEEV+Y PSR+DP RHA
Sbjct  344  RIFAYADTQRHRIGPNYMQLPVNAPKCAHHNNHRDGAMNFMHRDEEVDYLPSRFDPCRHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            EQ+PIP RVLTG+R+ C+IEKENNFKQ GERYRSW  DRQ+R++ +WVE LSDPRVT+EI
Sbjct  404  EQYPIPSRVLTGRREMCVIEKENNFKQAGERYRSWEPDRQDRYVSKWVEHLSDPRVTYEI  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            RSIWISY +QADKS GQK+ASRL ++PTM
Sbjct  464  RSIWISYLSQADKSCGQKVASRLTLKPTM  492



>sp|P49319.2|CATA1_TOBAC RecName: Full=Catalase isozyme 1; AltName: Full=Salicylic acid-binding 
protein; Short=SABP [Nicotiana tabacum]
 gb|AAA57552.1| catalase [Nicotiana tabacum]
Length=492

 Score =   365 bits (936),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 166/209 (79%), Positives = 190/209 (91%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPED+LPL PVGRLVLN+NIDNFFAENEQLAF P  +VPG+YYS+DKLLQT
Sbjct  284  FDPLDVTKTWPEDILPLMPVGRLVLNRNIDNFFAENEQLAFNPGHIVPGLYYSEDKLLQT  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIF+Y+DTQRHR+GPNY+QLPVNAPKCAHHNNH DG MNFMHRDEEV+Y PSR+DP RHA
Sbjct  344  RIFAYADTQRHRIGPNYMQLPVNAPKCAHHNNHRDGAMNFMHRDEEVDYLPSRFDPCRHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            EQ+PIP RVLTG+R+ C+IEKENNFKQ GERYRSW  DRQ+R++ +WVE LSDPRVT+EI
Sbjct  404  EQYPIPSRVLTGRREMCVIEKENNFKQAGERYRSWEPDRQDRYVSKWVEHLSDPRVTYEI  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            RSIWISY +QADKS GQK+ASRL ++PTM
Sbjct  464  RSIWISYLSQADKSCGQKVASRLTLKPTM  492



>emb|CDY29518.1| BnaA06g14520D [Brassica napus]
Length=492

 Score =   365 bits (936),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 169/209 (81%), Positives = 188/209 (90%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTK WPED+LPLQPVGRLVLNKNIDNFF ENEQLAFCPAIVVPG +YSDDKLLQ+
Sbjct  284  FDPLDVTKIWPEDILPLQPVGRLVLNKNIDNFFNENEQLAFCPAIVVPGFHYSDDKLLQS  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIFSY+D+QRHRLGPNYLQLPVNAPKCAHHNNHH+G MNFMHRDEEVNYFPSR +P RHA
Sbjct  344  RIFSYADSQRHRLGPNYLQLPVNAPKCAHHNNHHEGLMNFMHRDEEVNYFPSRLNPVRHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E++P  P    G R+KC+IEKENNFKQPGERYRSW  DRQERF+ R+V+AL++PRVTHEI
Sbjct  404  EKYPQNPIACAGNREKCMIEKENNFKQPGERYRSWDADRQERFVKRFVDALAEPRVTHEI  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            RSIWIS WT+AD+SLGQKLA+RLNV P  
Sbjct  464  RSIWISNWTKADESLGQKLATRLNVSPNF  492



>emb|CDY29519.1| BnaA06g14510D [Brassica napus]
Length=492

 Score =   365 bits (936),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 166/209 (79%), Positives = 189/209 (90%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTK WPED+LPLQPVGRLVLN+ IDNFF E EQLAF P +VVPG+YYSDDKLLQ 
Sbjct  284  FDPLDVTKIWPEDILPLQPVGRLVLNRTIDNFFNETEQLAFNPGLVVPGIYYSDDKLLQC  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIF+Y DTQRHRLGPNYLQLPVNAPKCAHHNNHH+GFMNFMHRDEE+NY+PS++DP R A
Sbjct  344  RIFAYGDTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEINYYPSKFDPVRCA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E+ PIP +  TG R KCII+KENNFKQPG+RYRSW+ DRQ+RF+ RWVE LS+PR+THEI
Sbjct  404  EKVPIPNKSYTGIRTKCIIKKENNFKQPGDRYRSWAPDRQDRFVKRWVEILSEPRLTHEI  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            RSIWISYW+QAD+SLGQKLASRLNVRP++
Sbjct  464  RSIWISYWSQADRSLGQKLASRLNVRPSI  492



