BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF009P14

Length=708
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_002266038.1|  PREDICTED: E3 ubiquitin-protein ligase arkad...    200   2e-60   Vitis vinifera
ref|XP_007013686.1|  RING/U-box superfamily protein                     198   9e-60   
emb|CAN73727.1|  hypothetical protein VITISV_034074                     197   3e-59   Vitis vinifera
ref|XP_009768604.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-like    184   3e-54   Nicotiana sylvestris
ref|XP_006359529.1|  PREDICTED: uncharacterized protein LOC102590358    183   7e-54   Solanum tuberosum [potatoes]
ref|XP_004242706.1|  PREDICTED: RING-H2 finger protein ATL30            181   4e-53   Solanum lycopersicum
ref|XP_011017944.1|  PREDICTED: RING finger protein 165-like isof...    178   6e-52   Populus euphratica
gb|KJB23768.1|  hypothetical protein B456_004G114100                    178   8e-52   Gossypium raimondii
gb|KHG08071.1|  Zinc/RING finger 3                                      177   1e-51   Gossypium arboreum [tree cotton]
ref|XP_006372131.1|  hypothetical protein POPTR_0018s12240g             177   1e-51   Populus trichocarpa [western balsam poplar]
ref|XP_002324572.1|  zinc finger family protein                         177   2e-51   
ref|XP_009613106.1|  PREDICTED: E3 ubiquitin-protein ligase RLIM-...    176   6e-51   Nicotiana tomentosiformis
ref|XP_008242900.1|  PREDICTED: NEP1-interacting protein 1              174   2e-50   Prunus mume [ume]
ref|XP_011017945.1|  PREDICTED: RING finger protein 165-like isof...    174   2e-50   Populus euphratica
ref|XP_010265712.1|  PREDICTED: E3 ubiquitin-protein ligase SDIR1       174   3e-50   Nelumbo nucifera [Indian lotus]
ref|XP_009610647.1|  PREDICTED: E3 ubiquitin-protein ligase At3g0...    172   2e-49   
ref|XP_011033494.1|  PREDICTED: E3 ubiquitin-protein ligase EL5-l...    172   3e-49   Populus euphratica
gb|KJB83251.1|  hypothetical protein B456_013G237500                    170   7e-49   Gossypium raimondii
ref|XP_011033493.1|  PREDICTED: E3 ubiquitin-protein ligase EL5-l...    171   7e-49   Populus euphratica
gb|KHG16465.1|  E3 ubiquitin-protein ligase DZIP3                       169   1e-48   Gossypium arboreum [tree cotton]
gb|KJB83252.1|  hypothetical protein B456_013G237500                    169   1e-48   Gossypium raimondii
ref|XP_007202613.1|  hypothetical protein PRUPE_ppa011840mg             169   2e-48   
ref|XP_002309314.1|  zinc finger family protein                         168   5e-48   
ref|XP_004139268.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    167   9e-48   Cucumis sativus [cucumbers]
emb|CDP10512.1|  unnamed protein product                                167   1e-47   Coffea canephora [robusta coffee]
ref|XP_009782022.1|  PREDICTED: E3 ubiquitin-protein ligase At3g0...    166   5e-47   Nicotiana sylvestris
ref|XP_008456717.1|  PREDICTED: RING-H2 finger protein ATL16 isof...    165   8e-47   
gb|AFK38095.1|  unknown                                                 164   1e-46   Lotus japonicus
ref|XP_008456709.1|  PREDICTED: RING-H2 finger protein ATL16 isof...    163   4e-46   Cucumis melo [Oriental melon]
ref|XP_010244774.1|  PREDICTED: E3 ubiquitin-protein ligase TTC3-...    163   4e-46   Nelumbo nucifera [Indian lotus]
ref|XP_004287232.1|  PREDICTED: RING-H2 finger protein ATL16            162   8e-46   Fragaria vesca subsp. vesca
ref|XP_010101184.1|  Zinc/RING finger protein 3                         162   9e-46   
gb|KDP30180.1|  hypothetical protein JCGZ_16962                         159   1e-44   Jatropha curcas
gb|KEH38087.1|  zinc finger, C3HC4 type (RING finger) protein           159   1e-44   Medicago truncatula
emb|CDY36641.1|  BnaA07g04160D                                          158   3e-44   Brassica napus [oilseed rape]
ref|XP_008384706.1|  PREDICTED: E3 ubiquitin-protein ligase EL5         156   2e-43   
ref|XP_009119405.1|  PREDICTED: RING-H2 finger protein ATL54            156   2e-43   Brassica rapa
ref|XP_010049884.1|  PREDICTED: RING finger protein 215-like            155   4e-43   Eucalyptus grandis [rose gum]
ref|XP_010942166.1|  PREDICTED: E3 ubiquitin-protein ligase EL5 i...    154   1e-42   
ref|XP_010047191.1|  PREDICTED: E3 ubiquitin-protein ligase RNF8-...    154   1e-42   Eucalyptus grandis [rose gum]
ref|XP_010942164.1|  PREDICTED: E3 ubiquitin-protein ligase EL5 i...    155   1e-42   
ref|XP_009341797.1|  PREDICTED: E3 ubiquitin-protein ligase EL5-like    154   1e-42   
ref|XP_010942165.1|  PREDICTED: E3 ubiquitin-protein ligase EL5 i...    154   2e-42   Elaeis guineensis
emb|CDY57225.1|  BnaCnng31690D                                          153   4e-42   Brassica napus [oilseed rape]
ref|NP_001238250.1|  uncharacterized protein LOC100527583               153   5e-42   Glycine max [soybeans]
ref|XP_006409544.1|  hypothetical protein EUTSA_v10022864mg             152   6e-42   Eutrema salsugineum [saltwater cress]
gb|KCW82707.1|  hypothetical protein EUGRSUZ_C04088                     152   8e-42   Eucalyptus grandis [rose gum]
ref|XP_010533079.1|  PREDICTED: NEP1-interacting protein 1              151   2e-41   Tarenaya hassleriana [spider flower]
gb|AFK42549.1|  unknown                                                 150   2e-41   Lotus japonicus
ref|XP_009338416.1|  PREDICTED: E3 ubiquitin-protein ligase SDIR1...    151   2e-41   Pyrus x bretschneideri [bai li]
gb|KHN42853.1|  Putative RING finger protein P32A8.03c                  151   3e-41   Glycine soja [wild soybean]
ref|XP_010517354.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    149   7e-41   Camelina sativa [gold-of-pleasure]
ref|XP_006473942.1|  PREDICTED: uncharacterized protein LOC102616965    150   1e-40   Citrus sinensis [apfelsine]
ref|XP_009390573.1|  PREDICTED: E3 ubiquitin-protein ligase SDIR1...    148   2e-40   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009358514.1|  PREDICTED: E3 ubiquitin-protein ligase SDIR1...    148   2e-40   Pyrus x bretschneideri [bai li]
ref|XP_006453710.1|  hypothetical protein CICLE_v10009499mg             149   2e-40   
gb|KFK40025.1|  hypothetical protein AALP_AA3G320300                    147   4e-40   Arabis alpina [alpine rockcress]
ref|XP_010488968.1|  PREDICTED: E3 ubiquitin-protein ligase arkad...    147   4e-40   Camelina sativa [gold-of-pleasure]
ref|XP_010467305.1|  PREDICTED: E3 ubiquitin-protein ligase arkad...    146   1e-39   Camelina sativa [gold-of-pleasure]
ref|XP_002883903.1|  zinc finger family protein                         144   1e-38   
ref|XP_008336937.1|  PREDICTED: E3 ubiquitin-protein ligase EL5-like    144   1e-38   
ref|XP_007138448.1|  hypothetical protein PHAVU_009G209800g             143   2e-38   Phaseolus vulgaris [French bean]
ref|NP_565376.1|  RING/U-box domain-containing protein                  142   7e-38   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010687760.1|  PREDICTED: E3 ubiquitin-protein ligase SDIR1       142   7e-38   Beta vulgaris subsp. vulgaris [field beet]
gb|KFK40024.1|  hypothetical protein AALP_AA3G320300                    142   8e-38   Arabis alpina [alpine rockcress]
gb|KHN48390.1|  Putative RING finger protein P32A8.03c                  141   1e-37   Glycine soja [wild soybean]
ref|XP_006298616.1|  hypothetical protein CARUB_v10014703mg             140   2e-37   Capsella rubella
ref|XP_009401071.1|  PREDICTED: E3 ubiquitin-protein ligase RNF10...    140   3e-37   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009380804.1|  PREDICTED: E3 ubiquitin-protein ligase ZNRF3       135   2e-35   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011078577.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    136   2e-35   Sesamum indicum [beniseed]
ref|XP_010942167.1|  PREDICTED: E3 ubiquitin-protein ligase EL5 i...    129   3e-33   
ref|XP_010942168.1|  PREDICTED: E3 ubiquitin-protein ligase EL5 i...    128   5e-33   
ref|XP_009401072.1|  PREDICTED: E3 ubiquitin-protein ligase RNF10...    129   5e-33   Musa acuminata subsp. malaccensis [pisang utan]
gb|EYU34927.1|  hypothetical protein MIMGU_mgv1a013960mg                127   2e-32   Erythranthe guttata [common monkey flower]
ref|XP_006587140.1|  PREDICTED: E3 ubiquitin-protein ligase RNF14...    120   7e-30   Glycine max [soybeans]
ref|XP_010047193.1|  PREDICTED: RING-H2 finger protein ATL52-like       113   3e-27   Eucalyptus grandis [rose gum]
emb|CBI25596.3|  unnamed protein product                                107   2e-25   Vitis vinifera
gb|EPS73396.1|  hypothetical protein M569_01360                         107   8e-25   Genlisea aurea
ref|XP_009613107.1|  PREDICTED: E3 ubiquitin-protein ligase SDIR1...    103   2e-23   Nicotiana tomentosiformis
ref|XP_006359528.1|  PREDICTED: uncharacterized protein LOC102590043    101   7e-23   Solanum tuberosum [potatoes]
ref|XP_009788592.1|  PREDICTED: RING-H2 finger protein ATL81-like...    100   2e-22   Nicotiana sylvestris
ref|XP_003564209.1|  PREDICTED: uncharacterized protein LOC100830912    101   2e-22   Brachypodium distachyon [annual false brome]
ref|XP_004242708.1|  PREDICTED: RING-box protein 2-like               99.8    3e-22   Solanum lycopersicum
dbj|BAJ89879.1|  predicted protein                                    97.1    1e-20   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001150294.1|  protein binding protein                          96.7    1e-20   
ref|XP_010256161.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  95.1    2e-20   Nelumbo nucifera [Indian lotus]
gb|KHG09461.1|  Chaperone DnaJ                                        93.6    2e-20   Gossypium arboreum [tree cotton]
gb|KJB63341.1|  hypothetical protein B456_010G056400                  92.0    8e-20   Gossypium raimondii
gb|EPS73395.1|  hypothetical protein M569_01359                       90.9    2e-19   Genlisea aurea
ref|XP_002532496.1|  conserved hypothetical protein                   90.9    3e-19   
gb|ADE77485.1|  unknown                                               90.9    1e-18   Picea sitchensis
ref|XP_006359530.1|  PREDICTED: uncharacterized protein LOC102590705  84.0    6e-17   Solanum tuberosum [potatoes]
ref|XP_009613105.1|  PREDICTED: uncharacterized protein LOC104106295  83.6    9e-17   Nicotiana tomentosiformis
ref|XP_004242707.1|  PREDICTED: uncharacterized protein LOC101251003  83.2    1e-16   Solanum lycopersicum
ref|NP_001048401.1|  Os02g0798200                                     84.3    4e-16   
dbj|BAC22255.1|  RING-H2 zinc finger protein-like                     83.6    1e-15   Oryza sativa Japonica Group [Japonica rice]
gb|EEC80129.1|  hypothetical protein OsI_21911                        82.8    1e-15   Oryza sativa Indica Group [Indian rice]
gb|KDP30179.1|  hypothetical protein JCGZ_16961                       79.7    2e-15   Jatropha curcas
gb|EEE57984.1|  hypothetical protein OsJ_08735                        82.0    2e-15   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006848840.1|  hypothetical protein AMTR_s00026p00191500        77.8    9e-15   
ref|XP_003570314.1|  PREDICTED: probable E3 ubiquitin-protein lig...  79.3    2e-14   Brachypodium distachyon [annual false brome]
ref|NP_001236714.1|  uncharacterized protein LOC100500350             75.5    6e-14   Glycine max [soybeans]
ref|XP_006600145.1|  PREDICTED: uncharacterized protein LOC100500...  75.1    6e-14   
ref|XP_010235924.1|  PREDICTED: probable E3 ubiquitin-protein lig...  77.4    8e-14   Brachypodium distachyon [annual false brome]
gb|AEW08590.1|  hypothetical protein CL647Contig1_04                  73.9    1e-13   Pinus radiata
gb|ACN41012.1|  unknown                                               76.3    3e-13   Picea sitchensis
ref|XP_004964679.1|  PREDICTED: E3 ubiquitin-protein ligase EL5-like  75.9    3e-13   
gb|AGU28437.1|  RING/U-box superfamily protein                        73.6    3e-13   Sinapis alba [bai jie]
ref|XP_008777376.1|  PREDICTED: RING finger protein 165-like          73.2    1e-12   Phoenix dactylifera
dbj|BAJ86795.1|  predicted protein                                    73.6    1e-12   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AFK38133.1|  unknown                                               72.4    2e-12   Lotus japonicus
gb|EMS68646.1|  RING-H2 finger protein ATL80                          72.4    2e-12   Triticum urartu
ref|XP_008443904.1|  PREDICTED: uncharacterized protein LOC103487...  71.6    2e-12   Cucumis melo [Oriental melon]
