BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF010E09

Length=563
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KDO54649.1|  hypothetical protein CISIN_1g0100252mg                  111   4e-27   Citrus sinensis [apfelsine]
gb|KJB30572.1|  hypothetical protein B456_005G149900                    115   7e-27   Gossypium raimondii
gb|KJB30571.1|  hypothetical protein B456_005G149900                    115   7e-27   Gossypium raimondii
gb|EMT13258.1|  Protein TRANSPARENT TESTA 12                            115   2e-26   
emb|CDM86692.1|  unnamed protein product                                114   3e-26   Triticum aestivum [Canadian hard winter wheat]
emb|CDM86696.1|  unnamed protein product                                114   3e-26   Triticum aestivum [Canadian hard winter wheat]
gb|EMT26282.1|  Protein TRANSPARENT TESTA 12                            112   5e-26   
emb|CDM86687.1|  unnamed protein product                                113   6e-26   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006447549.1|  hypothetical protein CICLE_v10014926mg             113   7e-26   Citrus clementina [clementine]
gb|EMS67482.1|  Protein TRANSPARENT TESTA 12                            112   1e-25   Triticum urartu
ref|XP_003540303.1|  PREDICTED: protein TRANSPARENT TESTA 12            112   2e-25   Glycine max [soybeans]
ref|XP_004487408.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       112   2e-25   Cicer arietinum [garbanzo]
ref|XP_009353271.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    111   2e-25   Pyrus x bretschneideri [bai li]
ref|XP_008812639.1|  PREDICTED: protein TRANSPARENT TESTA 12            111   3e-25   Phoenix dactylifera
ref|XP_004243470.1|  PREDICTED: protein TRANSPARENT TESTA 12            111   4e-25   Solanum lycopersicum
emb|CBI28940.3|  unnamed protein product                                104   4e-25   Vitis vinifera
ref|XP_011047996.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       110   4e-25   Populus euphratica
gb|KHG27903.1|  Protein TRANSPARENT TESTA 12 -like protein              110   4e-25   Gossypium arboreum [tree cotton]
ref|XP_011037771.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       110   4e-25   Populus euphratica
ref|XP_010100632.1|  Protein TRANSPARENT TESTA 12                       110   5e-25   
ref|XP_007026054.1|  MATE efflux family protein isoform 1               110   5e-25   
ref|XP_011463308.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       106   5e-25   Fragaria vesca subsp. vesca
gb|KDO75453.1|  hypothetical protein CISIN_1g010798mg                   110   5e-25   Citrus sinensis [apfelsine]
ref|XP_006449030.1|  hypothetical protein CICLE_v10014983mg             110   5e-25   Citrus clementina [clementine]
ref|XP_007026055.1|  MATE efflux family protein, expressed isoform 2    110   5e-25   
ref|XP_006468029.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       110   6e-25   Citrus sinensis [apfelsine]
ref|XP_009402851.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       110   6e-25   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB69293.1|  hypothetical protein B456_011G014800                    110   8e-25   Gossypium raimondii
ref|XP_004251515.1|  PREDICTED: protein TRANSPARENT TESTA 12            110   9e-25   Solanum lycopersicum
ref|XP_009353270.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    110   1e-24   Pyrus x bretschneideri [bai li]
ref|XP_008342112.1|  PREDICTED: MATE efflux family protein ALF5-like    105   1e-24   
ref|XP_007045633.1|  MATE efflux family protein isoform 1               109   1e-24   
ref|XP_011047998.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    108   1e-24   Populus euphratica
ref|XP_004487410.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       109   1e-24   Cicer arietinum [garbanzo]
ref|XP_006651561.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       108   2e-24   Oryza brachyantha
ref|XP_006375528.1|  hypothetical protein POPTR_0014s15130g             105   2e-24   
ref|XP_006650264.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       108   2e-24   
ref|XP_011047997.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    108   2e-24   Populus euphratica
emb|CDP11780.1|  unnamed protein product                                108   3e-24   Coffea canephora [robusta coffee]
emb|CDM86680.1|  unnamed protein product                                107   3e-24   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010233179.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    107   3e-24   Brachypodium distachyon [annual false brome]
ref|XP_010665570.1|  PREDICTED: protein TRANSPARENT TESTA 12            108   3e-24   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009388870.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       108   3e-24   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007026056.1|  MATE efflux family protein                         108   3e-24   
ref|XP_003562349.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    108   4e-24   Brachypodium distachyon [annual false brome]
ref|XP_010930135.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       108   4e-24   Elaeis guineensis
gb|EMS63520.1|  Protein TRANSPARENT TESTA 12                            107   5e-24   Triticum urartu
ref|XP_010930090.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       108   6e-24   Elaeis guineensis
gb|EMT13254.1|  Protein TRANSPARENT TESTA 12                            106   6e-24   
ref|XP_010930122.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       107   6e-24   
ref|XP_006383933.1|  hypothetical protein POPTR_0004s01620g             107   6e-24   
gb|AFW68307.1|  putative MATE efflux family protein                     106   7e-24   
gb|AAR00628.1|  putative MATE family protein                            106   7e-24   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009137220.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       107   7e-24   Brassica rapa
emb|CDX98711.1|  BnaA03g44960D                                          107   7e-24   
emb|CDX94061.1|  BnaC07g36950D                                          107   7e-24   
ref|XP_006389631.1|  hypothetical protein POPTR_0021s00800g             107   7e-24   Populus trichocarpa [western balsam poplar]
ref|XP_003596992.1|  Transparent testa 12 protein                       107   7e-24   Medicago truncatula
ref|XP_003526327.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       107   8e-24   Glycine max [soybeans]
gb|KHN41220.1|  Protein TRANSPARENT TESTA 12                            107   8e-24   Glycine soja [wild soybean]
ref|XP_009768477.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       107   9e-24   Nicotiana sylvestris
ref|XP_003633309.1|  PREDICTED: LOW QUALITY PROTEIN: protein TRAN...    107   9e-24   Vitis vinifera
ref|XP_002883313.1|  mate efflux family protein                         107   9e-24   
gb|ACZ55932.1|  MATE transporter 2                                      107   1e-23   Zea mays [maize]
gb|ACZ55931.1|  MATE transporter 2                                      107   1e-23   Zea mays [maize]
gb|ACF85423.1|  unknown                                                 107   1e-23   Zea mays [maize]
ref|XP_010276072.1|  PREDICTED: protein TRANSPARENT TESTA 12            107   1e-23   Nelumbo nucifera [Indian lotus]
ref|NP_001148084.1|  transparent testa 12 protein                       107   1e-23   Zea mays [maize]
ref|NP_188806.1|  MATE efflux family protein                            107   1e-23   Arabidopsis thaliana [mouse-ear cress]
gb|AAM20595.1|  integral membrane protein, putative                     107   1e-23   Arabidopsis thaliana [mouse-ear cress]
emb|CBI28938.3|  unnamed protein product                                106   1e-23   Vitis vinifera
ref|XP_009630733.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       107   1e-23   Nicotiana tomentosiformis
ref|XP_002279330.1|  PREDICTED: protein TRANSPARENT TESTA 12            107   1e-23   Vitis vinifera
ref|XP_006351961.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       107   1e-23   Solanum tuberosum [potatoes]
gb|EEC75604.1|  hypothetical protein OsI_12313                          106   1e-23   Oryza sativa Indica Group [Indian rice]
ref|NP_001050520.1|  Os03g0570800                                       106   1e-23   
ref|XP_002518492.1|  multidrug resistance pump, putative                106   1e-23   Ricinus communis
emb|CDM86677.1|  unnamed protein product                                106   1e-23   Triticum aestivum [Canadian hard winter wheat]
ref|XP_002279487.1|  PREDICTED: protein TRANSPARENT TESTA 12            106   1e-23   Vitis vinifera
gb|EMT13253.1|  Protein TRANSPARENT TESTA 12                            106   1e-23   
emb|CDP11781.1|  unnamed protein product                                105   2e-23   Coffea canephora [robusta coffee]
gb|ACL53378.1|  unknown                                                 106   2e-23   Zea mays [maize]
emb|CAN73203.1|  hypothetical protein VITISV_008169                     104   2e-23   Vitis vinifera
emb|CBI28937.3|  unnamed protein product                                107   2e-23   Vitis vinifera
ref|XP_004515070.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    106   2e-23   Cicer arietinum [garbanzo]
ref|XP_008670448.1|  PREDICTED: LOW QUALITY PROTEIN: protein TRAN...    106   2e-23   
ref|XP_011096076.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       106   2e-23   Sesamum indicum [beniseed]
ref|XP_006389633.1|  hypothetical protein POPTR_0021s00820g             106   2e-23   
ref|XP_009357445.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       106   3e-23   Pyrus x bretschneideri [bai li]
ref|XP_007149972.1|  hypothetical protein PHAVU_005G115000g             106   3e-23   Phaseolus vulgaris [French bean]
ref|XP_004515071.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    105   3e-23   Cicer arietinum [garbanzo]
ref|XP_004982537.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       105   3e-23   Setaria italica
ref|XP_002886501.1|  mate efflux family protein                         105   3e-23   
gb|KHN21236.1|  Protein TRANSPARENT TESTA 12                            105   3e-23   Glycine soja [wild soybean]
dbj|BAM34459.1|  multidrug and toxic compound extrusion-type tran...    101   4e-23   Nicotiana alata [flowering tobacco]
ref|XP_009590301.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    105   4e-23   Nicotiana tomentosiformis
ref|XP_004982535.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       105   4e-23   Setaria italica
ref|XP_008455435.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       105   4e-23   Cucumis melo [Oriental melon]
ref|XP_010488189.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       101   4e-23   Camelina sativa [gold-of-pleasure]
ref|XP_010466422.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       105   4e-23   Camelina sativa [gold-of-pleasure]
ref|XP_009590300.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    105   5e-23   Nicotiana tomentosiformis
ref|XP_010923890.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       105   5e-23   Elaeis guineensis
dbj|BAH20308.1|  AT1G61890                                              103   6e-23   Arabidopsis thaliana [mouse-ear cress]
gb|EMS63519.1|  Protein TRANSPARENT TESTA 12                            104   6e-23   Triticum urartu
gb|KDP20758.1|  hypothetical protein JCGZ_21229                         105   7e-23   Jatropha curcas
ref|XP_009790570.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       104   7e-23   Nicotiana sylvestris
ref|XP_011005125.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       103   7e-23   Populus euphratica
ref|XP_009108539.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       104   9e-23   Brassica rapa
emb|CDX76391.1|  BnaA08g10090D                                          104   9e-23   
ref|XP_006858199.1|  hypothetical protein AMTR_s00062p00172410          103   1e-22   
ref|NP_564787.1|  MATE efflux family protein                            104   1e-22   Arabidopsis thaliana [mouse-ear cress]
emb|CDY34833.1|  BnaA09g47590D                                          103   1e-22   Brassica napus [oilseed rape]
gb|KJB57730.1|  hypothetical protein B456_009G178100                    104   1e-22   Gossypium raimondii
emb|CDY47166.1|  BnaA01g22920D                                          104   1e-22   Brassica napus [oilseed rape]
ref|XP_009105791.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       104   1e-22   Brassica rapa
ref|XP_004295265.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       104   1e-22   Fragaria vesca subsp. vesca
ref|XP_008384070.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       104   1e-22   Malus domestica [apple tree]
ref|XP_010930104.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       104   1e-22   Elaeis guineensis
ref|XP_006406244.1|  hypothetical protein EUTSA_v10020869mg             103   1e-22   
gb|KJB57728.1|  hypothetical protein B456_009G178100                    104   1e-22   Gossypium raimondii
ref|XP_004144495.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       104   1e-22   Cucumis sativus [cucumbers]
ref|XP_007132552.1|  hypothetical protein PHAVU_011G104200g             104   1e-22   Phaseolus vulgaris [French bean]
ref|XP_010051023.1|  PREDICTED: protein TRANSPARENT TESTA 12            104   1e-22   
ref|XP_010466426.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       103   1e-22   Camelina sativa [gold-of-pleasure]
ref|XP_008441737.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       103   2e-22   Cucumis melo [Oriental melon]
emb|CDY25329.1|  BnaC01g29980D                                          103   2e-22   Brassica napus [oilseed rape]
gb|AAK82541.1|  At1g61890/F8K4_9                                        103   2e-22   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001147791.1|  transparent testa 12 protein                       103   2e-22   Zea mays [maize]
ref|XP_009118179.1|  PREDICTED: protein TRANSPARENT TESTA 12            103   2e-22   Brassica rapa
ref|XP_010434104.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       103   2e-22   Camelina sativa [gold-of-pleasure]
ref|XP_008362257.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       103   2e-22   
gb|KHG25345.1|  Protein TRANSPARENT TESTA 12 -like protein              103   2e-22   Gossypium arboreum [tree cotton]
ref|XP_006391952.1|  hypothetical protein EUTSA_v10023417mg             103   2e-22   Eutrema salsugineum [saltwater cress]
gb|AHI48506.1|  multidrug and toxic extrusion transporter               103   2e-22   Vaccinium corymbosum [American blueberry]
dbj|BAJ34540.1|  unnamed protein product                                103   2e-22   Eutrema halophilum
emb|CDY12916.1|  BnaA09g13580D                                          103   2e-22   Brassica napus [oilseed rape]
emb|CDY19507.1|  BnaC09g13960D                                          103   2e-22   Brassica napus [oilseed rape]
ref|XP_009113112.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       103   2e-22   Brassica rapa
ref|XP_011096071.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       103   2e-22   Sesamum indicum [beniseed]
ref|XP_010468355.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       102   2e-22   
gb|KJB57729.1|  hypothetical protein B456_009G178100                    102   2e-22   Gossypium raimondii
ref|XP_004982536.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       103   2e-22   
ref|XP_010052836.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       103   3e-22   Eucalyptus grandis [rose gum]
emb|CBI23253.3|  unnamed protein product                                100   3e-22   Vitis vinifera
ref|XP_002867813.1|  mate efflux family protein                         103   3e-22   Arabidopsis lyrata subsp. lyrata
ref|XP_009760618.1|  PREDICTED: LOW QUALITY PROTEIN: protein TRAN...    103   3e-22   Nicotiana sylvestris
ref|XP_009345548.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    102   3e-22   Pyrus x bretschneideri [bai li]
gb|ACF85024.1|  unknown                                               99.4    3e-22   Zea mays [maize]
gb|EYU27797.1|  hypothetical protein MIMGU_mgv1a004389mg                103   3e-22   Erythranthe guttata [common monkey flower]
dbj|BAF47751.1|  multi antimicrobial extrusion family protein           103   3e-22   Nicotiana tabacum [American tobacco]
emb|CBI23254.3|  unnamed protein product                                102   3e-22   Vitis vinifera
gb|KFK37989.1|  hypothetical protein AALP_AA3G055600                    103   3e-22   Arabis alpina [alpine rockcress]
ref|XP_006282889.1|  hypothetical protein CARUB_v10007133mg             103   3e-22   Capsella rubella
ref|XP_009361903.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    103   4e-22   Pyrus x bretschneideri [bai li]
ref|XP_006363107.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       102   4e-22   Solanum tuberosum [potatoes]
ref|XP_008364096.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    102   4e-22   
ref|XP_003605914.1|  Transparent testa 12 protein                       102   4e-22   Medicago truncatula
ref|XP_009345546.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    103   4e-22   Pyrus x bretschneideri [bai li]
ref|XP_010551032.1|  PREDICTED: protein TRANSPARENT TESTA 12            102   4e-22   Tarenaya hassleriana [spider flower]
ref|XP_009614256.1|  PREDICTED: LOW QUALITY PROTEIN: protein TRAN...    102   4e-22   Nicotiana tomentosiformis
ref|XP_006389632.1|  hypothetical protein POPTR_0021s00810g             102   4e-22   Populus trichocarpa [western balsam poplar]
ref|XP_010510483.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       102   5e-22   
ref|XP_006297470.1|  hypothetical protein CARUB_v10013491mg             102   5e-22   Capsella rubella
emb|CDY27431.1|  BnaC03g64710D                                          102   5e-22   Brassica napus [oilseed rape]
ref|XP_009108536.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    102   5e-22   Brassica rapa
ref|XP_008364093.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    102   5e-22   
ref|XP_008230071.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       102   5e-22   Prunus mume [ume]
ref|XP_009398220.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       102   5e-22   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008364094.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    102   5e-22   
ref|XP_008364092.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    102   5e-22   
ref|XP_002273739.2|  PREDICTED: protein TRANSPARENT TESTA 12            102   5e-22   Vitis vinifera
emb|CDY07257.1|  BnaC04g19140D                                          100   6e-22   
emb|CDP04390.1|  unnamed protein product                                101   6e-22   Coffea canephora [robusta coffee]
ref|XP_008364091.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    102   6e-22   
ref|NP_567640.1|  MATE efflux family protein                            102   6e-22   Arabidopsis thaliana [mouse-ear cress]
emb|CDX94063.1|  BnaC07g36970D                                          102   6e-22   
gb|KCW76952.1|  hypothetical protein EUGRSUZ_D01312                     100   7e-22   Eucalyptus grandis [rose gum]
dbj|BAH19969.1|  AT4G21910                                              102   7e-22   Arabidopsis thaliana [mouse-ear cress]
ref|NP_974587.1|  MATE efflux family protein                            102   7e-22   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010510494.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       102   7e-22   Camelina sativa [gold-of-pleasure]
gb|AAM62936.1|  unknown                                                 102   7e-22   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010054588.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       100   8e-22   
emb|CAN82750.1|  hypothetical protein VITISV_014577                     100   8e-22   Vitis vinifera
ref|XP_002279276.2|  PREDICTED: protein TRANSPARENT TESTA 12            102   8e-22   
emb|CDY34637.1|  BnaC08g41960D                                          101   9e-22   Brassica napus [oilseed rape]
ref|XP_006406242.1|  hypothetical protein EUTSA_v10020526mg             101   1e-21   Eutrema salsugineum [saltwater cress]
ref|XP_010430214.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    101   1e-21   
ref|XP_006302163.1|  hypothetical protein CARUB_v10020177mg             101   1e-21   Capsella rubella
ref|XP_004232716.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       101   1e-21   Solanum lycopersicum
ref|XP_010418166.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       101   1e-21   Camelina sativa [gold-of-pleasure]
ref|XP_010473410.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       101   1e-21   Camelina sativa [gold-of-pleasure]
ref|XP_006413712.1|  hypothetical protein EUTSA_v10024978mg             101   1e-21   
emb|CDY27434.1|  BnaC03g64740D                                          101   1e-21   Brassica napus [oilseed rape]
ref|XP_009417226.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       101   1e-21   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004231608.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       101   2e-21   Solanum lycopersicum
emb|CDP17486.1|  unnamed protein product                                101   2e-21   Coffea canephora [robusta coffee]
ref|XP_007026057.1|  MATE efflux family protein                         100   2e-21   
ref|XP_009608373.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       100   2e-21   Nicotiana tomentosiformis
ref|XP_002273901.2|  PREDICTED: protein TRANSPARENT TESTA 12-like       100   2e-21   Vitis vinifera
gb|EMT20038.1|  Protein TRANSPARENT TESTA 12                            100   2e-21   
gb|EEC75606.1|  hypothetical protein OsI_12318                          100   2e-21   Oryza sativa Indica Group [Indian rice]
ref|NP_001149176.1|  transparent testa 12 protein                       100   2e-21   Zea mays [maize]
tpg|DAA50100.1|  TPA: putative MATE efflux family protein               100   2e-21   
gb|ABF97209.1|  MATE efflux family protein, expressed                   100   2e-21   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006449717.1|  hypothetical protein CICLE_v10014968mg           99.4    3e-21   
ref|XP_010448968.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    100   3e-21   Camelina sativa [gold-of-pleasure]
ref|XP_002464321.1|  hypothetical protein SORBIDRAFT_01g016100          100   3e-21   Sorghum bicolor [broomcorn]
ref|XP_010278701.1|  PREDICTED: protein TRANSPARENT TESTA 12            100   3e-21   Nelumbo nucifera [Indian lotus]
emb|CDX98712.1|  BnaA03g44970D                                          100   3e-21   
ref|XP_004164859.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     99.0    3e-21   
ref|XP_010278702.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    100   3e-21   Nelumbo nucifera [Indian lotus]
ref|XP_006651562.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       100   3e-21   
ref|XP_010930069.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    100   4e-21   Elaeis guineensis
ref|NP_001050524.1|  Os03g0572900                                       100   4e-21   
emb|CBI23251.3|  unnamed protein product                              99.4    4e-21   Vitis vinifera
gb|EEC75610.1|  hypothetical protein OsI_12322                          100   4e-21   Oryza sativa Indica Group [Indian rice]
ref|XP_006389634.1|  hypothetical protein POPTR_0021s00830g           99.8    4e-21   
ref|XP_006449716.1|  hypothetical protein CICLE_v10014968mg           99.8    5e-21   Citrus clementina [clementine]
emb|CDX98713.1|  BnaA03g44980D                                        99.4    5e-21   
ref|XP_008230142.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     99.8    5e-21   Prunus mume [ume]
gb|AGT17223.1|  MATE efflux family protein                            99.8    5e-21   Saccharum hybrid cultivar R570
ref|XP_009137228.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     98.2    6e-21   
ref|NP_001142368.1|  uncharacterized protein LOC100274540             99.0    6e-21   Zea mays [maize]
ref|XP_004144494.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     99.4    6e-21   Cucumis sativus [cucumbers]
ref|XP_006413715.1|  hypothetical protein EUTSA_v10024969mg           99.4    7e-21   Eutrema salsugineum [saltwater cress]
ref|XP_002274027.2|  PREDICTED: protein TRANSPARENT TESTA 12          99.4    7e-21   Vitis vinifera
ref|XP_008224821.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     99.4    9e-21   Prunus mume [ume]
ref|XP_011048007.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  99.0    9e-21   Populus euphratica
gb|EMT14886.1|  Protein TRANSPARENT TESTA 12                          97.8    1e-20   
ref|XP_006413716.1|  hypothetical protein EUTSA_v10027142mg           99.0    1e-20   Eutrema salsugineum [saltwater cress]
ref|XP_004293282.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     99.0    1e-20   Fragaria vesca subsp. vesca
ref|XP_004957863.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     99.0    1e-20   Setaria italica
ref|XP_006467445.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  99.0    1e-20   Citrus sinensis [apfelsine]
ref|XP_006282967.1|  hypothetical protein CARUB_v10007727mg           99.0    1e-20   Capsella rubella
emb|CDY64933.1|  BnaCnng45550D                                        98.6    1e-20   Brassica napus [oilseed rape]
ref|XP_006597580.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     98.6    1e-20   Glycine max [soybeans]
gb|KHN33034.1|  Protein TRANSPARENT TESTA 12                          98.6    1e-20   Glycine soja [wild soybean]
ref|XP_008455432.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     98.6    1e-20   Cucumis melo [Oriental melon]
ref|XP_009110708.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     98.6    1e-20   Brassica rapa
ref|XP_009137221.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     98.6    1e-20   Brassica rapa
ref|XP_009135444.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     98.6    1e-20   Brassica rapa
ref|XP_011037658.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     98.6    1e-20   Populus euphratica
emb|CDX79109.1|  BnaA01g11760D                                        98.2    2e-20   
ref|XP_002460773.1|  hypothetical protein SORBIDRAFT_02g034720        98.2    2e-20   Sorghum bicolor [broomcorn]
ref|XP_006417328.1|  hypothetical protein EUTSA_v10007409mg           98.2    2e-20   Eutrema salsugineum [saltwater cress]
gb|AGT17221.1|  transparent testa 12 protein                          98.6    2e-20   Saccharum hybrid cultivar R570
dbj|BAD95082.1|  hypothetical protein                                 95.1    2e-20   Arabidopsis thaliana [mouse-ear cress]
gb|KDO78209.1|  hypothetical protein CISIN_1g010561mg                 97.1    2e-20   Citrus sinensis [apfelsine]
ref|XP_010237714.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     98.2    2e-20   Brachypodium distachyon [annual false brome]
ref|XP_008224820.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     98.2    2e-20   Prunus mume [ume]
ref|XP_011048003.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     97.8    2e-20   Populus euphratica
ref|XP_008455433.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     97.8    3e-20   Cucumis melo [Oriental melon]
ref|XP_008664994.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     97.4    3e-20   Zea mays [maize]
ref|XP_006389638.1|  MATE efflux family protein                       97.8    3e-20   
ref|XP_009798076.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     97.4    3e-20   Nicotiana sylvestris
gb|KFK39487.1|  hypothetical protein AALP_AA3G250500                  97.4    3e-20   Arabis alpina [alpine rockcress]
gb|KEH36840.1|  MATE efflux family protein                            97.1    4e-20   Medicago truncatula
gb|KGN43526.1|  hypothetical protein Csa_7G043680                     97.4    4e-20   Cucumis sativus [cucumbers]
gb|KGN64598.1|  hypothetical protein Csa_1G071120                     97.1    4e-20   Cucumis sativus [cucumbers]
gb|KDO78208.1|  hypothetical protein CISIN_1g010561mg                 97.1    4e-20   Citrus sinensis [apfelsine]
gb|KFK33086.1|  hypothetical protein AALP_AA6G328900                  97.4    5e-20   Arabis alpina [alpine rockcress]
gb|EYU29853.1|  hypothetical protein MIMGU_mgv1a004772mg              97.1    5e-20   Erythranthe guttata [common monkey flower]
ref|XP_008224822.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     96.7    6e-20   Prunus mume [ume]
ref|XP_008664995.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     96.7    6e-20   Zea mays [maize]
ref|XP_002518495.1|  multidrug resistance pump, putative              96.7    7e-20   Ricinus communis
gb|EEE67272.1|  hypothetical protein OsJ_24453                        95.5    8e-20   Oryza sativa Japonica Group [Japonica rice]
emb|CDY71092.1|  BnaAnng36070D                                        91.3    9e-20   Brassica napus [oilseed rape]
ref|XP_003562350.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     96.3    1e-19   Brachypodium distachyon [annual false brome]
ref|XP_011048004.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     96.3    1e-19   Populus euphratica
ref|XP_011047999.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  96.3    1e-19   Populus euphratica
ref|XP_009109391.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     95.9    1e-19   Brassica rapa
ref|XP_002518493.1|  multidrug resistance pump, putative              95.9    1e-19   Ricinus communis
gb|KFK39486.1|  hypothetical protein AALP_AA3G250400                  95.9    1e-19   Arabis alpina [alpine rockcress]
ref|XP_009109403.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     95.9    1e-19   Brassica rapa
ref|XP_007215031.1|  hypothetical protein PRUPE_ppa004291mg           95.5    2e-19   
ref|NP_001059785.1|  Os07g0516600                                     95.5    2e-19   
ref|XP_010052837.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     95.5    2e-19   Eucalyptus grandis [rose gum]
ref|XP_007211777.1|  hypothetical protein PRUPE_ppa004182mg           95.5    2e-19   Prunus persica
ref|XP_006389636.1|  hypothetical protein POPTR_0021s00860g           95.5    2e-19   Populus trichocarpa [western balsam poplar]
gb|EEC82143.1|  hypothetical protein OsI_26198                        95.5    2e-19   
ref|NP_001119025.1|  mate efflux domain-containing protein            95.5    2e-19   
ref|XP_010546899.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  95.1    2e-19   
ref|XP_009361291.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     95.1    2e-19   
ref|XP_009345550.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     95.1    2e-19   
ref|XP_009145463.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     95.1    2e-19   
ref|NP_001140602.1|  putative MATE efflux family protein isoform 1    95.1    2e-19   
ref|XP_006348110.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  94.7    3e-19   
ref|XP_008667480.1|  PREDICTED: putative MATE efflux family prote...  95.1    3e-19   
ref|XP_006389635.1|  hypothetical protein POPTR_0021s00850g           94.7    3e-19   
ref|XP_006348108.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  94.4    4e-19   
ref|XP_009135765.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     94.4    4e-19   
ref|XP_011037659.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     94.4    4e-19   
ref|XP_009361804.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  94.4    5e-19   
ref|XP_009361725.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  94.0    5e-19   
ref|XP_010538707.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     93.2    1e-18   
ref|XP_002464323.1|  hypothetical protein SORBIDRAFT_01g016140        93.2    1e-18   
ref|XP_010476100.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  93.2    1e-18   
ref|XP_006307297.1|  hypothetical protein CARUB_v10008916mg           93.2    1e-18   
ref|XP_011100217.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  93.2    1e-18   
ref|XP_010493132.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     93.2    1e-18   
ref|NP_172632.1|  MATE efflux family protein                          93.2    1e-18   
ref|XP_002867814.1|  mate efflux family protein                       93.2    1e-18   
ref|XP_011048006.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  92.8    2e-18   
gb|KDP20756.1|  hypothetical protein JCGZ_21227                       94.0    2e-18   
ref|XP_009145464.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     92.4    2e-18   
ref|XP_009760619.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     92.4    2e-18   
gb|KGN43522.1|  Mate efflux family protein                            92.0    2e-18   
ref|XP_004144588.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     92.0    2e-18   
ref|XP_008364803.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     89.7    3e-18   
ref|XP_007212986.1|  hypothetical protein PRUPE_ppa022523mg           91.7    4e-18   
emb|CDY33129.1|  BnaCnng07000D                                        91.3    5e-18   
ref|XP_002892653.1|  mate efflux family protein                       91.3    5e-18   
ref|XP_004159226.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     91.3    5e-18   
ref|XP_009345545.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     91.3    5e-18   
emb|CDM85992.1|  unnamed protein product                              90.9    6e-18   
gb|AAM98160.1|  unknown protein                                       90.5    9e-18   
ref|XP_010458574.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     90.5    9e-18   
ref|XP_009614257.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  90.5    1e-17   
ref|XP_006651560.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     90.5    1e-17   
ref|XP_008347106.1|  PREDICTED: LOW QUALITY PROTEIN: protein TRAN...  90.1    1e-17   
gb|EMT02572.1|  Protein TRANSPARENT TESTA 12                          90.5    2e-17   
gb|EMT03955.1|  Protein TRANSPARENT TESTA 12                          90.1    2e-17   
ref|XP_007212709.1|  hypothetical protein PRUPE_ppa018676mg           89.4    3e-17   
emb|CAN69304.1|  hypothetical protein VITISV_021604                   90.1    3e-17   
gb|EMS53434.1|  Protein TRANSPARENT TESTA 12                          88.2    5e-17   
ref|XP_008224855.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     88.2    6e-17   
gb|EPS67796.1|  hypothetical protein M569_06975                       87.8    7e-17   
ref|XP_008676828.1|  PREDICTED: transparent testa 12 protein isof...  87.8    8e-17   
ref|XP_010451295.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     87.4    9e-17   
gb|KFK39485.1|  hypothetical protein AALP_AA3G250300                  87.4    1e-16   
dbj|BAJ90668.1|  predicted protein                                    87.0    1e-16   
gb|ABF97208.1|  MATE efflux family protein, expressed                 85.5    1e-16   
gb|ADE77677.1|  unknown                                               87.0    1e-16   
ref|NP_001050521.1|  Os03g0571700                                     85.9    1e-16   
emb|CDX94064.1|  BnaC07g36980D                                        86.3    2e-16   
ref|XP_006348111.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     87.0    2e-16   
ref|XP_010093281.1|  Protein TRANSPARENT TESTA 12                     87.0    2e-16   
emb|CDY39494.1|  BnaA01g24940D                                        87.0    2e-16   
emb|CDY39493.1|  BnaA01g24950D                                        87.0    2e-16   
gb|EEE59383.1|  hypothetical protein OsJ_11499                        85.9    2e-16   
emb|CDY38631.1|  BnaA05g19560D                                        85.9    4e-16   
ref|XP_004232715.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     85.5    5e-16   
ref|XP_004158053.1|  PREDICTED: LOW QUALITY PROTEIN: polygalactur...  87.0    5e-16   
emb|CAN60226.1|  hypothetical protein VITISV_039920                   85.1    6e-16   
emb|CDP04391.1|  unnamed protein product                              85.5    7e-16   
gb|EYU29854.1|  hypothetical protein MIMGU_mgv1a005159mg              85.1    7e-16   
emb|CDY19294.1|  BnaC01g31860D                                        84.7    9e-16   
emb|CDY24252.1|  BnaC03g42250D                                        81.6    1e-15   
gb|EYU29852.1|  hypothetical protein MIMGU_mgv1a004818mg              84.3    1e-15   
gb|EPS59093.1|  hypothetical protein M569_15717                       80.9    2e-15   
gb|EMS54427.1|  Protein TRANSPARENT TESTA 12                          84.0    3e-15   
ref|XP_002466898.1|  hypothetical protein SORBIDRAFT_01g016120        83.6    3e-15   
gb|EYU29855.1|  hypothetical protein MIMGU_mgv1a004845mg              82.8    5e-15   
emb|CDY33131.1|  BnaCnng07020D                                        79.3    5e-15   
ref|NP_001190793.1|  MATE efflux family protein                       82.8    6e-15   
ref|XP_009798075.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     82.4    7e-15   
emb|CDY65669.1|  BnaCnng48120D                                        82.0    7e-15   
emb|CDX92916.1|  BnaA03g36380D                                        82.0    8e-15   
gb|AGT17222.1|  MATE efflux family protein                            81.3    2e-14   
gb|ABK24492.1|  unknown                                               80.9    2e-14   
emb|CAA17157.1|  putative protein                                     81.6    3e-14   
ref|XP_007212447.1|  hypothetical protein PRUPE_ppa017237mg           80.5    3e-14   
gb|AAS01962.1|  putative MATE efflux family protein                   80.1    4e-14   
ref|NP_001176767.1|  Os12g0125500                                     75.1    4e-14   
ref|XP_004144587.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     77.4    6e-14   
gb|EEC68782.1|  hypothetical protein OsI_37323                        76.3    7e-14   
gb|KGN43524.1|  hypothetical protein Csa_7G043660                     79.0    8e-14   
ref|XP_004982539.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  78.2    1e-13   
ref|XP_004982538.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  78.2    1e-13   
emb|CDP22168.1|  unnamed protein product                              72.0    2e-13   
gb|EEE51571.1|  hypothetical protein OsJ_32800                        76.6    3e-13   
ref|NP_001190792.1|  mate efflux domain-containing protein            77.4    3e-13   
ref|NP_001065641.2|  Os11g0129000                                     74.3    3e-13   
ref|NP_001176328.1|  Os11g0128900                                     76.3    4e-13   
emb|CDP20703.1|  unnamed protein product                              76.3    6e-13   
ref|NP_001066047.1|  Os12g0126000                                     75.9    1e-12   
gb|ABA91295.1|  MATE efflux family protein, expressed                 75.9    1e-12   
gb|EEC68785.1|  hypothetical protein OsI_37326                        75.9    1e-12   
gb|ABF97220.1|  MATE efflux family protein, expressed                 75.5    1e-12   
ref|XP_004174037.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     71.6    2e-12   
ref|XP_008455546.1|  PREDICTED: MATE efflux family protein LAL5-like  72.0    2e-12   
ref|XP_003578998.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     74.7    2e-12   
ref|NP_001176768.1|  Os12g0125800                                     72.8    2e-12   
gb|EEC68781.1|  hypothetical protein OsI_37322                        74.7    3e-12   
ref|XP_011086621.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     74.7    3e-12   
ref|XP_010931488.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     74.3    4e-12   
ref|XP_006856151.1|  hypothetical protein AMTR_s00059p00169290        73.9    4e-12   
ref|XP_011079018.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     73.6    6e-12   
emb|CDP13215.1|  unnamed protein product                              73.6    7e-12   
ref|XP_003561965.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     73.2    7e-12   
ref|NP_001141051.1|  putative MATE efflux family protein              73.2    8e-12   
emb|CDX83628.1|  BnaC07g23680D                                        72.8    8e-12   
gb|EMS63313.1|  Protein TRANSPARENT TESTA 12                          73.2    1e-11   
ref|XP_007044784.1|  MATE efflux family protein isoform 1             72.4    1e-11   
gb|ACF80989.1|  unknown                                               67.0    1e-11   
ref|XP_007044786.1|  MATE efflux family protein isoform 3             72.4    1e-11   
ref|XP_011468929.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     68.6    1e-11   
gb|ABA26978.1|  TO22-3                                                68.2    1e-11   
gb|AHI48503.1|  multidrug and toxic extrusion transporter             72.8    1e-11   
dbj|BAJ95959.1|  predicted protein                                    72.4    1e-11   
ref|XP_007044785.1|  MATE efflux family protein isoform 2             72.4    1e-11   
ref|XP_006856152.1|  hypothetical protein AMTR_s00059p00169820        72.4    1e-11   
ref|NP_001065623.1|  Os11g0126100                                     72.4    1e-11   
gb|EMS64531.1|  Protein TRANSPARENT TESTA 12                          72.4    2e-11   
ref|XP_004489770.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     72.4    2e-11   
ref|XP_003613128.1|  Protein TRANSPARENT TESTA                        72.4    2e-11   
ref|XP_011086620.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     72.4    2e-11   
ref|XP_006852301.1|  hypothetical protein AMTR_s00049p00190450        69.3    2e-11   
ref|XP_009413656.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     72.0    2e-11   
gb|EMS45672.1|  Protein TRANSPARENT TESTA 12                          72.4    2e-11   
ref|XP_011086623.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     72.0    2e-11   
gb|KHG29776.1|  Protein TRANSPARENT TESTA 12 -like protein            71.6    3e-11   
gb|KJB31160.1|  hypothetical protein B456_005G179100                  71.6    3e-11   
gb|AAN64140.1|  Putative ripening regulated protein                   70.9    3e-11   
ref|XP_006852295.1|  hypothetical protein AMTR_s00049p00187620        67.8    4e-11   
ref|XP_009365296.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     68.2    4e-11   
dbj|BAJ90744.1|  predicted protein                                    70.9    4e-11   
ref|XP_002272578.2|  PREDICTED: protein TRANSPARENT TESTA 12-like     70.9    4e-11   
emb|CBI31189.3|  unnamed protein product                              70.9    4e-11   
gb|EEE58464.1|  hypothetical protein OsJ_09708                        70.9    5e-11   
gb|EEC74654.1|  hypothetical protein OsI_10313                        70.9    5e-11   
ref|XP_010243273.1|  PREDICTED: protein TRANSPARENT TESTA 12 isof...  70.9    5e-11   
ref|XP_010243275.1|  PREDICTED: protein TRANSPARENT TESTA 12 isof...  70.5    5e-11   
ref|XP_008804797.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     70.9    5e-11   
ref|XP_010243274.1|  PREDICTED: protein TRANSPARENT TESTA 12 isof...  70.9    5e-11   
ref|XP_006663775.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     70.5    5e-11   
ref|XP_004239125.2|  PREDICTED: protein TRANSPARENT TESTA 12-like     70.9    5e-11   
gb|EEE51569.1|  hypothetical protein OsJ_32798                        70.5    5e-11   
ref|XP_010905904.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     70.9    5e-11   
ref|XP_010922926.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     70.5    6e-11   
ref|XP_010269383.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     70.5    6e-11   
gb|ABR16195.1|  unknown                                               70.5    6e-11   
gb|EEC73528.1|  hypothetical protein OsI_07920                        70.5    7e-11   
gb|KDP46214.1|  hypothetical protein JCGZ_10054                       70.5    7e-11   
ref|XP_002441747.1|  hypothetical protein SORBIDRAFT_08g001710        70.5    7e-11   
gb|AFK46935.1|  unknown                                               70.5    8e-11   
gb|KFK28220.1|  hypothetical protein AALP_AA8G488200                  66.6    8e-11   
ref|XP_009605336.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     70.1    8e-11   
ref|XP_009628061.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     70.1    8e-11   
ref|XP_006395543.1|  hypothetical protein EUTSA_v10005286mg           70.1    9e-11   
ref|XP_007051759.1|  MATE efflux family protein                       70.1    9e-11   
ref|XP_010270616.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     69.7    1e-10   
tpg|DAA40990.1|  TPA: putative MATE efflux family protein             69.7    1e-10   
ref|XP_010646478.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  69.7    1e-10   
gb|EAZ06832.1|  hypothetical protein OsI_29069                        69.7    1e-10   
gb|EMS64530.1|  Protein TRANSPARENT TESTA 12                          69.7    1e-10   
ref|XP_002272214.2|  PREDICTED: protein TRANSPARENT TESTA 12-like...  69.7    1e-10   
ref|XP_002267053.2|  PREDICTED: protein TRANSPARENT TESTA 12          69.7    1e-10   
emb|CDY13643.1|  BnaA06g32800D                                        69.7    1e-10   
emb|CDX83627.1|  BnaC07g23670D                                        69.7    1e-10   
ref|XP_009152044.1|  PREDICTED: protein TRANSPARENT TESTA 12          69.7    1e-10   
ref|XP_009380883.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     69.3    1e-10   
emb|CAN63841.1|  hypothetical protein VITISV_021179                   69.3    1e-10   
ref|XP_006437275.1|  hypothetical protein CICLE_v10032747mg           67.0    2e-10   
ref|XP_002865386.1|  mate efflux family protein                       69.3    2e-10   
emb|CDP13216.1|  unnamed protein product                              69.3    2e-10   
emb|CDY68535.1|  BnaCnng59430D                                        66.6    2e-10   
ref|XP_006437283.1|  hypothetical protein CICLE_v10032663mg           67.0    2e-10   
emb|CAN77557.1|  hypothetical protein VITISV_033224                   68.9    2e-10   
gb|KHN00401.1|  Protein TRANSPARENT TESTA 12                          68.9    2e-10   
ref|XP_006828412.1|  hypothetical protein AMTR_s00060p00075340        68.9    2e-10   
ref|XP_003519833.2|  PREDICTED: protein TRANSPARENT TESTA 12-like     68.9    2e-10   
ref|XP_002450192.1|  hypothetical protein SORBIDRAFT_05g001760        68.9    2e-10   
ref|XP_010064252.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     68.9    2e-10   
emb|CBI23362.3|  unnamed protein product                              69.7    2e-10   
ref|XP_008792470.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     68.9    2e-10   
ref|XP_003575793.2|  PREDICTED: protein TRANSPARENT TESTA 12-like     68.6    2e-10   
ref|XP_008240646.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     68.9    2e-10   
ref|NP_199218.1|  MATE efflux family protein                          68.9    2e-10   
ref|XP_007158392.1|  hypothetical protein PHAVU_002G149300g           68.6    2e-10   
gb|KCW66473.1|  hypothetical protein EUGRSUZ_F00275                   66.2    3e-10   
ref|XP_004985412.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  68.6    3e-10   
ref|XP_006438288.1|  hypothetical protein CICLE_v10031274mg           68.6    3e-10   
ref|XP_006438289.1|  hypothetical protein CICLE_v10031274mg           68.6    3e-10   
ref|XP_006483933.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     68.6    3e-10   
ref|XP_008386910.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  68.2    3e-10   
ref|XP_002468362.1|  hypothetical protein SORBIDRAFT_01g044660        68.6    3e-10   
emb|CDY69605.1|  BnaA06g39220D                                        65.5    3e-10   
ref|NP_001183811.1|  putative MATE efflux family protein              66.2    3e-10   
ref|XP_011087098.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     68.2    3e-10   
gb|KFK30626.1|  hypothetical protein AALP_AA6G006400                  68.2    3e-10   
ref|XP_006357608.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     68.2    4e-10   
ref|XP_009122060.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     68.2    4e-10   
ref|XP_009409170.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     68.2    4e-10   
ref|XP_007203372.1|  hypothetical protein PRUPE_ppa020699mg           68.2    4e-10   
ref|XP_004249274.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     68.2    4e-10   
ref|XP_008777525.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  65.5    4e-10   
ref|XP_003613101.1|  Protein TRANSPARENT TESTA                        67.8    4e-10   
ref|XP_008386909.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  67.8    4e-10   
ref|XP_008350142.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     67.8    5e-10   
ref|XP_002530955.1|  multidrug resistance pump, putative              67.8    5e-10   
ref|XP_004489662.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     67.8    5e-10   
ref|XP_007042719.1|  MATE efflux family protein                       67.8    5e-10   
ref|XP_004957085.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     67.8    5e-10   
ref|XP_010060175.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     67.8    5e-10   
ref|XP_004977438.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  67.8    5e-10   
dbj|BAD09618.1|  putative ripening regulated protein DDTFR18          67.4    5e-10   
ref|XP_011086624.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  67.8    6e-10   
gb|AFW55870.1|  putative MATE efflux family protein                   67.4    6e-10   
ref|NP_001062523.2|  Os08g0562800                                     67.4    6e-10   



