BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF010D13

Length=655
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|EYU30892.1|  hypothetical protein MIMGU_mgv1a003326mg                155   2e-40   Erythranthe guttata [common monkey flower]
ref|XP_011099916.1|  PREDICTED: transmembrane 9 superfamily member 3    155   2e-40   
gb|ABR25749.1|  transmembrane 9 superfamily protein member 1            145   3e-40   Oryza sativa Indica Group [Indian rice]
emb|CDP01680.1|  unnamed protein product                                154   4e-40   Coffea canephora [robusta coffee]
gb|AAF01248.1|AF187853_1  putative multispanning membrane protein       144   5e-40   Populus tremula x Populus alba [gray poplar]
dbj|BAD94118.1|  putative endosomal protein                             144   9e-40   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009785097.1|  PREDICTED: putative phagocytic receptor 1b         153   1e-39   Nicotiana sylvestris
ref|XP_009631354.1|  PREDICTED: putative phagocytic receptor 1b         153   1e-39   Nicotiana tomentosiformis
gb|ACF74283.1|  putative endosomal protein                              142   1e-39   Arachis hypogaea [goober]
emb|CDP01681.1|  unnamed protein product                                152   2e-39   Coffea canephora [robusta coffee]
ref|XP_006352389.1|  PREDICTED: putative phagocytic receptor 1b-l...    152   2e-39   Solanum tuberosum [potatoes]
ref|XP_004250237.1|  PREDICTED: putative phagocytic receptor 1b         152   2e-39   Solanum lycopersicum
dbj|BAH20237.1|  AT2G01970                                              148   3e-39   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006372422.1|  endomembrane protein 70                            152   4e-39   Populus trichocarpa [western balsam poplar]
ref|XP_011038406.1|  PREDICTED: transmembrane 9 superfamily membe...    152   4e-39   Populus euphratica
ref|XP_006372421.1|  hypothetical protein POPTR_0017s01480g             152   4e-39   Populus trichocarpa [western balsam poplar]
ref|XP_010036999.1|  PREDICTED: putative phagocytic receptor 1b         152   4e-39   Eucalyptus grandis [rose gum]
gb|KHG03505.1|  Putative phagocytic receptor 1b                         151   4e-39   Gossypium arboreum [tree cotton]
gb|KJB15314.1|  hypothetical protein B456_002G170500                    147   5e-39   Gossypium raimondii
gb|EYU30878.1|  hypothetical protein MIMGU_mgv1a003324mg                151   5e-39   Erythranthe guttata [common monkey flower]
ref|XP_011038404.1|  PREDICTED: transmembrane 9 superfamily member 4    151   6e-39   Populus euphratica
gb|KJB15315.1|  hypothetical protein B456_002G170500                    147   6e-39   Gossypium raimondii
ref|XP_011463508.1|  PREDICTED: transmembrane 9 superfamily member 2    151   6e-39   Fragaria vesca subsp. vesca
ref|XP_009602054.1|  PREDICTED: putative phagocytic receptor 1b         151   8e-39   Nicotiana tomentosiformis
ref|XP_009775043.1|  PREDICTED: putative phagocytic receptor 1b         151   8e-39   Nicotiana sylvestris
emb|CDY52038.1|  BnaA08g31510D                                          150   8e-39   Brassica napus [oilseed rape]
dbj|BAK08235.1|  predicted protein                                      148   9e-39   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006346764.1|  PREDICTED: putative phagocytic receptor 1b-like    150   1e-38   Solanum tuberosum [potatoes]
ref|XP_004236681.1|  PREDICTED: putative phagocytic receptor 1b         150   1e-38   Solanum lycopersicum
emb|CDY52035.1|  BnaA08g31480D                                          150   1e-38   Brassica napus [oilseed rape]
ref|XP_009110524.1|  PREDICTED: putative phagocytic receptor 1b         150   1e-38   Brassica rapa
ref|XP_009110529.1|  PREDICTED: putative phagocytic receptor 1b         150   1e-38   Brassica rapa
ref|XP_008393472.1|  PREDICTED: putative phagocytic receptor 1b         150   1e-38   Malus domestica [apple tree]
emb|CDX84018.1|  BnaC08g16270D                                          150   1e-38   
ref|XP_003548324.1|  PREDICTED: putative phagocytic receptor 1b-like    150   1e-38   Glycine max [soybeans]
ref|XP_004515238.1|  PREDICTED: putative phagocytic receptor 1b-like    150   1e-38   Cicer arietinum [garbanzo]
ref|XP_004239834.1|  PREDICTED: putative phagocytic receptor 1b         150   1e-38   Solanum lycopersicum
gb|AAF79217.1|AC006917_2  F10B6.3                                       147   1e-38   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006365862.1|  PREDICTED: putative phagocytic receptor 1b-like    150   1e-38   
gb|KHN43674.1|  Putative phagocytic receptor 1b                         150   1e-38   Glycine soja [wild soybean]
ref|XP_008466877.1|  PREDICTED: putative phagocytic receptor 1b         150   1e-38   Cucumis melo [Oriental melon]
ref|XP_003531127.1|  PREDICTED: putative phagocytic receptor 1b-like    150   1e-38   Glycine max [soybeans]
ref|XP_007158822.1|  hypothetical protein PHAVU_002G184900g             150   1e-38   Phaseolus vulgaris [French bean]
gb|KHN28892.1|  Putative phagocytic receptor 1b                         150   1e-38   Glycine soja [wild soybean]
gb|KJB08470.1|  hypothetical protein B456_001G083100                    150   1e-38   Gossypium raimondii
ref|XP_008462539.1|  PREDICTED: putative phagocytic receptor 1b i...    150   1e-38   Cucumis melo [Oriental melon]
emb|CDY56297.1|  BnaC09g52300D                                          150   2e-38   Brassica napus [oilseed rape]
ref|XP_006292411.1|  hypothetical protein CARUB_v10018624mg             150   2e-38   Capsella rubella
ref|XP_003524839.1|  PREDICTED: putative phagocytic receptor 1b-like    150   2e-38   Glycine max [soybeans]
gb|KHG09925.1|  Putative phagocytic receptor 1b                         150   2e-38   Gossypium arboreum [tree cotton]
ref|XP_004504610.1|  PREDICTED: putative phagocytic receptor 1b-like    150   2e-38   Cicer arietinum [garbanzo]
ref|XP_008461818.1|  PREDICTED: putative phagocytic receptor 1b i...    150   2e-38   Cucumis melo [Oriental melon]
ref|XP_010917284.1|  PREDICTED: transmembrane 9 superfamily membe...    150   2e-38   Elaeis guineensis
ref|XP_004137376.1|  PREDICTED: putative phagocytic receptor 1b-like    150   2e-38   Cucumis sativus [cucumbers]
gb|ACR33947.1|  unknown                                                 149   2e-38   Zea mays [maize]
ref|XP_004170088.1|  PREDICTED: putative phagocytic receptor 1b-like    149   2e-38   
ref|NP_001148980.1|  LOC100282600 precursor                             149   2e-38   Zea mays [maize]
ref|XP_003558407.1|  PREDICTED: putative phagocytic receptor 1b         149   2e-38   Brachypodium distachyon [annual false brome]
ref|XP_010691704.1|  PREDICTED: transmembrane 9 superfamily membe...    149   2e-38   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009616336.1|  PREDICTED: putative phagocytic receptor 1b         149   3e-38   Nicotiana tomentosiformis
gb|AGT15903.1|  transmembrane 9 superfamily protein                     149   3e-38   Saccharum hybrid cultivar R570
gb|KDP38192.1|  hypothetical protein JCGZ_04835                         149   3e-38   Jatropha curcas
ref|XP_010244840.1|  PREDICTED: putative phagocytic receptor 1b         149   3e-38   Nelumbo nucifera [Indian lotus]
emb|CDY03085.1|  BnaC07g21420D                                          149   3e-38   
emb|CDP05457.1|  unnamed protein product                                149   3e-38   Coffea canephora [robusta coffee]
ref|XP_002285238.1|  PREDICTED: transmembrane 9 superfamily member 2    149   3e-38   Vitis vinifera
dbj|BAJ89640.1|  predicted protein                                      149   3e-38   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002468203.1|  hypothetical protein SORBIDRAFT_01g041650          149   3e-38   Sorghum bicolor [broomcorn]
ref|XP_003620064.1|  Transmembrane 9 superfamily protein member         149   3e-38   Medicago truncatula
gb|ABR26036.1|  transmembrane 9 superfamily protein member 1 prec...    141   3e-38   Oryza sativa Indica Group [Indian rice]
gb|AFK34316.1|  unknown                                                 147   3e-38   Medicago truncatula
ref|XP_004985073.1|  PREDICTED: putative phagocytic receptor 1b-like    149   4e-38   Setaria italica
gb|EMS68537.1|  Putative phagocytic receptor 1b                         149   4e-38   Triticum urartu
ref|XP_009774478.1|  PREDICTED: putative phagocytic receptor 1b         149   4e-38   Nicotiana sylvestris
gb|AAF63170.1|AC010657_6  T5E21.15                                      149   4e-38   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007225615.1|  hypothetical protein PRUPE_ppa003229mg             149   4e-38   Prunus persica
ref|NP_178306.1|  putative endomembrane protein 70                      149   4e-38   Arabidopsis thaliana [mouse-ear cress]
emb|CDY15803.1|  BnaC02g34220D                                          149   4e-38   Brassica napus [oilseed rape]
ref|XP_010276303.1|  PREDICTED: putative phagocytic receptor 1b         149   4e-38   Nelumbo nucifera [Indian lotus]
ref|XP_008220963.1|  PREDICTED: putative phagocytic receptor 1b         149   4e-38   Prunus mume [ume]
ref|XP_010476529.1|  PREDICTED: putative phagocytic receptor 1b         149   4e-38   Camelina sativa [gold-of-pleasure]
ref|XP_006649701.1|  PREDICTED: putative phagocytic receptor 1b-like    148   4e-38   
ref|XP_007152616.1|  hypothetical protein PHAVU_004G145000g             149   4e-38   Phaseolus vulgaris [French bean]
ref|XP_006307070.1|  hypothetical protein CARUB_v10008657mg             149   4e-38   Capsella rubella
gb|KFK43715.1|  hypothetical protein AALP_AA1G163400                    149   4e-38   Arabis alpina [alpine rockcress]
emb|CDY41095.1|  BnaC05g10860D                                          149   4e-38   Brassica napus [oilseed rape]
ref|XP_009387842.1|  PREDICTED: putative phagocytic receptor 1b         149   4e-38   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001049492.1|  Os03g0237000                                       149   4e-38   
ref|XP_002876790.1|  hypothetical protein ARALYDRAFT_904415             149   4e-38   Arabidopsis lyrata subsp. lyrata
ref|XP_010936838.1|  PREDICTED: transmembrane 9 superfamily membe...    149   4e-38   Elaeis guineensis
ref|XP_010496367.1|  PREDICTED: putative phagocytic receptor 1b         149   4e-38   Camelina sativa [gold-of-pleasure]
ref|XP_006395825.1|  hypothetical protein EUTSA_v10003877mg             149   4e-38   Eutrema salsugineum [saltwater cress]
ref|NP_172919.1|  putative endomembrane protein 70                      149   4e-38   Arabidopsis thaliana [mouse-ear cress]
gb|KFK33411.1|  hypothetical protein AALP_AA5G009400                    149   5e-38   Arabis alpina [alpine rockcress]
ref|XP_006416990.1|  hypothetical protein EUTSA_v10007150mg             149   5e-38   Eutrema salsugineum [saltwater cress]
ref|XP_009355975.1|  PREDICTED: putative phagocytic receptor 1b         149   5e-38   Pyrus x bretschneideri [bai li]
gb|KHN24548.1|  Putative phagocytic receptor 1b                         149   5e-38   Glycine soja [wild soybean]
emb|CDX81659.1|  BnaC08g39420D                                          149   5e-38   
ref|XP_008791844.1|  PREDICTED: putative phagocytic receptor 1b         148   5e-38   Phoenix dactylifera
ref|XP_004150159.1|  PREDICTED: putative phagocytic receptor 1b-like    149   6e-38   
ref|XP_008375035.1|  PREDICTED: putative phagocytic receptor 1b         148   6e-38   
ref|XP_004299493.1|  PREDICTED: transmembrane 9 superfamily membe...    148   6e-38   Fragaria vesca subsp. vesca
ref|XP_010554368.1|  PREDICTED: putative phagocytic receptor 1b         148   6e-38   Tarenaya hassleriana [spider flower]
gb|ACG42357.1|  transmembrane 9 superfamily protein member 1 prec...    148   7e-38   Zea mays [maize]
ref|XP_010458976.1|  PREDICTED: putative phagocytic receptor 1b         148   7e-38   Camelina sativa [gold-of-pleasure]
ref|NP_001151315.1|  transmembrane 9 superfamily protein member 1...    148   7e-38   Zea mays [maize]
ref|XP_006384123.1|  hypothetical protein POPTR_0004s07400g             148   7e-38   
ref|XP_010069472.1|  PREDICTED: putative phagocytic receptor 1b         148   7e-38   Eucalyptus grandis [rose gum]
ref|XP_009351612.1|  PREDICTED: putative phagocytic receptor 1b         148   8e-38   Pyrus x bretschneideri [bai li]
ref|XP_002305925.2|  endomembrane protein 70                            148   8e-38   Populus trichocarpa [western balsam poplar]
ref|XP_007210263.1|  hypothetical protein PRUPE_ppa003204mg             148   9e-38   Prunus persica
gb|KJB15313.1|  hypothetical protein B456_002G170500                    147   9e-38   Gossypium raimondii
ref|XP_010939968.1|  PREDICTED: transmembrane 9 superfamily membe...    148   9e-38   Elaeis guineensis
ref|XP_010105529.1|  Putative phagocytic receptor 1b                    147   1e-37   Morus notabilis
ref|XP_008340538.1|  PREDICTED: putative phagocytic receptor 1b         147   1e-37   Malus domestica [apple tree]
ref|XP_011005913.1|  PREDICTED: transmembrane 9 superfamily membe...    147   1e-37   Populus euphratica
ref|XP_002521900.1|  transporter, putative                              147   1e-37   Ricinus communis
ref|XP_007031333.1|  Endomembrane protein 70 protein family             147   1e-37   
ref|XP_002521898.1|  transporter, putative                              147   1e-37   
gb|KJB15310.1|  hypothetical protein B456_002G170500                    147   1e-37   Gossypium raimondii
gb|KHG04463.1|  Putative phagocytic receptor 1b                         148   1e-37   Gossypium arboreum [tree cotton]
ref|XP_010691703.1|  PREDICTED: transmembrane 9 superfamily member 2    147   1e-37   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011005915.1|  PREDICTED: transmembrane 9 superfamily membe...    147   1e-37   Populus euphratica
gb|KHN39489.1|  Putative phagocytic receptor 1b                         147   1e-37   Glycine soja [wild soybean]
ref|XP_002521899.1|  transporter, putative                              147   1e-37   Ricinus communis
ref|XP_009389646.1|  PREDICTED: putative phagocytic receptor 1b         147   1e-37   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009404153.1|  PREDICTED: putative phagocytic receptor 1b         147   1e-37   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010932502.1|  PREDICTED: transmembrane 9 superfamily membe...    147   1e-37   Elaeis guineensis
gb|AHA84153.1|  phagocytic receptor 1b                                  147   1e-37   Phaseolus vulgaris [French bean]
ref|XP_010066537.1|  PREDICTED: putative phagocytic receptor 1b         147   1e-37   Eucalyptus grandis [rose gum]
ref|XP_008789222.1|  PREDICTED: putative phagocytic receptor 1b         147   1e-37   
ref|XP_006283389.1|  hypothetical protein CARUB_v10004434mg             147   2e-37   Capsella rubella
ref|XP_008798135.1|  PREDICTED: putative phagocytic receptor 1b         147   2e-37   Phoenix dactylifera
ref|XP_007045410.1|  Endomembrane protein 70 protein family isofo...    147   2e-37   
ref|XP_002870515.1|  transporter                                        147   2e-37   Arabidopsis lyrata subsp. lyrata
ref|XP_007045409.1|  Endomembrane protein 70 protein family isofo...    147   2e-37   
gb|AFK33397.1|  unknown                                                 145   2e-37   Medicago truncatula
ref|XP_006405901.1|  hypothetical protein EUTSA_v10027693mg             147   2e-37   
gb|KDP38191.1|  hypothetical protein JCGZ_04834                         147   2e-37   Jatropha curcas
gb|KHG00678.1|  Putative phagocytic receptor 1b                         146   2e-37   Gossypium arboreum [tree cotton]
ref|XP_003544357.1|  PREDICTED: putative phagocytic receptor 1b-like    147   2e-37   Glycine max [soybeans]
gb|KJB60873.1|  hypothetical protein B456_009G329300                    146   3e-37   Gossypium raimondii
gb|KJB60874.1|  hypothetical protein B456_009G329300                    146   3e-37   Gossypium raimondii
ref|XP_008787887.1|  PREDICTED: putative phagocytic receptor 1b i...    146   3e-37   Phoenix dactylifera
ref|XP_009108077.1|  PREDICTED: putative phagocytic receptor 1b         146   3e-37   Brassica rapa
emb|CDY62621.1|  BnaC08g46810D                                          146   3e-37   Brassica napus [oilseed rape]
ref|XP_007141945.1|  hypothetical protein PHAVU_008G239300g             146   3e-37   Phaseolus vulgaris [French bean]
emb|CDY47549.1|  BnaA08g07380D                                          146   3e-37   Brassica napus [oilseed rape]
ref|XP_010527833.1|  PREDICTED: putative phagocytic receptor 1b         146   3e-37   Tarenaya hassleriana [spider flower]
gb|KHN41041.1|  Putative phagocytic receptor 1b                         146   4e-37   Glycine soja [wild soybean]
ref|XP_010435562.1|  PREDICTED: putative phagocytic receptor 1b         146   4e-37   Camelina sativa [gold-of-pleasure]
ref|XP_010450487.1|  PREDICTED: putative phagocytic receptor 1b         146   5e-37   Camelina sativa [gold-of-pleasure]
ref|XP_010502204.1|  PREDICTED: putative phagocytic receptor 1b         145   5e-37   Camelina sativa [gold-of-pleasure]
ref|XP_010513951.1|  PREDICTED: putative phagocytic receptor 1b         145   5e-37   Camelina sativa [gold-of-pleasure]
ref|XP_010440841.1|  PREDICTED: putative phagocytic receptor 1b i...    145   5e-37   Camelina sativa [gold-of-pleasure]
ref|XP_008389133.1|  PREDICTED: putative phagocytic receptor 1b         145   6e-37   
ref|XP_006470811.1|  PREDICTED: putative phagocytic receptor 1b-like    145   6e-37   Citrus sinensis [apfelsine]
ref|XP_006431397.1|  hypothetical protein CICLE_v10000657mg             145   6e-37   Citrus clementina [clementine]
ref|XP_009419338.1|  PREDICTED: putative phagocytic receptor 1b         145   6e-37   Musa acuminata subsp. malaccensis [pisang utan]
gb|EPS73142.1|  hypothetical protein M569_01612                         145   6e-37   Genlisea aurea
ref|XP_011085893.1|  PREDICTED: transmembrane 9 superfamily membe...    145   6e-37   Sesamum indicum [beniseed]
ref|XP_006448062.1|  hypothetical protein CICLE_v10014688mg             145   8e-37   
ref|XP_009380058.1|  PREDICTED: putative phagocytic receptor 1b         145   9e-37   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006448061.1|  hypothetical protein CICLE_v10014688mg             145   9e-37   Citrus clementina [clementine]
ref|XP_010261665.1|  PREDICTED: putative phagocytic receptor 1b         145   9e-37   Nelumbo nucifera [Indian lotus]
ref|XP_003518365.2|  PREDICTED: putative phagocytic receptor 1b-l...    145   1e-36   Glycine max [soybeans]
ref|XP_006575472.1|  PREDICTED: putative phagocytic receptor 1b-l...    145   1e-36   Glycine max [soybeans]
ref|NP_001148367.1|  transmembrane 9 superfamily protein member 1...    144   2e-36   Zea mays [maize]
ref|XP_001699211.1|  EMP/nonaspanin domain family protein               144   2e-36   Chlamydomonas reinhardtii
ref|XP_003573450.1|  PREDICTED: putative phagocytic receptor 1b         144   2e-36   Brachypodium distachyon [annual false brome]
gb|AES99151.2|  transmembrane 9 family protein                          144   2e-36   Medicago truncatula
ref|XP_010528590.1|  PREDICTED: putative phagocytic receptor 1b         144   2e-36   Tarenaya hassleriana [spider flower]
dbj|BAJ89513.1|  predicted protein                                      144   2e-36   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMS60954.1|  Putative phagocytic receptor 1b                         144   2e-36   Triticum urartu
gb|EMT19161.1|  Putative phagocytic receptor 1b                         144   3e-36   
ref|XP_010523409.1|  PREDICTED: putative phagocytic receptor 1b         143   4e-36   Tarenaya hassleriana [spider flower]
ref|XP_010910473.1|  PREDICTED: transmembrane 9 superfamily membe...    143   4e-36   Elaeis guineensis
ref|NP_001064040.1|  Os10g0112600                                       143   4e-36   
ref|XP_008788644.1|  PREDICTED: putative phagocytic receptor 1b         143   4e-36   Phoenix dactylifera
ref|XP_010276746.1|  PREDICTED: putative phagocytic receptor 1b         143   5e-36   Nelumbo nucifera [Indian lotus]
ref|XP_009615620.1|  PREDICTED: putative phagocytic receptor 1b i...    143   5e-36   
ref|XP_006854108.1|  hypothetical protein AMTR_s00048p00146310          143   6e-36   
ref|XP_009615618.1|  PREDICTED: putative phagocytic receptor 1b i...    142   6e-36   
ref|XP_009615617.1|  PREDICTED: putative phagocytic receptor 1b i...    142   6e-36   Nicotiana tomentosiformis
ref|XP_009615619.1|  PREDICTED: putative phagocytic receptor 1b i...    142   7e-36   Nicotiana tomentosiformis
ref|XP_006659860.1|  PREDICTED: putative phagocytic receptor 1b-like    142   7e-36   Oryza brachyantha
dbj|BAC57816.1|  putative syntaxin SYP111                               142   8e-36   Oryza sativa Japonica Group [Japonica rice]
gb|EEC82941.1|  hypothetical protein OsI_27915                          142   8e-36   Oryza sativa Indica Group [Indian rice]
ref|XP_008813153.1|  PREDICTED: putative phagocytic receptor 1b         142   9e-36   Phoenix dactylifera
gb|KJB43178.1|  hypothetical protein B456_007G188200                    142   1e-35   Gossypium raimondii
ref|XP_004972769.1|  PREDICTED: putative phagocytic receptor 1b-l...    142   1e-35   Setaria italica
gb|ADQ43185.1|  endomemebrane protein 70                                142   1e-35   Schrenkiella parvula
ref|XP_009408099.1|  PREDICTED: putative phagocytic receptor 1b         142   1e-35   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006364083.1|  PREDICTED: putative phagocytic receptor 1b-like    142   1e-35   Solanum tuberosum [potatoes]
ref|XP_010920041.1|  PREDICTED: transmembrane 9 superfamily membe...    141   2e-35   
gb|KJB43179.1|  hypothetical protein B456_007G188200                    141   2e-35   Gossypium raimondii
ref|NP_198547.3|  putative endomembrane protein 70                      141   2e-35   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009784371.1|  PREDICTED: putative phagocytic receptor 1b i...    141   2e-35   Nicotiana sylvestris
ref|XP_009784372.1|  PREDICTED: putative phagocytic receptor 1b i...    141   2e-35   Nicotiana sylvestris
ref|XP_009784369.1|  PREDICTED: putative phagocytic receptor 1b i...    141   2e-35   Nicotiana sylvestris
ref|XP_009784373.1|  PREDICTED: putative phagocytic receptor 1b i...    140   2e-35   Nicotiana sylvestris
ref|XP_004972768.1|  PREDICTED: putative phagocytic receptor 1b-l...    142   3e-35   
ref|XP_006661606.1|  PREDICTED: putative phagocytic receptor 1b-like    140   3e-35   Oryza brachyantha
gb|EEC74833.1|  hypothetical protein OsI_10676                          144   3e-35   Oryza sativa Indica Group [Indian rice]
gb|ABK24901.1|  unknown                                                 140   5e-35   Picea sitchensis
gb|ABR16201.1|  unknown                                                 140   5e-35   Picea sitchensis
ref|XP_004490795.1|  PREDICTED: putative phagocytic receptor 1b-like    140   5e-35   Cicer arietinum [garbanzo]
gb|KHG20583.1|  Putative phagocytic receptor 1b                         139   9e-35   Gossypium arboreum [tree cotton]
ref|XP_010099693.1|  Putative phagocytic receptor 1b                    140   1e-34   
ref|XP_006849485.1|  hypothetical protein AMTR_s00024p00115620          138   2e-34   
ref|XP_002974646.1|  hypothetical protein SELMODRAFT_101645             138   3e-34   
ref|XP_002963357.1|  hypothetical protein SELMODRAFT_166118             138   3e-34   
ref|XP_001770691.1|  predicted protein                                  137   5e-34   
ref|XP_002956625.1|  hypothetical protein VOLCADRAFT_110022             137   5e-34   Volvox carteri f. nagariensis
ref|XP_001775546.1|  predicted protein                                  137   6e-34   
ref|XP_001689987.1|  EMP/nonaspanin domain family protein               137   6e-34   Chlamydomonas reinhardtii
ref|XP_010039016.1|  PREDICTED: putative phagocytic receptor 1b         137   1e-33   Eucalyptus grandis [rose gum]
ref|XP_002952428.1|  hypothetical protein VOLCADRAFT_75353              136   1e-33   Volvox carteri f. nagariensis
ref|XP_004228944.1|  PREDICTED: putative phagocytic receptor 1b         136   1e-33   Solanum lycopersicum
ref|XP_010037000.1|  PREDICTED: putative phagocytic receptor 1b         135   2e-33   Eucalyptus grandis [rose gum]
gb|EEE68090.1|  hypothetical protein OsJ_26137                          137   2e-33   Oryza sativa Japonica Group [Japonica rice]
gb|AAK52585.1|AC079685_16  Putative endosomal protein                   135   2e-33   Oryza sativa Japonica Group [Japonica rice]
gb|EEC66468.1|  hypothetical protein OsI_32547                          135   3e-33   Oryza sativa Indica Group [Indian rice]
ref|XP_005650801.1|  putative endosomal protein                         135   4e-33   Coccomyxa subellipsoidea C-169
