BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF010D18

Length=763
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|ACN31997.1|  unknown                                                 300   4e-99   Zea mays [maize]
ref|NP_001105391.1|  40S ribosomal protein S8                           300   4e-99   Zea mays [maize]
ref|NP_001046866.1|  Os02g0489400                                       299   1e-98   
ref|XP_002446216.1|  hypothetical protein SORBIDRAFT_06g004770          299   1e-98   Sorghum bicolor [broomcorn]
ref|NP_001052526.1|  Os04g0349500                                       299   1e-98   
ref|XP_010097296.1|  40S ribosomal protein S8                           298   2e-98   
gb|EAY93669.1|  hypothetical protein OsI_15456                          298   4e-98   Oryza sativa Indica Group [Indian rice]
ref|NP_001132384.1|  uncharacterized protein LOC100193830               298   4e-98   Zea mays [maize]
ref|XP_008679872.1|  PREDICTED: 40S ribosomal protein S8-like           301   4e-98   
dbj|BAA07207.1|  ribosomal protein S8                                   298   5e-98   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006652189.1|  PREDICTED: 40S ribosomal protein S8-like           297   7e-98   
ref|XP_002452585.1|  hypothetical protein SORBIDRAFT_04g028530          296   2e-97   Sorghum bicolor [broomcorn]
ref|XP_006648644.1|  PREDICTED: 40S ribosomal protein S8-like           295   4e-97   
ref|XP_010483522.1|  PREDICTED: 40S ribosomal protein S8-2-like         292   8e-96   Camelina sativa [gold-of-pleasure]
gb|KHG08050.1|  40S ribosomal S8                                        290   3e-95   Gossypium arboreum [tree cotton]
ref|XP_010454644.1|  PREDICTED: 40S ribosomal protein S8-2              289   1e-94   Camelina sativa [gold-of-pleasure]
ref|XP_004953910.1|  PREDICTED: 40S ribosomal protein S8-like           288   3e-94   Setaria italica
ref|XP_004242427.1|  PREDICTED: 40S ribosomal protein S8                288   4e-94   Solanum lycopersicum
ref|XP_006373483.1|  hypothetical protein POPTR_0017s14180g             288   4e-94   Populus trichocarpa [western balsam poplar]
ref|XP_011021175.1|  PREDICTED: 40S ribosomal protein S8 isoform X1     287   5e-94   Populus euphratica
ref|XP_004975334.1|  PREDICTED: 40S ribosomal protein S8-like           288   5e-94   Setaria italica
ref|XP_011008256.1|  PREDICTED: 40S ribosomal protein S8-like           287   7e-94   Populus euphratica
gb|KJB84080.1|  hypothetical protein B456_N005000                       286   1e-93   Gossypium raimondii
gb|KHG04827.1|  40S ribosomal S8                                        286   1e-93   Gossypium arboreum [tree cotton]
gb|KJB62960.1|  hypothetical protein B456_009G445800                    286   2e-93   Gossypium raimondii
ref|XP_010252680.1|  PREDICTED: 40S ribosomal protein S8                286   2e-93   Nelumbo nucifera [Indian lotus]
ref|XP_004240435.1|  PREDICTED: 40S ribosomal protein S8-2              286   2e-93   Solanum lycopersicum
gb|KJB62959.1|  hypothetical protein B456_009G445800                    286   2e-93   Gossypium raimondii
gb|KJB81682.1|  hypothetical protein B456_013G156600                    285   3e-93   Gossypium raimondii
gb|KDP39216.1|  hypothetical protein JCGZ_00973                         285   5e-93   Jatropha curcas
ref|XP_010060252.1|  PREDICTED: 40S ribosomal protein S8                285   6e-93   Eucalyptus grandis [rose gum]
gb|KJB22660.1|  hypothetical protein B456_004G059300                    285   6e-93   Gossypium raimondii
gb|KJB22659.1|  hypothetical protein B456_004G059300                    285   6e-93   Gossypium raimondii
gb|ACJ83894.1|  unknown                                                 285   7e-93   Medicago truncatula
emb|CDP03936.1|  unnamed protein product                                284   7e-93   Coffea canephora [robusta coffee]
ref|XP_006352667.1|  PREDICTED: 40S ribosomal protein S8-like           285   8e-93   Solanum tuberosum [potatoes]
ref|NP_200732.2|  40S ribosomal protein S8-2                            284   8e-93   Arabidopsis thaliana [mouse-ear cress]
gb|KJB22170.1|  hypothetical protein B456_004G033000                    284   9e-93   Gossypium raimondii
ref|XP_006437243.1|  hypothetical protein CICLE_v10032694mg             285   9e-93   Citrus clementina [clementine]
emb|CBI26725.3|  unnamed protein product                                284   1e-92   Vitis vinifera
gb|KJB81679.1|  hypothetical protein B456_013G156600                    284   1e-92   Gossypium raimondii
gb|KHG18510.1|  40S ribosomal S8                                        284   1e-92   Gossypium arboreum [tree cotton]
gb|KJB13806.1|  hypothetical protein B456_002G095300                    284   1e-92   Gossypium raimondii
emb|CBI39377.3|  unnamed protein product                                284   1e-92   Vitis vinifera
gb|KJB84081.1|  hypothetical protein B456_N005000                       285   1e-92   Gossypium raimondii
gb|KJB13805.1|  hypothetical protein B456_002G095300                    284   1e-92   Gossypium raimondii
gb|KHF98591.1|  40S ribosomal S8                                        284   1e-92   Gossypium arboreum [tree cotton]
ref|XP_002275094.1|  PREDICTED: 40S ribosomal protein S8                284   1e-92   Vitis vinifera
ref|XP_002269042.2|  PREDICTED: 40S ribosomal protein S8                284   1e-92   Vitis vinifera
gb|AFK40150.1|  unknown                                                 283   2e-92   Lotus japonicus
gb|KDO36309.1|  hypothetical protein CISIN_1g045444mg                   283   2e-92   Citrus sinensis [apfelsine]
gb|KHG14255.1|  40S ribosomal S8                                        283   2e-92   Gossypium arboreum [tree cotton]
gb|KCW58021.1|  hypothetical protein EUGRSUZ_H00750                     283   2e-92   Eucalyptus grandis [rose gum]
ref|XP_006452497.1|  hypothetical protein CICLE_v10009415mg             283   2e-92   Citrus clementina [clementine]
ref|XP_002299926.1|  40S ribosomal protein S8                           283   3e-92   Populus trichocarpa [western balsam poplar]
ref|XP_006484807.1|  PREDICTED: 40S ribosomal protein S8-like           283   3e-92   Citrus sinensis [apfelsine]
ref|XP_004510234.1|  PREDICTED: 40S ribosomal protein S8-like           282   4e-92   Cicer arietinum [garbanzo]
ref|XP_007049644.1|  40S ribosomal protein S8 isoform 1                 282   5e-92   Theobroma cacao [chocolate]
ref|XP_009373606.1|  PREDICTED: 40S ribosomal protein S8                282   7e-92   Pyrus x bretschneideri [bai li]
ref|XP_008222788.1|  PREDICTED: 40S ribosomal protein S8                282   7e-92   Prunus mume [ume]
ref|XP_004492266.1|  PREDICTED: 40S ribosomal protein S8-like           282   8e-92   Cicer arietinum [garbanzo]
ref|XP_009378162.1|  PREDICTED: 40S ribosomal protein S8-like           281   1e-91   Pyrus x bretschneideri [bai li]
ref|XP_007020644.1|  40S ribosomal protein S8 isoform 1                 281   1e-91   
ref|XP_008466734.1|  PREDICTED: 40S ribosomal protein S8-2              281   1e-91   Cucumis melo [Oriental melon]
ref|XP_009349000.1|  PREDICTED: 40S ribosomal protein S8-like           281   1e-91   Pyrus x bretschneideri [bai li]
ref|XP_008778380.1|  PREDICTED: 40S ribosomal protein S8-like           281   1e-91   Phoenix dactylifera
ref|XP_010693327.1|  PREDICTED: 40S ribosomal protein S8-like           281   2e-91   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007146564.1|  hypothetical protein PHAVU_006G051300g             281   2e-91   Phaseolus vulgaris [French bean]
ref|XP_011025495.1|  PREDICTED: 40S ribosomal protein S8-like           281   2e-91   Populus euphratica
ref|XP_006373482.1|  hypothetical protein POPTR_0017s14180g             281   2e-91   Populus trichocarpa [western balsam poplar]
ref|XP_010913108.1|  PREDICTED: 40S ribosomal protein S8 isoform X1     281   2e-91   Elaeis guineensis
ref|XP_011021176.1|  PREDICTED: 40S ribosomal protein S8 isoform X2     280   3e-91   Populus euphratica
ref|XP_004148331.1|  PREDICTED: 40S ribosomal protein S8-like           280   3e-91   Cucumis sativus [cucumbers]
ref|XP_010907235.1|  PREDICTED: 40S ribosomal protein S8-like           281   3e-91   Elaeis guineensis
ref|XP_009406344.1|  PREDICTED: 40S ribosomal protein S8-like           280   3e-91   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009416597.1|  PREDICTED: 40S ribosomal protein S8                280   3e-91   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006833291.1|  hypothetical protein AMTR_s00109p00031400          280   3e-91   Amborella trichopoda
ref|NP_001240243.1|  uncharacterized protein LOC100813170               280   4e-91   Glycine max [soybeans]
ref|XP_006601753.1|  PREDICTED: uncharacterized protein LOC100500...    280   4e-91   
ref|XP_010913109.1|  PREDICTED: 40S ribosomal protein S8 isoform X2     280   4e-91   Elaeis guineensis
ref|XP_006344091.1|  PREDICTED: 40S ribosomal protein S8-like           280   4e-91   Solanum tuberosum [potatoes]
ref|XP_010675861.1|  PREDICTED: 40S ribosomal protein S8                280   4e-91   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008337490.1|  PREDICTED: 40S ribosomal protein S8                280   5e-91   Malus domestica [apple tree]
gb|EMT18438.1|  40S ribosomal protein S8                                280   5e-91   
ref|XP_006369983.1|  hypothetical protein POPTR_0001s37140g             279   6e-91   
ref|XP_009126438.1|  PREDICTED: 40S ribosomal protein S8-1-like         280   6e-91   Brassica rapa
emb|CDP15136.1|  unnamed protein product                                281   6e-91   Coffea canephora [robusta coffee]
emb|CDY45095.1|  BnaA02g04810D                                          280   8e-91   Brassica napus [oilseed rape]
ref|XP_010278451.1|  PREDICTED: 40S ribosomal protein S8-like           279   1e-90   Nelumbo nucifera [Indian lotus]
ref|XP_010069614.1|  PREDICTED: 40S ribosomal protein S8-like           279   1e-90   Eucalyptus grandis [rose gum]
ref|XP_002529032.1|  40S ribosomal protein S8, putative                 279   1e-90   Ricinus communis
ref|XP_002313320.1|  40S ribosomal protein S8                           279   1e-90   Populus trichocarpa [western balsam poplar]
ref|XP_008451649.1|  PREDICTED: 40S ribosomal protein S8-like           279   1e-90   Cucumis melo [Oriental melon]
ref|XP_009413565.1|  PREDICTED: 40S ribosomal protein S8-like           279   2e-90   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008792950.1|  PREDICTED: 40S ribosomal protein S8                278   2e-90   Phoenix dactylifera
ref|NP_001236970.1|  uncharacterized protein LOC100500112               278   2e-90   
ref|XP_011069406.1|  PREDICTED: 40S ribosomal protein S8                278   2e-90   Sesamum indicum [beniseed]
dbj|BAJ89904.1|  predicted protein                                      278   3e-90   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010270147.1|  PREDICTED: 40S ribosomal protein S8-like           278   3e-90   Nelumbo nucifera [Indian lotus]
ref|XP_007134162.1|  hypothetical protein PHAVU_010G024600g             278   3e-90   Phaseolus vulgaris [French bean]
ref|XP_010235437.1|  PREDICTED: 40S ribosomal protein S8 isoform X2     278   3e-90   Brachypodium distachyon [annual false brome]
ref|XP_009371092.1|  PREDICTED: 40S ribosomal protein S8-like           278   4e-90   Pyrus x bretschneideri [bai li]
gb|ABL85034.1|  ribosomal subunit 8E protein                            278   4e-90   Brachypodium sylvaticum
gb|EYU27406.1|  hypothetical protein MIMGU_mgv1a013520mg                277   5e-90   Erythranthe guttata [common monkey flower]
ref|XP_010243157.1|  PREDICTED: 40S ribosomal protein S8-like iso...    277   5e-90   Nelumbo nucifera [Indian lotus]
ref|XP_003557224.1|  PREDICTED: 40S ribosomal protein S8                277   5e-90   Brachypodium distachyon [annual false brome]
ref|XP_002534344.1|  40S ribosomal protein S8, putative                 277   6e-90   Ricinus communis
ref|XP_011095494.1|  PREDICTED: 40S ribosomal protein S8                277   6e-90   Sesamum indicum [beniseed]
ref|XP_008809644.1|  PREDICTED: 40S ribosomal protein S8                277   6e-90   Phoenix dactylifera
ref|XP_002864608.1|  40S ribosomal protein S8                           276   6e-90   
ref|XP_003574981.1|  PREDICTED: 40S ribosomal protein S8 isoform X1     277   7e-90   Brachypodium distachyon [annual false brome]
ref|XP_010905161.1|  PREDICTED: 40S ribosomal protein S8-like           277   7e-90   Elaeis guineensis
ref|XP_010646836.1|  PREDICTED: 40S ribosomal protein S8                276   1e-89   
ref|XP_004244061.1|  PREDICTED: 40S ribosomal protein S8-like           276   1e-89   Solanum lycopersicum
ref|XP_007223947.1|  hypothetical protein PRUPE_ppa011148mg             276   1e-89   Prunus persica
ref|XP_010243156.1|  PREDICTED: 40S ribosomal protein S8-like iso...    276   1e-89   Nelumbo nucifera [Indian lotus]
sp|O81361.1|RS8_PRUAR  RecName: Full=40S ribosomal protein S8           276   1e-89   Prunus armeniaca
gb|KDP45274.1|  hypothetical protein JCGZ_15139                         276   1e-89   Jatropha curcas
ref|XP_009405538.1|  PREDICTED: 40S ribosomal protein S8-like           276   2e-89   Musa acuminata subsp. malaccensis [pisang utan]
gb|EMS65111.1|  40S ribosomal protein S8                                278   2e-89   Triticum urartu
gb|ACI15738.1|  putative 40S ribosomal protein S8-like protein          276   2e-89   Picrorhiza kurrooa
ref|XP_006281069.1|  hypothetical protein CARUB_v10027092mg             275   3e-89   Capsella rubella
ref|XP_004160707.1|  PREDICTED: 40S ribosomal protein S8-like           275   4e-89   
ref|XP_007049645.1|  40S ribosomal protein S8 isoform 3                 274   5e-89   
ref|XP_004149800.1|  PREDICTED: 40S ribosomal protein S8-like           275   6e-89   Cucumis sativus [cucumbers]
gb|KHM99496.1|  40S ribosomal protein S8                                275   6e-89   Glycine soja [wild soybean]
ref|XP_003532158.1|  PREDICTED: 40S ribosomal protein S8-like           275   6e-89   Glycine max [soybeans]
ref|XP_009778867.1|  PREDICTED: 40S ribosomal protein S8-like           275   7e-89   Nicotiana sylvestris
ref|XP_009403610.1|  PREDICTED: 40S ribosomal protein S8-like           274   8e-89   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008227073.1|  PREDICTED: 40S ribosomal protein S8-like           274   1e-88   Prunus mume [ume]
ref|XP_008366424.1|  PREDICTED: 40S ribosomal protein S8                274   1e-88   Malus domestica [apple tree]
ref|XP_009361080.1|  PREDICTED: 40S ribosomal protein S8-like           274   1e-88   Pyrus x bretschneideri [bai li]
gb|AET01418.2|  40S ribosomal protein S8                                276   1e-88   Medicago truncatula
ref|XP_009619873.1|  PREDICTED: 40S ribosomal protein S8-like           273   3e-88   Nicotiana tomentosiformis
ref|XP_006856815.1|  hypothetical protein AMTR_s00055p00155570          273   3e-88   Amborella trichopoda
ref|XP_007211997.1|  hypothetical protein PRUPE_ppa011067mg             273   3e-88   
gb|KHN25148.1|  40S ribosomal protein S8                                273   4e-88   Glycine soja [wild soybean]
ref|XP_010926672.1|  PREDICTED: 40S ribosomal protein S8-like iso...    272   4e-88   
ref|XP_006286561.1|  hypothetical protein CARUB_v10001914mg             272   5e-88   Capsella rubella
ref|XP_008364326.1|  PREDICTED: 40S ribosomal protein S8-like           272   6e-88   
gb|ACJ86093.1|  unknown                                                 271   7e-88   Medicago truncatula
ref|XP_008657369.1|  PREDICTED: uncharacterized protein LOC100193...    271   9e-88   Zea mays [maize]
gb|AFK47179.1|  unknown                                                 271   1e-87   Medicago truncatula
ref|XP_009783183.1|  PREDICTED: 40S ribosomal protein S8                271   1e-87   Nicotiana sylvestris
ref|XP_009770276.1|  PREDICTED: 40S ribosomal protein S8-like           271   1e-87   Nicotiana sylvestris
ref|XP_009610547.1|  PREDICTED: 40S ribosomal protein S8                271   1e-87   Nicotiana tomentosiformis
ref|XP_003520991.1|  PREDICTED: 40S ribosomal protein S8-like           271   2e-87   Glycine max [soybeans]
ref|XP_003547779.1|  PREDICTED: 40S ribosomal protein S8                271   2e-87   Glycine max [soybeans]
ref|XP_010926670.1|  PREDICTED: 40S ribosomal protein S8-like iso...    270   2e-87   
gb|ACU19111.1|  unknown                                                 270   2e-87   Glycine max [soybeans]
gb|AFK37035.1|  unknown                                                 270   3e-87   Lotus japonicus
ref|XP_004290159.1|  PREDICTED: 40S ribosomal protein S8-like           270   3e-87   Fragaria vesca subsp. vesca
gb|AFK33351.1|  unknown                                                 270   4e-87   Lotus japonicus
ref|NP_001274851.1|  uncharacterized protein LOC102577693               270   4e-87   Solanum tuberosum [potatoes]
ref|XP_003551567.1|  PREDICTED: 40S ribosomal protein S8                270   5e-87   Glycine max [soybeans]
ref|XP_004247043.1|  PREDICTED: 40S ribosomal protein S8                270   7e-87   Solanum lycopersicum
ref|XP_010420870.1|  PREDICTED: 40S ribosomal protein S8-1-like         269   1e-86   Camelina sativa [gold-of-pleasure]
gb|AGV54796.1|  40S ribosomal protein S8                                268   1e-86   Phaseolus vulgaris [French bean]
ref|XP_002873989.1|  ribosomal protein S8                               268   1e-86   Arabidopsis lyrata subsp. lyrata
gb|KFK31870.1|  hypothetical protein AALP_AA6G169300                    268   1e-86   Arabis alpina [alpine rockcress]
ref|XP_010493138.1|  PREDICTED: 40S ribosomal protein S8-1              268   2e-86   Camelina sativa [gold-of-pleasure]
gb|ACU16800.1|  unknown                                                 269   2e-86   Glycine max [soybeans]
gb|EYU33688.1|  hypothetical protein MIMGU_mgv1a013525mg                268   2e-86   Erythranthe guttata [common monkey flower]
ref|XP_011461093.1|  PREDICTED: 40S ribosomal protein S8                268   2e-86   Fragaria vesca subsp. vesca
ref|XP_007149668.1|  hypothetical protein PHAVU_005G089100g             268   3e-86   Phaseolus vulgaris [French bean]
ref|XP_009596732.1|  PREDICTED: 40S ribosomal protein S8                267   5e-86   Nicotiana tomentosiformis
ref|XP_009771719.1|  PREDICTED: 40S ribosomal protein S8                267   5e-86   Nicotiana sylvestris
gb|ACU16398.1|  unknown                                                 268   6e-86   Glycine max [soybeans]
emb|CDY60374.1|  BnaCnng36150D                                          267   6e-86   Brassica napus [oilseed rape]
ref|XP_006409551.1|  hypothetical protein EUTSA_v10022838mg             267   6e-86   Eutrema salsugineum [saltwater cress]
ref|XP_009131790.1|  PREDICTED: 40S ribosomal protein S8-1              266   9e-86   Brassica rapa
gb|KFK26269.1|  hypothetical protein AALP_AA8G225000                    266   1e-85   Arabis alpina [alpine rockcress]
ref|XP_006400597.1|  hypothetical protein EUTSA_v10014589mg             266   2e-85   Eutrema salsugineum [saltwater cress]
ref|XP_010541736.1|  PREDICTED: 40S ribosomal protein S8-1-like         265   2e-85   Tarenaya hassleriana [spider flower]
ref|XP_008679876.1|  PREDICTED: 40S ribosomal protein S8 isoform X1     266   2e-85   Zea mays [maize]
ref|XP_010535902.1|  PREDICTED: 40S ribosomal protein S8-1-like         264   8e-85   Tarenaya hassleriana [spider flower]
ref|XP_009602561.1|  PREDICTED: 40S ribosomal protein S8-like           263   2e-84   Nicotiana tomentosiformis
ref|XP_009120819.1|  PREDICTED: 40S ribosomal protein S8-1              263   2e-84   Brassica rapa
ref|XP_003604700.1|  Ribosomal protein S8                               265   2e-84   
emb|CDY35814.1|  BnaC09g37460D                                          264   2e-84   Brassica napus [oilseed rape]
ref|XP_009765854.1|  PREDICTED: 40S ribosomal protein S8-like           263   3e-84   Nicotiana sylvestris
emb|CDX88842.1|  BnaA03g08070D                                          263   3e-84   
ref|NP_197529.1|  40S ribosomal protein S8-1                            262   4e-84   Arabidopsis thaliana [mouse-ear cress]
emb|CDX92472.1|  BnaA10g15110D                                          263   6e-84   
ref|XP_010519957.1|  PREDICTED: 40S ribosomal protein S8-1              261   8e-84   Tarenaya hassleriana [spider flower]
ref|XP_009594581.1|  PREDICTED: 40S ribosomal protein S8-2-like         261   1e-83   Nicotiana tomentosiformis
gb|ABK21921.1|  unknown                                                 260   3e-83   Picea sitchensis
gb|EYU39184.1|  hypothetical protein MIMGU_mgv1a013531mg                259   5e-83   Erythranthe guttata [common monkey flower]
gb|AES86897.2|  40S ribosomal S8-like protein                           259   7e-83   Medicago truncatula
ref|XP_010327196.1|  PREDICTED: 40S ribosomal protein S8                259   1e-82   Solanum lycopersicum
ref|XP_003626942.1|  Ribosomal protein S8                               271   1e-82   
ref|XP_006346168.1|  PREDICTED: 40S ribosomal protein S8-like           258   2e-82   Solanum tuberosum [potatoes]
gb|ABK21933.1|  unknown                                                 258   2e-82   Picea sitchensis
gb|ABK22298.1|  unknown                                                 258   3e-82   Picea sitchensis
ref|XP_008676011.1|  PREDICTED: 40S ribosomal protein S8-like           261   6e-82   
ref|NP_001275100.1|  putative 40S ribosomal protein S8-like protein     256   1e-81   Solanum tuberosum [potatoes]
gb|ABR16896.1|  unknown                                                 256   1e-81   Picea sitchensis
ref|XP_010520566.1|  PREDICTED: 40S ribosomal protein S8-1-like         255   3e-81   Tarenaya hassleriana [spider flower]
ref|XP_011089042.1|  PREDICTED: 40S ribosomal protein S8-like           255   3e-81   Sesamum indicum [beniseed]
ref|XP_006352532.1|  PREDICTED: 40S ribosomal protein S8                254   6e-81   
gb|EPS68663.1|  hypothetical protein M569_06106                         254   6e-81   Genlisea aurea
ref|XP_004516802.1|  PREDICTED: 40S ribosomal protein S8-like           254   9e-80   
gb|KJB81683.1|  hypothetical protein B456_013G156600                    252   1e-79   Gossypium raimondii
ref|XP_001761026.1|  predicted protein                                  249   3e-79   
gb|EPS68749.1|  hypothetical protein M569_06019                         252   1e-77   Genlisea aurea
ref|XP_001773385.1|  predicted protein                                  243   1e-76   
ref|XP_001777587.1|  predicted protein                                  243   1e-76   
ref|XP_001780988.1|  predicted protein                                  243   2e-76   
ref|XP_001777813.1|  predicted protein                                  241   8e-76   
ref|XP_010539242.1|  PREDICTED: 40S ribosomal protein S8-1-like         238   2e-75   Tarenaya hassleriana [spider flower]
gb|KDD75705.1|  ribosomal protein S8e                                   241   5e-74   Helicosporidium sp. ATCC 50920
gb|AGE46026.1|  40S ribosomal protein S8                                234   9e-74   Elaeis guineensis
ref|XP_005648786.1|  40S ribosomal protein S8                           235   1e-73   Coccomyxa subellipsoidea C-169
emb|CEG02139.1|  Ribosomal protein S8e/ribosomal biogenesis NSA2        235   2e-73   Ostreococcus tauri
ref|XP_001696201.1|  ribosomal protein S8, component of cytosolic...    234   2e-73   Chlamydomonas reinhardtii
ref|XP_002963298.1|  hypothetical protein SELMODRAFT_80565              234   3e-73   
gb|EYU39185.1|  hypothetical protein MIMGU_mgv1a013531mg                233   3e-73   Erythranthe guttata [common monkey flower]
gb|EPZ31448.1|  40S ribosomal protein S8-B                              233   9e-73   Rozella allomycis CSF55
ref|XP_011397165.1|  40S ribosomal protein S8                           232   1e-72   Auxenochlorella protothecoides
gb|ABR25841.1|  40S ribosomal protein S8                                231   2e-72   Oryza sativa Indica Group [Indian rice]
gb|ABA01100.1|  40S ribosomal protein S8                                231   4e-72   Chlamydomonas incerta
ref|XP_002945874.1|  component of cytosolic 80S ribosome and 40S ...    231   6e-72   Volvox carteri f. nagariensis
ref|XP_005844426.1|  hypothetical protein CHLNCDRAFT_139122             231   7e-72   Chlorella variabilis
ref|XP_001422585.1|  Ribosomal protein S8, component of cytosolic...    231   8e-72   Ostreococcus lucimarinus CCE9901
gb|EKD00868.1|  40S ribosomal protein S8                                221   5e-68   Trichosporon asahii var. asahii CBS 8904
emb|CCA22399.1|  40S ribosomal protein S82 putative                     220   8e-68   Albugo laibachii Nc14
tpg|DAA53686.1|  TPA: putative ribosomal protein S8e family protein     223   1e-67   
ref|XP_007397269.1|  hypothetical protein PHACADRAFT_258531             218   4e-67   Phanerochaete carnosa HHB-10118-sp
gb|KIK09143.1|  hypothetical protein K443DRAFT_447984                   218   5e-67   Laccaria amethystina LaAM-08-1
ref|XP_001880116.1|  40S ribosomal protein S8                           218   5e-67   Laccaria bicolor S238N-H82
ref|XP_003083062.1|  RS8_MAIZE 40S ribosomal protein S8 pir||T040...    224   6e-67   
gb|KIO10111.1|  hypothetical protein M404DRAFT_996068                   218   7e-67   Pisolithus tinctorius Marx 270
gb|KJB81680.1|  hypothetical protein B456_013G156600                    216   7e-67   Gossypium raimondii
gb|EJT52835.1|  40S ribosomal protein S8                                218   8e-67   Trichosporon asahii var. asahii CBS 2479
ref|XP_003059699.1|  predicted protein                                  218   9e-67   Micromonas pusilla CCMP1545
emb|CDO76014.1|  hypothetical protein BN946_scf184665.g6                218   9e-67   Trametes cinnabarina
ref|XP_001745896.1|  hypothetical protein                               218   1e-66   Monosiga brevicollis MX1
ref|XP_002142692.1|  40S ribosomal protein S8                           217   1e-66   Cryptosporidium muris RN66
ref|XP_007311714.1|  40S ribosomal protein S8                           217   2e-66   Stereum hirsutum FP-91666 SS1
ref|XP_008799563.1|  PREDICTED: 40S ribosomal protein S8-like           214   2e-66   
ref|XP_002117056.1|  expressed hypothetical protein                     216   2e-66   Trichoplax adhaerens
ref|XP_572078.1|  40S ribosomal protein S8                              216   3e-66   Cryptococcus neoformans var. neoformans JEC21
gb|EMD32142.1|  hypothetical protein CERSUDRAFT_88417                   216   4e-66   Gelatoporia subvermispora B
gb|KIK27780.1|  hypothetical protein PISMIDRAFT_169173                  216   4e-66   Pisolithus microcarpus 441
ref|XP_007001047.1|  hypothetical protein TREMEDRAFT_55820              216   4e-66   Tremella mesenterica DSM 1558
ref|XP_006461206.1|  hypothetical protein AGABI2DRAFT_136253            216   5e-66   Agaricus bisporus var. bisporus H97
ref|XP_008365334.1|  PREDICTED: 40S ribosomal protein S8-like           214   5e-66   
gb|KIJ26939.1|  hypothetical protein M422DRAFT_76964                    216   6e-66   Sphaerobolus stellatus SS14
ref|XP_003195106.1|  40S ribosomal protein S8                           215   6e-66   Cryptococcus gattii WM276
gb|AFR96425.1|  small subunit ribosomal protein S8e                     215   7e-66   Cryptococcus neoformans var. grubii H99
gb|KIP11649.1|  hypothetical protein PHLGIDRAFT_27859                   215   7e-66   Phlebiopsis gigantea 11061_1 CR5-6
gb|KDO22073.1|  40S ribosomal protein S8                                215   8e-66   Saprolegnia parasitica CBS 223.65
ref|XP_007843664.1|  40s ribosomal protein s8                           215   8e-66   
ref|XP_005539190.1|  40S ribosomal protein S8                           215   8e-66   Cyanidioschyzon merolae strain 10D
ref|XP_007266897.1|  40S ribosomal protein S8                           215   9e-66   Fomitiporia mediterranea MF3/22
gb|KGB76549.1|  40S ribosomal protein S8                                215   9e-66   Cryptococcus gattii VGII R265
ref|XP_001622696.1|  hypothetical protein NEMVEDRAFT_v1g195152          215   1e-65   Nematostella vectensis
gb|KIM64970.1|  hypothetical protein SCLCIDRAFT_1212646                 215   1e-65   Scleroderma citrinum Foug A
ref|XP_005702569.1|  40S ribosomal protein S8e                          214   1e-65   Galdieria sulphuraria
gb|KIR49123.1|  ribosomal protein S8.e                                  214   1e-65   Cryptococcus gattii CA1280
ref|XP_002602335.1|  hypothetical protein BRAFLDRAFT_268377             214   1e-65   Branchiostoma floridae
ref|XP_668115.1|  ribosomal protein S8                                  214   1e-65   Cryptosporidium hominis TU502
gb|KDQ27658.1|  hypothetical protein PLEOSDRAFT_1089421                 214   2e-65   Pleurotus ostreatus PC15
gb|AFW66128.1|  putative ribosomal protein S8e family protein           212   2e-65   
gb|KIY49072.1|  hypothetical protein FISHEDRAFT_65531                   215   2e-65   Fistulina hepatica ATCC 64428
ref|XP_008608971.1|  40S ribosomal protein S8                           214   2e-65   Saprolegnia diclina VS20
emb|CCI48864.1|  unnamed protein product                                214   2e-65   Albugo candida
ref|XP_007317717.1|  hypothetical protein SERLADRAFT_387784             214   2e-65   Serpula lacrymans var. lacrymans S7.9
gb|KHG07290.1|  40S ribosomal S8                                        212   2e-65   Gossypium arboreum [tree cotton]
gb|EJU03954.1|  40S ribosomal protein S8                                214   3e-65   Dacryopinax primogenitus
ref|XP_009547527.1|  hypothetical protein HETIRDRAFT_440490             214   3e-65   Heterobasidion irregulare TC 32-1
gb|KDQ57766.1|  hypothetical protein JAAARDRAFT_35455                   214   3e-65   Jaapia argillacea MUCL 33604
ref|XP_003029339.1|  40S ribosomal protein S8                           214   3e-65   Schizophyllum commune H4-8
ref|XP_002472702.1|  40S ribosomal protein S8                           214   3e-65   
gb|KHG09566.1|  40S ribosomal protein S8                                212   3e-65   Gossypium arboreum [tree cotton]
gb|AGH70192.1|  40S ribosomal protein S8                                213   3e-65   Placozoa sp. H4
gb|KJB81681.1|  hypothetical protein B456_013G156600                    211   3e-65   Gossypium raimondii
ref|XP_007380781.1|  ribosomal protein S8e                              213   4e-65   Punctularia strigosozonata HHB-11173 SS5
gb|KIM92086.1|  hypothetical protein PILCRDRAFT_810109                  213   6e-65   Piloderma croceum F 1598
gb|KDR75758.1|  hypothetical protein GALMADRAFT_226405                  213   6e-65   
gb|EPT02637.1|  hypothetical protein FOMPIDRAFT_1022771                 213   6e-65   
ref|XP_007864455.1|  ribosomal protein S8e                              213   6e-65   
gb|KIL68834.1|  hypothetical protein M378DRAFT_157968                   213   7e-65   
ref|XP_627792.1|  40S ribosomal protein S8                              213   8e-65   
ref|XP_008033648.1|  40S ribosomal protein S8                           213   9e-65   
dbj|BAM18930.1|  ribosomal protein S8                                   212   1e-64   
sp|Q8WQI5.1|RS8_SPOFR  RecName: Full=40S ribosomal protein S8           212   1e-64   
gb|AAC69196.2|  40S ribosomal protein S8                                212   1e-64   
ref|NP_001037263.1|  ribosomal protein S8                               212   1e-64   
gb|KFH71035.1|  40S ribosomal protein S8                                212   1e-64   
emb|CDS03736.1|  hypothetical protein LRAMOSA01137                      212   1e-64   
emb|CDS12850.1|  hypothetical protein LRAMOSA05034                      211   2e-64   
gb|KIJ67640.1|  hypothetical protein HYDPIDRAFT_149439                  212   2e-64   
gb|KII92951.1|  hypothetical protein PLICRDRAFT_89444                   211   2e-64   
gb|ACY95327.1|  ribosomal protein S8                                    211   2e-64   
gb|EWM25134.1|  40s ribosomal protein s8                                211   2e-64   
dbj|BAM17705.1|  ribosomal protein S8                                   211   2e-64   
emb|CDS03533.1|  hypothetical protein LRAMOSA00935                      211   3e-64   
emb|CDH48276.1|  40s ribosomal protein s8                               211   3e-64   
gb|KIK45130.1|  hypothetical protein CY34DRAFT_22712                    211   3e-64   
gb|EXX59183.1|  ribosomal 40S subunit protein S8B                       211   3e-64   
gb|EHJ65952.1|  40S ribosomal protein S8                                214   3e-64   
ref|XP_007361817.1|  ribosomal protein S8e                              211   5e-64   
gb|KIY67149.1|  40S ribosomal protein S8                                210   6e-64   
gb|KDQ21918.1|  hypothetical protein BOTBODRAFT_150960                  210   7e-64   
gb|AEL28852.1|  ribosomal protein S8                                    210   8e-64   
gb|KGG52480.1|  40S ribosomal protein S8                                209   9e-64   
ref|XP_010746502.1|  PREDICTED: 40S ribosomal protein S8                209   1e-63   
gb|ADT80672.1|  ribosomal protein S8                                    209   2e-63   
ref|XP_009026500.1|  hypothetical protein HELRODRAFT_193555             209   2e-63   
gb|AJG43845.1|  ribosomal protein rps8                                  209   2e-63   
emb|CDH55703.1|  40s ribosomal protein s8                               209   2e-63   
ref|XP_007873882.1|  30S ribosomal protein S8e                          209   2e-63   
gb|AAX48884.1|  S8                                                      209   2e-63   
ref|XP_008333134.1|  PREDICTED: 40S ribosomal protein S8                209   3e-63   
ref|XP_003448492.1|  PREDICTED: 40S ribosomal protein S8-like           208   3e-63   
ref|XP_003742816.1|  PREDICTED: 40S ribosomal protein S8-like           208   3e-63   
gb|ADO27837.1|  40S ribosomal protein s8                                208   3e-63   
gb|KIK67276.1|  hypothetical protein GYMLUDRAFT_861869                  208   3e-63   
ref|XP_006114784.1|  PREDICTED: 40S ribosomal protein S8                208   4e-63   
gb|AFD93383.1|  40S ribosomal protein S8                                207   4e-63   
ref|NP_001128155.1|  40S ribosomal protein S8                           208   4e-63   
ref|XP_003725128.1|  PREDICTED: 40S ribosomal protein S8-like           208   4e-63   
gb|KIM40224.1|  hypothetical protein M413DRAFT_446389                   208   4e-63   
gb|AFM90620.1|  40S ribosomal protein S8                                208   4e-63   
emb|CCM03328.1|  predicted protein                                      208   5e-63   
ref|XP_007766704.1|  40S ribosomal protein S8                           208   5e-63   
emb|CDH48522.1|  40s ribosomal protein s8                               209   6e-63   
ref|XP_006881181.1|  PREDICTED: 40S ribosomal protein S8-like           207   6e-63   
gb|EMP34067.1|  40S ribosomal protein S8                                207   6e-63   
ref|XP_005924603.1|  PREDICTED: 40S ribosomal protein S8-like           207   6e-63   
gb|AAN05595.1|  ribosomal protein S8                                    207   6e-63   
ref|XP_003707560.1|  PREDICTED: 40S ribosomal protein S8-like           207   7e-63   
ref|XP_003699508.1|  PREDICTED: 40S ribosomal protein S8-like           207   7e-63   
ref|XP_005729057.1|  PREDICTED: 40S ribosomal protein S8-like           207   8e-63   
gb|ACQ57870.1|  40S ribosomal protein S8                                207   8e-63   
dbj|BAD26659.1|  Ribosomal protein S8                                   207   9e-63   
ref|XP_006015899.1|  PREDICTED: 40S ribosomal protein S8                206   1e-62   
ref|XP_003397407.1|  PREDICTED: 40S ribosomal protein S8-like           207   1e-62   
ref|XP_006634805.1|  PREDICTED: 40S ribosomal protein S8-like           207   1e-62   
ref|XP_001830182.1|  40S ribosomal protein S8                           207   1e-62   
gb|EMS22797.1|  40S ribosomal protein s8                                207   1e-62   
gb|EYU33690.1|  hypothetical protein MIMGU_mgv1a013952mg                207   1e-62   
ref|XP_003975488.1|  PREDICTED: 40S ribosomal protein S8-like           207   1e-62   
gb|ABZ04260.1|  ribosomal protein rps8                                  207   1e-62   
gb|EFN82821.1|  40S ribosomal protein S8                                206   1e-62   
emb|CCO29805.1|  40S ribosomal protein S8-A AltName: Full=RP19          207   1e-62   
ref|XP_008871313.1|  40S ribosomal protein S8                           206   2e-62   
ref|XP_005303088.1|  PREDICTED: 40S ribosomal protein S8                206   2e-62   
gb|EHH14717.1|  hypothetical protein EGK_00685                          206   2e-62   
ref|XP_009831251.1|  40S ribosomal protein S8                           206   2e-62   
ref|XP_007878137.1|  hypothetical protein PFL1_06854                    206   2e-62   
dbj|BAF45896.1|  ribosomal protein S8                                   206   2e-62   
ref|XP_005815191.1|  PREDICTED: 40S ribosomal protein S8-like iso...    206   2e-62   
ref|XP_007061727.1|  PREDICTED: 40S ribosomal protein S8                206   2e-62   
gb|AAZ38988.1|  40S ribosomal protein S8                                205   3e-62   
ref|XP_009943981.1|  PREDICTED: 40S ribosomal protein S8                207   3e-62   
gb|KIM21886.1|  hypothetical protein M408DRAFT_333202                   206   3e-62   
ref|XP_009679268.1|  PREDICTED: 40S ribosomal protein S8                207   4e-62   
emb|CAH57693.1|  40S ribosomal protein S8                               206   4e-62   
ref|NP_001239055.1|  40S ribosomal protein S8                           206   4e-62   
ref|XP_003690352.1|  PREDICTED: 40S ribosomal protein S8-like           206   4e-62   
ref|XP_006273333.1|  PREDICTED: 40S ribosomal protein S8                206   4e-62   
gb|AGR33944.1|  subunit ribosomal protein 8                             205   4e-62   
emb|CAA03954.1|  ribosomal protein S8                                   202   4e-62   
ref|XP_010005007.1|  PREDICTED: 40S ribosomal protein S8                206   4e-62   
ref|XP_009991314.1|  PREDICTED: 40S ribosomal protein S8                206   4e-62   
ref|XP_011141954.1|  PREDICTED: 40S ribosomal protein S8                205   4e-62   
ref|XP_006561561.1|  PREDICTED: 40S ribosomal protein S8 isoform X1     205   4e-62   
ref|NP_001187073.1|  40S ribosomal protein S8                           205   4e-62   
ref|XP_010292800.1|  PREDICTED: 40S ribosomal protein S8                206   5e-62   
ref|XP_002158630.1|  PREDICTED: 40S ribosomal protein S8-like iso...    205   5e-62   
gb|EOA94872.1|  40S ribosomal protein S8                                205   5e-62   
ref|XP_008107755.1|  PREDICTED: 40S ribosomal protein S8                205   5e-62   
ref|XP_010021976.1|  PREDICTED: 40S ribosomal protein S8                206   5e-62   
ref|XP_004678985.1|  PREDICTED: 40S ribosomal protein S8                205   5e-62   
ref|NP_001232282.1|  putative 40S ribosomal protein S8                  205   5e-62   
emb|CEG73596.1|  Putative 40S ribosomal protein S8                      205   5e-62   
ref|XP_010126964.1|  PREDICTED: 40S ribosomal protein S8                206   6e-62   
ref|XP_001376099.1|  PREDICTED: 40S ribosomal protein S8                205   6e-62   
ref|XP_009958964.1|  PREDICTED: 40S ribosomal protein S8                205   6e-62   
ref|XP_009510045.1|  PREDICTED: 40S ribosomal protein S8                206   6e-62   
ref|XP_008290025.1|  PREDICTED: 40S ribosomal protein S8                205   6e-62   
ref|XP_009813094.1|  PREDICTED: 40S ribosomal protein S8                205   6e-62   
ref|XP_007567486.1|  PREDICTED: 40S ribosomal protein S8                205   6e-62   
ref|XP_009075517.1|  PREDICTED: 40S ribosomal protein S8                206   6e-62   
ref|XP_004995866.1|  40S ribosomal protein S8                           205   6e-62   
emb|CEL58813.1|  40S ribosomal protein S8-B OS=Saccharomyces cere...    206   6e-62   
ref|XP_009863870.1|  PREDICTED: 40S ribosomal protein S8                206   6e-62   
ref|XP_005423220.1|  PREDICTED: 40S ribosomal protein S8                206   6e-62   
ref|XP_009970295.1|  PREDICTED: 40S ribosomal protein S8                205   6e-62   
ref|XP_010077725.1|  PREDICTED: 40S ribosomal protein S8                205   7e-62   
emb|CEG65019.1|  Putative 40S ribosomal protein S8                      205   7e-62   
gb|ACH44382.1|  putative 40S ribosomal protein S8                       205   7e-62   
ref|XP_005783873.1|  hypothetical protein EMIHUDRAFT_442198             205   7e-62   
ref|XP_005781609.1|  hypothetical protein EMIHUDRAFT_415402             205   7e-62   
ref|XP_009477726.1|  PREDICTED: 40S ribosomal protein S8                205   7e-62   
ref|XP_004555428.1|  PREDICTED: 40S ribosomal protein S8-like           207   7e-62   
ref|XP_009087131.1|  PREDICTED: 40S ribosomal protein S8                206   7e-62   
ref|XP_009699114.1|  PREDICTED: 40S ribosomal protein S8                205   7e-62   
ref|XP_009323882.1|  PREDICTED: 40S ribosomal protein S8                206   7e-62   
ref|XP_009637143.1|  PREDICTED: 40S ribosomal protein S8                205   7e-62   
ref|XP_010152828.1|  PREDICTED: 40S ribosomal protein S8                205   8e-62   
ref|XP_010172079.1|  PREDICTED: 40S ribosomal protein S8                205   8e-62   
ref|XP_009285726.1|  PREDICTED: 40S ribosomal protein S8                205   8e-62   
gb|AGR33967.1|  subunit ribosomal protein 8                             204   8e-62   
ref|XP_005501192.1|  PREDICTED: 40S ribosomal protein S8                206   9e-62   
ref|XP_010298650.1|  PREDICTED: 40S ribosomal protein S8                205   9e-62   
ref|XP_002787865.1|  40S ribosomal protein S8, putative                 204   9e-62   
ref|XP_009571612.1|  PREDICTED: 40S ribosomal protein S8                205   9e-62   
ref|XP_002771622.1|  40S ribosomal protein S8, putative                 204   9e-62   
gb|AFM88001.1|  40S ribosomal protein S8                                204   9e-62   
gb|KJA28980.1|  hypothetical protein HYPSUDRAFT_155175                  205   1e-61   
ref|XP_005482384.1|  PREDICTED: 40S ribosomal protein S8                206   1e-61   
ref|XP_006675830.1|  hypothetical protein BATDEDRAFT_36328              204   1e-61   
gb|AAX62461.1|  ribosomal protein S8                                    204   1e-61   
gb|ABR87483.1|  small subunit ribosomal protein 8                       204   1e-61   
ref|XP_008489142.1|  PREDICTED: 40S ribosomal protein S8                204   1e-61   
ref|XP_010714500.1|  PREDICTED: 40S ribosomal protein S8                206   1e-61   
ref|XP_002505425.1|  predicted protein                                  204   1e-61   
gb|KIK98345.1|  hypothetical protein PAXRUDRAFT_823950                  204   2e-61   
gb|ABR87469.1|  small subunit ribosomal protein 8                       204   2e-61   
gb|EDL06713.1|  mCG114749, isoform CRA_a                                203   2e-61   
gb|KIJ19037.1|  hypothetical protein PAXINDRAFT_166933                  204   2e-61   
gb|ABR87476.1|  small subunit ribosomal protein 8                       204   2e-61   
gb|AGJ03580.1|  small subunit ribosomal protein 8                       203   2e-61   
gb|ABR87478.1|  small subunit ribosomal protein 8                       203   2e-61   
ref|XP_004078646.1|  PREDICTED: 40S ribosomal protein S8                204   2e-61   
ref|XP_010206685.1|  PREDICTED: 40S ribosomal protein S8                204   2e-61   
gb|ABR87480.1|  small subunit ribosomal protein 8                       203   2e-61   
gb|ABR87470.1|  small subunit ribosomal protein 8                       203   2e-61   
gb|ABR87481.1|  small subunit ribosomal protein 8                       203   2e-61   
ref|XP_009900328.1|  PREDICTED: 40S ribosomal protein S8                204   2e-61   
gb|AFM89547.1|  40S ribosomal protein S8                                204   3e-61   
ref|XP_010132709.1|  PREDICTED: 40S ribosomal protein S8                204   3e-61   
ref|XP_010221385.1|  PREDICTED: 40S ribosomal protein S8                205   3e-61   
ref|XP_008550312.1|  PREDICTED: 40S ribosomal protein S8                203   3e-61   
gb|ABR87473.1|  small subunit ribosomal protein 8                       203   3e-61   
gb|ADX97198.1|  40S ribosomal protein s8                                203   3e-61   
gb|AHW80321.1|  ribosomal protein                                       203   3e-61   
gb|KDE09590.1|  40S ribosomal protein S8                                203   3e-61   
gb|KFR05294.1|  40S ribosomal protein S8                                202   3e-61   
ref|XP_009883160.1|  PREDICTED: 40S ribosomal protein S8                205   3e-61   
ref|XP_009557252.1|  PREDICTED: 40S ribosomal protein S8                206   3e-61   
ref|XP_008922662.1|  PREDICTED: 40S ribosomal protein S8                204   3e-61   
gb|ABR87482.1|  small subunit ribosomal protein 8                       203   3e-61   
ref|XP_003380490.1|  tRNA guanosine-2'-O-methyltransferase TRM11-...    215   3e-61   
ref|XP_004699536.1|  PREDICTED: 40S ribosomal protein S8                203   3e-61   
gb|ADQ00177.1|  40S ribosomal protein S8                                202   3e-61   
ref|XP_010186644.1|  PREDICTED: 40S ribosomal protein S8                204   3e-61   
dbj|BAN20524.1|  ribosomal protein S8                                   203   3e-61   
ref|XP_011167792.1|  PREDICTED: 40S ribosomal protein S8                203   4e-61   
gb|ACH44381.1|  putative 40S ribosomal protein S8                       203   4e-61   
gb|AFM90684.1|  40S ribosomal protein S8                                203   4e-61   
ref|NP_001279579.1|  ribosomal protein S8                               203   4e-61   
gb|ACI12874.1|  40S ribosomal protein S8                                202   4e-61   
gb|ABR87471.1|  small subunit ribosomal protein 8                       202   4e-61   
gb|ABR87479.1|  small subunit ribosomal protein 8                       202   4e-61   
gb|ABR27879.1|  40S ribosomal protein S8                                203   4e-61   
ref|XP_007355914.1|  40S ribosomal protein S8                           203   4e-61   
ref|XP_009524162.1|  hypothetical protein PHYSODRAFT_285611             202   4e-61   
ref|XP_005238555.1|  PREDICTED: 40S ribosomal protein S8                205   5e-61   
ref|XP_001496811.2|  PREDICTED: 40S ribosomal protein S8                203   5e-61   
gb|AFM90919.1|  40S ribosomal protein S8                                203   5e-61   
gb|KFU96342.1|  40S ribosomal protein S8                                202   5e-61   
gb|KFO74706.1|  40S ribosomal protein S8                                202   5e-61   
gb|KFQ82334.1|  40S ribosomal protein S8                                202   5e-61   
gb|KFO98567.1|  40S ribosomal protein S8                                202   5e-61   
ref|XP_007509806.1|  40S ribosomal protein S8                           205   5e-61   
ref|XP_008432867.1|  PREDICTED: 40S ribosomal protein S8                202   5e-61   
ref|XP_005678610.1|  PREDICTED: 40S ribosomal protein S8                202   5e-61   
gb|ETL40555.1|  40S ribosomal protein S8                                202   6e-61   
emb|CAJ17173.1|  ribosomal protein S8e                                  202   6e-61   
gb|KFV04043.1|  40S ribosomal protein S8                                202   6e-61   
ref|XP_011258954.1|  PREDICTED: 40S ribosomal protein S8                202   6e-61   
gb|KFP85157.1|  40S ribosomal protein S8                                202   6e-61   
gb|KFM12948.1|  40S ribosomal protein S8                                202   6e-61   
ref|NP_001011604.2|  40S ribosomal protein S8                           202   7e-61   
ref|XP_011338463.1|  PREDICTED: 40S ribosomal protein S8                202   7e-61   
ref|NP_001003.1|  40S ribosomal protein S8                              202   7e-61   
ref|XP_010407761.1|  PREDICTED: 40S ribosomal protein S8                205   7e-61   
gb|ABR87468.1|  small subunit ribosomal protein 8                       202   7e-61   
gb|EFB13159.1|  hypothetical protein PANDA_016005                       202   8e-61   
gb|ABR87484.1|  small subunit ribosomal protein 8                       202   8e-61   
ref|XP_002129681.1|  PREDICTED: 40S ribosomal protein S8                202   8e-61   
gb|ERE86265.1|  40S ribosomal protein S8-like protein                   203   8e-61   
gb|EPQ17073.1|  40S ribosomal protein S8                                201   8e-61   
ref|XP_008947226.1|  PREDICTED: 40S ribosomal protein S8                202   8e-61   
ref|XP_006178510.1|  PREDICTED: 40S ribosomal protein S8                202   8e-61   
ref|XP_001085841.1|  PREDICTED: 40S ribosomal protein S8-like iso...    202   8e-61   
gb|ELR57442.1|  40S ribosomal protein S8                                202   9e-61   
gb|KFO88664.1|  40S ribosomal protein S8                                201   9e-61   
gb|AFL56733.1|  small subunit ribosomal protein 8                       202   9e-61   
ref|XP_011059444.1|  PREDICTED: 40S ribosomal protein S8                202   1e-60   
gb|AAV84252.1|  ribosomal protein S8                                    202   1e-60   
ref|XP_008514229.1|  PREDICTED: 40S ribosomal protein S8                202   1e-60   
gb|EQB77469.1|  40S ribosomal protein S8                                202   1e-60   
ref|XP_006745357.1|  PREDICTED: 40S ribosomal protein S8-like           202   1e-60   
gb|ABR87472.1|  small subunit ribosomal protein 8                       201   1e-60   
gb|AFM85641.1|  40S ribosomal protein S8                                202   1e-60   