>gb|KDO54649.1| hypothetical protein CISIN_1g0100252mg, partial [Citrus sinensis]
Length=168

 Score =   111 bits (278),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 72/88 (82%), Positives = 82/88 (93%), Gaps = 0/88 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQTFVAYVNVGCYYVVGVPVG++LGFYFNLGAKGIW GMIGGTVMQT+IL+WV
Sbjct  80   GVAVGCGWQTFVAYVNVGCYYVVGVPVGSLLGFYFNLGAKGIWSGMIGGTVMQTLILIWV  139

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREPLL  281
            T RTDW KEV+ A KRL++W+ K++PLL
Sbjct  140  TFRTDWNKEVQEALKRLDRWEDKKKPLL  167



>gb|KJB30572.1| hypothetical protein B456_005G149900 [Gossypium raimondii]
 gb|KJB30573.1| hypothetical protein B456_005G149900 [Gossypium raimondii]
Length=396

 Score =   115 bits (287),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 70/88 (80%), Positives = 80/88 (91%), Gaps = 0/88 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQTFVAYVNVGCYY VGVP+G++LGFYFNLGAKGIW GMIGGTVMQT++L+WV
Sbjct  308  GVAVGCGWQTFVAYVNVGCYYFVGVPLGSLLGFYFNLGAKGIWSGMIGGTVMQTLVLIWV  367

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREPLL  281
            T RTDW KEVE A+KR++ W+ K EPLL
Sbjct  368  TFRTDWKKEVEEARKRMDAWEVKEEPLL  395



>gb|KJB30571.1| hypothetical protein B456_005G149900 [Gossypium raimondii]
Length=505

 Score =   115 bits (289),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 70/88 (80%), Positives = 80/88 (91%), Gaps = 0/88 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQTFVAYVNVGCYY VGVP+G++LGFYFNLGAKGIW GMIGGTVMQT++L+WV
Sbjct  417  GVAVGCGWQTFVAYVNVGCYYFVGVPLGSLLGFYFNLGAKGIWSGMIGGTVMQTLVLIWV  476

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREPLL  281
            T RTDW KEVE A+KR++ W+ K EPLL
Sbjct  477  TFRTDWKKEVEEARKRMDAWEVKEEPLL  504



>gb|EMT13258.1| Protein TRANSPARENT TESTA 12 [Aegilops tauschii]
Length=570

 Score =   115 bits (287),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 71/88 (81%), Positives = 79/88 (90%), Gaps = 0/88 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQ FVAYVNVG YY+VGVP+G VLGF+FNLGAKGIW G+IGGT +QT ILLWV
Sbjct  475  GVAVGCGWQQFVAYVNVGSYYIVGVPLGVVLGFFFNLGAKGIWGGLIGGTALQTAILLWV  534

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREPLL  281
            TIRTDW KEVE A+KRLN+WD K+EPLL
Sbjct  535  TIRTDWTKEVEEAQKRLNKWDEKKEPLL  562



>emb|CDM86692.1| unnamed protein product [Triticum aestivum]
Length=499

 Score =   114 bits (284),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 70/88 (80%), Positives = 79/88 (90%), Gaps = 0/88 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQ FVAYVNVG YY+VGVP+G VLGF+FNLGAKGIW G+IGGT +QT ILLWV
Sbjct  404  GVAVGCGWQQFVAYVNVGSYYIVGVPLGVVLGFFFNLGAKGIWGGLIGGTALQTTILLWV  463

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREPLL  281
            TIRTDW KEVE A+KRLN+WD K++PLL
Sbjct  464  TIRTDWTKEVEEAQKRLNKWDEKKQPLL  491



>emb|CDM86696.1| unnamed protein product [Triticum aestivum]
Length=499

 Score =   114 bits (284),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 70/88 (80%), Positives = 79/88 (90%), Gaps = 0/88 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQ FVAYVNVG YY+VGVP+G VLGF+FNLGAKGIW G+IGGT +QT ILLWV
Sbjct  404  GVAVGCGWQQFVAYVNVGSYYIVGVPLGVVLGFFFNLGAKGIWGGLIGGTALQTAILLWV  463

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREPLL  281
            T+RTDW KEVE A+KRLN+WD K+EPLL
Sbjct  464  TMRTDWTKEVEEAQKRLNKWDEKKEPLL  491



>gb|EMT26282.1| Protein TRANSPARENT TESTA 12 [Aegilops tauschii]
Length=402

 Score =   112 bits (281),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 70/88 (80%), Positives = 78/88 (89%), Gaps = 0/88 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQ FVAYVNVG YY+VGVP+G VLGF+FNLGAKGIW G+IGGT +QT ILLWV
Sbjct  308  GVAVGCGWQQFVAYVNVGSYYIVGVPLGVVLGFFFNLGAKGIWGGLIGGTALQTAILLWV  367

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREPLL  281
            TIRTDW KEVE A+KRLN+W  K+EPLL
Sbjct  368  TIRTDWTKEVEEAQKRLNKWSEKKEPLL  395



>emb|CDM86687.1| unnamed protein product [Triticum aestivum]
Length=501

 Score =   113 bits (282),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 70/88 (80%), Positives = 79/88 (90%), Gaps = 0/88 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQ FVAYVNVG YY+VGVP+G VLGF+FNLGAKGIW G+IGGT +QT ILLWV
Sbjct  406  GVAVGCGWQQFVAYVNVGSYYIVGVPLGVVLGFFFNLGAKGIWGGLIGGTALQTAILLWV  465

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREPLL  281
            TIRTDW KEVE A+KRLN+WD K++PLL
Sbjct  466  TIRTDWSKEVEEAQKRLNKWDEKKQPLL  493



>ref|XP_006447549.1| hypothetical protein CICLE_v10014926mg [Citrus clementina]
 ref|XP_006469688.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Citrus sinensis]
 gb|ESR60789.1| hypothetical protein CICLE_v10014926mg [Citrus clementina]
Length=520

 Score =   113 bits (282),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 72/88 (82%), Positives = 82/88 (93%), Gaps = 0/88 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQTFVAYVNVGCYYVVGVPVG++LGFYFNLGAKGIW GMIGGTVMQT+IL+WV
Sbjct  432  GVAVGCGWQTFVAYVNVGCYYVVGVPVGSLLGFYFNLGAKGIWSGMIGGTVMQTLILIWV  491

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREPLL  281
            T RTDW KEV+ A KRL++W+ K++PLL
Sbjct  492  TFRTDWNKEVQEALKRLDRWEDKKKPLL  519



>gb|EMS67482.1| Protein TRANSPARENT TESTA 12 [Triticum urartu]
Length=437

 Score =   112 bits (279),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 69/88 (78%), Positives = 79/88 (90%), Gaps = 0/88 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQ FVAYVNVG YY+VGVP+G VLGF+FNLGAKGIW G+IGGT +QT ILLWV
Sbjct  343  GVAVGCGWQKFVAYVNVGSYYIVGVPLGVVLGFFFNLGAKGIWGGLIGGTALQTTILLWV  402

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREPLL  281
            TIRT+W +EVE A+KRLN+WD K+EPLL
Sbjct  403  TIRTNWTEEVEEAQKRLNKWDEKKEPLL  430



>ref|XP_003540303.1| PREDICTED: protein TRANSPARENT TESTA 12 [Glycine max]
Length=504

 Score =   112 bits (279),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 71/88 (81%), Positives = 77/88 (88%), Gaps = 0/88 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQ FVAYVNVGCYY VG+P+GAVLGFYF  GAKGIW GM+GGTVMQTIILLWV
Sbjct  416  GVAVGCGWQAFVAYVNVGCYYGVGIPLGAVLGFYFQFGAKGIWLGMLGGTVMQTIILLWV  475

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREPLL  281
            T RTDW KEVE A KRL +W+ K+EPLL
Sbjct  476  TFRTDWTKEVEEAAKRLTKWEDKKEPLL  503



>ref|XP_004487408.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Cicer arietinum]
Length=507

 Score =   112 bits (279),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 69/88 (78%), Positives = 76/88 (86%), Gaps = 0/88 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQ FVAYVNV CYY VG+P+GAVLGFYF  GAKGIW GM+GGT MQTIIL+WV
Sbjct  418  GVAVGCGWQAFVAYVNVACYYGVGIPLGAVLGFYFQFGAKGIWLGMLGGTTMQTIILIWV  477

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREPLL  281
            T RTDW KEVE + KRLN+WD K+EPLL
Sbjct  478  TFRTDWNKEVEESAKRLNKWDDKKEPLL  505



>ref|XP_009353271.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Pyrus 
x bretschneideri]
Length=512

 Score =   111 bits (278),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 73/87 (84%), Positives = 79/87 (91%), Gaps = 1/87 (1%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQ FVAYVN+GCYYVVGVP GA+LGFYF LGAKGIW GM+GGT+MQT+ILLWV
Sbjct  426  GVAVGCGWQAFVAYVNIGCYYVVGVPFGALLGFYFKLGAKGIWLGMVGGTLMQTLILLWV  485

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREPL  284
            TIRTDW KEVE AKKRLN+WD K EPL
Sbjct  486  TIRTDWNKEVEEAKKRLNKWDVK-EPL  511



>ref|XP_008812639.1| PREDICTED: protein TRANSPARENT TESTA 12 [Phoenix dactylifera]
Length=522

 Score =   111 bits (278),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 68/88 (77%), Positives = 77/88 (88%), Gaps = 0/88 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQ FVAYVNV CYY+VG+P+G +LGF FNLGAKGIW GMIGGT MQT+ILLWV
Sbjct  431  GVAVGCGWQAFVAYVNVACYYIVGIPLGVLLGFKFNLGAKGIWSGMIGGTFMQTLILLWV  490

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREPLL  281
            T RTDW KEVE A KRLN+W+ K++PLL
Sbjct  491  TFRTDWNKEVEQAIKRLNKWEGKKQPLL  518



>ref|XP_004243470.1| PREDICTED: protein TRANSPARENT TESTA 12 [Solanum lycopersicum]
Length=503

 Score =   111 bits (277),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 70/90 (78%), Positives = 81/90 (90%), Gaps = 0/90 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQTFVAYVNVGCYY+VGVP+GA+LGFYF LGAKGIW GM+GGTVMQT+IL+W+
Sbjct  414  GVAVGCGWQTFVAYVNVGCYYIVGVPLGALLGFYFKLGAKGIWLGMMGGTVMQTVILIWI  473

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREPLLPK  275
            TIRTDW KEVE A+ RLN+W  K+EP L +
Sbjct  474  TIRTDWNKEVEAAQGRLNKWGDKKEPELKE  503



>emb|CBI28940.3| unnamed protein product [Vitis vinifera]
Length=100

 Score =   104 bits (259),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 67/88 (76%), Positives = 79/88 (90%), Gaps = 0/88 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQ FVAYVNVGCYY+VGVP+G++LGFYF LGAKGIW GM+GGT+MQT IL+WV
Sbjct  11   GVAVGCGWQAFVAYVNVGCYYIVGVPLGSLLGFYFKLGAKGIWLGMLGGTLMQTFILIWV  70

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREPLL  281
            T RT+W KEVE AK+RL +WD K++PLL
Sbjct  71   TARTNWNKEVEKAKERLEKWDDKKQPLL  98



>ref|XP_011047996.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Populus euphratica]
Length=499

 Score =   110 bits (276),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 69/88 (78%), Positives = 79/88 (90%), Gaps = 0/88 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQ FVAYVNVGCYY++GVPVG +LGF F+LGAKGIW GM+GGTV+QTIIL+WV
Sbjct  410  GVAVGCGWQAFVAYVNVGCYYLIGVPVGVLLGFTFDLGAKGIWSGMLGGTVLQTIILVWV  469