gb|KEH43812.1|  zinc finger, C3HC4 type (RING finger) protein         72.4    2e-12   Medicago truncatula
ref|NP_001189531.1|  RING/U-box domain-containing protein             71.2    3e-12   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008224255.1|  PREDICTED: E3 ubiquitin-protein ligase ZNRF3...  71.2    4e-12   Prunus mume [ume]
gb|ACJ83283.1|  unknown                                               71.2    6e-12   Medicago truncatula
ref|XP_008224257.1|  PREDICTED: E3 ubiquitin-protein ligase SGR9,...  70.9    6e-12   Prunus mume [ume]
ref|XP_004496688.1|  PREDICTED: E3 ubiquitin-protein ligase RNF12...  70.9    7e-12   Cicer arietinum [garbanzo]
ref|XP_011078578.1|  PREDICTED: uncharacterized protein LOC105162272  70.1    1e-11   Sesamum indicum [beniseed]
ref|XP_007223664.1|  hypothetical protein PRUPE_ppa012817mg           70.1    1e-11   Prunus persica
emb|CAN74781.1|  hypothetical protein VITISV_025062                   69.7    2e-11   Vitis vinifera
ref|XP_007223663.1|  hypothetical protein PRUPE_ppa012817mg           69.7    2e-11   Prunus persica
ref|NP_001056975.2|  Os06g0180800                                     68.9    2e-11   
ref|XP_002452986.1|  hypothetical protein SORBIDRAFT_04g036095        70.5    2e-11   
ref|XP_009124562.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...  70.5    2e-11   Brassica rapa
gb|AFW73878.1|  putative RING zinc finger domain superfamily protein  69.7    2e-11   
ref|XP_002283255.1|  PREDICTED: RING-H2 finger protein ATL33          68.9    3e-11   Vitis vinifera
ref|XP_006838971.1|  hypothetical protein AMTR_s00002p00271240        68.6    4e-11   Amborella trichopoda
ref|XP_007143303.1|  hypothetical protein PHAVU_007G061000g           68.6    4e-11   Phaseolus vulgaris [French bean]
gb|EYU34925.1|  hypothetical protein MIMGU_mgv1a016123mg              67.8    5e-11   Erythranthe guttata [common monkey flower]
gb|EMT12553.1|  Putative RING finger protein                          68.2    5e-11   
ref|XP_010932806.1|  PREDICTED: RING-H2 finger protein ATL22-like     68.6    5e-11   Elaeis guineensis
ref|XP_004146704.1|  PREDICTED: uncharacterized protein LOC101215379  67.8    5e-11   Cucumis sativus [cucumbers]
emb|CDY61552.1|  BnaA05g35870D                                        69.3    5e-11   Brassica napus [oilseed rape]
ref|XP_008443905.1|  PREDICTED: uncharacterized protein LOC103487...  67.0    9e-11   Cucumis melo [Oriental melon]
ref|XP_010534845.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  70.1    9e-11   Tarenaya hassleriana [spider flower]
gb|EIE89746.1|  hypothetical protein RO3G_14457                       67.0    1e-10   Rhizopus delemar RA 99-880
ref|XP_002988817.1|  hypothetical protein SELMODRAFT_447476           70.1    1e-10   
emb|CDY16531.1|  BnaA08g02360D                                        68.2    1e-10   Brassica napus [oilseed rape]
ref|XP_001771508.1|  predicted protein                                65.1    1e-10   
ref|XP_009395681.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  67.0    2e-10   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002640470.1|  Hypothetical protein CBG13603                    69.7    2e-10   Caenorhabditis briggsae
emb|CAP32377.2|  Protein CBR-TOE-4                                    69.7    2e-10   Caenorhabditis briggsae
gb|ACU20614.1|  unknown                                               67.0    2e-10   Glycine max [soybeans]
ref|XP_006338779.1|  PREDICTED: E3 ubiquitin-protein ligase RNF12...  66.2    2e-10   Solanum tuberosum [potatoes]
gb|KFK35098.1|  hypothetical protein AALP_AA5G235100                  67.8    3e-10   Arabis alpina [alpine rockcress]
ref|XP_011030369.1|  PREDICTED: uncharacterized protein LOC105129834  67.8    4e-10   Populus euphratica
ref|XP_006369739.1|  hypothetical protein POPTR_0001s30420g           67.4    5e-10   Populus trichocarpa [western balsam poplar]
ref|XP_002527484.1|  conserved hypothetical protein                   67.4    6e-10   Ricinus communis
ref|XP_007215930.1|  hypothetical protein PRUPE_ppa011057mg           66.2    7e-10   Prunus persica
gb|ADE77028.1|  unknown                                               66.2    8e-10   Picea sitchensis
ref|XP_003609511.1|  hypothetical protein MTR_4g116480                63.5    1e-09   
ref|XP_002961734.1|  hypothetical protein SELMODRAFT_69832            63.2    1e-09   
gb|EMT02218.1|  RING finger protein 126                               65.5    1e-09   
gb|KHN24008.1|  E3 ubiquitin-protein ligase RING1                     67.0    1e-09   Glycine soja [wild soybean]
ref|XP_002156770.2|  PREDICTED: RING finger protein 150-like          67.0    1e-09   Hydra vulgaris
ref|XP_007155113.1|  hypothetical protein PHAVU_003G174500g           63.5    1e-09   Phaseolus vulgaris [French bean]
gb|AAC69859.1|  RING-H2 finger protein RHY1a                          63.2    1e-09   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001190129.1|  RING/U-box domain-containing protein             65.9    1e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_001770862.1|  predicted protein                                62.0    1e-09   
gb|KFK35972.1|  hypothetical protein AALP_AA4G061800                  65.5    1e-09   Arabis alpina [alpine rockcress]
ref|XP_010516527.1|  PREDICTED: RING finger protein 165-like isof...  65.9    2e-09   Camelina sativa [gold-of-pleasure]
ref|XP_006392629.1|  hypothetical protein EUTSA_v10012351mg           66.6    2e-09   
ref|XP_006393209.1|  hypothetical protein EUTSA_v10011738mg           65.5    2e-09   Eutrema salsugineum [saltwater cress]
ref|XP_005810331.1|  PREDICTED: E3 ubiquitin-protein ligase RNF11...  66.2    2e-09   Xiphophorus maculatus
ref|XP_010504828.1|  PREDICTED: E3 ubiquitin-protein ligase ATL4-...  65.5    2e-09   Camelina sativa [gold-of-pleasure]
ref|XP_010427777.1|  PREDICTED: RING-H2 finger protein ATL5-like ...  65.5    2e-09   Camelina sativa [gold-of-pleasure]
ref|XP_009136274.1|  PREDICTED: uncharacterized protein LOC103860423  62.8    2e-09   Brassica rapa
ref|XP_004502170.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  66.6    2e-09   Cicer arietinum [garbanzo]
ref|XP_010538621.1|  PREDICTED: E3 ubiquitin-protein ligase RLIM      65.1    2e-09   Tarenaya hassleriana [spider flower]
dbj|BAJ91076.1|  predicted protein                                    66.6    2e-09   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002878235.1|  zinc finger family protein                       65.1    2e-09   
ref|XP_002525456.1|  zinc finger protein, putative                    66.2    2e-09   Ricinus communis
ref|XP_009104168.1|  PREDICTED: RING-H2 finger protein ATL52-like     65.5    2e-09   Brassica rapa
ref|NP_191431.1|  RING/U-box domain-containing protein                64.7    2e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006407223.1|  hypothetical protein EUTSA_v10021230mg           65.9    2e-09   
emb|CDX67761.1|  BnaA07g18010D                                        65.1    2e-09   
gb|EMS59452.1|  E3 ubiquitin-protein ligase RING1-like protein        65.1    3e-09   Triticum urartu
ref|XP_006489448.1|  PREDICTED: RING-H2 finger protein ATL45-like     64.3    3e-09   Citrus sinensis [apfelsine]
gb|KDQ14563.1|  hypothetical protein BOTBODRAFT_32695                 66.2    3e-09   Botryobasidium botryosum FD-172 SS1
gb|KHF98124.1|  E3 ubiquitin-protein ligase RLIM                      65.5    3e-09   Gossypium arboreum [tree cotton]
gb|KJB79429.1|  hypothetical protein B456_013G049100                  65.5    3e-09   Gossypium raimondii
ref|XP_006420021.1|  hypothetical protein CICLE_v10005915mg           63.9    3e-09   Citrus clementina [clementine]
ref|XP_009116555.1|  PREDICTED: RING finger protein 165-like isof...  64.7    3e-09   Brassica rapa
ref|XP_010504829.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...  64.7    3e-09   
ref|NP_564556.1|  RING/U-box superfamily protein                      64.7    3e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009107257.1|  PREDICTED: RING-H2 finger protein ATL72          64.3    3e-09   Brassica rapa
ref|XP_006290435.1|  hypothetical protein CARUB_v10019384mg           64.7    3e-09   
gb|AAG51778.1|AC079674_11  RING-H2 finger protein RHY1a; 24780-23662  64.7    3e-09   Arabidopsis thaliana [mouse-ear cress]
ref|NP_564693.1|  RING/U-box domain-containing protein                65.9    3e-09   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001239785.1|  uncharacterized protein LOC100805406             65.1    3e-09   Glycine max [soybeans]
emb|CDM82953.1|  unnamed protein product                              65.9    3e-09   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010516528.1|  PREDICTED: E3 ubiquitin-protein ligase ATL4-...  64.3    3e-09   
ref|XP_002964809.1|  hypothetical protein SELMODRAFT_9360             60.8    3e-09   
ref|XP_010427778.1|  PREDICTED: E3 ubiquitin-protein ligase ATL4-...  64.3    3e-09   
emb|CDY20854.1|  BnaC05g26380D                                        64.3    4e-09   Brassica napus [oilseed rape]
gb|AES71855.2|  zinc finger, C3HC4 type (RING finger) protein         65.5    4e-09   Medicago truncatula
ref|XP_003601604.1|  RING finger protein                              65.5    4e-09   
ref|XP_009778983.1|  PREDICTED: RING-H2 finger protein ATL79-like     62.8    4e-09   Nicotiana sylvestris
ref|XP_009339205.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  65.5    4e-09   Pyrus x bretschneideri [bai li]
ref|XP_009801324.1|  PREDICTED: RING finger protein 165-like          63.5    4e-09   Nicotiana sylvestris
ref|XP_003565656.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  65.9    4e-09   Brachypodium distachyon [annual false brome]
gb|AAM64325.1|  RING-H2 finger protein RHY1a                          64.3    4e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006446837.1|  hypothetical protein CICLE_v10016257mg           64.3    4e-09   
ref|XP_006446836.1|  hypothetical protein CICLE_v10016257mg           64.7    4e-09   Citrus clementina [clementine]
ref|XP_009365274.1|  PREDICTED: uncharacterized protein LOC103955128  63.9    4e-09   Pyrus x bretschneideri [bai li]
gb|EAR93534.3|  RING-H2 zinc finger protein                           63.2    4e-09   Tetrahymena thermophila SB210
ref|XP_003557291.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  65.5    4e-09   Brachypodium distachyon [annual false brome]
emb|CEG75181.1|  hypothetical protein RMATCC62417_10268               65.5    4e-09   Rhizopus microsporus
ref|XP_008228952.1|  PREDICTED: RING finger protein 215               63.9    4e-09   Prunus mume [ume]
emb|CDW53059.1|  zf-RING 3 and zf-RING 2 domain containing protein    64.3    4e-09   Trichuris trichiura
ref|XP_006445556.1|  hypothetical protein CICLE_v10015642mg           65.5    4e-09   Citrus clementina [clementine]
ref|XP_006468973.1|  PREDICTED: E3 ubiquitin-protein ligase RNF11...  64.3    4e-09   Citrus sinensis [apfelsine]
ref|XP_006468972.1|  PREDICTED: E3 ubiquitin-protein ligase RNF11...  64.7    4e-09   Citrus sinensis [apfelsine]
ref|XP_009116553.1|  PREDICTED: E3 ubiquitin-protein ligase RNF12...  65.1    5e-09   Brassica rapa
emb|CDY26096.1|  BnaC06g11000D                                        64.7    5e-09   Brassica napus [oilseed rape]
ref|XP_009116554.1|  PREDICTED: E3 ubiquitin-protein ligase At3g0...  64.3    5e-09   Brassica rapa
ref|XP_009497252.1|  hypothetical protein H696_05127                  65.9    5e-09   Fonticula alba
gb|EEE65206.1|  hypothetical protein OsJ_20345                        63.9    5e-09   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001055887.2|  Os05g0488800                                     65.1    5e-09   
gb|AAT77283.1|  hypothetical protein                                  65.1    5e-09   Oryza sativa Japonica Group [Japonica rice]
ref|XP_001013779.2|  hypothetical protein TTHERM_00426010             62.8    5e-09   
gb|AFG53317.1|  hypothetical protein 0_8445_01                        62.4    5e-09   Pinus taeda
ref|XP_002940130.1|  PREDICTED: RING finger protein 44-like           62.8    5e-09   
gb|AFG53307.1|  hypothetical protein 0_8445_01                        62.4    5e-09   Pinus taeda
gb|EAY98500.1|  hypothetical protein OsI_20412                        65.1    5e-09   Oryza sativa Indica Group [Indian rice]