ref|XP_009388099.1|  PREDICTED: putative phagocytic receptor 1b         135   4e-33   Musa acuminata subsp. malaccensis [pisang utan]
gb|KCW48636.1|  hypothetical protein EUGRSUZ_K02294                     132   2e-32   Eucalyptus grandis [rose gum]
ref|XP_003059958.1|  predicted protein                                  130   2e-31   Micromonas pusilla CCMP1545
ref|XP_009628018.1|  PREDICTED: putative phagocytic receptor 1b i...    129   3e-31   Nicotiana tomentosiformis
ref|XP_002317710.2|  hypothetical protein POPTR_0012s03920g             129   3e-31   
ref|XP_009628015.1|  PREDICTED: putative phagocytic receptor 1b i...    129   4e-31   Nicotiana tomentosiformis
ref|XP_005650990.1|  EMP/nonaspanin domain family protein               130   4e-31   Coccomyxa subellipsoidea C-169
ref|XP_006376703.1|  hypothetical protein POPTR_0012s03920g             129   5e-31   
ref|XP_010523530.1|  PREDICTED: putative phagocytic receptor 1b         125   9e-31   Tarenaya hassleriana [spider flower]
ref|XP_002973969.1|  hypothetical protein SELMODRAFT_173941             128   1e-30   Selaginella moellendorffii
ref|XP_002969094.1|  hypothetical protein SELMODRAFT_170330             128   1e-30   Selaginella moellendorffii
ref|XP_009782694.1|  PREDICTED: putative phagocytic receptor 1b i...    127   1e-30   Nicotiana sylvestris
ref|XP_009782678.1|  PREDICTED: putative phagocytic receptor 1b i...    127   1e-30   Nicotiana sylvestris
ref|XP_002505642.1|  predicted protein                                  126   3e-30   Micromonas commoda
ref|XP_011003771.1|  PREDICTED: transmembrane 9 superfamily membe...    126   3e-30   Populus euphratica
ref|XP_001755694.1|  predicted protein                                  126   4e-30   
ref|XP_011003770.1|  PREDICTED: transmembrane 9 superfamily membe...    126   4e-30   Populus euphratica
gb|KDD75073.1|  endomembrane protein 70                                 125   6e-30   Helicosporidium sp. ATCC 50920
ref|XP_006358745.1|  PREDICTED: putative phagocytic receptor 1b-like    126   6e-30   
ref|XP_005850808.1|  hypothetical protein CHLNCDRAFT_29709              125   1e-29   Chlorella variabilis
ref|XP_007512838.1|  predicted protein                                  126   1e-29   Bathycoccus prasinos
ref|XP_004240860.1|  PREDICTED: putative phagocytic receptor 1b i...    125   2e-29   
ref|XP_010322125.1|  PREDICTED: putative phagocytic receptor 1b i...    124   2e-29   
ref|XP_001783681.1|  predicted protein                                  123   6e-29   
gb|KDO37844.1|  hypothetical protein CISIN_1g034896mg                   114   9e-29   Citrus sinensis [apfelsine]
gb|EPS73381.1|  hypothetical protein M569_01372                         122   2e-28   Genlisea aurea
ref|XP_007045411.1|  Endomembrane protein 70 protein family isofo...    118   7e-28   
emb|CDP05443.1|  unnamed protein product                                120   1e-27   Coffea canephora [robusta coffee]
ref|XP_003616193.1|  Transmembrane 9 superfamily protein member         120   1e-27   
emb|CDP05446.1|  unnamed protein product                                119   2e-27   Coffea canephora [robusta coffee]
emb|CDP05453.1|  unnamed protein product                                119   2e-27   Coffea canephora [robusta coffee]
emb|CDP05450.1|  unnamed protein product                                114   2e-26   Coffea canephora [robusta coffee]
ref|XP_001422764.1|  predicted protein                                  117   2e-26   Ostreococcus lucimarinus CCE9901
emb|CEG02174.1|  Nonaspanin (TM9SF)                                     116   3e-26   Ostreococcus tauri
gb|KIY97757.1|  Putative phagocytic receptor 1b                         109   3e-26   Monoraphidium neglectum
ref|XP_006849484.1|  hypothetical protein AMTR_s00024p00115000          115   3e-26   Amborella trichopoda
ref|XP_010910475.1|  PREDICTED: transmembrane 9 superfamily membe...    115   3e-26   
ref|XP_011399711.1|  Putative phagocytic receptor 1b                    115   4e-26   Auxenochlorella protothecoides
ref|XP_009350847.1|  PREDICTED: putative phagocytic receptor 1b         114   2e-25   
ref|XP_008228600.1|  PREDICTED: putative phagocytic receptor 1b         114   2e-25   Prunus mume [ume]
ref|XP_009343744.1|  PREDICTED: putative phagocytic receptor 1b         113   2e-25   
ref|XP_004293072.1|  PREDICTED: transmembrane 9 superfamily member 5    113   3e-25   Fragaria vesca subsp. vesca
ref|XP_007208295.1|  hypothetical protein PRUPE_ppa003325mg             112   6e-25   
ref|XP_008382598.1|  PREDICTED: putative phagocytic receptor 1b         112   7e-25   
gb|EWM25418.1|  Nonaspanin (TM9SF)                                      110   1e-24   Nannochloropsis gaditana
ref|XP_003606114.1|  Transmembrane 9 superfamily member                 110   2e-24   Medicago truncatula
ref|XP_010105528.1|  Putative phagocytic receptor 1b                    110   3e-24   
ref|XP_003540797.1|  PREDICTED: putative phagocytic receptor 1b-like    110   3e-24   Glycine max [soybeans]
ref|XP_004506179.1|  PREDICTED: putative phagocytic receptor 1b-like    110   4e-24   Cicer arietinum [garbanzo]
gb|KJB55631.1|  hypothetical protein B456_009G086000                    108   9e-24   Gossypium raimondii
gb|KJB55630.1|  hypothetical protein B456_009G086000                    108   9e-24   Gossypium raimondii
gb|KDD73327.1|  hypothetical protein H632_c2295p0                       100   2e-23   Helicosporidium sp. ATCC 50920
emb|CBN73993.1|  conserved unknown protein                              107   4e-23   Ectocarpus siliculosus
ref|XP_005822074.1|  hypothetical protein GUITHDRAFT_166088             107   5e-23   Guillardia theta CCMP2712
gb|KHG11801.1|  Putative phagocytic receptor 1b                         106   6e-23   Gossypium arboreum [tree cotton]
ref|XP_011088889.1|  PREDICTED: transmembrane 9 superfamily membe...    104   7e-23   
ref|XP_006448059.1|  hypothetical protein CICLE_v10017699mg             104   8e-23   
ref|XP_007015826.1|  Endomembrane protein 70 protein family isofo...    105   1e-22   
ref|XP_007015827.1|  Endomembrane protein 70 protein family isofo...    105   1e-22   
gb|KDP33127.1|  hypothetical protein JCGZ_13574                         105   1e-22   
ref|XP_002274254.1|  PREDICTED: transmembrane 9 superfamily member 5    105   2e-22   
ref|NP_563812.1|  endomembrane protein 70                               104   2e-22   
emb|CBI28324.3|  unnamed protein product                                105   2e-22   
ref|XP_010066535.1|  PREDICTED: putative phagocytic receptor 1b i...    104   2e-22   
ref|NP_001077489.1|  endomembrane protein 70                            105   3e-22   
gb|AAK74038.1|  At1g08350/T27G7_4                                       104   3e-22   
ref|XP_011088888.1|  PREDICTED: transmembrane 9 superfamily membe...    104   3e-22   
ref|XP_011088887.1|  PREDICTED: transmembrane 9 superfamily membe...    104   3e-22   
gb|KCW64445.1|  hypothetical protein EUGRSUZ_G02063                     104   3e-22   
gb|KDO36860.1|  hypothetical protein CISIN_1g029473mg                   100   4e-22   
ref|XP_009043049.1|  hypothetical protein AURANDRAFT_39530              102   4e-22   
ref|XP_010066531.1|  PREDICTED: putative phagocytic receptor 1b i...    104   4e-22   
ref|XP_010271661.1|  PREDICTED: putative phagocytic receptor 1b         104   4e-22   
gb|KGN64925.1|  hypothetical protein Csa_1G162610                       102   5e-22   
ref|XP_007132435.1|  hypothetical protein PHAVU_011G094100g             103   5e-22   
ref|XP_002892454.1|  endomembrane protein 70 family protein             103   8e-22   
ref|XP_004159113.1|  PREDICTED: putative phagocytic receptor 1b-like    101   9e-22   
ref|XP_011007160.1|  PREDICTED: transmembrane 9 superfamily member 5    103   1e-21   
ref|XP_002906883.1|  endomembrane protein 70-like protein, putative     103   1e-21   
ref|XP_010475630.1|  PREDICTED: putative phagocytic receptor 1b i...    102   1e-21   
ref|XP_008898687.1|  hypothetical protein PPTG_06513                    103   1e-21   
gb|ETM31493.1|  hypothetical protein L914_20950                         102   1e-21   
gb|ETL25017.1|  hypothetical protein L916_21077                         102   1e-21   
emb|CDP05442.1|  unnamed protein product                                101   1e-21   
ref|XP_010475629.1|  PREDICTED: putative phagocytic receptor 1b i...    102   1e-21   
ref|XP_006384818.1|  hypothetical protein POPTR_0004s21340g             102   1e-21   
gb|ETL78232.1|  hypothetical protein L917_20933                         102   2e-21   
ref|XP_010475626.1|  PREDICTED: putative phagocytic receptor 1b i...    102   2e-21   
ref|XP_006417702.1|  hypothetical protein EUTSA_v10007170mg             102   2e-21   
ref|XP_004139482.1|  PREDICTED: putative phagocytic receptor 1b-like    102   2e-21   
gb|KDO58074.1|  hypothetical protein CISIN_1g036992mg                   101   3e-21   
ref|XP_006424246.1|  hypothetical protein CICLE_v10028069mg             102   3e-21   
ref|XP_009041654.1|  hypothetical protein AURANDRAFT_55500              102   3e-21   
ref|XP_006307081.1|  hypothetical protein CARUB_v10008667mg             101   3e-21   
ref|XP_006487944.1|  PREDICTED: putative phagocytic receptor 1b-l...    100   6e-21   
ref|XP_005824782.1|  hypothetical protein GUITHDRAFT_158562             100   6e-21   
ref|XP_006487943.1|  PREDICTED: putative phagocytic receptor 1b-l...    100   6e-21   
emb|CAN67239.1|  hypothetical protein VITISV_004804                     101   7e-21   
gb|EYU26707.1|  hypothetical protein MIMGU_mgv1a002565mg                100   8e-21   
emb|CDX95066.1|  BnaC05g06050D                                          100   9e-21   
ref|XP_009516022.1|  hypothetical protein PHYSODRAFT_552451             100   1e-20   
ref|XP_010488760.1|  PREDICTED: putative phagocytic receptor 1b i...  99.4    1e-20   
ref|XP_008461519.1|  PREDICTED: putative phagocytic receptor 1b i...  99.4    1e-20   
ref|XP_008461493.1|  PREDICTED: putative phagocytic receptor 1b i...  99.8    2e-20   
ref|XP_008461510.1|  PREDICTED: putative phagocytic receptor 1b i...  99.4    2e-20   
ref|XP_010488740.1|  PREDICTED: putative phagocytic receptor 1b i...  99.4    2e-20   
ref|XP_008461501.1|  PREDICTED: putative phagocytic receptor 1b i...  99.0    2e-20   
gb|EJK56326.1|  hypothetical protein THAOC_23816                        100   3e-20   
ref|XP_006361076.1|  PREDICTED: putative phagocytic receptor 1b-like  99.0    3e-20   
ref|XP_004241321.1|  PREDICTED: putative phagocytic receptor 1b i...  99.0    3e-20   
ref|XP_010089827.1|  Putative phagocytic receptor 1b                  99.0    3e-20   
emb|CDP06928.1|  unnamed protein product                              98.6    4e-20   
ref|XP_010271660.1|  PREDICTED: putative phagocytic receptor 1b       97.4    9e-20   
ref|XP_009148094.1|  PREDICTED: putative phagocytic receptor 1b i...  97.4    1e-19   
ref|XP_009148093.1|  PREDICTED: putative phagocytic receptor 1b i...  97.4    1e-19   
ref|XP_002167759.2|  PREDICTED: transmembrane 9 superfamily membe...  97.4    1e-19   
ref|XP_009779343.1|  PREDICTED: putative phagocytic receptor 1b       96.7    2e-19   
ref|XP_008617593.1|  hypothetical protein SDRG_13291                  96.7    2e-19   
ref|XP_009592973.1|  PREDICTED: putative phagocytic receptor 1b       96.3    2e-19   
gb|ELT97180.1|  hypothetical protein CAPTEDRAFT_172435                95.5    3e-19   
emb|CDX93569.1|  BnaA06g04790D                                        95.5    4e-19   
ref|XP_004341571.1|  Endomembrane protein 70 subfamily                95.5    5e-19   
gb|KDO18538.1|  hypothetical protein SPRG_16087                       95.5    5e-19   
gb|KDO24186.1|  hypothetical protein SPRG_10614                       95.5    5e-19   
ref|XP_009831493.1|  hypothetical protein H257_07606                  95.1    6e-19   
ref|XP_008878196.1|  hypothetical protein, variant                    95.1    7e-19   
ref|XP_008878197.1|  hypothetical protein H310_12781                  95.1    8e-19   
dbj|GAM27660.1|  hypothetical protein SAMD00019534_108360             94.0    1e-18   
ref|XP_004363702.2|  transmembrane 9 superfamily member 1             94.0    2e-18   
ref|XP_010521657.1|  PREDICTED: putative phagocytic receptor 1b i...  93.6    2e-18   
ref|XP_010521658.1|  PREDICTED: putative phagocytic receptor 1b i...  93.6    2e-18   
ref|XP_005109383.1|  PREDICTED: transmembrane 9 superfamily membe...  93.6    3e-18   
emb|CDY09399.1|  BnaA02g26110D                                        87.4    3e-18   
ref|XP_004698552.1|  PREDICTED: transmembrane 9 superfamily member 1  93.6    4e-18   
ref|XP_003083100.1|  putative syntaxin SYP111 (ISS)                   92.4    4e-18   
ref|XP_004997982.1|  transmembrane 9 superfamily member 1             92.4    5e-18   
ref|XP_002181450.1|  predicted protein                                92.4    5e-18   
ref|XP_007536361.1|  PREDICTED: transmembrane 9 superfamily membe...  92.0    1e-17   
ref|XP_001638325.1|  predicted protein                                90.1    2e-17   
ref|XP_002678482.1|  predicted protein                                85.9    2e-17   
ref|XP_004584775.1|  PREDICTED: transmembrane 9 superfamily member 1  91.7    2e-17   
ref|XP_006835458.1|  PREDICTED: charged multivesicular body prote...  91.7    2e-17   
ref|XP_004609499.1|  PREDICTED: transmembrane 9 superfamily membe...  91.7    2e-17   
ref|XP_010598840.1|  PREDICTED: transmembrane 9 superfamily membe...  91.7    2e-17   
ref|XP_008267651.1|  PREDICTED: transmembrane 9 superfamily membe...  91.7    2e-17   
ref|XP_003802004.1|  PREDICTED: transmembrane 9 superfamily member 1  91.3    2e-17   
ref|XP_006217338.1|  PREDICTED: charged multivesicular body prote...  91.3    2e-17   
gb|ETO29447.1|  EMP/nonaspanin domain family protein                  88.2    2e-17   
gb|EFX74144.1|  hypothetical protein DAPPUDRAFT_324641                90.9    2e-17   
ref|XP_006172880.1|  PREDICTED: charged multivesicular body prote...  91.3    2e-17   
dbj|BAH13215.1|  unnamed protein product                              91.3    2e-17   
ref|XP_006883243.1|  PREDICTED: transmembrane 9 superfamily membe...  91.3    2e-17   
ref|XP_004694659.1|  PREDICTED: transmembrane 9 superfamily member 1  90.9    2e-17   
ref|XP_010994078.1|  PREDICTED: LOW QUALITY PROTEIN: transmembran...  90.9    3e-17   
ref|XP_004463432.1|  PREDICTED: transmembrane 9 superfamily membe...  90.9    3e-17   
ref|XP_003385405.1|  PREDICTED: transmembrane 9 superfamily membe...  90.1    3e-17   
emb|CCI39563.1|  unnamed protein product                              89.7    4e-17   
emb|CCI39562.1|  unnamed protein product                              89.7    4e-17   
ref|XP_002667966.1|  syntaxin SYP111                                  86.7    4e-17   
ref|XP_007444445.1|  PREDICTED: transmembrane 9 superfamily member 1  89.4    5e-17   
ref|XP_006036573.1|  PREDICTED: transmembrane 9 superfamily membe...  89.4    5e-17   
ref|XP_006259786.1|  PREDICTED: transmembrane 9 superfamily member 1  89.4    6e-17   
ref|XP_009052622.1|  hypothetical protein LOTGIDRAFT_174735           89.0    6e-17   
ref|NP_001121353.1|  transmembrane 9 superfamily member 1             89.0    8e-17   
ref|XP_005685277.1|  PREDICTED: transmembrane 9 superfamily membe...  89.0    8e-17   
ref|XP_005985428.1|  PREDICTED: transmembrane 9 superfamily member 1  89.0    8e-17   
ref|XP_002939067.1|  PREDICTED: transmembrane 9 superfamily membe...  89.0    9e-17   
ref|XP_009024297.1|  hypothetical protein HELRODRAFT_157541           89.0    9e-17   
emb|CBY36864.1|  unnamed protein product                              88.2    1e-16   
emb|CCA19624.1|  endomembrane protein 70like protein putative         88.2    1e-16   
emb|CBY22138.1|  unnamed protein product                              88.2    1e-16   
ref|XP_010686010.1|  PREDICTED: transmembrane 9 superfamily membe...  87.8    1e-16   
ref|XP_005290178.1|  PREDICTED: transmembrane 9 superfamily member 1  87.8    1e-16   
ref|XP_010686009.1|  PREDICTED: transmembrane 9 superfamily membe...  88.2    1e-16   
ref|XP_007065454.1|  PREDICTED: transmembrane 9 superfamily member 1  87.8    2e-16   
gb|ETO15621.1|  hypothetical protein RFI_21749                        87.8    2e-16   
ref|XP_010779259.1|  PREDICTED: transmembrane 9 superfamily member 1  88.2    2e-16   
ref|XP_642757.1|  TM9 protein B                                       86.7    2e-16   
ref|XP_642756.1|  TM9 protein B                                       87.4    2e-16   
emb|CAD47840.1|  putative phagocytic receptor 1b                      87.4    2e-16   
gb|AAQ95660.1|  Phg1B                                                 87.4    3e-16   
ref|XP_008067922.1|  PREDICTED: transmembrane 9 superfamily member 1  87.4    3e-16   
ref|XP_007548006.1|  PREDICTED: transmembrane 9 superfamily member 1  87.0    3e-16   
ref|XP_005904977.1|  PREDICTED: transmembrane 9 superfamily member 1  87.0    3e-16   
ref|XP_008436895.1|  PREDICTED: transmembrane 9 superfamily member 1  87.0    3e-16   
ref|XP_003226712.1|  PREDICTED: transmembrane 9 superfamily member 1  87.0    3e-16   
ref|XP_005803703.1|  PREDICTED: transmembrane 9 superfamily membe...  87.0    4e-16   
gb|EAW66074.1|  transmembrane 9 superfamily member 1, isoform CRA_b   86.3    4e-16   
ref|XP_004609500.1|  PREDICTED: transmembrane 9 superfamily membe...  87.0    4e-16   
ref|XP_004463434.1|  PREDICTED: transmembrane 9 superfamily membe...  86.7    5e-16   
ref|XP_003726766.1|  PREDICTED: transmembrane 9 superfamily membe...  84.0    5e-16   
ref|XP_007984500.1|  PREDICTED: transmembrane 9 superfamily membe...  86.3    5e-16   
ref|XP_004055038.1|  PREDICTED: transmembrane 9 superfamily membe...  86.3    5e-16   
ref|NP_001275935.1|  transmembrane 9 superfamily member 1 isoform c   86.3    5e-16   
dbj|BAG65421.1|  unnamed protein product                              86.3    5e-16   
ref|XP_006739630.1|  PREDICTED: transmembrane 9 superfamily membe...  86.3    5e-16   
ref|XP_004421248.1|  PREDICTED: transmembrane 9 superfamily membe...  86.3    5e-16   
ref|XP_008959494.1|  PREDICTED: transmembrane 9 superfamily membe...  86.3    5e-16   
ref|XP_006835460.1|  PREDICTED: charged multivesicular body prote...  86.3    5e-16   
ref|XP_007130113.1|  PREDICTED: transmembrane 9 superfamily membe...  86.7    5e-16   
ref|XP_006883245.1|  PREDICTED: transmembrane 9 superfamily membe...  86.3    5e-16   
gb|AAH07187.1|  Tm9sf1 protein                                        86.3    5e-16   
ref|XP_007130114.1|  PREDICTED: transmembrane 9 superfamily membe...  86.7    5e-16   
ref|XP_006913615.1|  PREDICTED: transmembrane 9 superfamily member 1  86.7    6e-16   
ref|XP_005211436.1|  PREDICTED: transmembrane 9 superfamily membe...  86.3    6e-16   
ref|NP_001077212.1|  transmembrane 9 superfamily member 1 precursor   86.3    6e-16   
ref|XP_006043348.1|  PREDICTED: transmembrane 9 superfamily member 1  86.3    6e-16   
ref|XP_004463433.1|  PREDICTED: transmembrane 9 superfamily membe...  86.3    6e-16   
ref|XP_004390569.1|  PREDICTED: transmembrane 9 superfamily member 1  86.3    6e-16   
ref|XP_007947408.1|  PREDICTED: transmembrane 9 superfamily membe...  85.9    6e-16   
ref|XP_007180676.1|  PREDICTED: transmembrane 9 superfamily membe...  86.3    6e-16   
ref|XP_004283185.1|  PREDICTED: transmembrane 9 superfamily member 1  86.3    6e-16   
ref|XP_537385.2|  PREDICTED: transmembrane 9 superfamily member 1...  86.3    6e-16   
gb|AAC51782.1|  multispanning membrane protein                        86.3    7e-16   
ref|XP_003474483.1|  PREDICTED: transmembrane 9 superfamily membe...  86.3    7e-16   
ref|XP_004755298.1|  PREDICTED: transmembrane 9 superfamily membe...  86.3    7e-16   
ref|XP_004402105.1|  PREDICTED: transmembrane 9 superfamily membe...  86.3    7e-16   
ref|XP_006779604.1|  PREDICTED: LOW QUALITY PROTEIN: transmembran...  85.9    7e-16   
ref|XP_002921119.1|  PREDICTED: transmembrane 9 superfamily member 1  86.3    7e-16   
ref|XP_006739629.1|  PREDICTED: transmembrane 9 superfamily membe...  86.3    7e-16   
ref|XP_005338783.1|  PREDICTED: transmembrane 9 superfamily membe...  86.3    7e-16   
ref|XP_008707016.1|  PREDICTED: transmembrane 9 superfamily member 1  86.3    7e-16   
ref|XP_005085662.1|  PREDICTED: transmembrane 9 superfamily member 1  86.3    7e-16   
ref|NP_001267415.1|  transmembrane 9 superfamily member 1 precursor   86.3    7e-16   
ref|XP_007984497.1|  PREDICTED: transmembrane 9 superfamily membe...  86.3    7e-16   
ref|XP_007098088.1|  PREDICTED: transmembrane 9 superfamily membe...  86.3    7e-16   
ref|XP_011281457.1|  PREDICTED: transmembrane 9 superfamily member 1  86.3    7e-16   
ref|NP_006396.2|  transmembrane 9 superfamily member 1 isoform a ...  86.3    7e-16   
ref|XP_003260724.1|  PREDICTED: transmembrane 9 superfamily member 1  86.3    7e-16   
dbj|BAF84799.1|  unnamed protein product                              86.3    7e-16   
ref|XP_009004051.1|  PREDICTED: transmembrane 9 superfamily member 1  86.3    7e-16   
ref|XP_004421247.1|  PREDICTED: transmembrane 9 superfamily membe...  86.3    7e-16   
ref|XP_004055037.1|  PREDICTED: transmembrane 9 superfamily membe...  86.3    7e-16   
ref|XP_003502106.1|  PREDICTED: transmembrane 9 superfamily member 1  86.3    7e-16   
ref|XP_007130112.1|  PREDICTED: transmembrane 9 superfamily membe...  86.3    7e-16   
ref|NP_001253390.1|  transmembrane 9 superfamily member 1 precursor   86.3    7e-16   
ref|XP_005370493.1|  PREDICTED: transmembrane 9 superfamily membe...  86.3    7e-16   
ref|XP_006988599.1|  PREDICTED: transmembrane 9 superfamily membe...  86.3    8e-16   
ref|XP_005377087.1|  PREDICTED: transmembrane 9 superfamily member 1  86.3    8e-16   
ref|XP_003421009.1|  PREDICTED: transmembrane 9 superfamily membe...  86.3    8e-16   
ref|XP_001490063.1|  PREDICTED: transmembrane 9 superfamily member 1  86.3    8e-16   
ref|XP_004402104.1|  PREDICTED: transmembrane 9 superfamily membe...  86.3    8e-16   
ref|XP_004885399.1|  PREDICTED: transmembrane 9 superfamily membe...  86.3    8e-16   
ref|NP_083056.2|  transmembrane 9 superfamily member 1 precursor      86.3    8e-16   
ref|XP_004647518.1|  PREDICTED: transmembrane 9 superfamily member 1  86.3    8e-16   
emb|CDQ70386.1|  unnamed protein product                              85.9    8e-16   
ref|NP_001126136.1|  transmembrane 9 superfamily member 1 precursor   85.9    8e-16   
ref|XP_007180675.1|  PREDICTED: transmembrane 9 superfamily membe...  86.3    8e-16   
gb|ERE89416.1|  transmembrane 9 superfamily member 1 isoform 2        85.9    8e-16   
ref|XP_008838041.1|  PREDICTED: transmembrane 9 superfamily member 1  85.9    8e-16   
ref|XP_002718144.1|  PREDICTED: transmembrane 9 superfamily membe...  85.9    8e-16   
ref|XP_001380199.1|  PREDICTED: transmembrane 9 superfamily membe...  85.9    8e-16   
ref|XP_006144613.1|  PREDICTED: transmembrane 9 superfamily membe...  85.9    8e-16   
ref|XP_005859645.1|  PREDICTED: transmembrane 9 superfamily membe...  85.9    9e-16   
ref|XP_006102307.1|  PREDICTED: transmembrane 9 superfamily membe...  85.9    9e-16   
ref|XP_005005680.1|  PREDICTED: transmembrane 9 superfamily membe...  86.3    9e-16   
ref|XP_008156681.1|  PREDICTED: transmembrane 9 superfamily membe...  85.9    9e-16   
ref|XP_008156682.1|  PREDICTED: transmembrane 9 superfamily membe...  85.9    9e-16   
ref|XP_006883244.1|  PREDICTED: transmembrane 9 superfamily membe...  85.9    9e-16   
ref|XP_003294418.1|  hypothetical protein DICPUDRAFT_59030            85.9    9e-16   
gb|AAF98161.1|AF269152_1  transmembrane protein TM9SF1                85.9    9e-16   
ref|XP_006252052.1|  PREDICTED: transmembrane 9 superfamily membe...  85.9    1e-15   
gb|KHN38633.1|  Putative phagocytic receptor 1b                       84.3    1e-15   
ref|XP_007947407.1|  PREDICTED: transmembrane 9 superfamily membe...  85.9    1e-15   
ref|NP_001012155.1|  transmembrane 9 superfamily member 1 precursor   85.9    1e-15   
ref|XP_010636002.1|  PREDICTED: transmembrane 9 superfamily member 1  85.9    1e-15   
ref|XP_010953065.1|  PREDICTED: transmembrane 9 superfamily membe...  85.9    1e-15   
ref|XP_003755940.1|  PREDICTED: transmembrane 9 superfamily member 1  85.9    1e-15   
ref|XP_010953066.1|  PREDICTED: transmembrane 9 superfamily membe...  85.9    1e-15   
ref|XP_008276179.1|  PREDICTED: transmembrane 9 superfamily member 1  85.9    1e-15   
emb|CBN81815.1|  Transmembrane 9 superfamily member 1                 85.5    1e-15   
ref|XP_008570550.1|  PREDICTED: transmembrane 9 superfamily member 1  85.5    1e-15   
ref|XP_010739918.1|  PREDICTED: transmembrane 9 superfamily membe...  85.1    1e-15   
ref|XP_010045209.1|  PREDICTED: putative phagocytic receptor 1b       85.5    1e-15   
ref|XP_002679380.1|  endomembrane protein 70                          85.5    1e-15   
ref|XP_007447942.1|  PREDICTED: transmembrane 9 superfamily membe...  85.5    1e-15   