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREPLL  281
            T+RTDW KEVE AK RL+ WD KR+PLL
Sbjct  470  TLRTDWDKEVESAKNRLSSWDEKRQPLL  497



>gb|KHG27903.1| Protein TRANSPARENT TESTA 12 -like protein [Gossypium arboreum]
Length=506

 Score =   110 bits (276),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 70/89 (79%), Positives = 80/89 (90%), Gaps = 1/89 (1%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQTFVAYVNVGCYY VGVP+G++LGFYFNLGAKGIW GMIGGTVMQT++L+WV
Sbjct  417  GVAVGCGWQTFVAYVNVGCYYFVGVPLGSLLGFYFNLGAKGIWSGMIGGTVMQTLVLIWV  476

Query  364  TIRTDWVKEVEVAKKRLNQWDAKR-EPLL  281
            T RTDW KEVE A+KR++ W  K+ EPLL
Sbjct  477  TFRTDWKKEVEEARKRMDAWQVKKEEPLL  505



>ref|XP_011037771.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Populus euphratica]
Length=499

 Score =   110 bits (276),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 67/90 (74%), Positives = 80/90 (89%), Gaps = 0/90 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQ FVAYVNVGCYY++G+P+G +LGF F+LGAKGIW GM+GGT++QT+ILLWV
Sbjct  410  GVAVGCGWQAFVAYVNVGCYYLLGIPLGVLLGFKFDLGAKGIWSGMLGGTLLQTMILLWV  469

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREPLLPK  275
            T+RTDW KEVE AK RLN WD KR+P LP+
Sbjct  470  TLRTDWDKEVENAKNRLNTWDDKRQPPLPE  499



>ref|XP_010100632.1| Protein TRANSPARENT TESTA 12 [Morus notabilis]
 gb|EXB83380.1| Protein TRANSPARENT TESTA 12 [Morus notabilis]
Length=497

 Score =   110 bits (276),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 67/88 (76%), Positives = 77/88 (88%), Gaps = 0/88 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQT VAY+NVGCYY VGVP+G++LGFYF LG KGIW GMIGGTVMQT+IL W+
Sbjct  408  GVAVGCGWQTLVAYINVGCYYAVGVPLGSLLGFYFKLGVKGIWLGMIGGTVMQTLILFWI  467

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREPLL  281
            T RTDW KEVE A KRL++WDA +EP+L
Sbjct  468  TFRTDWNKEVEEATKRLSKWDASKEPIL  495



>ref|XP_007026054.1| MATE efflux family protein isoform 1 [Theobroma cacao]
 gb|EOY28676.1| MATE efflux family protein isoform 1 [Theobroma cacao]
Length=515

 Score =   110 bits (276),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 69/88 (78%), Positives = 79/88 (90%), Gaps = 0/88 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQ FVAYVNVGCYYVVG+P+G +LGF F LGAKGIW GMIGGT+MQTI+LLWV
Sbjct  426  GVAVGCGWQAFVAYVNVGCYYVVGIPLGCLLGFKFGLGAKGIWSGMIGGTLMQTIVLLWV  485

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREPLL  281
            T RTDW KEVE A+KRL++W+ K+EPLL
Sbjct  486  TFRTDWNKEVETARKRLDKWEDKKEPLL  513



>ref|XP_011463308.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Fragaria vesca 
subsp. vesca]
Length=186

 Score =   106 bits (265),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 69/88 (78%), Positives = 76/88 (86%), Gaps = 1/88 (1%)
 Frame = -2

Query  547  PGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLW  368
             GVAVGCGWQ FVAYVNVGCYY+VGVP+G +LGFYFN GAKGIW GM+ GT+MQTIILLW
Sbjct  98   SGVAVGCGWQAFVAYVNVGCYYLVGVPLGVLLGFYFNFGAKGIWLGMMAGTLMQTIILLW  157

Query  367  VTIRTDWVKEVEVAKKRLNQWDAKREPL  284
            +TIRTDW KEVE A +RLN WD K EPL
Sbjct  158  ITIRTDWKKEVEEAARRLNNWDVK-EPL  184



>gb|KDO75453.1| hypothetical protein CISIN_1g010798mg [Citrus sinensis]
Length=501

 Score =   110 bits (275),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 67/88 (76%), Positives = 77/88 (88%), Gaps = 0/88 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQ FVAYVN+ CYY+VG+P+G +LGF FN GAKGIW GMIGGT MQTIILLWV
Sbjct  412  GVAVGCGWQAFVAYVNIACYYIVGIPLGCLLGFKFNFGAKGIWSGMIGGTAMQTIILLWV  471

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREPLL  281
            TIRTDW KEVE AK RL++W+ K++PLL
Sbjct  472  TIRTDWKKEVEKAKMRLDKWEDKQQPLL  499



>ref|XP_006449030.1| hypothetical protein CICLE_v10014983mg [Citrus clementina]
 gb|ESR62270.1| hypothetical protein CICLE_v10014983mg [Citrus clementina]
Length=501

 Score =   110 bits (275),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 67/88 (76%), Positives = 77/88 (88%), Gaps = 0/88 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQ FVAYVN+ CYY+VG+P+G +LGF FN GAKGIW GMIGGT MQTIILLWV
Sbjct  412  GVAVGCGWQAFVAYVNIACYYIVGIPLGCLLGFKFNFGAKGIWSGMIGGTAMQTIILLWV  471

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREPLL  281
            TIRTDW KEVE AK RL++W+ K++PLL
Sbjct  472  TIRTDWKKEVEKAKMRLDKWEDKQQPLL  499



>ref|XP_007026055.1| MATE efflux family protein, expressed isoform 2 [Theobroma cacao]
 gb|EOY28677.1| MATE efflux family protein, expressed isoform 2 [Theobroma cacao]
Length=516

 Score =   110 bits (276),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 69/88 (78%), Positives = 79/88 (90%), Gaps = 0/88 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQ FVAYVNVGCYYVVG+P+G +LGF F LGAKGIW GMIGGT+MQTI+LLWV
Sbjct  427  GVAVGCGWQAFVAYVNVGCYYVVGIPLGCLLGFKFGLGAKGIWSGMIGGTLMQTIVLLWV  486

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREPLL  281
            T RTDW KEVE A+KRL++W+ K+EPLL
Sbjct  487  TFRTDWNKEVETARKRLDKWEDKKEPLL  514



>ref|XP_006468029.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Citrus sinensis]
Length=501

 Score =   110 bits (275),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 67/88 (76%), Positives = 77/88 (88%), Gaps = 0/88 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQ FVAYVN+ CYY+VG+P+G +LGF FN GAKGIW GMIGGT MQTIILLWV
Sbjct  412  GVAVGCGWQAFVAYVNIACYYIVGIPLGCLLGFKFNFGAKGIWSGMIGGTAMQTIILLWV  471

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREPLL  281
            TIRTDW KEVE AK RL++W+ K++PLL
Sbjct  472  TIRTDWKKEVEKAKMRLDKWEDKQQPLL  499



>ref|XP_009402851.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Musa acuminata 
subsp. malaccensis]
Length=486

 Score =   110 bits (274),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 70/88 (80%), Positives = 78/88 (89%), Gaps = 0/88 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQ FVAYVNVGCYY++GVP G++LGF F LGAKGIW GMIGGT MQT+ILLWV
Sbjct  398  GVAVGCGWQAFVAYVNVGCYYIIGVPFGSLLGFKFGLGAKGIWGGMIGGTFMQTLILLWV  457

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREPLL  281
            T RTDW KEVE AKKRLN+W+ K+EPLL
Sbjct  458  TFRTDWNKEVEEAKKRLNKWEDKKEPLL  485



>gb|KJB69293.1| hypothetical protein B456_011G014800 [Gossypium raimondii]
Length=522

 Score =   110 bits (275),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 70/88 (80%), Positives = 80/88 (91%), Gaps = 0/88 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQTFVAYVNVGCYYVVG+P+G +LGF ++LGAKGIW GMIGGT+MQT+ILLWV
Sbjct  433  GVAVGCGWQTFVAYVNVGCYYVVGIPLGCLLGFIYHLGAKGIWSGMIGGTLMQTLILLWV  492

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREPLL  281
            T RTDW KEVE AKKRL++W+ KRE LL
Sbjct  493  TFRTDWNKEVETAKKRLDKWEDKRETLL  520



>ref|XP_004251515.1| PREDICTED: protein TRANSPARENT TESTA 12 [Solanum lycopersicum]
Length=512

 Score =   110 bits (274),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 68/90 (76%), Positives = 80/90 (89%), Gaps = 0/90 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQTFVAYVN+GCYY+VGVP+GA+LGFYF LGAKGIW GM+GGTVMQTIIL+W+
Sbjct  423  GVAVGCGWQTFVAYVNIGCYYIVGVPLGALLGFYFKLGAKGIWSGMLGGTVMQTIILIWI  482

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREPLLPK  275
            T RTDW KEVE A+ RL +WD K+E +L +
Sbjct  483  TARTDWNKEVEAAQSRLKKWDDKKESILEE  512



>ref|XP_009353270.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Pyrus 
x bretschneideri]
Length=512

 Score =   110 bits (274),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 72/87 (83%), Positives = 78/87 (90%), Gaps = 1/87 (1%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQ FVAYVN+GCYYVVGVP GA+LGFYF LGAKGIW GM+GGT+MQT+ILLWV
Sbjct  426  GVAVGCGWQAFVAYVNIGCYYVVGVPFGALLGFYFKLGAKGIWLGMVGGTLMQTLILLWV  485

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREPL  284
            TIRTDW KEVE A KRLN+WD K EPL
Sbjct  486  TIRTDWNKEVEEANKRLNKWDVK-EPL  511



>ref|XP_008342112.1| PREDICTED: MATE efflux family protein ALF5-like [Malus domestica]
Length=179

 Score =   105 bits (262),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 70/81 (86%), Positives = 75/81 (93%), Gaps = 0/81 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQ FVAYVNVGCYYVVGVP GA+LGFYF LGAKGIW GM+GGT+MQT+ILLWV
Sbjct  97   GVAVGCGWQAFVAYVNVGCYYVVGVPFGALLGFYFKLGAKGIWLGMVGGTLMQTLILLWV  156

Query  364  TIRTDWVKEVEVAKKRLNQWD  302
            TIRTDW KEVE AKKRLN+WD
Sbjct  157  TIRTDWNKEVEEAKKRLNKWD  177



>ref|XP_007045633.1| MATE efflux family protein isoform 1 [Theobroma cacao]
 gb|EOY01465.1| MATE efflux family protein isoform 1 [Theobroma cacao]
Length=504

 Score =   109 bits (273),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 69/88 (78%), Positives = 78/88 (89%), Gaps = 0/88 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQ FVAYVNVGCYYVVG+P+G++LGFYF LGAKGIW GMIGGT MQT+IL+WV
Sbjct  416  GVAVGCGWQAFVAYVNVGCYYVVGIPLGSLLGFYFKLGAKGIWSGMIGGTAMQTLILVWV  475

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREPLL  281
            T RTDW KEVE A+KRL  W+ K+EPLL
Sbjct  476  TFRTDWKKEVEEARKRLVTWEDKKEPLL  503



>ref|XP_011047998.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Populus 
euphratica]
Length=405

 Score =   108 bits (270),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 68/88 (77%), Positives = 79/88 (90%), Gaps = 0/88 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQ FVAYVNVGCYY++GVP+G +LGF F+LGAKGIW GM+GGTV+QT+ILLWV
Sbjct  316  GVAVGCGWQAFVAYVNVGCYYLIGVPLGVLLGFTFDLGAKGIWSGMLGGTVLQTLILLWV  375

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREPLL  281
            T RTDW KEVEVAK RL+ WD +R+PLL
Sbjct  376  TWRTDWNKEVEVAKNRLSSWDDRRQPLL  403



>ref|XP_004487410.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Cicer arietinum]
Length=503

 Score =   109 bits (272),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 67/88 (76%), Positives = 76/88 (86%), Gaps = 0/88 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQ FVAYVNV CYY VG+P+GAVLGFYF  GAKGIW GM+GGT MQT+IL+WV
Sbjct  414  GVAVGCGWQAFVAYVNVACYYGVGIPLGAVLGFYFQFGAKGIWLGMLGGTTMQTVILMWV  473

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREPLL  281
            T RTDW KEV+ A KRLN+W+ K+EPLL
Sbjct  474  TFRTDWNKEVQEADKRLNKWEDKKEPLL  501



>ref|XP_006651561.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Oryza brachyantha]
Length=497

 Score =   108 bits (271),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 68/91 (75%), Positives = 77/91 (85%), Gaps = 0/91 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQ  VAY+NVGCYY VGVP+G +LGF F+LGAKGIW GM+GGT MQT+IL W+
Sbjct  405  GVAVGCGWQKTVAYINVGCYYFVGVPLGFLLGFKFHLGAKGIWSGMLGGTCMQTLILFWI  464

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREPLLPKT  272
            T RTDW KEVE AKKRLNQWD K++PLL  T
Sbjct  465  TFRTDWNKEVEQAKKRLNQWDDKKQPLLAST  495



>ref|XP_006375528.1| hypothetical protein POPTR_0014s15130g, partial [Populus trichocarpa]
 gb|ERP53325.1| hypothetical protein POPTR_0014s15130g, partial [Populus trichocarpa]
Length=194

 Score =   105 bits (261),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 67/88 (76%), Positives = 76/88 (86%), Gaps = 0/88 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQ FVAYVNVGCYYVVG+P+G++ GFYFNLGAKGIW GMI G V+QT+ILLWV
Sbjct  106  GVAVGCGWQAFVAYVNVGCYYVVGIPLGSLFGFYFNLGAKGIWSGMIAGIVLQTVILLWV  165

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREPLL  281
            TIRTDW KEV+ A KRL  W+ K EPL+
Sbjct  166  TIRTDWNKEVQEALKRLETWEGKEEPLV  193



>ref|XP_006650264.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Oryza brachyantha]
Length=499

 Score =   108 bits (271),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 67/88 (76%), Positives = 78/88 (89%), Gaps = 0/88 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQ FVAYVN+GCYY++GVP+G +LGF FNLG KGIW GM+GGT MQT IL+WV
Sbjct  405  GVAVGCGWQQFVAYVNIGCYYIIGVPLGVLLGFVFNLGVKGIWGGMLGGTCMQTAILVWV  464

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREPLL  281
            T+RTDW KEVE A+KRLN+WD K+EPLL
Sbjct  465  TLRTDWKKEVEEAQKRLNKWDDKKEPLL  492



>ref|XP_011047997.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Populus 
euphratica]
Length=500

 Score =   108 bits (271),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 68/88 (77%), Positives = 79/88 (90%), Gaps = 0/88 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQ FVAYVNVGCYY++GVP+G +LGF F+LGAKGIW GM+GGTV+QT+ILLWV
Sbjct  411  GVAVGCGWQAFVAYVNVGCYYLIGVPLGVLLGFTFDLGAKGIWSGMLGGTVLQTLILLWV  470

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREPLL  281
            T RTDW KEVEVAK RL+ WD +R+PLL
Sbjct  471  TWRTDWNKEVEVAKNRLSSWDDRRQPLL  498



>emb|CDP11780.1| unnamed protein product [Coffea canephora]
Length=501

 Score =   108 bits (270),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 70/89 (79%), Positives = 80/89 (90%), Gaps = 1/89 (1%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQ FVAYVNVGCYY+VG+P+G++LGFYF LGAKG+W GM+GGT MQTIILLWV
Sbjct  411  GVAVGCGWQAFVAYVNVGCYYLVGIPLGSLLGFYFQLGAKGLWSGMLGGTTMQTIILLWV  470

Query  364  TIRTDWVKEVEVAKKRLNQW-DAKREPLL  281
            TIRTDW KEVEVA KRL++W D K+E LL
Sbjct  471  TIRTDWNKEVEVALKRLDKWEDQKKEALL  499



>emb|CDM86680.1| unnamed protein product [Triticum aestivum]
Length=403

 Score =   107 bits (268),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 71/89 (80%), Positives = 77/89 (87%), Gaps = 1/89 (1%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQ FVAYVN+GCYY+VGVP+G VLGF FNLG KGIW GMIGGT MQT ILLWV
Sbjct  308  GVAVGCGWQQFVAYVNIGCYYIVGVPLGIVLGFVFNLGVKGIWSGMIGGTTMQTAILLWV  367

Query  364  TIRTDWVKEVEVAKKRLNQW-DAKREPLL  281
            TIRTDW KEVE A KRLN+W D K++PLL
Sbjct  368  TIRTDWSKEVEEAHKRLNKWDDTKKQPLL  396



>ref|XP_010233179.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Brachypodium 
distachyon]
Length=402

 Score =   107 bits (268),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 70/88 (80%), Positives = 78/88 (89%), Gaps = 0/88 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQ FVAYVN+GCYYVVGVP+G VLGF F LG KGIW GMIGGTVMQT+ILLWV
Sbjct  308  GVAVGCGWQQFVAYVNIGCYYVVGVPLGLVLGFVFKLGVKGIWGGMIGGTVMQTVILLWV  367

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREPLL  281
            TIRTDW KEVE A+KRL++W+  +EPLL
Sbjct  368  TIRTDWNKEVEEAQKRLSKWEGSKEPLL  395



>ref|XP_010665570.1| PREDICTED: protein TRANSPARENT TESTA 12 [Beta vulgaris subsp. 
vulgaris]
Length=508

 Score =   108 bits (270),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 68/88 (77%), Positives = 77/88 (88%), Gaps = 0/88 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQ+FVAYVNV CYYVVG+PVG +LGFYF LG KGIW GMIGGTV+QT+ILLWV
Sbjct  420  GVAVGCGWQSFVAYVNVACYYVVGIPVGVLLGFYFKLGVKGIWGGMIGGTVIQTVILLWV  479

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREPLL  281
            T RTDW KEVE A  RL++W+A +EPLL
Sbjct  480  TFRTDWQKEVEKAASRLDKWEAVKEPLL  507



>ref|XP_009388870.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Musa acuminata 
subsp. malaccensis]
Length=521

 Score =   108 bits (271),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 71/89 (80%), Positives = 79/89 (89%), Gaps = 1/89 (1%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQ FVAYVNVGCYY+VGVP G++LGF F LGAKGIW GMIGGT+MQT+IL+WV
Sbjct  432  GVAVGCGWQAFVAYVNVGCYYIVGVPFGSLLGFKFGLGAKGIWGGMIGGTIMQTLILMWV  491

Query  364  TIRTDWVKEVEVAKKRLNQWDAKR-EPLL  281
            T RTDW KEVE AKKRLN+WD K+ EPLL
Sbjct  492  TFRTDWNKEVEEAKKRLNKWDGKKEEPLL  520



>ref|XP_007026056.1| MATE efflux family protein [Theobroma cacao]
 gb|EOY28678.1| MATE efflux family protein [Theobroma cacao]
Length=519

 Score =   108 bits (270),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 70/88 (80%), Positives = 78/88 (89%), Gaps = 0/88 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQ FVAYVNVGCYYVVG+P+G VLGF F LGAKGIW GMIGGT+MQT+ILLWV
Sbjct  430  GVAVGCGWQAFVAYVNVGCYYVVGIPLGCVLGFKFGLGAKGIWSGMIGGTLMQTVILLWV  489

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREPLL  281
            T  TDW KEVE AKKRL++W+ K+EPLL
Sbjct  490  TFTTDWNKEVETAKKRLDRWEDKKEPLL  517



>ref|XP_003562349.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Brachypodium 
distachyon]
Length=494

 Score =   108 bits (269),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 70/88 (80%), Positives = 78/88 (89%), Gaps = 0/88 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQ FVAYVN+GCYYVVGVP+G VLGF F LG KGIW GMIGGTVMQT+ILLWV
Sbjct  400  GVAVGCGWQQFVAYVNIGCYYVVGVPLGLVLGFVFKLGVKGIWGGMIGGTVMQTVILLWV  459

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREPLL  281
            TIRTDW KEVE A+KRL++W+  +EPLL
Sbjct  460  TIRTDWNKEVEEAQKRLSKWEGSKEPLL  487



>ref|XP_010930135.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Elaeis guineensis]
Length=523

 Score =   108 bits (270),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 68/88 (77%), Positives = 78/88 (89%), Gaps = 0/88 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQ FVAYVNV CYY+VGVP+GA+LGF FNLGAKGIW GMIGGT+MQT+IL+WV
Sbjct  432  GVAVGCGWQAFVAYVNVACYYIVGVPLGALLGFKFNLGAKGIWSGMIGGTLMQTLILIWV  491

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREPLL  281
            T RTDW KEV  A KRLN+W+ K++PLL
Sbjct  492  TFRTDWNKEVNEAIKRLNKWEDKKKPLL  519



>gb|EMS63520.1| Protein TRANSPARENT TESTA 12 [Triticum urartu]
Length=403

 Score =   107 bits (266),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 71/89 (80%), Positives = 77/89 (87%), Gaps = 1/89 (1%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQ FVAYVN+GCYY+VGVP+G VLGF FNLG KGIW GMIGGT MQT ILLWV
Sbjct  308  GVAVGCGWQQFVAYVNIGCYYIVGVPLGIVLGFVFNLGVKGIWGGMIGGTTMQTAILLWV  367

Query  364  TIRTDWVKEVEVAKKRLNQW-DAKREPLL  281
            TIRTDW KEVE A KRLN+W D K++PLL
Sbjct  368  TIRTDWSKEVEEAHKRLNKWDDTKKQPLL  396



>ref|XP_010930090.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Elaeis guineensis]
Length=520

 Score =   108 bits (269),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 67/88 (76%), Positives = 78/88 (89%), Gaps = 0/88 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQ FVAYVNVGCYY+VG+P+G +LGF FNLGAKGIW GMIGGT MQT+IL+WV
Sbjct  431  GVAVGCGWQAFVAYVNVGCYYIVGIPLGVLLGFKFNLGAKGIWSGMIGGTFMQTLILIWV  490

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREPLL  281
            T RTDW KEV+ A KRLN+W+ K++PLL
Sbjct  491  TFRTDWNKEVDEAIKRLNKWEDKKQPLL  518



>gb|EMT13254.1| Protein TRANSPARENT TESTA 12 [Aegilops tauschii]
Length=403

 Score =   106 bits (265),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 71/89 (80%), Positives = 77/89 (87%), Gaps = 1/89 (1%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQ FVAYVN+GCYY+VGVP+G VLGF FNLG KGIW GMIGGT MQT ILLWV
Sbjct  308  GVAVGCGWQQFVAYVNIGCYYIVGVPLGIVLGFVFNLGVKGIWGGMIGGTTMQTAILLWV  367

Query  364  TIRTDWVKEVEVAKKRLNQW-DAKREPLL  281
            TIRTDW KEVE A KRLN+W D K++PLL
Sbjct  368  TIRTDWSKEVEEAHKRLNKWDDTKKQPLL  396



>ref|XP_010930122.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Elaeis guineensis]
Length=492

 Score =   107 bits (267),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 66/88 (75%), Positives = 78/88 (89%), Gaps = 0/88 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQ FVAYVNV CYY+VG+P+GA+LGF FNLGAKGIW GMIGGT MQT+IL+WV
Sbjct  401  GVAVGCGWQAFVAYVNVACYYIVGIPLGALLGFKFNLGAKGIWSGMIGGTFMQTVILIWV  460

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREPLL  281
            T RTDW KEV+ A KRLN+W+ +++PLL
Sbjct  461  TFRTDWNKEVDEAIKRLNKWEDEKQPLL  488



>ref|XP_006383933.1| hypothetical protein POPTR_0004s01620g [Populus trichocarpa]
 gb|ERP61730.1| hypothetical protein POPTR_0004s01620g [Populus trichocarpa]
Length=499

 Score =   107 bits (268),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 66/90 (73%), Positives = 79/90 (88%), Gaps = 0/90 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQ FVAYVNVGCYY++G+P+G +LGF F+LGAKGIW GM+GGT++QT+ILLWV
Sbjct  410  GVAVGCGWQAFVAYVNVGCYYLLGIPLGVLLGFKFDLGAKGIWSGMLGGTLLQTMILLWV  469

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREPLLPK  275
            T+RTDW KEVE AK RLN WD KR+P L +
Sbjct  470  TLRTDWNKEVENAKNRLNTWDDKRQPPLQE  499



>gb|AFW68307.1| putative MATE efflux family protein [Zea mays]
Length=401

 Score =   106 bits (265),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 66/88 (75%), Positives = 78/88 (89%), Gaps = 0/88 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQ FVAYVNVGCYY+VG+P+G +LGFYF+LGA GIW GMIGGT+MQT+IL+WV
Sbjct  310  GVAVGCGWQAFVAYVNVGCYYIVGIPLGCLLGFYFDLGAAGIWSGMIGGTLMQTLILIWV  369

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREPLL  281
            T RT+W KEVE A+KRLN+WD  + PLL
Sbjct  370  TFRTNWNKEVEEAQKRLNKWDDGKAPLL  397



>gb|AAR00628.1| putative MATE family protein [Oryza sativa Japonica Group]
 gb|EEE59381.1| hypothetical protein OsJ_11497 [Oryza sativa Japonica Group]
Length=401

 Score =   106 bits (265),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 66/91 (73%), Positives = 77/91 (85%), Gaps = 0/91 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQ  VAY+NVGCYY VG+P+G +LGF F+LGAKGIW GM+GGT MQT+IL W+
Sbjct  308  GVAVGCGWQKIVAYINVGCYYFVGIPLGFLLGFKFHLGAKGIWTGMLGGTCMQTLILFWI  367

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREPLLPKT  272
            T RTDW KEVE AKKRLNQW+ K++PLL  T
Sbjct  368  TFRTDWNKEVEEAKKRLNQWEDKKQPLLAGT  398



>ref|XP_009137220.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Brassica rapa]
Length=507

 Score =   107 bits (268),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 70/88 (80%), Positives = 79/88 (90%), Gaps = 0/88 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQTFVAYVNVGCYYVVG+P+G VLGF FNL AKGIW GMIGGT+MQT+ILL+V
Sbjct  419  GVAVGCGWQTFVAYVNVGCYYVVGIPIGCVLGFTFNLQAKGIWTGMIGGTLMQTLILLYV  478

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREPLL  281
            T RTDW KEV+ A+KRL+ WD K+EPLL
Sbjct  479  TYRTDWDKEVKKARKRLDMWDDKKEPLL  506



>emb|CDX98711.1| BnaA03g44960D [Brassica napus]
Length=507

 Score =   107 bits (267),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 70/88 (80%), Positives = 79/88 (90%), Gaps = 0/88 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQTFVAYVNVGCYYVVG+P+G VLGF FNL AKGIW GMIGGT+MQT+ILL+V
Sbjct  419  GVAVGCGWQTFVAYVNVGCYYVVGIPIGCVLGFTFNLQAKGIWTGMIGGTLMQTLILLYV  478

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREPLL  281
            T RTDW KEV+ A+KRL+ WD K+EPLL
Sbjct  479  TYRTDWDKEVKKARKRLDMWDDKKEPLL  506



>emb|CDX94061.1| BnaC07g36950D [Brassica napus]
Length=507

 Score =   107 bits (267),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 70/88 (80%), Positives = 79/88 (90%), Gaps = 0/88 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQTFVAYVNVGCYYVVG+P+G VLGF FNL AKGIW GMIGGT+MQT+ILL+V
Sbjct  419  GVAVGCGWQTFVAYVNVGCYYVVGIPIGCVLGFTFNLQAKGIWTGMIGGTLMQTLILLYV  478

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREPLL  281
            T RTDW KEV+ A+KRL+ WD K+EPLL
Sbjct  479  TYRTDWDKEVKKARKRLDMWDDKKEPLL  506



>ref|XP_006389631.1| hypothetical protein POPTR_0021s00800g [Populus trichocarpa]
 gb|ERP48545.1| hypothetical protein POPTR_0021s00800g [Populus trichocarpa]
Length=499