gb|KDR18580.1|  E3 ubiquitin-protein ligase                           62.4    5e-09   Zootermopsis nevadensis
emb|CEP10883.1|  hypothetical protein                                 65.5    5e-09   Parasitella parasitica
emb|CDY49247.1|  BnaA09g55260D                                        64.3    5e-09   Brassica napus [oilseed rape]
ref|XP_011033689.1|  PREDICTED: E3 ubiquitin-protein ligase TTC3      64.3    6e-09   Populus euphratica
ref|XP_006402756.1|  hypothetical protein EUTSA_v10006182mg           64.3    6e-09   Eutrema salsugineum [saltwater cress]
ref|XP_002894222.1|  ring-H2 finger protein RHY1a                     63.9    6e-09   Arabidopsis lyrata subsp. lyrata
gb|KHJ49254.1|  zinc finger, C3HC4 type                               64.3    6e-09   Trichuris suis
ref|XP_002285765.1|  PREDICTED: E3 ubiquitin-protein ligase CIP8      65.1    6e-09   
emb|CDY08249.1|  BnaA05g13700D                                        64.7    6e-09   Brassica napus [oilseed rape]
gb|KDO43107.1|  hypothetical protein CISIN_1g043965mg                 64.7    6e-09   Citrus sinensis [apfelsine]
dbj|BAJ88158.1|  predicted protein                                    64.3    6e-09   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009144743.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  64.7    7e-09   Brassica rapa
gb|EMT16443.1|  RING finger protein 115                               65.1    7e-09   
ref|XP_001994123.1|  GH17353                                          65.5    7e-09   Drosophila grimshawi
ref|XP_006829824.1|  hypothetical protein AMTR_s00119p00089020        64.7    7e-09   Amborella trichopoda
ref|XP_008455287.1|  PREDICTED: E3 ubiquitin-protein ligase RNF12...  63.5    7e-09   Cucumis melo [Oriental melon]
gb|KFD57597.1|  hypothetical protein M513_01700                       63.9    7e-09   Trichuris suis
gb|ACG42033.1|  RHC1A                                                 64.7    7e-09   Zea mays [maize]
ref|XP_008455285.1|  PREDICTED: E3 ubiquitin-protein ligase RNF12...  63.9    7e-09   Cucumis melo [Oriental melon]
gb|ETN59409.1|  hypothetical protein AND_008994                       65.5    7e-09   Anopheles darlingi [American malaria mosquito]
ref|XP_004289814.1|  PREDICTED: uncharacterized protein LOC101294809  63.9    8e-09   Fragaria vesca subsp. vesca
ref|XP_011185017.1|  PREDICTED: uncharacterized protein LOC105213...  65.5    8e-09   
ref|NP_001140503.1|  uncharacterized LOC100272564                     64.3    8e-09   Zea mays [maize]
gb|EMS59848.1|  E3 ubiquitin-protein ligase RING1-like protein        65.1    8e-09   Triticum urartu
gb|EJU00153.1|  hypothetical protein DACRYDRAFT_109569                64.3    8e-09   Dacryopinax primogenitus
emb|CBY30629.1|  unnamed protein product                              63.9    8e-09   Oikopleura dioica
dbj|GAN03740.1|  E3 ubiquitin-protein ligase RNF115-like              64.7    8e-09   Mucor ambiguus
ref|XP_011185010.1|  PREDICTED: uncharacterized protein LOC105213...  65.5    8e-09   Zeugodacus cucurbitae [melon fruit fly]
gb|ACG39333.1|  hypothetical protein                                  61.6    8e-09   Zea mays [maize]
ref|NP_001182786.1|  RHC1A                                            64.3    9e-09   
ref|XP_002882822.1|  zinc finger family protein                       63.9    9e-09   
ref|XP_011206689.1|  PREDICTED: uncharacterized protein LOC105228522  65.5    9e-09   Bactrocera dorsalis [papaya fruit fly]
ref|XP_001359674.2|  GA19959                                          65.1    9e-09   
ref|XP_002019405.1|  GL12252                                          65.1    9e-09   Drosophila persimilis
gb|EMT21114.1|  RING finger protein 126                               64.3    9e-09   
emb|CDX71931.1|  BnaC08g29430D                                        63.5    9e-09   
ref|XP_003115146.1|  CRE-TOE-4 protein                                64.7    9e-09   Caenorhabditis remanei
ref|XP_006649597.1|  PREDICTED: RING-H2 finger protein ATL63-like     62.0    9e-09   
gb|KJE88725.1|  hypothetical protein CAOG_000320                      64.7    9e-09   Capsaspora owczarzaki ATCC 30864
gb|ABR17941.1|  unknown                                               64.7    9e-09   Picea sitchensis
ref|NP_001056529.1|  Os06g0101300                                     64.3    9e-09   
ref|XP_004529300.1|  PREDICTED: serine-rich adhesin for platelets...  65.1    9e-09   Ceratitis capitata [medfly]
ref|XP_005178295.1|  PREDICTED: nuclear pore complex protein DDB_...  65.1    9e-09   Musca domestica
emb|CBI16568.3|  unnamed protein product                              64.3    9e-09   Vitis vinifera
gb|KHN15189.1|  E3 ubiquitin-protein ligase RING1-like                62.0    9e-09   Glycine soja [wild soybean]
gb|EEC79816.1|  hypothetical protein OsI_21260                        62.8    9e-09   Oryza sativa Indica Group [Indian rice]
ref|XP_010105294.1|  E3 ubiquitin-protein ligase RING1                64.3    1e-08   Morus notabilis
ref|XP_002172844.1|  ubiquitin-protein ligase E3                      64.7    1e-08   Schizosaccharomyces japonicus yFS275
ref|XP_001436417.1|  hypothetical protein                             61.6    1e-08   Paramecium tetraurelia strain d4-2
ref|XP_010536808.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  64.3    1e-08   Tarenaya hassleriana [spider flower]
emb|CBY22351.1|  unnamed protein product                              63.9    1e-08   Oikopleura dioica
ref|NP_594179.1|  ubiquitin-protein ligase E3 (predicted)             64.7    1e-08   Schizosaccharomyces pombe
ref|XP_010465177.1|  PREDICTED: E3 ubiquitin-protein ligase CIP8-...  64.3    1e-08   
emb|CDY32837.1|  BnaC08g02590D                                        62.8    1e-08   
ref|XP_005178296.1|  PREDICTED: mucin-19 isoform X2                   65.1    1e-08   
ref|XP_009146494.1|  PREDICTED: E3 ubiquitin-protein ligase RING1     63.9    1e-08   
ref|XP_008381187.1|  PREDICTED: uncharacterized protein LOC103444057  62.8    1e-08   
gb|ACF82510.1|  unknown                                               61.6    1e-08   
ref|XP_004365191.2|  hypothetical protein CAOG_00320                  64.3    1e-08   
ref|XP_010545310.1|  PREDICTED: E3 ubiquitin-protein ligase RNF12...  64.3    1e-08   
ref|XP_001359837.1|  GA11309                                          64.3    1e-08   
gb|KDO74472.1|  hypothetical protein CISIN_1g028791mg                 62.4    1e-08   
ref|XP_002031572.1|  GM26076                                          65.1    1e-08   
gb|AFW67216.1|  putative RING zinc finger domain superfamily protein  61.6    1e-08   
ref|NP_001144032.1|  uncharacterized protein LOC100276856             64.3    1e-08   
ref|XP_002070646.1|  GK10924                                          65.1    1e-08   
ref|XP_009106871.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  63.9    1e-08   
ref|XP_009378947.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  62.8    1e-08   
ref|XP_004529302.1|  PREDICTED: serine-rich adhesin for platelets...  64.7    1e-08   
gb|EXV00985.1|  RING finger domain protein                            64.3    1e-08   
gb|ADK63410.1|  C3HC4 type zinc finger protein                        63.9    1e-08   
ref|XP_006582262.1|  PREDICTED: E3 ubiquitin-protein ligase At3g0...  62.4    1e-08   
ref|XP_003291873.1|  hypothetical protein DICPUDRAFT_24826            60.1    1e-08   
dbj|BAD29097.2|  unknown protein                                      61.2    1e-08   
gb|KJB20029.1|  hypothetical protein B456_003G129400                  63.5    1e-08   
gb|KJB20022.1|  hypothetical protein B456_003G129400                  63.5    1e-08   
gb|KFG84586.1|  putative RING finger domain protein                   64.3    1e-08   
ref|XP_009400147.1|  PREDICTED: uncharacterized protein LOC103984394  64.7    1e-08   
ref|XP_010096591.1|  E3 ubiquitin-protein ligase                      62.8    1e-08   
ref|XP_006601659.1|  PREDICTED: E3 ubiquitin-protein ligase RNF12...  60.8    1e-08   
ref|XP_010500537.1|  PREDICTED: E3 ubiquitin-protein ligase RLIM-...  63.2    1e-08   
ref|NP_001147077.1|  RING finger protein 126                          63.9    1e-08   
gb|KID61891.1|  Zinc finger, RING/FYVE/PHD-type                       64.3    1e-08   
gb|AAR20783.1|  At3g13430                                             63.9    1e-08   
ref|XP_002894508.1|  zinc finger family protein                       63.9    1e-08   
ref|XP_007014039.1|  RING/U-box superfamily protein, putative iso...  63.9    1e-08   
ref|XP_002056562.1|  GJ11010                                          64.7    1e-08   
ref|XP_002000571.1|  GI22448                                          64.7    1e-08   
ref|XP_006655672.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  63.9    1e-08   
ref|XP_004961694.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  63.9    1e-08   
ref|NP_001262484.1|  CG6923, isoform D                                64.7    1e-08   
ref|XP_007817312.1|  zinc finger domain-containing protein            64.3    1e-08   
ref|NP_187951.1|  RING/U-box superfamily protein                      63.5    1e-08   
ref|XP_006654565.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  63.9    1e-08   
ref|NP_650112.1|  CG6923, isoform A                                   64.7    1e-08   
gb|AAT94533.1|  AT15166p                                              64.7    1e-08   
ref|XP_011002649.1|  PREDICTED: E3 ubiquitin-protein ligase SDIR1...  62.8    1e-08   
ref|XP_004964254.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  63.9    1e-08   
dbj|BAJ85700.1|  predicted protein                                    63.9    1e-08   
ref|XP_001954691.1|  GF16619                                          64.7    1e-08   
ref|XP_007556122.1|  PREDICTED: E3 ubiquitin-protein ligase RNF115    63.5    1e-08   
ref|XP_002531577.1|  protein binding protein, putative                63.2    1e-08   
ref|XP_002864451.1|  zinc finger family protein                       63.9    2e-08   
ref|XP_010044920.1|  PREDICTED: E3 ubiquitin-protein ligase CIP8-...  63.9    2e-08   
gb|AFK39085.1|  unknown                                               60.1    2e-08   
gb|EWM23657.1|  protease-associated RING/U-box zinc finger-contai...  64.3    2e-08   
ref|XP_004207377.1|  PREDICTED: uncharacterized protein LOC101237952  63.5    2e-08   
ref|XP_008351262.1|  PREDICTED: E3 ubiquitin-protein ligase CIP8-...  63.9    2e-08   
emb|CDY23599.1|  BnaC05g39950D                                        64.3    2e-08   
gb|KCW52328.1|  hypothetical protein EUGRSUZ_J01748                   63.9    2e-08   
ref|XP_007014035.1|  RING/U-box superfamily protein isoform 1         63.9    2e-08   
ref|XP_006829229.1|  hypothetical protein AMTR_s00001p00272380        63.2    2e-08   
ref|XP_010462406.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  63.5    2e-08   
gb|EPB81049.1|  hypothetical protein HMPREF1544_12247                 63.9    2e-08   
ref|XP_002097951.1|  GE10089                                          64.3    2e-08   
gb|EPY50649.1|  ubiquitin-protein ligase E3                           63.9    2e-08   
ref|XP_002297615.2|  hypothetical protein POPTR_0001s03880g           63.9    2e-08   
ref|XP_002468309.1|  hypothetical protein SORBIDRAFT_01g043460        63.2    2e-08   
gb|KFB45277.1|  hypothetical protein ZHAS_00013258                    64.3    2e-08   
ref|XP_010883123.1|  PREDICTED: E3 ubiquitin-protein ligase RNF115    63.5    2e-08   
ref|XP_003436399.1|  AGAP013357-PA                                    64.3    2e-08   
ref|XP_002517998.1|  protein binding protein, putative                62.8    2e-08   
ref|XP_011002648.1|  PREDICTED: E3 ubiquitin-protein ligase SDIR1...  63.2    2e-08   
ref|XP_001980514.1|  GG17197                                          64.3    2e-08   
ref|XP_010032834.1|  PREDICTED: E3 ubiquitin-protein ligase RNF12...  63.5    2e-08   
ref|XP_006582269.1|  PREDICTED: uncharacterized protein LOC100810...  62.8    2e-08   
ref|XP_008430974.1|  PREDICTED: E3 ubiquitin-protein ligase RNF115    63.2    2e-08   
ref|XP_010037572.1|  PREDICTED: RING-H2 finger protein ATL56-like     60.8    2e-08   
ref|XP_010276428.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  63.5    2e-08   
ref|XP_002303979.2|  zinc finger family protein                       63.5    2e-08   
ref|XP_007163423.1|  hypothetical protein PHAVU_001G233500g           62.8    2e-08   