>gb|ACN31997.1| unknown [Zea mays]
 gb|AFW66127.1| putative ribosomal protein S8e family protein [Zea mays]
 gb|AFW66131.1| putative ribosomal protein S8e family protein isoform 1 [Zea 
mays]
 gb|AFW66132.1| putative ribosomal protein S8e family protein isoform 2 [Zea 
mays]
 gb|AFW66139.1| putative ribosomal protein S8e family protein isoform 1 [Zea 
mays]
 gb|AFW66140.1| putative ribosomal protein S8e family protein isoform 2 [Zea 
mays]
Length=214

 Score =   300 bits (769),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 168/196 (86%), Positives = 177/196 (90%), Gaps = 2/196 (1%)
 Frame = -3

Query  761  KKAWRKKRKYEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKT  582
            +KAWRKKRKYE GRQPANTKLSSNKTVRR+RVRGGNVKWRALRLDTGNYSWGSEAVTRKT
Sbjct  11   QKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALRLDTGNYSWGSEAVTRKT  70

Query  581  RILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketae-  405
            RILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYL HYG DIGRKKK  A K+    
Sbjct  71   RILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLTHYGVDIGRKKKTPAAKKDNAE  130

Query  404  -etegvaaeetkKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGY  228
             +    AAEETKKSNHV RKLEKR++ R LD H+EEQFGSGRL+ACISSRPGQCGRADGY
Sbjct  131  GQEVEAAAEETKKSNHVTRKLEKRKEGRTLDPHIEEQFGSGRLLACISSRPGQCGRADGY  190

Query  227  ILEGKELEFYMKKIQR  180
            ILEGKELEFYMKK+QR
Sbjct  191  ILEGKELEFYMKKLQR  206



>ref|NP_001105391.1| 40S ribosomal protein S8 [Zea mays]
 ref|XP_008679873.1| PREDICTED: 40S ribosomal protein S8 [Zea mays]
 ref|XP_008679875.1| PREDICTED: 40S ribosomal protein S8 [Zea mays]
 ref|XP_008679877.1| PREDICTED: 40S ribosomal protein S8 isoform X2 [Zea mays]
 sp|Q08069.2|RS8_MAIZE RecName: Full=40S ribosomal protein S8 [Zea mays]
 gb|AAB06330.1| ribosomal protein S8 [Zea mays]
 gb|ACF80433.1| unknown [Zea mays]
 gb|ACG24637.1| 40S ribosomal protein S8 [Zea mays]
 gb|AFW66125.1| putative ribosomal protein S8e family protein [Zea mays]
 gb|AFW66129.1| putative ribosomal protein S8e family protein [Zea mays]
 gb|AFW66130.1| putative ribosomal protein S8e family protein [Zea mays]
 gb|AFW66138.1| putative ribosomal protein S8e family protein [Zea mays]
 gb|AFW66142.1| putative ribosomal protein S8e family protein [Zea mays]
Length=221

 Score =   300 bits (769),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 168/196 (86%), Positives = 177/196 (90%), Gaps = 2/196 (1%)
 Frame = -3

Query  761  KKAWRKKRKYEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKT  582
            +KAWRKKRKYE GRQPANTKLSSNKTVRR+RVRGGNVKWRALRLDTGNYSWGSEAVTRKT
Sbjct  18   QKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALRLDTGNYSWGSEAVTRKT  77

Query  581  RILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketae-  405
            RILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYL HYG DIGRKKK  A K+    
Sbjct  78   RILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLTHYGVDIGRKKKTPAAKKDNAE  137

Query  404  -etegvaaeetkKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGY  228
             +    AAEETKKSNHV RKLEKR++ R LD H+EEQFGSGRL+ACISSRPGQCGRADGY
Sbjct  138  GQEVEAAAEETKKSNHVTRKLEKRKEGRTLDPHIEEQFGSGRLLACISSRPGQCGRADGY  197

Query  227  ILEGKELEFYMKKIQR  180
            ILEGKELEFYMKK+QR
Sbjct  198  ILEGKELEFYMKKLQR  213



>ref|NP_001046866.1| Os02g0489400 [Oryza sativa Japonica Group]
 sp|P49199.2|RS8_ORYSJ RecName: Full=40S ribosomal protein S8 [Oryza sativa Japonica 
Group]
 pdb|3J60|I Chain I, Localization Of The Small Subunit Ribosomal Proteins 
Into A 5.5 A Cryo-em Map Of Triticum Aestivum Translating 80s 
Ribosome
 dbj|BAD21871.1| putative 40S ribosomal protein S8 [Oryza sativa Japonica Group]
 dbj|BAD21876.1| putative 40S ribosomal protein S8 [Oryza sativa Japonica Group]
 dbj|BAF08780.1| Os02g0489400 [Oryza sativa Japonica Group]
 dbj|BAG95703.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC73196.1| hypothetical protein OsI_07259 [Oryza sativa Indica Group]
 gb|EEE57012.1| hypothetical protein OsJ_06781 [Oryza sativa Japonica Group]
Length=220

 Score =   299 bits (766),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 169/195 (87%), Positives = 178/195 (91%), Gaps = 1/195 (1%)
 Frame = -3

Query  761  KKAWRKKRKYEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKT  582
            +KAWRKKRKYE GRQPANTKLSSNKTVRR+RVRGGNVKWRALRLDTGNYSWGSEAVTRKT
Sbjct  18   QKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALRLDTGNYSWGSEAVTRKT  77

Query  581  RILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketae-  405
            RILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYL HYG DIGRKKKA A K+ AE 
Sbjct  78   RILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLTHYGVDIGRKKKAPAAKKDAEG  137

Query  404  etegvaaeetkKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYI  225
            +      EE KKSNHV RKLEKRQ+ R LD+H+EEQFGSGRL+ACISSRPGQCGRADGYI
Sbjct  138  QDAEATTEEAKKSNHVVRKLEKRQQGRTLDAHIEEQFGSGRLLACISSRPGQCGRADGYI  197

Query  224  LEGKELEFYMKKIQR  180
            LEGKELEFYMKK+QR
Sbjct  198  LEGKELEFYMKKLQR  212



>ref|XP_002446216.1| hypothetical protein SORBIDRAFT_06g004770 [Sorghum bicolor]
 gb|EES10544.1| hypothetical protein SORBIDRAFT_06g004770 [Sorghum bicolor]
Length=220

 Score =   299 bits (766),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 170/195 (87%), Positives = 180/195 (92%), Gaps = 1/195 (1%)
 Frame = -3

Query  761  KKAWRKKRKYEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKT  582
            +KAWRKKRKYE GRQPANTKLSSNKTVRR+RVRGGNVKWRALRLDTGNYSWGSEA+TRKT
Sbjct  18   QKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALRLDTGNYSWGSEALTRKT  77

Query  581  RILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketae-  405
            RILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYL HYG DIGRKK   AKK+ AE 
Sbjct  78   RILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLTHYGVDIGRKKVPVAKKDAAEG  137

Query  404  etegvaaeetkKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYI  225
            +     AEETKKSNHVQRKLEKRQ+ R LD+H+EEQFGSGRL+ACISSRPGQCGRADGYI
Sbjct  138  QEGEAIAEETKKSNHVQRKLEKRQQGRALDTHIEEQFGSGRLLACISSRPGQCGRADGYI  197

Query  224  LEGKELEFYMKKIQR  180
            LEGKELEFYMKK+QR
Sbjct  198  LEGKELEFYMKKLQR  212



>ref|NP_001052526.1| Os04g0349500 [Oryza sativa Japonica Group]
 emb|CAE05511.1| OSJNBa0038P21.4 [Oryza sativa Japonica Group]
 dbj|BAF14440.1| Os04g0349500 [Oryza sativa Japonica Group]
 gb|EAZ30323.1| hypothetical protein OsJ_14370 [Oryza sativa Japonica Group]
 dbj|BAG90858.1| unnamed protein product [Oryza sativa Japonica Group]
Length=221

 Score =   299 bits (766),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 169/196 (86%), Positives = 178/196 (91%), Gaps = 2/196 (1%)
 Frame = -3

Query  761  KKAWRKKRKYEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKT  582
            +KAWRKKRKYE GRQPANTKLSSNKTVRR+RVRGGN+KWRALRLDTGNYSWGSEAVTRKT
Sbjct  18   QKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNLKWRALRLDTGNYSWGSEAVTRKT  77

Query  581  RILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketae-  405
            RILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYL HYG DIGRKKKA A K+ A  
Sbjct  78   RILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLTHYGVDIGRKKKAPAAKKDAAE  137

Query  404  -etegvaaeetkKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGY  228
             +    A EE KKSNHV RKLEKRQ+ R LDSH+EEQFGSGRL+ACISSRPGQCGRADGY
Sbjct  138  GQEGEAATEEAKKSNHVVRKLEKRQQTRTLDSHIEEQFGSGRLLACISSRPGQCGRADGY  197

Query  227  ILEGKELEFYMKKIQR  180
            ILEGKELEFYMKK+QR
Sbjct  198  ILEGKELEFYMKKLQR  213



>ref|XP_010097296.1| 40S ribosomal protein S8 [Morus notabilis]
 gb|EXB67448.1| 40S ribosomal protein S8 [Morus notabilis]
Length=215

 Score =   298 bits (764),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 166/198 (84%), Positives = 174/198 (88%), Gaps = 4/198 (2%)
 Frame = -3

Query  761  KKAWRKKRKYEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKT  582
            KKAWRKKRKYE GRQ ANTKLSS+KTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKT
Sbjct  11   KKAWRKKRKYELGRQSANTKLSSDKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKT  70

Query  581  RILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketaee  402
            RILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG DIGRKKK +A    A  
Sbjct  71   RILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVDIGRKKKTSAAAAAAAA  130

Query  401  ----tegvaaeetkKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRAD  234
                    A EE KKS+HV RKLEKRQ+ R LD+H+EEQF SGRL+ACISSRPGQCGRAD
Sbjct  131  QEGDAAAAATEEAKKSSHVLRKLEKRQQNRVLDAHIEEQFSSGRLLACISSRPGQCGRAD  190

Query  233  GYILEGKELEFYMKKIQR  180
            GYILEGKELEFYMKK+QR
Sbjct  191  GYILEGKELEFYMKKLQR  208



>gb|EAY93669.1| hypothetical protein OsI_15456 [Oryza sativa Indica Group]
Length=221

 Score =   298 bits (763),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 168/196 (86%), Positives = 178/196 (91%), Gaps = 2/196 (1%)
 Frame = -3

Query  761  KKAWRKKRKYEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKT  582
            +KAWRKKRKYE GRQPANTKLSSNKTVRR+RVRGGN+KWRALRLDTGNYSWGSEAVTRKT
Sbjct  18   QKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNLKWRALRLDTGNYSWGSEAVTRKT  77

Query  581  RILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketae-  405
            RILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYL HYG DIGRKKKA A K+ A  
Sbjct  78   RILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLTHYGVDIGRKKKAPAAKKDAAE  137

Query  404  -etegvaaeetkKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGY  228
             +    A EE KKSNHV RKLEKRQ+ R LD+H+EEQFGSGRL+ACISSRPGQCGRADGY
Sbjct  138  GQEGEAATEEAKKSNHVVRKLEKRQQTRTLDAHIEEQFGSGRLLACISSRPGQCGRADGY  197

Query  227  ILEGKELEFYMKKIQR  180
            ILEGKELEFYMKK+QR
Sbjct  198  ILEGKELEFYMKKLQR  213



>ref|NP_001132384.1| uncharacterized protein LOC100193830 [Zea mays]
 gb|ACF81204.1| unknown [Zea mays]
Length=221

 Score =   298 bits (763),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 167/196 (85%), Positives = 179/196 (91%), Gaps = 2/196 (1%)
 Frame = -3

Query  761  KKAWRKKRKYEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKT  582
            +KAWRKKRKYE GRQPANTKLSSNKTVRR+RVRGGNVKWRALRLDTGNYSWGSEA+TRKT
Sbjct  18   QKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALRLDTGNYSWGSEALTRKT  77

Query  581  RILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkk--aaakketa  408
            RILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYL HYG DIGRKKK   A K  T 
Sbjct  78   RILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLTHYGVDIGRKKKVPVAKKDATE  137

Query  407  eetegvaaeetkKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGY  228
             +     AEETKKSNHVQRK+EKRQ++R LD+H+EEQFGSGRL+ACIS+RPGQCGRADGY
Sbjct  138  GQEGEAIAEETKKSNHVQRKIEKRQQDRALDTHIEEQFGSGRLLACISARPGQCGRADGY  197

Query  227  ILEGKELEFYMKKIQR  180
            ILEGKELEFYMKK+QR
Sbjct  198  ILEGKELEFYMKKLQR  213



>ref|XP_008679872.1| PREDICTED: 40S ribosomal protein S8-like [Zea mays]
Length=301

 Score =   301 bits (770),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 168/196 (86%), Positives = 177/196 (90%), Gaps = 2/196 (1%)
 Frame = -3

Query  761  KKAWRKKRKYEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKT  582
            +KAWRKKRKYE GRQPANTKLSSNKTVRR+RVRGGNVKWRALRLDTGNYSWGSEAVTRKT
Sbjct  98   QKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALRLDTGNYSWGSEAVTRKT  157

Query  581  RILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketae-  405
            RILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYL HYG DIGRKKK  A K+    
Sbjct  158  RILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLTHYGVDIGRKKKTPAAKKDNAE  217

Query  404  -etegvaaeetkKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGY  228
             +    AAEETKKSNHV RKLEKR++ R LD H+EEQFGSGRL+ACISSRPGQCGRADGY
Sbjct  218  GQEVEAAAEETKKSNHVTRKLEKRKEGRTLDPHIEEQFGSGRLLACISSRPGQCGRADGY  277

Query  227  ILEGKELEFYMKKIQR  180
            ILEGKELEFYMKK+QR
Sbjct  278  ILEGKELEFYMKKLQR  293



>dbj|BAA07207.1| ribosomal protein S8 [Oryza sativa Japonica Group]
Length=220

 Score =   298 bits (762),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 164/195 (84%), Positives = 172/195 (88%), Gaps = 1/195 (1%)
 Frame = -3

Query  761  KKAWRKKRKYEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKT  582
            +KAWRKKRKYE GRQPANTKLSSNKTVRR+RVRGGNVKWRALRLDTGNYSWGSEAVTRKT
Sbjct  18   QKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALRLDTGNYSWGSEAVTRKT  77

Query  581  RILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakket-ae  405
            RILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYL HYG DIGRKKK          
Sbjct  78   RILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLTHYGVDIGRKKKEPPHPRGCCG  137

Query  404  etegvaaeetkKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYI  225
            +      EE KKSNHV RKLEKRQ+ R LD+H+EEQFGSGRL+ACISSRPGQCGRADGYI
Sbjct  138  QDAEATTEEAKKSNHVVRKLEKRQQGRTLDAHIEEQFGSGRLLACISSRPGQCGRADGYI  197

Query  224  LEGKELEFYMKKIQR  180
            LEGKELEFYMKK+QR
Sbjct  198  LEGKELEFYMKKLQR  212



>ref|XP_006652189.1| PREDICTED: 40S ribosomal protein S8-like [Oryza brachyantha]
Length=214

 Score =   297 bits (761),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 170/196 (87%), Positives = 178/196 (91%), Gaps = 2/196 (1%)
 Frame = -3

Query  761  KKAWRKKRKYEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKT  582
            +KAWRKKRKYE GRQPANTKLSSNKTVRR+RVRGGNVKWRALRLDTGNYSWGSEAVTRKT
Sbjct  11   QKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALRLDTGNYSWGSEAVTRKT  70

Query  581  RILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakket--a  408
            RILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYL HYG DIGRKKKA A K+    
Sbjct  71   RILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLTHYGVDIGRKKKAPAAKKDAVE  130

Query  407  eetegvaaeetkKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGY  228
             +    AAEETKKSNHV RKLEKRQ+ R LD H+EEQFGSGRL+ACISSRPGQCGRADGY
Sbjct  131  GQEGEAAAEETKKSNHVVRKLEKRQQGRTLDPHIEEQFGSGRLLACISSRPGQCGRADGY  190

Query  227  ILEGKELEFYMKKIQR  180
            ILEGKELEFYMKK+QR
Sbjct  191  ILEGKELEFYMKKLQR  206



>ref|XP_002452585.1| hypothetical protein SORBIDRAFT_04g028530 [Sorghum bicolor]
 gb|EES05561.1| hypothetical protein SORBIDRAFT_04g028530 [Sorghum bicolor]
Length=221

 Score =   296 bits (758),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 167/196 (85%), Positives = 178/196 (91%), Gaps = 2/196 (1%)
 Frame = -3

Query  761  KKAWRKKRKYEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKT  582
            +KAWRKKRKYE GRQPANTKLSSNKTVRR+RVRGGNVKWRALRLDTGNYSWGSEAVTRKT
Sbjct  18   QKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALRLDTGNYSWGSEAVTRKT  77

Query  581  RILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGR--kkkaaakketa  408
            RILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYL HYG DIGR  K  AA K+   
Sbjct  78   RILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLTHYGVDIGRKKKAPAAKKEAAE  137

Query  407  eetegvaaeetkKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGY  228
             +    AAEE KKSNHV+RKLEKRQ+ R+LD+H+EEQFGSGRL+ACISSRPGQCGRADGY
Sbjct  138  GQEGEAAAEEAKKSNHVKRKLEKRQEGRELDAHIEEQFGSGRLLACISSRPGQCGRADGY  197

Query  227  ILEGKELEFYMKKIQR  180
            ILEGKELEFYMKK+QR
Sbjct  198  ILEGKELEFYMKKLQR  213



>ref|XP_006648644.1| PREDICTED: 40S ribosomal protein S8-like [Oryza brachyantha]
Length=213

 Score =   295 bits (756),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 166/195 (85%), Positives = 176/195 (90%), Gaps = 1/195 (1%)
 Frame = -3

Query  761  KKAWRKKRKYEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKT  582
            +KAWRKKRKYE GRQPANTKLSSNKTVRR+RVRGGNVKWRALRLDTGNYSWGSEAVTRKT
Sbjct  11   QKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALRLDTGNYSWGSEAVTRKT  70

Query  581  RILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketae-  405
            R+LDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYL HYG DIGRKKKA A K+ AE 
Sbjct  71   RVLDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLTHYGVDIGRKKKAPAAKKDAEG  130

Query  404  etegvaaeetkKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYI  225
            +      EE KKSNHV RK+EKRQ+ R LD H+EEQF SGRL+ACISSRPGQCGRADGYI
Sbjct  131  QDAEATTEEAKKSNHVIRKIEKRQEGRTLDPHIEEQFSSGRLLACISSRPGQCGRADGYI  190

Query  224  LEGKELEFYMKKIQR  180
            LEGKELEFYMKK+QR
Sbjct  191  LEGKELEFYMKKLQR  205



>ref|XP_010483522.1| PREDICTED: 40S ribosomal protein S8-2-like [Camelina sativa]
Length=220

 Score =   292 bits (747),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 167/189 (88%), Positives = 174/189 (92%), Gaps = 0/189 (0%)
 Frame = -3

Query  761  KKAWRKKRKYEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKT  582
            +K WRKKRKYE GRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKT
Sbjct  18   QKMWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKT  77

Query  581  RILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketaee  402
            R+LDV YNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG DIGRKKKAAA K+  EE
Sbjct  78   RVLDVAYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVDIGRKKKAAASKKEGEE  137

Query  401  tegvaaeetkKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYIL  222
             + VA E+ KKSNHVQRKLE RQ+ R LDSHLEEQF SGRL+ACISSRPGQCGRADGYIL
Sbjct  138  GDAVATEDVKKSNHVQRKLEIRQEGRALDSHLEEQFSSGRLLACISSRPGQCGRADGYIL  197

Query  221  EGKELEFYM  195
            EGKELEFYM
Sbjct  198  EGKELEFYM  206



>gb|KHG08050.1| 40S ribosomal S8 [Gossypium arboreum]
Length=218

 Score =   290 bits (743),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 166/185 (90%), Positives = 170/185 (92%), Gaps = 0/185 (0%)
 Frame = -3

Query  734  YEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  555
            YE GRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA
Sbjct  27   YELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  86

Query  554  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketaeetegvaaeet  375
            SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG DIGRKKKAAA  +   E    A EE 
Sbjct  87   SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVDIGRKKKAAAAAKKEGEEGETATEEV  146

Query  374  kKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEGKELEFYM  195
            KKSNHV RKLEKRQ+ RKLDSH+EEQFGSGRL+ACISSRPGQCGRADGYILEGKELEFYM
Sbjct  147  KKSNHVLRKLEKRQQSRKLDSHIEEQFGSGRLLACISSRPGQCGRADGYILEGKELEFYM  206

Query  194  KKIQR  180
            KKIQR
Sbjct  207  KKIQR  211



>ref|XP_010454644.1| PREDICTED: 40S ribosomal protein S8-2 [Camelina sativa]
Length=218

 Score =   289 bits (740),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 162/189 (86%), Positives = 168/189 (89%), Gaps = 2/189 (1%)
 Frame = -3

Query  761  KKAWRKKRKYEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKT  582
            +K WRKKRKYE GRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKT
Sbjct  18   QKMWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKT  77

Query  581  RILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketaee  402
            R+LDV YNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG DIGR  K  A     +E
Sbjct  78   RVLDVAYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVDIGR--KKKAAAAATKE  135

Query  401  tegvaaeetkKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYIL  222
             + VA EE KKSNHVQRKLE RQ+ R LDSHLEEQF SGRL+ACISSRPGQCGRADGYIL
Sbjct  136  GDAVATEEVKKSNHVQRKLETRQEGRALDSHLEEQFSSGRLLACISSRPGQCGRADGYIL  195

Query  221  EGKELEFYM  195
            EGKELEFYM
Sbjct  196  EGKELEFYM  204



>ref|XP_004953910.1| PREDICTED: 40S ribosomal protein S8-like [Setaria italica]
Length=221

 Score =   288 bits (737),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 165/191 (86%), Positives = 173/191 (91%), Gaps = 2/191 (1%)
 Frame = -3

Query  761  KKAWRKKRKYEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKT  582
            +KAWRKKRKYE GRQPANTKLSSNKTVRR+RVRGGNVKWRALRLDTGNYSWGSEAVTRKT
Sbjct  18   QKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALRLDTGNYSWGSEAVTRKT  77

Query  581  RILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakke--ta  408
            RILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYL HYG DIGRKKKA A K+    
Sbjct  78   RILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLTHYGVDIGRKKKAPAAKKDGAE  137

Query  407  eetegvaaeetkKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGY  228
             +    AAEETKKSNHVQRKLEKR+  R LD H+EEQFGSGRL+ACI+SRPGQCGRADGY
Sbjct  138  GQEGEAAAEETKKSNHVQRKLEKRKDGRALDPHIEEQFGSGRLLACIASRPGQCGRADGY  197

Query  227  ILEGKELEFYM  195
            ILEGKELEFYM
Sbjct  198  ILEGKELEFYM  208



>ref|XP_004242427.1| PREDICTED: 40S ribosomal protein S8 [Solanum lycopersicum]
Length=220

 Score =   288 bits (736),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 168/190 (88%), Positives = 173/190 (91%), Gaps = 1/190 (1%)
 Frame = -3

Query  761  KKAWRKKRKYEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKT  582
            +K WRKKRKYE GRQPANTK+SSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEA TRKT
Sbjct  18   QKTWRKKRKYELGRQPANTKISSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEATTRKT  77

Query  581  RILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketaee  402
            RILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG DIGRKKK AA K+   E
Sbjct  78   RILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVDIGRKKKGAAAKKETAE  137

Query  401  t-egvaaeetkKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYI  225
              +G A EETKKSNHV RK+EKRQ ERKLDSHLEEQF SGRL ACISSRPGQCGRADGYI
Sbjct  138  EGDGAATEETKKSNHVLRKIEKRQAERKLDSHLEEQFSSGRLYACISSRPGQCGRADGYI  197

Query  224  LEGKELEFYM  195
            LEGKELEFYM
Sbjct  198  LEGKELEFYM  207



>ref|XP_006373483.1| hypothetical protein POPTR_0017s14180g [Populus trichocarpa]
 gb|ERP51280.1| hypothetical protein POPTR_0017s14180g [Populus trichocarpa]
Length=220

 Score =   288 bits (736),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 165/185 (89%), Positives = 170/185 (92%), Gaps = 0/185 (0%)
 Frame = -3

Query  734  YEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  555
            YE GRQPA+TKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA
Sbjct  27   YELGRQPASTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  86

Query  554  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketaeetegvaaeet  375
            SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG DIGRKKKA  KKET E+      EET
Sbjct  87   SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVDIGRKKKAVVKKETPEQEGEATTEET  146

Query  374  kKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEGKELEFYM  195
            KKSNHV RKLEKRQ+ RKLD H+EEQFGSGRL+A ISSRPGQCGRADGYILEGKELEFYM
Sbjct  147  KKSNHVIRKLEKRQQVRKLDPHIEEQFGSGRLLASISSRPGQCGRADGYILEGKELEFYM  206

Query  194  KKIQR  180
            KKIQR
Sbjct  207  KKIQR  211



>ref|XP_011021175.1| PREDICTED: 40S ribosomal protein S8 isoform X1 [Populus euphratica]
Length=218

 Score =   287 bits (735),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 165/185 (89%), Positives = 170/185 (92%), Gaps = 0/185 (0%)
 Frame = -3

Query  734  YEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  555
            YE GRQPA+TKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA
Sbjct  27   YELGRQPASTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  86

Query  554  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketaeetegvaaeet  375
            SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG DIGRKKKA  KKET E+      EET
Sbjct  87   SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVDIGRKKKAVVKKETPEQEGEATTEET  146

Query  374  kKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEGKELEFYM  195
            KKSNHV RKLEKRQ+ RKLD H+EEQFGSGRL+A ISSRPGQCGRADGYILEGKELEFYM
Sbjct  147  KKSNHVIRKLEKRQQGRKLDPHIEEQFGSGRLLASISSRPGQCGRADGYILEGKELEFYM  206

Query  194  KKIQR  180
            KKIQR
Sbjct  207  KKIQR  211



>ref|XP_004975334.1| PREDICTED: 40S ribosomal protein S8-like [Setaria italica]
Length=221

 Score =   288 bits (736),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 164/191 (86%), Positives = 173/191 (91%), Gaps = 2/191 (1%)
 Frame = -3

Query  761  KKAWRKKRKYEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKT  582
            +KAWRKKRKYE GRQPANTKLSSNKTVRR+RVRGGNVKWRALRLDTGNYSWGSEAVTRKT
Sbjct  18   QKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALRLDTGNYSWGSEAVTRKT  77

Query  581  RILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketae-  405
            RILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYL HYG DIGRKKKA A K+ A  
Sbjct  78   RILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLTHYGVDIGRKKKAPAAKKDAAE  137

Query  404  -etegvaaeetkKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGY  228
             +     AEETKKSNHV RKLEKR+  R+LD H+EEQFGSGRL+ACI+SRPGQCGRADGY
Sbjct  138  GQEGEAVAEETKKSNHVTRKLEKRKVGRQLDPHIEEQFGSGRLLACIASRPGQCGRADGY  197

Query  227  ILEGKELEFYM  195
            ILEGKELEFYM
Sbjct  198  ILEGKELEFYM  208



>ref|XP_011008256.1| PREDICTED: 40S ribosomal protein S8-like [Populus euphratica]
 ref|XP_011015899.1| PREDICTED: 40S ribosomal protein S8-like [Populus euphratica]
Length=220

 Score =   287 bits (735),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 163/185 (88%), Positives = 167/185 (90%), Gaps = 0/185 (0%)
 Frame = -3

Query  734  YEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  555
            YE GRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA
Sbjct  27   YELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  86

Query  554  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketaeetegvaaeet  375
            SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG DIGRKKK A   +   E    A EE 
Sbjct  87   SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVDIGRKKKTAPAAKKEGEDGEAAVEEE  146

Query  374  kKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEGKELEFYM  195
            KKSNHVQRKLEKRQ+ RKLD H+EEQFGSGRL+A ISSRPGQCGRADGYILEGKELEFYM
Sbjct  147  KKSNHVQRKLEKRQQTRKLDPHIEEQFGSGRLLASISSRPGQCGRADGYILEGKELEFYM  206

Query  194  KKIQR  180
            KKIQR
Sbjct  207  KKIQR  211



>gb|KJB84080.1| hypothetical protein B456_N005000 [Gossypium raimondii]
Length=219

 Score =   286 bits (733),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 168/185 (91%), Positives = 172/185 (93%), Gaps = 1/185 (1%)
 Frame = -3

Query  734  YEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  555
            YE GRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA
Sbjct  27   YELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  86

Query  554  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketaeetegvaaeet  375
            SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG DIGR KK  A K+ A E   VAAEET
Sbjct  87   SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVDIGR-KKKTAAKKEATEDGEVAAEET  145

Query  374  kKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEGKELEFYM  195
            KKSNHV RKLEKRQKER LD+H+EEQFGSGRL+ACISSRPGQCGRADGYILEGKELEFYM
Sbjct  146  KKSNHVLRKLEKRQKERTLDAHIEEQFGSGRLLACISSRPGQCGRADGYILEGKELEFYM  205

Query  194  KKIQR  180
            KKIQR
Sbjct  206  KKIQR  210



>gb|KHG04827.1| 40S ribosomal S8 [Gossypium arboreum]
Length=219

 Score =   286 bits (733),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 167/185 (90%), Positives = 171/185 (92%), Gaps = 1/185 (1%)
 Frame = -3

Query  734  YEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  555
            YE GRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA
Sbjct  27   YELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  86

Query  554  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketaeetegvaaeet  375
            SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG DIGR KK  A K+ A E   VA EET
Sbjct  87   SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVDIGR-KKKTAAKKEATEEGEVAVEET  145

Query  374  kKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEGKELEFYM  195
            KKSNHVQRK EKRQKER LD+H+EEQFGSGRL+ACISSRPGQCGRADGYILEGKELEFYM
Sbjct  146  KKSNHVQRKHEKRQKERTLDAHIEEQFGSGRLLACISSRPGQCGRADGYILEGKELEFYM  205

Query  194  KKIQR  180
            KKIQR
Sbjct  206  KKIQR  210



>gb|KJB62960.1| hypothetical protein B456_009G445800 [Gossypium raimondii]
Length=211

 Score =   286 bits (731),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 162/185 (88%), Positives = 168/185 (91%), Gaps = 0/185 (0%)
 Frame = -3

Query  734  YEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  555
            YE GRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA
Sbjct  20   YELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  79

Query  554  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketaeetegvaaeet  375
            SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG DIGRKKKAAA  +   E    A EE 
Sbjct  80   SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVDIGRKKKAAAGAKKEGEEGETATEEV  139

Query  374  kKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEGKELEFYM  195
            KKS+HV RKLEKRQ+ R LD H+EEQFGSGRL+ACISSRPGQCGRADGYILEGKELEFYM
Sbjct  140  KKSSHVLRKLEKRQQSRTLDPHIEEQFGSGRLLACISSRPGQCGRADGYILEGKELEFYM  199

Query  194  KKIQR  180
            KK+QR
Sbjct  200  KKMQR  204



>ref|XP_010252680.1| PREDICTED: 40S ribosomal protein S8 [Nelumbo nucifera]
Length=220

 Score =   286 bits (732),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 159/185 (86%), Positives = 166/185 (90%), Gaps = 0/185 (0%)
 Frame = -3

Query  734  YEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  555
            YE GRQPANTKLSSNKTVRR+RVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA
Sbjct  27   YELGRQPANTKLSSNKTVRRVRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  86

Query  554  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketaeetegvaaeet  375
            SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG DIGRKKK++A  +   E      EE 
Sbjct  87   SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVDIGRKKKSSASAKKEGEDGEATTEEA  146

Query  374  kKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEGKELEFYM  195
            KKSNHV RKLEKRQ+  KLD H+EEQFGSGRL+A ISSRPGQCGRADGYILEGKELEFYM
Sbjct  147  KKSNHVLRKLEKRQQGHKLDPHIEEQFGSGRLLAAISSRPGQCGRADGYILEGKELEFYM  206

Query  194  KKIQR  180
            KKIQR
Sbjct  207  KKIQR  211



>ref|XP_004240435.1| PREDICTED: 40S ribosomal protein S8-2 [Solanum lycopersicum]
Length=220

 Score =   286 bits (731),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 164/189 (87%), Positives = 170/189 (90%), Gaps = 1/189 (1%)
 Frame = -3

Query  761  KKAWRKKRKYEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKT  582
            +K WRKKRKYE GRQPANTK+SSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKT
Sbjct  18   QKTWRKKRKYELGRQPANTKISSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKT  77

Query  581  RILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketaee  402
            RILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG DI  +KK  A K+    
Sbjct  78   RILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGIDI-GRKKKGAAKKETTT  136

Query  401  tegvaaeetkKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYIL  222
             EG AAEE KKSNHV RK+EKRQK+R LDSHLEEQF SGRL ACISSRPGQCGRADGYIL
Sbjct  137  EEGDAAEEAKKSNHVVRKIEKRQKDRTLDSHLEEQFSSGRLYACISSRPGQCGRADGYIL  196

Query  221  EGKELEFYM  195
            EGKELEFYM
Sbjct  197  EGKELEFYM  205



>gb|KJB62959.1| hypothetical protein B456_009G445800 [Gossypium raimondii]
Length=218

 Score =   286 bits (731),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 162/185 (88%), Positives = 168/185 (91%), Gaps = 0/185 (0%)
 Frame = -3

Query  734  YEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  555
            YE GRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA
Sbjct  27   YELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  86

Query  554  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketaeetegvaaeet  375
            SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG DIGRKKKAAA  +   E    A EE 
Sbjct  87   SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVDIGRKKKAAAGAKKEGEEGETATEEV  146

Query  374  kKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEGKELEFYM  195
            KKS+HV RKLEKRQ+ R LD H+EEQFGSGRL+ACISSRPGQCGRADGYILEGKELEFYM
Sbjct  147  KKSSHVLRKLEKRQQSRTLDPHIEEQFGSGRLLACISSRPGQCGRADGYILEGKELEFYM  206

Query  194  KKIQR  180
            KK+QR
Sbjct  207  KKMQR  211



>gb|KJB81682.1| hypothetical protein B456_013G156600 [Gossypium raimondii]
Length=196

 Score =   285 bits (728),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 160/186 (86%), Positives = 167/186 (90%), Gaps = 1/186 (1%)
 Frame = -3

Query  737  KYEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYN  558
            +YE GRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYN
Sbjct  5    RYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYN  64

Query  557  ASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketaeetegvaaee  378
            ASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG DIGR KK +A  +   E    A EE
Sbjct  65   ASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGIDIGR-KKKSAAAKKEGEEGETATEE  123

Query  377  tkKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEGKELEFY  198
             KKSNH+ RKLEKRQ+ R LD H+EEQFGSGRL+ACISSRPGQCGRADGYILEGKELEFY
Sbjct  124  VKKSNHILRKLEKRQQNRALDPHIEEQFGSGRLLACISSRPGQCGRADGYILEGKELEFY  183

Query  197  MKKIQR  180
            MKKIQR
Sbjct  184  MKKIQR  189



>gb|KDP39216.1| hypothetical protein JCGZ_00973 [Jatropha curcas]
Length=219

 Score =   285 bits (729),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 161/185 (87%), Positives = 164/185 (89%), Gaps = 1/185 (1%)
 Frame = -3

Query  734  YEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  555
            YE GRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA
Sbjct  27   YELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  86

Query  554  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketaeetegvaaeet  375
            SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG DIGR KK  A  +   E    A EE 
Sbjct  87   SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVDIGR-KKKVAATKKEGEEGEGATEEV  145

Query  374  kKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEGKELEFYM  195
            KKSNHV RKLEKRQ+ RKLD H+EEQF  GRLMACISSRPGQCGRADGYILEGKELEFYM
Sbjct  146  KKSNHVLRKLEKRQQTRKLDPHIEEQFAGGRLMACISSRPGQCGRADGYILEGKELEFYM  205