>gb|EYU30892.1| hypothetical protein MIMGU_mgv1a003326mg [Erythranthe guttata]
Length=592

 Score =   155 bits (393),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 82/84 (98%), Positives = 83/84 (99%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDH+WWWRSFLCGGSTGLFIY YCLYYYYARSDMSGFMQTSFFFGYMACVCYAFFL
Sbjct  509  QLAAEDHEWWWRSFLCGGSTGLFIYSYCLYYYYARSDMSGFMQTSFFFGYMACVCYAFFL  568

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLGAVGFRAALFFVRHIYRSIKCE
Sbjct  569  MLGAVGFRAALFFVRHIYRSIKCE  592



>ref|XP_011099916.1| PREDICTED: transmembrane 9 superfamily member 3 [Sesamum indicum]
 ref|XP_011099917.1| PREDICTED: transmembrane 9 superfamily member 3 [Sesamum indicum]
 ref|XP_011099918.1| PREDICTED: transmembrane 9 superfamily member 3 [Sesamum indicum]
 ref|XP_011099919.1| PREDICTED: transmembrane 9 superfamily member 3 [Sesamum indicum]
Length=592

 Score =   155 bits (392),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 83/84 (99%), Positives = 84/84 (100%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDH+WWWRSFLCGGSTGLFIYGYCLYYYYARSDMSGFMQTSFFFGYMACVCYAFFL
Sbjct  509  QLAAEDHEWWWRSFLCGGSTGLFIYGYCLYYYYARSDMSGFMQTSFFFGYMACVCYAFFL  568

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLGAVGFRAALFFVRHIYRSIKCE
Sbjct  569  MLGAVGFRAALFFVRHIYRSIKCE  592



>gb|ABR25749.1| transmembrane 9 superfamily protein member 1 [Oryza sativa Indica 
Group]
Length=109

 Score =   145 bits (365),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 77/84 (92%), Positives = 82/84 (98%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDH+WWWRSFLCGGSTG F+YGYCLYYYYARSDMSGFMQTSFFFGYMAC+CYAFFL
Sbjct  26   QLAAEDHEWWWRSFLCGGSTGFFVYGYCLYYYYARSDMSGFMQTSFFFGYMACICYAFFL  85

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG +GFRAALFFVRHIY+SIKCE
Sbjct  86   MLGMIGFRAALFFVRHIYKSIKCE  109



>emb|CDP01680.1| unnamed protein product [Coffea canephora]
Length=594

 Score =   154 bits (390),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 82/84 (98%), Positives = 83/84 (99%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDH+WWWRSFLCGGSTGLFIYGYCLYYYYARSDMSGFMQTSFFFGYMACVCYAFFL
Sbjct  511  QLAAEDHEWWWRSFLCGGSTGLFIYGYCLYYYYARSDMSGFMQTSFFFGYMACVCYAFFL  570

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG VGFRAALFFVRHIYRSIKCE
Sbjct  571  MLGTVGFRAALFFVRHIYRSIKCE  594



>gb|AAF01248.1|AF187853_1 putative multispanning membrane protein [Populus tremula x Populus 
alba]
Length=104

 Score =   144 bits (363),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 77/84 (92%), Positives = 82/84 (98%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDH+WWWRSFLCGGSTGLFIYGYCLYYY+ARSDMSGFMQTSFFFGYMACVCY FFL
Sbjct  21   QLAAEDHEWWWRSFLCGGSTGLFIYGYCLYYYFARSDMSGFMQTSFFFGYMACVCYGFFL  80

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG++GFRA+LFFVRHIY SIKCE
Sbjct  81   MLGSIGFRASLFFVRHIYHSIKCE  104



>dbj|BAD94118.1| putative endosomal protein [Arabidopsis thaliana]
Length=124

 Score =   144 bits (363),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 78/84 (93%), Positives = 80/84 (95%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDH+WWWRSFLCGGSTGLFIY YCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFL
Sbjct  41   QLAAEDHEWWWRSFLCGGSTGLFIYAYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFL  100

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG VGFRAAL FVRHIYRSIKCE
Sbjct  101  MLGTVGFRAALLFVRHIYRSIKCE  124



>ref|XP_009785097.1| PREDICTED: putative phagocytic receptor 1b [Nicotiana sylvestris]
Length=596

 Score =   153 bits (387),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 81/84 (96%), Positives = 83/84 (99%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDH+WWWRSFLCGGSTGLFIYGYCLYYYYARSDMSGFMQTSFFFGYMAC+CYAFFL
Sbjct  513  QLAAEDHEWWWRSFLCGGSTGLFIYGYCLYYYYARSDMSGFMQTSFFFGYMACICYAFFL  572

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG VGFRAALFFVRHIYRSIKCE
Sbjct  573  MLGTVGFRAALFFVRHIYRSIKCE  596



>ref|XP_009631354.1| PREDICTED: putative phagocytic receptor 1b [Nicotiana tomentosiformis]
 ref|XP_009631355.1| PREDICTED: putative phagocytic receptor 1b [Nicotiana tomentosiformis]
Length=596

 Score =   153 bits (387),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 81/84 (96%), Positives = 83/84 (99%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDH+WWWRSFLCGGSTGLFIYGYCLYYYYARSDMSGFMQTSFFFGYMAC+CYAFFL
Sbjct  513  QLAAEDHEWWWRSFLCGGSTGLFIYGYCLYYYYARSDMSGFMQTSFFFGYMACICYAFFL  572

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG VGFRAALFFVRHIYRSIKCE
Sbjct  573  MLGTVGFRAALFFVRHIYRSIKCE  596



>gb|ACF74283.1| putative endosomal protein [Arachis hypogaea]
Length=86

 Score =   142 bits (359),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 78/84 (93%), Positives = 82/84 (98%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDH+WWWRSFLCGGSTGLFIYGYCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFL
Sbjct  3    QLAAEDHEWWWRSFLCGGSTGLFIYGYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFL  62

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG+VGFRA+L FVRHIYRSIKCE
Sbjct  63   MLGSVGFRASLLFVRHIYRSIKCE  86



>emb|CDP01681.1| unnamed protein product [Coffea canephora]
Length=595

 Score =   152 bits (385),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 81/84 (96%), Positives = 82/84 (98%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDH+WWWRSFLCGGSTGLFIYGYCLYYYYARSDMSGFMQTSFFFGYMACVCY FFL
Sbjct  512  QLAAEDHEWWWRSFLCGGSTGLFIYGYCLYYYYARSDMSGFMQTSFFFGYMACVCYGFFL  571

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG VGFRAALFFVRHIYRSIKCE
Sbjct  572  MLGTVGFRAALFFVRHIYRSIKCE  595



>ref|XP_006352389.1| PREDICTED: putative phagocytic receptor 1b-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006352390.1| PREDICTED: putative phagocytic receptor 1b-like isoform X2 [Solanum 
tuberosum]
Length=596

 Score =   152 bits (384),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 80/84 (95%), Positives = 83/84 (99%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDH+WWWRSF+CGGSTGLFIYGYCLYYYYARSDMSGFMQTSFFFGYMAC+CYAFFL
Sbjct  513  QLAAEDHEWWWRSFVCGGSTGLFIYGYCLYYYYARSDMSGFMQTSFFFGYMACICYAFFL  572

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG VGFRAALFFVRHIYRSIKCE
Sbjct  573  MLGTVGFRAALFFVRHIYRSIKCE  596



>ref|XP_004250237.1| PREDICTED: putative phagocytic receptor 1b [Solanum lycopersicum]
 ref|XP_010312729.1| PREDICTED: putative phagocytic receptor 1b [Solanum lycopersicum]
Length=596

 Score =   152 bits (384),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 80/84 (95%), Positives = 83/84 (99%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDH+WWWRSF+CGGSTGLFIYGYCLYYYYARSDMSGFMQTSFFFGYMAC+CYAFFL
Sbjct  513  QLAAEDHEWWWRSFVCGGSTGLFIYGYCLYYYYARSDMSGFMQTSFFFGYMACICYAFFL  572

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG VGFRAALFFVRHIYRSIKCE
Sbjct  573  MLGTVGFRAALFFVRHIYRSIKCE  596



>dbj|BAH20237.1| AT2G01970 [Arabidopsis thaliana]
Length=311

 Score =   148 bits (373),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 78/84 (93%), Positives = 80/84 (95%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDH+WWWRSFLCGGSTGLFIY YCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFL
Sbjct  228  QLAAEDHEWWWRSFLCGGSTGLFIYAYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFL  287

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG VGFRAAL FVRHIYRSIKCE
Sbjct  288  MLGTVGFRAALLFVRHIYRSIKCE  311



>ref|XP_006372422.1| endomembrane protein 70 [Populus trichocarpa]
 gb|ERP50219.1| endomembrane protein 70 [Populus trichocarpa]
Length=592

 Score =   152 bits (383),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 79/84 (94%), Positives = 83/84 (99%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDH+WWWRSFLCGGSTGLFIYGYCLYYYYARSDMSGFMQTSFFFGYMACVCY FFL
Sbjct  509  QLAAEDHEWWWRSFLCGGSTGLFIYGYCLYYYYARSDMSGFMQTSFFFGYMACVCYGFFL  568

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG++GFRA+LFFVRHIYRSIKCE
Sbjct  569  MLGSIGFRASLFFVRHIYRSIKCE  592



>ref|XP_011038406.1| PREDICTED: transmembrane 9 superfamily member 3-like [Populus 
euphratica]
Length=592

 Score =   152 bits (383),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 79/84 (94%), Positives = 83/84 (99%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDH+WWWRSFLCGGSTGLFIYGYCLYYYYARSDMSGFMQTSFFFGYMACVCY FFL
Sbjct  509  QLAAEDHEWWWRSFLCGGSTGLFIYGYCLYYYYARSDMSGFMQTSFFFGYMACVCYGFFL  568

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG++GFRA+LFFVRHIYRSIKCE
Sbjct  569  MLGSIGFRASLFFVRHIYRSIKCE  592



>ref|XP_006372421.1| hypothetical protein POPTR_0017s01480g [Populus trichocarpa]
 gb|ERP50218.1| hypothetical protein POPTR_0017s01480g [Populus trichocarpa]
Length=592

 Score =   152 bits (383),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 79/84 (94%), Positives = 83/84 (99%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDH+WWWRSFLCGGSTGLFIYGYCLYYYYARSDMSGFMQTSFFFGYMACVCY FFL
Sbjct  509  QLAAEDHEWWWRSFLCGGSTGLFIYGYCLYYYYARSDMSGFMQTSFFFGYMACVCYGFFL  568

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG++GFRA+LFFVRHIYRSIKCE
Sbjct  569  MLGSIGFRASLFFVRHIYRSIKCE  592



>ref|XP_010036999.1| PREDICTED: putative phagocytic receptor 1b [Eucalyptus grandis]
 gb|KCW48635.1| hypothetical protein EUGRSUZ_K02293 [Eucalyptus grandis]
Length=592

 Score =   152 bits (383),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 79/84 (94%), Positives = 81/84 (96%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDHKWWWRSFLCGGSTGLFIYGYCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFL
Sbjct  509  QLAAEDHKWWWRSFLCGGSTGLFIYGYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFL  568

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG VGFRAAL F+RHIYRSIKCE
Sbjct  569  MLGTVGFRAALLFIRHIYRSIKCE  592



>gb|KHG03505.1| Putative phagocytic receptor 1b [Gossypium arboreum]
Length=592

 Score =   151 bits (382),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 77/84 (92%), Positives = 81/84 (96%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDH+WWWRSFLCGGSTGLFIY YCLYYY ARSDMSGFMQTSFFFGYMAC+CY FFL
Sbjct  509  QLAAEDHEWWWRSFLCGGSTGLFIYAYCLYYYNARSDMSGFMQTSFFFGYMACICYGFFL  568

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLGA+GFRA+LFFVRHIYRSIKCE
Sbjct  569  MLGAIGFRASLFFVRHIYRSIKCE  592



>gb|KJB15314.1| hypothetical protein B456_002G170500 [Gossypium raimondii]
Length=281

 Score =   147 bits (370),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 77/84 (92%), Positives = 81/84 (96%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDH+WWWRSFLCGGSTGLFIY YCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFL
Sbjct  198  QLAAEDHEWWWRSFLCGGSTGLFIYAYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFL  257

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            +LG VGFRA+LFFVRHIYRSIKCE
Sbjct  258  LLGTVGFRASLFFVRHIYRSIKCE  281



>gb|EYU30878.1| hypothetical protein MIMGU_mgv1a003324mg [Erythranthe guttata]
 gb|EYU30879.1| hypothetical protein MIMGU_mgv1a003324mg [Erythranthe guttata]
Length=592

 Score =   151 bits (382),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 81/84 (96%), Positives = 83/84 (99%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDH+WWWRSFLCGGSTGLFIYGYCLYYYYARSDMSGFMQTSFFFGYMA VCYAFFL
Sbjct  509  QLAAEDHEWWWRSFLCGGSTGLFIYGYCLYYYYARSDMSGFMQTSFFFGYMASVCYAFFL  568

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLGAVGFRA+LFFVRHIYRSIKCE
Sbjct  569  MLGAVGFRASLFFVRHIYRSIKCE  592



>ref|XP_011038404.1| PREDICTED: transmembrane 9 superfamily member 4 [Populus euphratica]
 ref|XP_011038405.1| PREDICTED: transmembrane 9 superfamily member 4 [Populus euphratica]
Length=592

 Score =   151 bits (382),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 79/84 (94%), Positives = 82/84 (98%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDH+WWWRSFLCGGSTGLFIYGYCLYYYYARSDMSGFMQTSFFFGYMACVCY FFL
Sbjct  509  QLAAEDHEWWWRSFLCGGSTGLFIYGYCLYYYYARSDMSGFMQTSFFFGYMACVCYGFFL  568

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG +GFRA+LFFVRHIYRSIKCE
Sbjct  569  MLGTIGFRASLFFVRHIYRSIKCE  592



>gb|KJB15315.1| hypothetical protein B456_002G170500 [Gossypium raimondii]
Length=290

 Score =   147 bits (370),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 77/84 (92%), Positives = 81/84 (96%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDH+WWWRSFLCGGSTGLFIY YCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFL
Sbjct  207  QLAAEDHEWWWRSFLCGGSTGLFIYAYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFL  266

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            +LG VGFRA+LFFVRHIYRSIKCE
Sbjct  267  LLGTVGFRASLFFVRHIYRSIKCE  290



>ref|XP_011463508.1| PREDICTED: transmembrane 9 superfamily member 2 [Fragaria vesca 
subsp. vesca]
Length=592

 Score =   151 bits (382),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 79/84 (94%), Positives = 82/84 (98%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDH+WWWRSFLCGGSTGLFIYGYCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFL
Sbjct  509  QLAAEDHEWWWRSFLCGGSTGLFIYGYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFL  568

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG VGFRAALFFVRHIY+SIKCE
Sbjct  569  MLGTVGFRAALFFVRHIYKSIKCE  592



>ref|XP_009602054.1| PREDICTED: putative phagocytic receptor 1b [Nicotiana tomentosiformis]
Length=594

 Score =   151 bits (381),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 79/84 (94%), Positives = 82/84 (98%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDH+WWWR+FLCGGSTGLFIYGYCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFL
Sbjct  511  QLAAEDHEWWWRAFLCGGSTGLFIYGYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFL  570

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG VGFRAALFFVRHIYRSIKCE
Sbjct  571  MLGTVGFRAALFFVRHIYRSIKCE  594



>ref|XP_009775043.1| PREDICTED: putative phagocytic receptor 1b [Nicotiana sylvestris]
Length=593

 Score =   151 bits (381),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 79/84 (94%), Positives = 82/84 (98%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDH+WWWR+FLCGGSTGLFIYGYCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFL
Sbjct  510  QLAAEDHEWWWRAFLCGGSTGLFIYGYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFL  569

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG VGFRAALFFVRHIYRSIKCE
Sbjct  570  MLGTVGFRAALFFVRHIYRSIKCE  593



>emb|CDY52038.1| BnaA08g31510D [Brassica napus]
Length=480

 Score =   150 bits (378),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 79/84 (94%), Positives = 81/84 (96%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDH+WWWRSFLCGGSTGLFIY YCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFL
Sbjct  397  QLAAEDHQWWWRSFLCGGSTGLFIYAYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFL  456

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG VGFRAALFFVRHIYRSIKCE
Sbjct  457  MLGTVGFRAALFFVRHIYRSIKCE  480



>dbj|BAK08235.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=381

 Score =   148 bits (374),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 78/84 (93%), Positives = 82/84 (98%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDH+WWWRSFLCGGSTG F+YGYCLYYYYARSDMSGFMQTSFFFGYMAC+CYAFFL
Sbjct  298  QLAAEDHEWWWRSFLCGGSTGFFVYGYCLYYYYARSDMSGFMQTSFFFGYMACICYAFFL  357

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG VGFRAALFFVRHIY+SIKCE
Sbjct  358  MLGMVGFRAALFFVRHIYKSIKCE  381



>ref|XP_006346764.1| PREDICTED: putative phagocytic receptor 1b-like [Solanum tuberosum]
Length=598

 Score =   150 bits (380),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 79/84 (94%), Positives = 82/84 (98%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDH+WWWR+FLCGGSTGLFIYGYCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFL
Sbjct  515  QLAAEDHEWWWRAFLCGGSTGLFIYGYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFL  574

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG VGFRAALFFVRHIYRSIKCE
Sbjct  575  MLGTVGFRAALFFVRHIYRSIKCE  598



>ref|XP_004236681.1| PREDICTED: putative phagocytic receptor 1b [Solanum lycopersicum]
Length=598

 Score =   150 bits (380),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 79/84 (94%), Positives = 82/84 (98%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDH+WWWR+FLCGGSTGLFIYGYCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFL
Sbjct  515  QLAAEDHEWWWRAFLCGGSTGLFIYGYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFL  574

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG VGFRAALFFVRHIYRSIKCE
Sbjct  575  MLGTVGFRAALFFVRHIYRSIKCE  598



>emb|CDY52035.1| BnaA08g31480D [Brassica napus]
Length=589

 Score =   150 bits (380),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 79/84 (94%), Positives = 81/84 (96%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDH+WWWRSFLCGGSTGLFIY YCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFL
Sbjct  506  QLAAEDHQWWWRSFLCGGSTGLFIYAYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFL  565

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG VGFRAALFFVRHIYRSIKCE
Sbjct  566  MLGTVGFRAALFFVRHIYRSIKCE  589



>ref|XP_009110524.1| PREDICTED: putative phagocytic receptor 1b [Brassica rapa]
Length=589

 Score =   150 bits (380),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 79/84 (94%), Positives = 81/84 (96%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDH+WWWRSFLCGGSTGLFIY YCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFL
Sbjct  506  QLAAEDHQWWWRSFLCGGSTGLFIYAYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFL  565

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG VGFRAALFFVRHIYRSIKCE
Sbjct  566  MLGTVGFRAALFFVRHIYRSIKCE  589



>ref|XP_009110529.1| PREDICTED: putative phagocytic receptor 1b [Brassica rapa]
Length=589

 Score =   150 bits (380),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 79/84 (94%), Positives = 81/84 (96%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDH+WWWRSFLCGGSTGLFIY YCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFL
Sbjct  506  QLAAEDHQWWWRSFLCGGSTGLFIYAYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFL  565

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG VGFRAALFFVRHIYRSIKCE
Sbjct  566  MLGTVGFRAALFFVRHIYRSIKCE  589



>ref|XP_008393472.1| PREDICTED: putative phagocytic receptor 1b [Malus domestica]
Length=593

 Score =   150 bits (380),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 78/84 (93%), Positives = 80/84 (95%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDH+WWWRSFLCGGSTGLFIY YCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFL
Sbjct  510  QLAAEDHEWWWRSFLCGGSTGLFIYTYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFL  569

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG VGFRAAL FVRHIYRSIKCE
Sbjct  570  MLGTVGFRAALLFVRHIYRSIKCE  593



>emb|CDX84018.1| BnaC08g16270D [Brassica napus]
Length=589

 Score =   150 bits (380),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 79/84 (94%), Positives = 81/84 (96%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDH+WWWRSFLCGGSTGLFIY YCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFL
Sbjct  506  QLAAEDHQWWWRSFLCGGSTGLFIYAYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFL  565

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG VGFRAALFFVRHIYRSIKCE
Sbjct  566  MLGTVGFRAALFFVRHIYRSIKCE  589



>ref|XP_003548324.1| PREDICTED: putative phagocytic receptor 1b-like [Glycine max]
Length=587

 Score =   150 bits (379),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 78/84 (93%), Positives = 80/84 (95%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDH+WWWRSFLCGGSTGLFIY YCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFL
Sbjct  504  QLAAEDHEWWWRSFLCGGSTGLFIYTYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFL  563

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG VGFRAAL FVRHIYRSIKCE
Sbjct  564  MLGTVGFRAALLFVRHIYRSIKCE  587



>ref|XP_004515238.1| PREDICTED: putative phagocytic receptor 1b-like [Cicer arietinum]
Length=592

 Score =   150 bits (379),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 79/84 (94%), Positives = 81/84 (96%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDH+WWWRSFLCGGSTGLFIY YCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFL
Sbjct  509  QLAAEDHEWWWRSFLCGGSTGLFIYAYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFL  568

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG VGFRAALFFVRHIYRSIKCE
Sbjct  569  MLGTVGFRAALFFVRHIYRSIKCE  592



>ref|XP_004239834.1| PREDICTED: putative phagocytic receptor 1b [Solanum lycopersicum]
Length=597

 Score =   150 bits (379),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 78/84 (93%), Positives = 83/84 (99%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDH+WWWR+FLCGGSTGLFIYGYCLYYYYARSDM+GFMQTSFFFGYMAC+CY FFL
Sbjct  514  QLAAEDHEWWWRAFLCGGSTGLFIYGYCLYYYYARSDMTGFMQTSFFFGYMACICYGFFL  573

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG+VGFRAALFFVRHIYRSIKCE
Sbjct  574  MLGSVGFRAALFFVRHIYRSIKCE  597



>gb|AAF79217.1|AC006917_2 F10B6.3 [Arabidopsis thaliana]
Length=336

 Score =   147 bits (371),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 78/84 (93%), Positives = 80/84 (95%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDH+WWWRSFLCGGSTGLFIY YCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFL
Sbjct  253  QLAAEDHQWWWRSFLCGGSTGLFIYAYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFL  312

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG VGFRAAL FVRHIYRSIKCE
Sbjct  313  MLGTVGFRAALLFVRHIYRSIKCE  336



>ref|XP_006365862.1| PREDICTED: putative phagocytic receptor 1b-like [Solanum tuberosum]
Length=588

 Score =   150 bits (379),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 78/84 (93%), Positives = 83/84 (99%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDH+WWWR+FLCGGSTGLFIYGYCLYYYYARSDM+GFMQTSFFFGYMAC+CY FFL
Sbjct  505  QLAAEDHEWWWRAFLCGGSTGLFIYGYCLYYYYARSDMTGFMQTSFFFGYMACICYGFFL  564

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG+VGFRAALFFVRHIYRSIKCE
Sbjct  565  MLGSVGFRAALFFVRHIYRSIKCE  588



>gb|KHN43674.1| Putative phagocytic receptor 1b [Glycine soja]
Length=588

 Score =   150 bits (379),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 79/84 (94%), Positives = 81/84 (96%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDH+WWWRSFLCGGSTGLFIY YCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFL
Sbjct  505  QLAAEDHEWWWRSFLCGGSTGLFIYAYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFL  564

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG VGFRAALFFVRHIYRSIKCE
Sbjct  565  MLGTVGFRAALFFVRHIYRSIKCE  588



>ref|XP_008466877.1| PREDICTED: putative phagocytic receptor 1b [Cucumis melo]
Length=602

 Score =   150 bits (379),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 79/84 (94%), Positives = 81/84 (96%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QL AEDH+WWWRSFLCGGSTGLFIYGYCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFL
Sbjct  519  QLTAEDHEWWWRSFLCGGSTGLFIYGYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFL  578

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG VGFRAALFFVRHIYRSIKCE
Sbjct  579  MLGTVGFRAALFFVRHIYRSIKCE  602



>ref|XP_003531127.1| PREDICTED: putative phagocytic receptor 1b-like [Glycine max]
Length=604

 Score =   150 bits (379),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 78/84 (93%), Positives = 82/84 (98%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDH+WWWRSFLCGGSTGLFIYGYCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFL
Sbjct  521  QLAAEDHEWWWRSFLCGGSTGLFIYGYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFL  580

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG+VGFRA+L FVRHIYRSIKCE
Sbjct  581  MLGSVGFRASLLFVRHIYRSIKCE  604



>ref|XP_007158822.1| hypothetical protein PHAVU_002G184900g [Phaseolus vulgaris]
 gb|ESW30816.1| hypothetical protein PHAVU_002G184900g [Phaseolus vulgaris]
Length=592

 Score =   150 bits (379),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 78/84 (93%), Positives = 82/84 (98%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDH+WWWRSFLCGGSTGLFIYGYCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFL
Sbjct  509  QLAAEDHEWWWRSFLCGGSTGLFIYGYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFL  568

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG+VGFRA+L FVRHIYRSIKCE
Sbjct  569  MLGSVGFRASLLFVRHIYRSIKCE  592