dbj|GAM19726.1|  hypothetical protein SAMD00019534_029010             63.5    2e-08   
ref|XP_007200025.1|  hypothetical protein PRUPE_ppa024450mg           60.1    2e-08   
gb|KCW52329.1|  hypothetical protein EUGRSUZ_J01748                   63.5    2e-08   
emb|CDQ93718.1|  unnamed protein product                              62.8    2e-08   
ref|XP_006298099.1|  hypothetical protein CARUB_v10014141mg           63.5    2e-08   
ref|XP_003526219.1|  PREDICTED: uncharacterized protein LOC100810...  62.8    2e-08   
ref|XP_007005745.1|  hypothetical protein TREMEDRAFT_63337            63.5    2e-08   
ref|XP_010487098.1|  PREDICTED: E3 ubiquitin-protein ligase CIP8-...  63.2    2e-08   
ref|NP_173311.1|  C3HC4-type RING finger domain-containing protein    62.0    2e-08   
gb|EJK46102.1|  hypothetical protein THAOC_35250                      63.5    2e-08   
emb|CDP18575.1|  unnamed protein product                              63.5    2e-08   
ref|XP_010501167.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  63.5    2e-08   
gb|KCW52327.1|  hypothetical protein EUGRSUZ_J01748                   63.5    2e-08   
ref|XP_003526206.1|  PREDICTED: E3 ubiquitin-protein ligase At3g0...  62.8    2e-08   
gb|KDP44464.1|  hypothetical protein JCGZ_16297                       62.8    2e-08   
gb|KHN28097.1|  E3 ubiquitin-protein ligase RNF133-like protein       62.4    2e-08   
gb|EAY88970.1|  hypothetical protein OsI_10456                        62.8    2e-08   
ref|NP_001049323.1|  Os03g0206900                                     62.8    2e-08   
ref|XP_008233643.1|  PREDICTED: E3 ubiquitin-protein ligase SDIR1...  62.8    2e-08   
ref|XP_009292345.1|  PREDICTED: E3 ubiquitin-protein ligase RNF11...  62.0    2e-08   
gb|KHN15733.1|  E3 ubiquitin-protein ligase RNF115                    60.8    2e-08   
ref|XP_008366125.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  63.2    2e-08   
ref|XP_011001692.1|  PREDICTED: uncharacterized protein LOC105108889  62.8    2e-08   
ref|XP_011048150.1|  PREDICTED: E3 ubiquitin-protein ligase RNF12...  63.2    2e-08   
ref|XP_008358830.1|  PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin...  63.2    2e-08   
ref|XP_010277125.1|  PREDICTED: E3 ubiquitin-protein ligase ZNRF2...  62.8    2e-08   
ref|XP_008233644.1|  PREDICTED: E3 ubiquitin-protein ligase SDIR1...  62.8    2e-08   
ref|XP_007218797.1|  hypothetical protein PRUPE_ppa009804mg           62.8    2e-08   
gb|KHF99785.1|  E3 ubiquitin-protein ligase SDIR1                     62.8    2e-08   
gb|KHF99786.1|  E3 ubiquitin-protein ligase SDIR1                     62.8    2e-08   
ref|NP_001130065.1|  uncharacterized protein LOC100191157             63.2    2e-08   
ref|XP_775261.1|  hypothetical protein CNBE3220                       63.5    2e-08   
gb|KHF99784.1|  E3 ubiquitin-protein ligase SDIR1                     62.8    2e-08   
ref|XP_010918874.1|  PREDICTED: uncharacterized protein LOC105043...  63.5    3e-08   
dbj|BAJ95268.1|  predicted protein                                    63.2    3e-08   
ref|XP_008647279.1|  PREDICTED: uncharacterized protein LOC100191...  63.2    3e-08   
ref|XP_010483111.1|  PREDICTED: E3 ubiquitin-protein ligase RNF12...  63.2    3e-08   
ref|XP_001954769.1|  GF16575                                          63.2    3e-08   
ref|XP_010102130.1|  E3 ubiquitin-protein ligase RING1-like protein   62.8    3e-08   
ref|XP_571203.1|  hypothetical protein                                63.5    3e-08   
ref|NP_200445.1|  protein ATCRT1                                      63.2    3e-08   
ref|XP_010500491.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  63.2    3e-08   
gb|KDP20275.1|  hypothetical protein JCGZ_06861                       63.2    3e-08   
ref|XP_011089756.1|  PREDICTED: E3 ubiquitin-protein ligase CIP8-...  63.2    3e-08   
ref|XP_008235557.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  60.1    3e-08   
ref|XP_004956914.1|  PREDICTED: E3 ubiquitin-protein ligase AIP2-...  62.8    3e-08   
ref|XP_010918876.1|  PREDICTED: uncharacterized protein LOC105043...  63.5    3e-08   
emb|CAG14089.1|  unnamed protein product                              61.2    3e-08   
ref|XP_004955057.1|  PREDICTED: E3 ubiquitin-protein ligase Os03g...  60.8    3e-08   
ref|XP_011089755.1|  PREDICTED: E3 ubiquitin-protein ligase CIP8-...  63.2    3e-08   
ref|XP_010685714.1|  PREDICTED: E3 ubiquitin-protein ligase SDIR1...  62.4    3e-08   
gb|EMS20290.1|  E3 ubiquitin-protein ligase RNF115/126                63.5    3e-08   
emb|CDR43469.1|  RHTO0S08e02190g1_1                                   63.2    3e-08   
ref|XP_006279491.1|  hypothetical protein CARUB_v10026533mg           63.2    3e-08   
gb|ACF84253.1|  unknown                                               61.6    3e-08   
gb|KDP30629.1|  hypothetical protein JCGZ_16194                       63.2    3e-08   
ref|XP_010522349.1|  PREDICTED: E3 ubiquitin-protein ligase Praja-2   63.2    3e-08   
ref|XP_006305221.1|  hypothetical protein CARUB_v10009589mg           62.8    3e-08   
ref|XP_010480093.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  62.8    3e-08   
gb|KJB20559.1|  hypothetical protein B456_003G154300                  62.8    3e-08   
ref|XP_002523395.1|  zinc finger protein, putative                    63.2    3e-08   
ref|XP_010918877.1|  PREDICTED: uncharacterized protein LOC105043...  63.5    3e-08   
ref|XP_007904583.1|  PREDICTED: E3 ubiquitin-protein ligase Arkad...  63.5    3e-08   
ref|XP_001307175.1|  hypothetical protein                             60.1    3e-08   
ref|XP_002124964.1|  PREDICTED: RING finger protein 150               62.8    3e-08   
gb|ACF87482.1|  unknown                                               60.5    3e-08   
dbj|BAK03398.1|  predicted protein                                    62.8    3e-08   
dbj|BAC42901.1|  unknown protein                                      59.7    3e-08   
gb|ELT93759.1|  hypothetical protein CAPTEDRAFT_170762                60.5    3e-08   
ref|XP_009147503.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  62.4    3e-08   
emb|CDY50031.1|  BnaA06g00320D                                        62.4    3e-08   
ref|XP_004985269.1|  PREDICTED: uncharacterized protein LOC101766920  62.0    3e-08   
ref|XP_003558542.1|  PREDICTED: E3 ubiquitin-protein ligase RLIM      62.0    3e-08   
ref|XP_008807959.1|  PREDICTED: uncharacterized protein LOC103720...  63.2    3e-08   
ref|XP_008807958.1|  PREDICTED: uncharacterized protein LOC103720...  63.2    3e-08   
ref|XP_002437660.1|  hypothetical protein SORBIDRAFT_10g000250        62.8    3e-08   
ref|XP_002104183.1|  GD18588                                          62.8    4e-08   
gb|EGV99466.1|  RING finger protein 126                               60.1    4e-08   
emb|CDY56022.1|  BnaA08g29290D                                        62.4    4e-08   
ref|XP_002031956.1|  GM23778                                          62.8    4e-08   
ref|NP_649859.1|  CG11982                                             62.8    4e-08   
ref|XP_010748687.1|  PREDICTED: E3 ubiquitin-protein ligase RNF115    62.4    4e-08   
gb|KHG09036.1|  hypothetical protein F383_15552                       62.8    4e-08   
gb|ACN31910.1|  unknown                                               62.8    4e-08   
ref|XP_004136838.1|  PREDICTED: uncharacterized protein LOC101210416  62.0    4e-08   
ref|XP_005830041.1|  hypothetical protein GUITHDRAFT_61154            58.5    4e-08   
ref|XP_006420605.1|  hypothetical protein CICLE_v10006228mg           59.7    4e-08   
ref|XP_007016361.1|  Binding protein, putative isoform 3              60.8    4e-08   
ref|XP_007900646.1|  PREDICTED: E3 ubiquitin-protein ligase RNF13     62.8    4e-08   
ref|XP_002096888.1|  GE25922                                          62.8    4e-08   
ref|XP_008807355.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  62.4    4e-08   
ref|XP_002321062.1|  hypothetical protein POPTR_0014s13550g           62.0    4e-08   
ref|XP_007009244.1|  RING/U-box superfamily protein isoform 1         62.0    4e-08   
ref|XP_001980879.1|  GG14428                                          62.8    4e-08   
emb|CDY56081.1|  BnaC06g41710D                                        61.6    4e-08   
gb|EPS72886.1|  hypothetical protein M569_01875                       62.0    4e-08   
ref|XP_010479427.1|  PREDICTED: RING-H2 finger protein ATL54-like     61.6    4e-08   
ref|XP_001437186.1|  hypothetical protein                             59.7    4e-08   
ref|XP_010908890.1|  PREDICTED: E3 ubiquitin-protein ligase RNF18...  59.3    5e-08   
ref|XP_003536519.1|  PREDICTED: E3 ubiquitin-protein ligase RNF43...  60.1    5e-08   
ref|XP_001181593.2|  PREDICTED: RING finger protein 215-like          62.4    5e-08   
ref|XP_008441380.1|  PREDICTED: E3 ubiquitin-protein ligase SDIR1     62.0    5e-08   
gb|EWS74242.1|  C3HC4 type (RING finger) zinc finger protein          59.3    5e-08   
gb|ABR17677.1|  unknown                                               62.8    5e-08   
ref|XP_007042594.1|  RING/U-box superfamily protein, putative iso...  60.8    5e-08   
ref|XP_002886587.1|  hypothetical protein ARALYDRAFT_475251           61.2    5e-08   
ref|XP_004077961.1|  PREDICTED: E3 ubiquitin-protein ligase RNF115    62.0    5e-08   
ref|XP_002441287.1|  hypothetical protein SORBIDRAFT_09g023840        62.4    5e-08   
ref|NP_001066123.1|  Os12g0140600                                     60.1    5e-08   
gb|KHN02744.1|  E3 ubiquitin-protein ligase RNF115                    60.1    5e-08   
ref|NP_001062101.1|  Os08g0487500                                     61.6    5e-08   
ref|XP_007155197.1|  hypothetical protein PHAVU_003G181600g           62.4    5e-08   
ref|XP_004138475.1|  PREDICTED: E3 ubiquitin-protein ligase SDIR1...  61.6    5e-08   
ref|XP_004149638.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  62.4    5e-08   
ref|NP_001136628.1|  uncharacterized LOC100216754                     60.5    5e-08   
gb|KDO82940.1|  hypothetical protein CISIN_1g026833mg                 61.2    5e-08   
gb|ACG24533.1|  hypothetical protein                                  60.5    5e-08   
ref|XP_008449904.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  62.4    5e-08   
gb|KDD74273.1|  hypothetical protein H632_c1440p0                     60.5    6e-08   
gb|ABK21541.1|  unknown                                               62.0    6e-08   
ref|NP_001237666.1|  uncharacterized protein LOC100527548             59.7    6e-08   
ref|XP_002433945.1|  E3 ubiquitin ligase, putative                    61.6    6e-08   
ref|XP_006443366.1|  hypothetical protein CICLE_v10024260mg           62.0    6e-08   
ref|NP_001085602.1|  E3 ubiquitin-protein ligase RNF181               59.7    6e-08   
ref|XP_009931103.1|  PREDICTED: E3 ubiquitin-protein ligase RNF126    61.6    6e-08   
ref|XP_007152550.1|  hypothetical protein PHAVU_004G139600g           62.0    6e-08   
ref|XP_003200594.1|  PREDICTED: E3 ubiquitin-protein ligase RNF11...  62.0    6e-08   
gb|EKC32350.1|  RING finger protein 43                                62.4    6e-08   
ref|XP_006660652.1|  PREDICTED: E3 ubiquitin-protein ligase AIP2-...  62.0    6e-08   
ref|XP_009767589.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  62.0    6e-08   
ref|XP_010910393.1|  PREDICTED: E3 ubiquitin-protein ligase RNF18...  59.3    6e-08   
ref|NP_001062934.1|  Os09g0344900                                     60.8    6e-08   
gb|EAY73499.1|  hypothetical protein OsI_01381                        62.0    6e-08   
gb|KJB60892.1|  hypothetical protein B456_009G330000                  62.0    6e-08   
gb|KJB83397.1|  hypothetical protein B456_013G245300                  62.0    6e-08   
ref|XP_007904594.1|  PREDICTED: E3 ubiquitin-protein ligase Arkad...  62.8    6e-08   
ref|XP_010775454.1|  PREDICTED: E3 ubiquitin-protein ligase RNF126    62.0    6e-08   
ref|XP_009148219.1|  PREDICTED: RING-H2 finger protein ATL57-like     60.8    6e-08   
ref|XP_008343080.1|  PREDICTED: putative RING-H2 finger protein A...  60.8    6e-08   
gb|KEH34726.1|  RING zinc finger protein, putative                    61.6    6e-08   
ref|XP_005829482.1|  hypothetical protein GUITHDRAFT_111475           60.8    6e-08   
ref|XP_010728926.1|  PREDICTED: E3 ubiquitin-protein ligase RNF126    62.0    6e-08   