Query  194  KKIQR  180
            KKIQR
Sbjct  206  KKIQR  210



>ref|XP_010060252.1| PREDICTED: 40S ribosomal protein S8 [Eucalyptus grandis]
 gb|KCW66870.1| hypothetical protein EUGRSUZ_F00627 [Eucalyptus grandis]
Length=219

 Score =   285 bits (728),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 161/185 (87%), Positives = 165/185 (89%), Gaps = 0/185 (0%)
 Frame = -3

Query  734  YEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  555
            YE GRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA
Sbjct  27   YELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  86

Query  554  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketaeetegvaaeet  375
            SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG DIGRKKK  A  +   E     AEE 
Sbjct  87   SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVDIGRKKKNQASAKKEGEEAEAPAEEV  146

Query  374  kKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEGKELEFYM  195
            KKS+HV RKLEKRQ ERKLD H+EEQF SGRL+A ISSRPGQCGRADGYILEGKELEFYM
Sbjct  147  KKSSHVLRKLEKRQTERKLDQHIEEQFSSGRLLASISSRPGQCGRADGYILEGKELEFYM  206

Query  194  KKIQR  180
            KKIQR
Sbjct  207  KKIQR  211



>gb|KJB22660.1| hypothetical protein B456_004G059300 [Gossypium raimondii]
Length=212

 Score =   285 bits (728),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 163/188 (87%), Positives = 171/188 (91%), Gaps = 1/188 (1%)
 Frame = -3

Query  761  KKAWRKKRKYEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKT  582
            +KAWRKKRKYE GRQP NTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSE+VTRKT
Sbjct  11   QKAWRKKRKYELGRQPGNTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSESVTRKT  70

Query  581  RILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketaee  402
            RILDVVYNASNNELVRTQTLVKSAI+QVDAAPFKQWYLQHYG DIGR KK  A K+ A E
Sbjct  71   RILDVVYNASNNELVRTQTLVKSAIIQVDAAPFKQWYLQHYGIDIGR-KKKMASKKEATE  129

Query  401  tegvaaeetkKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYIL  222
                AAEETK+S HV RKLEKRQK+RKLD H+EEQFG GRL+ACISSRPGQCGRADGYIL
Sbjct  130  EPEGAAEETKRSKHVARKLEKRQKDRKLDPHVEEQFGGGRLLACISSRPGQCGRADGYIL  189

Query  221  EGKELEFY  198
            EGKELEFY
Sbjct  190  EGKELEFY  197



>gb|KJB22659.1| hypothetical protein B456_004G059300 [Gossypium raimondii]
Length=219

 Score =   285 bits (728),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 163/188 (87%), Positives = 171/188 (91%), Gaps = 1/188 (1%)
 Frame = -3

Query  761  KKAWRKKRKYEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKT  582
            +KAWRKKRKYE GRQP NTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSE+VTRKT
Sbjct  18   QKAWRKKRKYELGRQPGNTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSESVTRKT  77

Query  581  RILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketaee  402
            RILDVVYNASNNELVRTQTLVKSAI+QVDAAPFKQWYLQHYG DIGR KK  A K+ A E
Sbjct  78   RILDVVYNASNNELVRTQTLVKSAIIQVDAAPFKQWYLQHYGIDIGR-KKKMASKKEATE  136

Query  401  tegvaaeetkKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYIL  222
                AAEETK+S HV RKLEKRQK+RKLD H+EEQFG GRL+ACISSRPGQCGRADGYIL
Sbjct  137  EPEGAAEETKRSKHVARKLEKRQKDRKLDPHVEEQFGGGRLLACISSRPGQCGRADGYIL  196

Query  221  EGKELEFY  198
            EGKELEFY
Sbjct  197  EGKELEFY  204



>gb|ACJ83894.1| unknown [Medicago truncatula]
Length=216

 Score =   285 bits (728),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 161/189 (85%), Positives = 174/189 (92%), Gaps = 1/189 (1%)
 Frame = -3

Query  761  KKAWRKKRKYEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKT  582
            KK+WRKKRKYE GRQPANTKLSSNKTVRRIRVRGGNVKWRALRL TGN+SWGSEAVTRKT
Sbjct  17   KKSWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLGTGNFSWGSEAVTRKT  76

Query  581  RILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketaee  402
            R+LDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG ++GR KK  A K+ + E
Sbjct  77   RLLDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVEVGR-KKKTAAKKDSAE  135

Query  401  tegvaaeetkKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYIL  222
               V AEE KKS+HVQRKLE+RQK+R+LDSH+EEQFG GRL+ACISSRPGQCGRADGYIL
Sbjct  136  EAEVVAEEVKKSSHVQRKLEQRQKDRQLDSHIEEQFGGGRLLACISSRPGQCGRADGYIL  195

Query  221  EGKELEFYM  195
            EGKELEFYM
Sbjct  196  EGKELEFYM  204



>emb|CDP03936.1| unnamed protein product [Coffea canephora]
Length=213

 Score =   284 bits (727),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 160/185 (86%), Positives = 166/185 (90%), Gaps = 1/185 (1%)
 Frame = -3

Query  734  YEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  555
            YE GRQPANTKLSSNKTVRR+RVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDV+YNA
Sbjct  20   YELGRQPANTKLSSNKTVRRVRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVMYNA  79

Query  554  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketaeetegvaaeet  375
            SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG DIGR KK    K+ A E     AEET
Sbjct  80   SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVDIGR-KKKGPAKKDATEDGEATAEET  138

Query  374  kKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEGKELEFYM  195
            KKSNHV RKLEKRQ+ R LD H+EEQFG GRL+ACISSRPGQCGRADGYILEGKELEFYM
Sbjct  139  KKSNHVVRKLEKRQQGRTLDPHIEEQFGGGRLLACISSRPGQCGRADGYILEGKELEFYM  198

Query  194  KKIQR  180
            KKIQR
Sbjct  199  KKIQR  203



>ref|XP_006352667.1| PREDICTED: 40S ribosomal protein S8-like [Solanum tuberosum]
Length=221

 Score =   285 bits (728),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 164/191 (86%), Positives = 169/191 (88%), Gaps = 2/191 (1%)
 Frame = -3

Query  761  KKAWRKKRKYEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKT  582
            +K WRKKRKYE GRQPANTK+SSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEA TRKT
Sbjct  18   QKTWRKKRKYELGRQPANTKISSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEATTRKT  77

Query  581  RILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGR--kkkaaakketa  408
            RILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG DIGR  K  AA K+   
Sbjct  78   RILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVDIGRKKKGAAAKKETAE  137

Query  407  eetegvaaeetkKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGY  228
            E     AAEETKKSNHV RK+EKR  +RKLDSHLEEQF SGRL ACISSRPGQCGRADGY
Sbjct  138  EGESAAAAEETKKSNHVLRKIEKRLADRKLDSHLEEQFSSGRLYACISSRPGQCGRADGY  197

Query  227  ILEGKELEFYM  195
            ILEGKELEFYM
Sbjct  198  ILEGKELEFYM  208



>ref|NP_200732.2| 40S ribosomal protein S8-2 [Arabidopsis thaliana]
 sp|Q9FIF3.1|RS82_ARATH RecName: Full=40S ribosomal protein S8-2 [Arabidopsis thaliana]
 dbj|BAB09769.1| 40S ribosomal protein S8 [Arabidopsis thaliana]
 gb|AAO42849.1| At5g59240 [Arabidopsis thaliana]
 dbj|BAE99897.1| 40S ribosomal protein S8 - like [Arabidopsis thaliana]
 gb|AED97161.1| 40S ribosomal protein S8-2 [Arabidopsis thaliana]
Length=210

 Score =   284 bits (726),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 157/189 (83%), Positives = 164/189 (87%), Gaps = 10/189 (5%)
 Frame = -3

Query  761  KKAWRKKRKYEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKT  582
            +K WRKKRKYE GRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGN+SWGSEAVTRKT
Sbjct  18   QKMWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNFSWGSEAVTRKT  77

Query  581  RILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketaee  402
            RILDV YNASNNELVRTQTLVKSAIVQVDAAPFKQ YLQHYG DIGR           ++
Sbjct  78   RILDVAYNASNNELVRTQTLVKSAIVQVDAAPFKQGYLQHYGVDIGR----------KKK  127

Query  401  tegvaaeetkKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYIL  222
             E V  EE KKSNHVQRKLE RQ+ R LDSHLEEQF SGRL+ACI+SRPGQCGRADGYIL
Sbjct  128  GEAVTTEEVKKSNHVQRKLEMRQEGRALDSHLEEQFSSGRLLACIASRPGQCGRADGYIL  187

Query  221  EGKELEFYM  195
            EGKELEFYM
Sbjct  188  EGKELEFYM  196



>gb|KJB22170.1| hypothetical protein B456_004G033000 [Gossypium raimondii]
Length=216

 Score =   284 bits (727),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 156/185 (84%), Positives = 162/185 (88%), Gaps = 2/185 (1%)
 Frame = -3

Query  734  YEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  555
            YE GRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA
Sbjct  27   YELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  86

Query  554  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketaeetegvaaeet  375
            SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG DIGR  K     +   E      EE 
Sbjct  87   SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVDIGR--KKKTAAKKEGEEGETGTEEV  144

Query  374  kKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEGKELEFYM  195
            KKSNHV RK+EKRQ+ RKLD H+E+QF SGRL+ACISSRPGQCGRADGYILEGKELEFYM
Sbjct  145  KKSNHVLRKMEKRQQNRKLDPHIEDQFASGRLLACISSRPGQCGRADGYILEGKELEFYM  204

Query  194  KKIQR  180
            KKIQR
Sbjct  205  KKIQR  209



>ref|XP_006437243.1| hypothetical protein CICLE_v10032694mg [Citrus clementina]
 gb|ESR50483.1| hypothetical protein CICLE_v10032694mg [Citrus clementina]
Length=223

 Score =   285 bits (728),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 167/187 (89%), Positives = 173/187 (93%), Gaps = 2/187 (1%)
 Frame = -3

Query  734  YEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  555
            YE GRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA
Sbjct  27   YELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  86

Query  554  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketa--eetegvaae  381
            SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG DIGRKKKA  KKET    E+   AAE
Sbjct  87   SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVDIGRKKKAVTKKETTEEGESAAAAAE  146

Query  380  etkKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEGKELEF  201
            ETKKSNHV RKLEKRQK+R LD H+EEQFG+GRL+ACISSRPGQCGRADGYILEGKELEF
Sbjct  147  ETKKSNHVVRKLEKRQKDRTLDPHIEEQFGAGRLLACISSRPGQCGRADGYILEGKELEF  206

Query  200  YMKKIQR  180
            YMKK+QR
Sbjct  207  YMKKLQR  213



>emb|CBI26725.3| unnamed protein product [Vitis vinifera]
Length=212

 Score =   284 bits (726),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 161/185 (87%), Positives = 169/185 (91%), Gaps = 0/185 (0%)
 Frame = -3

Query  734  YEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  555
            YE GRQPA+TKLSSNKTVRR+RVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA
Sbjct  20   YELGRQPASTKLSSNKTVRRVRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  79

Query  554  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketaeetegvaaeet  375
            SNNELVRTQTLVKSAI+QVDAAPFKQWYLQHYG DIGRKKKA+A  +   E     AEET
Sbjct  80   SNNELVRTQTLVKSAIIQVDAAPFKQWYLQHYGLDIGRKKKASATAKKEGEEGDGPAEET  139

Query  374  kKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEGKELEFYM  195
            KKSNHV RKLEKRQ+E KLD H+EEQFGSGRL+A ISSRPGQCGRADGYILEGKELEFYM
Sbjct  140  KKSNHVVRKLEKRQQEHKLDPHIEEQFGSGRLLAAISSRPGQCGRADGYILEGKELEFYM  199

Query  194  KKIQR  180
            KKIQR
Sbjct  200  KKIQR  204



>gb|KJB81679.1| hypothetical protein B456_013G156600 [Gossypium raimondii]
Length=217

 Score =   284 bits (726),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 160/185 (86%), Positives = 166/185 (90%), Gaps = 1/185 (1%)
 Frame = -3

Query  734  YEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  555
            YE GRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA
Sbjct  27   YELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  86

Query  554  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketaeetegvaaeet  375
            SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG DIGR KK +A  +   E    A EE 
Sbjct  87   SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGIDIGR-KKKSAAAKKEGEEGETATEEV  145

Query  374  kKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEGKELEFYM  195
            KKSNH+ RKLEKRQ+ R LD H+EEQFGSGRL+ACISSRPGQCGRADGYILEGKELEFYM
Sbjct  146  KKSNHILRKLEKRQQNRALDPHIEEQFGSGRLLACISSRPGQCGRADGYILEGKELEFYM  205

Query  194  KKIQR  180
            KKIQR
Sbjct  206  KKIQR  210



>gb|KHG18510.1| 40S ribosomal S8 [Gossypium arboreum]
Length=216

 Score =   284 bits (726),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 157/185 (85%), Positives = 162/185 (88%), Gaps = 2/185 (1%)
 Frame = -3

Query  734  YEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  555
            YE GRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA
Sbjct  27   YELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  86

Query  554  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketaeetegvaaeet  375
            SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG DIGR  K     +   E      EE 
Sbjct  87   SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVDIGR--KKKTAAKKEGEEGETGTEEV  144

Query  374  kKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEGKELEFYM  195
            KKSNHV RKLEKRQ+ RKLD H+E+QF SGRL+ACISSRPGQCGRADGYILEGKELEFYM
Sbjct  145  KKSNHVLRKLEKRQQNRKLDPHIEDQFASGRLLACISSRPGQCGRADGYILEGKELEFYM  204

Query  194  KKIQR  180
            KKIQR
Sbjct  205  KKIQR  209



>gb|KJB13806.1| hypothetical protein B456_002G095300 [Gossypium raimondii]
Length=212

 Score =   284 bits (726),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 160/186 (86%), Positives = 166/186 (89%), Gaps = 1/186 (1%)
 Frame = -3

Query  734  YEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  555
            YE GRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA
Sbjct  20   YELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  79

Query  554  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketae-etegvaaee  378
            SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG D+GRKKK  A     + E     AEE
Sbjct  80   SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVDLGRKKKTLAAATKKDGEEGETVAEE  139

Query  377  tkKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEGKELEFY  198
             KKSNHV RKLEKRQ+ RKLD H+E+QF SGRL+ACISSRPGQCGRADGYILEGKELEFY
Sbjct  140  AKKSNHVLRKLEKRQQNRKLDPHIEDQFSSGRLLACISSRPGQCGRADGYILEGKELEFY  199

Query  197  MKKIQR  180
            MKKIQR
Sbjct  200  MKKIQR  205



>emb|CBI39377.3| unnamed protein product [Vitis vinifera]
Length=214

 Score =   284 bits (726),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 167/185 (90%), Positives = 173/185 (94%), Gaps = 0/185 (0%)
 Frame = -3

Query  734  YEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  555
            YE GRQPANTKLSSNKTVRR+RVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA
Sbjct  20   YELGRQPANTKLSSNKTVRRVRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  79

Query  554  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketaeetegvaaeet  375
            SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG DIGRKKK  AKKET EE EG A EET
Sbjct  80   SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVDIGRKKKTTAKKETTEEGEGGATEET  139

Query  374  kKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEGKELEFYM  195
            KKSNHV RKLEKRQ++ +LD H+EEQFGSGRL+A ISSRPGQCGRADGYILEGKELEFYM
Sbjct  140  KKSNHVLRKLEKRQQDHRLDPHIEEQFGSGRLLASISSRPGQCGRADGYILEGKELEFYM  199

Query  194  KKIQR  180
            KKIQR
Sbjct  200  KKIQR  204



>gb|KJB84081.1| hypothetical protein B456_N005000 [Gossypium raimondii]
Length=259

 Score =   285 bits (730),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 168/185 (91%), Positives = 172/185 (93%), Gaps = 1/185 (1%)
 Frame = -3

Query  734  YEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  555
            YE GRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA
Sbjct  67   YELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  126

Query  554  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketaeetegvaaeet  375
            SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG DIGR KK  A K+ A E   VAAEET
Sbjct  127  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVDIGR-KKKTAAKKEATEDGEVAAEET  185

Query  374  kKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEGKELEFYM  195
            KKSNHV RKLEKRQKER LD+H+EEQFGSGRL+ACISSRPGQCGRADGYILEGKELEFYM
Sbjct  186  KKSNHVLRKLEKRQKERTLDAHIEEQFGSGRLLACISSRPGQCGRADGYILEGKELEFYM  245

Query  194  KKIQR  180
            KKIQR
Sbjct  246  KKIQR  250



>gb|KJB13805.1| hypothetical protein B456_002G095300 [Gossypium raimondii]
 gb|KJB13807.1| hypothetical protein B456_002G095300 [Gossypium raimondii]
Length=219

 Score =   284 bits (726),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 160/186 (86%), Positives = 166/186 (89%), Gaps = 1/186 (1%)
 Frame = -3

Query  734  YEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  555
            YE GRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA
Sbjct  27   YELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  86

Query  554  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketae-etegvaaee  378
            SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG D+GRKKK  A     + E     AEE
Sbjct  87   SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVDLGRKKKTLAAATKKDGEEGETVAEE  146

Query  377  tkKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEGKELEFY  198
             KKSNHV RKLEKRQ+ RKLD H+E+QF SGRL+ACISSRPGQCGRADGYILEGKELEFY
Sbjct  147  AKKSNHVLRKLEKRQQNRKLDPHIEDQFSSGRLLACISSRPGQCGRADGYILEGKELEFY  206

Query  197  MKKIQR  180
            MKKIQR
Sbjct  207  MKKIQR  212



>gb|KHF98591.1| 40S ribosomal S8 [Gossypium arboreum]
Length=219

 Score =   284 bits (726),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 161/186 (87%), Positives = 166/186 (89%), Gaps = 1/186 (1%)
 Frame = -3

Query  734  YEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  555
            YE GRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA
Sbjct  27   YELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  86

Query  554  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketae-etegvaaee  378
            SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG D+GRKKK  A     E E     AEE
Sbjct  87   SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVDLGRKKKTPAAATKKEGEEGETVAEE  146

Query  377  tkKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEGKELEFY  198
             KKSNHV RKLEKRQ+ RKLD H+E+QF SGRL+ACISSRPGQCGRADGYILEGKELEFY
Sbjct  147  AKKSNHVLRKLEKRQQNRKLDPHIEDQFSSGRLLACISSRPGQCGRADGYILEGKELEFY  206

Query  197  MKKIQR  180
            MKKIQR
Sbjct  207  MKKIQR  212



>ref|XP_002275094.1| PREDICTED: 40S ribosomal protein S8 [Vitis vinifera]
Length=219

 Score =   284 bits (726),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 161/185 (87%), Positives = 169/185 (91%), Gaps = 0/185 (0%)
 Frame = -3

Query  734  YEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  555
            YE GRQPA+TKLSSNKTVRR+RVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA
Sbjct  27   YELGRQPASTKLSSNKTVRRVRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  86

Query  554  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketaeetegvaaeet  375
            SNNELVRTQTLVKSAI+QVDAAPFKQWYLQHYG DIGRKKKA+A  +   E     AEET
Sbjct  87   SNNELVRTQTLVKSAIIQVDAAPFKQWYLQHYGLDIGRKKKASATAKKEGEEGDGPAEET  146

Query  374  kKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEGKELEFYM  195
            KKSNHV RKLEKRQ+E KLD H+EEQFGSGRL+A ISSRPGQCGRADGYILEGKELEFYM
Sbjct  147  KKSNHVVRKLEKRQQEHKLDPHIEEQFGSGRLLAAISSRPGQCGRADGYILEGKELEFYM  206

Query  194  KKIQR  180
            KKIQR
Sbjct  207  KKIQR  211



>ref|XP_002269042.2| PREDICTED: 40S ribosomal protein S8 [Vitis vinifera]
 emb|CAN64937.1| hypothetical protein VITISV_011515 [Vitis vinifera]
Length=221

 Score =   284 bits (726),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 167/185 (90%), Positives = 173/185 (94%), Gaps = 0/185 (0%)
 Frame = -3

Query  734  YEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  555
            YE GRQPANTKLSSNKTVRR+RVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA
Sbjct  27   YELGRQPANTKLSSNKTVRRVRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  86

Query  554  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketaeetegvaaeet  375
            SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG DIGRKKK  AKKET EE EG A EET
Sbjct  87   SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVDIGRKKKTTAKKETTEEGEGGATEET  146

Query  374  kKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEGKELEFYM  195
            KKSNHV RKLEKRQ++ +LD H+EEQFGSGRL+A ISSRPGQCGRADGYILEGKELEFYM
Sbjct  147  KKSNHVLRKLEKRQQDHRLDPHIEEQFGSGRLLASISSRPGQCGRADGYILEGKELEFYM  206

Query  194  KKIQR  180
            KKIQR
Sbjct  207  KKIQR  211



>gb|AFK40150.1| unknown [Lotus japonicus]
Length=217

 Score =   283 bits (725),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 159/188 (85%), Positives = 169/188 (90%), Gaps = 1/188 (1%)
 Frame = -3

Query  761  KKAWRKKRKYEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKT  582
            +K WRKKRKYE GRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGN+SWGSE VTRKT
Sbjct  18   QKTWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNFSWGSETVTRKT  77

Query  581  RILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketaee  402
            R+LDVVYNASNNELVRTQTLVK AIVQVDAAPFKQWYLQHYG +IGR KK  A K+ + E
Sbjct  78   RLLDVVYNASNNELVRTQTLVKGAIVQVDAAPFKQWYLQHYGVEIGR-KKKTAAKKDSTE  136

Query  401  tegvaaeetkKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYIL  222
                 AE+TKKSNHVQRKLE RQK+R LDSH+EEQFG GRL+ACISSRPGQCGRADGYIL
Sbjct  137  EGEAVAEDTKKSNHVQRKLENRQKDRTLDSHIEEQFGGGRLLACISSRPGQCGRADGYIL  196

Query  221  EGKELEFY  198
            EGKELEFY
Sbjct  197  EGKELEFY  204



>gb|KDO36309.1| hypothetical protein CISIN_1g045444mg, partial [Citrus sinensis]
 gb|KDO60870.1| hypothetical protein CISIN_1g044642mg, partial [Citrus sinensis]
Length=217

 Score =   283 bits (725),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 165/187 (88%), Positives = 170/187 (91%), Gaps = 2/187 (1%)
 Frame = -3

Query  734  YEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  555
            YE GRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA
Sbjct  27   YELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  86

Query  554  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakk--etaeetegvaae  381
            SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG DIGRKKKA  KK      E    AAE
Sbjct  87   SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVDIGRKKKAVTKKETTEEGEGAAAAAE  146

Query  380  etkKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEGKELEF  201
            ETKKSNHV RKLEKRQK+R LD H+EEQFG+GRL+ACISSRPGQCGRADGYILEGKELEF
Sbjct  147  ETKKSNHVVRKLEKRQKDRTLDPHIEEQFGAGRLLACISSRPGQCGRADGYILEGKELEF  206

Query  200  YMKKIQR  180
            YMKK+QR
Sbjct  207  YMKKLQR  213



>gb|KHG14255.1| 40S ribosomal S8 [Gossypium arboreum]
Length=210

 Score =   283 bits (724),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 160/185 (86%), Positives = 166/185 (90%), Gaps = 1/185 (1%)
 Frame = -3

Query  734  YEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  555
            YE GRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEA+TRKTRILDVVYNA
Sbjct  20   YELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEALTRKTRILDVVYNA  79

Query  554  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketaeetegvaaeet  375
            SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG DIGR KK +A  +   E    A EE 
Sbjct  80   SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGIDIGR-KKKSAAAKKEGEEGETATEEV  138

Query  374  kKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEGKELEFYM  195
            KKSNHV RKLEKRQ+ R LD H+EEQFGSGRL+ACISSRPGQCGRADGYILEGKELEFYM
Sbjct  139  KKSNHVLRKLEKRQQNRTLDPHIEEQFGSGRLLACISSRPGQCGRADGYILEGKELEFYM  198

Query  194  KKIQR  180
            KKIQR
Sbjct  199  KKIQR  203



>gb|KCW58021.1| hypothetical protein EUGRSUZ_H00750 [Eucalyptus grandis]
Length=221

 Score =   283 bits (725),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 165/185 (89%), Positives = 173/185 (94%), Gaps = 0/185 (0%)
 Frame = -3

Query  734  YEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  555
            YE GRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYN+
Sbjct  27   YELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNS  86

Query  554  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketaeetegvaaeet  375
            SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG DIGRKKKAAA K+ A E E   AEE 
Sbjct  87   SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVDIGRKKKAAAAKKEATEGEAAPAEEA  146

Query  374  kKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEGKELEFYM  195
            KKS HV RKLEKRQK+R+LD+H+EEQFGSGRL+ACISSRPGQCGR+DGYILEGKELEFYM
Sbjct  147  KKSAHVLRKLEKRQKDRQLDAHIEEQFGSGRLLACISSRPGQCGRSDGYILEGKELEFYM  206

Query  194  KKIQR  180
            KKIQR
Sbjct  207  KKIQR  211



>ref|XP_006452497.1| hypothetical protein CICLE_v10009415mg [Citrus clementina]
 ref|XP_006474961.1| PREDICTED: 40S ribosomal protein S8-like [Citrus sinensis]
 gb|ESR65737.1| hypothetical protein CICLE_v10009415mg [Citrus clementina]
Length=223

 Score =   283 bits (725),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 166/188 (88%), Positives = 171/188 (91%), Gaps = 3/188 (2%)
 Frame = -3

Query  734  YEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  555
            YE GRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA
Sbjct  27   YELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  86

Query  554  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketa---eetegvaa  384
            SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG DIGRKKKAAA   T    EE E  A 
Sbjct  87   SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVDIGRKKKAAAAATTKKEGEEGEAPAT  146

Query  383  eetkKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEGKELE  204
            EE KKSNHV RKLEKRQK+R LD H+EEQFGSGRL+ACI+SRPGQCGRADGYILEGKELE
Sbjct  147  EEAKKSNHVSRKLEKRQKDRTLDPHIEEQFGSGRLLACIASRPGQCGRADGYILEGKELE  206

Query  203  FYMKKIQR  180
            FYMKK+QR
Sbjct  207  FYMKKLQR  214



>ref|XP_002299926.1| 40S ribosomal protein S8 [Populus trichocarpa]
 gb|ABK92677.1| unknown [Populus trichocarpa]
 gb|EEE84731.1| 40S ribosomal protein S8 [Populus trichocarpa]
Length=220

 Score =   283 bits (724),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 161/185 (87%), Positives = 166/185 (90%), Gaps = 0/185 (0%)
 Frame = -3

Query  734  YEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  555
            YE GRQPA+TKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA
Sbjct  27   YELGRQPASTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  86

Query  554  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketaeetegvaaeet  375
            SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG DIGRKKK A   +   E    A EE 
Sbjct  87   SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVDIGRKKKTAPAAKKEGEDGEAAVEEE  146

Query  374  kKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEGKELEFYM  195
            KKS HVQRKLEKRQ+ RKLD H+EEQFGSGRL+A ISSRPGQCGRADGYILEGKELEFYM
Sbjct  147  KKSKHVQRKLEKRQQTRKLDPHIEEQFGSGRLLASISSRPGQCGRADGYILEGKELEFYM  206

Query  194  KKIQR  180
            KKIQR
Sbjct  207  KKIQR  211



>ref|XP_006484807.1| PREDICTED: 40S ribosomal protein S8-like [Citrus sinensis]
Length=223

 Score =   283 bits (724),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 165/187 (88%), Positives = 170/187 (91%), Gaps = 2/187 (1%)
 Frame = -3

Query  734  YEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  555
            YE GRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA
Sbjct  27   YELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  86

Query  554  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakk--etaeetegvaae  381
            SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG DIGRKKKA  KK      E    AAE
Sbjct  87   SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVDIGRKKKAVTKKETTEEGEGAAAAAE  146

Query  380  etkKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEGKELEF  201
            ETKKSNHV RKLEKRQK+R LD H+EEQFG+GRL+ACISSRPGQCGRADGYILEGKELEF
Sbjct  147  ETKKSNHVVRKLEKRQKDRTLDPHIEEQFGAGRLLACISSRPGQCGRADGYILEGKELEF  206

Query  200  YMKKIQR  180
            YMKK+QR
Sbjct  207  YMKKLQR  213



>ref|XP_004510234.1| PREDICTED: 40S ribosomal protein S8-like [Cicer arietinum]
Length=217

 Score =   282 bits (722),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 160/185 (86%), Positives = 168/185 (91%), Gaps = 1/185 (1%)
 Frame = -3

Query  734  YEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  555
            YE GRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGN+SWGSEAVTRKTR+LDVVYNA
Sbjct  27   YELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNFSWGSEAVTRKTRLLDVVYNA  86

Query  554  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketaeetegvaaeet  375
            SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG +IGR KK  A K+ A E      EE 
Sbjct  87   SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVEIGR-KKKTASKKDAPEEAEAVTEEA  145

Query  374  kKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEGKELEFYM  195
            KKSNHVQRKLE RQKER+LDSH+EEQFG GRL+ACISSRPGQCGRADGYILEGKELEFYM
Sbjct  146  KKSNHVQRKLETRQKERQLDSHIEEQFGGGRLLACISSRPGQCGRADGYILEGKELEFYM  205

Query  194  KKIQR  180
            KK+QR
Sbjct  206  KKLQR  210



>ref|XP_007049644.1| 40S ribosomal protein S8 isoform 1 [Theobroma cacao]
 gb|EOX93801.1| 40S ribosomal protein S8 isoform 1 [Theobroma cacao]
Length=219

 Score =   282 bits (722),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 164/185 (89%), Positives = 170/185 (92%), Gaps = 1/185 (1%)
 Frame = -3

Query  734  YEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  555
            YE GRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA
Sbjct  27   YELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  86

Query  554  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketaeetegvaaeet  375
            SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG DIGR KK  A K+ A E     AEET
Sbjct  87   SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVDIGR-KKKTAAKKEATEEGEGVAEET  145

Query  374  kKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEGKELEFYM  195
            KKSNHV RKLEKRQK+RKLD+H+EEQFG+GRL+ACISSRPGQCGRADGYILEGKELEFY 
Sbjct  146  KKSNHVVRKLEKRQKDRKLDAHIEEQFGAGRLLACISSRPGQCGRADGYILEGKELEFYT  205

Query  194  KKIQR  180
            KKIQR
Sbjct  206  KKIQR  210



>ref|XP_009373606.1| PREDICTED: 40S ribosomal protein S8 [Pyrus x bretschneideri]
Length=221

 Score =   282 bits (722),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 156/185 (84%), Positives = 165/185 (89%), Gaps = 0/185 (0%)
 Frame = -3

Query  734  YEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  555
            YE GRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGN+SWGSEAVTRKTR+LDVVYNA
Sbjct  27   YELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNFSWGSEAVTRKTRLLDVVYNA  86

Query  554  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketaeetegvaaeet  375
            SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG +IGRKKK+A  K+   E      EE 
Sbjct  87   SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVEIGRKKKSAVAKKDTPEEGEGTTEEA  146

Query  374  kKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEGKELEFYM  195
            KKSNHV RKLEKRQ+ R LD H+EEQFG GRL+ACISSRPGQCGR DGYILEGKELEFYM
Sbjct  147  KKSNHVARKLEKRQQGRTLDPHIEEQFGGGRLLACISSRPGQCGRCDGYILEGKELEFYM  206

Query  194  KKIQR  180
            KK+QR
Sbjct  207  KKLQR  211



>ref|XP_008222788.1| PREDICTED: 40S ribosomal protein S8 [Prunus mume]
Length=221

 Score =   282 bits (721),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 158/185 (85%), Positives = 167/185 (90%), Gaps = 0/185 (0%)
 Frame = -3

Query  734  YEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  555
            YE GRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGN+SWGSEAVTRKTR+LDVVYNA
Sbjct  27   YELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNFSWGSEAVTRKTRLLDVVYNA  86

Query  554  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketaeetegvaaeet  375
            SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG +IGRKKK AA K+   E      EE 
Sbjct  87   SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVEIGRKKKTAAAKKDTPEEGEATTEEA  146

Query  374  kKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEGKELEFYM  195
            KKSNHV RKLEKRQ+ R LD+H+EEQFG GRL+ACISSRPGQCGRADGYILEGKELEFYM
Sbjct  147  KKSNHVARKLEKRQQGRTLDAHIEEQFGGGRLLACISSRPGQCGRADGYILEGKELEFYM  206

Query  194  KKIQR  180
            KK+QR
Sbjct  207  KKLQR  211



>ref|XP_004492266.1| PREDICTED: 40S ribosomal protein S8-like [Cicer arietinum]
Length=218

 Score =   282 bits (721),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 160/185 (86%), Positives = 171/185 (92%), Gaps = 0/185 (0%)
 Frame = -3

Query  734  YEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  555
            YE GRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGN+SWGSEAVTRKTR+LDVVYNA
Sbjct  27   YELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNFSWGSEAVTRKTRLLDVVYNA  86

Query  554  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketaeetegvaaeet  375
            SNNELVRTQTLVK AIVQVDAAPFKQWYLQHYG +IGRKKK+AA K+ + E    A EE 
Sbjct  87   SNNELVRTQTLVKGAIVQVDAAPFKQWYLQHYGVEIGRKKKSAAAKKDSVEEVEAATEEA  146

Query  374  kKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEGKELEFYM  195
            KKSNHVQRKLE RQK+R+LDSH+EEQFG GRL+ACISSRPGQCGRADGYILEGKELEFYM
Sbjct  147  KKSNHVQRKLENRQKDRQLDSHIEEQFGGGRLLACISSRPGQCGRADGYILEGKELEFYM  206

Query  194  KKIQR  180
            KK+QR
Sbjct  207  KKLQR  211



>ref|XP_009378162.1| PREDICTED: 40S ribosomal protein S8-like [Pyrus x bretschneideri]
Length=221

 Score =   281 bits (720),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 153/185 (83%), Positives = 165/185 (89%), Gaps = 0/185 (0%)
 Frame = -3

Query  734  YEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  555
            YE GRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGN+SWGSEAVTRKTR+LDVVYNA
Sbjct  27   YELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNFSWGSEAVTRKTRLLDVVYNA  86

Query  554  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketaeetegvaaeet  375
            SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG +IGRKKK+ A K+   +      EE 
Sbjct  87   SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVEIGRKKKSGAAKKDTPDEGEGTTEEA  146

Query  374  kKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEGKELEFYM  195
            +KSNHV RKLEKRQ+ R LD H+EEQFG GRL+ACISSRPGQCGR DGY+LEGKELEFYM
Sbjct  147  RKSNHVTRKLEKRQEGRTLDPHIEEQFGGGRLLACISSRPGQCGRCDGYVLEGKELEFYM  206

Query  194  KKIQR  180
            KK+QR
Sbjct  207  KKLQR  211



>ref|XP_007020644.1| 40S ribosomal protein S8 isoform 1 [Theobroma cacao]
 ref|XP_007020645.1| 40S ribosomal protein S8 isoform 1 [Theobroma cacao]
 gb|EOY12169.1| 40S ribosomal protein S8 isoform 1 [Theobroma cacao]
 gb|EOY12170.1| 40S ribosomal protein S8 isoform 1 [Theobroma cacao]
Length=220

 Score =   281 bits (720),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 164/187 (88%), Positives = 168/187 (90%), Gaps = 2/187 (1%)
 Frame = -3

Query  734  YEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  555
            YE GRQPA+TKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA
Sbjct  27   YELGRQPASTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  86

Query  554  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketae--etegvaae  381
            SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG DIGRKKK AA     E  E   +A E
Sbjct  87   SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVDIGRKKKTAAAAAKKEGGEDGEIATE  146

Query  380  etkKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEGKELEF  201
            E KKS HV RKLEKRQ  RKLDSH+EEQFGSGRL+ACISSRPGQCGRADGYILEGKELEF
Sbjct  147  EVKKSGHVLRKLEKRQLNRKLDSHIEEQFGSGRLLACISSRPGQCGRADGYILEGKELEF  206

Query  200  YMKKIQR  180
            YMKKIQR
Sbjct  207  YMKKIQR  213



>ref|XP_008466734.1| PREDICTED: 40S ribosomal protein S8-2 [Cucumis melo]
Length=220

 Score =   281 bits (720),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 162/185 (88%), Positives = 170/185 (92%), Gaps = 0/185 (0%)
 Frame = -3

Query  734  YEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  555
            YE GRQPANTKLSS+K++RRIRVRGGNVKWRA RLDTGNYSWGSEAVTRKTRILDVVYNA
Sbjct  27   YELGRQPANTKLSSDKSIRRIRVRGGNVKWRAFRLDTGNYSWGSEAVTRKTRILDVVYNA  86

Query  554  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketaeetegvaaeet  375
            SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG DIGRKKK AA  +  EE +  AAEE 
Sbjct  87   SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVDIGRKKKTAASTKKDEEGDAAAAEEV  146

Query  374  kKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEGKELEFYM  195
            KKSNHVQRKLEKRQ+ RKLD H+EEQF SGRLMACISSRPGQCGRADGYILEGKELEFYM
Sbjct  147  KKSNHVQRKLEKRQEGRKLDPHIEEQFSSGRLMACISSRPGQCGRADGYILEGKELEFYM  206

Query  194  KKIQR  180
            KK+QR
Sbjct  207  KKLQR  211



>ref|XP_009349000.1| PREDICTED: 40S ribosomal protein S8-like [Pyrus x bretschneideri]
Length=221

 Score =   281 bits (720),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 152/185 (82%), Positives = 164/185 (89%), Gaps = 0/185 (0%)
 Frame = -3

Query  734  YEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  555
            YE GRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGN+SWGSEAVTRKTR+LDVVYNA
Sbjct  27   YELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNFSWGSEAVTRKTRLLDVVYNA  86

Query  554  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketaeetegvaaeet  375
            SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG +IGRKKK+ A K+   +      EE 
Sbjct  87   SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVEIGRKKKSGAAKKDNPDEGEGTTEEA  146

Query  374  kKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEGKELEFYM  195
            +KSNHV RK EKRQ+ R LD H+EEQFG GRL+ACISSRPGQCGR DGY+LEGKELEFYM
Sbjct  147  RKSNHVTRKREKRQEGRTLDPHIEEQFGGGRLLACISSRPGQCGRCDGYVLEGKELEFYM  206

Query  194  KKIQR  180
            KK+QR
Sbjct  207  KKLQR  211



>ref|XP_008778380.1| PREDICTED: 40S ribosomal protein S8-like [Phoenix dactylifera]
Length=222

 Score =   281 bits (719),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 162/186 (87%), Positives = 170/186 (91%), Gaps = 1/186 (1%)
 Frame = -3

Query  734  YEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  555
            YE GRQPANTKLSSNKTVRR+RVRGGNVKWRALRLDTGNYSWGSEA+TRKTRILDVVYNA
Sbjct  27   YELGRQPANTKLSSNKTVRRVRVRGGNVKWRALRLDTGNYSWGSEALTRKTRILDVVYNA  86

Query  554  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaa-kketaeetegvaaee  378
            SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG +IGRKKKA A  K+ A E    A EE
Sbjct  87   SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVEIGRKKKAPAGTKKEATEEGEGATEE  146

Query  377  tkKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEGKELEFY  198
             KKSNHV RKL+KRQ+ RKLD H+EEQFGSGRL+ACISSRPGQCGRADGYILEGKELEFY
Sbjct  147  AKKSNHVLRKLDKRQQGRKLDPHIEEQFGSGRLLACISSRPGQCGRADGYILEGKELEFY  206

Query  197  MKKIQR  180
            MKKIQR
Sbjct  207  MKKIQR  212



>ref|XP_010693327.1| PREDICTED: 40S ribosomal protein S8-like [Beta vulgaris subsp. 
vulgaris]
Length=217

 Score =   281 bits (719),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 158/185 (85%), Positives = 166/185 (90%), Gaps = 1/185 (1%)
 Frame = -3

Query  734  YEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  555
            YE GRQPANTKLSSNKTVRR+RVRGGNVKWRALRLDTGN+SWGSEAVTRKTR+LDVVYNA
Sbjct  27   YELGRQPANTKLSSNKTVRRVRVRGGNVKWRALRLDTGNFSWGSEAVTRKTRLLDVVYNA  86

Query  554  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketaeetegvaaeet  375
            SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG D+GR KK AA     E  EG   EE 
Sbjct  87   SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVDVGR-KKKAAAAAKKETEEGETTEEA  145

Query  374  kKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEGKELEFYM  195
            KKSNHV RKLEKRQ+ R LD+H+EEQFG GRL+ACISSRPGQCGRADGYILEGKELEFYM
Sbjct  146  KKSNHVARKLEKRQQNRTLDAHIEEQFGGGRLLACISSRPGQCGRADGYILEGKELEFYM  205

Query  194  KKIQR  180
            KKIQR
Sbjct  206  KKIQR  210



>ref|XP_007146564.1| hypothetical protein PHAVU_006G051300g [Phaseolus vulgaris]
 gb|ESW18558.1| hypothetical protein PHAVU_006G051300g [Phaseolus vulgaris]
Length=218

 Score =   281 bits (719),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 154/180 (86%), Positives = 161/180 (89%), Gaps = 0/180 (0%)
 Frame = -3

Query  734  YEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  555
            YE GRQPANTKLSSNKT+RRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA
Sbjct  27   YELGRQPANTKLSSNKTIRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  86

Query  554  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketaeetegvaaeet  375
            SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG DIGRKKK  A  +   E    A EE 
Sbjct  87   SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVDIGRKKKIVASAKKEGEDGEAATEEV  146

Query  374  kKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEGKELEFYM  195
            KKSNHV RKLEKR++ R LDSH+EEQFG GRL+ACISSRPGQCGR+DGYILEGKELEFYM
Sbjct  147  KKSNHVLRKLEKRKQSRVLDSHIEEQFGGGRLLACISSRPGQCGRSDGYILEGKELEFYM  206



>ref|XP_011025495.1| PREDICTED: 40S ribosomal protein S8-like [Populus euphratica]
Length=219

 Score =   281 bits (718),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 162/186 (87%), Positives = 167/186 (90%), Gaps = 1/186 (1%)
 Frame = -3

Query  734  YEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  555
            YE GRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA
Sbjct  27   YELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  86

Query  554  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketaeetegvaaeet  375
            SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG DIGRKKK  A  +   E    AA E 
Sbjct  87   SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVDIGRKKKTTAASKKEGEEGEAAATEE  146

Query  374  -kKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEGKELEFY  198
             K+SNHVQRKLEKRQ+ RKLD H+EEQFGSGRL+A ISSRPGQCGRADGYILEGKELEFY
Sbjct  147  VKQSNHVQRKLEKRQQTRKLDPHIEEQFGSGRLLASISSRPGQCGRADGYILEGKELEFY  206

Query  197  MKKIQR  180
            MKKIQR
Sbjct  207  MKKIQR  212



>ref|XP_006373482.1| hypothetical protein POPTR_0017s14180g [Populus trichocarpa]
 gb|ERP51279.1| hypothetical protein POPTR_0017s14180g [Populus trichocarpa]
Length=219

 Score =   281 bits (718),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 161/185 (87%), Positives = 166/185 (90%), Gaps = 1/185 (1%)
 Frame = -3

Query  734  YEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  555
            YE GRQPA+TKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA
Sbjct  27   YELGRQPASTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  86

Query  554  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketaeetegvaaeet  375
            SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG DIGR KK A  K+   E      EET
Sbjct  87   SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVDIGR-KKKAVVKKETPEEGEATTEET  145

Query  374  kKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEGKELEFYM  195
            KKSNHV RKLEKRQ+ RKLD H+EEQFGSGRL+A ISSRPGQCGRADGYILEGKELEFYM
Sbjct  146  KKSNHVIRKLEKRQQVRKLDPHIEEQFGSGRLLASISSRPGQCGRADGYILEGKELEFYM  205

Query  194  KKIQR  180
            KKIQR
Sbjct  206  KKIQR  210



>ref|XP_010913108.1| PREDICTED: 40S ribosomal protein S8 isoform X1 [Elaeis guineensis]
Length=224

 Score =   281 bits (718),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 160/188 (85%), Positives = 167/188 (89%), Gaps = 3/188 (2%)
 Frame = -3

Query  734  YEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  555
            YE GRQPANTKLSSNKTVRR+RVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA
Sbjct  27   YELGRQPANTKLSSNKTVRRVRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  86

Query  554  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketaeetegv---aa  384
            SNNELVRTQTLVKSAI+QVDAAPFKQWYLQHYG +IGRKKKA A  +           A 
Sbjct  87   SNNELVRTQTLVKSAIIQVDAAPFKQWYLQHYGVEIGRKKKAPAATKKEATEGQEGEGAT  146