>gb|KHN28892.1| Putative phagocytic receptor 1b [Glycine soja]
Length=604

 Score =   150 bits (379),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 78/84 (93%), Positives = 82/84 (98%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDH+WWWRSFLCGGSTGLFIYGYCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFL
Sbjct  521  QLAAEDHEWWWRSFLCGGSTGLFIYGYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFL  580

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG+VGFRA+L FVRHIYRSIKCE
Sbjct  581  MLGSVGFRASLLFVRHIYRSIKCE  604



>gb|KJB08470.1| hypothetical protein B456_001G083100 [Gossypium raimondii]
Length=592

 Score =   150 bits (379),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 76/84 (90%), Positives = 80/84 (95%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDH+WWWRSFLCGGSTGLFIY YCLYYY ARSDMSGFMQTSFFFGYMAC+CY FFL
Sbjct  509  QLAAEDHEWWWRSFLCGGSTGLFIYTYCLYYYNARSDMSGFMQTSFFFGYMACICYGFFL  568

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLGA+GFRA+L FVRHIYRSIKCE
Sbjct  569  MLGAIGFRASLLFVRHIYRSIKCE  592



>ref|XP_008462539.1| PREDICTED: putative phagocytic receptor 1b isoform X2 [Cucumis 
melo]
Length=601

 Score =   150 bits (379),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 79/84 (94%), Positives = 81/84 (96%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDH+WWWRSFLCGGSTGLFIY YCLYYYYARSDMSGFMQTSFFFGYMACVCY FFL
Sbjct  518  QLAAEDHEWWWRSFLCGGSTGLFIYAYCLYYYYARSDMSGFMQTSFFFGYMACVCYGFFL  577

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLGA+GFRAAL FVRHIYRSIKCE
Sbjct  578  MLGAIGFRAALLFVRHIYRSIKCE  601



>emb|CDY56297.1| BnaC09g52300D [Brassica napus]
Length=535

 Score =   150 bits (378),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 78/84 (93%), Positives = 81/84 (96%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDH+WWWRSFLCGGSTGLFIY YCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFL
Sbjct  452  QLAAEDHEWWWRSFLCGGSTGLFIYAYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFL  511

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG VGFRA+LFFVRHIYRSIKCE
Sbjct  512  MLGTVGFRASLFFVRHIYRSIKCE  535



>ref|XP_006292411.1| hypothetical protein CARUB_v10018624mg [Capsella rubella]
 gb|EOA25309.1| hypothetical protein CARUB_v10018624mg [Capsella rubella]
Length=592

 Score =   150 bits (378),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 79/84 (94%), Positives = 81/84 (96%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDH+WWWRSFLCGGSTGLFIY YCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFL
Sbjct  509  QLAAEDHEWWWRSFLCGGSTGLFIYAYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFL  568

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLGAVGFRAAL FVRHIYRSIKCE
Sbjct  569  MLGAVGFRAALLFVRHIYRSIKCE  592



>ref|XP_003524839.1| PREDICTED: putative phagocytic receptor 1b-like [Glycine max]
 gb|KHN25962.1| Putative phagocytic receptor 1b [Glycine soja]
Length=601

 Score =   150 bits (378),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 78/84 (93%), Positives = 82/84 (98%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDH+WWWRSFLCGGSTGLFIYGYCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFL
Sbjct  518  QLAAEDHEWWWRSFLCGGSTGLFIYGYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFL  577

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG+VGFRA+L FVRHIYRSIKCE
Sbjct  578  MLGSVGFRASLLFVRHIYRSIKCE  601



>gb|KHG09925.1| Putative phagocytic receptor 1b [Gossypium arboreum]
Length=592

 Score =   150 bits (378),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 76/84 (90%), Positives = 80/84 (95%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDH+WWWRSFLCGGSTGLFIY YCLYYY ARSDMSGFMQTSFFFGYMAC+CY FFL
Sbjct  509  QLAAEDHEWWWRSFLCGGSTGLFIYAYCLYYYNARSDMSGFMQTSFFFGYMACICYGFFL  568

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLGA+GFRA+L FVRHIYRSIKCE
Sbjct  569  MLGAIGFRASLLFVRHIYRSIKCE  592



>ref|XP_004504610.1| PREDICTED: putative phagocytic receptor 1b-like [Cicer arietinum]
Length=592

 Score =   150 bits (378),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 78/84 (93%), Positives = 82/84 (98%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDH+WWWRSFLCGGSTGLFIYGYCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFL
Sbjct  509  QLAAEDHEWWWRSFLCGGSTGLFIYGYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFL  568

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG+VGFRA+L FVRHIYRSIKCE
Sbjct  569  MLGSVGFRASLLFVRHIYRSIKCE  592



>ref|XP_008461818.1| PREDICTED: putative phagocytic receptor 1b isoform X1 [Cucumis 
melo]
Length=591

 Score =   150 bits (378),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 79/84 (94%), Positives = 81/84 (96%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDH+WWWRSFLCGGSTGLFIY YCLYYYYARSDMSGFMQTSFFFGYMACVCY FFL
Sbjct  508  QLAAEDHEWWWRSFLCGGSTGLFIYAYCLYYYYARSDMSGFMQTSFFFGYMACVCYGFFL  567

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLGA+GFRAAL FVRHIYRSIKCE
Sbjct  568  MLGAIGFRAALLFVRHIYRSIKCE  591



>ref|XP_010917284.1| PREDICTED: transmembrane 9 superfamily member 2-like [Elaeis 
guineensis]
Length=596

 Score =   150 bits (378),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 79/84 (94%), Positives = 81/84 (96%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDH+WWWRSFLCGGSTGLFIYGYCLYYYYARSDMSGFMQTSFFFGYMACVCY FFL
Sbjct  513  QLAAEDHEWWWRSFLCGGSTGLFIYGYCLYYYYARSDMSGFMQTSFFFGYMACVCYGFFL  572

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG +GFRAAL FVRHIYRSIKCE
Sbjct  573  MLGTIGFRAALLFVRHIYRSIKCE  596



>ref|XP_004137376.1| PREDICTED: putative phagocytic receptor 1b-like [Cucumis sativus]
 ref|XP_004171887.1| PREDICTED: putative phagocytic receptor 1b-like [Cucumis sativus]
 gb|KGN63933.1| hypothetical protein Csa_1G029600 [Cucumis sativus]
Length=591

 Score =   150 bits (378),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 79/84 (94%), Positives = 81/84 (96%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDH+WWWRSFLCGGSTGLFIY YCLYYYYARSDMSGFMQTSFFFGYMACVCY FFL
Sbjct  508  QLAAEDHEWWWRSFLCGGSTGLFIYAYCLYYYYARSDMSGFMQTSFFFGYMACVCYGFFL  567

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLGA+GFRAAL FVRHIYRSIKCE
Sbjct  568  MLGAIGFRAALLFVRHIYRSIKCE  591



>gb|ACR33947.1| unknown [Zea mays]
Length=467

 Score =   149 bits (375),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 78/84 (93%), Positives = 82/84 (98%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDH+WWWRSFLCGGSTG F+YGYCLYYYYARSDMSGFMQTSFFFGYMAC+CYAFFL
Sbjct  384  QLAAEDHEWWWRSFLCGGSTGFFVYGYCLYYYYARSDMSGFMQTSFFFGYMACICYAFFL  443

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG VGFRAALFFVRHIY+SIKCE
Sbjct  444  MLGMVGFRAALFFVRHIYKSIKCE  467



>ref|XP_004170088.1| PREDICTED: putative phagocytic receptor 1b-like [Cucumis sativus]
 gb|KGN49739.1| hypothetical protein Csa_5G096460 [Cucumis sativus]
Length=589

 Score =   149 bits (377),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 78/84 (93%), Positives = 81/84 (96%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QL AEDH+WWWRSFLCGGSTGLFIYGYCLYYYYARSDM+GFMQTSFFFGYMAC+CY FFL
Sbjct  506  QLTAEDHEWWWRSFLCGGSTGLFIYGYCLYYYYARSDMTGFMQTSFFFGYMACICYGFFL  565

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG VGFRAALFFVRHIYRSIKCE
Sbjct  566  MLGTVGFRAALFFVRHIYRSIKCE  589



>ref|NP_001148980.1| LOC100282600 precursor [Zea mays]
 gb|ACG33705.1| transmembrane 9 superfamily protein member 1 precursor [Zea mays]
 tpg|DAA44288.1| TPA: transmembrane 9 family protein member 1 [Zea mays]
Length=593

 Score =   149 bits (377),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 78/84 (93%), Positives = 82/84 (98%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDH+WWWRSFLCGGSTG F+YGYCLYYYYARSDMSGFMQTSFFFGYMAC+CYAFFL
Sbjct  510  QLAAEDHEWWWRSFLCGGSTGFFVYGYCLYYYYARSDMSGFMQTSFFFGYMACICYAFFL  569

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG VGFRAALFFVRHIY+SIKCE
Sbjct  570  MLGMVGFRAALFFVRHIYKSIKCE  593



>ref|XP_003558407.1| PREDICTED: putative phagocytic receptor 1b [Brachypodium distachyon]
Length=593

 Score =   149 bits (377),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 78/84 (93%), Positives = 82/84 (98%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDH+WWWRSFLCGGSTG F+YGYCLYYYYARSDMSGFMQTSFFFGYMAC+CYAFFL
Sbjct  510  QLAAEDHEWWWRSFLCGGSTGFFVYGYCLYYYYARSDMSGFMQTSFFFGYMACICYAFFL  569

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG VGFRAALFFVRHIY+SIKCE
Sbjct  570  MLGMVGFRAALFFVRHIYKSIKCE  593



>ref|XP_010691704.1| PREDICTED: transmembrane 9 superfamily member 3-like [Beta vulgaris 
subsp. vulgaris]
Length=593

 Score =   149 bits (377),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 78/84 (93%), Positives = 81/84 (96%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDH+WWWRSFLCGGSTGLFIYGYCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFL
Sbjct  510  QLAAEDHEWWWRSFLCGGSTGLFIYGYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFL  569

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG VGFRA+L FVRHIYRSIKCE
Sbjct  570  MLGTVGFRASLLFVRHIYRSIKCE  593



>ref|XP_009616336.1| PREDICTED: putative phagocytic receptor 1b [Nicotiana tomentosiformis]
Length=593

 Score =   149 bits (377),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 78/84 (93%), Positives = 82/84 (98%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDH+WWWR+FLCGGSTGLFIYGYCLYYYYARSDM+GFMQTSFFFGYMAC+CY FFL
Sbjct  510  QLAAEDHEWWWRAFLCGGSTGLFIYGYCLYYYYARSDMTGFMQTSFFFGYMACICYGFFL  569

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG VGFRAALFFVRHIYRSIKCE
Sbjct  570  MLGNVGFRAALFFVRHIYRSIKCE  593



>gb|AGT15903.1| transmembrane 9 superfamily protein [Saccharum hybrid cultivar 
R570]
Length=593

 Score =   149 bits (377),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 78/84 (93%), Positives = 82/84 (98%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDH+WWWRSFLCGGSTG F+YGYCLYYYYARSDMSGFMQTSFFFGYMAC+CYAFFL
Sbjct  510  QLAAEDHEWWWRSFLCGGSTGFFVYGYCLYYYYARSDMSGFMQTSFFFGYMACICYAFFL  569

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG VGFRAALFFVRHIY+SIKCE
Sbjct  570  MLGMVGFRAALFFVRHIYKSIKCE  593



>gb|KDP38192.1| hypothetical protein JCGZ_04835 [Jatropha curcas]
Length=591

 Score =   149 bits (377),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 78/84 (93%), Positives = 81/84 (96%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDH+WWWRSFLCGGSTGLFIY YCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFL
Sbjct  508  QLAAEDHEWWWRSFLCGGSTGLFIYAYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFL  567

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG VGFRA+LFFVRHIYRSIKCE
Sbjct  568  MLGTVGFRASLFFVRHIYRSIKCE  591



>ref|XP_010244840.1| PREDICTED: putative phagocytic receptor 1b [Nelumbo nucifera]
 ref|XP_010244916.1| PREDICTED: putative phagocytic receptor 1b [Nelumbo nucifera]
Length=592

 Score =   149 bits (377),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 78/84 (93%), Positives = 81/84 (96%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDH+WWWRSFLCGGSTGLFIYGYCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFL
Sbjct  509  QLAAEDHEWWWRSFLCGGSTGLFIYGYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFL  568

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG VGFRA+L FVRHIYRSIKCE
Sbjct  569  MLGTVGFRASLLFVRHIYRSIKCE  592



>emb|CDY03085.1| BnaC07g21420D [Brassica napus]
Length=535

 Score =   149 bits (376),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 78/84 (93%), Positives = 80/84 (95%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDH+WWWRSFLCGGSTGLFIY YCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFL
Sbjct  452  QLAAEDHEWWWRSFLCGGSTGLFIYAYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFL  511

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG VGFRAAL FVRHIYRSIKCE
Sbjct  512  MLGTVGFRAALLFVRHIYRSIKCE  535



>emb|CDP05457.1| unnamed protein product [Coffea canephora]
Length=607

 Score =   149 bits (377),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 77/84 (92%), Positives = 80/84 (95%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDH WWWRSFLCGGSTG+FIY YCLYYY+ARSDMSGFMQTSFFFGYMAC+CY FFL
Sbjct  524  QLAAEDHNWWWRSFLCGGSTGIFIYSYCLYYYHARSDMSGFMQTSFFFGYMACICYGFFL  583

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLGAVGFRAAL FVRHIYRSIKCE
Sbjct  584  MLGAVGFRAALVFVRHIYRSIKCE  607



>ref|XP_002285238.1| PREDICTED: transmembrane 9 superfamily member 2 [Vitis vinifera]
 emb|CBI26762.3| unnamed protein product [Vitis vinifera]
Length=591

 Score =   149 bits (376),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 78/84 (93%), Positives = 81/84 (96%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDH+WWWRSFLCGGSTGLFIYGYCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFL
Sbjct  508  QLAAEDHEWWWRSFLCGGSTGLFIYGYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFL  567

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG VGFRA+L FVRHIYRSIKCE
Sbjct  568  MLGTVGFRASLLFVRHIYRSIKCE  591



>dbj|BAJ89640.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gb|EMT32275.1| Putative phagocytic receptor 1b [Aegilops tauschii]
Length=593

 Score =   149 bits (376),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 78/84 (93%), Positives = 82/84 (98%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDH+WWWRSFLCGGSTG F+YGYCLYYYYARSDMSGFMQTSFFFGYMAC+CYAFFL
Sbjct  510  QLAAEDHEWWWRSFLCGGSTGFFVYGYCLYYYYARSDMSGFMQTSFFFGYMACICYAFFL  569

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG VGFRAALFFVRHIY+SIKCE
Sbjct  570  MLGMVGFRAALFFVRHIYKSIKCE  593



>ref|XP_002468203.1| hypothetical protein SORBIDRAFT_01g041650 [Sorghum bicolor]
 gb|EER95201.1| hypothetical protein SORBIDRAFT_01g041650 [Sorghum bicolor]
Length=595

 Score =   149 bits (376),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 78/84 (93%), Positives = 82/84 (98%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDH+WWWRSFLCGGSTG F+YGYCLYYYYARSDMSGFMQTSFFFGYMAC+CYAFFL
Sbjct  512  QLAAEDHEWWWRSFLCGGSTGFFVYGYCLYYYYARSDMSGFMQTSFFFGYMACICYAFFL  571

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG VGFRAALFFVRHIY+SIKCE
Sbjct  572  MLGMVGFRAALFFVRHIYKSIKCE  595



>ref|XP_003620064.1| Transmembrane 9 superfamily protein member [Medicago truncatula]
 gb|AES76282.1| transmembrane 9 family protein [Medicago truncatula]
Length=588

 Score =   149 bits (376),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 78/84 (93%), Positives = 81/84 (96%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDH+WWWRSFLCGGSTGLFIY YCLYYYYARSDMSGFMQTSFFFGYMAC+C+ FFL
Sbjct  505  QLAAEDHEWWWRSFLCGGSTGLFIYAYCLYYYYARSDMSGFMQTSFFFGYMACICFGFFL  564

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG VGFRAALFFVRHIYRSIKCE
Sbjct  565  MLGTVGFRAALFFVRHIYRSIKCE  588



>gb|ABR26036.1| transmembrane 9 superfamily protein member 1 precursor [Oryza 
sativa Indica Group]
Length=166

 Score =   141 bits (355),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 72/84 (86%), Positives = 77/84 (92%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QL AEDH+WWWRSFLCGGSTG F++ YCLYYY  RSDMSGFMQTSFFFGYMAC+CYAFFL
Sbjct  83   QLTAEDHEWWWRSFLCGGSTGFFVFAYCLYYYRERSDMSGFMQTSFFFGYMACICYAFFL  142

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG VGFRAAL FVRHIY+SIKCE
Sbjct  143  MLGMVGFRAALLFVRHIYKSIKCE  166



>gb|AFK34316.1| unknown [Medicago truncatula]
Length=381

 Score =   147 bits (370),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 77/84 (92%), Positives = 81/84 (96%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDH+WWWRSFLCGGSTGLFIYGYCLYYYYARSDMSGFMQTSFFFGYMAC+CY FF 
Sbjct  298  QLAAEDHEWWWRSFLCGGSTGLFIYGYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFF  357

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG+VGFRA+L FVRHIYRSIKCE
Sbjct  358  MLGSVGFRASLLFVRHIYRSIKCE  381



>ref|XP_004985073.1| PREDICTED: putative phagocytic receptor 1b-like [Setaria italica]
Length=593

 Score =   149 bits (376),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 78/84 (93%), Positives = 82/84 (98%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDH+WWWRSFLCGGSTG F+YGYCLYYYYARSDMSGFMQTSFFFGYMAC+CYAFFL
Sbjct  510  QLAAEDHEWWWRSFLCGGSTGFFVYGYCLYYYYARSDMSGFMQTSFFFGYMACICYAFFL  569

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG VGFRAALFFVRHIY+SIKCE
Sbjct  570  MLGMVGFRAALFFVRHIYKSIKCE  593



>gb|EMS68537.1| Putative phagocytic receptor 1b [Triticum urartu]
Length=540

 Score =   149 bits (375),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 78/84 (93%), Positives = 82/84 (98%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDH+WWWRSFLCGGSTG F+YGYCLYYYYARSDMSGFMQTSFFFGYMAC+CYAFFL
Sbjct  457  QLAAEDHEWWWRSFLCGGSTGFFVYGYCLYYYYARSDMSGFMQTSFFFGYMACICYAFFL  516

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG VGFRAALFFVRHIY+SIKCE
Sbjct  517  MLGMVGFRAALFFVRHIYKSIKCE  540



>ref|XP_009774478.1| PREDICTED: putative phagocytic receptor 1b [Nicotiana sylvestris]
Length=593

 Score =   149 bits (376),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 77/84 (92%), Positives = 82/84 (98%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDH+WWWR+FLCGGSTGLFIYGYCLYYYYARSDM+GFMQTSFFFGYMAC+CY FFL
Sbjct  510  QLAAEDHEWWWRAFLCGGSTGLFIYGYCLYYYYARSDMTGFMQTSFFFGYMACICYGFFL  569

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG VGFRAALFFVRHIYRS+KCE
Sbjct  570  MLGNVGFRAALFFVRHIYRSVKCE  593



>gb|AAF63170.1|AC010657_6 T5E21.15 [Arabidopsis thaliana]
Length=546

 Score =   149 bits (375),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 78/84 (93%), Positives = 80/84 (95%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDH+WWWRSFLCGGSTGLFIY YCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFL
Sbjct  463  QLAAEDHQWWWRSFLCGGSTGLFIYAYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFL  522

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG VGFRAAL FVRHIYRSIKCE
Sbjct  523  MLGTVGFRAALLFVRHIYRSIKCE  546



>ref|XP_007225615.1| hypothetical protein PRUPE_ppa003229mg [Prunus persica]
 gb|EMJ26814.1| hypothetical protein PRUPE_ppa003229mg [Prunus persica]
Length=591

 Score =   149 bits (375),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 78/84 (93%), Positives = 81/84 (96%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDH+WWWRSFLCGGSTGLFIYGYCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFL
Sbjct  508  QLAAEDHEWWWRSFLCGGSTGLFIYGYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFL  567

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG VGFRAAL FVRHIY+SIKCE
Sbjct  568  MLGTVGFRAALLFVRHIYKSIKCE  591



>ref|NP_178306.1| putative endomembrane protein 70 [Arabidopsis thaliana]
 sp|Q9ZPS7.1|TMN3_ARATH RecName: Full=Transmembrane 9 superfamily member 3; AltName: 
Full=Endomembrane protein 9; AltName: Full=Transmembrane nine 
protein 3; Short=AtTMN3; Flags: Precursor [Arabidopsis thaliana]
 gb|AAD20090.1| putative endosomal protein [Arabidopsis thaliana]
 gb|AAL24256.1| At2g01970/F14H20.4 [Arabidopsis thaliana]
 dbj|BAE98629.1| putative endosomal protein [Arabidopsis thaliana]
 gb|AEC05528.1| putative endomembrane protein 70 [Arabidopsis thaliana]
Length=592

 Score =   149 bits (375),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 78/84 (93%), Positives = 80/84 (95%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDH+WWWRSFLCGGSTGLFIY YCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFL
Sbjct  509  QLAAEDHEWWWRSFLCGGSTGLFIYAYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFL  568

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG VGFRAAL FVRHIYRSIKCE
Sbjct  569  MLGTVGFRAALLFVRHIYRSIKCE  592



>emb|CDY15803.1| BnaC02g34220D [Brassica napus]
Length=592

 Score =   149 bits (375),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 78/84 (93%), Positives = 80/84 (95%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDH+WWWRSFLCGGSTGLFIY YCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFL
Sbjct  509  QLAAEDHEWWWRSFLCGGSTGLFIYAYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFL  568

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG VGFRAAL FVRHIYRSIKCE
Sbjct  569  MLGTVGFRAALLFVRHIYRSIKCE  592



>ref|XP_010276303.1| PREDICTED: putative phagocytic receptor 1b [Nelumbo nucifera]
Length=592

 Score =   149 bits (375),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 78/84 (93%), Positives = 81/84 (96%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDH+WWWRSFLCGGSTGLFIYGYCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFL
Sbjct  509  QLAAEDHEWWWRSFLCGGSTGLFIYGYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFL  568

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG VGFRA+L FVRHIYRSIKCE
Sbjct  569  MLGTVGFRASLLFVRHIYRSIKCE  592



>ref|XP_008220963.1| PREDICTED: putative phagocytic receptor 1b [Prunus mume]
Length=591

 Score =   149 bits (375),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 78/84 (93%), Positives = 81/84 (96%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDH+WWWRSFLCGGSTGLFIYGYCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFL
Sbjct  508  QLAAEDHEWWWRSFLCGGSTGLFIYGYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFL  567

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG VGFRAAL FVRHIY+SIKCE
Sbjct  568  MLGTVGFRAALLFVRHIYKSIKCE  591



>ref|XP_010476529.1| PREDICTED: putative phagocytic receptor 1b [Camelina sativa]
Length=592

 Score =   149 bits (375),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 78/84 (93%), Positives = 80/84 (95%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDH+WWWRSFLCGGSTGLFIY YCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFL
Sbjct  509  QLAAEDHQWWWRSFLCGGSTGLFIYAYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFL  568

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG VGFRAAL FVRHIYRSIKCE
Sbjct  569  MLGTVGFRAALLFVRHIYRSIKCE  592



>ref|XP_006649701.1| PREDICTED: putative phagocytic receptor 1b-like [Oryza brachyantha]
Length=467

 Score =   148 bits (373),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 77/84 (92%), Positives = 82/84 (98%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDH+WWWRSFLCGGSTG F+YGYCLYYYYARSDMSGFMQTSFFFGYMAC+CYAFFL
Sbjct  384  QLAAEDHEWWWRSFLCGGSTGFFVYGYCLYYYYARSDMSGFMQTSFFFGYMACICYAFFL  443

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG +GFRAALFFVRHIY+SIKCE
Sbjct  444  MLGMIGFRAALFFVRHIYKSIKCE  467



>ref|XP_007152616.1| hypothetical protein PHAVU_004G145000g [Phaseolus vulgaris]
 gb|ESW24610.1| hypothetical protein PHAVU_004G145000g [Phaseolus vulgaris]
Length=594

 Score =   149 bits (375),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 78/84 (93%), Positives = 80/84 (95%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDH+WWWRSFLCGGSTGLFIY YCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFL
Sbjct  511  QLAAEDHEWWWRSFLCGGSTGLFIYAYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFL  570

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG VGFRAAL FVRHIYRSIKCE
Sbjct  571  MLGTVGFRAALLFVRHIYRSIKCE  594



>ref|XP_006307070.1| hypothetical protein CARUB_v10008657mg [Capsella rubella]
 gb|EOA39968.1| hypothetical protein CARUB_v10008657mg [Capsella rubella]
Length=592

 Score =   149 bits (375),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 78/84 (93%), Positives = 80/84 (95%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDH+WWWRSFLCGGSTGLFIY YCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFL
Sbjct  509  QLAAEDHQWWWRSFLCGGSTGLFIYAYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFL  568

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG VGFRAAL FVRHIYRSIKCE
Sbjct  569  MLGTVGFRAALLFVRHIYRSIKCE  592



>gb|KFK43715.1| hypothetical protein AALP_AA1G163400 [Arabis alpina]
Length=592

 Score =   149 bits (375),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 78/84 (93%), Positives = 80/84 (95%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDH+WWWRSFLCGGSTGLFIY YCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFL
Sbjct  509  QLAAEDHQWWWRSFLCGGSTGLFIYAYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFL  568

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG VGFRAAL FVRHIYRSIKCE
Sbjct  569  MLGTVGFRAALLFVRHIYRSIKCE  592



>emb|CDY41095.1| BnaC05g10860D [Brassica napus]
Length=589

 Score =   149 bits (375),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 78/84 (93%), Positives = 80/84 (95%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDH+WWWRSFLCGGSTGLFIY YCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFL
Sbjct  506  QLAAEDHQWWWRSFLCGGSTGLFIYAYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFL  565

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG VGFRAAL FVRHIYRSIKCE
Sbjct  566  MLGTVGFRAALLFVRHIYRSIKCE  589



>ref|XP_009387842.1| PREDICTED: putative phagocytic receptor 1b [Musa acuminata subsp. 
malaccensis]
Length=597

 Score =   149 bits (375),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 77/84 (92%), Positives = 80/84 (95%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDH+WWWRSFLCGGSTGLF+YGYC YYYYARSDMSGFMQTSFFFGYMAC+CY FFL
Sbjct  514  QLAAEDHEWWWRSFLCGGSTGLFVYGYCWYYYYARSDMSGFMQTSFFFGYMACICYGFFL  573

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG VGFRAAL FVRHIYRSIKCE
Sbjct  574  MLGMVGFRAALLFVRHIYRSIKCE  597