>ref|XP_002266038.1| PREDICTED: E3 ubiquitin-protein ligase arkadia-like [Vitis vinifera]
 ref|XP_010656539.1| PREDICTED: E3 ubiquitin-protein ligase arkadia-like [Vitis vinifera]
Length=193

 Score =   200 bits (509),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 119/199 (60%), Positives = 142/199 (71%), Gaps = 16/199 (8%)
 Frame = -2

Query  644  MAGMLPGVECARRRRFHQSGGLSDsttstttssstrrsSFCLYTSNHDSHLsssssssSM  465
            MAGMLPGVECARRRRFHQSGG SDS T      + R S FCLYTSNH++H   ++SSSSM
Sbjct  1    MAGMLPGVECARRRRFHQSGGCSDSPTVAVHGCTRRSS-FCLYTSNHENH--HATSSSSM  57

Query  464  QRSTIGKAYQDEKLGAAAREAKERLDERLKSGHCKSDHKRNCRKTA---AEKGGMVMGDV  294
            QRS + +AY DEKLG  AREAKERLDERL++   KS+  RN  K +    +   MV+G++
Sbjct  58   QRSVLNQAYSDEKLGGVAREAKERLDERLRTQR-KSEPTRNKSKESLRIVDGRAMVVGEL  116

Query  293  QM-------LKSKAMKWAKKLGWKASEEEEECAICLDHFKVGETLMQLPCSHRFHSRCLL  135
            Q          SK   W K L WKAS++ E CAICL+ FK GE+L+ LPC+HRFHSRCL+
Sbjct  117  QTEVFGSKRSGSKRFSWGK-LSWKASDQVE-CAICLEGFKAGESLVHLPCAHRFHSRCLM  174

Query  134  PWLDTNAHCPCCRMGILSS  78
            PWL+TNAHCPCCRMGI  S
Sbjct  175  PWLETNAHCPCCRMGIFVS  193



>ref|XP_007013686.1| RING/U-box superfamily protein [Theobroma cacao]
 gb|EOY31305.1| RING/U-box superfamily protein [Theobroma cacao]
Length=191

 Score =   198 bits (504),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 118/198 (60%), Positives = 140/198 (71%), Gaps = 17/198 (9%)
 Frame = -2

Query  644  MAGMLPGVECARRRRFHQSGGLSDsttstttssstrrsSFCLYTSNHDSHLsssssssSM  465
            MAGMLPGVECARRRRFHQSGG SDS ++     + R S FCLYTSNH++H    SS SS 
Sbjct  1    MAGMLPGVECARRRRFHQSGGASDSPSTVPIGWTRRSS-FCLYTSNHETH---HSSVSSQ  56

Query  464  QRSTIGKAYQDEKLGAAAREAKERLDERLKSGHCKSDHKRNCRKTA---AEKGGMVMGDV  294
            QRS + +A QDEKLG  AREAKERLDERL+S   KS+ KR   K +    +   MV G+ 
Sbjct  57   QRSILNQANQDEKLGEVAREAKERLDERLRSQR-KSEPKRQNSKESLRCVDGRSMVQGEF  115

Query  293  -------QMLKSKAMKWAKKLGWKASEEEEECAICLDHFKVGETLMQLPCSHRFHSRCLL  135
                   +   +K   WAK L WKAS++EE CAICL+ FK GETL+ LPC+HRFHSRCL+
Sbjct  116  HKEVFGPKKSGTKRFSWAK-LSWKASDQEE-CAICLERFKAGETLVHLPCAHRFHSRCLI  173

Query  134  PWLDTNAHCPCCRMGILS  81
            PW++ NAHCPCCRMGILS
Sbjct  174  PWVENNAHCPCCRMGILS  191



>emb|CAN73727.1| hypothetical protein VITISV_034074 [Vitis vinifera]
Length=193

 Score =   197 bits (501),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 118/199 (59%), Positives = 141/199 (71%), Gaps = 16/199 (8%)
 Frame = -2

Query  644  MAGMLPGVECARRRRFHQSGGLSDsttstttssstrrsSFCLYTSNHDSHLsssssssSM  465
            MAGMLPGVECARRRRFHQSGG SDS T      + R S FCLYTSNH++H   ++SSSSM
Sbjct  1    MAGMLPGVECARRRRFHQSGGCSDSPTVAVHGCTRRSS-FCLYTSNHENH--HATSSSSM  57

Query  464  QRSTIGKAYQDEKLGAAAREAKERLDERLKSGHCKSDHKRNCRKTA---AEKGGMVMGDV  294
            QRS + +AY DEKLG  AREAKERLDERL++   KS+  RN  K +    +   MV+G++
Sbjct  58   QRSVLNQAYSDEKLGGVAREAKERLDERLRTQR-KSEPTRNKSKESLRIVDGRAMVVGEL  116

Query  293  QM-------LKSKAMKWAKKLGWKASEEEEECAICLDHFKVGETLMQLPCSHRFHSRCLL  135
            Q          SK   W K L WKAS++ E CAICL+ FK GE+L+ LPC+HRFHSRCL+
Sbjct  117  QTEVFGSKRSGSKRFSWGK-LSWKASDQVE-CAICLEGFKAGESLVHLPCAHRFHSRCLM  174

Query  134  PWLDTNAHCPCCRMGILSS  78
            PWL+TNAHCPC RMGI  S
Sbjct  175  PWLETNAHCPCXRMGIFVS  193



>ref|XP_009768604.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-like [Nicotiana sylvestris]
Length=201

 Score =   184 bits (468),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 112/205 (55%), Positives = 140/205 (68%), Gaps = 23/205 (11%)
 Frame = -2

Query  644  MAGMLPGVECARRRRFHQSGGLSDsttstttssstrrsSFCLYTSNHDSHLsssssssSM  465
            MAGMLPGVECARRRRFHQS G  DS+ +   SS+ R S FCLYTS+H+  L+SSSS    
Sbjct  1    MAGMLPGVECARRRRFHQSSGWLDSSHTFGFSSTRRSS-FCLYTSSHEYPLNSSSSK---  56

Query  464  QRSTIGKAYQDEKLGAAAREAKERLDERLKSGHCKSDHKRNCRK-TAAEKGGMV------  306
            QR    +AYQDEKLG AAREA++RLDERL S   KS +KR+       ++ GMV      
Sbjct  57   QRGATSQAYQDEKLGEAAREARQRLDERL-SAQWKSKNKRSVNNGQQNQRHGMVENRPKL  115

Query  305  ---------MGDVQMLKSKAMKWAKKLGWKASEEEEECAICLDHFKVGETLMQLPCSHRF  153
                        ++   SK   WAK + WK+SE++E CAICLD FK+G+ LMQL C+H+F
Sbjct  116  GVDKLQQEVFSGLKKSGSKKFNWAKMI-WKSSEQDE-CAICLDQFKIGDNLMQLQCAHKF  173

Query  152  HSRCLLPWLDTNAHCPCCRMGILSS  78
            HS+CL+PWL++NAHCPCCRM IL+S
Sbjct  174  HSKCLVPWLESNAHCPCCRMAILTS  198



>ref|XP_006359529.1| PREDICTED: uncharacterized protein LOC102590358 [Solanum tuberosum]
Length=198

 Score =   183 bits (465),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 111/199 (56%), Positives = 137/199 (69%), Gaps = 19/199 (10%)
 Frame = -2

Query  644  MAGMLPGVECARRRRFHQSGGLSDsttstttssstrrsSFCLYTSNHDSHLsssssssSM  465
            MAGMLPGVECARRRRFHQS G  DS+ +T  SS+ R S FCLYTSNH+  L+SSSS    
Sbjct  1    MAGMLPGVECARRRRFHQSSGCIDSSNTTGFSSTRRSS-FCLYTSNHEHPLNSSSSK---  56

Query  464  QRSTIGKAYQDEKLGAAAREAKERLDERLKSGHCKSDHKR--NCRKTAAEKG--------  315
            QR    +AYQDEKLG AAREAK+RLD+RL S   KS +KR  N R+   +          
Sbjct  57   QRGATSQAYQDEKLGEAAREAKQRLDDRL-SARWKSQNKRSPNNRQPPNQSQEMLDNRPN  115

Query  314  --GMVMGDVQMLKSKAMKWAKKLGWKASEEEEECAICLDHFKVGETLMQLPCSHRFHSRC  141
              G V   ++   SK   WAK + WK S+E++EC ICLD FK+ + LMQL C+H+FHS+C
Sbjct  116  LQGEVFSRLKKSGSKKFNWAKMI-WK-SQEQDECTICLDQFKISDNLMQLTCAHKFHSKC  173

Query  140  LLPWLDTNAHCPCCRMGIL  84
            L+PWL++NAHCPCCRM I+
Sbjct  174  LVPWLESNAHCPCCRMTII  192



>ref|XP_004242706.1| PREDICTED: RING-H2 finger protein ATL30 [Solanum lycopersicum]
Length=198

 Score =   181 bits (460),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 113/199 (57%), Positives = 140/199 (70%), Gaps = 19/199 (10%)
 Frame = -2

Query  644  MAGMLPGVECARRRRFHQSGGLSDsttstttssstrrsSFCLYTSNHDSHLsssssssSM  465
            MAGMLPGVECARRRRFHQS G  DS+ +++ SS+ R S  CLYTSNH+ HL+SSSS    
Sbjct  1    MAGMLPGVECARRRRFHQSNGCIDSSNTSSFSSTRRSSF-CLYTSNHEHHLNSSSSK---  56

Query  464  QRSTIGKAYQDEKLGAAAREAKERLDERLKSGHCKSDHKR--NCRKTAAEKGGMV-----  306
            QR  I +AYQDEKLG A REAK+RLDERL S   KS +KR  N R+   +   MV     
Sbjct  57   QRGVISQAYQDEKLGEAVREAKQRLDERL-SARWKSQNKRGLNNRQKPNQNQEMVENRPN  115

Query  305  -MGDV----QMLKSKAMKWAKKLGWKASEEEEECAICLDHFKVGETLMQLPCSHRFHSRC  141
              G+V    +   SK   WAK + WK S+E++EC+ICLD FK+ + LMQL C+H+FHS+C
Sbjct  116  LQGEVFSGLKRSGSKKFNWAKMI-WK-SQEQDECSICLDQFKISDNLMQLTCAHKFHSKC  173

Query  140  LLPWLDTNAHCPCCRMGIL  84
            L+PWL+ NAHCPCCRM I+
Sbjct  174  LVPWLEFNAHCPCCRMTII  192



>ref|XP_011017944.1| PREDICTED: RING finger protein 165-like isoform X1 [Populus euphratica]
Length=196

 Score =   178 bits (452),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 102/197 (52%), Positives = 127/197 (64%), Gaps = 17/197 (9%)
 Frame = -2

Query  644  MAGMLPGVECARRRRFHQSGGLSDsttstttssstrrsSFCLYTSNHDSHLsssssssSM  465
            MAGMLPGVECARRRRFHQSG     +        +R+ SFCLYTS+H+S+    SS    
Sbjct  1    MAGMLPGVECARRRRFHQSGD----SLGAPAHGWSRKPSFCLYTSSHESYHGLVSSLKQK  56

Query  464  QRSTIGKAYQDEKLGAAAREAKERLDERLKSGHCKSDHKRNCRKTA----AEKGGMVMGD  297
            QRS   +AY+D+KLG  AREAKERLDERL+    K    +  + T      +   MV+G+
Sbjct  57   QRSVSSQAYEDDKLGGVAREAKERLDERLRLQKKKKAETKRHKSTGNLRDVDGRSMVLGE  116