>emb|CDY31488.1| BnaC05g15970D [Brassica napus]
Length=500

 Score =   365 bits (936),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 166/209 (79%), Positives = 189/209 (90%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTK WPED+LPLQPVGRLVLN+ IDNFF E EQLAF P +VVPG+YYSDDKLLQ 
Sbjct  292  FDPLDVTKIWPEDILPLQPVGRLVLNRTIDNFFNETEQLAFNPGLVVPGIYYSDDKLLQC  351

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIF+Y DTQRHRLGPNYLQLPVNAPKCAHHNNHH+GFMNFMHRDEE+NY+PS++DP R A
Sbjct  352  RIFAYGDTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEINYYPSKFDPVRCA  411

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E+ PIP +  TG R KCII+KENNFKQPG+RYRSW+ DRQ+RF+ RWVE LS+PR+THEI
Sbjct  412  EKVPIPNKSYTGIRTKCIIKKENNFKQPGDRYRSWAPDRQDRFVKRWVEILSEPRLTHEI  471

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            RSIWISYW+QAD+SLGQKLASRLNVRP++
Sbjct  472  RSIWISYWSQADRSLGQKLASRLNVRPSI  500



>ref|XP_009103334.1| PREDICTED: catalase-3-like [Brassica rapa]
 gb|AAB53101.2| catalase [Brassica napus]
 gb|AET08935.1| catalase [Brassica napus]
Length=492

 Score =   365 bits (936),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 166/209 (79%), Positives = 189/209 (90%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTK WPED+LPLQPVGRLVLN+ IDNFF E EQLAF P +VVPG+YYSDDKLLQ 
Sbjct  284  FDPLDVTKIWPEDILPLQPVGRLVLNRTIDNFFNETEQLAFNPGLVVPGIYYSDDKLLQC  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIF+Y DTQRHRLGPNYLQLPVNAPKCAHHNNHH+GFMNFMHRDEE+NY+PS++DP R A
Sbjct  344  RIFAYGDTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEINYYPSKFDPVRCA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E+ PIP +  TG R KCII+KENNFKQPG+RYRSW+ DRQ+RF+ RWVE LS+PR+THEI
Sbjct  404  EKVPIPNKSYTGIRTKCIIKKENNFKQPGDRYRSWAPDRQDRFVKRWVEILSEPRLTHEI  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            RSIWISYW+QAD+SLGQKLASRLNVRP++
Sbjct  464  RSIWISYWSQADRSLGQKLASRLNVRPSI  492



>ref|XP_009149540.1| PREDICTED: catalase-1 [Brassica rapa]
 ref|XP_009149541.1| PREDICTED: catalase-1 [Brassica rapa]
Length=492

 Score =   365 bits (936),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 169/209 (81%), Positives = 188/209 (90%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTK WPED+LPLQPVGRLVLNKNIDNFF ENEQLAFCPAIVVPG +YSDDKLLQ+
Sbjct  284  FDPLDVTKIWPEDILPLQPVGRLVLNKNIDNFFNENEQLAFCPAIVVPGFHYSDDKLLQS  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIFSY+D+QRHRLGPNYLQLPVNAPKCAHHNNHH+G MNFMHRDEEVNYFPSR +P RHA
Sbjct  344  RIFSYADSQRHRLGPNYLQLPVNAPKCAHHNNHHEGLMNFMHRDEEVNYFPSRLNPVRHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E++P  P    G R+KC+IEKENNFKQPGERYRSW  DRQERF+ R+V+AL++PRVTHEI
Sbjct  404  EKYPQNPIACAGNREKCMIEKENNFKQPGERYRSWDADRQERFVKRFVDALAEPRVTHEI  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            RSIWIS WT+AD+SLGQKLA+RLNV P  
Sbjct  464  RSIWISNWTKADESLGQKLATRLNVSPNF  492



>ref|XP_002510677.1| catalase, putative [Ricinus communis]
 gb|EEF52864.1| catalase, putative [Ricinus communis]
Length=974