>ref|NP_001049492.1| Os03g0237000 [Oryza sativa Japonica Group]
 gb|AAO06970.1| Putative endosomal protein [Oryza sativa Japonica Group]
 gb|ABF94848.1| Endomembrane protein 70 containing protein, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF11406.1| Os03g0237000 [Oryza sativa Japonica Group]
 gb|EAZ26202.1| hypothetical protein OsJ_10070 [Oryza sativa Japonica Group]
 dbj|BAG89207.1| unnamed protein product [Oryza sativa Japonica Group]
Length=595

 Score =   149 bits (375),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 77/84 (92%), Positives = 82/84 (98%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDH+WWWRSFLCGGSTG F+YGYCLYYYYARSDMSGFMQTSFFFGYMAC+CYAFFL
Sbjct  512  QLAAEDHEWWWRSFLCGGSTGFFVYGYCLYYYYARSDMSGFMQTSFFFGYMACICYAFFL  571

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG +GFRAALFFVRHIY+SIKCE
Sbjct  572  MLGMIGFRAALFFVRHIYKSIKCE  595



>ref|XP_002876790.1| hypothetical protein ARALYDRAFT_904415 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH53049.1| hypothetical protein ARALYDRAFT_904415 [Arabidopsis lyrata subsp. 
lyrata]
Length=592

 Score =   149 bits (375),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 78/84 (93%), Positives = 80/84 (95%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDH+WWWRSFLCGGSTGLFIY YCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFL
Sbjct  509  QLAAEDHEWWWRSFLCGGSTGLFIYAYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFL  568

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG VGFRAAL FVRHIYRSIKCE
Sbjct  569  MLGTVGFRAALLFVRHIYRSIKCE  592



>ref|XP_010936838.1| PREDICTED: transmembrane 9 superfamily member 3-like [Elaeis 
guineensis]
Length=592

 Score =   149 bits (375),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 78/84 (93%), Positives = 81/84 (96%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDH+WWWR+FLCGGSTGLFIYGYCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFL
Sbjct  509  QLAAEDHEWWWRAFLCGGSTGLFIYGYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFL  568

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG VGFRAAL FVRHIYRSIKCE
Sbjct  569  MLGMVGFRAALLFVRHIYRSIKCE  592



>ref|XP_010496367.1| PREDICTED: putative phagocytic receptor 1b [Camelina sativa]
Length=592

 Score =   149 bits (375),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 78/84 (93%), Positives = 80/84 (95%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDH+WWWRSFLCGGSTGLFIY YCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFL
Sbjct  509  QLAAEDHQWWWRSFLCGGSTGLFIYAYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFL  568

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG VGFRAAL FVRHIYRSIKCE
Sbjct  569  MLGTVGFRAALLFVRHIYRSIKCE  592



>ref|XP_006395825.1| hypothetical protein EUTSA_v10003877mg [Eutrema salsugineum]
 gb|ACQ90591.1| putative transmembrane transporter [Eutrema halophilum]
 gb|ESQ33111.1| hypothetical protein EUTSA_v10003877mg [Eutrema salsugineum]
Length=592

 Score =   149 bits (375),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 78/84 (93%), Positives = 80/84 (95%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDH+WWWRSFLCGGSTGLFIY YCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFL
Sbjct  509  QLAAEDHEWWWRSFLCGGSTGLFIYAYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFL  568

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG VGFRAAL FVRHIYRSIKCE
Sbjct  569  MLGTVGFRAALLFVRHIYRSIKCE  592



>ref|NP_172919.1| putative endomembrane protein 70 [Arabidopsis thaliana]
 sp|Q940S0.1|TMN2_ARATH RecName: Full=Transmembrane 9 superfamily member 2; AltName: 
Full=Endomembrane protein 8; AltName: Full=Transmembrane nine 
protein 2; Short=AtTMN2; Flags: Precursor [Arabidopsis thaliana]
 gb|AAK96649.1| T5E21.14/T5E21.14 [Arabidopsis thaliana]
 gb|AAM16222.1| At1g14670/T5E21.14 [Arabidopsis thaliana]
 gb|AEE29200.1| putative endomembrane protein 70 [Arabidopsis thaliana]
Length=592

 Score =   149 bits (375),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 78/84 (93%), Positives = 80/84 (95%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDH+WWWRSFLCGGSTGLFIY YCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFL
Sbjct  509  QLAAEDHQWWWRSFLCGGSTGLFIYAYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFL  568

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG VGFRAAL FVRHIYRSIKCE
Sbjct  569  MLGTVGFRAALLFVRHIYRSIKCE  592



>gb|KFK33411.1| hypothetical protein AALP_AA5G009400 [Arabis alpina]
Length=592

 Score =   149 bits (375),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 78/84 (93%), Positives = 80/84 (95%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDH+WWWRSFLCGGSTGLFIY YCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFL
Sbjct  509  QLAAEDHEWWWRSFLCGGSTGLFIYAYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFL  568

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG VGFRAAL FVRHIYRSIKCE
Sbjct  569  MLGTVGFRAALLFVRHIYRSIKCE  592



>ref|XP_006416990.1| hypothetical protein EUTSA_v10007150mg [Eutrema salsugineum]
 gb|ESQ35343.1| hypothetical protein EUTSA_v10007150mg [Eutrema salsugineum]
Length=592

 Score =   149 bits (375),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 78/84 (93%), Positives = 80/84 (95%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDH+WWWRSFLCGGSTGLFIY YCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFL
Sbjct  509  QLAAEDHQWWWRSFLCGGSTGLFIYAYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFL  568

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG VGFRAAL FVRHIYRSIKCE
Sbjct  569  MLGTVGFRAALLFVRHIYRSIKCE  592



>ref|XP_009355975.1| PREDICTED: putative phagocytic receptor 1b [Pyrus x bretschneideri]
Length=593

 Score =   149 bits (375),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 78/84 (93%), Positives = 80/84 (95%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDH+WWWRSFLCGGSTGLFIY YCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFL
Sbjct  510  QLAAEDHEWWWRSFLCGGSTGLFIYAYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFL  569

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG VGFRAAL FVRHIYRSIKCE
Sbjct  570  MLGTVGFRAALLFVRHIYRSIKCE  593



>gb|KHN24548.1| Putative phagocytic receptor 1b [Glycine soja]
Length=586

 Score =   149 bits (375),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 78/84 (93%), Positives = 80/84 (95%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDH+WWWRSFLCGGSTGLFIY YCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFL
Sbjct  503  QLAAEDHEWWWRSFLCGGSTGLFIYAYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFL  562

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG VGFRAAL FVRHIYRSIKCE
Sbjct  563  MLGTVGFRAALLFVRHIYRSIKCE  586



>emb|CDX81659.1| BnaC08g39420D [Brassica napus]
Length=589

 Score =   149 bits (375),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 78/84 (93%), Positives = 80/84 (95%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDH+WWWRSFLCGGSTGLFIY YCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFL
Sbjct  506  QLAAEDHQWWWRSFLCGGSTGLFIYAYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFL  565

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG VGFRAAL FVRHIYRSIKCE
Sbjct  566  MLGTVGFRAALLFVRHIYRSIKCE  589



>ref|XP_008791844.1| PREDICTED: putative phagocytic receptor 1b [Phoenix dactylifera]
Length=596

 Score =   148 bits (374),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 77/84 (92%), Positives = 82/84 (98%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDH+WWWRSFLCGGSTGLFIYGYCLYYY+ARSDMSGFMQTSFFFGYMAC+CY FFL
Sbjct  513  QLAAEDHEWWWRSFLCGGSTGLFIYGYCLYYYHARSDMSGFMQTSFFFGYMACICYGFFL  572

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            +LGA+GFRAAL FVRHIYRSIKCE
Sbjct  573  LLGAIGFRAALLFVRHIYRSIKCE  596



>ref|XP_004150159.1| PREDICTED: putative phagocytic receptor 1b-like [Cucumis sativus]
Length=654

 Score =   149 bits (375),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 78/84 (93%), Positives = 81/84 (96%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QL AEDH+WWWRSFLCGGSTGLFIYGYCLYYYYARSDM+GFMQTSFFFGYMAC+CY FFL
Sbjct  571  QLTAEDHEWWWRSFLCGGSTGLFIYGYCLYYYYARSDMTGFMQTSFFFGYMACICYGFFL  630

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG VGFRAALFFVRHIYRSIKCE
Sbjct  631  MLGTVGFRAALFFVRHIYRSIKCE  654



>ref|XP_008375035.1| PREDICTED: putative phagocytic receptor 1b [Malus domestica]
Length=611

 Score =   148 bits (374),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 78/84 (93%), Positives = 80/84 (95%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDH+WWWRSFLCGGSTGLFIY YCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFL
Sbjct  528  QLAAEDHEWWWRSFLCGGSTGLFIYAYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFL  587

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG VGFRAAL FVRHIYRSIKCE
Sbjct  588  MLGTVGFRAALLFVRHIYRSIKCE  611



>ref|XP_004299493.1| PREDICTED: transmembrane 9 superfamily member 3-like [Fragaria 
vesca subsp. vesca]
Length=599

 Score =   148 bits (374),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 77/84 (92%), Positives = 81/84 (96%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDH+WWWRSFLCGGSTG+FIY YCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFL
Sbjct  516  QLAAEDHEWWWRSFLCGGSTGIFIYAYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFL  575

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG+VGFRAAL FVRHIYRSIKCE
Sbjct  576  MLGSVGFRAALLFVRHIYRSIKCE  599



>ref|XP_010554368.1| PREDICTED: putative phagocytic receptor 1b [Tarenaya hassleriana]
Length=592

 Score =   148 bits (374),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 78/84 (93%), Positives = 80/84 (95%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDH+WWWRSFLCGGSTGLFIY YCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFL
Sbjct  509  QLAAEDHEWWWRSFLCGGSTGLFIYAYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFL  568

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG VGFRAAL FVRHIYRSIKCE
Sbjct  569  MLGTVGFRAALLFVRHIYRSIKCE  592



>gb|ACG42357.1| transmembrane 9 superfamily protein member 1 precursor [Zea mays]
Length=593

 Score =   148 bits (374),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 77/84 (92%), Positives = 82/84 (98%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDH+WWWRSFLCGGSTG F+YGYCLYYYYARSDMSGFMQTSFFFGYMAC+CYAFFL
Sbjct  510  QLAAEDHEWWWRSFLCGGSTGFFVYGYCLYYYYARSDMSGFMQTSFFFGYMACICYAFFL  569

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG VGFRA+LFFVRHIY+SIKCE
Sbjct  570  MLGMVGFRASLFFVRHIYKSIKCE  593



>ref|XP_010458976.1| PREDICTED: putative phagocytic receptor 1b [Camelina sativa]
Length=592

 Score =   148 bits (374),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 77/84 (92%), Positives = 80/84 (95%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDH+WWWRSFLCGGSTGLFIY YCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFL
Sbjct  509  QLAAEDHQWWWRSFLCGGSTGLFIYAYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFL  568

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG +GFRAAL FVRHIYRSIKCE
Sbjct  569  MLGTIGFRAALLFVRHIYRSIKCE  592



>ref|NP_001151315.1| transmembrane 9 superfamily protein member 1 precursor [Zea mays]
 gb|ACN28721.1| unknown [Zea mays]
 gb|AFW89069.1| transmembrane 9 family protein member 1 [Zea mays]
Length=593

 Score =   148 bits (374),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 77/84 (92%), Positives = 82/84 (98%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDH+WWWRSFLCGGSTG F+YGYCLYYYYARSDMSGFMQTSFFFGYMAC+CYAFFL
Sbjct  510  QLAAEDHEWWWRSFLCGGSTGFFVYGYCLYYYYARSDMSGFMQTSFFFGYMACICYAFFL  569

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG VGFRA+LFFVRHIY+SIKCE
Sbjct  570  MLGMVGFRASLFFVRHIYKSIKCE  593



>ref|XP_006384123.1| hypothetical protein POPTR_0004s07400g [Populus trichocarpa]
 gb|ERP61920.1| hypothetical protein POPTR_0004s07400g [Populus trichocarpa]
Length=592

 Score =   148 bits (374),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 77/84 (92%), Positives = 82/84 (98%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDH+WWWRSFLCGGSTGLFIYGYCLYYY+ARSDMSGFMQTSFFFGYMACVCY FFL
Sbjct  509  QLAAEDHEWWWRSFLCGGSTGLFIYGYCLYYYFARSDMSGFMQTSFFFGYMACVCYGFFL  568

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG++GFRA+LFFVRHIY SIKCE
Sbjct  569  MLGSIGFRASLFFVRHIYHSIKCE  592



>ref|XP_010069472.1| PREDICTED: putative phagocytic receptor 1b [Eucalyptus grandis]
 gb|KCW57835.1| hypothetical protein EUGRSUZ_H00588 [Eucalyptus grandis]
Length=590

 Score =   148 bits (373),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 78/84 (93%), Positives = 80/84 (95%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDH+WWWRSFLCGGSTGLFIY YCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFL
Sbjct  507  QLAAEDHEWWWRSFLCGGSTGLFIYAYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFL  566

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG VGFRAAL FVRHIYRSIKCE
Sbjct  567  MLGMVGFRAALLFVRHIYRSIKCE  590



>ref|XP_009351612.1| PREDICTED: putative phagocytic receptor 1b [Pyrus x bretschneideri]
Length=592

 Score =   148 bits (373),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 78/84 (93%), Positives = 80/84 (95%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDH WWWRSFLCGGSTGLFIYGYCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFL
Sbjct  509  QLAAEDHGWWWRSFLCGGSTGLFIYGYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFL  568

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG VGFRAAL FVRHIY+SIKCE
Sbjct  569  MLGTVGFRAALLFVRHIYKSIKCE  592



>ref|XP_002305925.2| endomembrane protein 70 [Populus trichocarpa]
 gb|EEE86436.2| endomembrane protein 70 [Populus trichocarpa]
Length=592

 Score =   148 bits (373),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 77/84 (92%), Positives = 82/84 (98%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDH+WWWRSFLCGGSTGLFIYGYCLYYY+ARSDMSGFMQTSFFFGYMACVCY FFL
Sbjct  509  QLAAEDHEWWWRSFLCGGSTGLFIYGYCLYYYFARSDMSGFMQTSFFFGYMACVCYGFFL  568

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG++GFRA+LFFVRHIY SIKCE
Sbjct  569  MLGSIGFRASLFFVRHIYHSIKCE  592



>ref|XP_007210263.1| hypothetical protein PRUPE_ppa003204mg [Prunus persica]
 ref|XP_008240392.1| PREDICTED: putative phagocytic receptor 1b [Prunus mume]
 gb|EMJ11462.1| hypothetical protein PRUPE_ppa003204mg [Prunus persica]
Length=593

 Score =   148 bits (373),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 77/84 (92%), Positives = 80/84 (95%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDH+WWWRSFLCGGSTG+FIY YCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFL
Sbjct  510  QLAAEDHEWWWRSFLCGGSTGIFIYAYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFL  569

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG VGFRAAL FVRHIYRSIKCE
Sbjct  570  MLGTVGFRAALLFVRHIYRSIKCE  593



>gb|KJB15313.1| hypothetical protein B456_002G170500 [Gossypium raimondii]
Length=560

 Score =   147 bits (372),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 77/84 (92%), Positives = 81/84 (96%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDH+WWWRSFLCGGSTGLFIY YCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFL
Sbjct  477  QLAAEDHEWWWRSFLCGGSTGLFIYAYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFL  536

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            +LG VGFRA+LFFVRHIYRSIKCE
Sbjct  537  LLGTVGFRASLFFVRHIYRSIKCE  560



>ref|XP_010939968.1| PREDICTED: transmembrane 9 superfamily member 3-like [Elaeis 
guineensis]
Length=609

 Score =   148 bits (373),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 77/84 (92%), Positives = 81/84 (96%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDH+WWWRSFLCGGSTGLF+YGYCLYYY+ARSDMSGFMQTSFFFGYMAC+CY FFL
Sbjct  526  QLAAEDHEWWWRSFLCGGSTGLFVYGYCLYYYHARSDMSGFMQTSFFFGYMACICYGFFL  585

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG VGFRAAL FVRHIYRSIKCE
Sbjct  586  MLGMVGFRAALLFVRHIYRSIKCE  609



>ref|XP_010105529.1| Putative phagocytic receptor 1b [Morus notabilis]
 gb|EXC05024.1| Putative phagocytic receptor 1b [Morus notabilis]
Length=591

 Score =   147 bits (372),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 78/84 (93%), Positives = 80/84 (95%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDH+WWWRSFLCGGSTGLFIY YCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFL
Sbjct  508  QLAAEDHEWWWRSFLCGGSTGLFIYAYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFL  567

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG VGFRAAL FVRHIYRSIKCE
Sbjct  568  MLGMVGFRAALLFVRHIYRSIKCE  591



>ref|XP_008340538.1| PREDICTED: putative phagocytic receptor 1b [Malus domestica]
Length=592

 Score =   147 bits (372),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 78/84 (93%), Positives = 80/84 (95%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDH WWWRSFLCGGSTGLFIYGYCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFL
Sbjct  509  QLAAEDHGWWWRSFLCGGSTGLFIYGYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFL  568

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG VGFRAAL FVRHIY+SIKCE
Sbjct  569  MLGTVGFRAALLFVRHIYKSIKCE  592



>ref|XP_011005913.1| PREDICTED: transmembrane 9 superfamily member 4-like [Populus 
euphratica]
 ref|XP_011005914.1| PREDICTED: transmembrane 9 superfamily member 4-like [Populus 
euphratica]
Length=592

 Score =   147 bits (372),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 77/84 (92%), Positives = 82/84 (98%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDH+WWWRSFLCGGSTGLFIYGYCLYYY+ARSDMSGFMQTSFFFGYMACVCY FFL
Sbjct  509  QLAAEDHEWWWRSFLCGGSTGLFIYGYCLYYYFARSDMSGFMQTSFFFGYMACVCYGFFL  568

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG++GFRA+LFFVRHIY SIKCE
Sbjct  569  MLGSIGFRASLFFVRHIYHSIKCE  592



>ref|XP_002521900.1| transporter, putative [Ricinus communis]
 gb|EEF40536.1| transporter, putative [Ricinus communis]
Length=588

 Score =   147 bits (372),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 77/84 (92%), Positives = 80/84 (95%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDH+WWWRSFLCGGSTGLFIY YCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFL
Sbjct  505  QLAAEDHEWWWRSFLCGGSTGLFIYAYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFL  564

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG VGFRA+L FVRHIYRSIKCE
Sbjct  565  MLGTVGFRASLLFVRHIYRSIKCE  588



>ref|XP_007031333.1| Endomembrane protein 70 protein family [Theobroma cacao]
 gb|EOY02259.1| Endomembrane protein 70 protein family [Theobroma cacao]
Length=561

 Score =   147 bits (372),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 75/84 (89%), Positives = 79/84 (94%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDH+WWWRSFLCGGSTGLFIY YCLY Y ARSDMSGFMQTSFFFG MAC+CY FFL
Sbjct  478  QLAAEDHEWWWRSFLCGGSTGLFIYAYCLYSYNARSDMSGFMQTSFFFGCMACICYGFFL  537

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLGA+GFRA+LFFVRHIYRSIKCE
Sbjct  538  MLGAIGFRASLFFVRHIYRSIKCE  561



>ref|XP_002521898.1| transporter, putative [Ricinus communis]
 gb|EEF40534.1| transporter, putative [Ricinus communis]
Length=525

 Score =   147 bits (371),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 77/84 (92%), Positives = 80/84 (95%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDH+WWWRSFLCGGSTGLFIY YCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFL
Sbjct  442  QLAAEDHEWWWRSFLCGGSTGLFIYAYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFL  501

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG VGFRA+L FVRHIYRSIKCE
Sbjct  502  MLGTVGFRASLLFVRHIYRSIKCE  525



>gb|KJB15310.1| hypothetical protein B456_002G170500 [Gossypium raimondii]
 gb|KJB15312.1| hypothetical protein B456_002G170500 [Gossypium raimondii]
Length=594

 Score =   147 bits (372),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 77/84 (92%), Positives = 81/84 (96%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDH+WWWRSFLCGGSTGLFIY YCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFL
Sbjct  511  QLAAEDHEWWWRSFLCGGSTGLFIYAYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFL  570

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            +LG VGFRA+LFFVRHIYRSIKCE
Sbjct  571  LLGTVGFRASLFFVRHIYRSIKCE  594



>gb|KHG04463.1| Putative phagocytic receptor 1b [Gossypium arboreum]
Length=629

 Score =   148 bits (373),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 77/84 (92%), Positives = 81/84 (96%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDH+WWWRSF+CGGSTGLFIY YCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFL
Sbjct  546  QLAAEDHEWWWRSFVCGGSTGLFIYAYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFL  605

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG VGFRA+LFFVRHIYRSIKCE
Sbjct  606  MLGTVGFRASLFFVRHIYRSIKCE  629



>ref|XP_010691703.1| PREDICTED: transmembrane 9 superfamily member 2 [Beta vulgaris 
subsp. vulgaris]
Length=592

 Score =   147 bits (372),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 76/84 (90%), Positives = 81/84 (96%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDH+WWWR+FLCGGSTGLFIYGYCLYYYYARSDM+GFMQTSFFFGYMAC+CY FFL
Sbjct  509  QLAAEDHEWWWRAFLCGGSTGLFIYGYCLYYYYARSDMTGFMQTSFFFGYMACICYGFFL  568

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG VGFRA+L FVRHIYRSIKCE
Sbjct  569  MLGTVGFRASLLFVRHIYRSIKCE  592



>ref|XP_011005915.1| PREDICTED: transmembrane 9 superfamily member 4-like [Populus 
euphratica]
 ref|XP_011005916.1| PREDICTED: transmembrane 9 superfamily member 4-like [Populus 
euphratica]
Length=592

 Score =   147 bits (372),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 77/84 (92%), Positives = 82/84 (98%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDH+WWWRSFLCGGSTGLFIYGYCLYYY+ARSDMSGF QTSFFFGYMACVCY FFL
Sbjct  509  QLAAEDHEWWWRSFLCGGSTGLFIYGYCLYYYFARSDMSGFRQTSFFFGYMACVCYGFFL  568

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG++GFRA+LFFVRHIYRSIKCE
Sbjct  569  MLGSIGFRASLFFVRHIYRSIKCE  592



>gb|KHN39489.1| Putative phagocytic receptor 1b [Glycine soja]
Length=561

 Score =   147 bits (371),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 78/84 (93%), Positives = 79/84 (94%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLA EDH+WWWRSFLCGGSTGLFIYGYCLYYYYARSDMSGFMQTSFFFGYMACVCY FFL
Sbjct  478  QLATEDHEWWWRSFLCGGSTGLFIYGYCLYYYYARSDMSGFMQTSFFFGYMACVCYGFFL  537

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG VGFRAAL FVRHIY SIKCE
Sbjct  538  MLGTVGFRAALIFVRHIYHSIKCE  561



>ref|XP_002521899.1| transporter, putative [Ricinus communis]
 gb|EEF40535.1| transporter, putative [Ricinus communis]
Length=592

 Score =   147 bits (372),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 75/84 (89%), Positives = 81/84 (96%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDH+WWWRSFLCGGSTGLFIY YCLYYY+ARS+MSGFMQTSFFFGYMAC+CY FFL
Sbjct  509  QLAAEDHEWWWRSFLCGGSTGLFIYAYCLYYYHARSEMSGFMQTSFFFGYMACICYGFFL  568

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG VGFRA+LFFVRHIY+SIKCE
Sbjct  569  MLGTVGFRASLFFVRHIYKSIKCE  592



>ref|XP_009389646.1| PREDICTED: putative phagocytic receptor 1b [Musa acuminata subsp. 
malaccensis]
Length=599

 Score =   147 bits (372),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 77/84 (92%), Positives = 81/84 (96%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDH+WWWRSFLCGGSTGLF+YGYCLYYY+ARSDMSGFMQTSFFFGYMAC+CY FFL
Sbjct  516  QLAAEDHEWWWRSFLCGGSTGLFVYGYCLYYYHARSDMSGFMQTSFFFGYMACICYGFFL  575

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG VGFRAAL FVRHIYRSIKCE
Sbjct  576  MLGMVGFRAALLFVRHIYRSIKCE  599



>ref|XP_009404153.1| PREDICTED: putative phagocytic receptor 1b [Musa acuminata subsp. 
malaccensis]
Length=587

 Score =   147 bits (372),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 77/84 (92%), Positives = 81/84 (96%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDH+WWWRSFLCGGSTGLF+YGYCLYYY+ARSDMSGFMQTSFFFGYMAC+CY FFL
Sbjct  504  QLAAEDHEWWWRSFLCGGSTGLFVYGYCLYYYFARSDMSGFMQTSFFFGYMACICYGFFL  563

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG VGF AALFFVRHIYRSIKCE
Sbjct  564  MLGTVGFHAALFFVRHIYRSIKCE  587



>ref|XP_010932502.1| PREDICTED: transmembrane 9 superfamily member 3-like [Elaeis 
guineensis]
 ref|XP_010932503.1| PREDICTED: transmembrane 9 superfamily member 3-like [Elaeis 
guineensis]
Length=597

 Score =   147 bits (372),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 76/84 (90%), Positives = 81/84 (96%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDH+WWWR+FLCGGSTGLFIYGYCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFL
Sbjct  514  QLAAEDHEWWWRAFLCGGSTGLFIYGYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFL  573

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG +GFRA+L FVRHIYRSIKCE
Sbjct  574  MLGTIGFRASLLFVRHIYRSIKCE  597



>gb|AHA84153.1| phagocytic receptor 1b [Phaseolus vulgaris]
Length=588

 Score =   147 bits (372),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 78/84 (93%), Positives = 80/84 (95%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDH+WWWRSFLCGGSTGLFIY YCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFL
Sbjct  505  QLAAEDHEWWWRSFLCGGSTGLFIYAYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFL  564

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG VGFRAAL FVRHIYRSIKCE
Sbjct  565  MLGTVGFRAALLFVRHIYRSIKCE  588



>ref|XP_010066537.1| PREDICTED: putative phagocytic receptor 1b [Eucalyptus grandis]
 gb|KCW64446.1| hypothetical protein EUGRSUZ_G02064 [Eucalyptus grandis]
Length=598

 Score =   147 bits (372),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 77/84 (92%), Positives = 81/84 (96%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDH+WWWRSFLCGGSTGLFIYGYCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFL
Sbjct  515  QLAAEDHEWWWRSFLCGGSTGLFIYGYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFL  574

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG VGFRA+L FVRHIY+SIKCE
Sbjct  575  MLGMVGFRASLLFVRHIYKSIKCE  598



>ref|XP_008789222.1| PREDICTED: putative phagocytic receptor 1b [Phoenix dactylifera]
 ref|XP_008789223.1| PREDICTED: putative phagocytic receptor 1b [Phoenix dactylifera]
 ref|XP_008789224.1| PREDICTED: putative phagocytic receptor 1b [Phoenix dactylifera]
 ref|XP_008789225.1| PREDICTED: putative phagocytic receptor 1b [Phoenix dactylifera]
 ref|XP_008789226.1| PREDICTED: putative phagocytic receptor 1b [Phoenix dactylifera]
Length=595