 Score =   107 bits (267),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 69/88 (78%), Positives = 78/88 (89%), Gaps = 0/88 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQ FVAYVNVGCYY++GVPVG VLGF F+LGAKGIW GM+GGTV+QTIIL+WV
Sbjct  410  GVAVGCGWQAFVAYVNVGCYYLIGVPVGVVLGFTFDLGAKGIWSGMLGGTVLQTIILVWV  469

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREPLL  281
            T+RTDW KEVE AK RL+ WD K +PLL
Sbjct  470  TLRTDWDKEVESAKNRLSSWDEKGQPLL  497



>ref|XP_003596992.1| Transparent testa 12 protein [Medicago truncatula]
 gb|AES67243.1| MATE efflux family protein [Medicago truncatula]
Length=507

 Score =   107 bits (267),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 70/89 (79%), Positives = 79/89 (89%), Gaps = 1/89 (1%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQ FVAYVNVGCYY+VG+P+GAVLGFYFN GAKGIW GM+GGT MQTIIL+WV
Sbjct  418  GVAVGCGWQAFVAYVNVGCYYIVGIPLGAVLGFYFNFGAKGIWLGMLGGTTMQTIILMWV  477

Query  364  TIRTDWVKEVEVAKKRLNQWDA-KREPLL  281
            T RTDW KEV+ A KRLN+W+  K+EPLL
Sbjct  478  TFRTDWNKEVKEAAKRLNKWEEKKKEPLL  506



>ref|XP_003526327.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Glycine max]
Length=517

 Score =   107 bits (268),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 67/88 (76%), Positives = 77/88 (88%), Gaps = 0/88 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQTFVAYVNVGCYY +G+P+G+VLGFYF L AKGIW GM+GGTV+QTIIL+WV
Sbjct  429  GVAVGCGWQTFVAYVNVGCYYGIGIPLGSVLGFYFKLSAKGIWLGMLGGTVLQTIILVWV  488

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREPLL  281
            T RTDW  EVE A KRLN+W+ K EPL+
Sbjct  489  TFRTDWNNEVEEAAKRLNKWENKTEPLV  516



>gb|KHN41220.1| Protein TRANSPARENT TESTA 12 [Glycine soja]
Length=517

 Score =   107 bits (268),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 67/88 (76%), Positives = 77/88 (88%), Gaps = 0/88 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQTFVAYVNVGCYY +G+P+G+VLGFYF L AKGIW GM+GGTV+QTIIL+WV
Sbjct  429  GVAVGCGWQTFVAYVNVGCYYGIGIPLGSVLGFYFKLSAKGIWLGMLGGTVLQTIILVWV  488

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREPLL  281
            T RTDW  EVE A KRLN+W+ K EPL+
Sbjct  489  TFRTDWNNEVEEAAKRLNKWENKTEPLV  516



>ref|XP_009768477.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Nicotiana sylvestris]
Length=513

 Score =   107 bits (267),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 68/90 (76%), Positives = 80/90 (89%), Gaps = 0/90 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQTFVAYVNVGCYY+VGVP+GA+LGF+F LGAKGIW GM+GGTVMQTIIL+W+
Sbjct  424  GVAVGCGWQTFVAYVNVGCYYIVGVPLGALLGFHFKLGAKGIWSGMLGGTVMQTIILIWI  483

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREPLLPK  275
            T RTDW KEVE A+ RL +WD K+E +L +
Sbjct  484  TARTDWNKEVESAQYRLKKWDDKKESILEE  513



>ref|XP_003633309.1| PREDICTED: LOW QUALITY PROTEIN: protein TRANSPARENT TESTA 12 
[Vitis vinifera]
Length=507

 Score =   107 bits (267),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 67/88 (76%), Positives = 79/88 (90%), Gaps = 0/88 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQ FVAYVNVGCYY+VGVP+G++LGFYF LGAKGIW GM+GGT+MQT IL+WV
Sbjct  418  GVAVGCGWQAFVAYVNVGCYYIVGVPLGSLLGFYFKLGAKGIWLGMLGGTLMQTFILIWV  477

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREPLL  281
            T RT+W KEVE AK+RL +WD K++PLL
Sbjct  478  TARTNWNKEVEKAKERLEKWDDKKQPLL  505



>ref|XP_002883313.1| mate efflux family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH59572.1| mate efflux family protein [Arabidopsis lyrata subsp. lyrata]
Length=506

 Score =   107 bits (267),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 64/90 (71%), Positives = 77/90 (86%), Gaps = 0/90 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQTFVA VNVGCYY++G+P+GA+ GFYFN GAKGIW GMIGGTV+QT IL WV
Sbjct  417  GVAVGCGWQTFVAKVNVGCYYIIGIPLGALFGFYFNFGAKGIWTGMIGGTVIQTFILAWV  476

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREPLLPK  275
            T RTDW KEVE A KRL++W  K++ ++P+
Sbjct  477  TFRTDWTKEVEEASKRLDKWSNKKQEVVPE  506



>gb|ACZ55932.1| MATE transporter 2 [Zea mays]
 gb|ACZ55933.1| MATE transporter 2 [Zea mays]
Length=513

 Score =   107 bits (267),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 66/88 (75%), Positives = 78/88 (89%), Gaps = 0/88 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQ FVAYVNVGCYY+VG+P+G +LGFYF+LGA GIW GMIGGT+MQT+IL+WV
Sbjct  422  GVAVGCGWQAFVAYVNVGCYYIVGIPLGCLLGFYFDLGAAGIWSGMIGGTLMQTLILIWV  481

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREPLL  281
            T RT+W KEVE A+KRLN+WD  + PLL
Sbjct  482  TFRTNWNKEVEEAQKRLNKWDDGKAPLL  509



>gb|ACZ55931.1| MATE transporter 2 [Zea mays]
Length=511

 Score =   107 bits (266),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 66/88 (75%), Positives = 78/88 (89%), Gaps = 0/88 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQ FVAYVNVGCYY+VG+P+G +LGFYF+LGA GIW GMIGGT+MQT+IL+WV
Sbjct  420  GVAVGCGWQAFVAYVNVGCYYIVGIPLGCLLGFYFDLGAAGIWSGMIGGTLMQTLILIWV  479

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREPLL  281
            T RT+W KEVE A+KRLN+WD  + PLL
Sbjct  480  TFRTNWNKEVEEAQKRLNKWDDGKAPLL  507



>gb|ACF85423.1| unknown [Zea mays]
 gb|ACR35764.1| unknown [Zea mays]
 gb|AFW68308.1| putative MATE efflux family protein [Zea mays]
Length=513

 Score =   107 bits (266),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 66/88 (75%), Positives = 78/88 (89%), Gaps = 0/88 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQ FVAYVNVGCYY+VG+P+G +LGFYF+LGA GIW GMIGGT+MQT+IL+WV
Sbjct  422  GVAVGCGWQAFVAYVNVGCYYIVGIPLGCLLGFYFDLGAAGIWSGMIGGTLMQTLILIWV  481

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREPLL  281
            T RT+W KEVE A+KRLN+WD  + PLL
Sbjct  482  TFRTNWNKEVEEAQKRLNKWDDGKAPLL  509



>ref|XP_010276072.1| PREDICTED: protein TRANSPARENT TESTA 12 [Nelumbo nucifera]
Length=512

 Score =   107 bits (266),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 68/88 (77%), Positives = 79/88 (90%), Gaps = 0/88 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQ FVAYVNVGCYY++G+P+GA+LGF F+LGAKGIW GMIGGT+MQT+ILLWV
Sbjct  423  GVAVGCGWQAFVAYVNVGCYYILGIPLGALLGFKFDLGAKGIWSGMIGGTMMQTLILLWV  482

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREPLL  281
            T RT+W KEVE A KRLN+W+ K EPLL
Sbjct  483  TYRTNWNKEVEEATKRLNKWEDKPEPLL  510



>ref|NP_001148084.1| transparent testa 12 protein [Zea mays]
 gb|ACG29679.1| transparent testa 12 protein [Zea mays]
Length=511

 Score =   107 bits (266),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 66/88 (75%), Positives = 78/88 (89%), Gaps = 0/88 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQ FVAYVNVGCYY+VG+P+G +LGFYF+LGA GIW GMIGGT+MQT+IL+WV
Sbjct  420  GVAVGCGWQAFVAYVNVGCYYIVGIPLGCLLGFYFDLGAAGIWSGMIGGTLMQTLILIWV  479

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREPLL  281
            T RT+W KEVE A+KRLN+WD  + PLL
Sbjct  480  TFRTNWNKEVEEAQKRLNKWDDGKAPLL  507



>ref|NP_188806.1| MATE efflux family protein [Arabidopsis thaliana]
 dbj|BAB02363.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAU05531.1| At3g21690 [Arabidopsis thaliana]
 gb|AEE76538.1| MATE efflux family protein [Arabidopsis thaliana]
Length=506

 Score =   107 bits (266),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 64/90 (71%), Positives = 77/90 (86%), Gaps = 0/90 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQTFVA VNVGCYY++G+P+GA+ GFYFN GAKGIW GMIGGTV+QT IL WV
Sbjct  417  GVAVGCGWQTFVAKVNVGCYYIIGIPLGALFGFYFNFGAKGIWTGMIGGTVIQTFILAWV  476

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREPLLPK  275
            T RTDW KEVE A KRL++W  K++ ++P+
Sbjct  477  TFRTDWTKEVEEASKRLDKWSNKKQEVVPE  506



>gb|AAM20595.1| integral membrane protein, putative [Arabidopsis thaliana]
Length=506

 Score =   107 bits (266),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 64/90 (71%), Positives = 77/90 (86%), Gaps = 0/90 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQTFVA VNVGCYY++G+P+GA+ GFYFN GAKGIW GMIGGTV+QT IL WV
Sbjct  417  GVAVGCGWQTFVAKVNVGCYYIIGIPLGALFGFYFNFGAKGIWTGMIGGTVIQTFILAWV  476

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREPLLPK  275
            T RTDW KEVE A KRL++W  K++ ++P+
Sbjct  477  TFRTDWTKEVEEASKRLDKWSNKKQEVVPE  506



>emb|CBI28938.3| unnamed protein product [Vitis vinifera]
Length=434

 Score =   106 bits (264),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 66/89 (74%), Positives = 79/89 (89%), Gaps = 0/89 (0%)
 Frame = -2

Query  547  PGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLW  368
             GVAVGCGWQ FVAYVNVGCYY+VGVP+G++LGFYF LGAKGIW GM+GGT+MQT IL+W
Sbjct  344  SGVAVGCGWQAFVAYVNVGCYYIVGVPLGSLLGFYFKLGAKGIWLGMLGGTLMQTFILIW  403

Query  367  VTIRTDWVKEVEVAKKRLNQWDAKREPLL  281
            VT RT+W KEVE AK+R+ +WD K++PLL
Sbjct  404  VTARTNWNKEVEKAKERMEKWDDKKQPLL  432



>ref|XP_009630733.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Nicotiana tomentosiformis]
Length=513

 Score =   107 bits (266),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 68/90 (76%), Positives = 79/90 (88%), Gaps = 0/90 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQTFVAYVNVGCYY+VGVPVG +LGF+F LGAKGIW GM+GGTVMQTIIL+W+
Sbjct  424  GVAVGCGWQTFVAYVNVGCYYIVGVPVGVLLGFHFKLGAKGIWSGMLGGTVMQTIILIWI  483

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREPLLPK  275
            T RTDW KEVE A+ RL +WD K+E +L +
Sbjct  484  TARTDWNKEVESAQYRLKKWDDKKEAILEE  513



>ref|XP_002279330.1| PREDICTED: protein TRANSPARENT TESTA 12 [Vitis vinifera]
Length=507

 Score =   107 bits (266),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 66/88 (75%), Positives = 80/88 (91%), Gaps = 0/88 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQ FVAYVNVGCYY+VGVP+G++LGFYF LGAKGIW GM+GGT+MQT+IL+WV
Sbjct  418  GVAVGCGWQAFVAYVNVGCYYIVGVPLGSLLGFYFKLGAKGIWLGMLGGTLMQTLILIWV  477

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREPLL  281
            T RT+W KEVE A++RL +WD K++PLL
Sbjct  478  TTRTNWNKEVEKARERLEKWDDKKQPLL  505



>ref|XP_006351961.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Solanum tuberosum]
Length=512

 Score =   107 bits (266),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 66/90 (73%), Positives = 77/90 (86%), Gaps = 0/90 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQ FVAYVN+GCYY+VGVP+G +LGFYF LGAKGIW GM+GGTVMQTIIL+W+
Sbjct  423  GVAVGCGWQAFVAYVNIGCYYIVGVPLGVLLGFYFKLGAKGIWSGMLGGTVMQTIILIWI  482

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREPLLPK  275
            T RTDW KEVE A+ RL  WD K+E +L +
Sbjct  483  TARTDWNKEVESAQSRLKMWDDKKESILEE  512



>gb|EEC75604.1| hypothetical protein OsI_12313 [Oryza sativa Indica Group]
Length=500

 Score =   106 bits (265),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 66/91 (73%), Positives = 77/91 (85%), Gaps = 0/91 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQ  VAY+NVGCYY VG+P+G +LGF F+LGAKGIW GM+GGT MQT+IL W+
Sbjct  407  GVAVGCGWQKIVAYINVGCYYFVGIPLGFLLGFKFHLGAKGIWTGMLGGTCMQTLILFWI  466

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREPLLPKT  272
            T RTDW KEVE AKKRLNQW+ K++PLL  T
Sbjct  467  TFRTDWNKEVEEAKKRLNQWEDKKQPLLAGT  497



>ref|NP_001050520.1| Os03g0570800 [Oryza sativa Japonica Group]
 gb|ABF97202.1| MATE efflux family protein, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF12434.1| Os03g0570800 [Oryza sativa Japonica Group]
 dbj|BAG95165.1| unnamed protein product [Oryza sativa Japonica Group]
Length=500

 Score =   106 bits (265),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 66/91 (73%), Positives = 77/91 (85%), Gaps = 0/91 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQ  VAY+NVGCYY VG+P+G +LGF F+LGAKGIW GM+GGT MQT+IL W+
Sbjct  407  GVAVGCGWQKIVAYINVGCYYFVGIPLGFLLGFKFHLGAKGIWTGMLGGTCMQTLILFWI  466

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREPLLPKT  272
            T RTDW KEVE AKKRLNQW+ K++PLL  T
Sbjct  467  TFRTDWNKEVEEAKKRLNQWEDKKQPLLAGT  497



>ref|XP_002518492.1| multidrug resistance pump, putative [Ricinus communis]
 gb|EEF43879.1| multidrug resistance pump, putative [Ricinus communis]
Length=497

 Score =   106 bits (265),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 66/88 (75%), Positives = 78/88 (89%), Gaps = 0/88 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQ FVAYVNVGCYY++GVP+G +LGF F+LGAKGIW GMIGGT +QT+IL+WV
Sbjct  408  GVAVGCGWQAFVAYVNVGCYYLIGVPLGVLLGFKFDLGAKGIWSGMIGGTFLQTLILIWV  467

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREPLL  281
            T RTDW KEVE A++RLN W+ K+EPLL
Sbjct  468  TYRTDWNKEVEKARQRLNSWEDKKEPLL  495



>emb|CDM86677.1| unnamed protein product [Triticum aestivum]
Length=495

 Score =   106 bits (265),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 70/89 (79%), Positives = 77/89 (87%), Gaps = 1/89 (1%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQ FVAYVNVGCYY+VGVP+G +LGF FN G KG+W GMIGGT MQT ILLWV
Sbjct  400  GVAVGCGWQQFVAYVNVGCYYIVGVPLGVLLGFVFNFGVKGLWGGMIGGTAMQTAILLWV  459

Query  364  TIRTDWVKEVEVAKKRLNQW-DAKREPLL  281
            TIRTDW KEVE A+KRLN+W D K+EPLL
Sbjct  460  TIRTDWSKEVEEAQKRLNKWDDTKKEPLL  488



>ref|XP_002279487.1| PREDICTED: protein TRANSPARENT TESTA 12 [Vitis vinifera]
Length=507

 Score =   106 bits (265),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 66/88 (75%), Positives = 79/88 (90%), Gaps = 0/88 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQ FVAYVNVGCYY+VGVP+G++LGFYF LGAKGIW GM+GGT+MQT IL+WV
Sbjct  418  GVAVGCGWQAFVAYVNVGCYYIVGVPLGSLLGFYFKLGAKGIWLGMLGGTLMQTFILIWV  477

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREPLL  281
            T RT+W KEVE AK+R+ +WD K++PLL
Sbjct  478  TARTNWNKEVEKAKERMEKWDDKKQPLL  505



>gb|EMT13253.1| Protein TRANSPARENT TESTA 12 [Aegilops tauschii]
Length=498

 Score =   106 bits (265),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 70/89 (79%), Positives = 77/89 (87%), Gaps = 1/89 (1%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQ FVAYVNVGCYY+VGVP+G +LGF FN G KG+W GMIGGT MQT ILLWV
Sbjct  403  GVAVGCGWQQFVAYVNVGCYYIVGVPLGVLLGFVFNFGVKGLWGGMIGGTAMQTAILLWV  462

Query  364  TIRTDWVKEVEVAKKRLNQW-DAKREPLL  281
            TIRTDW KEVE A+KRLN+W D K+EPLL
Sbjct  463  TIRTDWSKEVEEAQKRLNKWDDTKKEPLL  491



>emb|CDP11781.1| unnamed protein product [Coffea canephora]
Length=427

 Score =   105 bits (263),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 64/85 (75%), Positives = 78/85 (92%), Gaps = 0/85 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQ FVAYVNVGCYY+VG+P+G+VLGFYF LGAKG+W GM+GGT+MQTIILLWV
Sbjct  343  GVAVGCGWQAFVAYVNVGCYYLVGIPLGSVLGFYFQLGAKGLWSGMLGGTIMQTIILLWV  402

Query  364  TIRTDWVKEVEVAKKRLNQWDAKRE  290
            TIRTDW+KEVE A +RL++W+  ++
Sbjct  403  TIRTDWIKEVEAALRRLDKWEVLKD  427



>gb|ACL53378.1| unknown [Zea mays]
 tpg|DAA40988.1| TPA: LOW QUALITY PROTEIN: putative MATE efflux family protein 
[Zea mays]
Length=462

 Score =   106 bits (264),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 69/89 (78%), Positives = 78/89 (88%), Gaps = 1/89 (1%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGM-IGGTVMQTIILLW  368
            GVAVGCGWQ FVAYVNVGCYYVVGVP+G  LGFY +LGAKGIW GM IGGT+MQT+ILLW
Sbjct  373  GVAVGCGWQAFVAYVNVGCYYVVGVPLGVFLGFYLDLGAKGIWSGMVIGGTMMQTLILLW  432

Query  367  VTIRTDWVKEVEVAKKRLNQWDAKREPLL  281
            VT RTDW KEVE A+ RL++WD K++PLL
Sbjct  433  VTFRTDWTKEVENARARLDKWDDKKQPLL  461



>emb|CAN73203.1| hypothetical protein VITISV_008169 [Vitis vinifera]
Length=265

 Score =   104 bits (259),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 66/89 (74%), Positives = 78/89 (88%), Gaps = 0/89 (0%)
 Frame = -2

Query  547  PGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLW  368
             GVAVGCGWQ FVAYVNVGCYY+VGVP+G++LGFYF LGAKGIW GM+GGT+MQT IL+W
Sbjct  175  SGVAVGCGWQAFVAYVNVGCYYIVGVPLGSLLGFYFKLGAKGIWLGMLGGTLMQTFILIW  234

Query  367  VTIRTDWVKEVEVAKKRLNQWDAKREPLL  281
            VT RT+W KEVE AK+R  +WD K++PLL
Sbjct  235  VTARTNWNKEVEKAKERXEKWDDKKQPLL  263



>emb|CBI28937.3| unnamed protein product [Vitis vinifera]
Length=543

 Score =   107 bits (266),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 66/88 (75%), Positives = 80/88 (91%), Gaps = 0/88 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQ FVAYVNVGCYY+VGVP+G++LGFYF LGAKGIW GM+GGT+MQT+IL+WV
Sbjct  454  GVAVGCGWQAFVAYVNVGCYYIVGVPLGSLLGFYFKLGAKGIWLGMLGGTLMQTLILIWV  513

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREPLL  281
            T RT+W KEVE A++RL +WD K++PLL
Sbjct  514  TTRTNWNKEVEKARERLEKWDDKKQPLL  541



>ref|XP_004515070.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Cicer 
arietinum]
Length=512

 Score =   106 bits (264),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 67/90 (74%), Positives = 78/90 (87%), Gaps = 0/90 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQTFVAYVNVGCYY +G+P+GAVLGFYF LGAKGIW GM+GG +MQTIILLWV
Sbjct  423  GVAVGCGWQTFVAYVNVGCYYGIGIPLGAVLGFYFKLGAKGIWLGMLGGVIMQTIILLWV  482

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREPLLPK  275
            T RTDW KEVE + KRLN+W+ + E L+ +
Sbjct  483  TFRTDWNKEVEESNKRLNKWEDRTETLIKE  512



>ref|XP_008670448.1| PREDICTED: LOW QUALITY PROTEIN: protein TRANSPARENT TESTA 12 
[Zea mays]
 gb|ACL54543.1| unknown [Zea mays]
Length=512

 Score =   106 bits (264),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 69/89 (78%), Positives = 78/89 (88%), Gaps = 1/89 (1%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGM-IGGTVMQTIILLW  368
            GVAVGCGWQ FVAYVNVGCYYVVGVP+G  LGFY +LGAKGIW GM IGGT+MQT+ILLW
Sbjct  423  GVAVGCGWQAFVAYVNVGCYYVVGVPLGVFLGFYLDLGAKGIWSGMVIGGTMMQTLILLW  482

Query  367  VTIRTDWVKEVEVAKKRLNQWDAKREPLL  281
            VT RTDW KEVE A+ RL++WD K++PLL
Sbjct  483  VTFRTDWTKEVENARARLDKWDDKKQPLL  511



>ref|XP_011096076.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Sesamum indicum]
Length=509

 Score =   106 bits (264),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 65/88 (74%), Positives = 77/88 (88%), Gaps = 0/88 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQ+FVA +NVGCYY+VG+P+G +LGF FNLG KGIW GMIGGT+MQT+ILLWV
Sbjct  420  GVAVGCGWQSFVACINVGCYYMVGIPIGCLLGFKFNLGVKGIWSGMIGGTMMQTLILLWV  479

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREPLL  281
            T RTDW KEVE A+KRL++W+   EPLL
Sbjct  480  TFRTDWNKEVEKARKRLDKWEEITEPLL  507



>ref|XP_006389633.1| hypothetical protein POPTR_0021s00820g [Populus trichocarpa]
 gb|ERP48547.1| hypothetical protein POPTR_0021s00820g [Populus trichocarpa]
Length=501

 Score =   106 bits (264),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 67/88 (76%), Positives = 77/88 (88%), Gaps = 0/88 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQ FVAYVNVGCYY++GVP+G +LGF F+LG KGIW GM+GGTV+QT+ILLWV
Sbjct  412  GVAVGCGWQAFVAYVNVGCYYLIGVPLGVLLGFTFDLGVKGIWSGMLGGTVLQTLILLWV  471

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREPLL  281
            T RTDW  EVEVAK RL+ WD KR+PLL
Sbjct  472  TWRTDWNTEVEVAKNRLSSWDDKRQPLL  499



>ref|XP_009357445.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Pyrus x bretschneideri]
Length=508

 Score =   106 bits (264),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 68/88 (77%), Positives = 77/88 (88%), Gaps = 0/88 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQ FVAYVNVGCYYVVG+P G VLGF F+LGA+GIW GMIGGT+MQT+ILLWV
Sbjct  419  GVAVGCGWQAFVAYVNVGCYYVVGIPCGCVLGFVFDLGAEGIWSGMIGGTLMQTLILLWV  478

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREPLL  281
            T RTDW KEVE AK R+ +WD K++PLL
Sbjct  479  TFRTDWDKEVENAKSRVEKWDDKKQPLL  506



>ref|XP_007149972.1| hypothetical protein PHAVU_005G115000g [Phaseolus vulgaris]
 gb|ESW21966.1| hypothetical protein PHAVU_005G115000g [Phaseolus vulgaris]
Length=507

 Score =   106 bits (264),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 65/88 (74%), Positives = 77/88 (88%), Gaps = 0/88 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQ FVAYVNVGCYY VG+P+G++LGFYF+ GAKGIW GM+GGT MQT+IL+WV
Sbjct  419  GVAVGCGWQAFVAYVNVGCYYGVGLPLGSLLGFYFDFGAKGIWLGMLGGTAMQTVILIWV  478

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREPLL  281
            T RTDW KEVE A KRL+ W+ K+EP+L
Sbjct  479  TFRTDWNKEVEEAAKRLSIWEDKKEPVL  506



>ref|XP_004515071.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Cicer 
arietinum]
Length=510

 Score =   105 bits (263),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 67/90 (74%), Positives = 78/90 (87%), Gaps = 0/90 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQTFVAYVNVGCYY +G+P+GAVLGFYF LGAKGIW GM+GG +MQTIILLWV
Sbjct  421  GVAVGCGWQTFVAYVNVGCYYGIGIPLGAVLGFYFKLGAKGIWLGMLGGVIMQTIILLWV  480

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREPLLPK  275
            T RTDW KEVE + KRLN+W+ + E L+ +
Sbjct  481  TFRTDWNKEVEESNKRLNKWEDRTETLIKE  510



>ref|XP_004982537.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Setaria italica]
Length=512

 Score =   105 bits (263),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 66/88 (75%), Positives = 80/88 (91%), Gaps = 1/88 (1%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQ FVAYVNVGCYY+VG+P+G +LGFYF+LGA GIW GMIGGT+MQT+IL+WV
Sbjct  424  GVAVGCGWQAFVAYVNVGCYYIVGIPLGCLLGFYFDLGAAGIWSGMIGGTLMQTLILIWV  483

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREPLL  281
            T RT+WVKEVE A+KRLN+W+ ++ PLL
Sbjct  484  TFRTNWVKEVEEAQKRLNKWE-EKSPLL  510



>ref|XP_002886501.1| mate efflux family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH62760.1| mate efflux family protein [Arabidopsis lyrata subsp. lyrata]
Length=501

 Score =   105 bits (263),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 68/90 (76%), Positives = 78/90 (87%), Gaps = 0/90 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQ FVAYVN+GCYYVVG+PVG VLGF F++GAKGIW GMIGGT+MQTIIL+ V
Sbjct  412  GVAVGCGWQAFVAYVNIGCYYVVGIPVGFVLGFTFDMGAKGIWTGMIGGTLMQTIILVIV  471

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREPLLPK  275
            T+RTDW KEVE A  RL+QW+  REPLL +
Sbjct  472  TLRTDWDKEVEKASSRLDQWEESREPLLKQ  501



>gb|KHN21236.1| Protein TRANSPARENT TESTA 12 [Glycine soja]
Length=517

 Score =   105 bits (263),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 67/88 (76%), Positives = 77/88 (88%), Gaps = 0/88 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQTFVAYVNVGCYY +G+P+G+VLGFYF L AKGIW GM+GGTV+QTIIL+WV
Sbjct  428  GVAVGCGWQTFVAYVNVGCYYGIGIPLGSVLGFYFKLSAKGIWLGMLGGTVLQTIILVWV  487

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREPLL  281
            T  TDW KEVE A KRLN+W+ K EPL+
Sbjct  488  TFGTDWNKEVEEAAKRLNKWEDKTEPLV  515



>dbj|BAM34459.1| multidrug and toxic compound extrusion-type transporter, partial 
[Nicotiana alata]
 dbj|BAM34460.1| multidrug and toxic compound extrusion-type transporter, partial 
[Nicotiana langsdorffii]
Length=164

 Score =   101 bits (251),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 67/81 (83%), Positives = 74/81 (91%), Gaps = 0/81 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQTFVAYVNVGCYY VG+PVG +LGF F+LGAKGIW GMIGGT+MQTIILLWV
Sbjct  82   GVAVGCGWQTFVAYVNVGCYYGVGIPVGCLLGFKFDLGAKGIWTGMIGGTMMQTIILLWV  141