 Score =   378 bits (970),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 174/209 (83%), Positives = 192/209 (92%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPED+LPLQPVGRLVLNKNIDNFFAENEQLAFCP IVVPGV YS+DKLLQT
Sbjct  766  FDPLDVTKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPGIVVPGVSYSEDKLLQT  825

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHH+GFMNFMHRDEEVNYFPSR DP R+A
Sbjct  826  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRCDPARNA  885

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E  P+P  + +GKR+KC+IEKENNFKQPGERYRSW+ DRQERF+ R V  LSDPR+THE+
Sbjct  886  ESFPVPSAICSGKREKCVIEKENNFKQPGERYRSWAPDRQERFLNRLVGGLSDPRITHEL  945

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            R+IWISYW Q DKSLGQKLA+RLNV+P++
Sbjct  946  RTIWISYWIQCDKSLGQKLATRLNVKPSI  974


 Score =   350 bits (898),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 160/208 (77%), Positives = 186/208 (89%), Gaps = 0/208 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLD+TK WPED+ PL PVGRLVLN+NIDN+FAENE LAF PA VVPGVYYS+DKL Q 
Sbjct  284  FDPLDMTKIWPEDMFPLHPVGRLVLNRNIDNWFAENEMLAFNPAHVVPGVYYSNDKLFQL  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            R+F+YSDTQRHRLG NYLQLPVNAPKC +HNNH+DGFMNFMHRDEEV+YF SRYDP RHA
Sbjct  344  RLFAYSDTQRHRLGTNYLQLPVNAPKCPYHNNHYDGFMNFMHRDEEVDYFQSRYDPVRHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E+ PIP  + +G+R+KC+IEKE+NF+QPG+RYRSW+ DRQERF+CR V ALS+PR+THEI
Sbjct  404  EKVPIPNAICSGRREKCVIEKEDNFRQPGDRYRSWAPDRQERFLCRLVNALSEPRITHEI  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPT  121
            RSIW+S+WTQ DKSLGQKLASRLN RP+
Sbjct  464  RSIWVSWWTQCDKSLGQKLASRLNNRPS  491



>ref|XP_009149539.1| PREDICTED: catalase-3 [Brassica rapa]
Length=543

 Score =   366 bits (939),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 166/209 (79%), Positives = 189/209 (90%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTK WPED+LPLQPVGRLVLN+ IDNFF E EQLAF P +VVPG+YYSDDKLLQ 
Sbjct  335  FDPLDVTKIWPEDILPLQPVGRLVLNRTIDNFFNETEQLAFNPGLVVPGIYYSDDKLLQC  394

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIF+Y DTQRHRLGPNYLQLPVNAPKCAHHNNHH+GFMNFMHRDEE+NY+PS++DP R A
Sbjct  395  RIFAYGDTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEINYYPSKFDPVRCA  454

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E+ PIP +  TG R KCII+KENNFKQPG+RYRSW+ DRQ+RF+ RWVE LS+PR+THEI
Sbjct  455  EKVPIPNKSYTGIRTKCIIKKENNFKQPGDRYRSWAPDRQDRFVKRWVEILSEPRLTHEI  514

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            RSIWISYW+QAD+SLGQKLASRLNVRP++
Sbjct  515  RSIWISYWSQADRSLGQKLASRLNVRPSI  543



>emb|CDY33636.1| BnaC08g19360D [Brassica napus]
Length=492

 Score =   364 bits (934),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 165/209 (79%), Positives = 189/209 (90%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTK WPED+LPLQPVGRLVLN+ +DNFF E EQLAF P +VVPG+YYSDDKLLQ 
Sbjct  284  FDPLDVTKIWPEDILPLQPVGRLVLNRTVDNFFNETEQLAFNPGLVVPGIYYSDDKLLQC  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIF+Y DTQRHRLGPNYLQLPVNAPKCAHHNNHH+GFMNFMHRDEE+NY+PS++DP R A
Sbjct  344  RIFAYGDTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEINYYPSKFDPVRCA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E+ PIP +  TG R KCII+KENNFKQPG+RYRSW+ DRQ+RF+ RWVE LS+PR+THEI
Sbjct  404  EKVPIPNKSYTGIRTKCIIKKENNFKQPGDRYRSWAPDRQDRFVKRWVEILSEPRLTHEI  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            RSIWISYW+QAD+SLGQKLASRLNVRP++
Sbjct  464  RSIWISYWSQADRSLGQKLASRLNVRPSI  492