 Score =   147 bits (371),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 76/84 (90%), Positives = 81/84 (96%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDH+WWWR+FLCGGSTGLFIYGYCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFL
Sbjct  512  QLAAEDHEWWWRAFLCGGSTGLFIYGYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFL  571

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG +GFRA+L FVRHIYRSIKCE
Sbjct  572  MLGTIGFRASLLFVRHIYRSIKCE  595



>ref|XP_006283389.1| hypothetical protein CARUB_v10004434mg [Capsella rubella]
 ref|XP_006283390.1| hypothetical protein CARUB_v10004434mg [Capsella rubella]
 gb|EOA16287.1| hypothetical protein CARUB_v10004434mg [Capsella rubella]
 gb|EOA16288.1| hypothetical protein CARUB_v10004434mg [Capsella rubella]
Length=590

 Score =   147 bits (371),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 76/84 (90%), Positives = 80/84 (95%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDH+WWWRSFLCGGSTGLFIY YCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFL
Sbjct  507  QLAAEDHEWWWRSFLCGGSTGLFIYAYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFL  566

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG +GFRA+L FVRHIYRSIKCE
Sbjct  567  MLGTIGFRASLLFVRHIYRSIKCE  590



>ref|XP_008798135.1| PREDICTED: putative phagocytic receptor 1b [Phoenix dactylifera]
Length=592

 Score =   147 bits (370),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 77/84 (92%), Positives = 81/84 (96%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDH+WWWRSFLCGGSTGLFIYGYCLYYY+ARSDMSGF+QTSFFFGYMAC+CY FFL
Sbjct  509  QLAAEDHEWWWRSFLCGGSTGLFIYGYCLYYYHARSDMSGFLQTSFFFGYMACICYGFFL  568

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG VGFRAAL FVRHIYRSIKCE
Sbjct  569  MLGMVGFRAALLFVRHIYRSIKCE  592



>ref|XP_007045410.1| Endomembrane protein 70 protein family isoform 2 [Theobroma cacao]
 gb|EOY01242.1| Endomembrane protein 70 protein family isoform 2 [Theobroma cacao]
Length=594

 Score =   147 bits (370),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 77/84 (92%), Positives = 80/84 (95%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDH+WWWRSFLCGGSTGLFIY YCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFL
Sbjct  511  QLAAEDHEWWWRSFLCGGSTGLFIYAYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFL  570

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG VGFRA+L FVRHIYRSIKCE
Sbjct  571  MLGTVGFRASLLFVRHIYRSIKCE  594



>ref|XP_002870515.1| transporter [Arabidopsis lyrata subsp. lyrata]
 gb|EFH46774.1| transporter [Arabidopsis lyrata subsp. lyrata]
Length=593

 Score =   147 bits (370),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 76/84 (90%), Positives = 80/84 (95%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDH+WWWRS LCGGSTGLFIY YCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFL
Sbjct  510  QLAAEDHEWWWRSLLCGGSTGLFIYAYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFL  569

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLGA+GFRA+L FVRHIYRSIKCE
Sbjct  570  MLGAIGFRASLLFVRHIYRSIKCE  593



>ref|XP_007045409.1| Endomembrane protein 70 protein family isoform 1 [Theobroma cacao]
 gb|EOY01241.1| Endomembrane protein 70 protein family isoform 1 [Theobroma cacao]
Length=594

 Score =   147 bits (370),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 77/84 (92%), Positives = 80/84 (95%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDH+WWWRSFLCGGSTGLFIY YCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFL
Sbjct  511  QLAAEDHEWWWRSFLCGGSTGLFIYAYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFL  570

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG VGFRA+L FVRHIYRSIKCE
Sbjct  571  MLGTVGFRASLLFVRHIYRSIKCE  594



>gb|AFK33397.1| unknown [Medicago truncatula]
Length=419

 Score =   145 bits (366),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 76/84 (90%), Positives = 79/84 (94%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QL AEDH+WWWRSFLCGGSTGLFIY YCLYYYYARSDMSGFMQT FFFGYMAC+C+ FFL
Sbjct  336  QLVAEDHEWWWRSFLCGGSTGLFIYAYCLYYYYARSDMSGFMQTPFFFGYMACICFGFFL  395

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG VGFRAALFFVRHIYRSIKCE
Sbjct  396  MLGTVGFRAALFFVRHIYRSIKCE  419



>ref|XP_006405901.1| hypothetical protein EUTSA_v10027693mg [Eutrema salsugineum]
 ref|XP_006405902.1| hypothetical protein EUTSA_v10027693mg [Eutrema salsugineum]
 gb|ESQ47354.1| hypothetical protein EUTSA_v10027693mg [Eutrema salsugineum]
 gb|ESQ47355.1| hypothetical protein EUTSA_v10027693mg [Eutrema salsugineum]
Length=595

 Score =   147 bits (370),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 75/84 (89%), Positives = 81/84 (96%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLA+EDH+WWWRS LCGGSTGLFIY YCLYYYYARSDM+GFMQTSFFFGYMAC+CY FFL
Sbjct  512  QLASEDHEWWWRSLLCGGSTGLFIYAYCLYYYYARSDMTGFMQTSFFFGYMACICYGFFL  571

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLGA+GFRA+LFFVRHIYRSIKCE
Sbjct  572  MLGAIGFRASLFFVRHIYRSIKCE  595



>gb|KDP38191.1| hypothetical protein JCGZ_04834 [Jatropha curcas]
Length=591

 Score =   147 bits (370),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 78/84 (93%), Positives = 79/84 (94%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDH WWWRSFLCGGSTGLFIY YCLYYYYARSDMSGFMQTSFFFGYMACVCY FFL
Sbjct  508  QLAAEDHGWWWRSFLCGGSTGLFIYAYCLYYYYARSDMSGFMQTSFFFGYMACVCYGFFL  567

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG VGFRA+L FVRHIYRSIKCE
Sbjct  568  MLGTVGFRASLLFVRHIYRSIKCE  591



>gb|KHG00678.1| Putative phagocytic receptor 1b [Gossypium arboreum]
Length=528

 Score =   146 bits (369),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 76/84 (90%), Positives = 80/84 (95%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDH+WWWRSFLCGGSTG+FIY YCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFL
Sbjct  445  QLAAEDHEWWWRSFLCGGSTGIFIYAYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFL  504

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG VGFRA+L FVRHIYRSIKCE
Sbjct  505  MLGTVGFRASLLFVRHIYRSIKCE  528



>ref|XP_003544357.1| PREDICTED: putative phagocytic receptor 1b-like [Glycine max]
Length=593

 Score =   147 bits (370),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 78/84 (93%), Positives = 79/84 (94%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLA EDH+WWWRSFLCGGSTGLFIYGYCLYYYYARSDMSGFMQTSFFFGYMACVCY FFL
Sbjct  510  QLATEDHEWWWRSFLCGGSTGLFIYGYCLYYYYARSDMSGFMQTSFFFGYMACVCYGFFL  569

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG VGFRAAL FVRHIY SIKCE
Sbjct  570  MLGTVGFRAALIFVRHIYHSIKCE  593



>gb|KJB60873.1| hypothetical protein B456_009G329300 [Gossypium raimondii]
Length=537

 Score =   146 bits (369),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 76/84 (90%), Positives = 80/84 (95%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDH+WWWRSFLCGGSTG+FIY YCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFL
Sbjct  454  QLAAEDHEWWWRSFLCGGSTGIFIYAYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFL  513

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG VGFRA+L FVRHIYRSIKCE
Sbjct  514  MLGTVGFRASLLFVRHIYRSIKCE  537



>gb|KJB60874.1| hypothetical protein B456_009G329300 [Gossypium raimondii]
Length=594

 Score =   146 bits (369),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 76/84 (90%), Positives = 80/84 (95%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDH+WWWRSFLCGGSTG+FIY YCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFL
Sbjct  511  QLAAEDHEWWWRSFLCGGSTGIFIYAYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFL  570

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG VGFRA+L FVRHIYRSIKCE
Sbjct  571  MLGTVGFRASLLFVRHIYRSIKCE  594



>ref|XP_008787887.1| PREDICTED: putative phagocytic receptor 1b isoform X1 [Phoenix 
dactylifera]
Length=592

 Score =   146 bits (369),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 78/84 (93%), Positives = 80/84 (95%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDH+WWWRSFLCGGSTGLFIYGYCLYYYYARSDMSGFMQTSFFF YMAC+CY FFL
Sbjct  509  QLAAEDHEWWWRSFLCGGSTGLFIYGYCLYYYYARSDMSGFMQTSFFFRYMACICYGFFL  568

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG VGFRAAL FVRHIYRSIKCE
Sbjct  569  MLGMVGFRAALLFVRHIYRSIKCE  592



>ref|XP_009108077.1| PREDICTED: putative phagocytic receptor 1b [Brassica rapa]
Length=592

 Score =   146 bits (369),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 75/84 (89%), Positives = 81/84 (96%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDH+WWWRS LCGGSTG+F+Y YCLYYYYARSDM+GFMQTSFFFGYMAC+CY FFL
Sbjct  509  QLAAEDHEWWWRSLLCGGSTGVFVYAYCLYYYYARSDMTGFMQTSFFFGYMACICYGFFL  568

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLGAVGFRA+LFFVRHIYRSIKCE
Sbjct  569  MLGAVGFRASLFFVRHIYRSIKCE  592



>emb|CDY62621.1| BnaC08g46810D [Brassica napus]
Length=592

 Score =   146 bits (369),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 75/84 (89%), Positives = 81/84 (96%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDH+WWWRS LCGGSTG+F+Y YCLYYYYARSDM+GFMQTSFFFGYMAC+CY FFL
Sbjct  509  QLAAEDHEWWWRSLLCGGSTGVFVYAYCLYYYYARSDMTGFMQTSFFFGYMACICYGFFL  568

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLGAVGFRA+LFFVRHIYRSIKCE
Sbjct  569  MLGAVGFRASLFFVRHIYRSIKCE  592



>ref|XP_007141945.1| hypothetical protein PHAVU_008G239300g [Phaseolus vulgaris]
 gb|ESW13939.1| hypothetical protein PHAVU_008G239300g [Phaseolus vulgaris]
Length=596

 Score =   146 bits (369),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 77/84 (92%), Positives = 79/84 (94%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLA EDH+WWWRSFLCGGSTGLFIYGYCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFL
Sbjct  513  QLATEDHEWWWRSFLCGGSTGLFIYGYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFL  572

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG VGFRAAL FVRHIY SIKCE
Sbjct  573  MLGTVGFRAALIFVRHIYHSIKCE  596



>emb|CDY47549.1| BnaA08g07380D [Brassica napus]
Length=592

 Score =   146 bits (369),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 75/84 (89%), Positives = 81/84 (96%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDH+WWWRS LCGGSTG+F+Y YCLYYYYARSDM+GFMQTSFFFGYMAC+CY FFL
Sbjct  509  QLAAEDHEWWWRSLLCGGSTGVFVYAYCLYYYYARSDMTGFMQTSFFFGYMACICYGFFL  568

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLGAVGFRA+LFFVRHIYRSIKCE
Sbjct  569  MLGAVGFRASLFFVRHIYRSIKCE  592



>ref|XP_010527833.1| PREDICTED: putative phagocytic receptor 1b [Tarenaya hassleriana]
Length=593

 Score =   146 bits (369),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 76/84 (90%), Positives = 80/84 (95%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDH+WWWRSF+CGGSTG+FIY YCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFL
Sbjct  510  QLAAEDHEWWWRSFVCGGSTGVFIYAYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFL  569

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG VGFRAAL FVRHIYRSIKCE
Sbjct  570  MLGTVGFRAALLFVRHIYRSIKCE  593



>gb|KHN41041.1| Putative phagocytic receptor 1b [Glycine soja]
Length=588

 Score =   146 bits (368),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 78/84 (93%), Positives = 79/84 (94%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLA EDH+WWWRSFLCGGSTGLFIYGYCLYYYYARSDMSGFMQTSFFFGYMACVCY FFL
Sbjct  505  QLATEDHEWWWRSFLCGGSTGLFIYGYCLYYYYARSDMSGFMQTSFFFGYMACVCYGFFL  564

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG VGFRAAL FVRHIY SIKCE
Sbjct  565  MLGTVGFRAALIFVRHIYLSIKCE  588



>ref|XP_010435562.1| PREDICTED: putative phagocytic receptor 1b [Camelina sativa]
Length=589

 Score =   146 bits (368),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 75/84 (89%), Positives = 80/84 (95%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDH+WWWRS LCGGSTGLFIY YCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFL
Sbjct  506  QLAAEDHEWWWRSLLCGGSTGLFIYAYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFL  565

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG++GFRA+L FVRHIYRSIKCE
Sbjct  566  MLGSIGFRASLLFVRHIYRSIKCE  589



>ref|XP_010450487.1| PREDICTED: putative phagocytic receptor 1b [Camelina sativa]
Length=593

 Score =   146 bits (368),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 75/84 (89%), Positives = 80/84 (95%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDH+WWWRS LCGGSTGLFIY YCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFL
Sbjct  510  QLAAEDHEWWWRSLLCGGSTGLFIYAYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFL  569

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG++GFRA+L FVRHIYRSIKCE
Sbjct  570  MLGSIGFRASLLFVRHIYRSIKCE  593



>ref|XP_010502204.1| PREDICTED: putative phagocytic receptor 1b [Camelina sativa]
Length=592

 Score =   145 bits (367),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 75/84 (89%), Positives = 81/84 (96%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDH+WWWRSFLCGGSTG+FIY YCLYYYYARSDMSGFMQTS+FFGYMAC+CY FFL
Sbjct  509  QLAAEDHEWWWRSFLCGGSTGVFIYAYCLYYYYARSDMSGFMQTSYFFGYMACICYGFFL  568

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLGAVGFR++L FVRHIYRSIKCE
Sbjct  569  MLGAVGFRSSLLFVRHIYRSIKCE  592



>ref|XP_010513951.1| PREDICTED: putative phagocytic receptor 1b [Camelina sativa]
 ref|XP_010424990.1| PREDICTED: putative phagocytic receptor 1b [Camelina sativa]
Length=592

 Score =   145 bits (367),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 75/84 (89%), Positives = 81/84 (96%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDH+WWWRSFLCGGSTG+FIY YCLYYYYARSDMSGFMQTS+FFGYMAC+CY FFL
Sbjct  509  QLAAEDHEWWWRSFLCGGSTGVFIYAYCLYYYYARSDMSGFMQTSYFFGYMACICYGFFL  568

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLGAVGFR++L FVRHIYRSIKCE
Sbjct  569  MLGAVGFRSSLLFVRHIYRSIKCE  592



>ref|XP_010440841.1| PREDICTED: putative phagocytic receptor 1b isoform X1 [Camelina 
sativa]
Length=587

 Score =   145 bits (367),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 75/84 (89%), Positives = 80/84 (95%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDH+WWWRS LCGGSTGLFIY YCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFL
Sbjct  504  QLAAEDHEWWWRSLLCGGSTGLFIYAYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFL  563

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG++GFRA+L FVRHIYRSIKCE
Sbjct  564  MLGSIGFRASLLFVRHIYRSIKCE  587



>ref|XP_008389133.1| PREDICTED: putative phagocytic receptor 1b [Malus domestica]
Length=591

 Score =   145 bits (367),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 77/84 (92%), Positives = 80/84 (95%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDH WWWRSFLCGGSTGLFIYGYCLYYYYARSDM+GFMQTSFFFGYMAC+CY FFL
Sbjct  508  QLAAEDHWWWWRSFLCGGSTGLFIYGYCLYYYYARSDMTGFMQTSFFFGYMACICYGFFL  567

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG VGFRAAL FVRHIY+SIKCE
Sbjct  568  MLGTVGFRAALLFVRHIYKSIKCE  591



>ref|XP_006470811.1| PREDICTED: putative phagocytic receptor 1b-like [Citrus sinensis]
Length=593

 Score =   145 bits (367),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 76/84 (90%), Positives = 80/84 (95%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDH+WWWRSFLCGGSTG+FIY YCLYYYYARSDMSGFMQTSFFFGYMACVCY FFL
Sbjct  510  QLAAEDHEWWWRSFLCGGSTGVFIYAYCLYYYYARSDMSGFMQTSFFFGYMACVCYGFFL  569

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG VGFRA+L FVRHIY+SIKCE
Sbjct  570  MLGTVGFRASLLFVRHIYKSIKCE  593



>ref|XP_006431397.1| hypothetical protein CICLE_v10000657mg [Citrus clementina]
 gb|ESR44637.1| hypothetical protein CICLE_v10000657mg [Citrus clementina]
Length=593

 Score =   145 bits (367),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 76/84 (90%), Positives = 80/84 (95%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDH+WWWRSFLCGGSTG+FIY YCLYYYYARSDMSGFMQTSFFFGYMACVCY FFL
Sbjct  510  QLAAEDHEWWWRSFLCGGSTGVFIYAYCLYYYYARSDMSGFMQTSFFFGYMACVCYGFFL  569

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG VGFRA+L FVRHIY+SIKCE
Sbjct  570  MLGTVGFRASLLFVRHIYKSIKCE  593



>ref|XP_009419338.1| PREDICTED: putative phagocytic receptor 1b [Musa acuminata subsp. 
malaccensis]
Length=593

 Score =   145 bits (367),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 76/84 (90%), Positives = 80/84 (95%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDH+WWWRSFLCGGSTG+F+Y YCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFL
Sbjct  510  QLAAEDHEWWWRSFLCGGSTGVFVYAYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFL  569

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG VGFRAAL FVRHIYRSIKCE
Sbjct  570  MLGMVGFRAALLFVRHIYRSIKCE  593



>gb|EPS73142.1| hypothetical protein M569_01612 [Genlisea aurea]
Length=540

 Score =   145 bits (366),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 79/84 (94%), Positives = 80/84 (95%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDH WWWRSFLCGGSTGLFIYGYC+YYYYARSDMSGFMQTSFFFGYMA VCY FFL
Sbjct  457  QLAAEDHGWWWRSFLCGGSTGLFIYGYCIYYYYARSDMSGFMQTSFFFGYMASVCYGFFL  516

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG VGFRAALFFVRHIYRSIKCE
Sbjct  517  MLGGVGFRAALFFVRHIYRSIKCE  540



>ref|XP_011085893.1| PREDICTED: transmembrane 9 superfamily member 2-like [Sesamum 
indicum]
Length=587

 Score =   145 bits (366),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 75/84 (89%), Positives = 78/84 (93%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QL AEDH+WWWRSFLCGGSTG+FIY YCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFL
Sbjct  504  QLVAEDHEWWWRSFLCGGSTGIFIYSYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFL  563

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG VGFRAAL FVRHIY SIKCE
Sbjct  564  MLGTVGFRAALLFVRHIYHSIKCE  587



>ref|XP_006448062.1| hypothetical protein CICLE_v10014688mg [Citrus clementina]
 gb|ESR61302.1| hypothetical protein CICLE_v10014688mg [Citrus clementina]
Length=531

 Score =   145 bits (365),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 76/84 (90%), Positives = 79/84 (94%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDH+WWWRSFLCGGSTG FIY YCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFL
Sbjct  448  QLAAEDHEWWWRSFLCGGSTGAFIYAYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFL  507

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG VGFRA+L FVRHIYRSIKCE
Sbjct  508  MLGTVGFRASLLFVRHIYRSIKCE  531



>ref|XP_009380058.1| PREDICTED: putative phagocytic receptor 1b [Musa acuminata subsp. 
malaccensis]
Length=587

 Score =   145 bits (365),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 74/84 (88%), Positives = 80/84 (95%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLA+EDH+WWWRS+LCGGSTGLF+YGYC YYY+ARSDMSGFMQTSFFFGYMAC+CY FFL
Sbjct  504  QLASEDHEWWWRSYLCGGSTGLFVYGYCFYYYFARSDMSGFMQTSFFFGYMACICYGFFL  563

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG VGFRAAL FVRHIYRSIKCE
Sbjct  564  MLGMVGFRAALLFVRHIYRSIKCE  587



>ref|XP_006448061.1| hypothetical protein CICLE_v10014688mg [Citrus clementina]
 ref|XP_006492286.1| PREDICTED: putative phagocytic receptor 1b-like isoform X1 [Citrus 
sinensis]
 ref|XP_006492287.1| PREDICTED: putative phagocytic receptor 1b-like isoform X2 [Citrus 
sinensis]
 gb|ESR61301.1| hypothetical protein CICLE_v10014688mg [Citrus clementina]
Length=593

 Score =   145 bits (365),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 76/84 (90%), Positives = 79/84 (94%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDH+WWWRSFLCGGSTG FIY YCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFL
Sbjct  510  QLAAEDHEWWWRSFLCGGSTGAFIYAYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFL  569

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG VGFRA+L FVRHIYRSIKCE
Sbjct  570  MLGTVGFRASLLFVRHIYRSIKCE  593



>ref|XP_010261665.1| PREDICTED: putative phagocytic receptor 1b [Nelumbo nucifera]
Length=644

 Score =   145 bits (366),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 75/84 (89%), Positives = 79/84 (94%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLA EDH+WWWRS LCGGSTG+FIYGYCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFL
Sbjct  561  QLAVEDHEWWWRSVLCGGSTGVFIYGYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFL  620

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG VGFRA+L FVRHIYRSIKCE
Sbjct  621  MLGTVGFRASLLFVRHIYRSIKCE  644



>ref|XP_003518365.2| PREDICTED: putative phagocytic receptor 1b-like isoform X1 [Glycine 
max]
Length=592

 Score =   145 bits (365),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 76/84 (90%), Positives = 79/84 (94%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLA EDH+WWWRSFLCGGSTGLFIYGYCLYYYYARSDMSGFMQT+FFFGYMAC+CY FFL
Sbjct  509  QLATEDHEWWWRSFLCGGSTGLFIYGYCLYYYYARSDMSGFMQTTFFFGYMACICYGFFL  568

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG VGFRAAL FVRHIY SIKCE
Sbjct  569  MLGTVGFRAALIFVRHIYLSIKCE  592



>ref|XP_006575472.1| PREDICTED: putative phagocytic receptor 1b-like isoform X2 [Glycine 
max]
Length=594

 Score =   145 bits (365),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 76/84 (90%), Positives = 79/84 (94%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLA EDH+WWWRSFLCGGSTGLFIYGYCLYYYYARSDMSGFMQT+FFFGYMAC+CY FFL
Sbjct  511  QLATEDHEWWWRSFLCGGSTGLFIYGYCLYYYYARSDMSGFMQTTFFFGYMACICYGFFL  570

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG VGFRAAL FVRHIY SIKCE
Sbjct  571  MLGTVGFRAALIFVRHIYLSIKCE  594



>ref|NP_001148367.1| transmembrane 9 superfamily protein member 1 precursor [Zea mays]
 gb|ACG31130.1| transmembrane 9 superfamily protein member 1 precursor [Zea mays]
 gb|ACN29105.1| unknown [Zea mays]
 gb|AFW57246.1| putative Transmembrane 9 family protein member 1 [Zea mays]
Length=589

 Score =   144 bits (364),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 72/84 (86%), Positives = 78/84 (93%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLA EDH+WWWRS LCGGSTG+FI+ YC+YYY+ARSDMSGFMQTSFFFGYM CVCY FFL
Sbjct  506  QLAVEDHQWWWRSVLCGGSTGIFIFFYCIYYYHARSDMSGFMQTSFFFGYMTCVCYGFFL  565

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG VGFRA+LFFVRHIYRSIKCE
Sbjct  566  MLGTVGFRASLFFVRHIYRSIKCE  589



>ref|XP_001699211.1| EMP/nonaspanin domain family protein [Chlamydomonas reinhardtii]
 gb|EDO98851.1| EMP/nonaspanin domain family protein [Chlamydomonas reinhardtii]
Length=594

 Score =   144 bits (363),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 75/84 (89%), Positives = 79/84 (94%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLA EDH+WWWRSFLCGGSTGLF+YGYC YYYYARSDMSGFMQTSFFFGY A VCYAFFL
Sbjct  511  QLAVEDHRWWWRSFLCGGSTGLFVYGYCFYYYYARSDMSGFMQTSFFFGYNAVVCYAFFL  570

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLGAVGFRA+L FVRHIYR+IKCE
Sbjct  571  MLGAVGFRASLLFVRHIYRAIKCE  594



>ref|XP_003573450.1| PREDICTED: putative phagocytic receptor 1b [Brachypodium distachyon]
Length=588

 Score =   144 bits (363),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 72/84 (86%), Positives = 77/84 (92%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLA EDHKWWWRS LCGGSTG+FI+ YC+YYY+ARSDMSGFMQTSFFFGYM CVCY FFL
Sbjct  505  QLAVEDHKWWWRSVLCGGSTGIFIFFYCIYYYHARSDMSGFMQTSFFFGYMTCVCYGFFL  564

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG VGFRA+L FVRHIYRSIKCE
Sbjct  565  MLGTVGFRASLLFVRHIYRSIKCE  588



>gb|AES99151.2| transmembrane 9 family protein [Medicago truncatula]
Length=591

 Score =   144 bits (363),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 72/84 (86%), Positives = 80/84 (95%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDH+WWWRSFLCGGSTGLFIYGYC+++Y+ARSDMSGFMQTSFFFGYMAC+CY FFL
Sbjct  508  QLAAEDHEWWWRSFLCGGSTGLFIYGYCMFFYHARSDMSGFMQTSFFFGYMACICYGFFL  567

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG V FRA+L FVRHIYRS+KCE
Sbjct  568  MLGTVSFRASLIFVRHIYRSLKCE  591



>ref|XP_010528590.1| PREDICTED: putative phagocytic receptor 1b [Tarenaya hassleriana]
Length=595

 Score =   144 bits (363),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 74/84 (88%), Positives = 79/84 (94%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDH+WWWRSFLCGGSTGLFIY YCLYYY+ARSDMSGFMQTSFFFGYMAC+CY FFL
Sbjct  512  QLAAEDHEWWWRSFLCGGSTGLFIYVYCLYYYHARSDMSGFMQTSFFFGYMACICYGFFL  571

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG +GFRA+L FVRHIY SIKCE
Sbjct  572  MLGTIGFRASLVFVRHIYGSIKCE  595



>dbj|BAJ89513.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=590

 Score =   144 bits (362),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 72/84 (86%), Positives = 77/84 (92%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLA EDHKWWWRS LCGGSTG+FI+ YC+YYY+ARSDMSGFMQTSFFFGYM CVCY FFL
Sbjct  507  QLAVEDHKWWWRSVLCGGSTGIFIFFYCIYYYHARSDMSGFMQTSFFFGYMTCVCYGFFL  566

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG VGFRA+L FVRHIYRSIKCE
Sbjct  567  MLGTVGFRASLLFVRHIYRSIKCE  590