Query  296  VQM-------LKSKAMKWAKKLGWKASEEEEECAICLDHFKVGETLMQLPCSHRFHSRCL  138
            +QM         SK   WAK L WKA++++E C ICLD FK GETL+ LPC+HR+H RCL
Sbjct  117  LQMEVYGAKRSGSKRFNWAK-LSWKAADQDE-CTICLDQFKSGETLVHLPCAHRYHPRCL  174

Query  137  LPWLDTNAHCPCCRMGI  87
            +PWL+ N HCPCCRM I
Sbjct  175  VPWLENNGHCPCCRMEI  191



>gb|KJB23768.1| hypothetical protein B456_004G114100 [Gossypium raimondii]
Length=191

 Score =   178 bits (451),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 113/198 (57%), Positives = 141/198 (71%), Gaps = 17/198 (9%)
 Frame = -2

Query  644  MAGMLPGVECARRRRFHQSGGLSDsttstttssstrrsSFCLYTSNHDSHLsssssssSM  465
            MAGMLPGVECARRRRFHQSG  S  ++S      TRRSSFCLYTSN+++H    SS SS 
Sbjct  1    MAGMLPGVECARRRRFHQSG-GSSDSSSVAVIGLTRRSSFCLYTSNNETH---HSSVSSQ  56

Query  464  QRSTIGKAYQDEKLGAAAREAKERLDERLKSGHCKSDHKRNCRKTA---AEKGGMVMGDV  294
            QRS + +++QD+KLG  AREAKERLDERL+S   KS+ KR+  K      +   +V G++
Sbjct  57   QRSILTQSFQDDKLGGVAREAKERLDERLRSQR-KSEPKRHSNKEGMKCVDGKSLVQGEL  115

Query  293  QM-------LKSKAMKWAKKLGWKASEEEEECAICLDHFKVGETLMQLPCSHRFHSRCLL  135
            +          SK   WAK L WKAS+++E CAICL+ FKV E+L+  PC+HRFHSRCL+
Sbjct  116  RTEVFGSKKSASKRFSWAK-LNWKASDQDE-CAICLERFKVDESLVHPPCAHRFHSRCLV  173

Query  134  PWLDTNAHCPCCRMGILS  81
            PWL+ +AHCPCCRMGILS
Sbjct  174  PWLENHAHCPCCRMGILS  191



>gb|KHG08071.1| Zinc/RING finger 3 [Gossypium arboreum]
Length=191

 Score =   177 bits (450),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 114/198 (58%), Positives = 139/198 (70%), Gaps = 17/198 (9%)
 Frame = -2

Query  644  MAGMLPGVECARRRRFHQSGGLSDsttstttssstrrsSFCLYTSNHDSHLsssssssSM  465
            MAGMLPGVECARRRRFHQSG  S  ++S      TRRSSFCLYTSN+++H    SS SS 
Sbjct  1    MAGMLPGVECARRRRFHQSG-GSSDSSSVAVIGLTRRSSFCLYTSNNETH---HSSVSSQ  56

Query  464  QRSTIGKAYQDEKLGAAAREAKERLDERLKSGHCKSDHKRNCRKTA---AEKGGMVMGDV  294
            QRS + + YQD+KLG  AREAKERLDERL+S   KS+ KR+  K      +   +V G++
Sbjct  57   QRSILTQTYQDDKLGGVAREAKERLDERLRSQR-KSEPKRHSNKEGMKCVDGKSLVQGEL  115

Query  293  QM-------LKSKAMKWAKKLGWKASEEEEECAICLDHFKVGETLMQLPCSHRFHSRCLL  135
            +          SK   WAK L WKAS++ E CAICL+ FKV E+L+  PC+HRFHSRCL+
Sbjct  116  RTEVFGSKKSASKRFSWAK-LNWKASDQVE-CAICLERFKVDESLVHPPCAHRFHSRCLV  173

Query  134  PWLDTNAHCPCCRMGILS  81
            PWL+ +AHCPCCRMGILS
Sbjct  174  PWLENHAHCPCCRMGILS  191



>ref|XP_006372131.1| hypothetical protein POPTR_0018s12240g [Populus trichocarpa]
 gb|ERP49928.1| hypothetical protein POPTR_0018s12240g [Populus trichocarpa]
Length=197

 Score =   177 bits (450),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 106/198 (54%), Positives = 128/198 (65%), Gaps = 18/198 (9%)
 Frame = -2

Query  644  MAGMLPGVECARRRRFHQSGGLSDsttstttssstrrsSFCLYTSNHDS-HLsssssssS  468
            MAGMLPGVECARRRRFHQSG     +        +R+ SFCLYTS+H+S H S SS    
Sbjct  1    MAGMLPGVECARRRRFHQSGD----SLGAPAHGWSRKPSFCLYTSSHESYHGSVSSLQKQ  56

Query  467  MQRSTIGKAYQDEKLGAAAREAKERLDERLKSGHCKSD----HKRNCRKTAAEKGGMVMG  300
             QRS   +AY+DEKLG  AREAKERLDERL+    K+     HK        +   MV+G
Sbjct  57   KQRSVSSQAYEDEKLGGVAREAKERLDERLRLQKKKTAETTRHKSTGNLRDVDGRSMVLG  116

Query  299  DVQM-------LKSKAMKWAKKLGWKASEEEEECAICLDHFKVGETLMQLPCSHRFHSRC  141
            ++QM         SK   WAK L WKA++++E C ICLD FK GETL+ LPC+HR+H RC
Sbjct  117  ELQMEVYGTKRSGSKRFNWAK-LSWKAADQDE-CTICLDRFKSGETLVHLPCAHRYHPRC  174

Query  140  LLPWLDTNAHCPCCRMGI  87
            L+PWL+ N HCPCCRM I
Sbjct  175  LVPWLENNGHCPCCRMEI  192



>ref|XP_002324572.1| zinc finger family protein [Populus trichocarpa]
 gb|EEF03137.1| zinc finger family protein [Populus trichocarpa]
Length=190

 Score =   177 bits (448),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 104/194 (54%), Positives = 128/194 (66%), Gaps = 17/194 (9%)
 Frame = -2

Query  644  MAGMLPGVECARRRRFHQSGGLSDsttstttssstrrsSFCLYTSNHDSHLsssssssSM  465
            MAGMLPGVECARRRRFHQSG     +        +R+ SFCLYTS+H+S+     S SS+
Sbjct  1    MAGMLPGVECARRRRFHQSG----DSLGAPAHGWSRKPSFCLYTSSHESY---HGSVSSL  53

Query  464  QRSTIGKAYQDEKLGAAAREAKERLDERLKSGHCKSDHKRNCRKTAAEKG-GMVMGDVQM  288
            QRS   +AY+DEKLG  AREAKERLDERL+    K+    +        G  MV+G++QM
Sbjct  54   QRSVSSQAYEDEKLGGVAREAKERLDERLRLQKKKTAETTSTGNLRDVDGRSMVLGELQM  113

Query  287  -------LKSKAMKWAKKLGWKASEEEEECAICLDHFKVGETLMQLPCSHRFHSRCLLPW  129
                     SK   WAK L WKA++++E C ICLD FK GETL+ LPC+HR+H RCL+PW
Sbjct  114  EVYGTKRSGSKRFNWAK-LSWKAADQDE-CTICLDRFKSGETLVHLPCAHRYHPRCLVPW  171

Query  128  LDTNAHCPCCRMGI  87
            L+ N HCPCCRM I
Sbjct  172  LENNGHCPCCRMEI  185



>ref|XP_009613106.1| PREDICTED: E3 ubiquitin-protein ligase RLIM-like [Nicotiana tomentosiformis]
Length=203

 Score =   176 bits (446),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 113/207 (55%), Positives = 139/207 (67%), Gaps = 25/207 (12%)
 Frame = -2

Query  644  MAGMLPGVECARRRRFHQSGGLSDsttstttssstrrsSFCLYTSNHDSHLsssssssSM  465
            MAGMLPGVECARRRRFHQS G  DS+ +   SS+ R S FCLYTS+H+  L+SSSS    
Sbjct  1    MAGMLPGVECARRRRFHQSSGWLDSSHTFGFSSTRRSS-FCLYTSSHEYPLNSSSSK---  56

Query  464  QRSTIGKAY--QDEKLGAAAREAKERLDERLKSGHCKSDHKR-------NCRKTAAEKGG  312
            QR T  +AY  QDEKLG AAREA++RLD+RL S   KS +KR       N R+   E   
Sbjct  57   QRGTTSQAYIYQDEKLGEAAREARQRLDDRL-SARWKSQNKRSLNNGQQNQRQGIVENRP  115

Query  311  M---------VMGDVQMLKSKAMKWAKKLGWKASEEEEECAICLDHFKVGETLMQLPCSH  159
                      V   ++   SK   WAK + WK+SE++E CAICLD FKV + L+QL C+H
Sbjct  116  SLGVDNLQQEVFSGLKKSGSKKFNWAKMI-WKSSEQDE-CAICLDQFKVCDNLLQLQCAH  173

Query  158  RFHSRCLLPWLDTNAHCPCCRMGILSS  78
            RFHS+CL+PWL++NAHCPCCRM IL+S
Sbjct  174  RFHSKCLVPWLESNAHCPCCRMAILTS  200



>ref|XP_008242900.1| PREDICTED: NEP1-interacting protein 1 [Prunus mume]
 ref|XP_008242901.1| PREDICTED: NEP1-interacting protein 1 [Prunus mume]
Length=193

 Score =   174 bits (442),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 108/201 (54%), Positives = 137/201 (68%), Gaps = 22/201 (11%)
 Frame = -2

Query  644  MAGMLPGVECARRRRFHQSGGLSDsttstttssstrrsSFCLYTSNHDSHLsssssssSM  465
            MAGMLPGVECARRRR HQSG     +    T   TRRSSFCLY SNH++H    +S+SS+
Sbjct  1    MAGMLPGVECARRRRVHQSG----ESPGVGTHGWTRRSSFCLYASNHETH---HTSTSSL  53

Query  464  QRSTIGKAYQDEKLGAAAREAKERLDERLKSGHCKSDHKRNCRKTAAEK---GG---MVM  303
            QRS + K+Y DEKLG  AREAK RLDERL++      +KR+      E+   GG   +++
Sbjct  54   QRSILNKSYMDEKLGVEAREAKGRLDERLRTQRKSEPNKRHSVHREEERCVDGGRSMVLL  113

Query  302  GDVQM-------LKSKAMKWAKKLGWKASEEEEECAICLDHFKVGETLMQLPCSHRFHSR  144
            G++Q          SK   WAK L WKAS+++E CA+CL+ F+ GETL+ LPC+HRFHS 
Sbjct  114  GELQKEVFGTKKSGSKRFGWAK-LSWKASDQDE-CAVCLERFRPGETLVHLPCAHRFHSG  171

Query  143  CLLPWLDTNAHCPCCRMGILS  81
            C++PWL  NAHCPCCRMGI+S
Sbjct  172  CMVPWLQNNAHCPCCRMGIVS  192



>ref|XP_011017945.1| PREDICTED: RING finger protein 165-like isoform X2 [Populus euphratica]
Length=195

 Score =   174 bits (442),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 102/197 (52%), Positives = 127/197 (64%), Gaps = 18/197 (9%)
 Frame = -2

Query  644  MAGMLPGVECARRRRFHQSGGLSDsttstttssstrrsSFCLYTSNHDSHLsssssssSM  465
            MAGMLPGVECARRRRFHQSG     +        +R+ SFCLYTS+H+S+     SS   
Sbjct  1    MAGMLPGVECARRRRFHQSGD----SLGAPAHGWSRKPSFCLYTSSHESY-HGLVSSLQK  55

Query  464  QRSTIGKAYQDEKLGAAAREAKERLDERLKSGHCKSDHKRNCRKTA----AEKGGMVMGD  297
            QRS   +AY+D+KLG  AREAKERLDERL+    K    +  + T      +   MV+G+
Sbjct  56   QRSVSSQAYEDDKLGGVAREAKERLDERLRLQKKKKAETKRHKSTGNLRDVDGRSMVLGE  115

Query  296  VQM-------LKSKAMKWAKKLGWKASEEEEECAICLDHFKVGETLMQLPCSHRFHSRCL  138
            +QM         SK   WAK L WKA++++E C ICLD FK GETL+ LPC+HR+H RCL
Sbjct  116  LQMEVYGAKRSGSKRFNWAK-LSWKAADQDE-CTICLDQFKSGETLVHLPCAHRYHPRCL  173

Query  137  LPWLDTNAHCPCCRMGI  87
            +PWL+ N HCPCCRM I
Sbjct  174  VPWLENNGHCPCCRMEI  190



>ref|XP_010265712.1| PREDICTED: E3 ubiquitin-protein ligase SDIR1 [Nelumbo nucifera]
 ref|XP_010265713.1| PREDICTED: E3 ubiquitin-protein ligase SDIR1 [Nelumbo nucifera]
 ref|XP_010265714.1| PREDICTED: E3 ubiquitin-protein ligase SDIR1 [Nelumbo nucifera]
Length=195

 Score =   174 bits (440),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 104/201 (52%), Positives = 127/201 (63%), Gaps = 19/201 (9%)
 Frame = -2