Query  364  TIRTDWVKEVEVAKKRLNQWD  302
            T RTDW KEVE AKKRL++W+
Sbjct  142  TFRTDWNKEVESAKKRLDKWE  162



>ref|XP_009590301.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Nicotiana 
tomentosiformis]
Length=488

 Score =   105 bits (262),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 67/90 (74%), Positives = 80/90 (89%), Gaps = 1/90 (1%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQTFVAYVNVGCYY+VGVP+G++LGFYF LGAKGIW GM+GGT+MQT+IL+WV
Sbjct  399  GVAVGCGWQTFVAYVNVGCYYIVGVPLGSLLGFYFKLGAKGIWSGMMGGTLMQTVILVWV  458

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREPLLPK  275
            T RTDW KEVE A+ RLN+W+  + P +PK
Sbjct  459  TFRTDWNKEVEAAQGRLNKWEDNKGP-VPK  487



>ref|XP_004982535.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Setaria italica]
Length=499

 Score =   105 bits (262),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 72/89 (81%), Positives = 78/89 (88%), Gaps = 1/89 (1%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQ FVAYVN+GCYYVVGVP+GA+LGF F LG KGIW GMIGGTVMQT ILLWV
Sbjct  404  GVAVGCGWQQFVAYVNIGCYYVVGVPLGALLGFVFKLGVKGIWGGMIGGTVMQTAILLWV  463

Query  364  TIRTDWVKEVEVAKKRLNQW-DAKREPLL  281
            T+RTDW KEVE A+KRLN+W D K EPLL
Sbjct  464  TLRTDWSKEVEEAQKRLNKWEDKKTEPLL  492



>ref|XP_008455435.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Cucumis melo]
Length=510

 Score =   105 bits (262),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 68/85 (80%), Positives = 76/85 (89%), Gaps = 0/85 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQ FVAYVNVGCYYVVG+P+GA+LGFYF LGAKGIW GMIGGT MQT+IL+WV
Sbjct  421  GVAVGCGWQAFVAYVNVGCYYVVGIPLGALLGFYFKLGAKGIWVGMIGGTFMQTVILIWV  480

Query  364  TIRTDWVKEVEVAKKRLNQWDAKRE  290
            T RTDW KEVE + KRLN+WD K+E
Sbjct  481  TYRTDWNKEVEESMKRLNKWDDKQE  505



>ref|XP_010488189.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Camelina sativa]
Length=188

 Score =   101 bits (252),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 63/89 (71%), Positives = 75/89 (84%), Gaps = 0/89 (0%)
 Frame = -2

Query  547  PGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLW  368
             GVAVGCGWQTFVA VNVGCYYV+G+P+GA+ GFY+N GAKGIW GMIGGTV+QT IL W
Sbjct  98   SGVAVGCGWQTFVAKVNVGCYYVIGIPLGALFGFYYNFGAKGIWTGMIGGTVIQTFILAW  157

Query  367  VTIRTDWVKEVEVAKKRLNQWDAKREPLL  281
            VT RTDW KEVE A KR+++W  K++ L+
Sbjct  158  VTFRTDWTKEVEEASKRMDKWSDKKQELV  186



>ref|XP_010466422.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Camelina sativa]
Length=506

 Score =   105 bits (262),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 63/90 (70%), Positives = 77/90 (86%), Gaps = 0/90 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQTFVA VNVGCYYV+G+P+GA+ GFY+N GAKGIW GMIGGTV+QT IL WV
Sbjct  417  GVAVGCGWQTFVAKVNVGCYYVIGIPLGALFGFYYNFGAKGIWTGMIGGTVIQTFILAWV  476

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREPLLPK  275
            T RTDW KEVE A KR+++W  K++ ++P+
Sbjct  477  TFRTDWTKEVEEASKRMDKWSNKKQEVVPE  506



>ref|XP_009590300.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Nicotiana 
tomentosiformis]
Length=513

 Score =   105 bits (262),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 67/90 (74%), Positives = 80/90 (89%), Gaps = 1/90 (1%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQTFVAYVNVGCYY+VGVP+G++LGFYF LGAKGIW GM+GGT+MQT+IL+WV
Sbjct  424  GVAVGCGWQTFVAYVNVGCYYIVGVPLGSLLGFYFKLGAKGIWSGMMGGTLMQTVILVWV  483

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREPLLPK  275
            T RTDW KEVE A+ RLN+W+  + P +PK
Sbjct  484  TFRTDWNKEVEAAQGRLNKWEDNKGP-VPK  512



>ref|XP_010923890.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Elaeis guineensis]
Length=523

 Score =   105 bits (262),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 66/88 (75%), Positives = 77/88 (88%), Gaps = 0/88 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQTFVAYVNV CYY+VGVP+G +LGF FN GAKGIW GMIGGT+MQT+ILLWV
Sbjct  432  GVAVGCGWQTFVAYVNVTCYYLVGVPLGILLGFKFNFGAKGIWSGMIGGTLMQTVILLWV  491

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREPLL  281
            T RTDW KEV+ A KRL++W+ K++ LL
Sbjct  492  TFRTDWNKEVDQALKRLDKWEDKKQHLL  519



>dbj|BAH20308.1| AT1G61890 [Arabidopsis thaliana]
Length=294

 Score =   103 bits (256),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 67/90 (74%), Positives = 78/90 (87%), Gaps = 0/90 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQ FVAYVN+GCYYVVG+PVG VLGF +++GAKGIW GMIGGT+MQTIIL+ V
Sbjct  205  GVAVGCGWQAFVAYVNIGCYYVVGIPVGFVLGFTYDMGAKGIWTGMIGGTLMQTIILVIV  264

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREPLLPK  275
            T+RTDW KEVE A  RL+QW+  REPLL +
Sbjct  265  TLRTDWDKEVEKASSRLDQWEESREPLLKQ  294



>gb|EMS63519.1| Protein TRANSPARENT TESTA 12 [Triticum urartu]
Length=498

 Score =   104 bits (260),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 69/89 (78%), Positives = 77/89 (87%), Gaps = 1/89 (1%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQ FVAYVNVGCYY+VGVP+G +LGF FN G KG+W GMIGGT +QT ILLWV
Sbjct  403  GVAVGCGWQQFVAYVNVGCYYIVGVPLGVLLGFVFNFGVKGLWGGMIGGTAIQTAILLWV  462

Query  364  TIRTDWVKEVEVAKKRLNQW-DAKREPLL  281
            TIRTDW KEVE A+KRLN+W D K+EPLL
Sbjct  463  TIRTDWSKEVEEAQKRLNKWDDTKKEPLL  491



>gb|KDP20758.1| hypothetical protein JCGZ_21229 [Jatropha curcas]
Length=506

 Score =   105 bits (261),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 68/87 (78%), Positives = 76/87 (87%), Gaps = 0/87 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQ FVAYVNVGCYY+VG+PVG VLGF F+ GAKGIW GMIGGTVMQTIILLWV
Sbjct  417  GVAVGCGWQAFVAYVNVGCYYLVGIPVGCVLGFKFDFGAKGIWSGMIGGTVMQTIILLWV  476

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREPL  284
            T RTDW+KEVE AK RL++WD  ++ L
Sbjct  477  TFRTDWIKEVEKAKMRLDKWDDDKQTL  503



>ref|XP_009790570.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Nicotiana sylvestris]
Length=500

 Score =   104 bits (260),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 67/87 (77%), Positives = 76/87 (87%), Gaps = 0/87 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQ FVAYVNVGCYY VG+P+G +LGF F+LGAKGIW GMIGGTVMQT+ILLWV
Sbjct  411  GVAVGCGWQAFVAYVNVGCYYGVGIPLGCLLGFKFDLGAKGIWTGMIGGTVMQTVILLWV  470

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREPL  284
            T RTDW KEVE AKKRL++W+  + PL
Sbjct  471  TFRTDWNKEVECAKKRLDKWENLKGPL  497



>ref|XP_011005125.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Populus euphratica]
Length=401

 Score =   103 bits (257),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 66/88 (75%), Positives = 77/88 (88%), Gaps = 0/88 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQ FVAYVNVGCYYVVG+P+G++ GFYFNLGAKGIW GMIGG V++T+ILLWV
Sbjct  313  GVAVGCGWQGFVAYVNVGCYYVVGIPLGSLFGFYFNLGAKGIWSGMIGGVVLRTVILLWV  372

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREPLL  281
            T RTDW KEV+ A KRL  W+ K+EPL+
Sbjct  373  TCRTDWNKEVQEALKRLETWEGKKEPLV  400



>ref|XP_009108539.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Brassica rapa]
 ref|XP_009108540.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Brassica rapa]
 ref|XP_009108541.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Brassica rapa]
Length=502

 Score =   104 bits (260),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 67/87 (77%), Positives = 76/87 (87%), Gaps = 0/87 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQ FVAYVNVGCYY+VG+PVG +LGF FN  AKGIW GMIGGT+MQT+ILL+V
Sbjct  414  GVAVGCGWQAFVAYVNVGCYYIVGIPVGCILGFTFNFQAKGIWTGMIGGTLMQTLILLYV  473

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREPL  284
            T RTDW KEVE A+KRL+ WD K+EPL
Sbjct  474  TYRTDWDKEVEKARKRLDMWDDKKEPL  500



>emb|CDX76391.1| BnaA08g10090D [Brassica napus]
Length=502

 Score =   104 bits (260),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 67/87 (77%), Positives = 76/87 (87%), Gaps = 0/87 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQ FVAYVNVGCYY+VG+PVG +LGF FN  AKGIW GMIGGT+MQT+ILL+V
Sbjct  414  GVAVGCGWQAFVAYVNVGCYYIVGIPVGCILGFTFNFQAKGIWTGMIGGTLMQTLILLYV  473

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREPL  284
            T RTDW KEVE A+KRL+ WD K+EPL
Sbjct  474  TYRTDWDKEVEKARKRLDMWDDKKEPL  500



>ref|XP_006858199.1| hypothetical protein AMTR_s00062p00172410 [Amborella trichopoda]
 gb|ERN19666.1| hypothetical protein AMTR_s00062p00172410 [Amborella trichopoda]
Length=461

 Score =   103 bits (258),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 67/87 (77%), Positives = 74/87 (85%), Gaps = 0/87 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQ FVAYVNVGCYY VGVP G +LGFYFNLGA GIW GMIGGT+MQTIIL WV
Sbjct  371  GVAVGCGWQAFVAYVNVGCYYFVGVPFGCLLGFYFNLGAMGIWSGMIGGTLMQTIILTWV  430

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREPL  284
            T+RTDW KEVE A++RLN+W  K+  L
Sbjct  431  TLRTDWSKEVETAQQRLNKWGDKQPAL  457



>ref|NP_564787.1| MATE efflux family protein [Arabidopsis thaliana]
 gb|AAK17168.1|AF325100_1 unknown protein [Arabidopsis thaliana]
 gb|AAC28507.1| EST gb|T04691 comes from this gene [Arabidopsis thaliana]
 gb|AAL14417.1| At1g61890/F8K4_9 [Arabidopsis thaliana]
 gb|AEE33899.1| MATE efflux family protein [Arabidopsis thaliana]
Length=501

 Score =   104 bits (259),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 67/90 (74%), Positives = 78/90 (87%), Gaps = 0/90 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQ FVAYVN+GCYYVVG+PVG VLGF +++GAKGIW GMIGGT+MQTIIL+ V
Sbjct  412  GVAVGCGWQAFVAYVNIGCYYVVGIPVGFVLGFTYDMGAKGIWTGMIGGTLMQTIILVIV  471

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREPLLPK  275
            T+RTDW KEVE A  RL+QW+  REPLL +
Sbjct  472  TLRTDWDKEVEKASSRLDQWEESREPLLKQ  501



>emb|CDY34833.1| BnaA09g47590D [Brassica napus]
Length=459

 Score =   103 bits (258),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 65/90 (72%), Positives = 78/90 (87%), Gaps = 0/90 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQ FVAYVN+GCYY+VG+P+G VLGF +++GAKGIW GMIGGT+MQTIILL V
Sbjct  370  GVAVGCGWQAFVAYVNIGCYYIVGIPIGYVLGFTYDMGAKGIWTGMIGGTLMQTIILLIV  429

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREPLLPK  275
            TIRTDW KEVE A +RL+QW+  + PLL +
Sbjct  430  TIRTDWDKEVETASRRLDQWEGSQAPLLKQ  459



>gb|KJB57730.1| hypothetical protein B456_009G178100 [Gossypium raimondii]
Length=499

 Score =   104 bits (259),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 65/87 (75%), Positives = 79/87 (91%), Gaps = 0/87 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQ FVAYVNVGCYYVVG+P+G VLGF ++LGAKGIW GMIGGT+MQT+ILLWV
Sbjct  410  GVAVGCGWQAFVAYVNVGCYYVVGIPLGCVLGFKYDLGAKGIWSGMIGGTMMQTLILLWV  469

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREPL  284
            T  TDW KEVE+A++RL++W+ K++PL
Sbjct  470  TFTTDWNKEVEIARRRLDRWEDKKQPL  496



>emb|CDY47166.1| BnaA01g22920D [Brassica napus]
Length=501

 Score =   104 bits (259),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 67/90 (74%), Positives = 78/90 (87%), Gaps = 0/90 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQ FVAYVN+GCYYVVG+PVG VLGF +++GAKGIW GMIGGT+MQTIIL+ V
Sbjct  412  GVAVGCGWQAFVAYVNIGCYYVVGIPVGFVLGFTYDMGAKGIWTGMIGGTLMQTIILVVV  471

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREPLLPK  275
            T+RTDW KEVE A  RL+QW+  REPLL +
Sbjct  472  TLRTDWDKEVEKASSRLDQWEESREPLLKQ  501



>ref|XP_009105791.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Brassica rapa]
Length=501

 Score =   104 bits (259),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 66/90 (73%), Positives = 78/90 (87%), Gaps = 0/90 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQ FVAYVN+GCYYVVG+P+G VLGF +++GAKGIW GMIGGT+MQTIIL+ V
Sbjct  412  GVAVGCGWQAFVAYVNIGCYYVVGIPIGFVLGFTYDMGAKGIWTGMIGGTLMQTIILVVV  471

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREPLLPK  275
            T+RTDW KEVE A  RL+QW+  REPLL +
Sbjct  472  TLRTDWDKEVEKASSRLDQWEESREPLLKQ  501



>ref|XP_004295265.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Fragaria vesca 
subsp. vesca]
Length=509

 Score =   104 bits (259),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 65/90 (72%), Positives = 77/90 (86%), Gaps = 0/90 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQ FVAYVNVGCYY++G+P+G VLGF F+ GA+GIW GMIGGT +QT+ILLWV
Sbjct  417  GVAVGCGWQAFVAYVNVGCYYIIGIPLGCVLGFKFDFGAQGIWSGMIGGTFIQTLILLWV  476

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREPLLPK  275
            T RTDW KEVE  K RL++WD K+EPLL +
Sbjct  477  TFRTDWKKEVENVKNRLDRWDDKKEPLLTE  506



>ref|XP_008384070.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Malus domestica]
Length=508

 Score =   104 bits (259),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 67/88 (76%), Positives = 76/88 (86%), Gaps = 0/88 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQ FVAYVNVGCYYVVG+P G VLGF F+LGA+GIW GMIGGT+MQT+ILLWV
Sbjct  419  GVAVGCGWQAFVAYVNVGCYYVVGIPCGCVLGFVFDLGAEGIWSGMIGGTLMQTLILLWV  478

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREPLL  281
            T RTDW KEV+ AK R+ +WD K +PLL
Sbjct  479  TFRTDWDKEVDNAKSRVEKWDDKEQPLL  506



>ref|XP_010930104.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Elaeis guineensis]
Length=522

 Score =   104 bits (259),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 65/88 (74%), Positives = 77/88 (88%), Gaps = 0/88 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQ FVAYVNV CYY+VG+P+GA+LGF F+LGAKGIW GMIGGT +QT+IL+WV
Sbjct  431  GVAVGCGWQAFVAYVNVACYYIVGIPLGALLGFKFDLGAKGIWSGMIGGTFIQTLILIWV  490

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREPLL  281
            T RTDW KEV  A KRLN+W+ K++PLL
Sbjct  491  TFRTDWNKEVYEATKRLNKWEDKKQPLL  518



>ref|XP_006406244.1| hypothetical protein EUTSA_v10020869mg [Eutrema salsugineum]
 gb|ESQ47697.1| hypothetical protein EUTSA_v10020869mg [Eutrema salsugineum]
Length=397

 Score =   103 bits (256),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 64/84 (76%), Positives = 73/84 (87%), Gaps = 0/84 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQTFVA VNVGCYY +G+P+GA+LGFYFN GAKGIW GMIGGT++QT+IL WV
Sbjct  308  GVAVGCGWQTFVAKVNVGCYYFIGIPLGALLGFYFNFGAKGIWTGMIGGTLIQTVILAWV  367

Query  364  TIRTDWVKEVEVAKKRLNQWDAKR  293
            T RTDWVKEVE A KRL+ W  K+
Sbjct  368  TFRTDWVKEVEEASKRLDIWSNKK  391



>gb|KJB57728.1| hypothetical protein B456_009G178100 [Gossypium raimondii]
Length=518

 Score =   104 bits (259),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 65/87 (75%), Positives = 79/87 (91%), Gaps = 0/87 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQ FVAYVNVGCYYVVG+P+G VLGF ++LGAKGIW GMIGGT+MQT+ILLWV
Sbjct  429  GVAVGCGWQAFVAYVNVGCYYVVGIPLGCVLGFKYDLGAKGIWSGMIGGTMMQTLILLWV  488

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREPL  284
            T  TDW KEVE+A++RL++W+ K++PL
Sbjct  489  TFTTDWNKEVEIARRRLDRWEDKKQPL  515



>ref|XP_004144495.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Cucumis sativus]
 ref|XP_004159201.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Cucumis sativus]
 gb|KGN43525.1| hypothetical protein Csa_7G043670 [Cucumis sativus]
Length=510

 Score =   104 bits (259),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 69/85 (81%), Positives = 76/85 (89%), Gaps = 0/85 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQ FVAYVNVGCYYVVGVP+GA+LGFYF LGAKGIW GMIGGT MQTIIL+WV
Sbjct  421  GVAVGCGWQAFVAYVNVGCYYVVGVPLGALLGFYFKLGAKGIWLGMIGGTCMQTIILIWV  480

Query  364  TIRTDWVKEVEVAKKRLNQWDAKRE  290
            T RTDW KEVE A KRLN+W+ K++
Sbjct  481  TYRTDWNKEVEEATKRLNKWEDKQQ  505



>ref|XP_007132552.1| hypothetical protein PHAVU_011G104200g [Phaseolus vulgaris]
 gb|ESW04546.1| hypothetical protein PHAVU_011G104200g [Phaseolus vulgaris]
Length=517

 Score =   104 bits (259),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 65/88 (74%), Positives = 77/88 (88%), Gaps = 0/88 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQTFVAYVNVGCYY +G+P+GAV+GFYF   AKGIW GM+GGTV+QT+IL+WV
Sbjct  428  GVAVGCGWQTFVAYVNVGCYYGIGIPLGAVMGFYFKFNAKGIWLGMLGGTVLQTLILMWV  487

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREPLL  281
            T RTDW KEV  A++RLNQW+  +EPLL
Sbjct  488  TFRTDWNKEVVEAERRLNQWEDVKEPLL  515



>ref|XP_010051023.1| PREDICTED: protein TRANSPARENT TESTA 12 [Eucalyptus grandis]
 gb|KCW89409.1| hypothetical protein EUGRSUZ_A01710 [Eucalyptus grandis]
Length=520

 Score =   104 bits (259),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 62/90 (69%), Positives = 77/90 (86%), Gaps = 0/90 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQ FVAY+NVGCYYV+G+P+G++LGFYF LGAKGIW GM+ GT+MQT+IL+W+
Sbjct  431  GVAVGCGWQAFVAYINVGCYYVLGIPLGSLLGFYFRLGAKGIWGGMLAGTIMQTLILMWI  490

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREPLLPK  275
            T RTDW KEVE A KRL++W   +EP L +
Sbjct  491  TFRTDWNKEVEEAMKRLDEWQDNKEPFLKE  520



>ref|XP_010466426.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Camelina sativa]
Length=506

 Score =   103 bits (258),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 62/90 (69%), Positives = 76/90 (84%), Gaps = 0/90 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQTFVA VNVGCYYV+G+P+GA+ GFY+N GAKGIW GMIGGT+ QT IL WV
Sbjct  417  GVAVGCGWQTFVAKVNVGCYYVIGIPLGALFGFYYNFGAKGIWTGMIGGTITQTFILAWV  476

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREPLLPK  275
            T RTDW KEVE A KR+++W  K++ ++P+
Sbjct  477  TFRTDWTKEVEEASKRMDKWSNKKQEVVPE  506



>ref|XP_008441737.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Cucumis melo]
Length=496

 Score =   103 bits (258),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 65/88 (74%), Positives = 75/88 (85%), Gaps = 0/88 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQ FVAYVN+GCYY+VGVP+G +LGFY+  GAKGIW GM+GGT MQTIIL+WV
Sbjct  407  GVAVGCGWQAFVAYVNIGCYYIVGVPLGVLLGFYYKFGAKGIWLGMMGGTCMQTIILIWV  466

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREPLL  281
            T RTDW KEVE + KRLN+WD K+E  L
Sbjct  467  TFRTDWNKEVEESMKRLNKWDVKQESTL  494



>emb|CDY25329.1| BnaC01g29980D [Brassica napus]
Length=501

 Score =   103 bits (257),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 66/90 (73%), Positives = 77/90 (86%), Gaps = 0/90 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQ FVAYVN+GCYYVVG+P+G VLGF +++GAKGIW GMIGGT+MQTIIL+ V
Sbjct  412  GVAVGCGWQAFVAYVNIGCYYVVGIPIGFVLGFTYDMGAKGIWTGMIGGTLMQTIILVIV  471

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREPLLPK  275
            T RTDW KEVE A  RL+QW+  REPLL +
Sbjct  472  TFRTDWDKEVEKASSRLDQWEESREPLLKQ  501



>gb|AAK82541.1| At1g61890/F8K4_9 [Arabidopsis thaliana]
Length=501

 Score =   103 bits (257),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 66/90 (73%), Positives = 78/90 (87%), Gaps = 0/90 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQ FVAYVN+GCYYVVG+PVG VLGF +++GAKGIW GMIGGT+MQTI+L+ V
Sbjct  412  GVAVGCGWQAFVAYVNIGCYYVVGIPVGFVLGFTYDMGAKGIWTGMIGGTLMQTIVLVIV  471

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREPLLPK  275
            T+RTDW KEVE A  RL+QW+  REPLL +
Sbjct  472  TLRTDWDKEVEKASSRLDQWEESREPLLKQ  501



>ref|NP_001147791.1| transparent testa 12 protein [Zea mays]
 gb|ACF88403.1| unknown [Zea mays]
 gb|ACG28718.1| transparent testa 12 protein [Zea mays]
 gb|ACG37262.1| transparent testa 12 protein [Zea mays]
 tpg|DAA62912.1| TPA: putative MATE efflux family protein [Zea mays]
Length=513

 Score =   103 bits (258),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 68/89 (76%), Positives = 78/89 (88%), Gaps = 1/89 (1%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGM-IGGTVMQTIILLW  368
            GVAVGCGWQ FVAYVNVGCYYVVGVP+G  LGFY +LGAKG+W GM IGGT+ QT+ILLW
Sbjct  422  GVAVGCGWQAFVAYVNVGCYYVVGVPLGVFLGFYLDLGAKGVWSGMVIGGTLTQTLILLW  481

Query  367  VTIRTDWVKEVEVAKKRLNQWDAKREPLL  281
            VT+RTDW KEVE AK RL++WD K++PLL
Sbjct  482  VTVRTDWNKEVENAKARLDKWDDKKQPLL  510



>ref|XP_009118179.1| PREDICTED: protein TRANSPARENT TESTA 12 [Brassica rapa]
Length=504

 Score =   103 bits (257),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 65/90 (72%), Positives = 78/90 (87%), Gaps = 0/90 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQ FVAYVN+GCYY+VG+P+G VLGF +++GAKGIW GMIGGT+MQTIILL V
Sbjct  415  GVAVGCGWQAFVAYVNIGCYYIVGIPIGYVLGFTYDMGAKGIWTGMIGGTLMQTIILLIV  474

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREPLLPK  275
            TIRTDW KEVE A +RL+QW+  + PLL +
Sbjct  475  TIRTDWDKEVETASRRLDQWEDSQAPLLKQ  504



>ref|XP_010434104.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Camelina sativa]
Length=508

 Score =   103 bits (257),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 67/86 (78%), Positives = 76/86 (88%), Gaps = 0/86 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQT+VAYVNVGCYY+VG+PVG +LGF FN  AKGIW GMIGGT+MQT+ILL+V
Sbjct  420  GVAVGCGWQTYVAYVNVGCYYIVGIPVGCILGFTFNYQAKGIWTGMIGGTLMQTLILLYV  479

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREP  287
            T RTDW KEVE AKKRL+ WD K+EP
Sbjct  480  TYRTDWDKEVEKAKKRLDMWDEKKEP  505



>ref|XP_008362257.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Malus domestica]
Length=506

 Score =   103 bits (257),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 69/81 (85%), Positives = 74/81 (91%), Gaps = 0/81 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQ FVAYVNVGCYYVVGVP GA+LGFYF LGAKGIW GM+ GT+MQT+ILLWV
Sbjct  424  GVAVGCGWQAFVAYVNVGCYYVVGVPFGALLGFYFKLGAKGIWLGMVWGTLMQTLILLWV  483

Query  364  TIRTDWVKEVEVAKKRLNQWD  302
            TIRTDW KEVE AKKRLN+WD
Sbjct  484  TIRTDWNKEVEEAKKRLNKWD  504



>gb|KHG25345.1| Protein TRANSPARENT TESTA 12 -like protein [Gossypium arboreum]
Length=518

 Score =   103 bits (257),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 66/88 (75%), Positives = 79/88 (90%), Gaps = 0/88 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQ FVAYVNVGCYYVVG+P+G VLGF  +LGAKGIW GMIGGT+MQT+ILLWV
Sbjct  429  GVAVGCGWQAFVAYVNVGCYYVVGIPLGCVLGFKNDLGAKGIWSGMIGGTMMQTLILLWV  488

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREPLL  281
            T  TDW KEVE+A++RL++W+ K++PLL
Sbjct  489  TFTTDWNKEVEIARRRLDRWEDKKQPLL  516



>ref|XP_006391952.1| hypothetical protein EUTSA_v10023417mg [Eutrema salsugineum]
 dbj|BAJ34317.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ29238.1| hypothetical protein EUTSA_v10023417mg [Eutrema salsugineum]
Length=501

 Score =   103 bits (257),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 66/90 (73%), Positives = 77/90 (86%), Gaps = 0/90 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQ FVAYVN+GCYYVVG+P+G VLGF +++GAKGIW GMIGGT+MQTIIL+ V
Sbjct  412  GVAVGCGWQAFVAYVNIGCYYVVGIPIGFVLGFTYDMGAKGIWTGMIGGTLMQTIILVIV  471

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREPLLPK  275
            T RTDW KEVE A  RL+QW+  REPLL +
Sbjct  472  TFRTDWDKEVEKASSRLDQWEESREPLLKQ  501



>gb|AHI48506.1| multidrug and toxic extrusion transporter [Vaccinium corymbosum]
Length=537

 Score =   103 bits (258),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 66/91 (73%), Positives = 77/91 (85%), Gaps = 0/91 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQ FVAYVNVGCYY VG+P+G VLGF F+LGAKGIW GMIGGTV+QT IL+W 
Sbjct  434  GVAVGCGWQAFVAYVNVGCYYFVGLPIGCVLGFKFDLGAKGIWSGMIGGTVLQTAILIWT  493

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREPLLPKT  272
            T +TDW+KEVE AKKRL++WD   +PLL  +
Sbjct  494  TYQTDWIKEVEKAKKRLDKWDDINQPLLKAS  524