Query  383  eetkKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEGKELE  204
            EE KKSNHV RKLEKRQ+ RKLD H+EEQFGSGRL+ACISSRPGQCGRADGYILEGKELE
Sbjct  147  EEPKKSNHVLRKLEKRQQGRKLDPHIEEQFGSGRLLACISSRPGQCGRADGYILEGKELE  206

Query  203  FYMKKIQR  180
            FYMKKIQR
Sbjct  207  FYMKKIQR  214



>ref|XP_011021176.1| PREDICTED: 40S ribosomal protein S8 isoform X2 [Populus euphratica]
Length=217

 Score =   280 bits (717),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 161/185 (87%), Positives = 166/185 (90%), Gaps = 1/185 (1%)
 Frame = -3

Query  734  YEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  555
            YE GRQPA+TKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA
Sbjct  27   YELGRQPASTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  86

Query  554  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketaeetegvaaeet  375
            SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG DIGR KK A  K+   E      EET
Sbjct  87   SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVDIGR-KKKAVVKKETPEEGEATTEET  145

Query  374  kKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEGKELEFYM  195
            KKSNHV RKLEKRQ+ RKLD H+EEQFGSGRL+A ISSRPGQCGRADGYILEGKELEFYM
Sbjct  146  KKSNHVIRKLEKRQQGRKLDPHIEEQFGSGRLLASISSRPGQCGRADGYILEGKELEFYM  205

Query  194  KKIQR  180
            KKIQR
Sbjct  206  KKIQR  210



>ref|XP_004148331.1| PREDICTED: 40S ribosomal protein S8-like [Cucumis sativus]
 ref|XP_004162922.1| PREDICTED: 40S ribosomal protein S8-like [Cucumis sativus]
 gb|KGN61144.1| hypothetical protein Csa_2G059750 [Cucumis sativus]
Length=219

 Score =   280 bits (717),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 155/185 (84%), Positives = 165/185 (89%), Gaps = 1/185 (1%)
 Frame = -3

Query  734  YEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  555
            YE GRQPANTKLSS+K++RRIRVRGGNVKWRA RLDTGNYSWGSEAVTRKTR+LDVVYNA
Sbjct  27   YELGRQPANTKLSSDKSIRRIRVRGGNVKWRAFRLDTGNYSWGSEAVTRKTRLLDVVYNA  86

Query  554  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketaeetegvaaeet  375
            SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG DIGR KK  +     EE      EE 
Sbjct  87   SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVDIGR-KKKTSASVKKEEEGDAGTEEV  145

Query  374  kKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEGKELEFYM  195
            KKSNHVQRK+EKRQ++RKLD H+EEQF SGRLMACISSRPGQCGRADGYILEGKELEFYM
Sbjct  146  KKSNHVQRKIEKRQQDRKLDPHIEEQFSSGRLMACISSRPGQCGRADGYILEGKELEFYM  205

Query  194  KKIQR  180
            KK+QR
Sbjct  206  KKLQR  210



>ref|XP_010907235.1| PREDICTED: 40S ribosomal protein S8-like [Elaeis guineensis]
Length=223

 Score =   281 bits (718),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 161/186 (87%), Positives = 168/186 (90%), Gaps = 1/186 (1%)
 Frame = -3

Query  734  YEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  555
            YE GRQPANTKLSSNKTVRR+RVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA
Sbjct  27   YELGRQPANTKLSSNKTVRRVRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  86

Query  554  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGR-kkkaaakketaeetegvaaee  378
            SNNELVRTQTLVKSAI+QVDAAPFKQWYLQHYG +IGR KK  AA K+ A E    A EE
Sbjct  87   SNNELVRTQTLVKSAIIQVDAAPFKQWYLQHYGVEIGRKKKAPAASKKEATEEGEGATEE  146

Query  377  tkKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEGKELEFY  198
             KKSNHV RKLEKRQ+ R LD H+EEQFGSGRL+ACISSRPGQCGRADGYILEGKELEFY
Sbjct  147  AKKSNHVLRKLEKRQQCRTLDPHIEEQFGSGRLLACISSRPGQCGRADGYILEGKELEFY  206

Query  197  MKKIQR  180
            MKKIQR
Sbjct  207  MKKIQR  212



>ref|XP_009406344.1| PREDICTED: 40S ribosomal protein S8-like [Musa acuminata subsp. 
malaccensis]
Length=221

 Score =   280 bits (717),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 160/185 (86%), Positives = 168/185 (91%), Gaps = 0/185 (0%)
 Frame = -3

Query  734  YEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  555
            YE GRQPA+TKLSSNKTVRRIRVRGGNVKWRALRLD GNYSWGSEAVTRKTRILDVVYNA
Sbjct  27   YELGRQPASTKLSSNKTVRRIRVRGGNVKWRALRLDHGNYSWGSEAVTRKTRILDVVYNA  86

Query  554  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketaeetegvaaeet  375
            SNNELVRTQTLVKSAI+QVDAAPFKQWYLQHYG +IGRKKKA + K+ A E    A EE 
Sbjct  87   SNNELVRTQTLVKSAIIQVDAAPFKQWYLQHYGVEIGRKKKAPSAKKEATEEGEAATEEE  146

Query  374  kKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEGKELEFYM  195
            KKSNHV RKLEKRQ+ RKLD H+EEQFGSGRL+A ISSRPGQCGRADGYILEGKELEFYM
Sbjct  147  KKSNHVTRKLEKRQQGRKLDPHIEEQFGSGRLLASISSRPGQCGRADGYILEGKELEFYM  206

Query  194  KKIQR  180
            KKIQR
Sbjct  207  KKIQR  211



>ref|XP_009416597.1| PREDICTED: 40S ribosomal protein S8 [Musa acuminata subsp. malaccensis]
Length=223

 Score =   280 bits (717),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 158/187 (84%), Positives = 168/187 (90%), Gaps = 2/187 (1%)
 Frame = -3

Query  734  YEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  555
            YE GRQPANTKLSSNKTVRR+RVRGGNVKWRALRLD GNYSWGSEAVTRKTRILDVVYNA
Sbjct  27   YELGRQPANTKLSSNKTVRRVRVRGGNVKWRALRLDHGNYSWGSEAVTRKTRILDVVYNA  86

Query  554  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketae--etegvaae  381
            SNNELVRTQTLVKSAI+QVDAAPFKQWYLQHYG +IGRKKKA A K+ A   +    A E
Sbjct  87   SNNELVRTQTLVKSAIIQVDAAPFKQWYLQHYGVEIGRKKKAPAVKKEATEGQEAEPATE  146

Query  380  etkKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEGKELEF  201
            E  KSNHV RKLEKRQ+ RKLD+H+EEQF SGRL+ACISSRPGQCGRADGY+LEGKELEF
Sbjct  147  EANKSNHVTRKLEKRQQGRKLDAHIEEQFSSGRLLACISSRPGQCGRADGYVLEGKELEF  206

Query  200  YMKKIQR  180
            YMKKIQR
Sbjct  207  YMKKIQR  213



>ref|XP_006833291.1| hypothetical protein AMTR_s00109p00031400 [Amborella trichopoda]
 gb|ERM98569.1| hypothetical protein AMTR_s00109p00031400 [Amborella trichopoda]
Length=218

 Score =   280 bits (717),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 155/185 (84%), Positives = 161/185 (87%), Gaps = 1/185 (1%)
 Frame = -3

Query  734  YEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  555
            YE GRQPANTKLSSNKTVRR+RVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA
Sbjct  27   YELGRQPANTKLSSNKTVRRVRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  86

Query  554  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketaeetegvaaeet  375
            SNNELVRTQTLVKSAIVQVDAAPF+QWYLQHYG DIGR KK     +   E    A EE 
Sbjct  87   SNNELVRTQTLVKSAIVQVDAAPFRQWYLQHYGIDIGR-KKKTGAAKKEGEEGEAAIEEV  145

Query  374  kKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEGKELEFYM  195
             KS HV RKLEKRQ+  KLD H+EEQFG GRL+ACISSRPGQCGRADGYILEGKELEFYM
Sbjct  146  NKSKHVLRKLEKRQEGHKLDPHIEEQFGGGRLLACISSRPGQCGRADGYILEGKELEFYM  205

Query  194  KKIQR  180
            KKIQR
Sbjct  206  KKIQR  210



>ref|NP_001240243.1| uncharacterized protein LOC100813170 [Glycine max]
 gb|ACU18370.1| unknown [Glycine max]
 gb|KHN10948.1| 40S ribosomal protein S8 [Glycine soja]
Length=217

 Score =   280 bits (716),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 161/185 (87%), Positives = 170/185 (92%), Gaps = 1/185 (1%)
 Frame = -3

Query  734  YEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  555
            YE GRQ ANTKLSSNKT+RRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA
Sbjct  27   YELGRQAANTKLSSNKTIRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  86

Query  554  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketaeetegvaaeet  375
            SNNELVRTQTLVKSAIVQVDAAPF+QWYLQHYG +IGR KK  A K+ + E    AAEET
Sbjct  87   SNNELVRTQTLVKSAIVQVDAAPFRQWYLQHYGVEIGR-KKKVAAKKDSTEEGEAAAEET  145

Query  374  kKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEGKELEFYM  195
            KKSNHVQRKLEKRQK+R LDSH+EEQFG GRL+ACISSRPGQCGRADGYILEGKELEFYM
Sbjct  146  KKSNHVQRKLEKRQKDRNLDSHIEEQFGGGRLLACISSRPGQCGRADGYILEGKELEFYM  205

Query  194  KKIQR  180
            KK+QR
Sbjct  206  KKLQR  210



>ref|XP_006601753.1| PREDICTED: uncharacterized protein LOC100500112 isoform X1 [Glycine 
max]
 gb|KHN21285.1| 40S ribosomal protein S8 [Glycine soja]
Length=217

 Score =   280 bits (716),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 162/185 (88%), Positives = 171/185 (92%), Gaps = 1/185 (1%)
 Frame = -3

Query  734  YEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  555
            YE GRQ ANTKLSSNKT+RRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA
Sbjct  27   YELGRQAANTKLSSNKTIRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  86

Query  554  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketaeetegvaaeet  375
            SNNELVRTQTLVK+AIVQVDAAPFKQWYLQHYG +IGR KK  A K+ + E    AAEET
Sbjct  87   SNNELVRTQTLVKNAIVQVDAAPFKQWYLQHYGVEIGR-KKKVASKKDSTEEGEAAAEET  145

Query  374  kKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEGKELEFYM  195
            KKSNHVQRKLEKRQK+RKLDSH+EEQFG GRL+ACISSRPGQCGRADGYILEGKELEFYM
Sbjct  146  KKSNHVQRKLEKRQKDRKLDSHIEEQFGGGRLLACISSRPGQCGRADGYILEGKELEFYM  205

Query  194  KKIQR  180
            KK+QR
Sbjct  206  KKLQR  210



>ref|XP_010913109.1| PREDICTED: 40S ribosomal protein S8 isoform X2 [Elaeis guineensis]
Length=222

 Score =   280 bits (717),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 161/186 (87%), Positives = 168/186 (90%), Gaps = 1/186 (1%)
 Frame = -3

Query  734  YEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  555
            YE GRQPANTKLSSNKTVRR+RVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA
Sbjct  27   YELGRQPANTKLSSNKTVRRVRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  86

Query  554  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketaeetegvaaeet  375
            SNNELVRTQTLVKSAI+QVDAAPFKQWYLQHYG +IGRKKKA A  +     EG  A E 
Sbjct  87   SNNELVRTQTLVKSAIIQVDAAPFKQWYLQHYGVEIGRKKKAPAATKKEATEEGEGATEE  146

Query  374  -kKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEGKELEFY  198
             KKSNHV RKLEKRQ+ RKLD H+EEQFGSGRL+ACISSRPGQCGRADGYILEGKELEFY
Sbjct  147  PKKSNHVLRKLEKRQQGRKLDPHIEEQFGSGRLLACISSRPGQCGRADGYILEGKELEFY  206

Query  197  MKKIQR  180
            MKKIQR
Sbjct  207  MKKIQR  212



>ref|XP_006344091.1| PREDICTED: 40S ribosomal protein S8-like [Solanum tuberosum]
Length=223

 Score =   280 bits (717),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 160/191 (84%), Positives = 166/191 (87%), Gaps = 2/191 (1%)
 Frame = -3

Query  761  KKAWRKKRKYEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKT  582
            +K WRKKRKYE GRQ ANTK+SSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKT
Sbjct  18   QKTWRKKRKYELGRQSANTKISSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKT  77

Query  581  RILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDI--GRkkkaaakketa  408
            RILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG DI   +K  A  +  T 
Sbjct  78   RILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVDIGRKKKGAAKKETTTE  137

Query  407  eetegvaaeetkKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGY  228
            E      AEE KKSNHV RK+EKRQK+R LDSHLEEQF SGRL ACISSRPGQCGRADGY
Sbjct  138  EGEAAAPAEEAKKSNHVVRKIEKRQKDRTLDSHLEEQFSSGRLYACISSRPGQCGRADGY  197

Query  227  ILEGKELEFYM  195
            ILEGKELEFYM
Sbjct  198  ILEGKELEFYM  208



>ref|XP_010675861.1| PREDICTED: 40S ribosomal protein S8 [Beta vulgaris subsp. vulgaris]
Length=217

 Score =   280 bits (716),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 158/185 (85%), Positives = 166/185 (90%), Gaps = 1/185 (1%)
 Frame = -3

Query  734  YEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  555
            YE GRQPANTKLSSNKTVRR+RVRGGNVKWRALRLDTGN+SWGSEAVTRKTR+LDVVYNA
Sbjct  27   YELGRQPANTKLSSNKTVRRVRVRGGNVKWRALRLDTGNFSWGSEAVTRKTRLLDVVYNA  86

Query  554  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketaeetegvaaeet  375
            SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG +IGR KK AA     E  EG   EE 
Sbjct  87   SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVEIGR-KKKAAASAKKEAEEGETTEEA  145

Query  374  kKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEGKELEFYM  195
            KKSNHV RKLEKRQ+ R LD+H+EEQFG GRL+ACISSRPGQCGRADGYILEGKELEFYM
Sbjct  146  KKSNHVARKLEKRQQTRTLDAHIEEQFGGGRLLACISSRPGQCGRADGYILEGKELEFYM  205

Query  194  KKIQR  180
            KKIQR
Sbjct  206  KKIQR  210



>ref|XP_008337490.1| PREDICTED: 40S ribosomal protein S8 [Malus domestica]
Length=221

 Score =   280 bits (716),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 154/185 (83%), Positives = 164/185 (89%), Gaps = 0/185 (0%)
 Frame = -3

Query  734  YEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  555
            YE GRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGN+SWGSEAVTRKTR+LDVVYNA
Sbjct  27   YELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNFSWGSEAVTRKTRLLDVVYNA  86

Query  554  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketaeetegvaaeet  375
            SNNELVRTQTLVK AIVQVDAAPFKQWYLQHYG +IGR+KK+A  K+   E      EE 
Sbjct  87   SNNELVRTQTLVKGAIVQVDAAPFKQWYLQHYGVEIGRRKKSAVAKKDTPEEGEGTTEEA  146

Query  374  kKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEGKELEFYM  195
            KKSNHV RKLEKRQ+ R LD H+EEQFG GRL+ACISSRPGQCGR DGYILEGKELEFYM
Sbjct  147  KKSNHVARKLEKRQQGRTLDPHIEEQFGGGRLLACISSRPGQCGRCDGYILEGKELEFYM  206

Query  194  KKIQR  180
            KK+QR
Sbjct  207  KKLQR  211



>gb|EMT18438.1| 40S ribosomal protein S8 [Aegilops tauschii]
Length=225

 Score =   280 bits (716),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 157/200 (79%), Positives = 172/200 (86%), Gaps = 6/200 (3%)
 Frame = -3

Query  761  KKAWRKKRKYEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKT  582
            +KAWRKKRKYE GRQPANTKLSSNKTVRR+RVRGGNVKWRALRLDTGN+SWGSEAVTRKT
Sbjct  18   QKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALRLDTGNFSWGSEAVTRKT  77

Query  581  RILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGR------kkkaaak  420
            R+LDVVYN+SNNELVRTQTLVK+AIVQVDAAPFKQWYL HYG +IGR        K  A 
Sbjct  78   RLLDVVYNSSNNELVRTQTLVKNAIVQVDAAPFKQWYLTHYGVEIGRKKKAAAAAKKEAA  137

Query  419  ketaeetegvaaeetkKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGR  240
            +    E    A EE KKSN+VQRKLEKRQ+ R LDSH+EEQF  GRL+ACISSRPGQCGR
Sbjct  138  EGQEAEVAAAATEEAKKSNNVQRKLEKRQQGRTLDSHIEEQFSGGRLLACISSRPGQCGR  197

Query  239  ADGYILEGKELEFYMKKIQR  180
            ADGYILEGKELEFYM+K+Q+
Sbjct  198  ADGYILEGKELEFYMRKLQK  217



>ref|XP_006369983.1| hypothetical protein POPTR_0001s37140g [Populus trichocarpa]
 gb|ERP66552.1| hypothetical protein POPTR_0001s37140g [Populus trichocarpa]
Length=199

 Score =   279 bits (713),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 157/185 (85%), Positives = 163/185 (88%), Gaps = 1/185 (1%)
 Frame = -3

Query  734  YEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  555
            YE GRQPA+TKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA
Sbjct  8    YELGRQPASTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  67

Query  554  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketaeetegvaaeet  375
            SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG DIGR KK     +   E      EE 
Sbjct  68   SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGIDIGR-KKKTTAAKKEGEEGEAVTEEV  126

Query  374  kKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEGKELEFYM  195
            KKSNHV RKLEKRQ+ RKLD H+EEQFGSGRL+A ISSRPGQCGRADGYILEGKELEFY+
Sbjct  127  KKSNHVLRKLEKRQQIRKLDPHIEEQFGSGRLLASISSRPGQCGRADGYILEGKELEFYL  186

Query  194  KKIQR  180
            KKIQR
Sbjct  187  KKIQR  191



>ref|XP_009126438.1| PREDICTED: 40S ribosomal protein S8-1-like [Brassica rapa]
Length=226

 Score =   280 bits (716),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 156/196 (80%), Positives = 166/196 (85%), Gaps = 8/196 (4%)
 Frame = -3

Query  761  KKAWRKKRKYEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKT  582
            +K WRKKRKYE GRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKT
Sbjct  18   QKGWRKKRKYEMGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKT  77

Query  581  RILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketae-  405
            R+LDVVYNASNNELVRT+TLVKSAIVQVDAAPFKQWYLQHYG ++GRKKK        E 
Sbjct  78   RVLDVVYNASNNELVRTKTLVKSAIVQVDAAPFKQWYLQHYGVEVGRKKKTVPSAAKKEG  137

Query  404  -------etegvaaeetkKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQC  246
                        A EE KKSNHVQRK+E RQ+ R LDSH+E+QF SGRL+ACISSRPGQC
Sbjct  138  EDGEEAAPAAAAAPEEVKKSNHVQRKIESRQEGRSLDSHIEDQFASGRLLACISSRPGQC  197

Query  245  GRADGYILEGKELEFY  198
            GRADGYILEGKELEFY
Sbjct  198  GRADGYILEGKELEFY  213



>emb|CDP15136.1| unnamed protein product [Coffea canephora]
Length=275

 Score =   281 bits (720),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 164/186 (88%), Positives = 169/186 (91%), Gaps = 1/186 (1%)
 Frame = -3

Query  734  YEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  555
            YE GRQ ANTKLSS+KTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA
Sbjct  81   YELGRQAANTKLSSDKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  140

Query  554  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGR-kkkaaakketaeetegvaaee  378
            SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG DIGR KK    KKE  E     A EE
Sbjct  141  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVDIGRKKKAVVVKKEGEEGEAAAATEE  200

Query  377  tkKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEGKELEFY  198
            TKKSNHV RK+EKRQKERKLD+H+EEQFGSGRL+ACISSRPGQCGRADGYILEGKELEFY
Sbjct  201  TKKSNHVLRKIEKRQKERKLDAHIEEQFGSGRLLACISSRPGQCGRADGYILEGKELEFY  260

Query  197  MKKIQR  180
            MKKIQR
Sbjct  261  MKKIQR  266



>emb|CDY45095.1| BnaA02g04810D [Brassica napus]
Length=244

 Score =   280 bits (717),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 157/196 (80%), Positives = 167/196 (85%), Gaps = 8/196 (4%)
 Frame = -3

Query  761  KKAWRKKRKYEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKT  582
            +K WRKKRKYE GRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKT
Sbjct  36   QKGWRKKRKYEMGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKT  95

Query  581  RILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketae-  405
            R+LDVVYNASNNELVRT+TLVKSAIVQVDAAPFKQWYLQHYG ++GRKKK A      E 
Sbjct  96   RVLDVVYNASNNELVRTKTLVKSAIVQVDAAPFKQWYLQHYGVEVGRKKKTAPSAAKKEG  155

Query  404  -------etegvaaeetkKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQC  246
                        A EE KKSNHVQRK+E RQ+ R LDSH+E+QF SGRL+ACISSRPGQC
Sbjct  156  EDGEEAAPAAAAAPEEVKKSNHVQRKIESRQEGRSLDSHIEDQFASGRLLACISSRPGQC  215

Query  245  GRADGYILEGKELEFY  198
            GRADGYILEGKELEFY
Sbjct  216  GRADGYILEGKELEFY  231



>ref|XP_010278451.1| PREDICTED: 40S ribosomal protein S8-like [Nelumbo nucifera]
Length=219

 Score =   279 bits (713),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 163/186 (88%), Positives = 171/186 (92%), Gaps = 1/186 (1%)
 Frame = -3

Query  734  YEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  555
            YE GRQPANTKLSSNKTVRR+RVRGGNVKWRALRLDTGNYSWGSE VTRKTRILDVVYNA
Sbjct  27   YELGRQPANTKLSSNKTVRRVRVRGGNVKWRALRLDTGNYSWGSEHVTRKTRILDVVYNA  86

Query  554  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketae-etegvaaee  378
            SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG DIGRKKKAAAKK+TAE +      EE
Sbjct  87   SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVDIGRKKKAAAKKDTAEGQEGDGTTEE  146

Query  377  tkKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEGKELEFY  198
            TKKS+HV RKLEKR +  KLD H+EEQFGSGRL+ACISSRPGQCGRADGYILEG+ELEFY
Sbjct  147  TKKSSHVLRKLEKRLQGHKLDPHIEEQFGSGRLLACISSRPGQCGRADGYILEGRELEFY  206

Query  197  MKKIQR  180
            MKKIQR
Sbjct  207  MKKIQR  212



>ref|XP_010069614.1| PREDICTED: 40S ribosomal protein S8-like [Eucalyptus grandis]
 gb|KCW58022.1| hypothetical protein EUGRSUZ_H00750 [Eucalyptus grandis]
Length=222

 Score =   279 bits (713),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 166/186 (89%), Positives = 173/186 (93%), Gaps = 1/186 (1%)
 Frame = -3

Query  734  YEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  555
            YE GRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYN+
Sbjct  27   YELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNS  86

Query  554  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGR-kkkaaakketaeetegvaaee  378
            SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG DIGR KK AAAKKE  EE E   AEE
Sbjct  87   SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVDIGRKKKAAAAKKEATEEGEAAPAEE  146

Query  377  tkKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEGKELEFY  198
             KKS HV RKLEKRQK+R+LD+H+EEQFGSGRL+ACISSRPGQCGR+DGYILEGKELEFY
Sbjct  147  AKKSAHVLRKLEKRQKDRQLDAHIEEQFGSGRLLACISSRPGQCGRSDGYILEGKELEFY  206

Query  197  MKKIQR  180
            MKKIQR
Sbjct  207  MKKIQR  212



>ref|XP_002529032.1| 40S ribosomal protein S8, putative [Ricinus communis]
 gb|EEF33343.1| 40S ribosomal protein S8, putative [Ricinus communis]
Length=219

 Score =   279 bits (713),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 158/185 (85%), Positives = 165/185 (89%), Gaps = 1/185 (1%)
 Frame = -3

Query  734  YEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  555
            YE GRQPA+TKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA
Sbjct  27   YELGRQPASTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  86

Query  554  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketaeetegvaaeet  375
            SNNELVRTQTLVKSAI+QVDAAPFKQWYLQHYG DIGR KK  A  +   E    A EE 
Sbjct  87   SNNELVRTQTLVKSAIIQVDAAPFKQWYLQHYGVDIGR-KKKTAAAKKEGEEGEAATEEV  145

Query  374  kKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEGKELEFYM  195
            KKSNHV RKLEKRQ+ RKLD H+EEQFG GRL+ACISSRPGQCGRADGYILEGKELEFYM
Sbjct  146  KKSNHVLRKLEKRQQIRKLDPHIEEQFGGGRLLACISSRPGQCGRADGYILEGKELEFYM  205

Query  194  KKIQR  180
            KK+QR
Sbjct  206  KKLQR  210



>ref|XP_002313320.1| 40S ribosomal protein S8 [Populus trichocarpa]
 gb|ABK92635.1| unknown [Populus trichocarpa]
 gb|EEE87275.1| 40S ribosomal protein S8 [Populus trichocarpa]
Length=219

 Score =   279 bits (713),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 164/186 (88%), Positives = 170/186 (91%), Gaps = 1/186 (1%)
 Frame = -3

Query  734  YEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  555
            YE GRQPA+TKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA
Sbjct  27   YELGRQPASTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  86

Query  554  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGR-kkkaaakketaeetegvaaee  378
            SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG DIGR KK  AA K+  EE E  A EE
Sbjct  87   SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVDIGRKKKTTAAAKKEGEEGEAAATEE  146

Query  377  tkKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEGKELEFY  198
             K+SNHVQRKLEKRQ+ RKLD H+EEQFGSGRL+A ISSRPGQCGRADGYILEGKELEFY
Sbjct  147  VKQSNHVQRKLEKRQQIRKLDPHIEEQFGSGRLLASISSRPGQCGRADGYILEGKELEFY  206

Query  197  MKKIQR  180
            MKKIQR
Sbjct  207  MKKIQR  212



>ref|XP_008451649.1| PREDICTED: 40S ribosomal protein S8-like [Cucumis melo]
Length=219

 Score =   279 bits (713),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 156/185 (84%), Positives = 165/185 (89%), Gaps = 1/185 (1%)
 Frame = -3

Query  734  YEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  555
            YE GRQPANTKLSS+K++RRIRVRGGNVKWRA RLDTGNYSWGSEAVTRKTRILDVVYNA
Sbjct  27   YELGRQPANTKLSSDKSIRRIRVRGGNVKWRAFRLDTGNYSWGSEAVTRKTRILDVVYNA  86

Query  554  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketaeetegvaaeet  375
            SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG DIGR KK  +     EE      EE 
Sbjct  87   SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVDIGR-KKKTSASAKKEEEGDAGTEEV  145

Query  374  kKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEGKELEFYM  195
            KKSNHVQRK+EKRQ++RKLD H+EEQF SGRLMACISSRPGQCGRADGYILEGKELEFYM
Sbjct  146  KKSNHVQRKIEKRQQDRKLDPHIEEQFSSGRLMACISSRPGQCGRADGYILEGKELEFYM  205

Query  194  KKIQR  180
            KK+QR
Sbjct  206  KKLQR  210



>ref|XP_009413565.1| PREDICTED: 40S ribosomal protein S8-like [Musa acuminata subsp. 
malaccensis]
Length=222

 Score =   279 bits (713),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 158/186 (85%), Positives = 168/186 (90%), Gaps = 1/186 (1%)
 Frame = -3

Query  734  YEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  555
            YE GRQPANTKLSSNKTVRR+RVRGGNVKWRALRLD+GNYSWGSEAVTRKTR+LDVVYNA
Sbjct  27   YELGRQPANTKLSSNKTVRRVRVRGGNVKWRALRLDSGNYSWGSEAVTRKTRVLDVVYNA  86

Query  554  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkka-aakketaeetegvaaee  378
            SNNELVRTQTLVKSAIVQVDAAPFKQWY QHYG +IGRKKKA  A K+ A E    A EE
Sbjct  87   SNNELVRTQTLVKSAIVQVDAAPFKQWYFQHYGIEIGRKKKAPTASKKEAAEEGEAAVEE  146

Query  377  tkKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEGKELEFY  198
             KKSNHV RKLEKRQ+  KLD H+EEQFG+GRL+ACISSRPGQCGRADGYILEG+ELEFY
Sbjct  147  GKKSNHVTRKLEKRQQGCKLDPHIEEQFGAGRLLACISSRPGQCGRADGYILEGRELEFY  206

Query  197  MKKIQR  180
            MKKIQR
Sbjct  207  MKKIQR  212



>ref|XP_008792950.1| PREDICTED: 40S ribosomal protein S8 [Phoenix dactylifera]
Length=222

 Score =   278 bits (712),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 159/186 (85%), Positives = 170/186 (91%), Gaps = 2/186 (1%)
 Frame = -3

Query  734  YEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  555
            YE GRQPANTKLSSNKTVRR+RVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA
Sbjct  27   YELGRQPANTKLSSNKTVRRVRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  86

Query  554  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketaeeteg--vaae  381
            SNNELVRTQTLVKSAIVQVDAAPFKQWY+QHYG +IGRKKK  A K+ A E +    AAE
Sbjct  87   SNNELVRTQTLVKSAIVQVDAAPFKQWYIQHYGVEIGRKKKTPAAKKEATEGQEGDGAAE  146

Query  380  etkKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEGKELEF  201
            E KKS+HV RKLEKRQ+ R+LD H+EEQFGSGRL+ACISSRPGQCGRADGYILEGKELEF
Sbjct  147  EVKKSSHVLRKLEKRQQGRQLDPHIEEQFGSGRLLACISSRPGQCGRADGYILEGKELEF  206

Query  200  YMKKIQ  183
            YM+KIQ
Sbjct  207  YMRKIQ  212



>ref|NP_001236970.1| uncharacterized protein LOC100500112 [Glycine max]
 gb|ACU14990.1| unknown [Glycine max]
Length=217

 Score =   278 bits (711),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 161/185 (87%), Positives = 170/185 (92%), Gaps = 1/185 (1%)
 Frame = -3

Query  734  YEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  555
            YE GRQ ANTKLSSNKT+RRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTR LDVVYNA
Sbjct  27   YELGRQAANTKLSSNKTIRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRTLDVVYNA  86

Query  554  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketaeetegvaaeet  375
            SNNELVRTQTLVK+AIVQVDAAPFKQWYLQHYG +IGR KK  A K+ + E    AAEET
Sbjct  87   SNNELVRTQTLVKNAIVQVDAAPFKQWYLQHYGVEIGR-KKKVASKKDSTEEGEAAAEET  145

Query  374  kKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEGKELEFYM  195
            KKSNHVQRKLEKRQK+RKLDSH+EEQFG GRL+ACISSRPGQCGRADGYILEGKELEFYM
Sbjct  146  KKSNHVQRKLEKRQKDRKLDSHIEEQFGGGRLLACISSRPGQCGRADGYILEGKELEFYM  205

Query  194  KKIQR  180
            KK+QR
Sbjct  206  KKLQR  210



>ref|XP_011069406.1| PREDICTED: 40S ribosomal protein S8 [Sesamum indicum]
Length=219

 Score =   278 bits (711),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 159/185 (86%), Positives = 169/185 (91%), Gaps = 1/185 (1%)
 Frame = -3

Query  734  YEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  555
            YE GRQPANTKLSSNKTVRR+RVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA
Sbjct  27   YELGRQPANTKLSSNKTVRRVRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  86

Query  554  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketaeetegvaaeet  375
            SNNELVRTQTLVKSAI+QVDAAPFKQWYLQHYG DIGR KK  A K+  EE E  A EE 
Sbjct  87   SNNELVRTQTLVKSAIIQVDAAPFKQWYLQHYGVDIGR-KKKTAAKKEGEEAEAAATEEV  145

Query  374  kKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEGKELEFYM  195
            KKSNHVQRK+EKRQ++RK+D H+EEQF SGRL+A ISSRPGQCGRADGYILEGKELEFYM
Sbjct  146  KKSNHVQRKIEKRQQDRKIDPHIEEQFSSGRLLAAISSRPGQCGRADGYILEGKELEFYM  205

Query  194  KKIQR  180
            KK+QR
Sbjct  206  KKLQR  210



>dbj|BAJ89904.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=225

 Score =   278 bits (712),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 156/200 (78%), Positives = 170/200 (85%), Gaps = 6/200 (3%)
 Frame = -3

Query  761  KKAWRKKRKYEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKT  582
            +KAWRKKRKYE GRQPANTKLSSNKTVRR+RVRGGNVKWRALRLDTGN+SWGSEA TRKT
Sbjct  18   QKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALRLDTGNFSWGSEATTRKT  77

Query  581  RILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGR------kkkaaak  420
            R+LDVVYN+SNNELVRTQTLVK+AIVQVDAAPFKQWYL HYG +IGR        K  A 
Sbjct  78   RLLDVVYNSSNNELVRTQTLVKNAIVQVDAAPFKQWYLTHYGVEIGRKKKAAAAAKKDAA  137

Query  419  ketaeetegvaaeetkKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGR  240
            +    E    A EE KKSN VQRKLEKRQ+ R LDSH+EEQF  GRL+ACISSRPGQCGR
Sbjct  138  EGQEAEVAAAATEEAKKSNKVQRKLEKRQQGRTLDSHIEEQFSGGRLLACISSRPGQCGR  197

Query  239  ADGYILEGKELEFYMKKIQR  180
            ADGYILEGKELEFYM+K+Q+
Sbjct  198  ADGYILEGKELEFYMRKLQK  217



>ref|XP_010270147.1| PREDICTED: 40S ribosomal protein S8-like [Nelumbo nucifera]
Length=221

 Score =   278 bits (711),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 154/185 (83%), Positives = 164/185 (89%), Gaps = 0/185 (0%)
 Frame = -3

Query  734  YEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  555
            YE GRQPANTKLSSNKTVRR+RVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA
Sbjct  27   YELGRQPANTKLSSNKTVRRVRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  86

Query  554  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketaeetegvaaeet  375
            SNNELVRTQTLVK AIVQVDAAPFKQWYLQHYG DIGRKKK+++  +   E      EE 
Sbjct  87   SNNELVRTQTLVKGAIVQVDAAPFKQWYLQHYGLDIGRKKKSSSAAKKEGEEGEATTEEA  146

Query  374  kKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEGKELEFYM  195
            KKSNHV RKLEKRQ+  KLD H+EEQF SGRL+A I+SRPGQCGRADGYILEG+ELEFYM
Sbjct  147  KKSNHVLRKLEKRQQGHKLDPHIEEQFSSGRLLAAIASRPGQCGRADGYILEGRELEFYM  206

Query  194  KKIQR  180
            KKIQR
Sbjct  207  KKIQR  211



>ref|XP_007134162.1| hypothetical protein PHAVU_010G024600g [Phaseolus vulgaris]
 gb|ESW06156.1| hypothetical protein PHAVU_010G024600g [Phaseolus vulgaris]
Length=218

 Score =   278 bits (710),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 163/180 (91%), Positives = 170/180 (94%), Gaps = 0/180 (0%)
 Frame = -3

Query  734  YEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  555
            YE GRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA
Sbjct  27   YELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  86

Query  554  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketaeetegvaaeet  375
            SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG DIGRKKK AAKK++AEE +  AAEE 
Sbjct  87   SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGLDIGRKKKTAAKKDSAEEGDAAAAEEA  146

Query  374  kKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEGKELEFYM  195
            KKSNHVQRKLEKRQK+RKLD+H+EEQF  GRL+ACISSRPGQCGR DGYILEGKELEFYM
Sbjct  147  KKSNHVQRKLEKRQKDRKLDAHIEEQFAGGRLLACISSRPGQCGRCDGYILEGKELEFYM  206



>ref|XP_010235437.1| PREDICTED: 40S ribosomal protein S8 isoform X2 [Brachypodium 
distachyon]
Length=226

 Score =   278 bits (711),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 160/196 (82%), Positives = 170/196 (87%), Gaps = 7/196 (4%)
 Frame = -3

Query  761  KKAWRKKRKYEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKT  582
            +KAWRKKRKYE GRQPANTKLSSNKTVRR+RVRGGNVKWRALRLDTGNYSWGSEAVTRKT
Sbjct  18   QKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALRLDTGNYSWGSEAVTRKT  77

Query  581  RILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketaee  402
            R+LDVVYN+SNNELVRTQTLVK+AIVQVDAAPFKQWYL HYG DIGRKKK  A  +    
Sbjct  78   RLLDVVYNSSNNELVRTQTLVKNAIVQVDAAPFKQWYLTHYGVDIGRKKKTPAATKKDAT  137

Query  401  t-------egvaaeetkKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCG  243
                       AAEETKKSN+VQRKLEKRQ+ R LD H+EEQF SGRL+ACISSRPGQCG
Sbjct  138  EDGDAAAPAAAAAEETKKSNNVQRKLEKRQQGRTLDPHIEEQFSSGRLLACISSRPGQCG  197

Query  242  RADGYILEGKELEFYM  195
            RADGYILEGKELEFYM
Sbjct  198  RADGYILEGKELEFYM  213



>ref|XP_009371092.1| PREDICTED: 40S ribosomal protein S8-like [Pyrus x bretschneideri]
Length=220

 Score =   278 bits (710),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 155/185 (84%), Positives = 164/185 (89%), Gaps = 1/185 (1%)
 Frame = -3

Query  734  YEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  555
            YE GRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGN+SWGSEAVTRKTR+LDVVYNA
Sbjct  27   YELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNFSWGSEAVTRKTRLLDVVYNA  86

Query  554  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketaeetegvaaeet  375
            SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG +IGR KK+A  K+   E      EE 
Sbjct  87   SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVEIGR-KKSAVAKKDTPEEGEGTTEEA  145

Query  374  kKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEGKELEFYM  195
            KKSNHV RKLEKRQ+ R LD H+EEQFG GRL+ACISSRPGQCGR DGYILEGKELEFYM
Sbjct  146  KKSNHVARKLEKRQQGRTLDPHIEEQFGGGRLLACISSRPGQCGRCDGYILEGKELEFYM  205

Query  194  KKIQR  180
            KK+QR
Sbjct  206  KKLQR  210



>gb|ABL85034.1| ribosomal subunit 8E protein [Brachypodium sylvaticum]
Length=223

 Score =   278 bits (710),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 158/193 (82%), Positives = 169/193 (88%), Gaps = 4/193 (2%)
 Frame = -3

Query  761  KKAWRKKRKYEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKT  582
            +KAWRKKRKYE GRQPANTKLSSNKTVRR+RVRGGNVKWRALRLDTGNYSWGSEAVTRKT
Sbjct  18   QKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALRLDTGNYSWGSEAVTRKT  77

Query  581  RILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketaee  402
            R+LDVVYN+SNNELVRTQTLVK+AIVQVDAAPFKQWYL HYG DIGRKKK  A  +    
Sbjct  78   RLLDVVYNSSNNELVRTQTLVKNAIVQVDAAPFKQWYLAHYGVDIGRKKKTPAATKKDAT  137

Query  401  tegvaaeet----kKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRAD  234
             +G AA       KKSN+VQRKLEKRQ+ R LD H+EEQF SGRL+ACISSRPGQCGRAD
Sbjct  138  EDGDAAAAAAEETKKSNNVQRKLEKRQQGRTLDPHIEEQFSSGRLLACISSRPGQCGRAD  197

Query  233  GYILEGKELEFYM  195
            GYILEGKELEFYM
Sbjct  198  GYILEGKELEFYM  210



>gb|EYU27406.1| hypothetical protein MIMGU_mgv1a013520mg [Erythranthe guttata]
Length=218

 Score =   277 bits (709),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 162/188 (86%), Positives = 171/188 (91%), Gaps = 1/188 (1%)
 Frame = -3

Query  758  KAWRKKRKYEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTR  579
            KAWRKKRKYE GRQPANTKLSSNKTVRR+RVRGGNVKWRALRLDTGN+SWGSEAVTRKTR
Sbjct  19   KAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALRLDTGNFSWGSEAVTRKTR  78

Query  578  ILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketaeet  399
            ILDVVYNASNNELVRTQTLVK AI+QVDAAPFKQWYLQHYG +IGR KK AA K+  EET
Sbjct  79   ILDVVYNASNNELVRTQTLVKGAIIQVDAAPFKQWYLQHYGVEIGR-KKKAAAKKEGEET  137

Query  398  egvaaeetkKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILE  219
            E  AAEE KKS HV RKLEKRQ+ER +D H+EEQFG GRL+A ISSRPGQCGRADGYILE
Sbjct  138  EAAAAEEVKKSKHVLRKLEKRQEERTIDQHIEEQFGGGRLLAAISSRPGQCGRADGYILE  197

Query  218  GKELEFYM  195
            GKELEFYM
Sbjct  198  GKELEFYM  205



>ref|XP_010243157.1| PREDICTED: 40S ribosomal protein S8-like isoform X2 [Nelumbo 
nucifera]
Length=217

 Score =   277 bits (709),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 156/185 (84%), Positives = 163/185 (88%), Gaps = 1/185 (1%)
 Frame = -3

Query  734  YEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  555
            YE GRQPANTKLSSNKTVRR+RVRGGNVKWRALRLDTGNYSWGSE VTRKTRILDVVYNA
Sbjct  27   YELGRQPANTKLSSNKTVRRVRVRGGNVKWRALRLDTGNYSWGSEHVTRKTRILDVVYNA  86

Query  554  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketaeetegvaaeet  375
            SNNELVRTQTLV+SAIVQVDAAPFKQWYLQHYG DI  +KK  A K+   E      EET
Sbjct  87   SNNELVRTQTLVRSAIVQVDAAPFKQWYLQHYGVDI-GRKKKGAAKKDTAEEGDGTTEET  145

Query  374  kKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEGKELEFYM  195
            KKSNHV RKLEKR +  KLD H+EEQFGSGRL+ACISSRPGQCGRADGYILEGKELEFYM
Sbjct  146  KKSNHVLRKLEKRLQSHKLDPHIEEQFGSGRLLACISSRPGQCGRADGYILEGKELEFYM  205

Query  194  KKIQR  180
            KKIQR
Sbjct  206  KKIQR  210



>ref|XP_003557224.1| PREDICTED: 40S ribosomal protein S8 [Brachypodium distachyon]
Length=226

 Score =   277 bits (709),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 159/196 (81%), Positives = 170/196 (87%), Gaps = 7/196 (4%)
 Frame = -3

Query  761  KKAWRKKRKYEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKT  582
            +KAWRKKRKYE GRQPANTKLSSNKTVRR+RVRGGNVKWRALRLDTGNYSWGSEAVTRKT
Sbjct  18   QKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALRLDTGNYSWGSEAVTRKT  77

Query  581  RILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketaee  402
            R+LDVVYN+SNNELVRTQTLVK+AIVQVDAAPFKQWYL HYG DIGRKKK  A  +    
Sbjct  78   RLLDVVYNSSNNELVRTQTLVKNAIVQVDAAPFKQWYLTHYGVDIGRKKKTPAATKKDAT  137

Query  401  te-------gvaaeetkKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCG  243
             +         AAEE KKSN+VQRKLEKRQ+ R LD H+EEQF SGRL+ACISSRPGQCG
Sbjct  138  EDGDAAAPAAAAAEEAKKSNNVQRKLEKRQQGRTLDPHIEEQFSSGRLLACISSRPGQCG  197

Query  242  RADGYILEGKELEFYM  195
            RADGYILEGKELEFYM
Sbjct  198  RADGYILEGKELEFYM  213



>ref|XP_002534344.1| 40S ribosomal protein S8, putative [Ricinus communis]
 gb|EEF28038.1| 40S ribosomal protein S8, putative [Ricinus communis]
Length=221

 Score =   277 bits (709),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 164/186 (88%), Positives = 171/186 (92%), Gaps = 1/186 (1%)
 Frame = -3

Query  734  YEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  555
            YE GRQ ANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA
Sbjct  27   YELGRQAANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  86

Query  554  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkka-aakketaeetegvaaee  378
            SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG DIGRKKK  A K+    E EG AAEE
Sbjct  87   SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVDIGRKKKTVAKKETEEGEGEGAAAEE  146

Query  377  tkKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEGKELEFY  198
            +KKSNHV RKLEKRQK+RKLD+H+EEQF  GRL+ACISSRPGQCGRADGYILEGKELEFY
Sbjct  147  SKKSNHVIRKLEKRQKDRKLDAHIEEQFWGGRLLACISSRPGQCGRADGYILEGKELEFY  206