Query  644  MAGMLPGVECARRRRFHQSGGLSDsttstttssstrrsSFCLYTSNHDSHLsssssssSM  465
            MAGMLPGVECARRRRFHQ G  ++S      + + R S FCLYTS+H++HL S SS    
Sbjct  1    MAGMLPGVECARRRRFHQGGSWAESQGIAGNTRTRRPS-FCLYTSSHETHLVSISSK---  56

Query  464  QRSTIGKAYQDEKLGAAAREAKERLDERLKSGHCKSDHKRN------CRKTAAEKGGMVM  303
            Q +   +   DEKL   AREAKERLDERL+S       + N      C         ++ 
Sbjct  57   QITKSNQNLLDEKLDGVAREAKERLDERLRSQRKPETKRHNSGESFKCEDNGRSLRSVIF  116

Query  302  GDVQML-------KSKAMKWAKKLGWKASEEEEECAICLDHFKVGETLMQLPCSHRFHSR  144
            GD+Q L        SK   WAK +GWK S+++E C +CL+ FK GE L+QLPC HRFHSR
Sbjct  117  GDLQTLLFGSKRSSSKKFSWAK-MGWKYSKQDE-CTVCLEQFKSGEALVQLPCGHRFHSR  174

Query  143  CLLPWLDTNAHCPCCRMGILS  81
            CL+PWL+ NAHCPCCRMGILS
Sbjct  175  CLVPWLENNAHCPCCRMGILS  195



>ref|XP_009610647.1| PREDICTED: E3 ubiquitin-protein ligase At3g02290-like [Nicotiana 
tomentosiformis]
 ref|XP_009610652.1| PREDICTED: E3 ubiquitin-protein ligase At3g02290-like [Nicotiana 
tomentosiformis]
Length=193

 Score =   172 bits (436),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 102/204 (50%), Positives = 134/204 (66%), Gaps = 29/204 (14%)
 Frame = -2

Query  644  MAGMLPGVECARRRRFHQSGGLSDsttstttssstrrsSFCLYTSNHDS-HLsssssssS  468
            MAGMLPG+E ARRRRFHQ G   DS+ +  +S       FC+YTSNHD  HLSSS S   
Sbjct  1    MAGMLPGIEHARRRRFHQRGSWLDSSNTRKSS-------FCIYTSNHDQYHLSSSCSK--  51

Query  467  MQRSTIGKAYQDEKLGAAAREAKERLDERLKSGHCKSDHKRNCRKTAAEKGGMV------  306
             QRS     YQDEKL   AREAK+R+DERL S   KS++KR+      +K G+V      
Sbjct  52   -QRSAASHVYQDEKLVEIAREAKQRVDERL-SAQWKSENKRSTVNNRQKKQGVVEIKPIL  109

Query  305  -MGDVQM--------LKSKAMKWAKKLGWKASEEEEECAICLDHFKVGETLMQLPCSHRF  153
             M ++Q         +  + + W + L WK+SE++E CAICLD F++ + LMQLPC+H+F
Sbjct  110  GMKNLQKEVFRLKKSMTKRFINWTE-LRWKSSEQDE-CAICLDKFRIRDNLMQLPCAHKF  167

Query  152  HSRCLLPWLDTNAHCPCCRMGILS  81
            HS+CL+PWL++N+HCPCCRM IL+
Sbjct  168  HSKCLVPWLESNSHCPCCRMEILT  191



>ref|XP_011033494.1| PREDICTED: E3 ubiquitin-protein ligase EL5-like isoform X2 [Populus 
euphratica]
Length=204

 Score =   172 bits (435),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 104/206 (50%), Positives = 131/206 (64%), Gaps = 27/206 (13%)
 Frame = -2

Query  644  MAGMLPGVECARRRRFHQSGGLSDsttstttssstrrsSFCLYTSNHDSHLsssssssSM  465
            MAG+LPGVECARRRRFH+SG     +        TRR SFCLYTS+H++H   S SS   
Sbjct  1    MAGVLPGVECARRRRFHRSGD----SLGAPAHGWTRRPSFCLYTSSHENH-HGSISSVPK  55

Query  464  QRSTIGKAYQDEKLGAAAREAKERLDERLKSGHCKSD-------------HKRNCRKTAA  324
            QRS + +AY+DEKLGA A+EAKERLDERL+    KS+             HK        
Sbjct  56   QRSILNQAYEDEKLGAVAKEAKERLDERLRMQKKKSEITRKTMASAQFIWHKSTGNLRGV  115

Query  323  EKGGMVMGDVQM-------LKSKAMKWAKKLGWKASEEEEECAICLDHFKVGETLMQLPC  165
            +   MV+G++QM         SK + WAK L WKA++++E C ICLD FK GETL+ LPC
Sbjct  116  DGRSMVLGELQMEVYSPKRSGSKRLNWAK-LSWKAADQDE-CTICLDRFKSGETLVHLPC  173

Query  164  SHRFHSRCLLPWLDTNAHCPCCRMGI  87
            +HR+H +CL+PWL+ N  CPCCRM I
Sbjct  174  AHRYHPKCLVPWLENNGQCPCCRMEI  199



>gb|KJB83251.1| hypothetical protein B456_013G237500 [Gossypium raimondii]
Length=185

 Score =   170 bits (430),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 102/196 (52%), Positives = 126/196 (64%), Gaps = 19/196 (10%)
 Frame = -2

Query  644  MAGMLPGVECARRRRFHQSGGLSDsttstttssstrrsSFCLYTSNHDSHLsssssssSM  465
            MAGML GVECARRRRFHQSGG SDS    T   S     FCLYTSNH+S     SS  S 
Sbjct  1    MAGMLAGVECARRRRFHQSGGSSDSVLGFTRRPS-----FCLYTSNHES---LHSSVFSQ  52

Query  464  QRSTIGKAYQD--EKLGAAAREAKERLDERLKSGHCKSDHKRNCRKTAAEKGG--MVMGD  297
            QR  + + Y+D  EKLG  AREAKERLDERL+S       ++N ++T     G  ++ G+
Sbjct  53   QRRVLIEGYEDDDEKLGEVAREAKERLDERLRSQRKSEPKRQNSKETMNHMQGKCLIQGE  112

Query  296  VQMLKSKAMKWAKKLGWK----ASEEEEECAICLDHFKVGETLMQLPCSHRFHSRCLLPW  129
               L  +     ++LGW      + E +EC ICL+ FK GETL++ PC+HRFHSRCL+PW
Sbjct  113  ---LHREVFGSKRRLGWVNLSCKALEHDECLICLERFKAGETLVRPPCAHRFHSRCLVPW  169

Query  128  LDTNAHCPCCRMGILS  81
            L+ N HCPCCR+GILS
Sbjct  170  LENNGHCPCCRLGILS  185



>ref|XP_011033493.1| PREDICTED: E3 ubiquitin-protein ligase EL5-like isoform X1 [Populus 
euphratica]
Length=209

 Score =   171 bits (432),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 104/210 (50%), Positives = 133/210 (63%), Gaps = 30/210 (14%)
 Frame = -2

Query  644  MAGMLPGVECARRRRFHQSGGLSDsttstttssstrrsSFCLYTSNHDSHLsssssssSM  465
            MAG+LPGVECARRRRFH+SG     +        TRR SFCLYTS+H++H  S SS + +
Sbjct  1    MAGVLPGVECARRRRFHRSGD----SLGAPAHGWTRRPSFCLYTSSHENHHGSISSVNWI  56

Query  464  ----QRSTIGKAYQDEKLGAAAREAKERLDERLKSGHCKSD-------------HKRNCR  336
                QRS + +AY+DEKLGA A+EAKERLDERL+    KS+             HK    
Sbjct  57   EKPKQRSILNQAYEDEKLGAVAKEAKERLDERLRMQKKKSEITRKTMASAQFIWHKSTGN  116

Query  335  KTAAEKGGMVMGDVQM-------LKSKAMKWAKKLGWKASEEEEECAICLDHFKVGETLM  177
                +   MV+G++QM         SK + WAK L WKA++++E C ICLD FK GETL+
Sbjct  117  LRGVDGRSMVLGELQMEVYSPKRSGSKRLNWAK-LSWKAADQDE-CTICLDRFKSGETLV  174

Query  176  QLPCSHRFHSRCLLPWLDTNAHCPCCRMGI  87
             LPC+HR+H +CL+PWL+ N  CPCCRM I
Sbjct  175  HLPCAHRYHPKCLVPWLENNGQCPCCRMEI  204



>gb|KHG16465.1| E3 ubiquitin-protein ligase DZIP3 [Gossypium arboreum]
Length=184

 Score =   169 bits (429),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 101/196 (52%), Positives = 126/196 (64%), Gaps = 20/196 (10%)
 Frame = -2

Query  644  MAGMLPGVECARRRRFHQSGGLSDsttstttssstrrsSFCLYTSNHDSHLsssssssSM  465
            MAGML GVECARRRRFHQSGG SDS    T   S     FCLYTSNH+S      SS   
Sbjct  1    MAGMLAGVECARRRRFHQSGGSSDSVLGFTRRPS-----FCLYTSNHES----LHSSVFS  51

Query  464  QRSTIGKAYQD--EKLGAAAREAKERLDERLKSGHCKSDHKRNCRKTAAEKGG--MVMGD  297
            QR  I + Y+D  EKLG  AREAKERLDERL+S       +++ ++T     G  ++ G+
Sbjct  52   QRRVIIEGYEDDDEKLGEIAREAKERLDERLRSQRKSEPKRQHSKETMNHMHGKCLIQGE  111

Query  296  VQMLKSKAMKWAKKLGW----KASEEEEECAICLDHFKVGETLMQLPCSHRFHSRCLLPW  129
               L  +     ++LGW    + + E +EC ICL+ FK GETL++ PC+HRFHSRCL+PW
Sbjct  112  ---LHREVFGSKRRLGWMKLSRKALEHDECVICLERFKAGETLVRPPCAHRFHSRCLVPW  168

Query  128  LDTNAHCPCCRMGILS  81
            L+ N HCPCCR+GILS
Sbjct  169  LENNGHCPCCRLGILS  184



>gb|KJB83252.1| hypothetical protein B456_013G237500 [Gossypium raimondii]
Length=184

 Score =   169 bits (428),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 101/196 (52%), Positives = 125/196 (64%), Gaps = 20/196 (10%)
 Frame = -2

Query  644  MAGMLPGVECARRRRFHQSGGLSDsttstttssstrrsSFCLYTSNHDSHLsssssssSM  465
            MAGML GVECARRRRFHQSGG SDS    T   S     FCLYTSNH+S      SS   
Sbjct  1    MAGMLAGVECARRRRFHQSGGSSDSVLGFTRRPS-----FCLYTSNHES----LHSSVFS  51

Query  464  QRSTIGKAYQD--EKLGAAAREAKERLDERLKSGHCKSDHKRNCRKTAAEKGG--MVMGD  297
            QR  + + Y+D  EKLG  AREAKERLDERL+S       ++N ++T     G  ++ G+
Sbjct  52   QRRVLIEGYEDDDEKLGEVAREAKERLDERLRSQRKSEPKRQNSKETMNHMQGKCLIQGE  111

Query  296  VQMLKSKAMKWAKKLGWK----ASEEEEECAICLDHFKVGETLMQLPCSHRFHSRCLLPW  129
               L  +     ++LGW      + E +EC ICL+ FK GETL++ PC+HRFHSRCL+PW
Sbjct  112  ---LHREVFGSKRRLGWVNLSCKALEHDECLICLERFKAGETLVRPPCAHRFHSRCLVPW  168

Query  128  LDTNAHCPCCRMGILS  81
            L+ N HCPCCR+GILS
Sbjct  169  LENNGHCPCCRLGILS  184



>ref|XP_007202613.1| hypothetical protein PRUPE_ppa011840mg [Prunus persica]
 ref|XP_007202614.1| hypothetical protein PRUPE_ppa011840mg [Prunus persica]
 gb|EMJ03812.1| hypothetical protein PRUPE_ppa011840mg [Prunus persica]
 gb|EMJ03813.1| hypothetical protein PRUPE_ppa011840mg [Prunus persica]
Length=193

 Score =   169 bits (429),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 105/201 (52%), Positives = 134/201 (67%), Gaps = 22/201 (11%)
 Frame = -2

Query  644  MAGMLPGVECARRRRFHQSGGLSDsttstttssstrrsSFCLYTSNHDSHLsssssssSM  465
            MAGMLPGVECARRRR HQSG     +    T   TRRSSFCLY SNH++H    +S+ S+
Sbjct  1    MAGMLPGVECARRRRVHQSG----ESPGVGTHGWTRRSSFCLYASNHETH---HTSTFSL  53

Query  464  QRSTIGKAYQDEKLGAAAREAKERLDERLKSGHCKSDHKRNCRKTAAEK---GG---MVM  303
            QRS + ++Y DEKLG  AREAK RLDERL++      +KR+      E+   GG    ++
Sbjct  54   QRSILNQSYMDEKLGVEAREAKGRLDERLRTQRKSEPNKRHSVHREEERCVDGGRSMFLL  113

Query  302  GDVQM-------LKSKAMKWAKKLGWKASEEEEECAICLDHFKVGETLMQLPCSHRFHSR  144
            G++Q          SK   WAK L WKAS+++E CA+CL+ F+  ETL+ LPC+HRFHS 
Sbjct  114  GELQKEVFGTKKSGSKRFSWAK-LSWKASDQDE-CAVCLEIFRPRETLVHLPCAHRFHSG  171