>gb|EMS60954.1| Putative phagocytic receptor 1b [Triticum urartu]
Length=590

 Score =   144 bits (362),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 72/84 (86%), Positives = 77/84 (92%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLA EDHKWWWRS LCGGSTG+FI+ YC+YYY+ARSDMSGFMQTSFFFGYM CVCY FFL
Sbjct  507  QLAVEDHKWWWRSVLCGGSTGIFIFFYCIYYYHARSDMSGFMQTSFFFGYMTCVCYGFFL  566

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG VGFRA+L FVRHIYRSIKCE
Sbjct  567  MLGTVGFRASLLFVRHIYRSIKCE  590



>gb|EMT19161.1| Putative phagocytic receptor 1b [Aegilops tauschii]
Length=590

 Score =   144 bits (362),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 72/84 (86%), Positives = 77/84 (92%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLA EDHKWWWRS LCGGSTG+FI+ YC+YYY+ARSDMSGFMQTSFFFGYM CVCY FFL
Sbjct  507  QLAVEDHKWWWRSVLCGGSTGIFIFFYCIYYYHARSDMSGFMQTSFFFGYMTCVCYGFFL  566

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG VGFRA+L FVRHIYRSIKCE
Sbjct  567  MLGTVGFRASLLFVRHIYRSIKCE  590



>ref|XP_010523409.1| PREDICTED: putative phagocytic receptor 1b [Tarenaya hassleriana]
 ref|XP_010523411.1| PREDICTED: putative phagocytic receptor 1b isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010523412.1| PREDICTED: putative phagocytic receptor 1b isoform X2 [Tarenaya 
hassleriana]
 ref|XP_010523413.1| PREDICTED: putative phagocytic receptor 1b isoform X3 [Tarenaya 
hassleriana]
Length=592

 Score =   143 bits (361),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 71/84 (85%), Positives = 81/84 (96%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDH+WWWRSFLCGGSTG+FIYGYC+YYYY RSDM+GFMQTSFFFGYMAC+CY FFL
Sbjct  509  QLAAEDHEWWWRSFLCGGSTGMFIYGYCVYYYYGRSDMTGFMQTSFFFGYMACICYGFFL  568

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG++GFR++L FVRHIY+SIKCE
Sbjct  569  MLGSIGFRSSLLFVRHIYKSIKCE  592



>ref|XP_010910473.1| PREDICTED: transmembrane 9 superfamily member 2-like isoform 
X1 [Elaeis guineensis]
Length=590

 Score =   143 bits (361),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 71/84 (85%), Positives = 78/84 (93%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDH+WWWRS LCGGSTG+FI+ YC+YYY+ARSDMSGFMQTSFFFGYM C+CY FFL
Sbjct  507  QLAAEDHEWWWRSVLCGGSTGIFIFFYCIYYYHARSDMSGFMQTSFFFGYMTCICYGFFL  566

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG VGFRA+L FVRHIYRSIKCE
Sbjct  567  MLGTVGFRASLLFVRHIYRSIKCE  590



>ref|NP_001064040.1| Os10g0112600 [Oryza sativa Japonica Group]
 gb|AAP51848.2| Endomembrane protein 70 containing protein, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF25954.1| Os10g0112600 [Oryza sativa Japonica Group]
 dbj|BAG94270.1| unnamed protein product [Oryza sativa Japonica Group]
Length=585

 Score =   143 bits (360),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 72/84 (86%), Positives = 77/84 (92%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QL AEDH+WWWRSFLCGGSTG F++ YCLYYY  RSDMSGFMQTSFFFGYMAC+CYAFFL
Sbjct  502  QLTAEDHEWWWRSFLCGGSTGFFVFAYCLYYYRERSDMSGFMQTSFFFGYMACICYAFFL  561

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG VGFRAAL FVRHIY+SIKCE
Sbjct  562  MLGMVGFRAALLFVRHIYKSIKCE  585



>ref|XP_008788644.1| PREDICTED: putative phagocytic receptor 1b [Phoenix dactylifera]
 ref|XP_008788651.1| PREDICTED: putative phagocytic receptor 1b [Phoenix dactylifera]
Length=588

 Score =   143 bits (360),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 72/84 (86%), Positives = 78/84 (93%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLA EDH+WWWRS LCGGSTG+FI+ YCLYYY+ARSDMSGFMQTSFFFGYMAC+CY FFL
Sbjct  505  QLAVEDHEWWWRSVLCGGSTGIFIFFYCLYYYHARSDMSGFMQTSFFFGYMACICYGFFL  564

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG VGFRA+L FVRHIYRSIKCE
Sbjct  565  MLGTVGFRASLLFVRHIYRSIKCE  588



>ref|XP_010276746.1| PREDICTED: putative phagocytic receptor 1b [Nelumbo nucifera]
Length=590

 Score =   143 bits (360),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 72/84 (86%), Positives = 79/84 (94%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLA EDH+WWWRS LCGGSTG+FIYGYC++YY+ARSDMSGFMQTSFFFGYMAC+CY FFL
Sbjct  507  QLAVEDHEWWWRSVLCGGSTGVFIYGYCIFYYFARSDMSGFMQTSFFFGYMACICYGFFL  566

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG VGFRA+L FVRHIYRSIKCE
Sbjct  567  MLGTVGFRASLLFVRHIYRSIKCE  590



>ref|XP_009615620.1| PREDICTED: putative phagocytic receptor 1b isoform X4 [Nicotiana 
tomentosiformis]
Length=557

 Score =   143 bits (360),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 75/84 (89%), Positives = 79/84 (94%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDHKWWWRSFL GGST +FIYGYCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFL
Sbjct  474  QLAAEDHKWWWRSFLYGGSTSIFIYGYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFL  533

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG VGFR++L FVRHIYRSIKCE
Sbjct  534  MLGTVGFRSSLLFVRHIYRSIKCE  557



>ref|XP_006854108.1| hypothetical protein AMTR_s00048p00146310 [Amborella trichopoda]
 gb|ERN15575.1| hypothetical protein AMTR_s00048p00146310 [Amborella trichopoda]
Length=631

 Score =   143 bits (360),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 74/84 (88%), Positives = 78/84 (93%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLA EDH+WWWRS LCGGSTG+FI GYCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFL
Sbjct  548  QLAVEDHEWWWRSVLCGGSTGVFILGYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFL  607

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG VGFRA+L FVRHIYRSIKCE
Sbjct  608  MLGTVGFRASLLFVRHIYRSIKCE  631



>ref|XP_009615618.1| PREDICTED: putative phagocytic receptor 1b isoform X2 [Nicotiana 
tomentosiformis]
Length=575

 Score =   142 bits (359),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 75/84 (89%), Positives = 79/84 (94%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDHKWWWRSFL GGST +FIYGYCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFL
Sbjct  492  QLAAEDHKWWWRSFLYGGSTSIFIYGYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFL  551

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG VGFR++L FVRHIYRSIKCE
Sbjct  552  MLGTVGFRSSLLFVRHIYRSIKCE  575



>ref|XP_009615617.1| PREDICTED: putative phagocytic receptor 1b isoform X1 [Nicotiana 
tomentosiformis]
Length=596

 Score =   142 bits (359),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 75/84 (89%), Positives = 79/84 (94%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDHKWWWRSFL GGST +FIYGYCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFL
Sbjct  513  QLAAEDHKWWWRSFLYGGSTSIFIYGYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFL  572

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG VGFR++L FVRHIYRSIKCE
Sbjct  573  MLGTVGFRSSLLFVRHIYRSIKCE  596



>ref|XP_009615619.1| PREDICTED: putative phagocytic receptor 1b isoform X3 [Nicotiana 
tomentosiformis]
Length=563

 Score =   142 bits (359),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 75/84 (89%), Positives = 79/84 (94%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDHKWWWRSFL GGST +FIYGYCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFL
Sbjct  480  QLAAEDHKWWWRSFLYGGSTSIFIYGYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFL  539

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG VGFR++L FVRHIYRSIKCE
Sbjct  540  MLGTVGFRSSLLFVRHIYRSIKCE  563



>ref|XP_006659860.1| PREDICTED: putative phagocytic receptor 1b-like [Oryza brachyantha]
Length=590

 Score =   142 bits (359),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 71/84 (85%), Positives = 77/84 (92%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLA EDH+WWWRS LCGGSTG+FI+ YC+YYY+ARSDMSGFMQTSFFFGYM CVCY FFL
Sbjct  507  QLAVEDHEWWWRSILCGGSTGIFIFFYCIYYYHARSDMSGFMQTSFFFGYMTCVCYGFFL  566

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG VGFRA+L FVRHIYRSIKCE
Sbjct  567  MLGTVGFRASLLFVRHIYRSIKCE  590



>dbj|BAC57816.1| putative syntaxin SYP111 [Oryza sativa Japonica Group]
Length=589

 Score =   142 bits (359),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 71/84 (85%), Positives = 77/84 (92%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLA EDH+WWWRS LCGGSTG+FI+ YC+YYY+ARSDMSGFMQTSFFFGYM CVCY FFL
Sbjct  506  QLAVEDHEWWWRSVLCGGSTGIFIFFYCIYYYHARSDMSGFMQTSFFFGYMTCVCYGFFL  565

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG VGFRA+L FVRHIYRSIKCE
Sbjct  566  MLGTVGFRASLLFVRHIYRSIKCE  589



>gb|EEC82941.1| hypothetical protein OsI_27915 [Oryza sativa Indica Group]
Length=592

 Score =   142 bits (358),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 71/84 (85%), Positives = 77/84 (92%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLA EDH+WWWRS LCGGSTG+FI+ YC+YYY+ARSDMSGFMQTSFFFGYM CVCY FFL
Sbjct  509  QLAVEDHEWWWRSVLCGGSTGIFIFFYCIYYYHARSDMSGFMQTSFFFGYMTCVCYGFFL  568

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG VGFRA+L FVRHIYRSIKCE
Sbjct  569  MLGTVGFRASLLFVRHIYRSIKCE  592



>ref|XP_008813153.1| PREDICTED: putative phagocytic receptor 1b [Phoenix dactylifera]
Length=590

 Score =   142 bits (358),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 70/84 (83%), Positives = 77/84 (92%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLA EDH+WWWRS LCGGSTG+FI+ YC+YYY+ARSDMSGFMQTSFFFGYM C+CY FFL
Sbjct  507  QLAVEDHEWWWRSILCGGSTGIFIFFYCIYYYHARSDMSGFMQTSFFFGYMTCICYGFFL  566

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG VGFRA+L FVRHIYRSIKCE
Sbjct  567  MLGTVGFRASLLFVRHIYRSIKCE  590



>gb|KJB43178.1| hypothetical protein B456_007G188200 [Gossypium raimondii]
Length=541

 Score =   142 bits (357),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 73/84 (87%), Positives = 78/84 (93%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDH WWWRSFLCGGSTGLF+Y YC YYY A+SDMSGFMQTSFFFGYMAC+CY FFL
Sbjct  458  QLAAEDHGWWWRSFLCGGSTGLFMYAYCFYYYSAQSDMSGFMQTSFFFGYMACICYGFFL  517

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLGA+GF A+LFFVRHIYRSIKCE
Sbjct  518  MLGAIGFCASLFFVRHIYRSIKCE  541



>ref|XP_004972769.1| PREDICTED: putative phagocytic receptor 1b-like isoform X2 [Setaria 
italica]
Length=589

 Score =   142 bits (357),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 71/84 (85%), Positives = 77/84 (92%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLA EDH+WWWRS LCGGSTG+FI+ YC+YYY+ARSDMSGFMQTSFFFGYM CVCY FFL
Sbjct  506  QLAVEDHQWWWRSVLCGGSTGIFIFFYCIYYYHARSDMSGFMQTSFFFGYMTCVCYGFFL  565

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            ML  VGFRA+LFFVRHIYRSIKCE
Sbjct  566  MLSTVGFRASLFFVRHIYRSIKCE  589



>gb|ADQ43185.1| endomemebrane protein 70 [Schrenkiella parvula]
Length=587

 Score =   142 bits (357),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 77/84 (92%), Positives = 79/84 (94%), Gaps = 1/84 (1%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDH+WWW SFLCGGSTGLFIY YCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFL
Sbjct  505  QLAAEDHEWWW-SFLCGGSTGLFIYAYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFL  563

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG VGFRAAL FVRHIYRSIKCE
Sbjct  564  MLGTVGFRAALLFVRHIYRSIKCE  587



>ref|XP_009408099.1| PREDICTED: putative phagocytic receptor 1b [Musa acuminata subsp. 
malaccensis]
Length=589

 Score =   142 bits (357),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 70/84 (83%), Positives = 77/84 (92%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDH+WWWRS LCGGSTG+FI+ YC+YYY ARSDMSGFMQTSFFFGYM C+CY FFL
Sbjct  506  QLAAEDHEWWWRSVLCGGSTGIFIFFYCIYYYQARSDMSGFMQTSFFFGYMTCICYGFFL  565

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG VGFRA+L FVRHIY+SIKCE
Sbjct  566  MLGTVGFRASLLFVRHIYQSIKCE  589



>ref|XP_006364083.1| PREDICTED: putative phagocytic receptor 1b-like [Solanum tuberosum]
Length=597

 Score =   142 bits (357),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 75/84 (89%), Positives = 78/84 (93%), Gaps = 1/84 (1%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDHKWWWRSFLCGGSTGLFIY YCLYYY ARS MSGFMQTSFFFGYMAC+CY FFL
Sbjct  515  QLAAEDHKWWWRSFLCGGSTGLFIYTYCLYYY-ARSGMSGFMQTSFFFGYMACICYGFFL  573

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG +GFRA+L FVRHIYRSIKCE
Sbjct  574  MLGTIGFRASLLFVRHIYRSIKCE  597



>ref|XP_010920041.1| PREDICTED: transmembrane 9 superfamily member 2-like isoform 
X1 [Elaeis guineensis]
Length=588

 Score =   141 bits (356),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 71/84 (85%), Positives = 78/84 (93%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLA EDH+WWWRS LCGGSTG+FI+ YCLYYY+ARSDMSGFMQTSFFFGYMAC+CY FFL
Sbjct  505  QLAVEDHEWWWRSVLCGGSTGIFIFFYCLYYYHARSDMSGFMQTSFFFGYMACICYGFFL  564

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG VGFRA+L FV+HIYRSIKCE
Sbjct  565  MLGTVGFRASLLFVQHIYRSIKCE  588



>gb|KJB43179.1| hypothetical protein B456_007G188200 [Gossypium raimondii]
 gb|KJB43180.1| hypothetical protein B456_007G188200 [Gossypium raimondii]
Length=589

 Score =   141 bits (356),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 73/84 (87%), Positives = 78/84 (93%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDH WWWRSFLCGGSTGLF+Y YC YYY A+SDMSGFMQTSFFFGYMAC+CY FFL
Sbjct  506  QLAAEDHGWWWRSFLCGGSTGLFMYAYCFYYYSAQSDMSGFMQTSFFFGYMACICYGFFL  565

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLGA+GF A+LFFVRHIYRSIKCE
Sbjct  566  MLGAIGFCASLFFVRHIYRSIKCE  589



>ref|NP_198547.3| putative endomembrane protein 70 [Arabidopsis thaliana]
 sp|Q9FHT4.1|TMN4_ARATH RecName: Full=Transmembrane 9 superfamily member 4; AltName: 
Full=Endomembrane protein 10; AltName: Full=Transmembrane nine 
protein 4; Short=AtTMN4; Flags: Precursor [Arabidopsis thaliana]
 dbj|BAB09103.1| endosomal protein-like [Arabidopsis thaliana]
 dbj|BAE99006.1| multispanning membrane protein - like [Arabidopsis thaliana]
 gb|AED94164.1| putative endomembrane protein 70 [Arabidopsis thaliana]
Length=593

 Score =   141 bits (356),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 74/84 (88%), Positives = 78/84 (93%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDH+WWWRS LCGGSTGLFIY YCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFL
Sbjct  510  QLAAEDHEWWWRSLLCGGSTGLFIYAYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFL  569

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG +GF A+L FVRHIYRSIKCE
Sbjct  570  MLGTIGFCASLLFVRHIYRSIKCE  593



>ref|XP_009784371.1| PREDICTED: putative phagocytic receptor 1b isoform X2 [Nicotiana 
sylvestris]
Length=562

 Score =   141 bits (355),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 71/84 (85%), Positives = 77/84 (92%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDHKWWWRSF+CGGST +FIY YCLYYYY RSDMSGFMQ SFFFGYMAC+CY FFL
Sbjct  479  QLAAEDHKWWWRSFICGGSTSIFIYSYCLYYYYTRSDMSGFMQISFFFGYMACICYGFFL  538

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG VGFR+++ FVRHIYRSIKCE
Sbjct  539  MLGTVGFRSSMLFVRHIYRSIKCE  562



>ref|XP_009784372.1| PREDICTED: putative phagocytic receptor 1b isoform X3 [Nicotiana 
sylvestris]
Length=550

 Score =   141 bits (355),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 71/84 (85%), Positives = 77/84 (92%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDHKWWWRSF+CGGST +FIY YCLYYYY RSDMSGFMQ SFFFGYMAC+CY FFL
Sbjct  467  QLAAEDHKWWWRSFICGGSTSIFIYSYCLYYYYTRSDMSGFMQISFFFGYMACICYGFFL  526

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG VGFR+++ FVRHIYRSIKCE
Sbjct  527  MLGTVGFRSSMLFVRHIYRSIKCE  550



>ref|XP_009784369.1| PREDICTED: putative phagocytic receptor 1b isoform X1 [Nicotiana 
sylvestris]
Length=595

 Score =   141 bits (355),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 71/84 (85%), Positives = 77/84 (92%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDHKWWWRSF+CGGST +FIY YCLYYYY RSDMSGFMQ SFFFGYMAC+CY FFL
Sbjct  512  QLAAEDHKWWWRSFICGGSTSIFIYSYCLYYYYTRSDMSGFMQISFFFGYMACICYGFFL  571

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG VGFR+++ FVRHIYRSIKCE
Sbjct  572  MLGTVGFRSSMLFVRHIYRSIKCE  595



>ref|XP_009784373.1| PREDICTED: putative phagocytic receptor 1b isoform X4 [Nicotiana 
sylvestris]
Length=495

 Score =   140 bits (354),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 71/84 (85%), Positives = 77/84 (92%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDHKWWWRSF+CGGST +FIY YCLYYYY RSDMSGFMQ SFFFGYMAC+CY FFL
Sbjct  412  QLAAEDHKWWWRSFICGGSTSIFIYSYCLYYYYTRSDMSGFMQISFFFGYMACICYGFFL  471

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG VGFR+++ FVRHIYRSIKCE
Sbjct  472  MLGTVGFRSSMLFVRHIYRSIKCE  495



>ref|XP_004972768.1| PREDICTED: putative phagocytic receptor 1b-like isoform X1 [Setaria 
italica]
Length=768

 Score =   142 bits (358),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 71/84 (85%), Positives = 77/84 (92%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLA EDH+WWWRS LCGGSTG+FI+ YC+YYY+ARSDMSGFMQTSFFFGYM CVCY FFL
Sbjct  685  QLAVEDHQWWWRSVLCGGSTGIFIFFYCIYYYHARSDMSGFMQTSFFFGYMTCVCYGFFL  744

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            ML  VGFRA+LFFVRHIYRSIKCE
Sbjct  745  MLSTVGFRASLFFVRHIYRSIKCE  768



>ref|XP_006661606.1| PREDICTED: putative phagocytic receptor 1b-like [Oryza brachyantha]
Length=586

 Score =   140 bits (354),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 71/84 (85%), Positives = 79/84 (94%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QL +EDH+WWWRSFLCGGSTG F++GYCLYYY+ RSDMSGFMQTSFFFGYMAC+CYAFFL
Sbjct  503  QLTSEDHEWWWRSFLCGGSTGFFVFGYCLYYYHERSDMSGFMQTSFFFGYMACICYAFFL  562

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG VGFRA+L FVRHIY+SIKCE
Sbjct  563  MLGMVGFRASLLFVRHIYKSIKCE  586



>gb|EEC74833.1| hypothetical protein OsI_10676 [Oryza sativa Indica Group]
Length=1316

 Score =   144 bits (362),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 75/82 (91%), Positives = 80/82 (98%), Gaps = 0/82 (0%)
 Frame = -3

Query  653   QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
             QLAAEDH+WWWRSFLCGGSTG F+YGYCLYYYYARSDMSGFMQTSFFFGYMAC+CYAFFL
Sbjct  939   QLAAEDHEWWWRSFLCGGSTGFFVYGYCLYYYYARSDMSGFMQTSFFFGYMACICYAFFL  998

Query  473   MLGAVGFRAALFFVRHIYRSIK  408
             MLG +GFRAALFFVRHIY+SIK
Sbjct  999   MLGMIGFRAALFFVRHIYKSIK  1020



>gb|ABK24901.1| unknown [Picea sitchensis]
Length=585

 Score =   140 bits (353),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 71/84 (85%), Positives = 78/84 (93%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLA EDH+WWWRS LCGGSTG+FI+GYCLYYY+ARSDM+GFMQTSFFFGYM C+CY FFL
Sbjct  502  QLAVEDHEWWWRSVLCGGSTGVFIFGYCLYYYFARSDMNGFMQTSFFFGYMTCICYGFFL  561

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG VGFRA+L FVRHIYRSIKCE
Sbjct  562  MLGTVGFRASLLFVRHIYRSIKCE  585



>gb|ABR16201.1| unknown [Picea sitchensis]
Length=585

 Score =   140 bits (353),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 70/84 (83%), Positives = 78/84 (93%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLA EDH+WWWRS LCGGSTG+FI+GYC+YYY+ARSDM+GFMQTSFFFGYM C+CY FFL
Sbjct  502  QLAVEDHQWWWRSVLCGGSTGVFIFGYCVYYYFARSDMTGFMQTSFFFGYMTCICYGFFL  561

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG VGFRA+L FVRHIYRSIKCE
Sbjct  562  MLGTVGFRASLLFVRHIYRSIKCE  585



>ref|XP_004490795.1| PREDICTED: putative phagocytic receptor 1b-like [Cicer arietinum]
Length=593

 Score =   140 bits (353),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 72/84 (86%), Positives = 77/84 (92%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDH WW RSFLCGGSTGLFIYGYC+++Y ARSDMSGFMQTSFFFGYMAC+CY FFL
Sbjct  510  QLAAEDHDWWGRSFLCGGSTGLFIYGYCMFFYNARSDMSGFMQTSFFFGYMACICYGFFL  569

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG VGFRA+L FVRHIY SIKCE
Sbjct  570  MLGTVGFRASLIFVRHIYHSIKCE  593



>gb|KHG20583.1| Putative phagocytic receptor 1b [Gossypium arboreum]
Length=589

 Score =   139 bits (351),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 71/84 (85%), Positives = 77/84 (92%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDH WWWRSFLCGGSTGLF+Y YC Y+Y A+SDMSG MQTSFFFGYMAC+CY FFL
Sbjct  506  QLAAEDHGWWWRSFLCGGSTGLFMYAYCFYFYSAQSDMSGLMQTSFFFGYMACICYGFFL  565

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLGA+GF A+LFFVRHIYRSIKCE
Sbjct  566  MLGAIGFCASLFFVRHIYRSIKCE  589



>ref|XP_010099693.1| Putative phagocytic receptor 1b [Morus notabilis]
 gb|EXB80270.1| Putative phagocytic receptor 1b [Morus notabilis]
Length=637

 Score =   140 bits (352),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 83/107 (78%), Gaps = 16/107 (15%)
 Frame = -3

Query  653  QLAAEDHKWWWR----------------SFLCGGSTGLFIygyclyyyYARSDMSGFMQT  522
            QLAAEDH+WWWR                SFLCGGSTG+FIY YCLYYYYARSDMSGFMQT
Sbjct  507  QLAAEDHEWWWRIGHRLVVLNDVSYVGRSFLCGGSTGIFIYAYCLYYYYARSDMSGFMQT  566

Query  521  SFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE*AARHPV  381
            SFFFGYMAC+CY FFLMLG VGFRAAL FVRHIYRSIKC+  A H +
Sbjct  567  SFFFGYMACICYGFFLMLGTVGFRAALLFVRHIYRSIKCDDGASHAI  613



>ref|XP_006849485.1| hypothetical protein AMTR_s00024p00115620 [Amborella trichopoda]
 gb|ERN11066.1| hypothetical protein AMTR_s00024p00115620 [Amborella trichopoda]
Length=591

 Score =   138 bits (348),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 73/84 (87%), Positives = 77/84 (92%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDH+WWWRS L GGSTG FI+GYCLYYYY RSDMSGFMQTSFFFGYMAC+CY FFL
Sbjct  508  QLAAEDHEWWWRSLLYGGSTGFFIFGYCLYYYYVRSDMSGFMQTSFFFGYMACICYGFFL  567

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG VGFRA+L FVRHIYRSIKCE
Sbjct  568  MLGTVGFRASLLFVRHIYRSIKCE  591



>ref|XP_002974646.1| hypothetical protein SELMODRAFT_101645 [Selaginella moellendorffii]
 gb|EFJ24166.1| hypothetical protein SELMODRAFT_101645 [Selaginella moellendorffii]
Length=589

 Score =   138 bits (347),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 69/84 (82%), Positives = 77/84 (92%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLA EDH+WWWRS  CGGSTGLF+YGYC YYY+ARSDM+G MQTSFFFGYMACVCY FFL
Sbjct  506  QLAIEDHEWWWRSVFCGGSTGLFVYGYCYYYYFARSDMTGLMQTSFFFGYMACVCYGFFL  565

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG+VG+RA+L FVRHIYR+IKCE
Sbjct  566  MLGSVGYRASLLFVRHIYRAIKCE  589



>ref|XP_002963357.1| hypothetical protein SELMODRAFT_166118 [Selaginella moellendorffii]
 gb|EFJ35228.1| hypothetical protein SELMODRAFT_166118 [Selaginella moellendorffii]
Length=589

 Score =   138 bits (347),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 69/84 (82%), Positives = 77/84 (92%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLA EDH+WWWRS  CGGSTGLF+YGYC YYY+ARSDM+G MQTSFFFGYMACVCY FFL
Sbjct  506  QLAIEDHEWWWRSVFCGGSTGLFVYGYCYYYYFARSDMTGLMQTSFFFGYMACVCYGFFL  565

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG+VG+RA+L FVRHIYR+IKCE
Sbjct  566  MLGSVGYRASLLFVRHIYRAIKCE  589



>ref|XP_001770691.1| predicted protein [Physcomitrella patens]
 gb|EDQ64515.1| predicted protein [Physcomitrella patens]
Length=590

 Score =   137 bits (345),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 70/84 (83%), Positives = 78/84 (93%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLA EDH+WWWR+ LCGGSTG+FI+GYC YYYYARSDMSGFMQTSFFFGYMAC+CY FFL
Sbjct  507  QLAVEDHEWWWRAVLCGGSTGVFIFGYCFYYYYARSDMSGFMQTSFFFGYMACICYGFFL  566