>dbj|BAJ34540.1| unnamed protein product [Thellungiella halophila]
Length=505

 Score =   103 bits (257),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 64/84 (76%), Positives = 73/84 (87%), Gaps = 0/84 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQTFVA VNVGCYY +G+P+GA+LGFYFN GAKGIW GMIGGT++QT+IL WV
Sbjct  416  GVAVGCGWQTFVAKVNVGCYYFIGIPLGALLGFYFNFGAKGIWTGMIGGTLIQTVILAWV  475

Query  364  TIRTDWVKEVEVAKKRLNQWDAKR  293
            T RTDWVKEVE A KRL+ W  K+
Sbjct  476  TFRTDWVKEVEEASKRLDIWSNKK  499



>emb|CDY12916.1| BnaA09g13580D [Brassica napus]
Length=501

 Score =   103 bits (257),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 66/90 (73%), Positives = 77/90 (86%), Gaps = 0/90 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQ FVAYVN+GCYYVVG+P+G VLGF +++GAKGIW GMIGGT+MQTIIL+ V
Sbjct  412  GVAVGCGWQAFVAYVNIGCYYVVGIPIGFVLGFTYDMGAKGIWTGMIGGTLMQTIILVIV  471

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREPLLPK  275
            T RTDW KEVE A  RL+QW+  REPLL +
Sbjct  472  TFRTDWDKEVEKASSRLDQWEESREPLLKQ  501



>emb|CDY19507.1| BnaC09g13960D [Brassica napus]
Length=501

 Score =   103 bits (257),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 66/90 (73%), Positives = 77/90 (86%), Gaps = 0/90 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQ FVAYVN+GCYYVVG+P+G VLGF +++GAKGIW GMIGGT+MQTIIL+ V
Sbjct  412  GVAVGCGWQAFVAYVNIGCYYVVGIPIGFVLGFTYDMGAKGIWTGMIGGTLMQTIILVIV  471

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREPLLPK  275
            T RTDW KEVE A  RL+QW+  REPLL +
Sbjct  472  TFRTDWDKEVEKASSRLDQWEESREPLLKQ  501



>ref|XP_009113112.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Brassica rapa]
Length=501

 Score =   103 bits (257),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 65/90 (72%), Positives = 77/90 (86%), Gaps = 0/90 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQ FVAYVN+GCYYVVG+P+G +LGF +++GAKGIW GMIGGT+MQTIIL+ V
Sbjct  412  GVAVGCGWQAFVAYVNIGCYYVVGIPIGFILGFTYDMGAKGIWTGMIGGTLMQTIILVIV  471

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREPLLPK  275
            T RTDW KEVE A  RL+QW+  REPLL +
Sbjct  472  TFRTDWDKEVEKASSRLDQWEESREPLLKQ  501



>ref|XP_011096071.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Sesamum indicum]
Length=512

 Score =   103 bits (257),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 63/85 (74%), Positives = 75/85 (88%), Gaps = 0/85 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQ FVAYVNVG YY +G+P+GAVLGF F LGAKGIW GM+GGT +QTIIL+WV
Sbjct  418  GVAVGCGWQAFVAYVNVGSYYFLGIPLGAVLGFVFKLGAKGIWSGMLGGTALQTIILIWV  477

Query  364  TIRTDWVKEVEVAKKRLNQWDAKRE  290
            T+RTDW KEVE+A+ RLN+W+ K+E
Sbjct  478  TVRTDWNKEVEIARGRLNRWEDKKE  502



>ref|XP_010468355.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Camelina sativa]
Length=438

 Score =   102 bits (255),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 62/90 (69%), Positives = 77/90 (86%), Gaps = 0/90 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQTFVA VNVGCYYV+G+P+GA+ GFY+N GAKGIW GMIGGTV+QT IL WV
Sbjct  349  GVAVGCGWQTFVAKVNVGCYYVIGIPLGALFGFYYNFGAKGIWTGMIGGTVIQTFILAWV  408

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREPLLPK  275
            T RTDW KEVE A KR+++W  +++ ++P+
Sbjct  409  TFRTDWNKEVEEASKRMDKWSNQKQEVVPE  438



>gb|KJB57729.1| hypothetical protein B456_009G178100 [Gossypium raimondii]
Length=357

 Score =   102 bits (253),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 64/86 (74%), Positives = 78/86 (91%), Gaps = 0/86 (0%)
 Frame = -2

Query  541  VAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVT  362
            VAVGCGWQ FVAYVNVGCYYVVG+P+G VLGF ++LGAKGIW GMIGGT+MQT+ILLWVT
Sbjct  269  VAVGCGWQAFVAYVNVGCYYVVGIPLGCVLGFKYDLGAKGIWSGMIGGTMMQTLILLWVT  328

Query  361  IRTDWVKEVEVAKKRLNQWDAKREPL  284
              TDW KEVE+A++RL++W+ K++PL
Sbjct  329  FTTDWNKEVEIARRRLDRWEDKKQPL  354



>ref|XP_004982536.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Setaria italica]
Length=516

 Score =   103 bits (257),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 66/88 (75%), Positives = 78/88 (89%), Gaps = 1/88 (1%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQ FVAYVNVGCYY+VG+P+G +LGFYF+LGA GIWCGMIGGT+MQT+IL+WV
Sbjct  430  GVAVGCGWQAFVAYVNVGCYYIVGIPLGCLLGFYFDLGAAGIWCGMIGGTLMQTLILVWV  489

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREPLL  281
            T RT+W KEVE A KRLN+W+ K  P+L
Sbjct  490  TFRTNWNKEVEEALKRLNKWEDK-SPIL  516



>ref|XP_010052836.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Eucalyptus grandis]
 gb|KCW76955.1| hypothetical protein EUGRSUZ_D01315 [Eucalyptus grandis]
Length=512

 Score =   103 bits (257),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 66/88 (75%), Positives = 78/88 (89%), Gaps = 0/88 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQ FVAYVNVGCYYVVG+P+G +LGF F+LGAKGIW GM+GGT MQT+IL+WV
Sbjct  423  GVAVGCGWQAFVAYVNVGCYYVVGIPIGCILGFKFDLGAKGIWSGMLGGTTMQTLILIWV  482

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREPLL  281
            T RTDW KEVE AK RL++W+ K++PLL
Sbjct  483  TYRTDWNKEVEKAKGRLDKWEDKKKPLL  510



>emb|CBI23253.3| unnamed protein product [Vitis vinifera]
Length=221

 Score =   100 bits (248),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 68/89 (76%), Positives = 78/89 (88%), Gaps = 1/89 (1%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQ FVAY+NVGCYYVVG+P+G VLGF F+LGAKGIW GMIGGTVMQT+IL+WV
Sbjct  131  GVAVGCGWQAFVAYINVGCYYVVGIPLGCVLGFKFDLGAKGIWSGMIGGTVMQTLILVWV  190

Query  364  TIRTDWVKEVEVAKKRLNQW-DAKREPLL  281
            T RTDW KEV  AK+RL++W D + EPLL
Sbjct  191  TYRTDWSKEVGKAKQRLDKWEDKEDEPLL  219



>ref|XP_002867813.1| mate efflux family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH44072.1| mate efflux family protein [Arabidopsis lyrata subsp. lyrata]
Length=507

 Score =   103 bits (256),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 67/87 (77%), Positives = 76/87 (87%), Gaps = 0/87 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQT+VAYVNVGCYYVVG+PVG +LGF F+  AKGIW GMIGGT MQT+ILL+V
Sbjct  419  GVAVGCGWQTYVAYVNVGCYYVVGIPVGCILGFAFDFQAKGIWTGMIGGTFMQTLILLYV  478

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREPL  284
            T RTDW KEVE A+KRL+ WD K+EPL
Sbjct  479  TYRTDWDKEVETARKRLDMWDDKKEPL  505



>ref|XP_009760618.1| PREDICTED: LOW QUALITY PROTEIN: protein TRANSPARENT TESTA 12 
[Nicotiana sylvestris]
Length=504

 Score =   103 bits (256),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 66/89 (74%), Positives = 74/89 (83%), Gaps = 0/89 (0%)
 Frame = -2

Query  550  YPGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILL  371
            + GVAVGCGWQ FVAYVNVGC Y VG+PVG +LGF F+LGAKGIW GMIGGTVMQTIILL
Sbjct  413  FSGVAVGCGWQAFVAYVNVGCNYAVGIPVGCLLGFRFDLGAKGIWTGMIGGTVMQTIILL  472

Query  370  WVTIRTDWVKEVEVAKKRLNQWDAKREPL  284
            W T RTDW KEVE A+ RL++W   +EPL
Sbjct  473  WFTYRTDWNKEVEKARTRLDKWGNVKEPL  501



>ref|XP_009345548.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Pyrus 
x bretschneideri]
Length=455

 Score =   102 bits (254),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 65/88 (74%), Positives = 77/88 (88%), Gaps = 0/88 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQ FVAYVNVGCYYVVG+P G +LGF F+LGA+GIW GMIGGT++QT+ILLWV
Sbjct  366  GVAVGCGWQAFVAYVNVGCYYVVGIPFGCILGFRFDLGAEGIWVGMIGGTLIQTLILLWV  425

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREPLL  281
            T RTDW KEV+ AK R+ +WD K++PLL
Sbjct  426  TFRTDWNKEVDKAKNRVEKWDDKKQPLL  453



>gb|ACF85024.1| unknown [Zea mays]
Length=186

 Score = 99.4 bits (246),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 62/87 (71%), Positives = 76/87 (87%), Gaps = 0/87 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQ  VAYVNVGCYY+VG+P+G +LGFYF+LGA GIW GMIGGT+MQT+IL+WV
Sbjct  99   GVAVGCGWQALVAYVNVGCYYIVGIPLGCLLGFYFDLGAAGIWSGMIGGTLMQTMILVWV  158

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREPL  284
            T RT+W KEVE A+KRLN+W+  + P+
Sbjct  159  TFRTNWNKEVEEAQKRLNKWEDSKAPV  185



>gb|EYU27797.1| hypothetical protein MIMGU_mgv1a004389mg [Erythranthe guttata]
Length=530

 Score =   103 bits (257),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 69/100 (69%), Positives = 78/100 (78%), Gaps = 2/100 (2%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQ +VAYVN+GCYYVVG+P+G +LGF FNLG KGIW GMIGGT MQT+ILLWV
Sbjct  427  GVAVGCGWQAYVAYVNIGCYYVVGIPIGCLLGFKFNLGVKGIWTGMIGGTAMQTLILLWV  486

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREPLLPKT*KRSIHETK  245
            T RTDW KEVE A KRL  WD  +EPLL     + + E K
Sbjct  487  TFRTDWNKEVEKAGKRLAMWDDIKEPLLKY--HKEVEEIK  524



>dbj|BAF47751.1| multi antimicrobial extrusion family protein [Nicotiana tabacum]
Length=500

 Score =   103 bits (256),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 66/87 (76%), Positives = 76/87 (87%), Gaps = 0/87 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQ FVAYVNVGCYY VG+P+G +LGF F+LGAKGIW GMIGGTVMQT+ILLWV
Sbjct  411  GVAVGCGWQAFVAYVNVGCYYGVGIPLGCLLGFKFDLGAKGIWTGMIGGTVMQTVILLWV  470

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREPL  284
            T RTDW K+VE AKKRL++W+  + PL
Sbjct  471  TFRTDWNKKVECAKKRLDKWENLKGPL  497



>emb|CBI23254.3| unnamed protein product [Vitis vinifera]
Length=435

 Score =   102 bits (254),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 68/89 (76%), Positives = 79/89 (89%), Gaps = 1/89 (1%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQ FVAYVNVGCYYVVG+P+G VLGF F+LGAKGIW GMIGGTVMQT+IL+W+
Sbjct  345  GVAVGCGWQAFVAYVNVGCYYVVGIPLGCVLGFKFDLGAKGIWSGMIGGTVMQTLILVWI  404

Query  364  TIRTDWVKEVEVAKKRLNQW-DAKREPLL  281
            T RTDW KEVE AK+RL++W D + +PLL
Sbjct  405  TYRTDWSKEVEKAKQRLDKWEDKEDQPLL  433



>gb|KFK37989.1| hypothetical protein AALP_AA3G055600 [Arabis alpina]
Length=501

 Score =   103 bits (256),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 66/90 (73%), Positives = 77/90 (86%), Gaps = 0/90 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQ FVAYVN+GCYYVVG+P+G VLGF +++GAKGIW GMIGGT+MQTIIL+ V
Sbjct  412  GVAVGCGWQAFVAYVNIGCYYVVGIPIGFVLGFTYDMGAKGIWTGMIGGTLMQTIILVIV  471

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREPLLPK  275
            TIRTDW KEV  A  RL+QW+  REPLL +
Sbjct  472  TIRTDWDKEVAKASSRLDQWEESREPLLKQ  501



>ref|XP_006282889.1| hypothetical protein CARUB_v10007133mg [Capsella rubella]
 gb|EOA15787.1| hypothetical protein CARUB_v10007133mg [Capsella rubella]
Length=504

 Score =   103 bits (256),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 66/86 (77%), Positives = 76/86 (88%), Gaps = 0/86 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQT+VAYVNVGCYY+VG+PVG +LGF FN  AKGIW GMIGG++MQT+ILL+V
Sbjct  416  GVAVGCGWQTYVAYVNVGCYYIVGIPVGCILGFTFNFQAKGIWTGMIGGSLMQTLILLYV  475

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREP  287
            T RTDW KEVE AKKRL+ WD K+EP
Sbjct  476  TYRTDWDKEVEKAKKRLDMWDEKKEP  501



>ref|XP_009361903.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Pyrus 
x bretschneideri]
Length=528

 Score =   103 bits (256),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 65/88 (74%), Positives = 77/88 (88%), Gaps = 0/88 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQ FVAYVNVGCYYVVG+P G +LGF F+LGA+GIW GMIGGT++QT+ILLWV
Sbjct  439  GVAVGCGWQAFVAYVNVGCYYVVGIPFGCILGFRFDLGAEGIWVGMIGGTLIQTLILLWV  498

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREPLL  281
            T RTDW KEV+ AK R+ +WD K++PLL
Sbjct  499  TFRTDWNKEVDKAKNRVEKWDDKKQPLL  526



>ref|XP_006363107.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Solanum tuberosum]
Length=500

 Score =   102 bits (255),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 69/88 (78%), Positives = 75/88 (85%), Gaps = 1/88 (1%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQ FVAYVNVGCYYVVG+P+G VLGFYFNL AKGIW GM+GGT MQTIILLWV
Sbjct  410  GVAVGCGWQAFVAYVNVGCYYVVGIPLGIVLGFYFNLEAKGIWLGMLGGTAMQTIILLWV  469

Query  364  TIRTDWVKEVEVAKKRLNQW-DAKREPL  284
            T RTDW KEVE AK RLN W +  ++PL
Sbjct  470  TFRTDWEKEVEQAKSRLNMWQNNSKKPL  497



>ref|XP_008364096.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X6 [Malus 
domestica]
Length=462

 Score =   102 bits (254),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 65/88 (74%), Positives = 77/88 (88%), Gaps = 0/88 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQ FVAYVNVGCYYVVG+P G VLGF F+LGA+GIW GMIGGT++QT+ILLW+
Sbjct  373  GVAVGCGWQAFVAYVNVGCYYVVGIPFGCVLGFRFDLGAEGIWVGMIGGTLIQTLILLWI  432

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREPLL  281
            T RTDW KEV+ AK R+ +WD K++PLL
Sbjct  433  TFRTDWNKEVDKAKNRVEKWDDKKQPLL  460



>ref|XP_003605914.1| Transparent testa 12 protein [Medicago truncatula]
 gb|AES88111.1| MATE efflux family protein [Medicago truncatula]
 gb|AFK38335.1| unknown [Medicago truncatula]
Length=519

 Score =   102 bits (255),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 66/88 (75%), Positives = 75/88 (85%), Gaps = 0/88 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQTFVAYVNVGCYY +G+P+GAVLGFYF  GAKGIW GM+GGTV+QTIIL+WV
Sbjct  430  GVAVGCGWQTFVAYVNVGCYYGLGIPLGAVLGFYFKFGAKGIWLGMLGGTVLQTIILMWV  489

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREPLL  281
            T RTDW  EV  + KRLN+W+ K E LL
Sbjct  490  TFRTDWNNEVVESNKRLNKWEGKTESLL  517



>ref|XP_009345546.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009345547.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Pyrus 
x bretschneideri]
Length=528

 Score =   103 bits (256),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 65/88 (74%), Positives = 77/88 (88%), Gaps = 0/88 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQ FVAYVNVGCYYVVG+P G +LGF F+LGA+GIW GMIGGT++QT+ILLWV
Sbjct  439  GVAVGCGWQAFVAYVNVGCYYVVGIPFGCILGFRFDLGAEGIWVGMIGGTLIQTLILLWV  498

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREPLL  281
            T RTDW KEV+ AK R+ +WD K++PLL
Sbjct  499  TFRTDWNKEVDKAKNRVEKWDDKKQPLL  526



>ref|XP_010551032.1| PREDICTED: protein TRANSPARENT TESTA 12 [Tarenaya hassleriana]
Length=506

 Score =   102 bits (255),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 64/87 (74%), Positives = 74/87 (85%), Gaps = 0/87 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            G+AVGCGWQTFVA VNVGCYY+VG+P+GA+ GFYF  GAKGIW GMI GTVMQTIIL WV
Sbjct  415  GMAVGCGWQTFVAKVNVGCYYIVGIPLGALFGFYFKFGAKGIWTGMICGTVMQTIILAWV  474

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREPL  284
            T  TDW KEV++A KRL+QW  ++EPL
Sbjct  475  TFSTDWNKEVDLATKRLDQWSDRKEPL  501



>ref|XP_009614256.1| PREDICTED: LOW QUALITY PROTEIN: protein TRANSPARENT TESTA 12 
[Nicotiana tomentosiformis]
Length=503

 Score =   102 bits (255),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 67/87 (77%), Positives = 75/87 (86%), Gaps = 0/87 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQ FVAYVNVGCYY VG+PVG +LGF F+LGAKGIW GMIGGTVMQTIILLW 
Sbjct  414  GVAVGCGWQAFVAYVNVGCYYGVGIPVGCLLGFKFDLGAKGIWTGMIGGTVMQTIILLWF  473

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREPL  284
            T RTDW KEVE A+ RL++W+  +EPL
Sbjct  474  TYRTDWNKEVEKARTRLDKWENVKEPL  500



>ref|XP_006389632.1| hypothetical protein POPTR_0021s00810g [Populus trichocarpa]
 gb|ERP48546.1| hypothetical protein POPTR_0021s00810g [Populus trichocarpa]
Length=501

 Score =   102 bits (255),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 67/90 (74%), Positives = 77/90 (86%), Gaps = 0/90 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQ FVAYVNVGCYY++G+P+G +LGF F+LGAKGIW GM+GGTV+QT+ILL V
Sbjct  412  GVAVGCGWQAFVAYVNVGCYYLIGIPLGVLLGFTFDLGAKGIWSGMLGGTVLQTLILLGV  471

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREPLLPK  275
            T RTDW KEVE AK RL+ WD K EPLL K
Sbjct  472  TWRTDWNKEVEGAKNRLSTWDDKSEPLLQK  501



>ref|XP_010510483.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Camelina sativa]
Length=517

 Score =   102 bits (255),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 61/90 (68%), Positives = 76/90 (84%), Gaps = 0/90 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQTFVA VN+GCYYV+G+P+GA+ GFY+N GAKGIW GMIGGTV+QT IL WV
Sbjct  428  GVAVGCGWQTFVAKVNIGCYYVIGIPLGALFGFYYNFGAKGIWTGMIGGTVIQTFILAWV  487

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREPLLPK  275
            T RTDW KE E A KR+++W  K++ ++P+
Sbjct  488  TFRTDWTKEEEEASKRMDKWSNKKQEVVPE  517



>ref|XP_006297470.1| hypothetical protein CARUB_v10013491mg [Capsella rubella]
 gb|EOA30368.1| hypothetical protein CARUB_v10013491mg [Capsella rubella]
Length=507

 Score =   102 bits (254),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 62/90 (69%), Positives = 76/90 (84%), Gaps = 0/90 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQTFVA VNVGCYY++G+P+GA+ GFY+N GAKGIW GMIGGTV+QT IL WV
Sbjct  418  GVAVGCGWQTFVAKVNVGCYYIIGIPLGALFGFYYNFGAKGIWTGMIGGTVIQTFILAWV  477

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREPLLPK  275
            T RTDW KEVE A KRL++W  K++ ++ +
Sbjct  478  TFRTDWTKEVEEASKRLDKWSNKKQDVVSE  507



>emb|CDY27431.1| BnaC03g64710D [Brassica napus]
Length=507

 Score =   102 bits (254),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 68/85 (80%), Positives = 76/85 (89%), Gaps = 0/85 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQTFVAYVNVGCYYVVG+P+G VLGF FNL AKGIW GMIGGT+MQT+ILL+V
Sbjct  419  GVAVGCGWQTFVAYVNVGCYYVVGIPIGCVLGFTFNLQAKGIWTGMIGGTLMQTLILLYV  478

Query  364  TIRTDWVKEVEVAKKRLNQWDAKRE  290
            T RTDW KEVE AKKRL+ WD K++
Sbjct  479  TYRTDWDKEVEKAKKRLDMWDDKKD  503



>ref|XP_009108536.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Brassica 
rapa]
 ref|XP_009108538.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Brassica 
rapa]
Length=507

 Score =   102 bits (254),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 68/85 (80%), Positives = 76/85 (89%), Gaps = 0/85 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQTFVAYVNVGCYYVVG+P+G VLGF FNL AKGIW GMIGGT+MQT+ILL+V
Sbjct  419  GVAVGCGWQTFVAYVNVGCYYVVGIPIGCVLGFTFNLQAKGIWTGMIGGTLMQTLILLYV  478

Query  364  TIRTDWVKEVEVAKKRLNQWDAKRE  290
            T RTDW KEVE AKKRL+ WD K++
Sbjct  479  TYRTDWDKEVEKAKKRLDMWDDKKD  503



>ref|XP_008364093.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X3 [Malus 
domestica]
Length=531

 Score =   102 bits (255),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 65/88 (74%), Positives = 77/88 (88%), Gaps = 0/88 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQ FVAYVNVGCYYVVG+P G VLGF F+LGA+GIW GMIGGT++QT+ILLW+
Sbjct  442  GVAVGCGWQAFVAYVNVGCYYVVGIPFGCVLGFRFDLGAEGIWVGMIGGTLIQTLILLWI  501

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREPLL  281
            T RTDW KEV+ AK R+ +WD K++PLL
Sbjct  502  TFRTDWNKEVDKAKNRVEKWDDKKQPLL  529



>ref|XP_008230071.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Prunus mume]
Length=518

 Score =   102 bits (254),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 67/87 (77%), Positives = 74/87 (85%), Gaps = 0/87 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQ FVAYVNVGCYY+VGVP GA+LGFYF  GAKGIW GM+ GT+MQTIIL+WV
Sbjct  431  GVAVGCGWQAFVAYVNVGCYYLVGVPFGALLGFYFKCGAKGIWLGMMAGTLMQTIILIWV  490

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREPL  284
            T RTDW KEVE A KRLN+W   +EPL
Sbjct  491  TYRTDWKKEVEEAAKRLNKWGKVKEPL  517



>ref|XP_009398220.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Musa acuminata 
subsp. malaccensis]
Length=524

 Score =   102 bits (255),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 67/88 (76%), Positives = 74/88 (84%), Gaps = 0/88 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQ FVAYVNVGCYY+VGVP G +LGF F LG KGIWCG+I GTV QT+ILL V
Sbjct  436  GVAVGCGWQAFVAYVNVGCYYIVGVPAGCLLGFKFGLGVKGIWCGLIAGTVNQTLILLVV  495

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREPLL  281
            T RTDW KEVE AKKRL++W+ K EPLL
Sbjct  496  TFRTDWNKEVEEAKKRLDKWEEKEEPLL  523



>ref|XP_008364094.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X4 [Malus 
domestica]
Length=528

 Score =   102 bits (255),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 65/88 (74%), Positives = 77/88 (88%), Gaps = 0/88 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQ FVAYVNVGCYYVVG+P G VLGF F+LGA+GIW GMIGGT++QT+ILLW+
Sbjct  439  GVAVGCGWQAFVAYVNVGCYYVVGIPFGCVLGFRFDLGAEGIWVGMIGGTLIQTLILLWI  498

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREPLL  281
            T RTDW KEV+ AK R+ +WD K++PLL
Sbjct  499  TFRTDWNKEVDKAKNRVEKWDDKKQPLL  526



>ref|XP_008364092.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Malus 
domestica]
Length=535

 Score =   102 bits (255),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 65/88 (74%), Positives = 77/88 (88%), Gaps = 0/88 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQ FVAYVNVGCYYVVG+P G VLGF F+LGA+GIW GMIGGT++QT+ILLW+
Sbjct  446  GVAVGCGWQAFVAYVNVGCYYVVGIPFGCVLGFRFDLGAEGIWVGMIGGTLIQTLILLWI  505

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREPLL  281
            T RTDW KEV+ AK R+ +WD K++PLL
Sbjct  506  TFRTDWNKEVDKAKNRVEKWDDKKQPLL  533



>ref|XP_002273739.2| PREDICTED: protein TRANSPARENT TESTA 12 [Vitis vinifera]
Length=509

 Score =   102 bits (254),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 68/89 (76%), Positives = 79/89 (89%), Gaps = 1/89 (1%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQ FVAYVNVGCYYVVG+P+G VLGF F+LGAKGIW GMIGGTVMQT+IL+W+
Sbjct  419  GVAVGCGWQAFVAYVNVGCYYVVGIPLGCVLGFKFDLGAKGIWSGMIGGTVMQTLILVWI  478

Query  364  TIRTDWVKEVEVAKKRLNQW-DAKREPLL  281
            T RTDW KEVE AK+RL++W D + +PLL
Sbjct  479  TYRTDWSKEVEKAKQRLDKWEDKEDQPLL  507



>emb|CDY07257.1| BnaC04g19140D [Brassica napus]
Length=327

 Score =   100 bits (250),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 64/90 (71%), Positives = 78/90 (87%), Gaps = 0/90 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQ FVAYVN+GCYYVVG+P+G VLGF +++GAKGIW GMIGGT+MQTIIL+ V
Sbjct  238  GVAVGCGWQAFVAYVNIGCYYVVGIPIGFVLGFTYDMGAKGIWTGMIGGTLMQTIILVVV  297

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREPLLPK  275
            T++TDW KEVE +  RL+QW+  REPLL +
Sbjct  298  TLKTDWDKEVEKSSSRLDQWEESREPLLKQ  327



>emb|CDP04390.1| unnamed protein product [Coffea canephora]
Length=434

 Score =   101 bits (252),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 65/88 (74%), Positives = 76/88 (86%), Gaps = 0/88 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQ +VAYVNVGCYYVVG+P+G +LGF + LGAKGIW GMIGGT+MQT+IL+W 
Sbjct  345  GVAVGCGWQAYVAYVNVGCYYVVGIPLGCLLGFKYKLGAKGIWSGMIGGTMMQTLILVWS  404

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREPLL  281
            T RTDW KEVE A++RL  WD K+EPLL
Sbjct  405  TFRTDWNKEVEKARERLRTWDDKKEPLL  432



>ref|XP_008364091.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Malus 
domestica]
Length=538

 Score =   102 bits (255),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 65/88 (74%), Positives = 77/88 (88%), Gaps = 0/88 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQ FVAYVNVGCYYVVG+P G VLGF F+LGA+GIW GMIGGT++QT+ILLW+
Sbjct  449  GVAVGCGWQAFVAYVNVGCYYVVGIPFGCVLGFRFDLGAEGIWVGMIGGTLIQTLILLWI  508

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREPLL  281
            T RTDW KEV+ AK R+ +WD K++PLL
Sbjct  509  TFRTDWNKEVDKAKNRVEKWDDKKQPLL  536