Query  197  MKKIQR  180
            MKK+QR
Sbjct  207  MKKLQR  212



>ref|XP_011095494.1| PREDICTED: 40S ribosomal protein S8 [Sesamum indicum]
Length=219

 Score =   277 bits (708),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 158/185 (85%), Positives = 168/185 (91%), Gaps = 1/185 (1%)
 Frame = -3

Query  734  YEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  555
            YE GRQPANTKLSSNKTVRR+RVRGGNVKWRALRLDTGN+SWGSEAVTRKTRILDVVYNA
Sbjct  27   YELGRQPANTKLSSNKTVRRVRVRGGNVKWRALRLDTGNFSWGSEAVTRKTRILDVVYNA  86

Query  554  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketaeetegvaaeet  375
            SNNELVRTQTLVK AI+QVDAAPFKQWYLQHYG DIGR KK  A K+  EETE    EE 
Sbjct  87   SNNELVRTQTLVKGAIIQVDAAPFKQWYLQHYGVDIGR-KKKTAAKKEGEETEAAGTEEV  145

Query  374  kKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEGKELEFYM  195
            KKSNHVQRKLEKRQ++RK+D H+EEQFG GRL+A ISSRPGQCGRADGYILEGKELEFYM
Sbjct  146  KKSNHVQRKLEKRQQDRKIDQHIEEQFGGGRLLAAISSRPGQCGRADGYILEGKELEFYM  205

Query  194  KKIQR  180
            KK+QR
Sbjct  206  KKLQR  210



>ref|XP_008809644.1| PREDICTED: 40S ribosomal protein S8 [Phoenix dactylifera]
Length=223

 Score =   277 bits (709),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 158/186 (85%), Positives = 168/186 (90%), Gaps = 1/186 (1%)
 Frame = -3

Query  734  YEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  555
            YE GRQPANTKLSSNKTVRR+RVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA
Sbjct  27   YELGRQPANTKLSSNKTVRRVRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  86

Query  554  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGR-kkkaaakketaeetegvaaee  378
            SNNELVRTQTLVKSAI+Q+DAAPFKQWYLQHYG +IGR KK  AA K+ A E    A EE
Sbjct  87   SNNELVRTQTLVKSAIIQIDAAPFKQWYLQHYGVEIGRKKKAPAATKKEATEEGEGATEE  146

Query  377  tkKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEGKELEFY  198
             KKS+HV RKLEKRQ+ R LD H+EEQFGSGRL+ACISSRPGQCGR+DGYILEGKELEFY
Sbjct  147  AKKSSHVLRKLEKRQQGRTLDPHIEEQFGSGRLLACISSRPGQCGRSDGYILEGKELEFY  206

Query  197  MKKIQR  180
            MKKIQR
Sbjct  207  MKKIQR  212



>ref|XP_002864608.1| 40S ribosomal protein S8 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH40867.1| 40S ribosomal protein S8 [Arabidopsis lyrata subsp. lyrata]
Length=210

 Score =   276 bits (707),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 153/189 (81%), Positives = 162/189 (86%), Gaps = 10/189 (5%)
 Frame = -3

Query  761  KKAWRKKRKYEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKT  582
            +K WRKKRKYE GRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGN+SWGSEAVTRKT
Sbjct  18   QKMWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNFSWGSEAVTRKT  77

Query  581  RILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketaee  402
            RILDV YNASNNELVRTQTLVKSAIV VDAAPFKQ YLQHYG DIGR           ++
Sbjct  78   RILDVAYNASNNELVRTQTLVKSAIVLVDAAPFKQGYLQHYGVDIGR----------KKK  127

Query  401  tegvaaeetkKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYIL  222
             + V  EE KKSNH+QRKLE RQ+ R LDSHLEEQF SGRL+ACI+SRPGQ GRADGYIL
Sbjct  128  GDAVTTEEVKKSNHIQRKLEMRQEGRALDSHLEEQFSSGRLLACIASRPGQSGRADGYIL  187

Query  221  EGKELEFYM  195
            EGKELEFYM
Sbjct  188  EGKELEFYM  196



>ref|XP_003574981.1| PREDICTED: 40S ribosomal protein S8 isoform X1 [Brachypodium 
distachyon]
Length=229

 Score =   277 bits (709),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 160/199 (80%), Positives = 170/199 (85%), Gaps = 10/199 (5%)
 Frame = -3

Query  761  KKAWRKKRKYEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKT  582
            +KAWRKKRKYE GRQPANTKLSSNKTVRR+RVRGGNVKWRALRLDTGNYSWGSEAVTRKT
Sbjct  18   QKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALRLDTGNYSWGSEAVTRKT  77

Query  581  RILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketaee  402
            R+LDVVYN+SNNELVRTQTLVK+AIVQVDAAPFKQWYL HYG DIGRKKK  A  +    
Sbjct  78   RLLDVVYNSSNNELVRTQTLVKNAIVQVDAAPFKQWYLTHYGVDIGRKKKTPAATKKDAT  137

Query  401  tegv----------aaeetkKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPG  252
                          AAEETKKSN+VQRKLEKRQ+ R LD H+EEQF SGRL+ACISSRPG
Sbjct  138  ETLQDGDAAAPAAAAAEETKKSNNVQRKLEKRQQGRTLDPHIEEQFSSGRLLACISSRPG  197

Query  251  QCGRADGYILEGKELEFYM  195
            QCGRADGYILEGKELEFYM
Sbjct  198  QCGRADGYILEGKELEFYM  216



>ref|XP_010905161.1| PREDICTED: 40S ribosomal protein S8-like [Elaeis guineensis]
Length=224

 Score =   277 bits (708),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 162/187 (87%), Positives = 169/187 (90%), Gaps = 2/187 (1%)
 Frame = -3

Query  734  YEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  555
            YE GRQPANTKLSSNKTVRR+RVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA
Sbjct  27   YELGRQPANTKLSSNKTVRRVRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  86

Query  554  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketaeeteg--vaae  381
            SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG +IGRKKKAA  K+   E +    AAE
Sbjct  87   SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVEIGRKKKAAVAKKETAEGQEGDGAAE  146

Query  380  etkKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEGKELEF  201
            E KKSNHV RKLEKRQ+ RKLD H+EEQFG GRL+A ISSRPGQCGRADGYILEGKELEF
Sbjct  147  EAKKSNHVLRKLEKRQQGRKLDPHIEEQFGGGRLLASISSRPGQCGRADGYILEGKELEF  206

Query  200  YMKKIQR  180
            YMKKIQR
Sbjct  207  YMKKIQR  213



>ref|XP_010646836.1| PREDICTED: 40S ribosomal protein S8 [Vitis vinifera]
Length=220

 Score =   276 bits (707),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 159/185 (86%), Positives = 166/185 (90%), Gaps = 1/185 (1%)
 Frame = -3

Query  734  YEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  555
            YE GRQPANTKLSSNKTVRR+RVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA
Sbjct  27   YELGRQPANTKLSSNKTVRRVRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  86

Query  554  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketaeetegvaaeet  375
            SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG DIGR KK AA K+   E      EET
Sbjct  87   SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVDIGR-KKKAAAKKETTEEGEAPVEET  145

Query  374  kKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEGKELEFYM  195
            KKS+HV RKLEKRQ +RKLD H+EEQF SGRL+ACISSRPGQCGRADGYILEGKELEFY 
Sbjct  146  KKSSHVLRKLEKRQADRKLDPHIEEQFSSGRLLACISSRPGQCGRADGYILEGKELEFYT  205

Query  194  KKIQR  180
            +KIQR
Sbjct  206  RKIQR  210



>ref|XP_004244061.1| PREDICTED: 40S ribosomal protein S8-like [Solanum lycopersicum]
Length=221

 Score =   276 bits (707),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 159/194 (82%), Positives = 170/194 (88%), Gaps = 2/194 (1%)
 Frame = -3

Query  761  KKAWRKKRKYEXGRQPANTKLSSN-KTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRK  585
            +K WRKKRKYE GRQPANTKL  N KTVRRIRVRGGNVKWRALRLDTGN+SWGSEAVTRK
Sbjct  18   QKTWRKKRKYELGRQPANTKLVPNAKTVRRIRVRGGNVKWRALRLDTGNFSWGSEAVTRK  77

Query  584  TRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketae  405
            TR+LDVVYNASNNELVRTQTLVKSAI+QVDAAPFKQWYLQHYG +IGR KK  A     E
Sbjct  78   TRLLDVVYNASNNELVRTQTLVKSAIIQVDAAPFKQWYLQHYGVEIGR-KKKTAASSKKE  136

Query  404  etegvaaeetkKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYI  225
              E  A  E KKSNHVQRKLEKRQ++RK+D H+EEQF SGRL+A ISSRPGQCGRADGYI
Sbjct  137  GEEAEAVAEEKKSNHVQRKLEKRQQDRKIDPHVEEQFASGRLLAAISSRPGQCGRADGYI  196

Query  224  LEGKELEFYMKKIQ  183
            LEGKELEFYMKK+Q
Sbjct  197  LEGKELEFYMKKLQ  210



>ref|XP_007223947.1| hypothetical protein PRUPE_ppa011148mg [Prunus persica]
 gb|EMJ25146.1| hypothetical protein PRUPE_ppa011148mg [Prunus persica]
Length=222

 Score =   276 bits (707),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 157/186 (84%), Positives = 165/186 (89%), Gaps = 1/186 (1%)
 Frame = -3

Query  734  YEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  555
            YE GRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGN+SWGSEAVTRKTR+LDVVYNA
Sbjct  27   YELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNFSWGSEAVTRKTRLLDVVYNA  86

Query  554  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketae-etegvaaee  378
            SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG +IGRKKK AA  +    E      EE
Sbjct  87   SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVEIGRKKKTAAAAKKDTPEEGEATTEE  146

Query  377  tkKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEGKELEFY  198
             KKSNHV RKLEKRQ+ R LD H+EEQFG GRL+ACISSRPGQCGRADGYILEGKELEFY
Sbjct  147  AKKSNHVARKLEKRQQGRTLDGHIEEQFGGGRLLACISSRPGQCGRADGYILEGKELEFY  206

Query  197  MKKIQR  180
            MKK+QR
Sbjct  207  MKKLQR  212



>ref|XP_010243156.1| PREDICTED: 40S ribosomal protein S8-like isoform X1 [Nelumbo 
nucifera]
Length=219

 Score =   276 bits (706),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 163/186 (88%), Positives = 170/186 (91%), Gaps = 1/186 (1%)
 Frame = -3

Query  734  YEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  555
            YE GRQPANTKLSSNKTVRR+RVRGGNVKWRALRLDTGNYSWGSE VTRKTRILDVVYNA
Sbjct  27   YELGRQPANTKLSSNKTVRRVRVRGGNVKWRALRLDTGNYSWGSEHVTRKTRILDVVYNA  86

Query  554  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketae-etegvaaee  378
            SNNELVRTQTLV+SAIVQVDAAPFKQWYLQHYG DIGRKKK AAKK+TAE +      EE
Sbjct  87   SNNELVRTQTLVRSAIVQVDAAPFKQWYLQHYGVDIGRKKKGAAKKDTAEGQEGDGTTEE  146

Query  377  tkKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEGKELEFY  198
            TKKSNHV RKLEKR +  KLD H+EEQFGSGRL+ACISSRPGQCGRADGYILEGKELEFY
Sbjct  147  TKKSNHVLRKLEKRLQSHKLDPHIEEQFGSGRLLACISSRPGQCGRADGYILEGKELEFY  206

Query  197  MKKIQR  180
            MKKIQR
Sbjct  207  MKKIQR  212



>sp|O81361.1|RS8_PRUAR RecName: Full=40S ribosomal protein S8 [Prunus armeniaca]
 gb|AAC24583.1| 40S ribosomal protein S8 [Prunus armeniaca]
Length=221

 Score =   276 bits (706),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 154/185 (83%), Positives = 165/185 (89%), Gaps = 0/185 (0%)
 Frame = -3

Query  734  YEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  555
            YE GRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGN+SWGSEAVTRKTR+LDVVYNA
Sbjct  27   YELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNFSWGSEAVTRKTRLLDVVYNA  86

Query  554  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketaeetegvaaeet  375
            SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG +IGRKKK AA K+   E      EE 
Sbjct  87   SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVEIGRKKKTAAAKKDTPEEGEATTEEA  146

Query  374  kKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEGKELEFYM  195
            KKSNHV  KLEKRQ+ R LD+H+EEQFG G+L+ACISSRPGQCG+ADG ILEGKELEFYM
Sbjct  147  KKSNHVAIKLEKRQQGRTLDAHIEEQFGGGKLLACISSRPGQCGKADGDILEGKELEFYM  206

Query  194  KKIQR  180
            KK+QR
Sbjct  207  KKLQR  211



>gb|KDP45274.1| hypothetical protein JCGZ_15139 [Jatropha curcas]
Length=221

 Score =   276 bits (706),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 164/183 (90%), Positives = 168/183 (92%), Gaps = 3/183 (2%)
 Frame = -3

Query  734  YEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  555
            YE GRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA
Sbjct  27   YELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  86

Query  554  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketaee---tegvaa  384
            SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG DIGRKKK  AKKET EE        A
Sbjct  87   SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVDIGRKKKTVAKKETTEEGDAAAPATA  146

Query  383  eetkKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEGKELE  204
            EE KKSNHVQRKLEKRQK+RKLD H+EEQFG+GRL+ACISSRPGQCGRADGYILEGKELE
Sbjct  147  EEAKKSNHVQRKLEKRQKDRKLDPHIEEQFGAGRLLACISSRPGQCGRADGYILEGKELE  206

Query  203  FYM  195
            FYM
Sbjct  207  FYM  209



>ref|XP_009405538.1| PREDICTED: 40S ribosomal protein S8-like [Musa acuminata subsp. 
malaccensis]
Length=224

 Score =   276 bits (706),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 158/188 (84%), Positives = 165/188 (88%), Gaps = 3/188 (2%)
 Frame = -3

Query  734  YEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  555
            YE GRQPANTKLSSNKTVRR+RVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA
Sbjct  27   YELGRQPANTKLSSNKTVRRVRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  86

Query  554  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketaeet---egvaa  384
            SNNELVRTQTLVKSAIVQVDA PFK WYLQHYG +IGRKKKA A  +           AA
Sbjct  87   SNNELVRTQTLVKSAIVQVDATPFKHWYLQHYGVEIGRKKKAPAAAKKEATEVPEGEAAA  146

Query  383  eetkKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEGKELE  204
            EE KKSNHV RKLEKRQ+ R LD H+EEQFG+GRL+ACISSRPGQCGRADGYILEGKELE
Sbjct  147  EEAKKSNHVTRKLEKRQQGRTLDPHIEEQFGAGRLLACISSRPGQCGRADGYILEGKELE  206

Query  203  FYMKKIQR  180
            FYMKKIQR
Sbjct  207  FYMKKIQR  214



>gb|EMS65111.1| 40S ribosomal protein S8 [Triticum urartu]
Length=274

 Score =   278 bits (711),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 161/200 (81%), Positives = 176/200 (88%), Gaps = 6/200 (3%)
 Frame = -3

Query  761  KKAWRKKRKYEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKT  582
            +KAWRKKRKYE GRQPANTKLSSNKTVRR+RVRGGNVKWRALRLDTGN+SWGSEAVTRKT
Sbjct  67   QKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALRLDTGNFSWGSEAVTRKT  126

Query  581  RILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketa--  408
            R+LDVVYN+SNNELVRTQTLVK+AIVQVDAAPFKQWYL HYG +IGRKKKAAA  +    
Sbjct  127  RLLDVVYNSSNNELVRTQTLVKNAIVQVDAAPFKQWYLTHYGVEIGRKKKAAAAAKKEPA  186

Query  407  ----eetegvaaeetkKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGR  240
                 E    A EE KKSN+VQRKLEKRQ+ R LDSH+EEQF  GRL+ACISSRPGQCGR
Sbjct  187  EGQEAEVAAAATEEAKKSNNVQRKLEKRQQGRTLDSHIEEQFSGGRLLACISSRPGQCGR  246

Query  239  ADGYILEGKELEFYMKKIQR  180
            ADGYILEGKELEFYM+K+Q+
Sbjct  247  ADGYILEGKELEFYMRKLQK  266



>gb|ACI15738.1| putative 40S ribosomal protein S8-like protein [Picrorhiza kurrooa]
Length=216

 Score =   276 bits (705),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 154/185 (83%), Positives = 164/185 (89%), Gaps = 2/185 (1%)
 Frame = -3

Query  734  YEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  555
            YE GRQPANTKLSSNKTVRR+RVRGGNVKWRALRLDTGN+SWGSEAVTRKTRILDVVYNA
Sbjct  27   YELGRQPANTKLSSNKTVRRVRVRGGNVKWRALRLDTGNFSWGSEAVTRKTRILDVVYNA  86

Query  554  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketaeetegvaaeet  375
            SNNELVRTQTLVK AI+QVDAAPFKQWYLQHYG +IGR  K     +   E   V AEE 
Sbjct  87   SNNELVRTQTLVKGAIIQVDAAPFKQWYLQHYGVEIGR--KKKTAAKKEGEEAEVVAEEV  144

Query  374  kKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEGKELEFYM  195
            KKSNHVQRKLEKRQ+ERK+DSH+EEQF  GRL+A ISSRPGQCGRADGYILEGKELEFYM
Sbjct  145  KKSNHVQRKLEKRQEERKIDSHIEEQFSGGRLLAAISSRPGQCGRADGYILEGKELEFYM  204

Query  194  KKIQR  180
            KK+QR
Sbjct  205  KKLQR  209



>ref|XP_006281069.1| hypothetical protein CARUB_v10027092mg [Capsella rubella]
 gb|EOA13967.1| hypothetical protein CARUB_v10027092mg [Capsella rubella]
Length=220

 Score =   275 bits (704),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 156/180 (87%), Positives = 164/180 (91%), Gaps = 0/180 (0%)
 Frame = -3

Query  734  YEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  555
            YE GRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGN+SWGSE VTRKTRILDV YNA
Sbjct  27   YELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNFSWGSETVTRKTRILDVAYNA  86

Query  554  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketaeetegvaaeet  375
            SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG DIGRKKKAAA K+  E  + V  EE 
Sbjct  87   SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVDIGRKKKAAATKKEGEGGDAVTTEEV  146

Query  374  kKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEGKELEFYM  195
            KKSNHVQRKLE RQ++R +DSHLEEQF SGRL+ACI+SRPGQCGRADGYILEGKELEFYM
Sbjct  147  KKSNHVQRKLEMRQEDRAIDSHLEEQFSSGRLLACIASRPGQCGRADGYILEGKELEFYM  206



>ref|XP_004160707.1| PREDICTED: 40S ribosomal protein S8-like [Cucumis sativus]
Length=221

 Score =   275 bits (703),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 159/186 (85%), Positives = 169/186 (91%), Gaps = 1/186 (1%)
 Frame = -3

Query  734  YEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  555
            YE GRQPANTKLSS+K++RRIRVRGGNVKWRA RLDTGNYSWGSEAV+RKTRILDVVYNA
Sbjct  27   YELGRQPANTKLSSDKSIRRIRVRGGNVKWRAFRLDTGNYSWGSEAVSRKTRILDVVYNA  86

Query  554  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketaeetegvaaeet  375
            SNNELVRTQTLVKSA+VQVDAAPFKQWYLQHYG DIGRKKK AA  +  EE +  AA E 
Sbjct  87   SNNELVRTQTLVKSAVVQVDAAPFKQWYLQHYGVDIGRKKKTAASAKKDEEGDAAAAAEE  146

Query  374  -kKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEGKELEFY  198
             KKSNHVQRKLEKRQ+ RKLD H+EEQF SGRLMACISSRPGQCGRADGYILEGKELEFY
Sbjct  147  VKKSNHVQRKLEKRQEGRKLDPHIEEQFSSGRLMACISSRPGQCGRADGYILEGKELEFY  206

Query  197  MKKIQR  180
            MKK+QR
Sbjct  207  MKKLQR  212



>ref|XP_007049645.1| 40S ribosomal protein S8 isoform 3 [Theobroma cacao]
 gb|EOX93802.1| 40S ribosomal protein S8 isoform 3 [Theobroma cacao]
Length=195

 Score =   274 bits (700),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 150/186 (81%), Positives = 159/186 (85%), Gaps = 7/186 (4%)
 Frame = -3

Query  737  KYEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYN  558
            +YE GRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYN
Sbjct  8    RYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYN  67

Query  557  ASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketaeetegvaaee  378
            ASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG DIGRKKK AAKKE  E       +E
Sbjct  68   ASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVDIGRKKKTAAKKEATEVESFFIWQE  127

Query  377  tkKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEGKELEFY  198
                      + +  K+ KLD+H+EEQFG+GRL+ACISSRPGQCGRADGYILEGKELEFY
Sbjct  128  -------GEGVAEETKKSKLDAHIEEQFGAGRLLACISSRPGQCGRADGYILEGKELEFY  180

Query  197  MKKIQR  180
             KKIQR
Sbjct  181  TKKIQR  186



>ref|XP_004149800.1| PREDICTED: 40S ribosomal protein S8-like [Cucumis sativus]
 gb|KGN47709.1| hypothetical protein Csa_6G382970 [Cucumis sativus]
Length=222

 Score =   275 bits (702),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 158/187 (84%), Positives = 168/187 (90%), Gaps = 2/187 (1%)
 Frame = -3

Query  734  YEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  555
            YE GRQPANTKLSS+K++RRIRVRGGNVKWRA RLDTGNYSWGSEAV+RKTRILDVVYNA
Sbjct  27   YELGRQPANTKLSSDKSIRRIRVRGGNVKWRAFRLDTGNYSWGSEAVSRKTRILDVVYNA  86

Query  554  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketaeetegvaaeet  375
            SNNELVRTQTLVKSA+VQVDAAPFKQWYLQHYG DIGRKKK AA  +  EE +  AA   
Sbjct  87   SNNELVRTQTLVKSAVVQVDAAPFKQWYLQHYGVDIGRKKKTAASAKKDEEGDAAAAAAE  146

Query  374  --kKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEGKELEF  201
              KKSNHVQRKLEKRQ+ RKLD H+EEQF SGRLMACISSRPGQCGRADGYILEGKELEF
Sbjct  147  EVKKSNHVQRKLEKRQEGRKLDPHIEEQFSSGRLMACISSRPGQCGRADGYILEGKELEF  206

Query  200  YMKKIQR  180
            YMKK+QR
Sbjct  207  YMKKLQR  213



>gb|KHM99496.1| 40S ribosomal protein S8 [Glycine soja]
Length=219

 Score =   275 bits (702),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 155/181 (86%), Positives = 162/181 (90%), Gaps = 1/181 (1%)
 Frame = -3

Query  734  YEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  555
            YE GRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA
Sbjct  27   YELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  86

Query  554  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketae-etegvaaee  378
            SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG ++GRKKK+AA     E E    A EE
Sbjct  87   SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVEVGRKKKSAAASVKKEGEDGEAATEE  146

Query  377  tkKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEGKELEFY  198
             KKSNHV RKLEKR++ R LD H+EEQFG GRL+ACISSRPGQCGRADGYILEGKELEFY
Sbjct  147  VKKSNHVVRKLEKRKQNRVLDPHIEEQFGGGRLLACISSRPGQCGRADGYILEGKELEFY  206

Query  197  M  195
            M
Sbjct  207  M  207



>ref|XP_003532158.1| PREDICTED: 40S ribosomal protein S8-like [Glycine max]
Length=219

 Score =   275 bits (702),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 155/181 (86%), Positives = 162/181 (90%), Gaps = 1/181 (1%)
 Frame = -3

Query  734  YEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  555
            YE GRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA
Sbjct  27   YELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  86

Query  554  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketae-etegvaaee  378
            SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG ++GRKKK+AA     E E    A EE
Sbjct  87   SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVEVGRKKKSAAASVKKEGEDGEAATEE  146

Query  377  tkKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEGKELEFY  198
             KKSNHV RKLEKR++ R LD H+EEQFG GRL+ACISSRPGQCGRADGYILEGKELEFY
Sbjct  147  VKKSNHVVRKLEKRKQNRVLDPHIEEQFGGGRLLACISSRPGQCGRADGYILEGKELEFY  206

Query  197  M  195
            M
Sbjct  207  M  207



>ref|XP_009778867.1| PREDICTED: 40S ribosomal protein S8-like [Nicotiana sylvestris]
Length=223

 Score =   275 bits (702),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 158/181 (87%), Positives = 162/181 (90%), Gaps = 1/181 (1%)
 Frame = -3

Query  734  YEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  555
            YE GRQPANTK+S NKTVRRIRVRGGNVKWRALRLDTGNYSWGSEA TRKTRILDVVYNA
Sbjct  27   YELGRQPANTKISGNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEATTRKTRILDVVYNA  86

Query  554  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkk-aaakketaeetegvaaee  378
            SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG DIGRKKK A+ K+ T E       EE
Sbjct  87   SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVDIGRKKKGASKKETTEEGEAAAPVEE  146

Query  377  tkKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEGKELEFY  198
             KKSNHV RKLEKRQK+RKLD HLEEQFGSGRL ACISSRPGQCGRADGYILEGKELEFY
Sbjct  147  AKKSNHVARKLEKRQKDRKLDPHLEEQFGSGRLYACISSRPGQCGRADGYILEGKELEFY  206

Query  197  M  195
            M
Sbjct  207  M  207



>ref|XP_009403610.1| PREDICTED: 40S ribosomal protein S8-like [Musa acuminata subsp. 
malaccensis]
Length=220

 Score =   274 bits (701),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 157/186 (84%), Positives = 169/186 (91%), Gaps = 1/186 (1%)
 Frame = -3

Query  734  YEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  555
            YE GRQPANTKLSSNKTVRR+RVRGGNVKWRALRLD+GNYSWGSEAVTRKTRILDVVYNA
Sbjct  27   YELGRQPANTKLSSNKTVRRVRVRGGNVKWRALRLDSGNYSWGSEAVTRKTRILDVVYNA  86

Query  554  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkka-aakketaeetegvaaee  378
            SNNELVRTQTLVKSAIVQVDAAPF+QWYLQHYG +IGRKKKA  A K+ A E    AAEE
Sbjct  87   SNNELVRTQTLVKSAIVQVDAAPFRQWYLQHYGVEIGRKKKAPTASKKDAMEEGEAAAEE  146

Query  377  tkKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEGKELEFY  198
             KKSNHV RKLEKRQ+ R LD H+E+QFG+GRL+ACISSRPGQCGR+DGYILEGKELEFY
Sbjct  147  EKKSNHVTRKLEKRQQGRILDPHIEDQFGAGRLLACISSRPGQCGRSDGYILEGKELEFY  206

Query  197  MKKIQR  180
             KK+QR
Sbjct  207  TKKLQR  212



>ref|XP_008227073.1| PREDICTED: 40S ribosomal protein S8-like [Prunus mume]
Length=225

 Score =   274 bits (701),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 157/191 (82%), Positives = 165/191 (86%), Gaps = 6/191 (3%)
 Frame = -3

Query  734  YEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  555
            YE GRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGN+SWGSEAVTRKTR+LDVVYNA
Sbjct  27   YELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNFSWGSEAVTRKTRLLDVVYNA  86

Query  554  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketaeet------eg  393
            SNNELVRTQTLVK AIVQVDAAPFKQWYLQHYG +IGRKKK AA  +   E         
Sbjct  87   SNNELVRTQTLVKGAIVQVDAAPFKQWYLQHYGVEIGRKKKTAAAAKKEGEEGDAAAAPA  146

Query  392  vaaeetkKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEGK  213
              AEE KKSNHV RKLEKRQ+ R LD H+EEQFG GRL+ACISSRPGQCGRADGYILEGK
Sbjct  147  AVAEEVKKSNHVVRKLEKRQQSRTLDQHIEEQFGGGRLLACISSRPGQCGRADGYILEGK  206

Query  212  ELEFYMKKIQR  180
            ELEFYMKK+QR
Sbjct  207  ELEFYMKKLQR  217



>ref|XP_008366424.1| PREDICTED: 40S ribosomal protein S8 [Malus domestica]
 ref|XP_009364625.1| PREDICTED: 40S ribosomal protein S8-like [Pyrus x bretschneideri]
 ref|XP_009364657.1| PREDICTED: 40S ribosomal protein S8-like [Pyrus x bretschneideri]
 ref|XP_009335423.1| PREDICTED: 40S ribosomal protein S8-like [Pyrus x bretschneideri]
Length=222

 Score =   274 bits (700),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 155/188 (82%), Positives = 164/188 (87%), Gaps = 3/188 (2%)
 Frame = -3

Query  734  YEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  555
            YE GRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGN+SWGSEAVTRKTR+LDVVYNA
Sbjct  27   YELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNFSWGSEAVTRKTRLLDVVYNA  86

Query  554  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGR---kkkaaakketaeetegvaa  384
            SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG +IGR      AA K+    E    AA
Sbjct  87   SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVEIGRKKKTAAAAKKEAEDGEAPAAAA  146

Query  383  eetkKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEGKELE  204
            EE KKSNHV RKLEKRQ+ R LD H+EEQFG GRL+ACISSRPGQCGR DGYILEG+ELE
Sbjct  147  EEAKKSNHVARKLEKRQQTRTLDQHIEEQFGGGRLLACISSRPGQCGRCDGYILEGRELE  206

Query  203  FYMKKIQR  180
            FYMKK+QR
Sbjct  207  FYMKKLQR  214



>ref|XP_009361080.1| PREDICTED: 40S ribosomal protein S8-like [Pyrus x bretschneideri]
 ref|XP_009348460.1| PREDICTED: 40S ribosomal protein S8-like [Pyrus x bretschneideri]
Length=222

 Score =   274 bits (700),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 156/188 (83%), Positives = 165/188 (88%), Gaps = 3/188 (2%)
 Frame = -3

Query  734  YEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  555
            YE GRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGN+SWGSEAVTRKTR+LDVVYNA
Sbjct  27   YELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNFSWGSEAVTRKTRLLDVVYNA  86

Query  554  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketae---etegvaa  384
            SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG +IGRKKK AA  +      E    A 
Sbjct  87   SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVEIGRKKKTAAAAKKEAEDGEAPAAAP  146

Query  383  eetkKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEGKELE  204
            EE KKSNHV RKLEKRQ+ R LD H+EEQFG GRL+ACISSRPGQCGR DGYILEG+ELE
Sbjct  147  EEAKKSNHVARKLEKRQQTRTLDQHIEEQFGGGRLLACISSRPGQCGRCDGYILEGRELE  206

Query  203  FYMKKIQR  180
            FYMKK+QR
Sbjct  207  FYMKKLQR  214



>gb|AET01418.2| 40S ribosomal protein S8 [Medicago truncatula]
Length=288

 Score =   276 bits (706),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 155/194 (80%), Positives = 171/194 (88%), Gaps = 1/194 (1%)
 Frame = -3

Query  761  KKAWRKKRKYEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKT  582
            +K   KKRKYE GRQPANTKLSSNKTVR IRVRGGN+K RALRLDTGN SWGSEAVTRK+
Sbjct  89   RKTCIKKRKYELGRQPANTKLSSNKTVRSIRVRGGNLKCRALRLDTGNISWGSEAVTRKS  148

Query  581  RILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketaee  402
            R+L+VVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG +IG  KK  A K+ + +
Sbjct  149  RLLNVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVEIGN-KKKTAAKQDSAK  207

Query  401  tegvaaeetkKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYIL  222
                A EETKKSNHV RKLE R+K+R+LD+H+EEQFG GRL+ACISSRPGQCGRADGYIL
Sbjct  208  EAEAATEETKKSNHVLRKLENREKDRQLDAHIEEQFGGGRLLACISSRPGQCGRADGYIL  267

Query  221  EGKELEFYMKKIQR  180
            EGKELEFYMKK+QR
Sbjct  268  EGKELEFYMKKLQR  281



>ref|XP_009619873.1| PREDICTED: 40S ribosomal protein S8-like [Nicotiana tomentosiformis]
Length=220

 Score =   273 bits (698),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 152/186 (82%), Positives = 161/186 (87%), Gaps = 3/186 (2%)
 Frame = -3

Query  734  YEXGRQPANTKLSSN-KTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYN  558
            YE GRQPANTKL  N KTVRRIRVRGGNVKWRALRLDTGNYSWGSEA+TRKTR+LDVVYN
Sbjct  27   YELGRQPANTKLVPNAKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAITRKTRLLDVVYN  86

Query  557  ASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketaeetegvaaee  378
            ASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG DIGR  K        E  E  A  E
Sbjct  87   ASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVDIGR--KKKTAASKKEGEEAEAVPE  144

Query  377  tkKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEGKELEFY  198
             KKSNHVQRKL+KRQ++RK+D H+EEQF SGRL+A ISSRPGQCGRADGYILEGKELEFY
Sbjct  145  EKKSNHVQRKLQKRQQDRKIDPHIEEQFASGRLLAAISSRPGQCGRADGYILEGKELEFY  204

Query  197  MKKIQR  180
            MKK+QR
Sbjct  205  MKKLQR  210



>ref|XP_006856815.1| hypothetical protein AMTR_s00055p00155570 [Amborella trichopoda]
 gb|ERN18282.1| hypothetical protein AMTR_s00055p00155570 [Amborella trichopoda]
Length=218

 Score =   273 bits (697),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 154/185 (83%), Positives = 164/185 (89%), Gaps = 1/185 (1%)
 Frame = -3

Query  734  YEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  555
            YE GRQPANTKLSSNKTVRR+RVRGGNVKWRALRLDTGN SWGSEAVTRKTRILDVVYNA
Sbjct  27   YELGRQPANTKLSSNKTVRRVRVRGGNVKWRALRLDTGNCSWGSEAVTRKTRILDVVYNA  86

Query  554  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketaeetegvaaeet  375
            SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG D+G KKK A+  +   E    A EE 
Sbjct  87   SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVDLG-KKKKASATKKEGEEAEGATEEV  145

Query  374  kKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEGKELEFYM  195
            KKS+HV+RKLEKR +  KLD H+EEQFG GRL+ACISSRPGQCGRADGY+LEGKELEFYM
Sbjct  146  KKSDHVKRKLEKRLEGHKLDPHIEEQFGGGRLLACISSRPGQCGRADGYVLEGKELEFYM  205

Query  194  KKIQR  180
            KKIQR
Sbjct  206  KKIQR  210



>ref|XP_007211997.1| hypothetical protein PRUPE_ppa011067mg [Prunus persica]
 ref|XP_007211998.1| hypothetical protein PRUPE_ppa011067mg [Prunus persica]
 gb|EMJ13196.1| hypothetical protein PRUPE_ppa011067mg [Prunus persica]
 gb|EMJ13197.1| hypothetical protein PRUPE_ppa011067mg [Prunus persica]
Length=225

 Score =   273 bits (698),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 156/191 (82%), Positives = 165/191 (86%), Gaps = 6/191 (3%)
 Frame = -3

Query  734  YEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  555
            YE GRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGN+SWGSEAVTRKTR+LDVVYNA
Sbjct  27   YELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNFSWGSEAVTRKTRLLDVVYNA  86

Query  554  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketaeet------eg  393
            SNNELVRTQTLVK AIVQVDAAPFKQWYLQHYG +IGRKKK AA  +   E         
Sbjct  87   SNNELVRTQTLVKGAIVQVDAAPFKQWYLQHYGVEIGRKKKTAAAAKKEGEEGDAAAAPA  146

Query  392  vaaeetkKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEGK  213
              AEE KKSNHV RKLEKRQ+ R LD H+EEQFG GRL+ACISSRPGQCGR+DGYILEGK
Sbjct  147  AVAEEVKKSNHVVRKLEKRQQSRTLDQHIEEQFGGGRLLACISSRPGQCGRSDGYILEGK  206

Query  212  ELEFYMKKIQR  180
            ELEFYMKK+QR
Sbjct  207  ELEFYMKKLQR  217



>gb|KHN25148.1| 40S ribosomal protein S8 [Glycine soja]
Length=219

 Score =   273 bits (697),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 160/181 (88%), Positives = 167/181 (92%), Gaps = 1/181 (1%)
 Frame = -3

Query  734  YEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  555
            YE GRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA
Sbjct  27   YELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  86

Query  554  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGR-kkkaaakketaeetegvaaee  378
            SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG +IGR KK AA K+   E    VA EE
Sbjct  87   SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVEIGRKKKTAAKKETAEEGAAAVAVEE  146

Query  377  tkKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEGKELEFY  198
             KKSNH+QRKLEKRQK+RKLD+H+EEQFGSGRL+ACISSRPGQCGRADGYILEGKELEFY
Sbjct  147  AKKSNHLQRKLEKRQKDRKLDAHIEEQFGSGRLLACISSRPGQCGRADGYILEGKELEFY  206

Query  197  M  195
            M
Sbjct  207  M  207



>ref|XP_010926672.1| PREDICTED: 40S ribosomal protein S8-like isoform X2 [Elaeis guineensis]
Length=207

 Score =   272 bits (695),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 156/186 (84%), Positives = 168/186 (90%), Gaps = 2/186 (1%)
 Frame = -3

Query  746  KKRKYEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDV  567
            + R+YE GR+PANTKLSSNKTVRR+RVRGGNVKWRALRLDTGNYSWGSEAVTRKTR+LDV
Sbjct  6    RARRYELGRRPANTKLSSNKTVRRVRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRVLDV  65

Query  566  VYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketaeeteg--  393
            VYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG +IGRKKK  A K+ A E +   
Sbjct  66   VYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVEIGRKKKTLAAKKEATEGQEGD  125

Query  392  vaaeetkKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEGK  213
             AAEE KKSNHV RKLEKRQ+ R+LD H+EEQFGSGRL+ACISSRPGQCGRADG ILEGK
Sbjct  126  GAAEEVKKSNHVLRKLEKRQQGRQLDPHIEEQFGSGRLLACISSRPGQCGRADGCILEGK  185

Query  212  ELEFYM  195
            ELEFYM
Sbjct  186  ELEFYM  191



>ref|XP_006286561.1| hypothetical protein CARUB_v10001914mg [Capsella rubella]
 gb|EOA19459.1| hypothetical protein CARUB_v10001914mg [Capsella rubella]
Length=221

 Score =   272 bits (696),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 153/183 (84%), Positives = 164/183 (90%), Gaps = 3/183 (2%)
 Frame = -3

Query  734  YEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  555
            YE GRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNY+WGSEAVTRKTR+LDVVYNA
Sbjct  27   YEMGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYAWGSEAVTRKTRVLDVVYNA  86

Query  554  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketae---etegvaa  384
            SNNELVRT+TLVKSAIVQVDAAPFKQWYLQHYG ++GRKKK AA     E   + E  A 
Sbjct  87   SNNELVRTKTLVKSAIVQVDAAPFKQWYLQHYGVEVGRKKKNAATSTKKEGEDKEEVAAP  146

Query  383  eetkKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEGKELE  204
            EETKKSNHVQRK+E RQ+ R LDSH+E+QF SGRL+ACISSRPGQCGRADGYILEGKELE
Sbjct  147  EETKKSNHVQRKIEGRQETRTLDSHIEDQFASGRLLACISSRPGQCGRADGYILEGKELE  206

Query  203  FYM  195
            FYM
Sbjct  207  FYM  209



>ref|XP_008364326.1| PREDICTED: 40S ribosomal protein S8-like [Malus domestica]
 ref|XP_008345024.1| PREDICTED: 40S ribosomal protein S8 [Malus domestica]
 ref|XP_008355313.1| PREDICTED: 40S ribosomal protein S8 [Malus domestica]
Length=222

 Score =   272 bits (696),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 155/188 (82%), Positives = 164/188 (87%), Gaps = 3/188 (2%)
 Frame = -3

Query  734  YEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  555
            YE GRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGN+SWGSE VTRKTR+LDVVYNA
Sbjct  27   YELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNFSWGSETVTRKTRLLDVVYNA  86

Query  554  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketae---etegvaa  384
            SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG +IGRKKK AA  +      E    A 
Sbjct  87   SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVEIGRKKKTAAAAKKEAEDGEAPAAAP  146

Query  383  eetkKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEGKELE  204
            EE KKSNHV RKLEKRQ+ R LD H+EEQFG GRL+ACISSRPGQCGR DGYILEG+ELE
Sbjct  147  EEAKKSNHVARKLEKRQQTRTLDQHIEEQFGGGRLLACISSRPGQCGRCDGYILEGRELE  206

Query  203  FYMKKIQR  180
            FYMKK+QR
Sbjct  207  FYMKKLQR  214



>gb|ACJ86093.1| unknown [Medicago truncatula]
 gb|AFK33939.1| unknown [Medicago truncatula]
 gb|KEH22555.1| 40S ribosomal S8-like protein [Medicago truncatula]
Length=217

 Score =   271 bits (694),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 154/180 (86%), Positives = 166/180 (92%), Gaps = 1/180 (1%)
 Frame = -3

Query  734  YEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  555
            YE GRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGN+SWGSEAVTRKTR+LDVVYNA
Sbjct  27   YELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNFSWGSEAVTRKTRLLDVVYNA  86

Query  554  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketaeetegvaaeet  375
            SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG ++GR KK  A K+ + E   V AEE 
Sbjct  87   SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVEVGR-KKKTAAKKDSAEEAEVVAEEV  145

Query  374  kKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEGKELEFYM  195
            KKS+HVQRKLE+RQK+R+LDSH+EEQFG GRL+ACISSRPGQCGRADGYILEGKELEFYM
Sbjct  146  KKSSHVQRKLEQRQKDRQLDSHIEEQFGGGRLLACISSRPGQCGRADGYILEGKELEFYM  205



>ref|XP_008657369.1| PREDICTED: uncharacterized protein LOC100193830 isoform X1 [Zea 
mays]
Length=223

 Score =   271 bits (694),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 157/192 (82%), Positives = 169/192 (88%), Gaps = 4/192 (2%)
 Frame = -3

Query  761  KKAWRKKRKYEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKT  582
            +KAWRKKRKYE GRQPANTKLSSNKTVRR+RVRGGNVKWRALRLDTGNYSWGSEA+TRKT
Sbjct  18   QKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALRLDTGNYSWGSEALTRKT  77

Query  581  RILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkk--aaakketa  408
            RILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYL HYG DIGRKKK   A K  T 
Sbjct  78   RILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLTHYGVDIGRKKKVPVAKKDATE  137

Query  407  eetegvaaeetkKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGY  228
             +     AEETKKSNHVQRK+EKRQ++R LD+H+EEQFGSGRL+ACIS+RPGQCGRADGY
Sbjct  138  GQEGEAIAEETKKSNHVQRKIEKRQQDRALDTHIEEQFGSGRLLACISARPGQCGRADGY  197

Query  227  ILEG--KELEFY  198
            ILE     + FY
Sbjct  198  ILEANYSGISFY  209



>gb|AFK47179.1| unknown [Medicago truncatula]
 gb|KEH18114.1| 40S ribosomal S8-like protein [Medicago truncatula]
Length=215

 Score =   271 bits (693),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 152/180 (84%), Positives = 159/180 (88%), Gaps = 3/180 (2%)
 Frame = -3

Query  734  YEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  555
            YE GRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGN+SWGSEAVTRKTR+LDVVYNA
Sbjct  27   YELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNFSWGSEAVTRKTRLLDVVYNA  86

Query  554  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketaeetegvaaeet  375
            SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG DIGR           EE    A EE 
Sbjct  87   SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVDIGR---KKKNVSKKEEEAEAATEEV  143

Query  374  kKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEGKELEFYM  195
            KKS HVQRKLE+RQKER+LD+H+EEQFG GRL+ACISSRPGQCGRADGYILEGKELEFYM
Sbjct  144  KKSAHVQRKLEQRQKERQLDAHIEEQFGGGRLLACISSRPGQCGRADGYILEGKELEFYM  203



>ref|XP_009783183.1| PREDICTED: 40S ribosomal protein S8 [Nicotiana sylvestris]
Length=224

 Score =   271 bits (693),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 156/182 (86%), Positives = 163/182 (90%), Gaps = 2/182 (1%)
 Frame = -3

Query  734  YEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  555
            YE GRQPANTK+S+NKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA
Sbjct  27   YELGRQPANTKISTNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  86

Query  554  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkk--aaakketaeetegvaae  381
            SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG DIGRKKK  A  +     E    AAE
Sbjct  87   SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVDIGRKKKGPAKKETTEEGEGAAAAAE  146