>emb|CDY31878.1| BnaC07g15280D [Brassica napus]
Length=492

 Score =   364 bits (934),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 165/209 (79%), Positives = 188/209 (90%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTK WPED+LPLQPVGRLVLN+ IDNFF E EQLAF P +VVPG+YYSDDKLLQ 
Sbjct  284  FDPLDVTKIWPEDILPLQPVGRLVLNRTIDNFFNETEQLAFNPGLVVPGIYYSDDKLLQC  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIF+Y DTQRHRLGPNYLQLPVNAPKCAHHNNHH+GFMNFMHRDEE+NY+PS++DP R A
Sbjct  344  RIFAYGDTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEINYYPSKFDPVRCA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            E+ PIP +  TG R KCII+KENNFKQPG+RYRSW+ DRQ+RF+ RWVE LS+PR+THEI
Sbjct  404  EKAPIPNKSYTGIRTKCIIKKENNFKQPGDRYRSWAPDRQDRFVKRWVEILSEPRLTHEI  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            R IWISYW+QAD+SLGQKLASRLNVRP++
Sbjct  464  RGIWISYWSQADRSLGQKLASRLNVRPSI  492



>dbj|BAF91369.1| catalase [Capsicum annuum]
Length=492

 Score =   363 bits (933),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 168/209 (80%), Positives = 190/209 (91%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPED+LPL PVGRLVLN+NIDNFFAENEQLAF P  +VPGVYYS+DKLLQT
Sbjct  284  FDPLDVTKTWPEDILPLMPVGRLVLNRNIDNFFAENEQLAFNPGHIVPGVYYSEDKLLQT  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIF+Y+DTQRHR+GPNY+QLPVNAPKCAHHNNH DG MNFMHRDEEV+Y PSR+DP R A
Sbjct  344  RIFAYADTQRHRIGPNYMQLPVNAPKCAHHNNHRDGAMNFMHRDEEVDYLPSRFDPCRPA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            EQ+PIP  VLTG+R+KC+I KENNFKQ GERYRSW+ DRQ+R+I +WVE+LSDPRVTHEI
Sbjct  404  EQYPIPSCVLTGRREKCVIPKENNFKQAGERYRSWAPDRQDRYINKWVESLSDPRVTHEI  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            RSIWISY +QADKS GQK+ASRL V+PTM
Sbjct  464  RSIWISYLSQADKSCGQKVASRLTVKPTM  492



>ref|XP_002961779.1| hypothetical protein SELMODRAFT_140901 [Selaginella moellendorffii]
 ref|XP_002964850.1| hypothetical protein SELMODRAFT_167253 [Selaginella moellendorffii]
 gb|EFJ33688.1| hypothetical protein SELMODRAFT_167253 [Selaginella moellendorffii]
 gb|EFJ37039.1| hypothetical protein SELMODRAFT_140901 [Selaginella moellendorffii]
Length=492

 Score =   363 bits (933),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 163/209 (78%), Positives = 187/209 (89%), Gaps = 0/209 (0%)
 Frame = -1

Query  744  LDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQT  565
             DPLDVTKTWPE++ PLQPVGR+VLNKNIDNFFAENEQLAFCPA++VPGVYY+DDK+LQT
Sbjct  284  FDPLDVTKTWPEEMFPLQPVGRMVLNKNIDNFFAENEQLAFCPALIVPGVYYTDDKMLQT  343

Query  564  RIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPXRHA  385
            RIFSY+DTQRHRLGPNYL LP NAPKCAHHNNHH+GFMNFMHRDEEVNYFPSR+D  RHA
Sbjct  344  RIFSYADTQRHRLGPNYLMLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDAVRHA  403

Query  384  EQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEI  205
            EQ PIP R ++G+R+K ++EKENNF QPG RYRSW  DRQERFI  WV+ALSD RVTHEI
Sbjct  404  EQVPIPSRPVSGRREKVMLEKENNFAQPGVRYRSWPADRQERFIENWVDALSDSRVTHEI  463

Query  204  RSIWISYWTQADKSLGQKLASRLNVRPTM  118
            RS+WISYW+Q DKSLGQ++A++L  +  M
Sbjct  464  RSVWISYWSQCDKSLGQRIAAQLQSKSNM  492



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1441039810680