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG+VGFRA+  FVRHIY+SIKCE
Sbjct  567  MLGSVGFRASHLFVRHIYQSIKCE  590



>ref|XP_002956625.1| hypothetical protein VOLCADRAFT_110022 [Volvox carteri f. nagariensis]
 gb|EFJ42227.1| hypothetical protein VOLCADRAFT_110022 [Volvox carteri f. nagariensis]
Length=605

 Score =   137 bits (346),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 71/84 (85%), Positives = 77/84 (92%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLA EDH+WWWRSFLCGGSTG+F+YGYC YYYYARSDMSGFMQTSFFFGYM  VCY FFL
Sbjct  522  QLAVEDHQWWWRSFLCGGSTGIFVYGYCFYYYYARSDMSGFMQTSFFFGYMLMVCYGFFL  581

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG VG+RA+L FVRHIYR+IKCE
Sbjct  582  MLGTVGWRASLMFVRHIYRAIKCE  605



>ref|XP_001775546.1| predicted protein [Physcomitrella patens]
 gb|EDQ59629.1| predicted protein [Physcomitrella patens]
Length=590

 Score =   137 bits (345),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 70/84 (83%), Positives = 78/84 (93%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLA EDH+WWWR+ LCGGSTG+FIYGYC YYYYARSDMSGFMQTSFFFGYMAC+C+ FFL
Sbjct  507  QLAVEDHEWWWRAVLCGGSTGVFIYGYCFYYYYARSDMSGFMQTSFFFGYMACICFGFFL  566

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG+VGFRA+  FVRHIY+SIKCE
Sbjct  567  MLGSVGFRASHLFVRHIYQSIKCE  590



>ref|XP_001689987.1| EMP/nonaspanin domain family protein [Chlamydomonas reinhardtii]
 gb|EDP09725.1| EMP/nonaspanin domain family protein [Chlamydomonas reinhardtii]
Length=605

 Score =   137 bits (345),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 70/84 (83%), Positives = 78/84 (93%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLA EDH+WWWRSFLCGGSTG+F+YGYC YYYYARSDMSGFMQT+FFFGYMA VC+ FFL
Sbjct  522  QLAVEDHQWWWRSFLCGGSTGIFVYGYCFYYYYARSDMSGFMQTTFFFGYMAMVCFGFFL  581

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG VG+RA+L FVRHIYR+IKCE
Sbjct  582  MLGTVGWRASLMFVRHIYRAIKCE  605



>ref|XP_010039016.1| PREDICTED: putative phagocytic receptor 1b [Eucalyptus grandis]
Length=682

 Score =   137 bits (345),  Expect = 1e-33, Method: Composition-based stats.
 Identities = 72/84 (86%), Positives = 75/84 (89%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDHKWWWRSFLCGGSTGLFIYGYCLYYYYARSDM GFMQTSFFFGYMAC+CY   L
Sbjct  599  QLAAEDHKWWWRSFLCGGSTGLFIYGYCLYYYYARSDMDGFMQTSFFFGYMACICYGVSL  658

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            +LG VGF AAL F+R IY SIKCE
Sbjct  659  VLGTVGFCAALLFIRRIYGSIKCE  682



>ref|XP_002952428.1| hypothetical protein VOLCADRAFT_75353 [Volvox carteri f. nagariensis]
 gb|EFJ46571.1| hypothetical protein VOLCADRAFT_75353 [Volvox carteri f. nagariensis]
Length=554

 Score =   136 bits (342),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 72/84 (86%), Positives = 77/84 (92%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLA EDH+WWWRSFLCGGSTG+F+YGYC YYYY RSDMSGFMQTSFFFGY A VCYAFFL
Sbjct  471  QLAVEDHRWWWRSFLCGGSTGIFVYGYCFYYYYVRSDMSGFMQTSFFFGYNAVVCYAFFL  530

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG VGFRA+L FVRHIYR+IKCE
Sbjct  531  MLGTVGFRASLLFVRHIYRAIKCE  554



>ref|XP_004228944.1| PREDICTED: putative phagocytic receptor 1b [Solanum lycopersicum]
Length=594

 Score =   136 bits (342),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 73/84 (87%), Positives = 76/84 (90%), Gaps = 1/84 (1%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDHKWWWRSFLCGGSTGLFIY YCLYYY ARS MSGFMQTS FFGYMAC+CY FFL
Sbjct  512  QLAAEDHKWWWRSFLCGGSTGLFIYTYCLYYY-ARSGMSGFMQTSCFFGYMACICYGFFL  570

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            M G +GFRA+L FVRHIYRSIKCE
Sbjct  571  MFGTIGFRASLLFVRHIYRSIKCE  594



>ref|XP_010037000.1| PREDICTED: putative phagocytic receptor 1b [Eucalyptus grandis]
 gb|KCW48638.1| hypothetical protein EUGRSUZ_K02296 [Eucalyptus grandis]
Length=592

 Score =   135 bits (341),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 73/84 (87%), Positives = 76/84 (90%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDHKWWWRSFLCGGSTGLFIYGYCLYYYYARSDM GFMQTSFFFGYMAC+CY  FL
Sbjct  509  QLAAEDHKWWWRSFLCGGSTGLFIYGYCLYYYYARSDMDGFMQTSFFFGYMACICYGVFL  568

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            +LG VGF AAL F+R IY SIKCE
Sbjct  569  VLGTVGFCAALLFIRRIYGSIKCE  592



>gb|EEE68090.1| hypothetical protein OsJ_26137 [Oryza sativa Japonica Group]
Length=864

 Score =   137 bits (346),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 69/82 (84%), Positives = 75/82 (91%), Gaps = 0/82 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLA EDH+WWWRS LCGGSTG+FI+ YC+YYY+ARSDMSGFMQTSFFFGYM CVCY FFL
Sbjct  509  QLAVEDHEWWWRSVLCGGSTGIFIFFYCIYYYHARSDMSGFMQTSFFFGYMTCVCYGFFL  568

Query  473  MLGAVGFRAALFFVRHIYRSIK  408
            MLG VGFRA+L FVRHIYRSIK
Sbjct  569  MLGTVGFRASLLFVRHIYRSIK  590



>gb|AAK52585.1|AC079685_16 Putative endosomal protein [Oryza sativa Japonica Group]
 gb|AAM44876.1|AC098694_15 Putative endosomal protein [Oryza sativa Japonica Group]
 gb|EAZ15105.1| hypothetical protein OsJ_30519 [Oryza sativa Japonica Group]
Length=627

 Score =   135 bits (341),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 69/81 (85%), Positives = 74/81 (91%), Gaps = 0/81 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QL AEDH+WWWRSFLCGGSTG F++ YCLYYY  RSDMSGFMQTSFFFGYMAC+CYAFFL
Sbjct  499  QLTAEDHEWWWRSFLCGGSTGFFVFAYCLYYYRERSDMSGFMQTSFFFGYMACICYAFFL  558

Query  473  MLGAVGFRAALFFVRHIYRSI  411
            MLG VGFRAAL FVRHIY+SI
Sbjct  559  MLGMVGFRAALLFVRHIYKSI  579



>gb|EEC66468.1| hypothetical protein OsI_32547 [Oryza sativa Indica Group]
Length=631

 Score =   135 bits (341),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 69/81 (85%), Positives = 74/81 (91%), Gaps = 0/81 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QL AEDH+WWWRSFLCGGSTG F++ YCLYYY  RSDMSGFMQTSFFFGYMAC+CYAFFL
Sbjct  503  QLTAEDHEWWWRSFLCGGSTGFFVFAYCLYYYRERSDMSGFMQTSFFFGYMACICYAFFL  562

Query  473  MLGAVGFRAALFFVRHIYRSI  411
            MLG VGFRAAL FVRHIY+SI
Sbjct  563  MLGMVGFRAALLFVRHIYKSI  583



>ref|XP_005650801.1| putative endosomal protein [Coccomyxa subellipsoidea C-169]
 gb|EIE26257.1| putative endosomal protein [Coccomyxa subellipsoidea C-169]
Length=607

 Score =   135 bits (339),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 69/84 (82%), Positives = 77/84 (92%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLA EDH+WWWRSF+CGGSTGLFIYGYC YYY ARSDM G+MQTSFFFGYMACVC AFF+
Sbjct  524  QLALEDHRWWWRSFMCGGSTGLFIYGYCFYYYLARSDMGGWMQTSFFFGYMACVCLAFFI  583

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG +G+RA+L FVRHIYR+IKCE
Sbjct  584  MLGTIGWRASLLFVRHIYRAIKCE  607



>ref|XP_009388099.1| PREDICTED: putative phagocytic receptor 1b [Musa acuminata subsp. 
malaccensis]
 ref|XP_009388100.1| PREDICTED: putative phagocytic receptor 1b [Musa acuminata subsp. 
malaccensis]
Length=586

 Score =   135 bits (339),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 67/84 (80%), Positives = 75/84 (89%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDH+WWWRS LCGGSTG+FI  YC+YYY ARSDMSGFMQTSFFFGYM+C+CY FFL
Sbjct  503  QLAAEDHEWWWRSVLCGGSTGIFILFYCIYYYRARSDMSGFMQTSFFFGYMSCICYGFFL  562

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG +GF A+L FVRHIY+ IKCE
Sbjct  563  MLGTIGFCASLLFVRHIYQLIKCE  586



>gb|KCW48636.1| hypothetical protein EUGRSUZ_K02294, partial [Eucalyptus grandis]
Length=526

 Score =   132 bits (332),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 72/84 (86%), Positives = 75/84 (89%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDHKWWWRSFLCGGSTGLFIYGYCLYYYYARSDM GFMQTSFFFGYMAC+CY   L
Sbjct  443  QLAAEDHKWWWRSFLCGGSTGLFIYGYCLYYYYARSDMDGFMQTSFFFGYMACICYGVSL  502

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            +LG VGF AAL F+R IY SIKCE
Sbjct  503  VLGTVGFCAALLFIRRIYGSIKCE  526



>ref|XP_003059958.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH55910.1| predicted protein [Micromonas pusilla CCMP1545]
Length=614

 Score =   130 bits (328),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 65/84 (77%), Positives = 75/84 (89%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLA EDH+WWWRS LCGGSTG+FIY YC YYYYARSDM+GFMQTSFFFGYM+ +CY FFL
Sbjct  531  QLAVEDHQWWWRSVLCGGSTGVFIYAYCFYYYYARSDMTGFMQTSFFFGYMSVICYGFFL  590

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            +LG +GFRA+  FVRHIY++IKCE
Sbjct  591  LLGNIGFRASSLFVRHIYKAIKCE  614



>ref|XP_009628018.1| PREDICTED: putative phagocytic receptor 1b isoform X2 [Nicotiana 
tomentosiformis]
Length=555

 Score =   129 bits (325),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 66/84 (79%), Positives = 74/84 (88%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDH+WWWRSFLCGGSTGL+++GY  YYY++RSDMSGFMQTSFFFGYMACV Y  FL
Sbjct  472  QLAAEDHEWWWRSFLCGGSTGLYLFGYSFYYYFSRSDMSGFMQTSFFFGYMACVSYGVFL  531

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG +GFRA L FVR +Y SIKCE
Sbjct  532  MLGTIGFRACLLFVRLLYGSIKCE  555



>ref|XP_002317710.2| hypothetical protein POPTR_0012s03920g [Populus trichocarpa]
 gb|EEE95930.2| hypothetical protein POPTR_0012s03920g [Populus trichocarpa]
Length=594

 Score =   129 bits (325),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 70/91 (77%), Positives = 76/91 (84%), Gaps = 0/91 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDH+WWWRSFLCGGSTGLFIY YC YYYYA SDMSGFMQTSF FGYMAC+ +  FL
Sbjct  504  QLAAEDHRWWWRSFLCGGSTGLFIYAYCFYYYYALSDMSGFMQTSFIFGYMACISFGCFL  563

Query  473  MLGAVGFRAALFFVRHIYRSIKCE*AARHPV  381
            MLG VG+ AAL FVRH+Y SIKCE A   P+
Sbjct  564  MLGTVGYLAALRFVRHVYGSIKCEWAVSSPL  594



>ref|XP_009628015.1| PREDICTED: putative phagocytic receptor 1b isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009628016.1| PREDICTED: putative phagocytic receptor 1b isoform X1 [Nicotiana 
tomentosiformis]
Length=592

 Score =   129 bits (325),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 66/84 (79%), Positives = 74/84 (88%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDH+WWWRSFLCGGSTGL+++GY  YYY++RSDMSGFMQTSFFFGYMACV Y  FL
Sbjct  509  QLAAEDHEWWWRSFLCGGSTGLYLFGYSFYYYFSRSDMSGFMQTSFFFGYMACVSYGVFL  568

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG +GFRA L FVR +Y SIKCE
Sbjct  569  MLGTIGFRACLLFVRLLYGSIKCE  592



>ref|XP_005650990.1| EMP/nonaspanin domain family protein [Coccomyxa subellipsoidea 
C-169]
 gb|EIE26446.1| EMP/nonaspanin domain family protein [Coccomyxa subellipsoidea 
C-169]
Length=624

 Score =   130 bits (326),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 67/84 (80%), Positives = 75/84 (89%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLA EDH+WWWRSFLCGGSTGLFI+ YC YYY+ARSDMSGFMQTSFFF YM  +CYAFFL
Sbjct  541  QLAVEDHRWWWRSFLCGGSTGLFIFAYCFYYYFARSDMSGFMQTSFFFCYMGMICYAFFL  600

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLGAVG+RA+L FVRHIY +IK +
Sbjct  601  MLGAVGYRASLTFVRHIYSAIKSD  624



>ref|XP_006376703.1| hypothetical protein POPTR_0012s03920g [Populus trichocarpa]
 gb|ERP54500.1| hypothetical protein POPTR_0012s03920g [Populus trichocarpa]
Length=625

 Score =   129 bits (325),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 70/91 (77%), Positives = 76/91 (84%), Gaps = 0/91 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDH+WWWRSFLCGGSTGLFIY YC YYYYA SDMSGFMQTSF FGYMAC+ +  FL
Sbjct  535  QLAAEDHRWWWRSFLCGGSTGLFIYAYCFYYYYALSDMSGFMQTSFIFGYMACISFGCFL  594

Query  473  MLGAVGFRAALFFVRHIYRSIKCE*AARHPV  381
            MLG VG+ AAL FVRH+Y SIKCE A   P+
Sbjct  595  MLGTVGYLAALRFVRHVYGSIKCEWAVSSPL  625



>ref|XP_010523530.1| PREDICTED: putative phagocytic receptor 1b, partial [Tarenaya 
hassleriana]
Length=277

 Score =   125 bits (313),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 67/82 (82%), Positives = 77/82 (94%), Gaps = 1/82 (1%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDH+WWWRSFLCGGSTG+FIYGYC+YYYY RSDM+GFMQTSFFFGYMAC+CY FFL
Sbjct  189  QLAAEDHEWWWRSFLCGGSTGMFIYGYCVYYYYGRSDMTGFMQTSFFFGYMACICYGFFL  248

Query  473  MLGAVGFRAALFFVRHIYRSIK  408
            MLG++GFR++L FVR I+ SIK
Sbjct  249  MLGSIGFRSSLLFVR-IFFSIK  269



>ref|XP_002973969.1| hypothetical protein SELMODRAFT_173941 [Selaginella moellendorffii]
 gb|EFJ24924.1| hypothetical protein SELMODRAFT_173941 [Selaginella moellendorffii]
Length=591

 Score =   128 bits (321),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 64/84 (76%), Positives = 73/84 (87%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLA EDH WWWRS  CGGST  F+YGYC YYY+ARSDM+G MQTSF+FGYMACVCY FFL
Sbjct  508  QLAMEDHTWWWRSIFCGGSTAFFVYGYCFYYYFARSDMTGLMQTSFYFGYMACVCYGFFL  567

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG VG++A+L FVRHIY++IKCE
Sbjct  568  MLGTVGYQASLLFVRHIYKAIKCE  591



>ref|XP_002969094.1| hypothetical protein SELMODRAFT_170330 [Selaginella moellendorffii]
 gb|EFJ30210.1| hypothetical protein SELMODRAFT_170330 [Selaginella moellendorffii]
Length=591

 Score =   128 bits (321),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 64/84 (76%), Positives = 73/84 (87%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLA EDH WWWRS  CGGST  F+YGYC YYY+ARSDM+G MQTSF+FGYMACVCY FFL
Sbjct  508  QLAMEDHTWWWRSIFCGGSTAFFVYGYCFYYYFARSDMTGLMQTSFYFGYMACVCYGFFL  567

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG VG++A+L FVRHIY++IKCE
Sbjct  568  MLGTVGYQASLLFVRHIYKAIKCE  591



>ref|XP_009782694.1| PREDICTED: putative phagocytic receptor 1b isoform X2 [Nicotiana 
sylvestris]
Length=555

 Score =   127 bits (320),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 66/84 (79%), Positives = 73/84 (87%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDH+WWWRSFLCGGSTGL+++GY  YYY+ RSDMSGFMQTSFFFGYMACV Y  FL
Sbjct  472  QLAAEDHEWWWRSFLCGGSTGLYLFGYSFYYYFLRSDMSGFMQTSFFFGYMACVSYGVFL  531

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG VGFR+ L FVR +Y SIKCE
Sbjct  532  MLGTVGFRSCLLFVRLLYGSIKCE  555



>ref|XP_009782678.1| PREDICTED: putative phagocytic receptor 1b isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009782682.1| PREDICTED: putative phagocytic receptor 1b isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009782687.1| PREDICTED: putative phagocytic receptor 1b isoform X1 [Nicotiana 
sylvestris]
Length=592

 Score =   127 bits (320),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 66/84 (79%), Positives = 73/84 (87%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDH+WWWRSFLCGGSTGL+++GY  YYY+ RSDMSGFMQTSFFFGYMACV Y  FL
Sbjct  509  QLAAEDHEWWWRSFLCGGSTGLYLFGYSFYYYFLRSDMSGFMQTSFFFGYMACVSYGVFL  568

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG VGFR+ L FVR +Y SIKCE
Sbjct  569  MLGTVGFRSCLLFVRLLYGSIKCE  592



>ref|XP_002505642.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO66900.1| predicted protein [Micromonas sp. RCC299]
Length=468

 Score =   126 bits (316),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 66/84 (79%), Positives = 73/84 (87%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLA EDH+WWWR+ LCGGSTG FIYGYC YYYYARSDMSGFMQTSFFFGYM  +CY FFL
Sbjct  385  QLAVEDHEWWWRAVLCGGSTGCFIYGYCFYYYYARSDMSGFMQTSFFFGYMWTICYGFFL  444

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG +GFRA+  FV HIY++IKCE
Sbjct  445  MLGNIGFRASKLFVMHIYKAIKCE  468



>ref|XP_011003771.1| PREDICTED: transmembrane 9 superfamily member 2-like isoform 
X2 [Populus euphratica]
Length=547

 Score =   126 bits (317),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 67/84 (80%), Positives = 73/84 (87%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDH WWWRSFLCGGSTGLFIY YC +YYYAR++MSGFMQTSF FGYMACV +  FL
Sbjct  464  QLAAEDHSWWWRSFLCGGSTGLFIYAYCFHYYYARTEMSGFMQTSFMFGYMACVSFGCFL  523

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG VG+ AAL FVRH+Y SIKCE
Sbjct  524  MLGTVGYLAALRFVRHVYGSIKCE  547



>ref|XP_001755694.1| predicted protein [Physcomitrella patens]
 gb|EDQ79367.1| predicted protein [Physcomitrella patens]
Length=591

 Score =   126 bits (317),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 64/84 (76%), Positives = 73/84 (87%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLA EDH+WWWRS  CGGSTGLFIYGYC YY+  RS M+G MQTSFF+GYM CVCY FFL
Sbjct  508  QLAIEDHEWWWRSVFCGGSTGLFIYGYCFYYHRFRSGMAGLMQTSFFYGYMGCVCYGFFL  567

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            +LG+VG+RA+L FVRHIYR+IKCE
Sbjct  568  LLGSVGYRASLLFVRHIYRAIKCE  591



>ref|XP_011003770.1| PREDICTED: transmembrane 9 superfamily member 2-like isoform 
X1 [Populus euphratica]
Length=586

 Score =   126 bits (317),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 67/84 (80%), Positives = 73/84 (87%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDH WWWRSFLCGGSTGLFIY YC +YYYAR++MSGFMQTSF FGYMACV +  FL
Sbjct  503  QLAAEDHSWWWRSFLCGGSTGLFIYAYCFHYYYARTEMSGFMQTSFMFGYMACVSFGCFL  562

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG VG+ AAL FVRH+Y SIKCE
Sbjct  563  MLGTVGYLAALRFVRHVYGSIKCE  586



>gb|KDD75073.1| endomembrane protein 70 [Helicosporidium sp. ATCC 50920]
Length=558

 Score =   125 bits (315),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 65/84 (77%), Positives = 74/84 (88%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDH+WWWRSFLCGGSTG+F+YGY  YYY ARSDMSGFMQ +F+FGY A VC AFFL
Sbjct  475  QLAAEDHRWWWRSFLCGGSTGIFVYGYSFYYYLARSDMSGFMQATFYFGYNAMVCLAFFL  534

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            +LG VG+RA+L FVR IYR+IKCE
Sbjct  535  ILGYVGWRASLAFVRRIYRAIKCE  558



>ref|XP_006358745.1| PREDICTED: putative phagocytic receptor 1b-like [Solanum tuberosum]
Length=591

 Score =   126 bits (316),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 65/84 (77%), Positives = 73/84 (87%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDH+WWWRSFLCGGSTGL+I+GY +YYY++RSDM+GFMQTSFFFGYMACV Y  FL
Sbjct  508  QLAAEDHEWWWRSFLCGGSTGLYIFGYSIYYYFSRSDMNGFMQTSFFFGYMACVSYGVFL  567

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG VGF A L FVR +Y  IKCE
Sbjct  568  MLGTVGFHACLLFVRLLYGCIKCE  591



>ref|XP_005850808.1| hypothetical protein CHLNCDRAFT_29709 [Chlorella variabilis]
 gb|EFN58706.1| hypothetical protein CHLNCDRAFT_29709 [Chlorella variabilis]
Length=599

 Score =   125 bits (315),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 64/84 (76%), Positives = 72/84 (86%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLA EDH WWWRS +CGGST LFIY YC YY+YARSDM+G MQ SF+FGYM  VCY FFL
Sbjct  516  QLAVEDHSWWWRSVMCGGSTALFIYAYCFYYWYARSDMNGLMQASFYFGYMLMVCYGFFL  575

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG+VGFRA+L FVRHIY++IKCE
Sbjct  576  MLGSVGFRASLGFVRHIYKAIKCE  599



>ref|XP_007512838.1| predicted protein [Bathycoccus prasinos]
 emb|CCO17438.1| predicted protein [Bathycoccus prasinos]
Length=632

 Score =   126 bits (316),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 64/84 (76%), Positives = 72/84 (86%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDH WWWRS  CGGSTG+FI GYC YYY ARSDMSGFMQTSFFFGYM+ +CY FFL
Sbjct  549  QLAAEDHAWWWRSVFCGGSTGIFILGYCFYYYEARSDMSGFMQTSFFFGYMSIICYGFFL  608

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG VGFRA+  FV+HIY++IK +
Sbjct  609  MLGNVGFRASSLFVKHIYKAIKSD  632



>ref|XP_004240860.1| PREDICTED: putative phagocytic receptor 1b isoform X1 [Solanum 
lycopersicum]
 ref|XP_010322124.1| PREDICTED: putative phagocytic receptor 1b isoform X1 [Solanum 
lycopersicum]
Length=591

 Score =   125 bits (313),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 64/84 (76%), Positives = 73/84 (87%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDH+WWWRSFLCGGSTGL+++GY +YYY++RSDM+GFMQTSFFFGYMACV Y  FL
Sbjct  508  QLAAEDHEWWWRSFLCGGSTGLYLFGYSMYYYFSRSDMNGFMQTSFFFGYMACVSYGVFL  567

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG VGF A L FVR +Y  IKCE
Sbjct  568  MLGTVGFHACLLFVRLLYGCIKCE  591



>ref|XP_010322125.1| PREDICTED: putative phagocytic receptor 1b isoform X2 [Solanum 
lycopersicum]
Length=560

 Score =   124 bits (312),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 64/84 (76%), Positives = 73/84 (87%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLAAEDH+WWWRSFLCGGSTGL+++GY +YYY++RSDM+GFMQTSFFFGYMACV Y  FL
Sbjct  477  QLAAEDHEWWWRSFLCGGSTGLYLFGYSMYYYFSRSDMNGFMQTSFFFGYMACVSYGVFL  536

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG VGF A L FVR +Y  IKCE
Sbjct  537  MLGTVGFHACLLFVRLLYGCIKCE  560



>ref|XP_001783681.1| predicted protein [Physcomitrella patens]
 gb|EDQ51511.1| predicted protein [Physcomitrella patens]
Length=586

 Score =   123 bits (309),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 63/84 (75%), Positives = 72/84 (86%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QLA EDH+WWWRS  CGGSTG+FIYGYC YYY+ RS M G MQ SFF+GYM CVCY FFL
Sbjct  503  QLAVEDHEWWWRSVFCGGSTGMFIYGYCFYYYHIRSGMVGLMQASFFYGYMGCVCYGFFL  562

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG+VG+RA+L FVR+IYR+IKCE
Sbjct  563  MLGSVGYRASLLFVRNIYRAIKCE  586



>gb|KDO37844.1| hypothetical protein CISIN_1g034896mg [Citrus sinensis]
Length=80

 Score =   114 bits (285),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 66/73 (90%), Positives = 69/73 (95%), Gaps = 0/73 (0%)
 Frame = -3

Query  620  RSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAAL  441
            RSFLCGGSTG+FIY YCLYYYYARSDMSGFMQTSFFFGYMACVCY FFLMLG VGFRA+L
Sbjct  8    RSFLCGGSTGVFIYAYCLYYYYARSDMSGFMQTSFFFGYMACVCYGFFLMLGTVGFRASL  67

Query  440  FFVRHIYRSIKCE  402
             FVRHIY+SIKCE
Sbjct  68   LFVRHIYKSIKCE  80



>gb|EPS73381.1| hypothetical protein M569_01372, partial [Genlisea aurea]
Length=584

 Score =   122 bits (306),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 64/84 (76%), Positives = 72/84 (86%), Gaps = 0/84 (0%)
 Frame = -3

Query  653  QLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFL  474
            QL AED+ WWWR+FL GGSTG FIY YC YYY++ S+MSGFMQ SFFFGYM+ +CY FFL
Sbjct  501  QLVAEDYHWWWRAFLYGGSTGAFIYVYCFYYYHSLSNMSGFMQASFFFGYMSAICYGFFL  560

Query  473  MLGAVGFRAALFFVRHIYRSIKCE  402
            MLG VGFRAAL FVRHIYR+IKCE
Sbjct  561  MLGMVGFRAALVFVRHIYRAIKCE  584



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1014965446875