Query  380  etkKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEGKELEF  201
            ETKKSNHV RK+E RQK+RKLD H+EEQFG GRL+ACISSRPGQCGRADGYILEGKELEF
Sbjct  147  ETKKSNHVLRKIETRQKDRKLDPHIEEQFGGGRLLACISSRPGQCGRADGYILEGKELEF  206

Query  200  YM  195
            YM
Sbjct  207  YM  208



>ref|XP_009770276.1| PREDICTED: 40S ribosomal protein S8-like [Nicotiana sylvestris]
Length=220

 Score =   271 bits (693),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 151/186 (81%), Positives = 160/186 (86%), Gaps = 3/186 (2%)
 Frame = -3

Query  734  YEXGRQPANTKLSSN-KTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYN  558
            YE GRQPANTKL  N KTVRRIRVRGGNVKWRALRLDTGNYSWGSEA+TRKTR+LDVVYN
Sbjct  27   YELGRQPANTKLVPNAKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAITRKTRLLDVVYN  86

Query  557  ASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketaeetegvaaee  378
            ASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG DIGR  K        E  E  A  E
Sbjct  87   ASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVDIGR--KKKTAASKKEGEEAEAVPE  144

Query  377  tkKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEGKELEFY  198
             KKSNHVQRKL+KRQ++RK+D H+EEQF  GRL+A ISSRPGQCGRADGYILEGKELEFY
Sbjct  145  EKKSNHVQRKLQKRQQDRKIDPHIEEQFAGGRLLAAISSRPGQCGRADGYILEGKELEFY  204

Query  197  MKKIQR  180
            MKK+QR
Sbjct  205  MKKLQR  210



>ref|XP_009610547.1| PREDICTED: 40S ribosomal protein S8 [Nicotiana tomentosiformis]
Length=224

 Score =   271 bits (693),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 156/182 (86%), Positives = 163/182 (90%), Gaps = 2/182 (1%)
 Frame = -3

Query  734  YEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  555
            YE GRQPANTK+S+NKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA
Sbjct  27   YELGRQPANTKISANKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  86

Query  554  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkk--aaakketaeetegvaae  381
            SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG DIGRKKK  A  +     E    AAE
Sbjct  87   SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVDIGRKKKGPAKKETTEEGEGAAAAAE  146

Query  380  etkKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEGKELEF  201
            ETKKSNHV RK+E RQK+RKLD H+EEQFG GRL+ACISSRPGQCGRADGYILEGKELEF
Sbjct  147  ETKKSNHVLRKIETRQKDRKLDPHIEEQFGGGRLLACISSRPGQCGRADGYILEGKELEF  206

Query  200  YM  195
            YM
Sbjct  207  YM  208



>ref|XP_003520991.1| PREDICTED: 40S ribosomal protein S8-like [Glycine max]
 gb|KHN05782.1| 40S ribosomal protein S8 [Glycine soja]
Length=220

 Score =   271 bits (692),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 155/182 (85%), Positives = 162/182 (89%), Gaps = 2/182 (1%)
 Frame = -3

Query  734  YEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  555
            YE GRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTR+LDVVYNA
Sbjct  27   YELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRVLDVVYNA  86

Query  554  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGR--kkkaaakketaeetegvaae  381
            SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG +IGR  K  A  +          AAE
Sbjct  87   SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVEIGRKKKTAAKKETAEEGGDAAAAAE  146

Query  380  etkKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEGKELEF  201
            E KKSNHVQRKLEKRQK+RKLD+H+EEQFG GRL+ACISSRPGQCGRADGYILEGKELEF
Sbjct  147  EAKKSNHVQRKLEKRQKDRKLDAHIEEQFGGGRLLACISSRPGQCGRADGYILEGKELEF  206

Query  200  YM  195
            YM
Sbjct  207  YM  208



>ref|XP_003547779.1| PREDICTED: 40S ribosomal protein S8 [Glycine max]
Length=219

 Score =   271 bits (692),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 159/181 (88%), Positives = 166/181 (92%), Gaps = 1/181 (1%)
 Frame = -3

Query  734  YEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  555
            YE GRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA
Sbjct  27   YELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  86

Query  554  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGR-kkkaaakketaeetegvaaee  378
            SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG +IGR KK AA K+   E    VA EE
Sbjct  87   SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVEIGRKKKTAAKKETAEEGAAAVAVEE  146

Query  377  tkKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEGKELEFY  198
             KKSNH+QRKLEKRQK+RKLD+H+EEQFG GRL+ACISSRPGQCGRADGYILEGKELEFY
Sbjct  147  AKKSNHLQRKLEKRQKDRKLDAHIEEQFGGGRLLACISSRPGQCGRADGYILEGKELEFY  206

Query  197  M  195
            M
Sbjct  207  M  207



>ref|XP_010926670.1| PREDICTED: 40S ribosomal protein S8-like isoform X1 [Elaeis guineensis]
 ref|XP_010926671.1| PREDICTED: 40S ribosomal protein S8-like isoform X1 [Elaeis guineensis]
Length=212

 Score =   270 bits (691),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 155/184 (84%), Positives = 167/184 (91%), Gaps = 2/184 (1%)
 Frame = -3

Query  740  RKYEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVY  561
            ++YE GR+PANTKLSSNKTVRR+RVRGGNVKWRALRLDTGNYSWGSEAVTRKTR+LDVVY
Sbjct  13   KRYELGRRPANTKLSSNKTVRRVRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRVLDVVY  72

Query  560  NASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketaeeteg--va  387
            NASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG +IGRKKK  A K+ A E +    A
Sbjct  73   NASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVEIGRKKKTLAAKKEATEGQEGDGA  132

Query  386  aeetkKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEGKEL  207
            AEE KKSNHV RKLEKRQ+ R+LD H+EEQFGSGRL+ACISSRPGQCGRADG ILEGKEL
Sbjct  133  AEEVKKSNHVLRKLEKRQQGRQLDPHIEEQFGSGRLLACISSRPGQCGRADGCILEGKEL  192

Query  206  EFYM  195
            EFYM
Sbjct  193  EFYM  196



>gb|ACU19111.1| unknown [Glycine max]
Length=220

 Score =   270 bits (691),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 163/182 (90%), Positives = 170/182 (93%), Gaps = 2/182 (1%)
 Frame = -3

Query  734  YEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  555
            YE GRQPA+TKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTR+LDVVYNA
Sbjct  27   YELGRQPASTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRVLDVVYNA  86

Query  554  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketaee--tegvaae  381
            SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG +IGRKKK AAKKETAEE      A E
Sbjct  87   SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVEIGRKKKTAAKKETAEEGGDAVAATE  146

Query  380  etkKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEGKELEF  201
            E KKSNHVQRKLEKRQK+RKLD+H+EEQFG GRL+ACISSRPGQCGRADGYILEGKELEF
Sbjct  147  EAKKSNHVQRKLEKRQKDRKLDAHIEEQFGGGRLLACISSRPGQCGRADGYILEGKELEF  206

Query  200  YM  195
            YM
Sbjct  207  YM  208



>gb|AFK37035.1| unknown [Lotus japonicus]
Length=218

 Score =   270 bits (691),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 148/180 (82%), Positives = 157/180 (87%), Gaps = 0/180 (0%)
 Frame = -3

Query  734  YEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  555
            YE GRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGN+SWGSE VTRKTRILDVVYNA
Sbjct  27   YELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNFSWGSETVTRKTRILDVVYNA  86

Query  554  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketaeetegvaaeet  375
            SNNELVRTQTLVK AI+QVDAAPFKQWYLQHYG D+GRKKK A   +   E    A EE 
Sbjct  87   SNNELVRTQTLVKGAIIQVDAAPFKQWYLQHYGVDLGRKKKGATAAKKEGEDVETATEEA  146

Query  374  kKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEGKELEFYM  195
            KKSNHV RKLEKR + R LD+H+EEQFG GRL+ACISSRPGQCGR+DGYILE KELEFYM
Sbjct  147  KKSNHVLRKLEKRTENRTLDAHIEEQFGGGRLLACISSRPGQCGRSDGYILESKELEFYM  206



>ref|XP_004290159.1| PREDICTED: 40S ribosomal protein S8-like [Fragaria vesca subsp. 
vesca]
Length=224

 Score =   270 bits (691),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 158/188 (84%), Positives = 168/188 (89%), Gaps = 3/188 (2%)
 Frame = -3

Query  734  YEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  555
            YE GRQPANTK+SSNKTVRRIRVRGGNVKWRALRLDTGN+SWGSEAVTRKTRILDVVYNA
Sbjct  27   YELGRQPANTKISSNKTVRRIRVRGGNVKWRALRLDTGNFSWGSEAVTRKTRILDVVYNA  86

Query  554  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakket---aeetegvaa  384
            SNNELVRTQTLVKSAIVQVDAAPF+QWYLQHY  DIGRKKK AAKK+    A E      
Sbjct  87   SNNELVRTQTLVKSAIVQVDAAPFRQWYLQHYNVDIGRKKKTAAKKDAKDVAAEEADGTT  146

Query  383  eetkKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEGKELE  204
            EETKKS ++ RKLEKRQK+R LDSH+EEQF  GRL+ACISSRPGQCGRADGYILEGKELE
Sbjct  147  EETKKSGNLLRKLEKRQKDRTLDSHIEEQFSGGRLLACISSRPGQCGRADGYILEGKELE  206

Query  203  FYMKKIQR  180
            FYMKK+QR
Sbjct  207  FYMKKLQR  214



>gb|AFK33351.1| unknown [Lotus japonicus]
Length=218

 Score =   270 bits (690),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 147/180 (82%), Positives = 156/180 (87%), Gaps = 0/180 (0%)
 Frame = -3

Query  734  YEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  555
            YE GRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGN+SWGSE VTRKTRILDVVYNA
Sbjct  27   YELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNFSWGSETVTRKTRILDVVYNA  86

Query  554  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketaeetegvaaeet  375
            SNNELVRTQTLVK AI+QVDAAPFKQWYLQHYG D+GRKKK A   +   E      EE 
Sbjct  87   SNNELVRTQTLVKGAIIQVDAAPFKQWYLQHYGVDLGRKKKGATAAKKEGEDVETVTEEA  146

Query  374  kKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEGKELEFYM  195
            KKSNHV RKLEKR + R LD+H+EEQFG GRL+ACISSRPGQCGR+DGYILE KELEFYM
Sbjct  147  KKSNHVLRKLEKRTENRTLDAHIEEQFGGGRLLACISSRPGQCGRSDGYILESKELEFYM  206



>ref|NP_001274851.1| uncharacterized protein LOC102577693 [Solanum tuberosum]
 gb|ABA46755.1| unknown [Solanum tuberosum]
Length=224

 Score =   270 bits (690),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 156/182 (86%), Positives = 162/182 (89%), Gaps = 2/182 (1%)
 Frame = -3

Query  734  YEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  555
            YE GRQPANTKLS+NKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA
Sbjct  27   YELGRQPANTKLSNNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  86

Query  554  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkk--aaakketaeetegvaae  381
            SNNELVRTQTLVKSAI+QVDAAPFKQWYLQHYG DIGRKKK  A  +     E    AAE
Sbjct  87   SNNELVRTQTLVKSAIIQVDAAPFKQWYLQHYGADIGRKKKGPAKKETTEEGEGAAAAAE  146

Query  380  etkKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEGKELEF  201
            ETKKSNHVQRK+E RQK+R LD HLEEQFG GRL+ACISSRPGQCGR DGYILEGKELEF
Sbjct  147  ETKKSNHVQRKIENRQKDRTLDPHLEEQFGGGRLLACISSRPGQCGRCDGYILEGKELEF  206

Query  200  YM  195
            YM
Sbjct  207  YM  208



>ref|XP_003551567.1| PREDICTED: 40S ribosomal protein S8 [Glycine max]
 gb|KHN28407.1| 40S ribosomal protein S8 [Glycine soja]
Length=219

 Score =   270 bits (689),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 154/181 (85%), Positives = 161/181 (89%), Gaps = 1/181 (1%)
 Frame = -3

Query  734  YEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  555
            YE GRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEA TRKTRILDVVYNA
Sbjct  27   YELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAATRKTRILDVVYNA  86

Query  554  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketae-etegvaaee  378
            SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG ++GRKKK+AA     E E    A EE
Sbjct  87   SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVEVGRKKKSAAASAKKEGEDGEAATEE  146

Query  377  tkKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEGKELEFY  198
             KKSNHV RKLEKR++ R LD H+EEQFG GRL+ACISSRPGQCGRADGYILEGKELEFY
Sbjct  147  VKKSNHVLRKLEKRKQNRVLDPHIEEQFGGGRLLACISSRPGQCGRADGYILEGKELEFY  206

Query  197  M  195
            M
Sbjct  207  M  207



>ref|XP_004247043.1| PREDICTED: 40S ribosomal protein S8 [Solanum lycopersicum]
Length=222

 Score =   270 bits (689),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 161/180 (89%), Positives = 167/180 (93%), Gaps = 0/180 (0%)
 Frame = -3

Query  734  YEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  555
            YE GRQPANTKLS+NKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA
Sbjct  27   YELGRQPANTKLSNNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  86

Query  554  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketaeetegvaaeet  375
            SNNELVRTQTLVKSAI+QVDAAPFKQWYLQHYG DIGRKKK AAKK+T EE E  A EET
Sbjct  87   SNNELVRTQTLVKSAIIQVDAAPFKQWYLQHYGADIGRKKKGAAKKDTTEEGEAAAPEET  146

Query  374  kKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEGKELEFYM  195
            KKSNHVQRK+E RQK+R LD HLEEQFG GRL+ACISSRPGQCGR DGYILEGKELEFYM
Sbjct  147  KKSNHVQRKIENRQKDRTLDPHLEEQFGGGRLLACISSRPGQCGRCDGYILEGKELEFYM  206



>ref|XP_010420870.1| PREDICTED: 40S ribosomal protein S8-1-like [Camelina sativa]
Length=223

 Score =   269 bits (687),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 152/185 (82%), Positives = 164/185 (89%), Gaps = 5/185 (3%)
 Frame = -3

Query  734  YEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  555
            YE GRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNY+WGSEAVTRKTR+LDVVYNA
Sbjct  27   YEMGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYAWGSEAVTRKTRVLDVVYNA  86

Query  554  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakk-----etaeetegv  390
            SNNELVRT+TLVKSAIVQVDAAPFKQWYLQHYG ++GRKKK AA       E A+E    
Sbjct  87   SNNELVRTKTLVKSAIVQVDAAPFKQWYLQHYGVEVGRKKKTAATTTKKDGEDADEAAPA  146

Query  389  aaeetkKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEGKE  210
              EETKKSNHV+RK+E RQ+ R LDSH+E+QF SGRL+ACISSRPGQCGRADGYILEGKE
Sbjct  147  IPEETKKSNHVKRKIETRQESRTLDSHIEDQFASGRLLACISSRPGQCGRADGYILEGKE  206

Query  209  LEFYM  195
            LEFYM
Sbjct  207  LEFYM  211



>gb|AGV54796.1| 40S ribosomal protein S8 [Phaseolus vulgaris]
Length=218

 Score =   268 bits (686),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 160/180 (89%), Positives = 167/180 (93%), Gaps = 0/180 (0%)
 Frame = -3

Query  734  YEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  555
            YE G  PANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA
Sbjct  27   YELGPPPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  86

Query  554  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketaeetegvaaeet  375
            SNNELVRTQTLVKSAIVQVDAAPFKQWYLQ YG DIGRKKK AAKK++AEE +  AAEE 
Sbjct  87   SNNELVRTQTLVKSAIVQVDAAPFKQWYLQPYGLDIGRKKKTAAKKDSAEEGDAAAAEEA  146

Query  374  kKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEGKELEFYM  195
            KKSNHVQRKLEKRQK+RKLD+H+EEQF  GRL+ACISSRPGQCGR DGYILEGKELEFYM
Sbjct  147  KKSNHVQRKLEKRQKDRKLDAHIEEQFAGGRLLACISSRPGQCGRCDGYILEGKELEFYM  206



>ref|XP_002873989.1| ribosomal protein S8 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH50248.1| ribosomal protein S8 [Arabidopsis lyrata subsp. lyrata]
Length=220

 Score =   268 bits (686),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 151/182 (83%), Positives = 162/182 (89%), Gaps = 2/182 (1%)
 Frame = -3

Query  734  YEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  555
            YE GRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTR+LDVVYNA
Sbjct  27   YEMGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRVLDVVYNA  86

Query  554  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakket--aeetegvaae  381
            SNNELVRT+TLVKSAIVQVDAAPFKQWYL HYG ++GRKKK AA  +    E  E  A E
Sbjct  87   SNNELVRTKTLVKSAIVQVDAAPFKQWYLSHYGVEVGRKKKNAASTKKDAEEGEEVAAVE  146

Query  380  etkKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEGKELEF  201
            ETKKSNH+ RK+E RQ+ R LDSH+E+QF SGRL+ACISSRPGQCGRADGYILEGKELEF
Sbjct  147  ETKKSNHLSRKIESRQEGRSLDSHIEDQFASGRLLACISSRPGQCGRADGYILEGKELEF  206

Query  200  YM  195
            YM
Sbjct  207  YM  208



>gb|KFK31870.1| hypothetical protein AALP_AA6G169300 [Arabis alpina]
Length=219

 Score =   268 bits (686),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 150/181 (83%), Positives = 162/181 (90%), Gaps = 1/181 (1%)
 Frame = -3

Query  734  YEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  555
            YE GRQPANTKLS NKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTR+LDVVYNA
Sbjct  27   YEMGRQPANTKLSGNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRVLDVVYNA  86

Query  554  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketae-etegvaaee  378
            SNNELVRT+TLVKSAIVQVDAAPFKQWYL HYG ++GRKKK A      E E    AAEE
Sbjct  87   SNNELVRTKTLVKSAIVQVDAAPFKQWYLSHYGVEVGRKKKPAPSATKKEGEDVEEAAEE  146

Query  377  tkKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEGKELEFY  198
            TKKSNHV RK+++RQ++R LDSH+E+QF SGRL+ACISSRPGQCGRADGYILEGKELEFY
Sbjct  147  TKKSNHVLRKIKERQEDRNLDSHIEDQFSSGRLLACISSRPGQCGRADGYILEGKELEFY  206

Query  197  M  195
            M
Sbjct  207  M  207



>ref|XP_010493138.1| PREDICTED: 40S ribosomal protein S8-1 [Camelina sativa]
Length=223

 Score =   268 bits (686),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 151/185 (82%), Positives = 162/185 (88%), Gaps = 5/185 (3%)
 Frame = -3

Query  734  YEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  555
            YE GRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNY+WGSEAVTRKTR+LDVVYNA
Sbjct  27   YEMGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYAWGSEAVTRKTRVLDVVYNA  86

Query  554  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketae-----etegv  390
            SNNELVRT+TLVKSAIVQVDAAPFKQWYLQHYG ++GRKKK A      +     E    
Sbjct  87   SNNELVRTKTLVKSAIVQVDAAPFKQWYLQHYGVEVGRKKKTAVTTTKKDGEDGDEAAPA  146

Query  389  aaeetkKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEGKE  210
             AEETKKSNHVQRK+E RQ+ R LDSH+E+QF SGRL+ACISSRPGQCGRADGYILEGKE
Sbjct  147  VAEETKKSNHVQRKIESRQETRTLDSHIEDQFASGRLLACISSRPGQCGRADGYILEGKE  206

Query  209  LEFYM  195
            LEFYM
Sbjct  207  LEFYM  211



>gb|ACU16800.1| unknown [Glycine max]
Length=243

 Score =   269 bits (687),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 159/181 (88%), Positives = 166/181 (92%), Gaps = 1/181 (1%)
 Frame = -3

Query  734  YEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  555
            YE GRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA
Sbjct  27   YELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  86

Query  554  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGR-kkkaaakketaeetegvaaee  378
            SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG +IGR KK AA K+   E    VA EE
Sbjct  87   SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVEIGRKKKTAAKKETAEEGAAAVAVEE  146

Query  377  tkKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEGKELEFY  198
             KKSNH+QRKLEKRQK+RKLD+H+EEQFG GRL+ACISSRPGQCGRADGYILEGKELEFY
Sbjct  147  AKKSNHLQRKLEKRQKDRKLDAHIEEQFGGGRLLACISSRPGQCGRADGYILEGKELEFY  206

Query  197  M  195
            M
Sbjct  207  M  207



>gb|EYU33688.1| hypothetical protein MIMGU_mgv1a013525mg [Erythranthe guttata]
Length=218

 Score =   268 bits (685),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 155/180 (86%), Positives = 166/180 (92%), Gaps = 1/180 (1%)
 Frame = -3

Query  734  YEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  555
            YE GRQPANTKLSSNKTVRR+RVRGGNVKWRALRLDTGN+SWGSEAVTRKTRILDVVYNA
Sbjct  27   YELGRQPANTKLSSNKTVRRVRVRGGNVKWRALRLDTGNFSWGSEAVTRKTRILDVVYNA  86

Query  554  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketaeetegvaaeet  375
            SNNELVRT+TLVKSAI+QVDAAPFKQWYLQHYG DI R KK AA K+  EE E  A EE 
Sbjct  87   SNNELVRTKTLVKSAIIQVDAAPFKQWYLQHYGVDISR-KKKAAVKKEGEEAEAAATEEA  145

Query  374  kKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEGKELEFYM  195
            KKSNHVQRK+EKRQ+ERK+D+H+EEQFGSGRL+A ISSRPGQCGRADGYILEGKELEFYM
Sbjct  146  KKSNHVQRKIEKRQEERKIDTHIEEQFGSGRLLAAISSRPGQCGRADGYILEGKELEFYM  205



>ref|XP_011461093.1| PREDICTED: 40S ribosomal protein S8 [Fragaria vesca subsp. vesca]
 ref|XP_011461096.1| PREDICTED: 40S ribosomal protein S8 [Fragaria vesca subsp. vesca]
Length=225

 Score =   268 bits (685),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 153/191 (80%), Positives = 162/191 (85%), Gaps = 6/191 (3%)
 Frame = -3

Query  734  YEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  555
            YE GRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGN+SWGSEAVTRKTR+LDVVYNA
Sbjct  27   YELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNFSWGSEAVTRKTRLLDVVYNA  86

Query  554  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGR------kkkaaakketaeeteg  393
            SNNELVRTQTLVKSAIVQVDAAPFKQWY  HYG +IGR        K  A+   A     
Sbjct  87   SNNELVRTQTLVKSAIVQVDAAPFKQWYSTHYGVEIGRKKKTAAAIKKEAEDGEAATAAA  146

Query  392  vaaeetkKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEGK  213
             AAEE KKS HV+RKLEKRQ+ R LD H+EEQFG GRL+ACISSRPGQCGRADGYILEGK
Sbjct  147  AAAEEVKKSKHVERKLEKRQQTRVLDHHIEEQFGGGRLLACISSRPGQCGRADGYILEGK  206

Query  212  ELEFYMKKIQR  180
            ELEFYMKK+QR
Sbjct  207  ELEFYMKKLQR  217



>ref|XP_007149668.1| hypothetical protein PHAVU_005G089100g [Phaseolus vulgaris]
 gb|ESW21662.1| hypothetical protein PHAVU_005G089100g [Phaseolus vulgaris]
Length=217

 Score =   268 bits (684),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 158/180 (88%), Positives = 166/180 (92%), Gaps = 1/180 (1%)
 Frame = -3

Query  734  YEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  555
            YE GRQ ANTKLSSNKT+RRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA
Sbjct  27   YELGRQSANTKLSSNKTIRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  86

Query  554  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketaeetegvaaeet  375
            SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG +IGR KK AA K+ + E    AAEET
Sbjct  87   SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVEIGR-KKKAASKKDSTEEADAAAEET  145

Query  374  kKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEGKELEFYM  195
            KKSNHVQRKLEKRQK+RKLD+H+EEQF  GRL+ACISSRPGQCGRADGYILEGKELEFYM
Sbjct  146  KKSNHVQRKLEKRQKDRKLDAHIEEQFAGGRLLACISSRPGQCGRADGYILEGKELEFYM  205



>ref|XP_009596732.1| PREDICTED: 40S ribosomal protein S8 [Nicotiana tomentosiformis]
Length=223

 Score =   267 bits (683),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 162/181 (90%), Positives = 165/181 (91%), Gaps = 1/181 (1%)
 Frame = -3

Query  734  YEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  555
            YE GRQPANTK+S NKTVRRIRVRGGNVKWRALRLDTGNYSWGSEA TRKTRILDVVYNA
Sbjct  27   YELGRQPANTKISGNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEATTRKTRILDVVYNA  86

Query  554  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketaee-tegvaaee  378
            SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG DIGRKKK AAKKET EE      AEE
Sbjct  87   SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVDIGRKKKGAAKKETTEEGEAATPAEE  146

Query  377  tkKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEGKELEFY  198
             KKSNHV RKLEKRQK+RKLD HLEEQFG+GRL ACISSRPGQCGRADGYILEGKELEFY
Sbjct  147  AKKSNHVARKLEKRQKDRKLDPHLEEQFGAGRLYACISSRPGQCGRADGYILEGKELEFY  206

Query  197  M  195
            M
Sbjct  207  M  207



>ref|XP_009771719.1| PREDICTED: 40S ribosomal protein S8 [Nicotiana sylvestris]
Length=224

 Score =   267 bits (683),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 154/182 (85%), Positives = 162/182 (89%), Gaps = 2/182 (1%)
 Frame = -3

Query  734  YEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  555
            YE GRQPANTK+SSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEA TRKTRILDVVYNA
Sbjct  27   YELGRQPANTKISSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEATTRKTRILDVVYNA  86

Query  554  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDI--GRkkkaaakketaeetegvaae  381
            SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG DI   +K  A  +     E    AAE
Sbjct  87   SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVDIGRKKKGAAKKETAEEGEGAAAAAE  146

Query  380  etkKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEGKELEF  201
            ETKKSNHV RKLEKRQK+R+LD+HLEEQFG+GRL+ACISSRPGQCGRADGYILEGKELEF
Sbjct  147  ETKKSNHVARKLEKRQKDRQLDAHLEEQFGAGRLLACISSRPGQCGRADGYILEGKELEF  206

Query  200  YM  195
            YM
Sbjct  207  YM  208



>gb|ACU16398.1| unknown [Glycine max]
Length=256

 Score =   268 bits (685),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 154/181 (85%), Positives = 161/181 (89%), Gaps = 1/181 (1%)
 Frame = -3

Query  734  YEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  555
            YE GRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEA TRKTRILDVVYNA
Sbjct  27   YELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAATRKTRILDVVYNA  86

Query  554  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketae-etegvaaee  378
            SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG ++GRKKK+AA     E E    A EE
Sbjct  87   SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVEVGRKKKSAAASAKKEGEDGEAATEE  146

Query  377  tkKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEGKELEFY  198
             KKSNHV RKLEKR++ R LD H+EEQFG GRL+ACISSRPGQCGRADGYILEGKELEFY
Sbjct  147  VKKSNHVLRKLEKRKQNRVLDPHIEEQFGGGRLLACISSRPGQCGRADGYILEGKELEFY  206

Query  197  M  195
            M
Sbjct  207  M  207



>emb|CDY60374.1| BnaCnng36150D, partial [Brassica napus]
Length=228

 Score =   267 bits (683),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 149/187 (80%), Positives = 160/187 (86%), Gaps = 8/187 (4%)
 Frame = -3

Query  734  YEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  555
            YE GRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTR+LDVVYNA
Sbjct  29   YEMGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRVLDVVYNA  88

Query  554  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketae--------et  399
            SNNELVRT+TLVKSAIVQVDAAPFKQWYLQHYG ++GRKKK A+     +          
Sbjct  89   SNNELVRTKTLVKSAIVQVDAAPFKQWYLQHYGVEVGRKKKNASAAAVKKDGEEGGEAAP  148

Query  398  egvaaeetkKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILE  219
               A EETKKSNHV RK+E RQ+ R LDSH+E+QF SGRL+ACISSRPGQCGRADGYILE
Sbjct  149  AAAAPEETKKSNHVLRKIESRQEGRSLDSHIEDQFASGRLLACISSRPGQCGRADGYILE  208

Query  218  GKELEFY  198
            GKELEFY
Sbjct  209  GKELEFY  215



>ref|XP_006409551.1| hypothetical protein EUTSA_v10022838mg [Eutrema salsugineum]
 gb|ESQ51004.1| hypothetical protein EUTSA_v10022838mg [Eutrema salsugineum]
Length=225

 Score =   267 bits (682),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 150/186 (81%), Positives = 161/186 (87%), Gaps = 7/186 (4%)
 Frame = -3

Query  734  YEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  555
            YE GRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTR+LDVVYNA
Sbjct  27   YEMGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRVLDVVYNA  86

Query  554  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketae-------ete  396
            SNNELVRT+TLVKSAIVQVDAAPFKQWYLQHYG ++GRKKK A+     E          
Sbjct  87   SNNELVRTKTLVKSAIVQVDAAPFKQWYLQHYGVEVGRKKKNASSATKKEGEDGEDASAP  146

Query  395  gvaaeetkKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEG  216
              A EETKKSNHV RK+E+RQ+ R LDSH+E+QF SGRL+ACISSRPGQCGRADGYILEG
Sbjct  147  AAAPEETKKSNHVLRKIEQRQEGRSLDSHIEDQFASGRLLACISSRPGQCGRADGYILEG  206

Query  215  KELEFY  198
            KELEFY
Sbjct  207  KELEFY  212



>ref|XP_009131790.1| PREDICTED: 40S ribosomal protein S8-1 [Brassica rapa]
Length=226

 Score =   266 bits (681),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 149/187 (80%), Positives = 160/187 (86%), Gaps = 8/187 (4%)
 Frame = -3

Query  734  YEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  555
            YE GRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTR+LDVVYNA
Sbjct  27   YEMGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRVLDVVYNA  86

Query  554  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketae--------et  399
            SNNELVRT+TLVKSAIVQVDAAPFKQWYLQHYG ++GRKKK A+     +          
Sbjct  87   SNNELVRTKTLVKSAIVQVDAAPFKQWYLQHYGVEVGRKKKNASAVAAKKDGEEGEEVAP  146

Query  398  egvaaeetkKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILE  219
               A EETKKSNHV RK+E RQ+ R LDSH+E+QF SGRL+ACISSRPGQCGRADGYILE
Sbjct  147  AAAAPEETKKSNHVLRKIESRQEGRSLDSHIEDQFASGRLLACISSRPGQCGRADGYILE  206

Query  218  GKELEFY  198
            GKELEFY
Sbjct  207  GKELEFY  213



>gb|KFK26269.1| hypothetical protein AALP_AA8G225000 [Arabis alpina]
Length=223

 Score =   266 bits (680),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 151/185 (82%), Positives = 163/185 (88%), Gaps = 5/185 (3%)
 Frame = -3

Query  734  YEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  555
            YE GRQPANTKLS NKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTR+LDVVYNA
Sbjct  27   YEMGRQPANTKLSGNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRVLDVVYNA  86

Query  554  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketae-----etegv  390
            SNNELVRT+TLVKSAIVQVDAAPFKQWYL HYG ++GRKKKAA      E     E    
Sbjct  87   SNNELVRTKTLVKSAIVQVDAAPFKQWYLSHYGVEVGRKKKAAVSATKKEGEDVEEAPPA  146

Query  389  aaeetkKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEGKE  210
            AAEETKKSNHV RK+++RQ++R LDSH+E+QF SGRL+ACISSRPGQCGRADGYILEGKE
Sbjct  147  AAEETKKSNHVLRKIKERQEDRNLDSHIEDQFSSGRLLACISSRPGQCGRADGYILEGKE  206

Query  209  LEFYM  195
            LEFYM
Sbjct  207  LEFYM  211



>ref|XP_006400597.1| hypothetical protein EUTSA_v10014589mg [Eutrema salsugineum]
 gb|ESQ42050.1| hypothetical protein EUTSA_v10014589mg [Eutrema salsugineum]
Length=226

 Score =   266 bits (679),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 149/187 (80%), Positives = 159/187 (85%), Gaps = 8/187 (4%)
 Frame = -3

Query  734  YEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  555
            YE GRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTR+LDVVYNA
Sbjct  27   YEMGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRVLDVVYNA  86

Query  554  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketae--------et  399
            SNNELVRT+TLVKSAIVQVDAAPFKQWYLQHYG ++GRKKK A      E          
Sbjct  87   SNNELVRTKTLVKSAIVQVDAAPFKQWYLQHYGVEVGRKKKNAGASTKKEGEDTEDAPAA  146

Query  398  egvaaeetkKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILE  219
                 EETKKSNHV RK+E+RQ+ R LDSH+E+QF SGRL+ACISSRPGQCGRADGYILE
Sbjct  147  AAATPEETKKSNHVLRKIEQRQEGRSLDSHIEDQFASGRLLACISSRPGQCGRADGYILE  206

Query  218  GKELEFY  198
            GKELEFY
Sbjct  207  GKELEFY  213



>ref|XP_010541736.1| PREDICTED: 40S ribosomal protein S8-1-like [Tarenaya hassleriana]
Length=222

 Score =   265 bits (678),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 154/184 (84%), Positives = 160/184 (87%), Gaps = 4/184 (2%)
 Frame = -3

Query  734  YEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  555
            YE GR  ANTKLSSNKTVRR+RVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA
Sbjct  27   YELGRVAANTKLSSNKTVRRVRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  86

Query  554  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketaeete----gva  387
            SNNELVRT+TLVKSAIVQVDAAPFKQWYLQHYG +IGRKKK  A     E  E      A
Sbjct  87   SNNELVRTKTLVKSAIVQVDAAPFKQWYLQHYGVEIGRKKKTPATSGKKEGEEGEDGAAA  146

Query  386  aeetkKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEGKEL  207
             EETKKSNHV RKLEKRQK R LDSH+E+QF SGRL+ACISSRPGQCGRADGYILEGKEL
Sbjct  147  PEETKKSNHVLRKLEKRQKNRALDSHIEDQFASGRLLACISSRPGQCGRADGYILEGKEL  206

Query  206  EFYM  195
            EFYM
Sbjct  207  EFYM  210



>ref|XP_008679876.1| PREDICTED: 40S ribosomal protein S8 isoform X1 [Zea mays]
Length=258

 Score =   266 bits (681),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 153/180 (85%), Positives = 161/180 (89%), Gaps = 2/180 (1%)
 Frame = -3

Query  761  KKAWRKKRKYEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKT  582
            +KAWRKKRKYE GRQPANTKLSSNKTVRR+RVRGGNVKWRALRLDTGNYSWGSEAVTRKT
Sbjct  18   QKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALRLDTGNYSWGSEAVTRKT  77

Query  581  RILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketae-  405
            RILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYL HYG DIGRKKK  A K+    
Sbjct  78   RILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLTHYGVDIGRKKKTPAAKKDNAE  137

Query  404  -etegvaaeetkKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGY  228
             +    AAEETKKSNHV RKLEKR++ R LD H+EEQFGSGRL+ACISSRPGQCGRADGY
Sbjct  138  GQEVEAAAEETKKSNHVTRKLEKRKEGRTLDPHIEEQFGSGRLLACISSRPGQCGRADGY  197



>ref|XP_010535902.1| PREDICTED: 40S ribosomal protein S8-1-like [Tarenaya hassleriana]
Length=220

 Score =   264 bits (675),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 153/182 (84%), Positives = 162/182 (89%), Gaps = 2/182 (1%)
 Frame = -3

Query  734  YEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  555
            YE GR  ANTKLSSNKTVRR+RVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA
Sbjct  27   YELGRVAANTKLSSNKTVRRVRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  86

Query  554  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakk--etaeetegvaae  381
            SNNELVRT+TLVKSAIVQVD APFKQWYLQHYG ++GRKKK AA    +  EE E  A E
Sbjct  87   SNNELVRTKTLVKSAIVQVDVAPFKQWYLQHYGVEVGRKKKTAATSGKKEGEEGEDAAPE  146

Query  380  etkKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEGKELEF  201
            ETKKSNHV RKLEKRQ+ R LDSH+E+QF SGRL+ACISSRPGQCGRADGYILEGKELEF
Sbjct  147  ETKKSNHVLRKLEKRQQNRSLDSHIEDQFASGRLLACISSRPGQCGRADGYILEGKELEF  206

Query  200  YM  195
            YM
Sbjct  207  YM  208



>ref|XP_009602561.1| PREDICTED: 40S ribosomal protein S8-like [Nicotiana tomentosiformis]
Length=224

 Score =   263 bits (673),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 153/182 (84%), Positives = 161/182 (88%), Gaps = 2/182 (1%)
 Frame = -3

Query  734  YEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  555
            YE GRQPANTK+S NKTVRRIRVRGGNVKWRALRLDTGNYSWGSEA TRKTRILDVVYNA
Sbjct  27   YELGRQPANTKISGNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEATTRKTRILDVVYNA  86

Query  554  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDI--GRkkkaaakketaeetegvaae  381
            SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG DI   +K  A  +     E    AAE
Sbjct  87   SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVDIGRKKKGAAKKETAEEGEGAAAAAE  146

Query  380  etkKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEGKELEF  201
            ETKKSNHV RKLEKRQK+RKLD+HLEEQFG+GRL+ACISSRPGQCGRADGYILEGKELEF
Sbjct  147  ETKKSNHVARKLEKRQKDRKLDAHLEEQFGAGRLLACISSRPGQCGRADGYILEGKELEF  206

Query  200  YM  195
            Y+
Sbjct  207  YI  208



>ref|XP_009120819.1| PREDICTED: 40S ribosomal protein S8-1 [Brassica rapa]
Length=227

 Score =   263 bits (673),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 151/188 (80%), Positives = 161/188 (86%), Gaps = 9/188 (5%)
 Frame = -3

Query  734  YEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  555
            YE GRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTR+LDVVYNA
Sbjct  27   YEMGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRVLDVVYNA  86

Query  554  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketaee---------  402
            SNNELVRT+TLVKSAIVQVDAAPFKQWYLQHYG ++GRKKK AA     +E         
Sbjct  87   SNNELVRTKTLVKSAIVQVDAAPFKQWYLQHYGVEVGRKKKNAAASAAKKEGEDGEDAAP  146

Query  401  tegvaaeetkKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYIL  222
                A EE KKSNHVQRK+E RQ+ R LDSH+E+QF SGRL+ACISSRPGQCGRADGYIL
Sbjct  147  AAAAAPEEVKKSNHVQRKIESRQEGRTLDSHIEDQFASGRLLACISSRPGQCGRADGYIL  206

Query  221  EGKELEFY  198
            EGKELEFY
Sbjct  207  EGKELEFY  214



>ref|XP_003604700.1| Ribosomal protein S8 [Medicago truncatula]
Length=280

 Score =   265 bits (678),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 150/189 (79%), Positives = 165/189 (87%), Gaps = 1/189 (1%)
 Frame = -3

Query  746  KKRKYEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDV  567
            KKRKYE GRQPANTKLSSNKT+R IRVRGGNVK RALRLDTGN SWGSEAVTRKTR+L+V
Sbjct  4    KKRKYELGRQPANTKLSSNKTLRTIRVRGGNVKCRALRLDTGNCSWGSEAVTRKTRLLNV  63

Query  566  VYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketaeetegva  387
            VYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG +IG   K  + K+ + E     
Sbjct  64   VYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVEIG-SAKKTSGKKDSAEESEAV  122

Query  386  aeetkKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEGKEL  207
             EE KKSN+VQRKLE+RQK+R+LD  +E QFG GRL+ACISSRPGQCGRADGYILEGKEL
Sbjct  123  TEEVKKSNNVQRKLEQRQKDRRLDPLIEVQFGGGRLLACISSRPGQCGRADGYILEGKEL  182

Query  206  EFYMKKIQR  180
            EFYMKK+Q+
Sbjct  183  EFYMKKLQK  191


 Score = 83.6 bits (205),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 35/43 (81%), Positives = 40/43 (93%), Gaps = 0/43 (0%)
 Frame = -3

Query  308  LEEQFGSGRLMACISSRPGQCGRADGYILEGKELEFYMKKIQR  180
            +EEQ G GRL+ACISSRPGQCG ADGYIL+GKELEFYMKK+Q+
Sbjct  231  IEEQLGGGRLLACISSRPGQCGTADGYILKGKELEFYMKKLQK  273



>emb|CDY35814.1| BnaC09g37460D [Brassica napus]
Length=258

 Score =   264 bits (675),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 151/187 (81%), Positives = 161/187 (86%), Gaps = 8/187 (4%)
 Frame = -3

Query  734  YEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  555
            YE GRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTR+LDVVYNA
Sbjct  59   YEMGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRVLDVVYNA  118

Query  554  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketaee--------t  399
            SNNELVRT+TLVKSAIVQVDAAPFKQWYLQHYG ++GRKKK AA     +E         
Sbjct  119  SNNELVRTKTLVKSAIVQVDAAPFKQWYLQHYGVEVGRKKKNAAASAAKKEGEDGEDAAP  178

Query  398  egvaaeetkKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILE  219
               A EE KKSNHVQRK+E RQ+ R LDSH+E+QF SGRL+ACISSRPGQCGRADGYILE
Sbjct  179  AAAAPEEVKKSNHVQRKIESRQEGRTLDSHIEDQFASGRLLACISSRPGQCGRADGYILE  238

Query  218  GKELEFY  198
            GKELEFY
Sbjct  239  GKELEFY  245



>ref|XP_009765854.1| PREDICTED: 40S ribosomal protein S8-like [Nicotiana sylvestris]
Length=221

 Score =   263 bits (671),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 152/181 (84%), Positives = 163/181 (90%), Gaps = 2/181 (1%)
 Frame = -3

Query  734  YEXGRQPANTKLSSN-KTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYN  558
            YE GRQPANTKL +N KTVRRIRVRGGNVKWRALRLDTGN+SWGSEAVTRKTR+LDVVYN
Sbjct  27   YELGRQPANTKLVTNAKTVRRIRVRGGNVKWRALRLDTGNFSWGSEAVTRKTRLLDVVYN  86

Query  557  ASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketaeetegvaaee  378
            ASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG DIGR KK +A K+  EE E   A E
Sbjct  87   ASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVDIGR-KKKSAAKKEGEEAETAPAAE  145

Query  377  tkKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEGKELEFY  198
             KKSNHVQRKL+KRQ++RK+D H+EEQF SGRL+A ISSRPGQCGRADGYILEGKELEFY
Sbjct  146  EKKSNHVQRKLQKRQQDRKIDPHVEEQFASGRLLAAISSRPGQCGRADGYILEGKELEFY  205

Query  197  M  195
            M
Sbjct  206  M  206



>emb|CDX88842.1| BnaA03g08070D [Brassica napus]
Length=239

 Score =   263 bits (672),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 150/188 (80%), Positives = 162/188 (86%), Gaps = 9/188 (5%)
 Frame = -3

Query  734  YEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  555
            YE GRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTR+LDVVYNA
Sbjct  39   YEMGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRVLDVVYNA  98

Query  554  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketaee---------  402
            SNNELVRT+TLVKSAIVQVDAAPFKQWYLQHYG ++GRKKK A+    A++         
Sbjct  99   SNNELVRTKTLVKSAIVQVDAAPFKQWYLQHYGVEVGRKKKNASAAAAAKKDGEEGEEAA  158

Query  401  tegvaaeetkKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYIL  222
                A EETKKSNHV RK+E RQ+ R LDSH+E+QF SGRL+ACISSRPGQCGRADGYIL
Sbjct  159  PAAAAPEETKKSNHVLRKIESRQEGRSLDSHIEDQFASGRLLACISSRPGQCGRADGYIL  218

Query  221  EGKELEFY  198
            EGKELEFY
Sbjct  219  EGKELEFY  226



>ref|NP_197529.1| 40S ribosomal protein S8-1 [Arabidopsis thaliana]
 sp|Q93VG5.1|RS81_ARATH RecName: Full=40S ribosomal protein S8-1 [Arabidopsis thaliana]
 gb|AAK93614.1| unknown protein [Arabidopsis thaliana]
 gb|AAK96530.1| AT5g20290/F5O24_180 [Arabidopsis thaliana]
 gb|AAL31236.1| AT5g20290/F5O24_180 [Arabidopsis thaliana]
 gb|AAM14111.1| unknown protein [Arabidopsis thaliana]
 gb|AAM64526.1| 40S ribosomal protein S8-like [Arabidopsis thaliana]
 dbj|BAE98439.1| hypothetical protein [Arabidopsis thaliana]
 gb|AED92825.1| 40S ribosomal protein S8-1 [Arabidopsis thaliana]
Length=222

 Score =   262 bits (670),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 148/184 (80%), Positives = 160/184 (87%), Gaps = 4/184 (2%)
 Frame = -3