>ref|NP_567640.1| MATE efflux family protein [Arabidopsis thaliana]
 ref|NP_974588.1| MATE efflux family protein [Arabidopsis thaliana]
 gb|AAL06895.1| AT4g21910/T8O5_120 [Arabidopsis thaliana]
 gb|AAM91351.1| At4g21910/T8O5_120 [Arabidopsis thaliana]
 dbj|BAH19610.1| AT4G21910 [Arabidopsis thaliana]
 gb|AEE84526.1| MATE efflux family protein [Arabidopsis thaliana]
 gb|AEE84527.1| MATE efflux family protein [Arabidopsis thaliana]
Length=507

 Score =   102 bits (254),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 67/87 (77%), Positives = 77/87 (89%), Gaps = 0/87 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQT+VAYVNVGCYYVVG+PVG +LGF F+  AKGIW GMIGGT+MQT+ILL+V
Sbjct  419  GVAVGCGWQTYVAYVNVGCYYVVGIPVGCILGFTFDFQAKGIWTGMIGGTLMQTLILLYV  478

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREPL  284
            T RTDW KEVE A+KRL+ WD K+EPL
Sbjct  479  TYRTDWDKEVEKARKRLDLWDDKKEPL  505



>emb|CDX94063.1| BnaC07g36970D [Brassica napus]
Length=507

 Score =   102 bits (253),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 67/87 (77%), Positives = 76/87 (87%), Gaps = 0/87 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQTFVAYVNVGCYYV+G+P+G VLGF FNL AKGIW GMIGGT+MQT+ILL+V
Sbjct  419  GVAVGCGWQTFVAYVNVGCYYVIGIPIGCVLGFTFNLQAKGIWTGMIGGTLMQTLILLYV  478

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREPL  284
            T RTDW KEVE A+KRL+ WD K+  L
Sbjct  479  TYRTDWDKEVEKARKRLDMWDDKKNSL  505



>gb|KCW76952.1| hypothetical protein EUGRSUZ_D01312 [Eucalyptus grandis]
Length=397

 Score =   100 bits (250),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 65/88 (74%), Positives = 77/88 (88%), Gaps = 0/88 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQ FVAYVNVGCYYVVG+P+G +LGF F+LGAKGIW GMIGGT +QT+IL+WV
Sbjct  308  GVAVGCGWQAFVAYVNVGCYYVVGIPIGCILGFKFDLGAKGIWSGMIGGTALQTLILIWV  367

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREPLL  281
            T R DW KEVE AK RL++W+ K++PLL
Sbjct  368  TYRADWNKEVEKAKGRLDKWEDKKKPLL  395



>dbj|BAH19969.1| AT4G21910 [Arabidopsis thaliana]
Length=509

 Score =   102 bits (253),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 67/87 (77%), Positives = 77/87 (89%), Gaps = 0/87 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQT+VAYVNVGCYYVVG+PVG +LGF F+  AKGIW GMIGGT+MQT+ILL+V
Sbjct  421  GVAVGCGWQTYVAYVNVGCYYVVGIPVGCILGFTFDFQAKGIWTGMIGGTLMQTLILLYV  480

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREPL  284
            T RTDW KEVE A+KRL+ WD K+EPL
Sbjct  481  TYRTDWDKEVEKARKRLDLWDDKKEPL  507



>ref|NP_974587.1| MATE efflux family protein [Arabidopsis thaliana]
 gb|AEE84525.1| MATE efflux family protein [Arabidopsis thaliana]
Length=509

 Score =   102 bits (253),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 67/87 (77%), Positives = 77/87 (89%), Gaps = 0/87 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQT+VAYVNVGCYYVVG+PVG +LGF F+  AKGIW GMIGGT+MQT+ILL+V
Sbjct  421  GVAVGCGWQTYVAYVNVGCYYVVGIPVGCILGFTFDFQAKGIWTGMIGGTLMQTLILLYV  480

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREPL  284
            T RTDW KEVE A+KRL+ WD K+EPL
Sbjct  481  TYRTDWDKEVEKARKRLDLWDDKKEPL  507



>ref|XP_010510494.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Camelina sativa]
Length=506

 Score =   102 bits (253),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 60/90 (67%), Positives = 77/90 (86%), Gaps = 0/90 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQT+VA VN+GCYYV+G+P+GA+LGFY+N GAKGIW GMIGGTV+QT IL WV
Sbjct  417  GVAVGCGWQTYVAKVNIGCYYVIGIPLGALLGFYYNFGAKGIWTGMIGGTVIQTFILAWV  476

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREPLLPK  275
            T RTDW KE E A KR+++W  +++ ++P+
Sbjct  477  TFRTDWSKEAEEASKRMDKWSNQKQEVVPE  506



>gb|AAM62936.1| unknown [Arabidopsis thaliana]
Length=507

 Score =   102 bits (253),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 67/87 (77%), Positives = 77/87 (89%), Gaps = 0/87 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQT+VAYVNVGCYYVVG+PVG +LGF F+  AKGIW GMIGGT+MQT+ILL+V
Sbjct  419  GVAVGCGWQTYVAYVNVGCYYVVGIPVGCILGFTFDFQAKGIWTGMIGGTLMQTLILLYV  478

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREPL  284
            T RTDW KEVE A+KRL+ WD K+EPL
Sbjct  479  TYRTDWDKEVEKARKRLDLWDDKKEPL  505



>ref|XP_010054588.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Eucalyptus grandis]
Length=422

 Score =   100 bits (250),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 65/88 (74%), Positives = 77/88 (88%), Gaps = 0/88 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQ FVAYVNVGCYYVVG+P+G +LGF F+LGAKGIW GMIGGT +QT+IL+WV
Sbjct  333  GVAVGCGWQAFVAYVNVGCYYVVGIPIGCILGFKFDLGAKGIWSGMIGGTALQTLILIWV  392

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREPLL  281
            T R DW KEVE AK RL++W+ K++PLL
Sbjct  393  TYRADWNKEVEKAKGRLDKWEDKKKPLL  420



>emb|CAN82750.1| hypothetical protein VITISV_014577 [Vitis vinifera]
Length=398

 Score =   100 bits (250),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 68/89 (76%), Positives = 78/89 (88%), Gaps = 1/89 (1%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQ FVAY+NVGCYYVVG+P+G VLGF F+LGAKGIW GMIGGTVMQT+IL+WV
Sbjct  308  GVAVGCGWQAFVAYINVGCYYVVGIPLGCVLGFKFDLGAKGIWSGMIGGTVMQTLILVWV  367

Query  364  TIRTDWVKEVEVAKKRLNQW-DAKREPLL  281
            T RTDW KEV  AK+RL++W D + EPLL
Sbjct  368  TYRTDWSKEVGKAKQRLDKWEDXEDEPLL  396



>ref|XP_002279276.2| PREDICTED: protein TRANSPARENT TESTA 12 [Vitis vinifera]
 emb|CBI28936.3| unnamed protein product [Vitis vinifera]
Length=515

 Score =   102 bits (253),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 65/90 (72%), Positives = 79/90 (88%), Gaps = 0/90 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQ FVAYVNVGCYY+VGVP+G++LGFYF  GAKGIW G++GGT+MQTIIL+ V
Sbjct  426  GVAVGCGWQAFVAYVNVGCYYIVGVPLGSLLGFYFKHGAKGIWLGLLGGTLMQTIILIVV  485

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREPLLPK  275
             +RTDW KEVE A +RL+QW+ K+EPLL +
Sbjct  486  MVRTDWNKEVEKALERLDQWEDKKEPLLKE  515



>emb|CDY34637.1| BnaC08g41960D [Brassica napus]
Length=459

 Score =   101 bits (251),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 64/90 (71%), Positives = 77/90 (86%), Gaps = 0/90 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQ FVAYVN+GCYY VG+P+G VLGF +++GAKGIW GMIGGT+MQTIILL V
Sbjct  370  GVAVGCGWQAFVAYVNIGCYYFVGIPIGYVLGFTYDMGAKGIWTGMIGGTLMQTIILLIV  429

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREPLLPK  275
            TIRTDW KEVE A +RL++W+  + PLL +
Sbjct  430  TIRTDWDKEVETASRRLDKWEDTQAPLLKQ  459



>ref|XP_006406242.1| hypothetical protein EUTSA_v10020526mg [Eutrema salsugineum]
 gb|ESQ47695.1| hypothetical protein EUTSA_v10020526mg [Eutrema salsugineum]
Length=515

 Score =   101 bits (252),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 65/90 (72%), Positives = 75/90 (83%), Gaps = 0/90 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQTFVA VNVGCYY+VGVP+GA+ GFYF   AKGIW GMI GTVMQT+IL WV
Sbjct  426  GVAVGCGWQTFVAKVNVGCYYIVGVPLGALFGFYFKFDAKGIWTGMICGTVMQTVILAWV  485

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREPLLPK  275
            T RTDWVKEVE A KRL++W  K+  ++P+
Sbjct  486  TFRTDWVKEVEEASKRLDKWSNKKLEVVPE  515



>ref|XP_010430214.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Camelina 
sativa]
 ref|XP_010430215.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Camelina 
sativa]
Length=501

 Score =   101 bits (251),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 65/90 (72%), Positives = 76/90 (84%), Gaps = 0/90 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQ FVAYVN+GCYYVVG+P+G VLGF +++GAKGIW GMIGGT+MQTIIL+ V
Sbjct  412  GVAVGCGWQAFVAYVNIGCYYVVGIPIGFVLGFTYDMGAKGIWTGMIGGTLMQTIILVIV  471

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREPLLPK  275
            T RTDW KEV  A  RL+QW+  REPLL +
Sbjct  472  TFRTDWDKEVAKASSRLDQWEESREPLLKQ  501



>ref|XP_006302163.1| hypothetical protein CARUB_v10020177mg [Capsella rubella]
 gb|EOA35061.1| hypothetical protein CARUB_v10020177mg [Capsella rubella]
Length=501

 Score =   101 bits (251),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 66/90 (73%), Positives = 76/90 (84%), Gaps = 0/90 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQ FVAYVN+GCYYVVG+PVG VLGF +++GAKGIW GMIGGT+MQTIIL+ V
Sbjct  412  GVAVGCGWQAFVAYVNIGCYYVVGIPVGFVLGFTYDMGAKGIWTGMIGGTLMQTIILVIV  471

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREPLLPK  275
            T RTDW KEV  A  RL+QW+  REPLL +
Sbjct  472  TFRTDWDKEVAKASSRLDQWEESREPLLKQ  501



>ref|XP_004232716.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Solanum lycopersicum]
Length=499

 Score =   101 bits (251),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 65/91 (71%), Positives = 76/91 (84%), Gaps = 0/91 (0%)
 Frame = -2

Query  547  PGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLW  368
             GVAVGCGWQ FVAYVNVGCYY VG+P+G +LGF ++LGAKGIW GMIGGTVMQT IL+W
Sbjct  409  SGVAVGCGWQAFVAYVNVGCYYGVGIPLGCLLGFKYDLGAKGIWTGMIGGTVMQTFILIW  468

Query  367  VTIRTDWVKEVEVAKKRLNQWDAKREPLLPK  275
             T RTDW KEVE AK+RL++W+  +EPL  K
Sbjct  469  FTFRTDWNKEVEKAKERLDKWENVKEPLSKK  499



>ref|XP_010418166.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Camelina sativa]
Length=501

 Score =   101 bits (251),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 65/90 (72%), Positives = 76/90 (84%), Gaps = 0/90 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQ FVAYVN+GCYYVVG+P+G VLGF +++GAKGIW GMIGGT+MQTIIL+ V
Sbjct  412  GVAVGCGWQAFVAYVNIGCYYVVGIPIGFVLGFTYDMGAKGIWTGMIGGTLMQTIILVIV  471

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREPLLPK  275
            T RTDW KEV  A  RL+QW+  REPLL +
Sbjct  472  TFRTDWDKEVAKASSRLDQWEESREPLLKQ  501



>ref|XP_010473410.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Camelina sativa]
Length=501

 Score =   101 bits (251),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 65/90 (72%), Positives = 76/90 (84%), Gaps = 0/90 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQ FVAYVN+GCYYVVG+P+G VLGF +++GAKGIW GMIGGT+MQTIIL+ V
Sbjct  412  GVAVGCGWQAFVAYVNIGCYYVVGIPIGFVLGFTYDMGAKGIWTGMIGGTLMQTIILVIV  471

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREPLLPK  275
            T RTDW KEV  A  RL+QW+  REPLL +
Sbjct  472  TFRTDWDKEVAKASSRLDQWEESREPLLKQ  501



>ref|XP_006413712.1| hypothetical protein EUTSA_v10024978mg [Eutrema salsugineum]
 ref|XP_006413713.1| hypothetical protein EUTSA_v10024978mg [Eutrema salsugineum]
 ref|XP_006413714.1| hypothetical protein EUTSA_v10024978mg [Eutrema salsugineum]
 dbj|BAJ34508.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ55165.1| hypothetical protein EUTSA_v10024978mg [Eutrema salsugineum]
 gb|ESQ55166.1| hypothetical protein EUTSA_v10024978mg [Eutrema salsugineum]
 gb|ESQ55167.1| hypothetical protein EUTSA_v10024978mg [Eutrema salsugineum]
Length=502

 Score =   101 bits (251),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 66/87 (76%), Positives = 76/87 (87%), Gaps = 0/87 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQTFVAYVNVGCYY+VG+PVG +LGF FN  AKGIW GMIGGT+MQT+ILL+V
Sbjct  414  GVAVGCGWQTFVAYVNVGCYYIVGIPVGCILGFTFNFQAKGIWTGMIGGTLMQTLILLYV  473

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREPL  284
            T +TDW KEVE A+KRL+ WD K+E L
Sbjct  474  TYQTDWDKEVEKARKRLDMWDDKKESL  500



>emb|CDY27434.1| BnaC03g64740D [Brassica napus]
Length=502

 Score =   101 bits (251),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 66/87 (76%), Positives = 75/87 (86%), Gaps = 0/87 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQ FVAYVNVGCYY+VG+PVG +LG  FN  AKGIW GMIGGT+MQT+ILL+V
Sbjct  414  GVAVGCGWQAFVAYVNVGCYYIVGIPVGCILGSTFNFQAKGIWTGMIGGTLMQTLILLYV  473

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREPL  284
            T RTDW KEVE A+KRL+ WD K+EPL
Sbjct  474  TYRTDWDKEVEKARKRLDMWDDKKEPL  500



>ref|XP_009417226.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Musa acuminata 
subsp. malaccensis]
Length=495

 Score =   101 bits (251),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 63/90 (70%), Positives = 76/90 (84%), Gaps = 0/90 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQ FVAYVNVGCYY VG+P+G +LGF F+LGAKGIW GM+GGT+MQT IL+WV
Sbjct  404  GVAVGCGWQAFVAYVNVGCYYFVGIPLGILLGFKFDLGAKGIWGGMLGGTLMQTFILIWV  463

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREPLLPK  275
            T RTDW KEVE A +RL++W+  ++PLL  
Sbjct  464  TFRTDWNKEVEQAMRRLDKWEDNKQPLLSN  493



>ref|XP_004231608.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Solanum lycopersicum]
Length=504

 Score =   101 bits (251),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 67/87 (77%), Positives = 75/87 (86%), Gaps = 2/87 (2%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQ FVAYVNVGCYYVVG+P+G +LGFYFNL AKGIW GM+GGT MQTIILLWV
Sbjct  414  GVAVGCGWQAFVAYVNVGCYYVVGIPLGILLGFYFNLEAKGIWLGMLGGTAMQTIILLWV  473

Query  364  TIRTDWVKEVEVAKKRLNQW--DAKRE  290
            T RTDW KEVE AK RLN W  ++K++
Sbjct  474  TFRTDWEKEVEQAKSRLNMWQNNSKKQ  500



>emb|CDP17486.1| unnamed protein product [Coffea canephora]
Length=514

 Score =   101 bits (251),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 62/88 (70%), Positives = 75/88 (85%), Gaps = 0/88 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQTFVAYVNVGCYY++G+P+GA+ GFYF  GAKGIW G+I G  +QT+ILLW 
Sbjct  423  GVAVGCGWQTFVAYVNVGCYYLIGIPLGALFGFYFKYGAKGIWIGIISGVFLQTLILLWT  482

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREPLL  281
            T RTDW KEVE+A+KRL  WD +++PLL
Sbjct  483  TFRTDWNKEVEIAQKRLATWDDQKQPLL  510



>ref|XP_007026057.1| MATE efflux family protein [Theobroma cacao]
 gb|EOY28679.1| MATE efflux family protein [Theobroma cacao]
Length=512

 Score =   100 bits (250),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 62/88 (70%), Positives = 76/88 (86%), Gaps = 0/88 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQ FVAYVNVGC+Y VG+P+G VLGF F+ GAKGIW GM+GGTV+QT+IL++V
Sbjct  424  GVAVGCGWQAFVAYVNVGCFYFVGIPLGCVLGFKFDFGAKGIWSGMMGGTVIQTLILMYV  483

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREPLL  281
            T RTDW KEVE  + RL++W+ K+EPLL
Sbjct  484  TFRTDWTKEVEKTRNRLDRWEDKKEPLL  511



>ref|XP_009608373.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Nicotiana tomentosiformis]
 dbj|BAF47752.1| multi antimicrobial extrusion family protein [Nicotiana tabacum]
Length=500

 Score =   100 bits (250),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 65/87 (75%), Positives = 74/87 (85%), Gaps = 0/87 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQ FVAYVNVGCYY VG+P+G +LGF F+ GAKGIW GMIGGTVMQTIILLWV
Sbjct  411  GVAVGCGWQAFVAYVNVGCYYGVGIPLGCLLGFKFDFGAKGIWTGMIGGTVMQTIILLWV  470

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREPL  284
            T  TDW KEVE A+KRL++W+  + PL
Sbjct  471  TFSTDWNKEVESARKRLDKWENLKGPL  497



>ref|XP_002273901.2| PREDICTED: protein TRANSPARENT TESTA 12-like [Vitis vinifera]
Length=508

 Score =   100 bits (250),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 68/89 (76%), Positives = 78/89 (88%), Gaps = 1/89 (1%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQ FVAY+NVGCYYVVG+P+G VLGF F+LGAKGIW GMIGGTVMQT+IL+WV
Sbjct  418  GVAVGCGWQAFVAYINVGCYYVVGIPLGCVLGFKFDLGAKGIWSGMIGGTVMQTLILVWV  477

Query  364  TIRTDWVKEVEVAKKRLNQW-DAKREPLL  281
            T RTDW KEV  AK+RL++W D + EPLL
Sbjct  478  TYRTDWSKEVGKAKQRLDKWEDKEDEPLL  506



>gb|EMT20038.1| Protein TRANSPARENT TESTA 12 [Aegilops tauschii]
Length=456

 Score =   100 bits (248),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 66/88 (75%), Positives = 77/88 (88%), Gaps = 1/88 (1%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            G+AVGCGWQ FVAYVNVGCYYVVGVP+G +LGFYF+LGA GIWCGMIGGT MQT+IL+WV
Sbjct  366  GMAVGCGWQAFVAYVNVGCYYVVGVPLGCLLGFYFDLGAAGIWCGMIGGTFMQTVILVWV  425

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREPLL  281
            TIRT+W  EV  A KRL++W+ K+ PLL
Sbjct  426  TIRTNWDSEVAEAMKRLHKWEDKK-PLL  452



>gb|EEC75606.1| hypothetical protein OsI_12318 [Oryza sativa Indica Group]
Length=520

 Score =   100 bits (250),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 65/90 (72%), Positives = 78/90 (87%), Gaps = 1/90 (1%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQ FVAYVNVGCYY+VG+P+G +LGFYF+LGA GIW GMIGGT+MQT+IL+WV
Sbjct  432  GVAVGCGWQAFVAYVNVGCYYIVGIPLGCLLGFYFDLGAAGIWSGMIGGTLMQTLILMWV  491

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREPLLPK  275
            T RT+W +EVE A KRLN+W+ K  PLL +
Sbjct  492  TFRTNWNREVEEAMKRLNKWEDKT-PLLSE  520



>ref|NP_001149176.1| transparent testa 12 protein [Zea mays]
 gb|ACG34462.1| transparent testa 12 protein [Zea mays]
Length=513

 Score =   100 bits (250),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 62/87 (71%), Positives = 76/87 (87%), Gaps = 0/87 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQ  VAYVNVGCYY+VG+P+G +LGFYF+LGA GIW GMIGGT+MQT+IL+WV
Sbjct  426  GVAVGCGWQALVAYVNVGCYYIVGIPLGCLLGFYFDLGAAGIWSGMIGGTLMQTMILVWV  485

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREPL  284
            T RT+W KEVE A+KRLN+W+  + P+
Sbjct  486  TFRTNWNKEVEEAQKRLNKWEDSKAPV  512



>tpg|DAA50100.1| TPA: putative MATE efflux family protein [Zea mays]
Length=513

 Score =   100 bits (250),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 62/87 (71%), Positives = 76/87 (87%), Gaps = 0/87 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQ  VAYVNVGCYY+VG+P+G +LGFYF+LGA GIW GMIGGT+MQT+IL+WV
Sbjct  426  GVAVGCGWQALVAYVNVGCYYIVGIPLGCLLGFYFDLGAAGIWSGMIGGTLMQTMILVWV  485

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREPL  284
            T RT+W KEVE A+KRLN+W+  + P+
Sbjct  486  TFRTNWNKEVEEAQKRLNKWEDSKAPV  512



>gb|ABF97209.1| MATE efflux family protein, expressed [Oryza sativa Japonica 
Group]
 gb|EEE59385.1| hypothetical protein OsJ_11501 [Oryza sativa Japonica Group]
Length=520

 Score =   100 bits (250),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 65/90 (72%), Positives = 78/90 (87%), Gaps = 1/90 (1%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQ FVAYVNVGCYY+VG+P+G +LGFYF+LGA GIW GMIGGT+MQT+IL+WV
Sbjct  432  GVAVGCGWQAFVAYVNVGCYYIVGIPLGCLLGFYFDLGAAGIWSGMIGGTLMQTLILMWV  491

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREPLLPK  275
            T RT+W +EVE A KRLN+W+ K  PLL +
Sbjct  492  TFRTNWNREVEEAMKRLNKWEDKT-PLLSE  520



>ref|XP_006449717.1| hypothetical protein CICLE_v10014968mg [Citrus clementina]
 gb|ESR62957.1| hypothetical protein CICLE_v10014968mg [Citrus clementina]
Length=397

 Score = 99.4 bits (246),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 63/91 (69%), Positives = 78/91 (86%), Gaps = 0/91 (0%)
 Frame = -2

Query  547  PGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLW  368
             GVAVGCGWQ FVAYVNVGCYY++G+P+G +LGF FNLGAKGIW GMIGGT++QTIIL++
Sbjct  307  SGVAVGCGWQAFVAYVNVGCYYLIGIPIGCLLGFKFNLGAKGIWSGMIGGTLIQTIILVY  366

Query  367  VTIRTDWVKEVEVAKKRLNQWDAKREPLLPK  275
            VT+RTDW KEVE A+ R+++W  K E LL +
Sbjct  367  VTLRTDWNKEVEKARNRMDEWGDKTEQLLKE  397



>ref|XP_010448968.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Camelina 
sativa]
 ref|XP_010448969.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Camelina 
sativa]
Length=508

 Score =   100 bits (249),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 66/86 (77%), Positives = 75/86 (87%), Gaps = 0/86 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQT+VAYVNVGCYY+VG+PVG +LGF FN  AKGIW GMIGGT+MQT+ILL+V
Sbjct  420  GVAVGCGWQTYVAYVNVGCYYIVGIPVGCILGFTFNYQAKGIWTGMIGGTLMQTLILLYV  479

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREP  287
            T RT W KEVE AKKRL+ WD K+EP
Sbjct  480  TYRTAWDKEVEKAKKRLDMWDEKKEP  505



>ref|XP_002464321.1| hypothetical protein SORBIDRAFT_01g016100 [Sorghum bicolor]
 gb|EER91319.1| hypothetical protein SORBIDRAFT_01g016100 [Sorghum bicolor]
Length=503

 Score =   100 bits (249),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 68/90 (76%), Positives = 78/90 (87%), Gaps = 2/90 (2%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQ FVAYVN+GCYY+VGVP+GA+LGF F LG KGIW GMIGGT MQT ILLWV
Sbjct  407  GVAVGCGWQQFVAYVNIGCYYIVGVPLGAILGFVFKLGVKGIWGGMIGGTCMQTAILLWV  466

Query  364  TIRTDWVKEVEVAKKRLNQWDAKR--EPLL  281
            T+RTDW KEVE A+KRL++W+ K+  EPLL
Sbjct  467  TLRTDWNKEVEEAQKRLHKWEDKKTTEPLL  496



>ref|XP_010278701.1| PREDICTED: protein TRANSPARENT TESTA 12 [Nelumbo nucifera]
Length=506

 Score =   100 bits (249),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 65/85 (76%), Positives = 74/85 (87%), Gaps = 0/85 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQ FVAYVNVGCYY VG+P+GA+LGF F+LGAKGIW GMIGGT+MQTIILLWV
Sbjct  415  GVAVGCGWQVFVAYVNVGCYYFVGIPLGALLGFKFDLGAKGIWSGMIGGTLMQTIILLWV  474

Query  364  TIRTDWVKEVEVAKKRLNQWDAKRE  290
              RTDW +EVE A KRLN+W+ K +
Sbjct  475  ACRTDWKREVEEAAKRLNKWEDKHK  499



>emb|CDX98712.1| BnaA03g44970D [Brassica napus]
Length=507

 Score =   100 bits (249),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 67/87 (77%), Positives = 75/87 (86%), Gaps = 0/87 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQ FVAYVNVGCYYVVG+P+G VLGF FNL AKGIW GMIGGT+MQT+ILL+V
Sbjct  419  GVAVGCGWQAFVAYVNVGCYYVVGIPIGCVLGFTFNLQAKGIWTGMIGGTLMQTLILLYV  478

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREPL  284
            T RTDW KEVE A+KRL+ WD K+  L
Sbjct  479  TYRTDWDKEVEKARKRLDMWDDKKNSL  505



>ref|XP_004164859.1| PREDICTED: protein TRANSPARENT TESTA 12-like, partial [Cucumis 
sativus]
Length=398

 Score = 99.0 bits (245),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 63/88 (72%), Positives = 77/88 (88%), Gaps = 0/88 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQ FVAYVN+GCYY+VGVP+G++LGFYFN GAKGIW G++GGT MQT+IL+WV
Sbjct  310  GVAVGCGWQAFVAYVNIGCYYIVGVPLGSLLGFYFNFGAKGIWVGLMGGTFMQTLILVWV  369

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREPLL  281
            T RTDW KEVE A KRL++WD   +P++
Sbjct  370  TWRTDWNKEVEEAIKRLSKWDDTAKPIV  397



>ref|XP_010278702.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Nelumbo 
nucifera]
Length=513

 Score =   100 bits (248),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 69/88 (78%), Positives = 76/88 (86%), Gaps = 0/88 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQ FVAYVNVGCYYVVGVPVG +LGF F+LGAKGIW GMIGGT +QT+IL+WV
Sbjct  424  GVAVGCGWQAFVAYVNVGCYYVVGVPVGVLLGFKFDLGAKGIWSGMIGGTTVQTLILIWV  483

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREPLL  281
            T RT+W KEVE A KRL  WD K+EPLL
Sbjct  484  TYRTNWNKEVEEAMKRLETWDEKKEPLL  511



>ref|XP_006651562.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Oryza brachyantha]
Length=539

 Score =   100 bits (249),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 65/90 (72%), Positives = 78/90 (87%), Gaps = 1/90 (1%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQ FVAYVNVGCYY+VG+P+G +LGFYF+LGA GIW GMIGGT+MQT+IL+WV
Sbjct  451  GVAVGCGWQAFVAYVNVGCYYIVGIPLGCLLGFYFDLGAAGIWSGMIGGTLMQTLILVWV  510

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREPLLPK  275
            T RT+W +EVE A KRLN+W+ K  PLL +
Sbjct  511  TFRTNWNREVEEAMKRLNKWEDK-TPLLSE  539