Query  734  YEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  555
            YE GRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEA TRKTR+LDVVYNA
Sbjct  27   YEMGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEATTRKTRVLDVVYNA  86

Query  554  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaak----ketaeetegva  387
            SNNELVRT+TLVKSAIVQVDAAPFKQWYL HYG ++GRKKK+A+      E  EE    A
Sbjct  87   SNNELVRTKTLVKSAIVQVDAAPFKQWYLSHYGVELGRKKKSASSTKKDGEEGEEAAVAA  146

Query  386  aeetkKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEGKEL  207
             EE KKSNH+ RK+  RQ+ R LDSH+E+QF SGRL+ACISSRPGQCGRADGYILEGKEL
Sbjct  147  PEEVKKSNHLLRKIASRQEGRSLDSHIEDQFASGRLLACISSRPGQCGRADGYILEGKEL  206

Query  206  EFYM  195
            EFYM
Sbjct  207  EFYM  210



>emb|CDX92472.1| BnaA10g15110D [Brassica napus]
Length=246

 Score =   263 bits (671),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 152/188 (81%), Positives = 161/188 (86%), Gaps = 9/188 (5%)
 Frame = -3

Query  734  YEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  555
            YE GRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTR+LDVVYNA
Sbjct  46   YEMGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRVLDVVYNA  105

Query  554  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakk---------etaee  402
            SNNELVRT+TLVKSAIVQVDAAPFKQWYLQHYG ++GRKKK AA           E A  
Sbjct  106  SNNELVRTKTLVKSAIVQVDAAPFKQWYLQHYGVEVGRKKKNAAASAAKKEGEDGEDAAP  165

Query  401  tegvaaeetkKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYIL  222
                A EE KKSNHVQRK+E RQ+ R LDSH+E+QF SGRL+ACISSRPGQCGRADGYIL
Sbjct  166  AAAAAPEEVKKSNHVQRKIESRQEGRTLDSHIEDQFASGRLLACISSRPGQCGRADGYIL  225

Query  221  EGKELEFY  198
            EGKELEFY
Sbjct  226  EGKELEFY  233



>ref|XP_010519957.1| PREDICTED: 40S ribosomal protein S8-1 [Tarenaya hassleriana]
Length=222

 Score =   261 bits (668),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 150/184 (82%), Positives = 158/184 (86%), Gaps = 4/184 (2%)
 Frame = -3

Query  734  YEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  555
            YE GR  ANTKLSSNKTVRR+RVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA
Sbjct  27   YEMGRVAANTKLSSNKTVRRVRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  86

Query  554  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketae----etegva  387
            SNNELVRT+TLVKSAIVQVDAAPFKQWYL HYG ++GRKKK +A     E    E    A
Sbjct  87   SNNELVRTKTLVKSAIVQVDAAPFKQWYLSHYGVEVGRKKKTSATSGKKEGDEGEDAAAA  146

Query  386  aeetkKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEGKEL  207
             EETKKSNHV RKLEKRQ  R LD H+E+QF SGRL+ACISSRPGQCGRADGYILEGKEL
Sbjct  147  PEETKKSNHVLRKLEKRQSNRSLDPHIEDQFTSGRLLACISSRPGQCGRADGYILEGKEL  206

Query  206  EFYM  195
            EFYM
Sbjct  207  EFYM  210



>ref|XP_009594581.1| PREDICTED: 40S ribosomal protein S8-2-like [Nicotiana tomentosiformis]
Length=221

 Score =   261 bits (667),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 152/181 (84%), Positives = 163/181 (90%), Gaps = 2/181 (1%)
 Frame = -3

Query  734  YEXGRQPANTKLSSN-KTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYN  558
            YE GRQPANTKL +N KTVRRIRVRGGNVKWRALRLDTGN+SWGSEAVTRKTR+LDVVYN
Sbjct  27   YELGRQPANTKLVTNAKTVRRIRVRGGNVKWRALRLDTGNFSWGSEAVTRKTRLLDVVYN  86

Query  557  ASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketaeetegvaaee  378
            ASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG DIGR KK +A K+  EE E   A E
Sbjct  87   ASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVDIGR-KKKSATKKEGEEAEAAPAAE  145

Query  377  tkKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEGKELEFY  198
             KKSNHVQRKL+KRQ++RK+D H+EEQF SGRL+A ISSRPGQCGRADGYILEGKELEFY
Sbjct  146  EKKSNHVQRKLQKRQQDRKIDPHVEEQFASGRLLAAISSRPGQCGRADGYILEGKELEFY  205

Query  197  M  195
            M
Sbjct  206  M  206



>gb|ABK21921.1| unknown [Picea sitchensis]
Length=221

 Score =   260 bits (664),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 151/186 (81%), Positives = 162/186 (87%), Gaps = 1/186 (1%)
 Frame = -3

Query  734  YEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  555
            YE GRQP+ TKLSSNKTVRR+RVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA
Sbjct  27   YELGRQPSMTKLSSNKTVRRVRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  86

Query  554  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketaeetegvaaeet  375
            SNNELVRTQTLVKSAI+QVDAAPF+QWY QHYG DIGRKKKAAA K+   E     AEE 
Sbjct  87   SNNELVRTQTLVKSAIIQVDAAPFRQWYEQHYGLDIGRKKKAAAAKKETTEEGEATAEEE  146

Query  374  kKSNHVqrkl-ekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEGKELEFY  198
            KK +    K  EKRQ+  KLDSHLEEQFGSGRL+A I+SRPGQCGRADGYILEG+ELEFY
Sbjct  147  KKKSKHLLKKIEKRQEGHKLDSHLEEQFGSGRLLAAIASRPGQCGRADGYILEGRELEFY  206

Query  197  MKKIQR  180
            +KKIQR
Sbjct  207  LKKIQR  212



>gb|EYU39184.1| hypothetical protein MIMGU_mgv1a013531mg [Erythranthe guttata]
Length=218

 Score =   259 bits (663),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 148/181 (82%), Positives = 160/181 (88%), Gaps = 2/181 (1%)
 Frame = -3

Query  734  YEXGRQPANTKLSS-NKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYN  558
            YE GRQPANTKL + NKTVRRIRVRGGNVKWRALRL+TGNYSWGSEA+TRKTR+LDVVYN
Sbjct  27   YELGRQPANTKLDTVNKTVRRIRVRGGNVKWRALRLNTGNYSWGSEAITRKTRVLDVVYN  86

Query  557  ASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketaeetegvaaee  378
            ASNNELVRT+TLVKSAI+QVDAAPFKQWYL HYG DIGR KK     +  E  EG AA+E
Sbjct  87   ASNNELVRTKTLVKSAIIQVDAAPFKQWYLTHYGVDIGR-KKKGGADKKEETEEGEAAQE  145

Query  377  tkKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEGKELEFY  198
             KKS+HV RK+EKRQ ERKLD H+EEQF SGRL+ACISSRPGQCGRADGYILEGKELEFY
Sbjct  146  AKKSSHVLRKIEKRQAERKLDPHVEEQFSSGRLLACISSRPGQCGRADGYILEGKELEFY  205

Query  197  M  195
            M
Sbjct  206  M  206



>gb|AES86897.2| 40S ribosomal S8-like protein [Medicago truncatula]
Length=218

 Score =   259 bits (661),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 146/186 (78%), Positives = 162/186 (87%), Gaps = 1/186 (1%)
 Frame = -3

Query  737  KYEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYN  558
            +YE GRQPANTKLSSNKT+R IRVRGGNVK RALRLDTGN SWGSEAVTRKTR+L+VVYN
Sbjct  26   RYELGRQPANTKLSSNKTLRTIRVRGGNVKCRALRLDTGNCSWGSEAVTRKTRLLNVVYN  85

Query  557  ASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketaeetegvaaee  378
            ASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG +IG   K  + K+ + E      EE
Sbjct  86   ASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVEIG-SAKKTSGKKDSAEESEAVTEE  144

Query  377  tkKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEGKELEFY  198
             KKSN+VQRKLE+RQK+R+LD  +E QFG GRL+ACISSRPGQCGRADGYILEGKELEFY
Sbjct  145  VKKSNNVQRKLEQRQKDRRLDPLIEVQFGGGRLLACISSRPGQCGRADGYILEGKELEFY  204

Query  197  MKKIQR  180
            MKK+Q+
Sbjct  205  MKKLQK  210



>ref|XP_010327196.1| PREDICTED: 40S ribosomal protein S8 [Solanum lycopersicum]
Length=221

 Score =   259 bits (661),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 148/181 (82%), Positives = 158/181 (87%), Gaps = 3/181 (2%)
 Frame = -3

Query  734  YEXGRQPANTKLSSN-KTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYN  558
            YE GRQ ANTKL  N KTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTR+LDVVYN
Sbjct  27   YEMGRQSANTKLVPNAKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRLLDVVYN  86

Query  557  ASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketaeetegvaaee  378
            ASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG +IGR  K  +  +   E    AA E
Sbjct  87   ASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVEIGR--KKKSAAKKEGEEVAEAAAE  144

Query  377  tkKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEGKELEFY  198
             KKSNHVQRKLEKRQ++RK+D+H+EEQF SGRL+A ISSRPGQCGRADGYILEGKELEFY
Sbjct  145  EKKSNHVQRKLEKRQQDRKIDAHIEEQFASGRLLAAISSRPGQCGRADGYILEGKELEFY  204

Query  197  M  195
            M
Sbjct  205  M  205



>ref|XP_003626942.1| Ribosomal protein S8 [Medicago truncatula]
Length=605

 Score =   271 bits (692),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 152/180 (84%), Positives = 159/180 (88%), Gaps = 3/180 (2%)
 Frame = -3

Query  734  YEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  555
            YE GRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGN+SWGSEAVTRKTR+LDVVYNA
Sbjct  417  YELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNFSWGSEAVTRKTRLLDVVYNA  476

Query  554  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketaeetegvaaeet  375
            SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG DIGR           EE    A EE 
Sbjct  477  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVDIGR---KKKNVSKKEEEAEAATEEV  533

Query  374  kKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEGKELEFYM  195
            KKS HVQRKLE+RQKER+LD+H+EEQFG GRL+ACISSRPGQCGRADGYILEGKELEFYM
Sbjct  534  KKSAHVQRKLEQRQKERQLDAHIEEQFGGGRLLACISSRPGQCGRADGYILEGKELEFYM  593


 Score =   265 bits (677),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 150/186 (81%), Positives = 166/186 (89%), Gaps = 1/186 (1%)
 Frame = -3

Query  737  KYEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYN  558
            +YE GRQPANTKLSSNKTVR IRVRGGN+K RALRLDTGN SWGSEAVTRK+R+L+VVYN
Sbjct  127  RYELGRQPANTKLSSNKTVRSIRVRGGNLKCRALRLDTGNISWGSEAVTRKSRLLNVVYN  186

Query  557  ASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketaeetegvaaee  378
            ASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG +IG  KK  A K+ + +    A EE
Sbjct  187  ASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVEIG-NKKKTAAKQDSAKEAEAATEE  245

Query  377  tkKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEGKELEFY  198
            TKKSNHV RKLE R+K+R+LD+H+EEQFG GRL+ACISSRPGQCGRADGYILEGKELEFY
Sbjct  246  TKKSNHVLRKLENREKDRQLDAHIEEQFGGGRLLACISSRPGQCGRADGYILEGKELEFY  305

Query  197  MKKIQR  180
            MKK+QR
Sbjct  306  MKKLQR  311



>ref|XP_006346168.1| PREDICTED: 40S ribosomal protein S8-like [Solanum tuberosum]
Length=220

 Score =   258 bits (659),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 147/181 (81%), Positives = 156/181 (86%), Gaps = 3/181 (2%)
 Frame = -3

Query  734  YEXGRQPANTKLSSN-KTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYN  558
            YE GRQPANTKL  N KTVRRIRVRGGNVKWRALRLDTGN+SWGSEAVTRKTR+LDVVYN
Sbjct  27   YELGRQPANTKLVPNAKTVRRIRVRGGNVKWRALRLDTGNFSWGSEAVTRKTRLLDVVYN  86

Query  557  ASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketaeetegvaaee  378
            ASNNELVRTQTLVKSAI+QVDAAPFKQWYLQHYG +IGR  K        E  E  A  E
Sbjct  87   ASNNELVRTQTLVKSAIIQVDAAPFKQWYLQHYGVEIGR--KKKTAASKKEGEEAEAVAE  144

Query  377  tkKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEGKELEFY  198
             KKSNHVQRKLEKRQ++RK+D H+EEQF SGRL+A ISSRPGQCGRADGYILEGKELEFY
Sbjct  145  EKKSNHVQRKLEKRQQDRKIDPHVEEQFASGRLLAAISSRPGQCGRADGYILEGKELEFY  204

Query  197  M  195
            M
Sbjct  205  M  205



>gb|ABK21933.1| unknown [Picea sitchensis]
Length=221

 Score =   258 bits (659),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 147/186 (79%), Positives = 161/186 (87%), Gaps = 1/186 (1%)
 Frame = -3

Query  734  YEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  555
            YE GRQP+ TKLSSNKTVRR+RVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA
Sbjct  27   YELGRQPSMTKLSSNKTVRRVRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  86

Query  554  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketaeetegvaaeet  375
            SNNELVRTQTLVKSAI+QVDAAPF+QWY QHYG DIGRKKKAAA K+   E     AEE 
Sbjct  87   SNNELVRTQTLVKSAIIQVDAAPFRQWYEQHYGLDIGRKKKAAAAKKETTEEGEATAEEE  146

Query  374  kKSNHVqrklekrqke-rkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEGKELEFY  198
            KK +    K  ++++E  KLDSHLEEQF SGRL+A I+SRPGQCGRADGYILEG+ELEFY
Sbjct  147  KKKSKHLLKKIEKRQEGHKLDSHLEEQFASGRLLAAIASRPGQCGRADGYILEGRELEFY  206

Query  197  MKKIQR  180
            +KKIQR
Sbjct  207  LKKIQR  212



>gb|ABK22298.1| unknown [Picea sitchensis]
Length=222

 Score =   258 bits (658),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 143/187 (76%), Positives = 157/187 (84%), Gaps = 2/187 (1%)
 Frame = -3

Query  734  YEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  555
            YE GRQP+ TKLSSNKTVRR+RVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA
Sbjct  27   YELGRQPSMTKLSSNKTVRRVRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  86

Query  554  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketaeetegvaaeet  375
            SNNELVRTQTLVKSAI+QVDAAPF+QWY QHYG DIGRKKKAAA  +     EG A  E 
Sbjct  87   SNNELVRTQTLVKSAIIQVDAAPFRQWYEQHYGLDIGRKKKAAAAAKKETTEEGEATAEE  146

Query  374  kKSNHVqrklekrqker--kLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEGKELEF  201
            +K        +  +++   KLDSHLEEQF SGRL+A I+SRPGQCGRADGYILEG+ELEF
Sbjct  147  EKKKSKHLLKKIEKRQEGHKLDSHLEEQFASGRLLAAIASRPGQCGRADGYILEGRELEF  206

Query  200  YMKKIQR  180
            Y+KKIQR
Sbjct  207  YLKKIQR  213



>ref|XP_008676011.1| PREDICTED: 40S ribosomal protein S8-like [Zea mays]
Length=335

 Score =   261 bits (666),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 145/188 (77%), Positives = 160/188 (85%), Gaps = 2/188 (1%)
 Frame = -3

Query  737  KYEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYN  558
            +YE GRQPANTKLSSN+TVRR+ VRGGN KWRALRLDTGN SWGSEA+ RKT ILDVVYN
Sbjct  148  RYELGRQPANTKLSSNETVRRVHVRGGNAKWRALRLDTGNCSWGSEALIRKTHILDVVYN  207

Query  557  ASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketae--etegvaa  384
            ASNNELVRTQTLVKSAIVQVDAAPFKQWYL HYG DIGRKKK    K+     +      
Sbjct  208  ASNNELVRTQTLVKSAIVQVDAAPFKQWYLTHYGVDIGRKKKVHVAKKDDTEGQEGEAIV  267

Query  383  eetkKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEGKELE  204
            EETKKSNHVQRK++KR + R LD+H+EE+FGSGRL+ACIS+ P QCGRADGYILEGKELE
Sbjct  268  EETKKSNHVQRKIDKRHQYRALDTHIEEKFGSGRLLACISAHPRQCGRADGYILEGKELE  327

Query  203  FYMKKIQR  180
            FYMKK+QR
Sbjct  328  FYMKKLQR  335



>ref|NP_001275100.1| putative 40S ribosomal protein S8-like protein [Solanum tuberosum]
 gb|ABB72814.1| putative 40S ribosomal protein S8-like protein [Solanum tuberosum]
Length=221

 Score =   256 bits (654),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 147/181 (81%), Positives = 156/181 (86%), Gaps = 3/181 (2%)
 Frame = -3

Query  734  YEXGRQPANTKLSSN-KTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYN  558
            YE GRQ ANTKL  N KTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTR+LDVVYN
Sbjct  27   YEMGRQSANTKLVPNAKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRLLDVVYN  86

Query  557  ASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketaeetegvaaee  378
            ASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG +IGR  K  +  +   E     A E
Sbjct  87   ASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVEIGR--KKKSAAKKEGEEAAEGAAE  144

Query  377  tkKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEGKELEFY  198
             KKSNHVQRKLEKRQ++RK+D H+EEQF SGRL+A ISSRPGQCGRADGYILEGKELEFY
Sbjct  145  EKKSNHVQRKLEKRQQDRKIDPHVEEQFASGRLLAAISSRPGQCGRADGYILEGKELEFY  204

Query  197  M  195
            M
Sbjct  205  M  205



>gb|ABR16896.1| unknown [Picea sitchensis]
Length=221

 Score =   256 bits (653),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 146/186 (78%), Positives = 160/186 (86%), Gaps = 1/186 (1%)
 Frame = -3

Query  734  YEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  555
            YE GRQP+ TKLSSNKTVRR+RVRGGNVKWRALRLDTGNYSWGSE VTRKTRILDVVYNA
Sbjct  27   YELGRQPSMTKLSSNKTVRRVRVRGGNVKWRALRLDTGNYSWGSEPVTRKTRILDVVYNA  86

Query  554  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketaeetegvaaeet  375
            SNNELVRTQTLVKSAI+QVDAAPF+QWY QHYG DIGRKKKAAA K+   E     AEE 
Sbjct  87   SNNELVRTQTLVKSAIIQVDAAPFRQWYEQHYGLDIGRKKKAAAAKKETTEEGEATAEEE  146

Query  374  kKSNHVqrklekrqke-rkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEGKELEFY  198
            KK +    K  ++++E  KLDSHLEEQF SGRL+A I+SRPGQCGRADGYILEG+ELEFY
Sbjct  147  KKKSKHLLKKIEKRQEGHKLDSHLEEQFASGRLLAAIASRPGQCGRADGYILEGRELEFY  206

Query  197  MKKIQR  180
            +KKIQR
Sbjct  207  LKKIQR  212



>ref|XP_010520566.1| PREDICTED: 40S ribosomal protein S8-1-like [Tarenaya hassleriana]
Length=224

 Score =   255 bits (652),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 144/186 (77%), Positives = 160/186 (86%), Gaps = 6/186 (3%)
 Frame = -3

Query  734  YEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  555
            YE GR  ANTKLSSNKTVRR+RVRGGN+KWRALRLDTGN+SWGSEA TRK+RILDVVYNA
Sbjct  27   YELGRVAANTKLSSNKTVRRLRVRGGNIKWRALRLDTGNFSWGSEAATRKSRILDVVYNA  86

Query  554  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketae------eteg  393
            SNNELVRT+TLVKSAIVQ+DAAPFKQWYL HYG ++GRKKKA+A     E        + 
Sbjct  87   SNNELVRTKTLVKSAIVQIDAAPFKQWYLSHYGVEVGRKKKASASSGKKEEEGEDGAEKA  146

Query  392  vaaeetkKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEGK  213
             A EETKKSNHV RKLEKRQ+ R LDSH+++QF +GRL+ACISSRPGQCGRADGYILEGK
Sbjct  147  AAPEETKKSNHVLRKLEKRQQNRALDSHIDDQFSTGRLLACISSRPGQCGRADGYILEGK  206

Query  212  ELEFYM  195
            ELEFYM
Sbjct  207  ELEFYM  212



>ref|XP_011089042.1| PREDICTED: 40S ribosomal protein S8-like [Sesamum indicum]
Length=220

 Score =   255 bits (651),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 149/181 (82%), Positives = 157/181 (87%), Gaps = 2/181 (1%)
 Frame = -3

Query  734  YEXGRQPANTKLSS-NKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYN  558
            YE GRQPANTKL +  KTVRRIRVRGGNVKWRALRL+TGNYSWGSEA+TRKTRILDVVYN
Sbjct  27   YELGRQPANTKLDTLQKTVRRIRVRGGNVKWRALRLNTGNYSWGSEAITRKTRILDVVYN  86

Query  557  ASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketaeetegvaaee  378
            ASNNELVRTQTLVKSAIVQVDAAPFKQWYL HYG DI  +KK  A K+   E     A+E
Sbjct  87   ASNNELVRTQTLVKSAIVQVDAAPFKQWYLTHYGVDI-GRKKKGAAKKDEAEEGEGIAQE  145

Query  377  tkKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEGKELEFY  198
            TKKSNHV RKLEKRQ  RKLD H+EEQF SGRL+ACISSRPGQCGRADGYILEGKELEFY
Sbjct  146  TKKSNHVLRKLEKRQAARKLDPHVEEQFSSGRLLACISSRPGQCGRADGYILEGKELEFY  205

Query  197  M  195
            M
Sbjct  206  M  206



>ref|XP_006352532.1| PREDICTED: 40S ribosomal protein S8 [Solanum tuberosum]
Length=221

 Score =   254 bits (649),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 147/181 (81%), Positives = 157/181 (87%), Gaps = 3/181 (2%)
 Frame = -3

Query  734  YEXGRQPANTKLSSN-KTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYN  558
            YE GRQ ANTKL  N KTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTR+LDVVYN
Sbjct  27   YEMGRQSANTKLVPNAKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRLLDVVYN  86

Query  557  ASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketaeetegvaaee  378
            ASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG +IGR  K  +  +   E    AA E
Sbjct  87   ASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVEIGR--KKKSAAKKEGEEAAEAAAE  144

Query  377  tkKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEGKELEFY  198
             KKSNHVQRKLEKRQ++RK++ H+EEQF SGRL+A ISSRPGQCGRADGYILEGKELEFY
Sbjct  145  EKKSNHVQRKLEKRQQDRKINPHVEEQFASGRLLAAISSRPGQCGRADGYILEGKELEFY  204

Query  197  M  195
            M
Sbjct  205  M  205



>gb|EPS68663.1| hypothetical protein M569_06106, partial [Genlisea aurea]
Length=217

 Score =   254 bits (648),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 143/181 (79%), Positives = 155/181 (86%), Gaps = 2/181 (1%)
 Frame = -3

Query  734  YEXGRQPANTKL-SSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYN  558
            YE GRQPANTKL ++ KTVRR+RVRGGNVKWRALRL+TGNYSWGSEAVTRKTRILDVVYN
Sbjct  26   YELGRQPANTKLDTTQKTVRRVRVRGGNVKWRALRLNTGNYSWGSEAVTRKTRILDVVYN  85

Query  557  ASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketaeetegvaaee  378
            ASNNELVRTQTLVKSAIV VDAAPFKQWY  HYG +IG+ KK +  K      EG AA  
Sbjct  86   ASNNELVRTQTLVKSAIVMVDAAPFKQWYSTHYGVEIGK-KKKSNAKRDEPTEEGDAATV  144

Query  377  tkKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEGKELEFY  198
             K SNHV+RK +KRQ +RK+DSHLEEQF SGRL+A ISSRPGQCGRADGYILEGKELEFY
Sbjct  145  GKASNHVERKRKKRQVDRKVDSHLEEQFSSGRLLASISSRPGQCGRADGYILEGKELEFY  204

Query  197  M  195
            M
Sbjct  205  M  205



>ref|XP_004516802.1| PREDICTED: 40S ribosomal protein S8-like [Cicer arietinum]
Length=312

 Score =   254 bits (649),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 142/187 (76%), Positives = 159/187 (85%), Gaps = 5/187 (3%)
 Frame = -3

Query  740  RKYEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVY  561
            ++YE GRQ A+TKLSSNKT+RRIRVRGGNVKWR LR DTGN+SWGSEAVTRKTR+LD+VY
Sbjct  19   QRYELGRQLASTKLSSNKTIRRIRVRGGNVKWRDLRWDTGNFSWGSEAVTRKTRLLDMVY  78

Query  560  NASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketaeetegvaae  381
            NASNNELVRTQTLVK+AIVQVD APFKQWYLQHYG +IGR           +    VAAE
Sbjct  79   NASNNELVRTQTLVKNAIVQVDVAPFKQWYLQHYGVEIGR-----NITMVLKLEVEVAAE  133

Query  380  etkKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEGKELEF  201
            E KK+NHVQRKLE RQK+R+LDSH+EEQFG GRL+ACI S PGQCGR DGYILEGKE +F
Sbjct  134  EAKKNNHVQRKLENRQKDRQLDSHIEEQFGGGRLLACILSHPGQCGRLDGYILEGKEPKF  193

Query  200  YMKKIQR  180
            YMKK+QR
Sbjct  194  YMKKLQR  200



>gb|KJB81683.1| hypothetical protein B456_013G156600 [Gossypium raimondii]
Length=245

 Score =   252 bits (643),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 145/173 (84%), Positives = 152/173 (88%), Gaps = 1/173 (1%)
 Frame = -3

Query  734  YEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  555
            YE GRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA
Sbjct  27   YELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  86

Query  554  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketaeetegvaaeet  375
            SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG DIGR KK +A  +   E    A EE 
Sbjct  87   SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGIDIGR-KKKSAAAKKEGEEGETATEEV  145

Query  374  kKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEG  216
            KKSNH+ RKLEKRQ+ R LD H+EEQFGSGRL+ACISSRPGQCGRADGY+  G
Sbjct  146  KKSNHILRKLEKRQQNRALDPHIEEQFGSGRLLACISSRPGQCGRADGYLHLG  198



>ref|XP_001761026.1| predicted protein [Physcomitrella patens]
 gb|EDQ74093.1| predicted protein [Physcomitrella patens]
Length=216

 Score =   249 bits (637),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 138/179 (77%), Positives = 150/179 (84%), Gaps = 3/179 (2%)
 Frame = -3

Query  734  YEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  555
            YE GRQ A TKLSSNKTVRRIRVRGGN K+RALRLDTGNYSWGSEAVTRKTR+LDVVYNA
Sbjct  27   YELGRQGAMTKLSSNKTVRRIRVRGGNSKFRALRLDTGNYSWGSEAVTRKTRVLDVVYNA  86

Query  554  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketaeetegvaaeet  375
            SNNELVRTQTLVK+AIVQVDAAPF+ WY QHYG +IG   K        +  +  A EE 
Sbjct  87   SNNELVRTQTLVKNAIVQVDAAPFRTWYSQHYGVEIG---KKKKSAAKKDSEDAEATEEE  143

Query  374  kKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEGKELEFY  198
            KKSNHVQ+KL KR +  KLDSHLE+QF SGRL+ACI+SRPGQCGRADGYILEGKELEFY
Sbjct  144  KKSNHVQKKLAKRVEGHKLDSHLEDQFASGRLLACIASRPGQCGRADGYILEGKELEFY  202



>gb|EPS68749.1| hypothetical protein M569_06019 [Genlisea aurea]
Length=411

 Score =   252 bits (643),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 134/181 (74%), Positives = 149/181 (82%), Gaps = 4/181 (2%)
 Frame = -3

Query  734  YEXGRQPANTKL-SSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYN  558
            YE GRQPANTKL ++ KTVRRIRVRGGNVKWRALRL+TGNYSWGSEAVTRKTRILDVVYN
Sbjct  219  YELGRQPANTKLDTTTKTVRRIRVRGGNVKWRALRLNTGNYSWGSEAVTRKTRILDVVYN  278

Query  557  ASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketaeetegvaaee  378
            ASNNELVRTQTLVKSAIV VDA PFKQWYL HYG DIG+           ++        
Sbjct  279  ASNNELVRTQTLVKSAIVMVDATPFKQWYLTHYGVDIGK---KRKLPAAKKDEAEEPDAN  335

Query  377  tkKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEGKELEFY  198
            TK S+HV++K +KRQ +RK++ H+EEQF  GRL+ACISSRPGQCGRADGYILEGKELEFY
Sbjct  336  TKVSHHVEKKRKKRQVDRKIEPHVEEQFAGGRLLACISSRPGQCGRADGYILEGKELEFY  395

Query  197  M  195
            M
Sbjct  396  M  396



>ref|XP_001773385.1| predicted protein [Physcomitrella patens]
 gb|EDQ61758.1| predicted protein [Physcomitrella patens]
Length=216

 Score =   243 bits (621),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 134/179 (75%), Positives = 149/179 (83%), Gaps = 3/179 (2%)
 Frame = -3

Query  734  YEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  555
            YE GRQ A TKLSSNKTVRRIRVRGGN K+RALRLDTGN+SWGSEAVTRKTRILDVVYNA
Sbjct  27   YELGRQGAMTKLSSNKTVRRIRVRGGNSKFRALRLDTGNFSWGSEAVTRKTRILDVVYNA  86

Query  554  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketaeetegvaaeet  375
            SNNELVRTQTLVK+AI+QVDAAPF+ WY QHYG +IG   K        EE      EE 
Sbjct  87   SNNELVRTQTLVKNAIIQVDAAPFRTWYSQHYGVEIG---KKKKAAVKKEEVAETTEEEK  143

Query  374  kKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEGKELEFY  198
            K+S+HV RK+ KR + +KLD+HLE+QF SGRL+ACISSRPGQCGR+DGYILEGKELEFY
Sbjct  144  KQSSHVLRKIAKRAEGQKLDAHLEDQFASGRLLACISSRPGQCGRSDGYILEGKELEFY  202



>ref|XP_001777587.1| predicted protein [Physcomitrella patens]
 gb|EDQ57630.1| predicted protein [Physcomitrella patens]
Length=216

 Score =   243 bits (620),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 135/179 (75%), Positives = 149/179 (83%), Gaps = 3/179 (2%)
 Frame = -3

Query  734  YEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  555
            YE GRQ A TKLSSNKTVRRIRVRGGN K+RALRLDTGN+SWGSEAVTRKTR+LDVVYNA
Sbjct  27   YELGRQGAMTKLSSNKTVRRIRVRGGNSKFRALRLDTGNFSWGSEAVTRKTRVLDVVYNA  86

Query  554  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketaeetegvaaeet  375
            SNNELVRTQTLVK+AI+QVDAAPF+ WY QHYG +IG   K        +  +    EE 
Sbjct  87   SNNELVRTQTLVKNAIIQVDAAPFRTWYSQHYGVEIG---KKKKAAAKKDTEDAETTEEE  143

Query  374  kKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEGKELEFY  198
            KKS HVQRKL KR + +KLDSHLE+QF SGRL+ACI+SRPGQCGRADGYILEGKELEFY
Sbjct  144  KKSAHVQRKLAKRLEGQKLDSHLEDQFASGRLLACIASRPGQCGRADGYILEGKELEFY  202



>ref|XP_001780988.1| predicted protein [Physcomitrella patens]
 gb|EDQ54172.1| predicted protein [Physcomitrella patens]
Length=216

 Score =   243 bits (619),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 133/179 (74%), Positives = 149/179 (83%), Gaps = 3/179 (2%)
 Frame = -3

Query  734  YEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  555
            YE GRQ A TKLSSNKTVRRIRVRGGN K+RALRLDTGN+SWGSEAVTRKTR+LDVVYNA
Sbjct  27   YELGRQGAMTKLSSNKTVRRIRVRGGNSKFRALRLDTGNFSWGSEAVTRKTRVLDVVYNA  86

Query  554  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketaeetegvaaeet  375
            SNNELVRTQTLVK+AI+QVDAAPF+ WY QHYG +IG   K        +E      E+T
Sbjct  87   SNNELVRTQTLVKNAIIQVDAAPFRTWYSQHYGVEIG---KKKKAAAKKDEEAEATEEQT  143

Query  374  kKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEGKELEFY  198
            K+S HV RK+ KR + +KLDSHLE+QF SGRL+ACI+SRPGQCGRADGYILEGKELEFY
Sbjct  144  KQSGHVLRKIAKRVEGQKLDSHLEDQFASGRLLACIASRPGQCGRADGYILEGKELEFY  202



>ref|XP_001777813.1| predicted protein [Physcomitrella patens]
 gb|EDQ57351.1| predicted protein [Physcomitrella patens]
Length=216

 Score =   241 bits (615),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 133/179 (74%), Positives = 148/179 (83%), Gaps = 3/179 (2%)
 Frame = -3

Query  734  YEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  555
            YE GRQ A TKLSSNKTVRRIRVRGGN K+RALRLDTGN+SWGSEAVTRKTR+LDVVYNA
Sbjct  27   YELGRQGAMTKLSSNKTVRRIRVRGGNFKFRALRLDTGNFSWGSEAVTRKTRVLDVVYNA  86

Query  554  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketaeetegvaaeet  375
            SNNELVRTQTLVK+AI+QVDAAPF+ WY QHYG +IG   K        +  E  A EE 
Sbjct  87   SNNELVRTQTLVKNAIIQVDAAPFRTWYSQHYGVEIG---KKKKTAAKKDAEEAEATEEE  143

Query  374  kKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEGKELEFY  198
            KKS HV RK+ KR + +KLD+HLE+QF SGRL+ACI+SRPGQCGR DGYILEGKELEFY
Sbjct  144  KKSKHVLRKIAKRVESQKLDAHLEDQFASGRLLACIASRPGQCGRVDGYILEGKELEFY  202



>ref|XP_010539242.1| PREDICTED: 40S ribosomal protein S8-1-like, partial [Tarenaya 
hassleriana]
Length=180

 Score =   238 bits (608),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 138/167 (83%), Positives = 147/167 (88%), Gaps = 3/167 (2%)
 Frame = -3

Query  686  TVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAI  507
            TVRR+RVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYN+SNNELVRT+TLVKSAI
Sbjct  2    TVRRVRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNSSNNELVRTKTLVKSAI  61

Query  506  VQVDAAPFKQWYLQHYGFDIGRkkkaaakketaeete---gvaaeetkKSNHVqrklekr  336
            VQVDAAPFKQWYLQHYG ++GRKKK AA     E  E     A EETKKSNHV RKLEKR
Sbjct  62   VQVDAAPFKQWYLQHYGVEVGRKKKTAATAGKKEGEEGEDTAALEETKKSNHVLRKLEKR  121

Query  335  qkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEGKELEFYM  195
            Q+ R LD H+E+QF SGRL+ACISSRPGQCGRADGYILEGKELEFYM
Sbjct  122  QQNRNLDPHIEDQFASGRLLACISSRPGQCGRADGYILEGKELEFYM  168



>gb|KDD75705.1| ribosomal protein S8e [Helicosporidium sp. ATCC 50920]
Length=353

 Score =   241 bits (615),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 127/191 (66%), Positives = 144/191 (75%), Gaps = 13/191 (7%)
 Frame = -3

Query  752  WRKKRKYEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRIL  573
            WRKKRK+E GRQPANTKLSSN TVR +R RGGN+K+RALRLD+GN+SWGSEA TR+TRIL
Sbjct  21   WRKKRKFELGRQPANTKLSSNVTVRPVRCRGGNMKYRALRLDSGNFSWGSEATTRRTRIL  80

Query  572  DVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketaeeteg  393
             V YNASNNELVRTQTLVKSAIVQVDAAPFK WY Q YG ++GR              + 
Sbjct  81   SVSYNASNNELVRTQTLVKSAIVQVDAAPFKAWYSQRYGTELGR-------------KKA  127

Query  392  vaaeetkKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEGK  213
               E+   S  V +K   R K   LDS LE+QF  GRL A ISSRPGQCGRADGYILEGK
Sbjct  128  AEEEKEPVSERVAKKQAARAKNHSLDSLLEDQFSVGRLYALISSRPGQCGRADGYILEGK  187

Query  212  ELEFYMKKIQR  180
            ELEFY++K+Q+
Sbjct  188  ELEFYLRKMQK  198



>gb|AGE46026.1| 40S ribosomal protein S8, partial [Elaeis guineensis]
Length=173

 Score =   234 bits (597),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 137/163 (84%), Positives = 143/163 (88%), Gaps = 3/163 (2%)
 Frame = -3

Query  659  GNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFK  480
            GNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAI+QVDAAPFK
Sbjct  1    GNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIIQVDAAPFK  60

Query  479  QWYLQHYGFDIGRkkkaaakketaeetegv---aaeetkKSNHVqrklekrqkerkLDSH  309
            QWYLQHYG +IGRKKKA A  +           A EE KKSNHV RKLEKRQ+ RKLD H
Sbjct  61   QWYLQHYGVEIGRKKKAPAATKKEATEGQEGEGATEEPKKSNHVLRKLEKRQQGRKLDPH  120

Query  308  LEEQFGSGRLMACISSRPGQCGRADGYILEGKELEFYMKKIQR  180
            +EEQFGSGRL+ACISSRPGQCGRADGYILEGKELEFYMKKIQR
Sbjct  121  IEEQFGSGRLLACISSRPGQCGRADGYILEGKELEFYMKKIQR  163



>ref|XP_005648786.1| 40S ribosomal protein S8 [Coccomyxa subellipsoidea C-169]
 gb|EIE24242.1| 40S ribosomal protein S8 [Coccomyxa subellipsoidea C-169]
Length=214

 Score =   235 bits (600),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 139/194 (72%), Positives = 157/194 (81%), Gaps = 1/194 (1%)
 Frame = -3

Query  761  KKAWRKKRKYEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKT  582
            +K WRKKRK+E GRQPANTKLSSN TVRR+RVRGGN K+RALRLD+GN+SWGSEAVTRKT
Sbjct  18   QKTWRKKRKFELGRQPANTKLSSNVTVRRVRVRGGNFKFRALRLDSGNFSWGSEAVTRKT  77

Query  581  RILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketaee  402
            R+LDVVYNASNNELVRTQTLVKSAIVQVDA PFKQ+Y QHYG + G  KK +     AEE
Sbjct  78   RVLDVVYNASNNELVRTQTLVKSAIVQVDATPFKQFYTQHYGVEAG-LKKKSGAAAAAEE  136

Query  401  tegvaaeetkKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYIL  222
             +    E  K SNHV RKL+ R +  KLD  L+ QF  GRL+A ISSRPGQCGR DGYIL
Sbjct  137  EKKAGEEAKKTSNHVDRKLKLRNQNHKLDEVLDAQFAGGRLLAAISSRPGQCGRVDGYIL  196

Query  221  EGKELEFYMKKIQR  180
            EGKELEFY +K+Q+
Sbjct  197  EGKELEFYQRKLQK  210



>emb|CEG02139.1| Ribosomal protein S8e/ribosomal biogenesis NSA2 [Ostreococcus 
tauri]
Length=217

 Score =   235 bits (599),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 124/194 (64%), Positives = 146/194 (75%), Gaps = 7/194 (4%)
 Frame = -3

Query  761  KKAWRKKRKYEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKT  582
            +K WRKKRKYE GRQPANTKLSSN TVR++R RGGNVK RALRLDTGNYSWGSE  TRKT
Sbjct  18   QKPWRKKRKYELGRQPANTKLSSNVTVRQVRCRGGNVKHRALRLDTGNYSWGSENCTRKT  77

Query  581  RILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketaee  402
            RILDVVYNASNNELVRT+TLVKSA+V VDAAPF+ WY QHYG  IG        K     
Sbjct  78   RILDVVYNASNNELVRTKTLVKSAVVAVDAAPFRAWYAQHYGKKIG-------IKVKNGA  130

Query  401  tegvaaeetkKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYIL  222
                   + K+S  V  KL +R ++  ++S ++ QF +GRL+A ++SRPGQCGR DGYIL
Sbjct  131  KVEEEDIDEKRSKSVTMKLRRRNRDHAVESAIDAQFSTGRLLAIVTSRPGQCGRCDGYIL  190

Query  221  EGKELEFYMKKIQR  180
            EGKELEFY +K+ +
Sbjct  191  EGKELEFYQRKLSK  204



>ref|XP_001696201.1| ribosomal protein S8, component of cytosolic 80S ribosome and 
40S small subunit [Chlamydomonas reinhardtii]
 gb|EDP08178.1| ribosomal protein S8 [Chlamydomonas reinhardtii]
Length=208

 Score =   234 bits (598),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 126/180 (70%), Positives = 143/180 (79%), Gaps = 9/180 (5%)
 Frame = -3

Query  734  YEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  555
            YE GR PANTKLS+N  VR +RVRGG+ K+RALRLDTGNYSWGSEAVTRK RILDVVYNA
Sbjct  27   YEMGRVPANTKLSTNVAVRTVRVRGGHTKFRALRLDTGNYSWGSEAVTRKVRILDVVYNA  86

Query  554  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketaeetegvaaeet  375
            SNNELVRTQTLVK+AIVQVDA PFKQWY +HY  ++G            +       EE 
Sbjct  87   SNNELVRTQTLVKNAIVQVDATPFKQWYQKHYNVELG---------AKNQAEIVPKPEEI  137

Query  374  kKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEGKELEFYM  195
            K SNHV+RK+++R ++RKLDSHL EQF +GRL ACISSRPGQCGR DGYILEGKELEFY+
Sbjct  138  KGSNHVKRKIKERLQKRKLDSHLAEQFSTGRLFACISSRPGQCGRCDGYILEGKELEFYV  197



>ref|XP_002963298.1| hypothetical protein SELMODRAFT_80565, partial [Selaginella moellendorffii]
 ref|XP_002974597.1| hypothetical protein SELMODRAFT_101634, partial [Selaginella 
moellendorffii]
 gb|EFJ24117.1| hypothetical protein SELMODRAFT_101634, partial [Selaginella 
moellendorffii]
 gb|EFJ35169.1| hypothetical protein SELMODRAFT_80565, partial [Selaginella moellendorffii]
Length=214

 Score =   234 bits (597),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 130/180 (72%), Positives = 140/180 (78%), Gaps = 3/180 (2%)
 Frame = -3

Query  734  YEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  555
            YE GRQPA TKL++ KTVRRIRVRGGN K RALRLD GNYSWG+EAV RKTRIL+VVYNA
Sbjct  26   YELGRQPAMTKLAA-KTVRRIRVRGGNFKLRALRLDAGNYSWGTEAVARKTRILEVVYNA  84

Query  554  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketaeetegvaaeet  375
            SNNELVRTQTLVKSAIVQVDA PF+ WY QHYG D+ R  K     E   E    A EE 
Sbjct  85   SNNELVRTQTLVKSAIVQVDATPFRAWYNQHYGVDLSR--KKKPSAEATTEAGPAAEEEK  142

Query  374  kKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEGKELEFYM  195
             KS H  RKL  R +  KLD H+EEQ  SGRL+ACI+SRPGQCGRADGYILEGKELEFYM
Sbjct  143  PKSKHTLRKLANRAEGHKLDPHIEEQMASGRLLACIASRPGQCGRADGYILEGKELEFYM  202



>gb|EYU39185.1| hypothetical protein MIMGU_mgv1a013531mg [Erythranthe guttata]
Length=194

 Score =   233 bits (595),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 136/169 (80%), Positives = 148/169 (88%), Gaps = 2/169 (1%)
 Frame = -3

Query  734  YEXGRQPANTKLSS-NKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYN  558
            YE GRQPANTKL + NKTVRRIRVRGGNVKWRALRL+TGNYSWGSEA+TRKTR+LDVVYN
Sbjct  27   YELGRQPANTKLDTVNKTVRRIRVRGGNVKWRALRLNTGNYSWGSEAITRKTRVLDVVYN  86

Query  557  ASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketaeetegvaaee  378
            ASNNELVRT+TLVKSAI+QVDAAPFKQWYL HYG DIGR KK     +  E  EG AA+E
Sbjct  87   ASNNELVRTKTLVKSAIIQVDAAPFKQWYLTHYGVDIGR-KKKGGADKKEETEEGEAAQE  145

Query  377  tkKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADG  231
             KKS+HV RK+EKRQ ERKLD H+EEQF SGRL+ACISSRPGQCGRADG
Sbjct  146  AKKSSHVLRKIEKRQAERKLDPHVEEQFSSGRLLACISSRPGQCGRADG  194



>gb|EPZ31448.1| 40S ribosomal protein S8-B [Rozella allomycis CSF55]
Length=205

 Score =   233 bits (593),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 126/190 (66%), Positives = 153/190 (81%), Gaps = 8/190 (4%)
 Frame = -3

Query  752  WRKKRKYEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRIL  573
            +RKKRK+E GRQPANTKL + K +  +RVRGGN K+RA+RLDTGN+SWGSEA+TRKTRI+
Sbjct  21   YRKKRKFELGRQPANTKLGA-KRIHPVRVRGGNTKFRAMRLDTGNFSWGSEAITRKTRII  79

Query  572  DVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketaeeteg  393
            DVVYNASNNELVRT+TLVKSAIVQ+DA PF+QWY  HYG  +G+       K+ A+    
Sbjct  80   DVVYNASNNELVRTKTLVKSAIVQIDATPFRQWYEAHYGSLLGK-------KKLAKAAST  132

Query  392  vaaeetkKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEGK  213
             A +  KKSNHVQRK+E R+K+  +D  L++QF +GRL ACISSRPGQ GR DGYILEGK
Sbjct  133  EAGDAEKKSNHVQRKIESRKKDAHVDQALDDQFSTGRLYACISSRPGQSGRCDGYILEGK  192

Query  212  ELEFYMKKIQ  183
            ELEFY+KKI+
Sbjct  193  ELEFYVKKIK  202



>ref|XP_011397165.1| 40S ribosomal protein S8 [Auxenochlorella protothecoides]
 gb|KFM24278.1| 40S ribosomal protein S8 [Auxenochlorella protothecoides]
Length=191

 Score =   232 bits (591),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 133/189 (70%), Positives = 147/189 (78%), Gaps = 27/189 (14%)
 Frame = -3

Query  761  KKAWRKKRKYEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKT  582
            +KAWRKKRKYE GRQPANTKLSSN TVRR+RVRGGN K+RALRLD+GN+SWGSEA TRKT
Sbjct  18   QKAWRKKRKYELGRQPANTKLSSNVTVRRVRVRGGNSKFRALRLDSGNFSWGSEATTRKT  77

Query  581  RILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketaee  402
            RILDV YNASNNELVRTQTLVK+AI+Q+DAAPFKQWY QHYG +                
Sbjct  78   RILDVSYNASNNELVRTQTLVKNAIIQIDAAPFKQWYQQHYGVE----------------  121

Query  401  tegvaaeetkKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYIL  222
                       S+HVQRKL+ R K+R LD  L+EQF  GRL ACISSRPGQCGRADGYIL
Sbjct  122  -----------SDHVQRKLKLRNKDRTLDPLLDEQFSVGRLYACISSRPGQCGRADGYIL  170

Query  221  EGKELEFYM  195
            EGKELEFY+
Sbjct  171  EGKELEFYL  179



>gb|ABR25841.1| 40S ribosomal protein S8 [Oryza sativa Indica Group]
Length=168

 Score =   231 bits (588),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 135/160 (84%), Positives = 143/160 (89%), Gaps = 2/160 (1%)
 Frame = -3

Query  653  VKWRALRLDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQW  474
            +KWRALRLDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQW
Sbjct  1    LKWRALRLDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQW  60

Query  473  YLQHYGFDIGRkkkaaakketae--etegvaaeetkKSNHVqrklekrqkerkLDSHLEE  300
            YL HYG DIGRKKKA A K+ A   +    A EE KKSNHV RKLEKRQ+ R LD+H+EE
Sbjct  61   YLTHYGVDIGRKKKAPAAKKDAAEGQEGEAATEEEKKSNHVVRKLEKRQQTRTLDAHIEE  120

Query  299  QFGSGRLMACISSRPGQCGRADGYILEGKELEFYMKKIQR  180
            QFGSGRL+ACISSRPGQCGRADGYILEGKELEFYMKK+QR
Sbjct  121  QFGSGRLLACISSRPGQCGRADGYILEGKELEFYMKKLQR  160



>gb|ABA01100.1| 40S ribosomal protein S8 [Chlamydomonas incerta]
Length=208

 Score =   231 bits (589),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 123/179 (69%), Positives = 143/179 (80%), Gaps = 9/179 (5%)
 Frame = -3

Query  734  YEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  555
            YE GR PANTKLS+N  VR +RVRGG+ K+RALRLDTGNYSWGSEAVTRK RILDVVYNA
Sbjct  27   YEMGRVPANTKLSTNVAVRTVRVRGGHTKFRALRLDTGNYSWGSEAVTRKVRILDVVYNA  86

Query  554  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketaeetegvaaeet  375
            SNNELVRTQTLVK+AIVQVDA PFKQWY +HY  ++G           ++       EE 
Sbjct  87   SNNELVRTQTLVKNAIVQVDATPFKQWYQKHYNVELG---------AKSQLEVVPKPEEV  137

Query  374  kKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEGKELEFY  198
            K SNHV+RK+++R ++RKLD+H+ EQF +GRL ACI+SRPGQCGR DGYILEGKELEFY
Sbjct  138  KGSNHVKRKIKERLQKRKLDAHMAEQFSTGRLFACIASRPGQCGRCDGYILEGKELEFY  196



>ref|XP_002945874.1| component of cytosolic 80S ribosome and 40S small subunit [Volvox 
carteri f. nagariensis]
 gb|EFJ52869.1| component of cytosolic 80S ribosome and 40S small subunit [Volvox 
carteri f. nagariensis]
Length=209

 Score =   231 bits (588),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 124/180 (69%), Positives = 143/180 (79%), Gaps = 8/180 (4%)
 Frame = -3

Query  734  YEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  555
            YE GR PANTKLSSN  VR +RVRGG+ K+RALRLDTGNYSWGSEAVTRK RILDVVYNA
Sbjct  27   YEMGRVPANTKLSSNVAVRTVRVRGGHTKFRALRLDTGNYSWGSEAVTRKVRILDVVYNA  86

Query  554  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketaeetegvaaeet  375
            SNNELVRTQTLVK+AIVQVDA  FKQWY +HY  ++G         +  +       EE 
Sbjct  87   SNNELVRTQTLVKNAIVQVDATQFKQWYQKHYNVELG--------AKKDQPDVAPKPEEI  138

Query  374  kKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEGKELEFYM  195
            + SNHV+RK+++R ++RKLD HL EQF +GRL ACI+SRPGQCGRADGYILEGKELEFY+
Sbjct  139  QGSNHVKRKIKERLQKRKLDPHLAEQFTTGRLFACIASRPGQCGRADGYILEGKELEFYL  198



>ref|XP_005844426.1| hypothetical protein CHLNCDRAFT_139122 [Chlorella variabilis]
 gb|EFN52324.1| hypothetical protein CHLNCDRAFT_139122 [Chlorella variabilis]
Length=233

 Score =   231 bits (590),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 131/189 (69%), Positives = 151/189 (80%), Gaps = 2/189 (1%)
 Frame = -3

Query  761  KKAWRKKRKYEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKT  582
            +K WRKKRKYE GRQPA TKLSSN  VRR+RVRGGN K+RALRLD GN+SWGSEAVTRK 
Sbjct  35   QKPWRKKRKYELGRQPAMTKLSSNVCVRRVRVRGGNSKFRALRLDHGNFSWGSEAVTRKV  94

Query  581  RILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketaee  402
            RILDV YNASNNELVRTQTLVKSAI+Q+DAAPFKQWY QHYG ++G+  K  +    A  
Sbjct  95   RILDVSYNASNNELVRTQTLVKSAIIQIDAAPFKQWYQQHYGLEVGQ--KKKSAAAAAAA  152

Query  401  tegvaaeetkKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYIL  222
                      +SNHV+RKL++R + RKLD HL++QF +GRL A ISSRPGQCGR DGYIL
Sbjct  153  AAEGEEAAAPQSNHVKRKLKQRNQGRKLDQHLDDQFATGRLYAAISSRPGQCGRCDGYIL  212

Query  221  EGKELEFYM  195
            EG+ELEFY+
Sbjct  213  EGRELEFYL  221



>ref|XP_001422585.1| Ribosomal protein S8, component of cytosolic 80S ribosome and 
40S small subunit [Ostreococcus lucimarinus CCE9901]
 gb|ABP00902.1| Ribosomal protein S8, component of cytosolic 80S ribosome and 
40S small subunit [Ostreococcus lucimarinus CCE9901]
Length=220

 Score =   231 bits (588),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 121/188 (64%), Positives = 142/188 (76%), Gaps = 7/188 (4%)
 Frame = -3

Query  761  KKAWRKKRKYEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKT  582
            +K WRKKRKYE GRQPANTKLSSN TVR++R RGGN+K RALRLDTGN++WGSE  TRKT
Sbjct  18   QKPWRKKRKYELGRQPANTKLSSNVTVRQVRCRGGNIKHRALRLDTGNFAWGSENCTRKT  77

Query  581  RILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketaee  402
            RILDVVYNASNNELVRT+TLVKSA++ VDAAPF+ WY QHYG  IG        K     
Sbjct  78   RILDVVYNASNNELVRTKTLVKSAVIAVDAAPFRAWYAQHYGKKIG-------IKVKNGA  130

Query  401  tegvaaeetkKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYIL  222
                   E K+S  V  KL  R ++ ++   ++EQF +GRL+A I+SRPGQCGRADGY+L
Sbjct  131  KVESEDIEEKRSKSVTMKLRSRNQKHEVAKAIDEQFATGRLLAIITSRPGQCGRADGYVL  190

Query  221  EGKELEFY  198
            EGKELEFY
Sbjct  191  EGKELEFY  198



>gb|EKD00868.1| 40S ribosomal protein S8 [Trichosporon asahii var. asahii CBS 
8904]
Length=207

 Score =   221 bits (562),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 116/190 (61%), Positives = 148/190 (78%), Gaps = 11/190 (6%)
 Frame = -3

Query  752  WRKKRKYEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRIL  573
            +RKKRK+E GRQ A TKL + K +  +R RGGNVK+RA+RLDTGN+SWGSEA TRKTR+L
Sbjct  21   YRKKRKFELGRQAAMTKLDTTKRIHTVRTRGGNVKYRAIRLDTGNFSWGSEATTRKTRLL  80

Query  572  DVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketaeeteg  393
            +V YN++NNEL+RTQTLVKSA+V+VDA PF+QWY  HY   + +           +    
Sbjct  81   NVRYNSTNNELLRTQTLVKSAVVEVDATPFRQWYEAHYAQPVTK-----------KGQAE  129

Query  392  vaaeetkKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEGK  213
              A+E KKSNHVQR L +R+K+ K+D+HLE+QF +GRL+A I+SRPGQ GRADGYILEGK
Sbjct  130  APADEGKKSNHVQRILAERKKDAKIDNHLEQQFRTGRLLAMITSRPGQSGRADGYILEGK  189

Query  212  ELEFYMKKIQ  183
            EL+FY+KK+Q
Sbjct  190  ELDFYLKKLQ  199



>emb|CCA22399.1| 40S ribosomal protein S82 putative [Albugo laibachii Nc14]
Length=206

 Score =   220 bits (560),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 119/183 (65%), Positives = 140/183 (77%), Gaps = 10/183 (5%)
 Frame = -3

Query  734  YEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  555
            +E GRQPANTKL   K V R+RVRGG+ K+RALRL+TGN+SWGSEAV+RKTRILDVVYNA
Sbjct  27   FELGRQPANTKLG-GKRVHRVRVRGGHFKFRALRLETGNFSWGSEAVSRKTRILDVVYNA  85

Query  554  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketaeetegvaaeet  375
            SNNELVRT+TLVKSAIV +DA PF+QWY  HYG  IG+                   E+ 
Sbjct  86   SNNELVRTKTLVKSAIVSIDATPFRQWYETHYGVKIGQ---------KKNAETTEKVEQE  136

Query  374  kKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEGKELEFYM  195
            KKS+HV RKL +RQ+ R  D  L+EQF SGR++AC+SSRPGQ GRADGYILEGKELEFY 
Sbjct  137  KKSDHVMRKLAQRQRGRIFDPKLDEQFTSGRILACVSSRPGQSGRADGYILEGKELEFYQ  196

Query  194  KKI  186
            +K+
Sbjct  197  RKL  199



>tpg|DAA53686.1| TPA: putative ribosomal protein S8e family protein, partial [Zea 
mays]
Length=296

 Score =   223 bits (568),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 130/166 (78%), Positives = 142/166 (86%), Gaps = 2/166 (1%)
 Frame = -3

Query  695  SNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVK  516
            SNKTVRR+ VRGGNVKW ALRLDTGNYSWGSEA+T KT ILDVVYNASNNELVRTQTLVK
Sbjct  131  SNKTVRRVCVRGGNVKWSALRLDTGNYSWGSEALTHKTHILDVVYNASNNELVRTQTLVK  190

Query  515  SAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketae--etegvaaeetkKSNHVqrkle  342
            SAIVQVDAAPFKQWYL  YG DIGRKKK    K+ A   +      EETKKSNHVQRK+E
Sbjct  191  SAIVQVDAAPFKQWYLTRYGMDIGRKKKVHVAKKDATEGQAGEAIVEETKKSNHVQRKIE  250

Query  341  krqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEGKELE  204
            KRQ++  LD+H+EEQFGSGRL+ACIS+ PGQCG+ADGYILEGKELE
Sbjct  251  KRQQDCALDTHIEEQFGSGRLLACISACPGQCGQADGYILEGKELE  296



>ref|XP_007397269.1| hypothetical protein PHACADRAFT_258531 [Phanerochaete carnosa 
HHB-10118-sp]
 gb|EKM54580.1| hypothetical protein PHACADRAFT_258531 [Phanerochaete carnosa 
HHB-10118-sp]
Length=211

 Score =   218 bits (556),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 121/193 (63%), Positives = 147/193 (76%), Gaps = 9/193 (5%)
 Frame = -3

Query  761  KKAWRKKRKYEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKT  582
            + ++RKKRK+E GRQPANTKL   K V  +RVRGGN+K+RALRL+TGN++WGSE  TRKT
Sbjct  18   RPSYRKKRKFELGRQPANTKLGP-KRVHTVRVRGGNLKYRALRLETGNFAWGSEHTTRKT  76

Query  581  RILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketaee  402
            RIL VVYNASNNELVRT TLVKSAIVQVDA PF+QWY  HY   + +          A++
Sbjct  77   RILTVVYNASNNELVRTNTLVKSAIVQVDATPFRQWYEAHYAQPVTK--------RGAKK  128

Query  401  tegvaaeetkKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYIL  222
                A EE K S H QR L++++K+ K+D  LE QF +GRL ACISSRPGQ GRADGY+L
Sbjct  129  ETTEATEEKKLSQHAQRHLDEKRKDAKVDILLETQFAAGRLYACISSRPGQSGRADGYVL  188

Query  221  EGKELEFYMKKIQ  183
            EGKELEFY++KI+
Sbjct  189  EGKELEFYLRKIR  201



>gb|KIK09143.1| hypothetical protein K443DRAFT_447984 [Laccaria amethystina LaAM-08-1]
Length=211

 Score =   218 bits (556),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 118/190 (62%), Positives = 146/190 (77%), Gaps = 8/190 (4%)
 Frame = -3

Query  752  WRKKRKYEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRIL  573
            +RKKRK+E GRQPANTKL + K V  +RVRGGN+K+RALRLD+GN++WGSE +TRKTRI+
Sbjct  21   YRKKRKFELGRQPANTKLGA-KRVHTVRVRGGNLKYRALRLDSGNFAWGSEQITRKTRII  79

Query  572  DVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketaeeteg  393
             VVYNASNNELVRT TLVKSAI+QVDA PF+QWY  HY   + +       K        
Sbjct  80   SVVYNASNNELVRTNTLVKSAIIQVDATPFRQWYESHYAQPVTK-------KGKTTIATD  132

Query  392  vaaeetkKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEGK  213
             AAE  K SNH QR L++++KE K+D+ LE QF +GRL A I+SRPGQ GRADGY+LEGK
Sbjct  133  AAAEPKKLSNHAQRSLDEKKKEAKIDTLLESQFAAGRLYAAIASRPGQSGRADGYVLEGK  192

Query  212  ELEFYMKKIQ  183
            ELEFY++K++
Sbjct  193  ELEFYLRKLR  202



>ref|XP_001880116.1| 40S ribosomal protein S8 [Laccaria bicolor S238N-H82]
 gb|EDR08803.1| predicted protein, partial [Laccaria bicolor S238N-H82]
Length=211

 Score =   218 bits (555),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 119/190 (63%), Positives = 147/190 (77%), Gaps = 8/190 (4%)
 Frame = -3

Query  752  WRKKRKYEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRIL  573
            +RKKRK+E GRQPANTKL + K V  +RVRGGN+K+RALRLD+GN++WGSE +TRKTRI+
Sbjct  21   YRKKRKFELGRQPANTKLGA-KRVHTVRVRGGNLKYRALRLDSGNFAWGSEQITRKTRII  79

Query  572  DVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketaeeteg  393
             VVYNASNNELVRT TLVKSAI+Q+DA PF+QWY  HY   + +       K        
Sbjct  80   SVVYNASNNELVRTNTLVKSAIIQIDATPFRQWYESHYAQPVTK-------KGKTTIVTD  132

Query  392  vaaeetkKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEGK  213
             AAE TK SNH QR L++++KE K+D+ LE QF +GRL A I+SRPGQ GRADGYILEGK
Sbjct  133  AAAEPTKLSNHAQRSLDEKKKEAKIDTLLESQFAAGRLYAAIASRPGQSGRADGYILEGK  192

Query  212  ELEFYMKKIQ  183
            ELEFY++K++
Sbjct  193  ELEFYLRKLR  202



>ref|XP_003083062.1| RS8_MAIZE 40S ribosomal protein S8 pir||T04088 ribosomal protein 
S8-maize (ISS) [Ostreococcus tauri]
Length=388

 Score =   224 bits (570),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 117/185 (63%), Positives = 138/185 (75%), Gaps = 7/185 (4%)
 Frame = -3

Query  734  YEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  555
            YE GRQPANTKLSSN TVR++R RGGNVK RALRLDTGNYSWGSE  TRKTRILDVVYNA
Sbjct  33   YELGRQPANTKLSSNVTVRQVRCRGGNVKHRALRLDTGNYSWGSENCTRKTRILDVVYNA  92

Query  554  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketaeetegvaaeet  375
            SNNELVRT+TLVKSA+V VDAAPF+ WY QHYG  IG        K            + 
Sbjct  93   SNNELVRTKTLVKSAVVAVDAAPFRAWYAQHYGKKIG-------IKVKNGAKVEEEDIDE  145

Query  374  kKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEGKELEFYM  195
            K+S  V  KL +R ++  ++S ++ QF +GRL+A ++SRPGQCGR DGYILEGKELEFY 
Sbjct  146  KRSKSVTMKLRRRNRDHAVESAIDAQFSTGRLLAIVTSRPGQCGRCDGYILEGKELEFYQ  205

Query  194  KKIQR  180
            +K+ +
Sbjct  206  RKLSK  210



>gb|KIO10111.1| hypothetical protein M404DRAFT_996068 [Pisolithus tinctorius 
Marx 270]
Length=212

 Score =   218 bits (555),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 122/190 (64%), Positives = 147/190 (77%), Gaps = 8/190 (4%)
 Frame = -3

Query  752  WRKKRKYEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRIL  573
            +RKKRK+E GRQPANTKL   K + R+RVRGGN K+RALRLDTGN++W SE  TRKTRI+
Sbjct  21   YRKKRKFELGRQPANTKLGP-KRIHRVRVRGGNFKFRALRLDTGNFAWASEHTTRKTRII  79

Query  572  DVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketaeeteg  393
             VVYNASNNELVRT TLV+ AI+QVDA PF+QWY  HY   + +       K    +   
Sbjct  80   GVVYNASNNELVRTNTLVQGAIIQVDATPFRQWYEAHYAQPVTK-------KGAKAQATA  132

Query  392  vaaeetkKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEGK  213
               E TK+SNH+QRKLE+R+K+ KLD  LE+QF +GRL ACISSRPGQCGRADGYILEGK
Sbjct  133  SGEEPTKRSNHLQRKLEERRKDSKLDLLLEQQFVAGRLYACISSRPGQCGRADGYILEGK  192

Query  212  ELEFYMKKIQ  183
            ELEFY++K++
Sbjct  193  ELEFYVRKLR  202



>gb|KJB81680.1| hypothetical protein B456_013G156600 [Gossypium raimondii]
Length=155

 Score =   216 bits (550),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 105/107 (98%), Positives = 105/107 (98%), Gaps = 0/107 (0%)
 Frame = -3

Query  761  KKAWRKKRKYEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKT  582
            KKAWRKKRKYE GRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKT
Sbjct  18   KKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKT  77

Query  581  RILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGR  441
            RILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG DIGR
Sbjct  78   RILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGIDIGR  124



>gb|EJT52835.1| 40S ribosomal protein S8 [Trichosporon asahii var. asahii CBS 
2479]
Length=207

 Score =   218 bits (554),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 115/190 (61%), Positives = 147/190 (77%), Gaps = 11/190 (6%)
 Frame = -3

Query  752  WRKKRKYEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRIL  573
            +RKKRK+E GRQ A TKL + K +  +R RGGNVK+RA+RLDTGN+SWG EA TRKTR+L
Sbjct  21   YRKKRKFELGRQAAMTKLDTTKRIHTVRTRGGNVKYRAIRLDTGNFSWGYEATTRKTRLL  80

Query  572  DVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketaeeteg  393
            +V YN++NNEL+RTQTLVKSA+V+VDA PF+QWY  HY   + +           +    
Sbjct  81   NVRYNSTNNELLRTQTLVKSAVVEVDATPFRQWYEAHYAQPVTK-----------KGQAE  129

Query  392  vaaeetkKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEGK  213
              A+E KKSNHVQR L +R+K+ K+D+HLE+QF +GRL+A I+SRPGQ GRADGYILEGK
Sbjct  130  APADEGKKSNHVQRILAERKKDAKIDNHLEQQFRTGRLLAMITSRPGQSGRADGYILEGK  189

Query  212  ELEFYMKKIQ  183
            EL+FY+KK+Q
Sbjct  190  ELDFYLKKLQ  199



>ref|XP_003059699.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH55651.1| predicted protein [Micromonas pusilla CCMP1545]
Length=213

 Score =   218 bits (554),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 117/194 (60%), Positives = 146/194 (75%), Gaps = 7/194 (4%)
 Frame = -3

Query  761  KKAWRKKRKYEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKT  582
            +K WRKKRKYE GRQ  NTKLSS+ +VR +R RGGN K+RA+RLD+GN+SWGSE  T KT
Sbjct  18   QKPWRKKRKYELGRQSGNTKLSSSVSVRTVRCRGGNKKFRAIRLDSGNFSWGSENTTHKT  77

Query  581  RILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketaee  402
            RILDV YNASNNELVRT+TLVK+A+VQVDAAPF+ WY QHYG  IG        KE   E
Sbjct  78   RILDVNYNASNNELVRTKTLVKNAVVQVDAAPFRAWYQQHYGKKIG-------IKEKNGE  130

Query  401  tegvaaeetkKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYIL  222
                   + K+SN ++RKL  R  +  + ++++ QF +GRL A ++SRPGQCGR DGYIL
Sbjct  131  KVEAEDIDEKRSNTLKRKLRDRNNKHAVPANVDTQFSTGRLYALVTSRPGQCGRCDGYIL  190

Query  221  EGKELEFYMKKIQR  180
            EGKEL+FY+KK+Q+
Sbjct  191  EGKELDFYVKKMQK  204



>emb|CDO76014.1| hypothetical protein BN946_scf184665.g6 [Trametes cinnabarina]
Length=219

 Score =   218 bits (555),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 121/190 (64%), Positives = 146/190 (77%), Gaps = 7/190 (4%)
 Frame = -3

Query  752  WRKKRKYEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRIL  573
            +RKKRK+E GRQPANTKL   K +  +RVRGGN+K+RALRLD+GN++WGSE VTRKTRI+
Sbjct  27   YRKKRKFELGRQPANTKLGP-KRIHTVRVRGGNLKYRALRLDSGNFAWGSEHVTRKTRII  85

Query  572  DVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketaeeteg  393
             VVYNASNNELVRT TLVKSAI+QVDA PF+QWY  HY   + +      +    +    
Sbjct  86   GVVYNASNNELVRTNTLVKSAIIQVDATPFRQWYEAHYAQPVTK------RGAKKDAAPQ  139

Query  392  vaaeetkKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEGK  213
               EE K SNHVQRKLE+R+K+ K+D  LE QF +GRL A ISSRPGQ GRADGYILEG+
Sbjct  140  ETEEEKKLSNHVQRKLEERKKDAKIDPLLESQFAAGRLYAAISSRPGQSGRADGYILEGR  199

Query  212  ELEFYMKKIQ  183
            ELEFY++KI+
Sbjct  200  ELEFYLRKIR  209



>ref|XP_001745896.1| hypothetical protein [Monosiga brevicollis MX1]
 gb|EDQ89320.1| predicted protein [Monosiga brevicollis MX1]
Length=222

 Score =   218 bits (554),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 117/189 (62%), Positives = 142/189 (75%), Gaps = 5/189 (3%)
 Frame = -3

Query  749  RKKRKYEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILD  570
            R KRKYE GR PA TKL+  K V  IR  GGN K+RALRL+TGN+SWGSE V+RKTR++D
Sbjct  36   RMKRKYELGRPPALTKLAGPKRVHEIRTMGGNRKFRALRLETGNFSWGSEGVSRKTRLID  95

Query  569  VVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketaeetegv  390
            VVYNASNNELVRT+TLVK+AI+ VDA PFKQWY  HYG  IG+      K    +     
Sbjct  96   VVYNASNNELVRTKTLVKNAIIVVDATPFKQWYETHYGLPIGK-----KKGGRNQSEVDE  150

Query  389  aaeetkKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEGKE  210
            A     +SNH++RKLE+R+   K+D HLEEQF +GRL AC+SSRPGQ GR DGYILEGKE
Sbjct  151  AILNKPRSNHLKRKLEERKAGAKVDVHLEEQFAAGRLYACVSSRPGQSGRCDGYILEGKE  210

Query  209  LEFYMKKIQ  183
            L+FY++K++
Sbjct  211  LDFYLRKLR  219



>ref|XP_002142692.1| 40S ribosomal protein S8 [Cryptosporidium muris RN66]
 gb|EEA08343.1| 40S ribosomal protein S8, putative [Cryptosporidium muris RN66]
Length=209

 Score =   217 bits (553),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 111/189 (59%), Positives = 142/189 (75%), Gaps = 7/189 (4%)
 Frame = -3

Query  746  KKRKYEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDV  567
            KKRKYE GR  +NTKL S + +R +R RGGN K+RALRLD+GNYSWGS+ ++RKTRIL+V
Sbjct  23   KKRKYELGRPASNTKLGSPR-IRVVRCRGGNKKFRALRLDSGNYSWGSQGISRKTRILEV  81

Query  566  VYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketaeetegva  387
            VYNASNNELVRT+TLVK+AIV +DA PF+Q+YLQHYG ++GR      ++  +++     
Sbjct  82   VYNASNNELVRTKTLVKNAIVVIDATPFRQYYLQHYGVELGR------RRNKSDDITDSR  135

Query  386  aeetkKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEGKEL  207
            A+    S HV    + R     +D  +EEQF  GRL+ACISSRPGQCGR DGYILEGKEL
Sbjct  136  ADIQSGSRHVLATKKARLDNNVIDPLVEEQFTIGRLLACISSRPGQCGRCDGYILEGKEL  195

Query  206  EFYMKKIQR  180
            EFY +K+++
Sbjct  196  EFYKRKLEK  204



>ref|XP_007311714.1| 40S ribosomal protein S8, partial [Stereum hirsutum FP-91666 
SS1]
 gb|EIM79171.1| 40S ribosomal protein S8, partial [Stereum hirsutum FP-91666 
SS1]
Length=211

 Score =   217 bits (552),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 120/190 (63%), Positives = 144/190 (76%), Gaps = 8/190 (4%)
 Frame = -3

Query  752  WRKKRKYEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRIL  573
            +RKKRK+E GRQ ANT+L   K V  +RVRGGN+K+RALRLD GN++WGSE VT+KTRI+
Sbjct  20   YRKKRKFELGRQAANTRLGP-KRVHSVRVRGGNLKFRALRLDAGNFAWGSEHVTKKTRII  78

Query  572  DVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketaeeteg  393
             VVYNASNNELVRT TLVKSAI+QVDA PF+QWY  HY   + +       K   +  E 
Sbjct  79   GVVYNASNNELVRTNTLVKSAIIQVDATPFRQWYEAHYALPVSK-------KLAKQAGEK  131

Query  392  vaaeetkKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEGK  213
               E  K SNH QR LE+R+KE K+D  LE QFG+GRL A +SSRPGQCGRADGYILEGK
Sbjct  132  EETEPKKLSNHAQRHLEERKKEAKIDPLLESQFGAGRLYAVVSSRPGQCGRADGYILEGK  191

Query  212  ELEFYMKKIQ  183
            ELEFY++K++
Sbjct  192  ELEFYVRKLR  201



>ref|XP_008799563.1| PREDICTED: 40S ribosomal protein S8-like [Phoenix dactylifera]
Length=146

 Score =   214 bits (546),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 103/107 (96%), Positives = 105/107 (98%), Gaps = 0/107 (0%)
 Frame = -3

Query  761  KKAWRKKRKYEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKT  582
            KKAWRKKRKYE GRQPANTKLSSNKTVRR+RVRGGNVKWRALRLDTGNYSWGSEAVTRKT
Sbjct  18   KKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALRLDTGNYSWGSEAVTRKT  77

Query  581  RILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGR  441
            RILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG +IGR
Sbjct  78   RILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVEIGR  124



>ref|XP_002117056.1| expressed hypothetical protein [Trichoplax adhaerens]
 gb|EDV20362.1| expressed hypothetical protein [Trichoplax adhaerens]
Length=210

 Score =   216 bits (551),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 118/193 (61%), Positives = 148/193 (77%), Gaps = 8/193 (4%)
 Frame = -3

Query  761  KKAWRKKRKYEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKT  582
            K   RKKRK+E GRQPA TK+ + K +  +R RGGN K+RALRL+TGNYSW SEA++RK+
Sbjct  21   KAPLRKKRKFELGRQPAMTKMGA-KRIHTVRTRGGNYKYRALRLETGNYSWASEAISRKS  79

Query  581  RILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketaee  402
            RILDVVYNASNNELVRT+TLVK+ IVQ+DA PFKQWY  HY   I R       K++ ++
Sbjct  80   RILDVVYNASNNELVRTKTLVKNCIVQIDATPFKQWYESHYNIPIVR-------KKSKQQ  132

Query  401  tegvaaeetkKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYIL  222
                  EE ++S  V++KLE R++  K+ S LEEQFG+GR+ AC++SRPGQCGR DGYIL
Sbjct  133  QTTEETEEIRRSKRVEKKLEARKRFAKIASALEEQFGTGRIYACVASRPGQCGRCDGYIL  192

Query  221  EGKELEFYMKKIQ  183
            EGKELEFY+KKI+
Sbjct  193  EGKELEFYLKKIR  205



>ref|XP_572078.1| 40S ribosomal protein S8 [Cryptococcus neoformans var. neoformans 
JEC21]
 ref|XP_774458.1| 40S ribosomal protein S8 [Cryptococcus neoformans var. neoformans 
B-3501A]
 gb|EAL19811.1| hypothetical protein CNBG1040 [Cryptococcus neoformans var. neoformans 
B-3501A]
 gb|AAW44771.1| 40S ribosomal protein S8, putative [Cryptococcus neoformans var. 
neoformans JEC21]
Length=208

 Score =   216 bits (550),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 113/190 (59%), Positives = 142/190 (75%), Gaps = 10/190 (5%)
 Frame = -3

Query  752  WRKKRKYEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRIL  573
            +RKKRK+E GRQPA TKL S+K +  +R RGGNVK+RALRLD+GN++WGSE+VTRKTR++
Sbjct  21   YRKKRKFELGRQPAMTKLDSSKRIHEVRTRGGNVKYRALRLDSGNFAWGSESVTRKTRLI  80

Query  572  DVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketaeeteg  393
             V YNA+NNEL+RTQTLVK A+V +DA PF+QWY  HY     R            ++  
Sbjct  81   QVRYNATNNELLRTQTLVKGAVVDIDATPFRQWYESHYAQPASR----------GAKSAV  130

Query  392  vaaeetkKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEGK  213
                + K+SNHV+R LE+R+K  K+D  LE+QF +GRL+A ISSRPGQ GRADGYILEGK
Sbjct  131  TEEADKKQSNHVKRILEERKKVAKIDPLLEQQFRAGRLLAVISSRPGQSGRADGYILEGK  190

Query  212  ELEFYMKKIQ  183
            ELEFY  K+Q
Sbjct  191  ELEFYHHKLQ  200



>gb|EMD32142.1| hypothetical protein CERSUDRAFT_88417 [Ceriporiopsis subvermispora 
B]
Length=213

 Score =   216 bits (550),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 120/190 (63%), Positives = 147/190 (77%), Gaps = 7/190 (4%)
 Frame = -3

Query  752  WRKKRKYEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRIL  573
            +RKKRK+E GRQ A+TKL + K V  +RVRGGN+K+RALRL++GN++WGSE VTRKTRI+
Sbjct  21   YRKKRKFELGRQAASTKLGA-KRVHTVRVRGGNLKYRALRLESGNFAWGSEHVTRKTRII  79

Query  572  DVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketaeeteg  393
             VVYNASNNELVRT TLVKSAI+QVDA PF+QWY  HY   + +      K    +    
Sbjct  80   GVVYNASNNELVRTNTLVKSAIIQVDATPFRQWYEAHYAQPVTK------KGAKKDVAAE  133

Query  392  vaaeetkKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEGK  213
             +AEE K SNH QRK E+R+ + K+D+ LE QF +GRL A ISSRPGQCGRADGYILEGK
Sbjct  134  ESAEEKKLSNHAQRKYEERKGDAKIDTLLESQFAAGRLYAAISSRPGQCGRADGYILEGK  193

Query  212  ELEFYMKKIQ  183
            ELEFY++KI+
Sbjct  194  ELEFYLRKIR  203



>gb|KIK27780.1| hypothetical protein PISMIDRAFT_169173 [Pisolithus microcarpus 
441]
Length=210

 Score =   216 bits (549),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 119/190 (63%), Positives = 145/190 (76%), Gaps = 10/190 (5%)
 Frame = -3

Query  752  WRKKRKYEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRIL  573
            +RKKRK+E GRQPANT+L   K +  +RVRGGN K+RALRLDTGN++W SE  TRKTR++
Sbjct  21   YRKKRKFELGRQPANTRLGP-KRIHPVRVRGGNFKYRALRLDTGNFAWASEHTTRKTRVI  79

Query  572  DVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketaeeteg  393
             VVYNASNNELVRT TLVK AI+QVDA PF+QWY  HY   I +            +   
Sbjct  80   GVVYNASNNELVRTNTLVKGAIIQVDATPFRQWYEAHYAQPITK---------KGAKAAA  130

Query  392  vaaeetkKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEGK  213
               E TK+SNH+QRKLE+R+K+ K+D  LE+QF +GRL ACISSRPGQCGRADGYILEGK
Sbjct  131  SGEEPTKRSNHLQRKLEERRKDSKIDPLLEQQFVAGRLYACISSRPGQCGRADGYILEGK  190

Query  212  ELEFYMKKIQ  183
            ELEFY++K++
Sbjct  191  ELEFYVRKLR  200



>ref|XP_007001047.1| hypothetical protein TREMEDRAFT_55820 [Tremella mesenterica DSM 
1558]
 gb|EIW72131.1| hypothetical protein TREMEDRAFT_55820 [Tremella mesenterica DSM 
1558]
Length=205

 Score =   216 bits (549),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 112/193 (58%), Positives = 143/193 (74%), Gaps = 11/193 (6%)
 Frame = -3

Query  761  KKAWRKKRKYEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKT  582
            K ++RKKRK+E GRQPA TKL ++K +  +R RGGN K+RALRLDTGN++WGSE VTRKT
Sbjct  18   KASYRKKRKFELGRQPAMTKLDTSKRINTVRTRGGNTKYRALRLDTGNFAWGSEHVTRKT  77

Query  581  RILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketaee  402
            R+L V YNASNNEL+RTQTLVKS ++ VDA PF+QWY  HY   I R             
Sbjct  78   RLLQVRYNASNNELLRTQTLVKSCVIDVDATPFRQWYEAHYAQPIFR-----------GA  126

Query  401  tegvaaeetkKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYIL  222
                   E  +SNHV+R L++R+K+ K+D  LE+QF +GRL+A ++SRPGQ GRADGYIL
Sbjct  127  KLPEEQTEKTQSNHVKRILDERKKDAKIDPLLEQQFKAGRLLAILTSRPGQSGRADGYIL  186

Query  221  EGKELEFYMKKIQ  183
            EGKEL+FY++K+Q
Sbjct  187  EGKELDFYLRKLQ  199



>ref|XP_006461206.1| hypothetical protein AGABI2DRAFT_136253 [Agaricus bisporus var. 
bisporus H97]
 ref|XP_007328588.1| hypothetical protein AGABI1DRAFT_99162 [Agaricus bisporus var. 
burnettii JB137-S8]
 gb|EKM81075.1| hypothetical protein AGABI1DRAFT_99162 [Agaricus bisporus var. 
burnettii JB137-S8]
 gb|EKV47556.1| hypothetical protein AGABI2DRAFT_136253 [Agaricus bisporus var. 
bisporus H97]
Length=216

 Score =   216 bits (550),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 122/190 (64%), Positives = 148/190 (78%), Gaps = 3/190 (2%)
 Frame = -3

Query  752  WRKKRKYEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRIL  573
            +RKKRK+E GRQPANT+L   K +  +RVRGGN+K+RALRLD GN++WGSE+VTRKTRIL
Sbjct  21   YRKKRKFELGRQPANTRLGP-KRIHEVRVRGGNIKYRALRLDGGNFAWGSESVTRKTRIL  79

Query  572  DVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketaeeteg  393
             VVYNASNNELVRT TLVKSAI+Q+DA PF+QWY  HY   +   KK+A  +     T+G
Sbjct  80   TVVYNASNNELVRTNTLVKSAIIQIDATPFRQWYEAHYAQPV--SKKSAKAQAAQAATDG  137

Query  392  vaaeetkKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEGK  213
               E  K SNH QR L +R+K+ K+D  LE QFG+GRL A ISSRPGQ GRADGY+LEGK
Sbjct  138  ATEEPKKLSNHAQRNLTERKKDAKIDPLLETQFGAGRLYARISSRPGQSGRADGYVLEGK  197

Query  212  ELEFYMKKIQ  183
            ELEFY++KI+
Sbjct  198  ELEFYLRKIR  207



>ref|XP_008365334.1| PREDICTED: 40S ribosomal protein S8-like [Malus domestica]
Length=169

 Score =   214 bits (545),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 112/168 (67%), Positives = 125/168 (74%), Gaps = 18/168 (11%)
 Frame = -3

Query  677  RIRVRGGNVKWRALR--LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIV  504
            +IRVRGGNVKWRALR  LDTGN+SWGSEAVTRKTR+LDVVY ASNNELVRTQTLVKSAI 
Sbjct  8    QIRVRGGNVKWRALRFILDTGNFSWGSEAVTRKTRLLDVVYRASNNELVRTQTLVKSAIF  67

Query  503  QVDAAPFKQWYLQHYGFDIGRkkkaaakketaeetegvaaeetkKSNHVqrklekrqker  324
            QVDAAPFKQWYLQHYG  +GR  + +    T+ +    A  + +  +             
Sbjct  68   QVDAAPFKQWYLQHYGVSVGRSIENSIFICTSRKENPCARRQCQMES-------------  114

Query  323  kLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEGKELEFYMKKIQR  180
               S +EEQFG GRL+ACISSRPGQCGR DGYILEGKELEFYMKK QR
Sbjct  115  ---SQVEEQFGGGRLLACISSRPGQCGRCDGYILEGKELEFYMKKFQR  159



>gb|KIJ26939.1| hypothetical protein M422DRAFT_76964 [Sphaerobolus stellatus 
SS14]
Length=214

 Score =   216 bits (549),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 122/190 (64%), Positives = 147/190 (77%), Gaps = 3/190 (2%)
 Frame = -3

Query  752  WRKKRKYEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRIL  573
            +RKKRK+E GRQ ANTKL   K V  +RVRGGN+K+RALRL++GN++WGSE VTRKTRI+
Sbjct  21   YRKKRKFELGRQAANTKLGP-KRVHTVRVRGGNLKYRALRLESGNFAWGSETVTRKTRII  79

Query  572  DVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketaeeteg  393
             VVYNASNNELVRT TLVK AIVQVDAAPF+QWY QHY   + +  K       A     
Sbjct  80   GVVYNASNNELVRTNTLVKGAIVQVDAAPFRQWYEQHYAQPVTK--KVKPIAAPAAVEGE  137

Query  392  vaaeetkKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEGK  213
              AE   KSNHVQRK+++R+K+ K+D  LE+QF +GRL A ISSRPGQ GRADGYILEGK
Sbjct  138  APAEPATKSNHVQRKVDERKKDGKIDVLLEQQFNAGRLYASISSRPGQSGRADGYILEGK  197

Query  212  ELEFYMKKIQ  183
            ELEFY++K++
Sbjct  198  ELEFYVRKLR  207



>ref|XP_003195106.1| 40S ribosomal protein S8 [Cryptococcus gattii WM276]
 gb|ADV23319.1| 40S ribosomal protein S8, putative [Cryptococcus gattii WM276]
 gb|KIR51973.1| ribosomal protein S8.e [Cryptococcus gattii Ru294]
 gb|KIR77902.1| ribosomal protein S8.e [Cryptococcus gattii EJB2]
 gb|KIY31985.1| ribosomal protein S8.e [Cryptococcus gattii E566]
 gb|KJE03251.1| ribosomal protein S8.e [Cryptococcus gattii NT-10]
Length=208

 Score =   215 bits (548),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 113/190 (59%), Positives = 142/190 (75%), Gaps = 10/190 (5%)
 Frame = -3

Query  752  WRKKRKYEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRIL  573
            +RKKRK+E GRQPA TKL S+K V  +R RGGNVK+RALRLD+GN++WGSE++TRKTR++
Sbjct  21   YRKKRKFELGRQPAMTKLDSSKRVHEVRTRGGNVKYRALRLDSGNFAWGSESITRKTRLI  80

Query  572  DVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketaeeteg  393
             V YNA+NNEL+RTQTLVK A+V +DA PF+QWY  HY     R            ++  
Sbjct  81   QVRYNATNNELLRTQTLVKGAVVDIDATPFRQWYESHYAQPAFR----------GAKSAV  130

Query  392  vaaeetkKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEGK  213
                + K+SNHV+R LE+R+K  K+D  LE+QF +GRL+A ISSRPGQ GRADGYILEGK
Sbjct  131  TEEADKKQSNHVKRILEERKKVAKIDPLLEQQFKAGRLLAVISSRPGQSGRADGYILEGK  190

Query  212  ELEFYMKKIQ  183
            ELEFY  K+Q
Sbjct  191  ELEFYHHKLQ  200



>gb|AFR96425.1| small subunit ribosomal protein S8e [Cryptococcus neoformans 
var. grubii H99]
Length=208

 Score =   215 bits (548),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 112/190 (59%), Positives = 142/190 (75%), Gaps = 10/190 (5%)
 Frame = -3

Query  752  WRKKRKYEXGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRIL  573
            +RKKRK+E GRQPA TKL S+K +  +R RGGNVK+RALRLD+GN++WGSE++TRKTR++
Sbjct  21   YRKKRKFELGRQPAMTKLDSSKRIHEVRTRGGNVKYRALRLDSGNFAWGSESITRKTRLI  80

Query  572  DVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGFDIGRkkkaaakketaeeteg  393
             V YNA+NNEL+RTQTLVK A+V +DA PF+QWY  HY     R            ++  
Sbjct  81   QVRYNATNNELLRTQTLVKGAVVDIDATPFRQWYESHYAQPAFR----------GAKSAA  130

Query  392  vaaeetkKSNHVqrklekrqkerkLDSHLEEQFGSGRLMACISSRPGQCGRADGYILEGK  213
                + K+SNHV+R LE+R+K  K+D  LE+QF +GRL+A ISSRPGQ GRADGYILEGK
Sbjct  131  AEEADKKQSNHVKRILEERKKVAKIDPLLEQQFKAGRLLAVISSRPGQSGRADGYILEGK  190

Query  212  ELEFYMKKIQ  183
            ELEFY  K+Q
Sbjct  191  ELEFYHHKLQ  200



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1441039810680