>ref|XP_010930069.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Elaeis 
guineensis]
Length=523

 Score =   100 bits (249),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 64/88 (73%), Positives = 76/88 (86%), Gaps = 0/88 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQ FVAYVNVGCYY+VG+P+G +LGF FNLGAKGIW GMIGGT +QT+IL+WV
Sbjct  432  GVAVGCGWQAFVAYVNVGCYYIVGIPLGVLLGFKFNLGAKGIWSGMIGGTFIQTLILIWV  491

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREPLL  281
            T RTDW KEV+ A KRLN+W+  ++ LL
Sbjct  492  TFRTDWNKEVDEAIKRLNKWEDNKKALL  519



>ref|NP_001050524.1| Os03g0572900 [Oryza sativa Japonica Group]
 gb|AAS01970.1| putative MATE efflux family protein [Oryza sativa Japonica Group]
 gb|ABF97219.1| MATE efflux family protein, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF12438.1| Os03g0572900 [Oryza sativa Japonica Group]
 dbj|BAG95442.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE59388.1| hypothetical protein OsJ_11504 [Oryza sativa Japonica Group]
Length=500

 Score =   100 bits (248),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 66/89 (74%), Positives = 76/89 (85%), Gaps = 1/89 (1%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQ FVAYVN+GCYY+VGVP+G +LGF F LG KGIW GM+GGT MQT IL+WV
Sbjct  405  GVAVGCGWQQFVAYVNIGCYYIVGVPLGVLLGFVFKLGVKGIWGGMLGGTCMQTAILVWV  464

Query  364  TIRTDWVKEVEVAKKRLNQW-DAKREPLL  281
            T+RTDW  EVE A+KRLN+W D K+EPLL
Sbjct  465  TLRTDWNNEVEEAQKRLNKWEDKKKEPLL  493



>emb|CBI23251.3| unnamed protein product [Vitis vinifera]
Length=431

 Score = 99.4 bits (246),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 67/89 (75%), Positives = 72/89 (81%), Gaps = 0/89 (0%)
 Frame = -2

Query  547  PGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLW  368
             GVAVGCGWQ FVAYVNVGCYYVVG+P+GA+LGF F+LG KGIW GMIGGTVMQT+ILLW
Sbjct  342  SGVAVGCGWQAFVAYVNVGCYYVVGIPLGALLGFKFDLGVKGIWSGMIGGTVMQTLILLW  401

Query  367  VTIRTDWVKEVEVAKKRLNQWDAKREPLL  281
            VT RTDW KEVE AK RL  WD      L
Sbjct  402  VTYRTDWNKEVEKAKSRLETWDTNNSASL  430



>gb|EEC75610.1| hypothetical protein OsI_12322 [Oryza sativa Indica Group]
Length=500

 Score =   100 bits (248),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 66/89 (74%), Positives = 76/89 (85%), Gaps = 1/89 (1%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQ FVAYVN+GCYY+VGVP+G +LGF F LG KGIW GM+GGT MQT IL+WV
Sbjct  405  GVAVGCGWQQFVAYVNIGCYYIVGVPLGVLLGFVFKLGVKGIWGGMLGGTCMQTAILVWV  464

Query  364  TIRTDWVKEVEVAKKRLNQW-DAKREPLL  281
            T+RTDW  EVE A+KRLN+W D K+EPLL
Sbjct  465  TLRTDWNNEVEEAQKRLNKWEDKKKEPLL  493



>ref|XP_006389634.1| hypothetical protein POPTR_0021s00830g [Populus trichocarpa]
 gb|ERP48548.1| hypothetical protein POPTR_0021s00830g [Populus trichocarpa]
Length=486

 Score = 99.8 bits (247),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 63/90 (70%), Positives = 73/90 (81%), Gaps = 0/90 (0%)
 Frame = -2

Query  550  YPGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILL  371
            + GVAVGCGWQ FVAYVNVGCYY +G+P+G V+GF  + G KGIW GMIGGT++QTIILL
Sbjct  395  FTGVAVGCGWQAFVAYVNVGCYYFIGIPLGCVMGFKLDFGVKGIWSGMIGGTLIQTIILL  454

Query  370  WVTIRTDWVKEVEVAKKRLNQWDAKREPLL  281
            WVT RTDW KEVE A  RLN WD  ++PLL
Sbjct  455  WVTFRTDWNKEVEKATNRLNTWDNIKQPLL  484



>ref|XP_006449716.1| hypothetical protein CICLE_v10014968mg [Citrus clementina]
 gb|ESR62956.1| hypothetical protein CICLE_v10014968mg [Citrus clementina]
Length=508

 Score = 99.8 bits (247),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 63/91 (69%), Positives = 78/91 (86%), Gaps = 0/91 (0%)
 Frame = -2

Query  547  PGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLW  368
             GVAVGCGWQ FVAYVNVGCYY++G+P+G +LGF FNLGAKGIW GMIGGT++QTIIL++
Sbjct  418  SGVAVGCGWQAFVAYVNVGCYYLIGIPIGCLLGFKFNLGAKGIWSGMIGGTLIQTIILVY  477

Query  367  VTIRTDWVKEVEVAKKRLNQWDAKREPLLPK  275
            VT+RTDW KEVE A+ R+++W  K E LL +
Sbjct  478  VTLRTDWNKEVEKARNRMDEWGDKTEQLLKE  508



>emb|CDX98713.1| BnaA03g44980D [Brassica napus]
Length=455

 Score = 99.4 bits (246),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 65/85 (76%), Positives = 73/85 (86%), Gaps = 0/85 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQTFVAYVNVGCYY+VG+PVG +LGF FN  AKGIW GMIGGT+MQT+ILL+V
Sbjct  368  GVAVGCGWQTFVAYVNVGCYYIVGIPVGCILGFTFNFQAKGIWTGMIGGTLMQTLILLYV  427

Query  364  TIRTDWVKEVEVAKKRLNQWDAKRE  290
            T RTDW KEVE A+KRL+ WD K  
Sbjct  428  TYRTDWDKEVEKARKRLDMWDDKES  452



>ref|XP_008230142.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Prunus mume]
Length=517

 Score = 99.8 bits (247),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 64/87 (74%), Positives = 73/87 (84%), Gaps = 0/87 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQ FVAYVNVGCYY+VGVP G +LGFYF  GAKGIW GM+ GT+MQT+IL+WV
Sbjct  430  GVAVGCGWQAFVAYVNVGCYYLVGVPFGVLLGFYFKYGAKGIWLGMMAGTLMQTVILIWV  489

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREPL  284
            T RTDW KEVE A KRLN+W+  +E L
Sbjct  490  TYRTDWKKEVEEAAKRLNKWEEVKEQL  516



>gb|AGT17223.1| MATE efflux family protein [Saccharum hybrid cultivar R570]
Length=516

 Score = 99.8 bits (247),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 62/93 (67%), Positives = 76/93 (82%), Gaps = 0/93 (0%)
 Frame = -2

Query  559  NLYYPGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTI  380
             L+ PGVAVGCGWQ  VAY+NVGCYY VG+P+G +LGF F+LGAKGIW GM+GGT MQT+
Sbjct  419  RLWSPGVAVGCGWQKLVAYINVGCYYFVGIPLGILLGFKFHLGAKGIWTGMLGGTCMQTL  478

Query  379  ILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  281
            IL W+T RT+W KEVE  +KRLNQ +  ++PLL
Sbjct  479  ILFWITFRTNWNKEVEEVRKRLNQCEDNKQPLL  511



>ref|XP_009137228.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Brassica rapa]
Length=400

 Score = 98.2 bits (243),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 65/85 (76%), Positives = 73/85 (86%), Gaps = 0/85 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQTFVAYVNVGCYY+VG+PVG +LGF FN  AKGIW GMIGGT+MQT+ILL+V
Sbjct  313  GVAVGCGWQTFVAYVNVGCYYIVGIPVGCILGFTFNFQAKGIWTGMIGGTLMQTLILLYV  372

Query  364  TIRTDWVKEVEVAKKRLNQWDAKRE  290
            T RTDW KEVE A+KRL+ WD K  
Sbjct  373  TYRTDWDKEVEKARKRLDMWDDKES  397



>ref|NP_001142368.1| uncharacterized protein LOC100274540 [Zea mays]
 gb|ACF88316.1| unknown [Zea mays]
Length=448

 Score = 99.0 bits (245),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 67/90 (74%), Positives = 77/90 (86%), Gaps = 2/90 (2%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQ FVAYVN+GCYY+VGVP+GAVLGF F LG KGIW GMIGGT MQT IL+WV
Sbjct  352  GVAVGCGWQQFVAYVNIGCYYIVGVPLGAVLGFVFKLGVKGIWAGMIGGTCMQTAILVWV  411

Query  364  TIRTDWVKEVEVAKKRLNQWDAKR--EPLL  281
            T+RTDW KEVE A+ RL++W+A +  EPLL
Sbjct  412  TLRTDWNKEVEEAQNRLHKWEANKTTEPLL  441



>ref|XP_004144494.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Cucumis sativus]
 gb|KGN43528.1| hypothetical protein Csa_7G044190 [Cucumis sativus]
Length=513

 Score = 99.4 bits (246),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 63/88 (72%), Positives = 77/88 (88%), Gaps = 0/88 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQ FVAYVN+GCYY+VGVP+G++LGFYFN GAKGIW G++GGT MQT+IL+WV
Sbjct  425  GVAVGCGWQAFVAYVNIGCYYIVGVPLGSLLGFYFNFGAKGIWVGLMGGTFMQTLILVWV  484

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREPLL  281
            T RTDW KEVE A KRL++WD   +P++
Sbjct  485  TWRTDWNKEVEEAIKRLSKWDDTAKPIV  512



>ref|XP_006413715.1| hypothetical protein EUTSA_v10024969mg [Eutrema salsugineum]
 gb|ESQ55168.1| hypothetical protein EUTSA_v10024969mg [Eutrema salsugineum]
Length=504

 Score = 99.4 bits (246),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 65/87 (75%), Positives = 75/87 (86%), Gaps = 0/87 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQTFVAYVNVGCYY+VG+PVG +LGF F+  AKGIW GMIGGT+MQT+ILL+V
Sbjct  416  GVAVGCGWQTFVAYVNVGCYYIVGIPVGCILGFTFDFQAKGIWTGMIGGTLMQTLILLYV  475

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREPL  284
            T RTDW KEVE A+ RL+ WD K+E L
Sbjct  476  TYRTDWDKEVEKARTRLDMWDEKKESL  502



>ref|XP_002274027.2| PREDICTED: protein TRANSPARENT TESTA 12 [Vitis vinifera]
Length=504

 Score = 99.4 bits (246),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 67/89 (75%), Positives = 72/89 (81%), Gaps = 0/89 (0%)
 Frame = -2

Query  547  PGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLW  368
             GVAVGCGWQ FVAYVNVGCYYVVG+P+GA+LGF F+LG KGIW GMIGGTVMQT+ILLW
Sbjct  415  SGVAVGCGWQAFVAYVNVGCYYVVGIPLGALLGFKFDLGVKGIWSGMIGGTVMQTLILLW  474

Query  367  VTIRTDWVKEVEVAKKRLNQWDAKREPLL  281
            VT RTDW KEVE AK RL  WD      L
Sbjct  475  VTYRTDWNKEVEKAKSRLETWDTNNSASL  503



>ref|XP_008224821.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Prunus mume]
Length=513

 Score = 99.4 bits (246),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 64/86 (74%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQ FVAYVNVGCYYV+G+P+G +LGF F+LGA+GIW GMIGGT MQTIILLWV
Sbjct  422  GVAVGCGWQAFVAYVNVGCYYVLGIPIGCLLGFKFDLGAEGIWSGMIGGTFMQTIILLWV  481

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREP  287
            T RTDW KEVE A  RL +W+ K+ P
Sbjct  482  TFRTDWNKEVETAGNRLKKWEDKKLP  507



>ref|XP_011048007.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Populus 
euphratica]
Length=514

 Score = 99.0 bits (245),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 64/88 (73%), Positives = 75/88 (85%), Gaps = 0/88 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQ  VAYVNVGCYYVVG+P G ++GF F+LG KGIW GMIGGT++QT+ILLWV
Sbjct  426  GVAVGCGWQASVAYVNVGCYYVVGIPFGCLMGFKFDLGVKGIWSGMIGGTLLQTLILLWV  485

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREPLL  281
            T RTDW KEVE AK RL++W+ KR+P L
Sbjct  486  TFRTDWRKEVEKAKSRLHKWEDKRKPSL  513



>gb|EMT14886.1| Protein TRANSPARENT TESTA 12 [Aegilops tauschii]
Length=400

 Score = 97.8 bits (242),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 60/88 (68%), Positives = 76/88 (86%), Gaps = 0/88 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQ  VAY+N+GCYY +GVP+GA+LGF F+ G KG+W GMIGGT++QTIILLW+
Sbjct  308  GVAVGCGWQALVAYINIGCYYFIGVPLGALLGFKFDYGIKGLWGGMIGGTLIQTIILLWI  367

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREPLL  281
            T RTDW KEVE A++RL++WD  ++PLL
Sbjct  368  TFRTDWNKEVEEARRRLDKWDDAKQPLL  395



>ref|XP_006413716.1| hypothetical protein EUTSA_v10027142mg [Eutrema salsugineum]
 gb|ESQ55169.1| hypothetical protein EUTSA_v10027142mg [Eutrema salsugineum]
Length=508

 Score = 99.0 bits (245),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 64/88 (73%), Positives = 78/88 (89%), Gaps = 0/88 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQTFVAYVNVGCYY+VG+PVG +LGF F+  AKGIW GMIGGT++QT+ILL+V
Sbjct  420  GVAVGCGWQTFVAYVNVGCYYIVGIPVGCILGFTFDFQAKGIWTGMIGGTLLQTLILLYV  479

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREPLL  281
            T RTDW KEV+ A+KRL+ W+ K+EP+L
Sbjct  480  TYRTDWDKEVKKARKRLDIWEDKKEPVL  507



>ref|XP_004293282.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Fragaria vesca 
subsp. vesca]
Length=525

 Score = 99.0 bits (245),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 66/92 (72%), Positives = 77/92 (84%), Gaps = 4/92 (4%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQ FVAYVNVGCYYVVG+P+G VLGF F+LGA+GIW GMIGGT MQTIILLWV
Sbjct  419  GVAVGCGWQAFVAYVNVGCYYVVGIPLGCVLGFKFDLGAQGIWSGMIGGTFMQTIILLWV  478

Query  364  TIRTDWVKEVEVAKKRLNQWD----AKREPLL  281
            T RTDW+KEV  ++ RL +WD     +++PLL
Sbjct  479  TFRTDWIKEVGTSRDRLEKWDDSNKQQQQPLL  510



>ref|XP_004957863.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Setaria italica]
Length=501

 Score = 99.0 bits (245),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 58/88 (66%), Positives = 76/88 (86%), Gaps = 0/88 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQ  VAY+N+GCYY +G+P+G +LGF F+ G KG+W GMIGGT++QT+IL+W+
Sbjct  410  GVAVGCGWQAMVAYINIGCYYFIGLPLGVLLGFKFDFGIKGLWGGMIGGTLIQTLILIWI  469

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREPLL  281
            T+RTDW KEVE A+KRL++WD  R+PLL
Sbjct  470  TLRTDWNKEVEEARKRLDKWDDTRQPLL  497



>ref|XP_006467445.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Citrus 
sinensis]
Length=507

 Score = 99.0 bits (245),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 63/91 (69%), Positives = 78/91 (86%), Gaps = 0/91 (0%)
 Frame = -2

Query  547  PGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLW  368
             GVAVGCGWQ FVAYVNVGCYY++G+P+G +LGF FNLGAKGIW GMIGGT++QTIIL++
Sbjct  417  SGVAVGCGWQAFVAYVNVGCYYLIGIPIGCLLGFKFNLGAKGIWSGMIGGTLIQTIILVY  476

Query  367  VTIRTDWVKEVEVAKKRLNQWDAKREPLLPK  275
            VT+RTDW KEVE A+ R+++W  K E LL +
Sbjct  477  VTLRTDWNKEVEKARNRMDEWGDKTELLLKE  507



>ref|XP_006282967.1| hypothetical protein CARUB_v10007727mg [Capsella rubella]
 gb|EOA15865.1| hypothetical protein CARUB_v10007727mg [Capsella rubella]
Length=505

 Score = 99.0 bits (245),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 65/85 (76%), Positives = 74/85 (87%), Gaps = 0/85 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQT+VAYVNVGCYY+VG+PVG +LGF FN  AKGIW GMIGGT+MQT+ILL+V
Sbjct  416  GVAVGCGWQTYVAYVNVGCYYIVGIPVGCILGFTFNYQAKGIWTGMIGGTLMQTLILLYV  475

Query  364  TIRTDWVKEVEVAKKRLNQWDAKRE  290
            T RTDW KEVE AKKRL+ WD  +E
Sbjct  476  TYRTDWDKEVETAKKRLDMWDDVKE  500



>emb|CDY64933.1| BnaCnng45550D [Brassica napus]
Length=505

 Score = 98.6 bits (244),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 63/90 (70%), Positives = 76/90 (84%), Gaps = 0/90 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQ FVAYVN+GCYY+VG+P+G VLGF +++GAKGIW GMI GT+MQTIILL V
Sbjct  416  GVAVGCGWQAFVAYVNIGCYYIVGIPIGYVLGFTYDMGAKGIWTGMIAGTLMQTIILLIV  475

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREPLLPK  275
            T RTDW KEVE A +RL+QW+  + PLL +
Sbjct  476  TFRTDWDKEVEKASRRLDQWEDTQAPLLKQ  505



>ref|XP_006597580.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Glycine max]
Length=505

 Score = 98.6 bits (244),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 62/86 (72%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQ  VAYVNVGCYY +G+P+G VLGF F LG +GIW GMIGGT++QT+ILLW+
Sbjct  416  GVAVGCGWQAIVAYVNVGCYYGIGIPLGCVLGFTFGLGVQGIWSGMIGGTMLQTLILLWI  475

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREP  287
            T+RTDW KEV  AKKRLN+W  K+EP
Sbjct  476  TLRTDWNKEVNTAKKRLNKWGYKKEP  501



>gb|KHN33034.1| Protein TRANSPARENT TESTA 12 [Glycine soja]
Length=504

 Score = 98.6 bits (244),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 62/86 (72%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQ  VAYVNVGCYY +G+P+G VLGF F LG +GIW GMIGGT++QT+ILLW+
Sbjct  415  GVAVGCGWQAIVAYVNVGCYYGIGIPLGCVLGFTFGLGVQGIWSGMIGGTMLQTLILLWI  474

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREP  287
            T+RTDW KEV  AKKRLN+W  K+EP
Sbjct  475  TLRTDWNKEVNTAKKRLNKWGYKKEP  500



>ref|XP_008455432.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Cucumis melo]
Length=513

 Score = 98.6 bits (244),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 62/88 (70%), Positives = 77/88 (88%), Gaps = 0/88 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQ FVAYVN+GCYY+VGVP+G++LGFYFN GAKGIW G++GGT MQT+IL+WV
Sbjct  425  GVAVGCGWQAFVAYVNIGCYYIVGVPLGSLLGFYFNFGAKGIWVGLMGGTFMQTVILVWV  484

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREPLL  281
            T RTDW KEV+ A KRL++WD   +P++
Sbjct  485  TWRTDWNKEVDEAIKRLSKWDDTAKPVV  512



>ref|XP_009110708.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Brassica rapa]
Length=504

 Score = 98.6 bits (244),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 63/90 (70%), Positives = 76/90 (84%), Gaps = 0/90 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQ FVAYVN+GCYY+VG+P+G VLGF +++GAKGIW GMI GT+MQTIILL V
Sbjct  415  GVAVGCGWQAFVAYVNIGCYYIVGIPIGYVLGFTYDMGAKGIWTGMIAGTLMQTIILLIV  474

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREPLLPK  275
            T RTDW KEVE A +RL+QW+  + PLL +
Sbjct  475  TFRTDWDKEVEKASRRLDQWEDTQAPLLKQ  504



>ref|XP_009137221.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Brassica rapa]
Length=508

 Score = 98.6 bits (244),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 66/87 (76%), Positives = 75/87 (86%), Gaps = 0/87 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQ FVAYVNVGCYYVVG+P+G VLGF FNL AKGIW GMIGGT+MQT+ILL+V
Sbjct  420  GVAVGCGWQAFVAYVNVGCYYVVGIPIGCVLGFTFNLQAKGIWTGMIGGTLMQTLILLYV  479

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREPL  284
            T +TDW KEVE A+KRL+ WD K+  L
Sbjct  480  TYQTDWDKEVEKARKRLDMWDDKKNSL  506



>ref|XP_009135444.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Brassica rapa]
Length=497

 Score = 98.6 bits (244),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 65/84 (77%), Positives = 73/84 (87%), Gaps = 0/84 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQTFVAYVNVGCYY+VG+PVG +LGF FN  AKGIW GMIGGT+MQT+ILL+V
Sbjct  414  GVAVGCGWQTFVAYVNVGCYYIVGIPVGCLLGFTFNFQAKGIWTGMIGGTLMQTLILLYV  473

Query  364  TIRTDWVKEVEVAKKRLNQWDAKR  293
            T RTDW KEVE A KRL+ WD K+
Sbjct  474  TYRTDWDKEVEKANKRLDMWDDKK  497



>ref|XP_011037658.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Populus euphratica]
Length=513

 Score = 98.6 bits (244),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 59/90 (66%), Positives = 74/90 (82%), Gaps = 0/90 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQ FVAYVN+ CYY++G+P+G VLGF  ++GAKGIW GM+GGT+MQTI+LLW 
Sbjct  424  GVAVGCGWQAFVAYVNIACYYIIGIPLGCVLGFTCDMGAKGIWSGMLGGTIMQTIVLLWA  483

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREPLLPK  275
            T RT+W KEVE A  RL+ W+  +EPLL +
Sbjct  484  TFRTNWKKEVEKAHSRLDSWNDNKEPLLKE  513



>emb|CDX79109.1| BnaA01g11760D [Brassica napus]
Length=497

 Score = 98.2 bits (243),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 65/84 (77%), Positives = 73/84 (87%), Gaps = 0/84 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQTFVAYVNVGCYY+VG+PVG +LGF FN  AKGIW GMIGGT+MQT+ILL+V
Sbjct  414  GVAVGCGWQTFVAYVNVGCYYIVGIPVGCLLGFTFNFQAKGIWTGMIGGTLMQTLILLYV  473

Query  364  TIRTDWVKEVEVAKKRLNQWDAKR  293
            T RTDW KEVE A KRL+ WD K+
Sbjct  474  TYRTDWDKEVEKANKRLDMWDDKK  497



>ref|XP_002460773.1| hypothetical protein SORBIDRAFT_02g034720 [Sorghum bicolor]
 gb|EER97294.1| hypothetical protein SORBIDRAFT_02g034720 [Sorghum bicolor]
Length=496

 Score = 98.2 bits (243),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 58/90 (64%), Positives = 76/90 (84%), Gaps = 0/90 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQ  VAY+N+GCYY +G+P+G +LGF F+ G KG+W GMIGGT++QT+IL+W+
Sbjct  405  GVAVGCGWQATVAYINIGCYYFIGIPLGVLLGFKFDFGIKGLWGGMIGGTLIQTLILIWI  464

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREPLLPK  275
            T+RTDW KEVE A+KRL++WD  R+PLL  
Sbjct  465  TLRTDWNKEVEEARKRLDKWDDTRQPLLAS  494



>ref|XP_006417328.1| hypothetical protein EUTSA_v10007409mg [Eutrema salsugineum]
 gb|ESQ35681.1| hypothetical protein EUTSA_v10007409mg [Eutrema salsugineum]
Length=507

 Score = 98.2 bits (243),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 63/90 (70%), Positives = 76/90 (84%), Gaps = 0/90 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQ FVAYVN+GCYY+VG+P+G VLGF +++GA GIW GMIGGT+MQTIILL V
Sbjct  418  GVAVGCGWQAFVAYVNIGCYYIVGIPIGYVLGFTYDMGAMGIWTGMIGGTLMQTIILLIV  477

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREPLLPK  275
            T RTDW KEVE A +RL+QW+  + PLL +
Sbjct  478  TFRTDWDKEVEKASRRLDQWEDTQAPLLKQ  507



>gb|AGT17221.1| transparent testa 12 protein [Saccharum hybrid cultivar R570]
Length=524

 Score = 98.6 bits (244),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 64/98 (65%), Positives = 78/98 (80%), Gaps = 10/98 (10%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQ FVAYVNVGCYY+VG+P+G +LGFYF+LGA GIW GMIGGT MQT+IL+WV
Sbjct  423  GVAVGCGWQAFVAYVNVGCYYIVGIPLGCLLGFYFDLGAAGIWSGMIGGTFMQTLILVWV  482

Query  364  TIRTDWVKEVEV----------AKKRLNQWDAKREPLL  281
            T RT+W KEV++          A+KRLN+W+  + PLL
Sbjct  483  TYRTNWTKEVQIAITYSNLVEEAQKRLNKWNDSKAPLL  520



>dbj|BAD95082.1| hypothetical protein [Arabidopsis thaliana]
Length=219

 Score = 95.1 bits (235),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 62/90 (69%), Positives = 77/90 (86%), Gaps = 1/90 (1%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQ +VAYVN+GCYY+VG+P+G VLGF +++GA+GIW GMIGGT+MQTIIL+ V
Sbjct  131  GVAVGCGWQAYVAYVNIGCYYIVGIPIGYVLGFTYDMGARGIWTGMIGGTLMQTIILVIV  190

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREPLLPK  275
            T RTDWVKEVE A +RL+QW+    PLL +
Sbjct  191  TFRTDWVKEVEKASRRLDQWE-DTSPLLKQ  219



>gb|KDO78209.1| hypothetical protein CISIN_1g010561mg [Citrus sinensis]
Length=397

 Score = 97.1 bits (240),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 62/91 (68%), Positives = 77/91 (85%), Gaps = 0/91 (0%)
 Frame = -2

Query  547  PGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLW  368
             GVAVGCGWQ FVAYVNVGCYY++G+P+G +LGF FNLG KGIW GMIGGT++QTIIL++
Sbjct  307  SGVAVGCGWQAFVAYVNVGCYYLIGIPIGCLLGFKFNLGTKGIWSGMIGGTLIQTIILVY  366

Query  367  VTIRTDWVKEVEVAKKRLNQWDAKREPLLPK  275
            VT+RTDW KEVE A+ R+++W  K E LL +
Sbjct  367  VTLRTDWNKEVEKARNRMDEWGDKTELLLKE  397



>ref|XP_010237714.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Brachypodium distachyon]
Length=496

 Score = 98.2 bits (243),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 59/90 (66%), Positives = 75/90 (83%), Gaps = 0/90 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQ  VAY+N+GCYY +GVP+G +LGF F+ G KG+W GMIGGT++QTIILLW+
Sbjct  405  GVAVGCGWQALVAYINIGCYYFIGVPLGVLLGFKFDYGIKGLWGGMIGGTLIQTIILLWI  464

Query  364  TIRTDWVKEVEVAKKRLNQWDAKREPLLPK  275
            T RTDW KEVE A++RL++WD  ++PLL  
Sbjct  465  TFRTDWNKEVEEARRRLDKWDEAKQPLLAN  494



>ref|XP_008224820.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Prunus mume]
Length=523

 Score = 98.2 bits (243),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 65/85 (76%), Positives = 73/85 (86%), Gaps = 0/85 (0%)
 Frame = -2

Query  544  GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWV  365
            GVAVGCGWQ FVAYVNVGCYYVVG+P+G +LGF F+LGAKGIW GMIGGT+MQTIILLWV
Sbjct  422  GVAVGCGWQAFVAYVNVGCYYVVGIPLGCLLGFKFDLGAKGIWTGMIGGTLMQTIILLWV  481

Query  364  TIRTDWVKEVEVAKKRLNQWDAKRE  290
            T RTDW KEV  A  RL +WD ++E
Sbjct  482  TFRTDWNKEVGTAINRLEKWDDRQE  506



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 644970849880