Query  143  CLLPWLDTNAHCPCCRMGILS  81
            C++PWL  NAHCPCCRMGI+S
Sbjct  172  CMVPWLQNNAHCPCCRMGIVS  192



>ref|XP_002309314.1| zinc finger family protein [Populus trichocarpa]
 gb|EEE92837.1| zinc finger family protein [Populus trichocarpa]
Length=202

 Score =   168 bits (426),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 103/206 (50%), Positives = 129/206 (63%), Gaps = 29/206 (14%)
 Frame = -2

Query  644  MAGMLPGVECARRRRFHQSGGLSDsttstttssstrrsSFCLYTSNHDSHLsssssssSM  465
            MAG+LPGVECARRRRFH+SG     +        TRR SFCLYTS+H++H     S SS+
Sbjct  1    MAGVLPGVECARRRRFHRSG----DSLGAPAHGWTRRPSFCLYTSSHENH---HGSISSL  53

Query  464  QRSTIGKAYQDEKLGAAAREAKERLDERLKSGHCKSD-------------HKRNCRKTAA  324
            QRS + +AY+DEKLG  A+EAKERLDERL+    K +             HK        
Sbjct  54   QRSILNQAYEDEKLGGVAKEAKERLDERLRMQKKKPEITRKTMASAQFIWHKSTGNLRGV  113

Query  323  EKGGMVMGDVQM-------LKSKAMKWAKKLGWKASEEEEECAICLDHFKVGETLMQLPC  165
            +   MV G++QM         SK  KWAK L WKA++++E C ICLD FK GETL+ LPC
Sbjct  114  DGRSMVPGELQMEVYGPKRSGSKRYKWAK-LSWKAADQDE-CTICLDRFKSGETLVHLPC  171

Query  164  SHRFHSRCLLPWLDTNAHCPCCRMGI  87
            +HR+H +CL+PWL+ N  CPCCRM I
Sbjct  172  AHRYHPKCLVPWLENNGQCPCCRMEI  197



>ref|XP_004139268.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Cucumis sativus]
 ref|XP_004159405.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Cucumis sativus]
 gb|KGN60748.1| hypothetical protein Csa_2G009360 [Cucumis sativus]
Length=201

 Score =   167 bits (424),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 109/200 (55%), Positives = 132/200 (66%), Gaps = 18/200 (9%)
 Frame = -2

Query  644  MAGMLPGVECARRRRFHQSGGLSDsttstttssstrrsSFCLYTSNHDSHLsssssssSM  465
            MAGMLPGVECARRRRFHQS   SDS  +   S STRR SFCLYTSN D HL SSSSS   
Sbjct  1    MAGMLPGVECARRRRFHQSINSSDSPFTAGKSGSTRRPSFCLYTSNRDFHLISSSSS--Q  58

Query  464  QRSTIGKAYQDEKLGAAAREAKERLDERLKSGHCKSDHKRNCRKTAAEKGGMVM----GD  297
            QRS   +AYQ++KLG  AREAKERLDERL++ H K ++ R        KG        G+
Sbjct  59   QRSLTNQAYQNDKLGEIAREAKERLDERLRT-HRKPENSRKKNNNEEVKGKESREKNNGE  117

Query  296  VQMLKS---------KAMKWAKKL-GWKASEEEEECAICLDHFKVGETLMQLPCSHRFHS  147
             + +K+         K   W +KL  WKASE+EE C++CL+ F++ E L+ LPC+H+FHS
Sbjct  118  KKEMKNTKGKEEETKKRFSWGRKLMKWKASEQEE-CSVCLERFRLSEPLLHLPCAHKFHS  176

Query  146  RCLLPWLDTNAHCPCCRMGI  87
             CL+PWL  NAHCPCCR  I
Sbjct  177  TCLVPWLQANAHCPCCRFPI  196



>emb|CDP10512.1| unnamed protein product [Coffea canephora]
Length=195

 Score =   167 bits (423),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 107/199 (54%), Positives = 134/199 (67%), Gaps = 17/199 (9%)
 Frame = -2

Query  644  MAGMLPGVECARRRRFHQSGGLSDsttstttss-strrsSFCLYTSNHDSHLsssssssS  468
            MAGMLPGVE ARRRRFHQSGG  DS++++ +   STRRSSFCLY SNH+S LSSS+S   
Sbjct  1    MAGMLPGVEVARRRRFHQSGGWLDSSSASPSGHCSTRRSSFCLYVSNHESPLSSSTSI--  58

Query  467  MQRSTIGKAYQDEKLGAAAREAKERLDERLK-----------SGHCKSDHKRNCRKTAAE  321
            + RS+I +AY D+KL  AAREAK+RLD RL+           SG  +S    N R T   
Sbjct  59   VPRSSISQAYCDQKLNDAAREAKQRLDGRLRAQWKSETKRGHSGRQRSRQSEN-RPTEVR  117

Query  320  KGGMVMGDVQMLKSKAMKWAKKLGWKASEEEEECAICLDHFKVGETLMQLPCSHRFHSRC  141
            +    +  V+   SK   W K L WK+SE++E CA+CL+ F+  E LMQL C+HRFHS C
Sbjct  118  ELQTEVSGVKKSGSKRFSWVK-LSWKSSEQDE-CAVCLEEFRAEEKLMQLACAHRFHSGC  175

Query  140  LLPWLDTNAHCPCCRMGIL  84
            L+PWL+ NAHCPCCR  I+
Sbjct  176  LVPWLENNAHCPCCRTEIV  194



>ref|XP_009782022.1| PREDICTED: E3 ubiquitin-protein ligase At3g02290-like [Nicotiana 
sylvestris]
 ref|XP_009782031.1| PREDICTED: E3 ubiquitin-protein ligase At3g02290-like [Nicotiana 
sylvestris]
Length=194

 Score =   166 bits (419),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 97/202 (48%), Positives = 127/202 (63%), Gaps = 26/202 (13%)
 Frame = -2

Query  644  MAGMLPGVECARRRRFHQSGGLSDsttstttssstrrsSFCLYTSNHDSHLsssssssSM  465
            MAGMLPG+E ARRRRFHQ G   DS+ +  +S       FC+YTSNHD +    SSS S 
Sbjct  1    MAGMLPGIEHARRRRFHQRGSWLDSSNTRRSS-------FCIYTSNHDQY--HLSSSCSK  51

Query  464  QRSTIGKAYQDEKLGAAAREAKERLDERLKSGHCKSDHKRNCRKTAAEKGGMV-------  306
            QRS     YQDEKL   AREAK+RLDE+L S   KS+ KR+      ++ G+V       
Sbjct  52   QRSAASHVYQDEKLVEIAREAKQRLDEKL-SAQWKSEKKRSTINNRPQRQGLVEIKPILG  110

Query  305  MGDV--------QMLKSKAMKWAKKLGWKASEEEEECAICLDHFKVGETLMQLPCSHRFH  150
            M D+        + +  + + WAK LGWK+  E++ECAICLD ++  + L+QL C+H+FH
Sbjct  111  MSDLHKEVFRLKKSVSKRFINWAK-LGWKSLLEQDECAICLDQYRKRDNLIQLSCAHKFH  169

Query  149  SRCLLPWLDTNAHCPCCRMGIL  84
            S CL+PWL+ N+HCPCCRM I 
Sbjct  170  SNCLVPWLEFNSHCPCCRMEIF  191



>ref|XP_008456717.1| PREDICTED: RING-H2 finger protein ATL16 isoform X2 [Cucumis melo]
Length=196

 Score =   165 bits (418),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 106/199 (53%), Positives = 131/199 (66%), Gaps = 16/199 (8%)
 Frame = -2

Query  644  MAGMLPGVECARRRRFHQSGGLSDsttstttssstrrsSFCLYTSNHDSHLsssssssSM  465
            MAGMLPGVECARRRRFH S   SDS ++   S STRR SFCLYTSN D HL SSSSS   
Sbjct  1    MAGMLPGVECARRRRFHHSINSSDSPSTAAKSGSTRRPSFCLYTSNRDFHLISSSSS--Q  58

Query  464  QRSTIGKAYQDEKLGAAAREAKERLDERLKSGHCKSDHKRNCR------KTAAEKGGMVM  303
            QRS   KA+Q+EKLG  AREAKERLDERL++     +  +N +      K + EK     
Sbjct  59   QRSLTNKAHQNEKLGEIAREAKERLDERLRTHRKPENSSKNSKNEEVKWKESREKNNGER  118

Query  302  GDVQMLKSKA------MKWAKKL-GWKASEEEEECAICLDHFKVGETLMQLPCSHRFHSR  144
             +++  K K         W +KL  WKASE++E C++CL+ F+ GE L+ LPC+H+FHS 
Sbjct  119  KEMRSTKGKEEETRKRFSWGRKLMKWKASEQDE-CSVCLERFRSGEPLLHLPCAHKFHST  177

Query  143  CLLPWLDTNAHCPCCRMGI  87
            CL+PWL  NAHCPCCR  +
Sbjct  178  CLVPWLQANAHCPCCRASL  196



>gb|AFK38095.1| unknown [Lotus japonicus]
Length=183

 Score =   164 bits (416),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 96/188 (51%), Positives = 125/188 (66%), Gaps = 6/188 (3%)
 Frame = -2

Query  644  MAGMLPGVECARRRRFHQSGGLSDsttstttssstrrsSFCLYTSNHDSHLsssssssSM  465
            MAGMLPGVE ARRRRFH+SGG  D       + + R S FCLY SNH+S +SSSSS   +
Sbjct  1    MAGMLPGVESARRRRFHKSGGCLDGPLLAPHNPTRRSS-FCLYASNHESRISSSSS---L  56

Query  464  QRSTIGKAYQDEKLGAAAREAKERLDERLKSGHCKSDHKRNCRKTAAEKGGMVMGDVQML  285
            QR  + +A+ DE LG AAREAK RLD++ ++      +    R+ +  + G      +  
Sbjct  57   QRGLLYQAHLDESLGGAAREAKHRLDDKFRAQRVSETNSVEERRRSLGELGTETYGSRKS  116

Query  284  KSKAMKWAKKLGWKASEEEEECAICLDHFKVGETLMQLPCSHRFHSRCLLPWLDTNAHCP  105
             S+   W+K L WKASE+E+ CA+CL+ F+ GETL+ LPC+HRFHSRCL PWL+ N+HCP
Sbjct  117  GSRRFSWSK-LSWKASEQED-CAVCLETFRNGETLIPLPCAHRFHSRCLKPWLENNSHCP  174

Query  104  CCRMGILS  81
            CCR  ILS
Sbjct  175  CCRTTILS  182



>ref|XP_008456709.1| PREDICTED: RING-H2 finger protein ATL16 isoform X1 [Cucumis melo]
Length=197

 Score =   163 bits (413),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 108/201 (54%), Positives = 133/201 (66%), Gaps = 19/201 (9%)
 Frame = -2

Query  644  MAGMLPGVECARRRRFHQSGGLSDsttstttssstrrsSFCLYTSNHDSHLsssssssSM  465
            MAGMLPGVECARRRRFH S   SDS ++   S STRR SFCLYTSN D HL SSSSS   
Sbjct  1    MAGMLPGVECARRRRFHHSINSSDSPSTAAKSGSTRRPSFCLYTSNRDFHLISSSSS--Q  58

Query  464  QRSTIGKAYQDEKLGAAAREAKERLDERLKSGHCKSDHKRNCR--------KTAAEKGGM  309
            QRS   KA+Q+EKLG  AREAKERLDERL++ H K ++ R+          K + EK   
Sbjct  59   QRSLTNKAHQNEKLGEIAREAKERLDERLRT-HRKPENSRSKNSKNEEVKWKESREKNNG  117

Query  308  VMGDVQMLKSKA------MKWAKKL-GWKASEEEEECAICLDHFKVGETLMQLPCSHRFH  150
               +++  K K         W +KL  WKASE++E C++CL+ F+ GE L+ LPC+H+FH
Sbjct  118  ERKEMRSTKGKEEETRKRFSWGRKLMKWKASEQDE-CSVCLERFRSGEPLLHLPCAHKFH  176

Query  149  SRCLLPWLDTNAHCPCCRMGI  87
            S CL+PWL  NAHCPCCR  +
Sbjct  177  STCLVPWLQANAHCPCCRASL  197



>ref|XP_010244774.1| PREDICTED: E3 ubiquitin-protein ligase TTC3-like [Nelumbo nucifera]
Length=196

 Score =   163 bits (413),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 105/203 (52%), Positives = 136/203 (67%), Gaps = 22/203 (11%)
 Frame = -2

Query  644  MAGMLPGVECARRRRFHQSGGLSDsttstttssstrrsSFCLYTSNHDSHLsssssssSM  465
            MAGMLPGVECARR+RFHQ GG S         + TRR+SFCLYTS+H++HL+SSSS   +
Sbjct  1    MAGMLPGVECARRKRFHQ-GGSSAEPLGIAGHNRTRRTSFCLYTSSHETHLNSSSS---L  56

Query  464  QRSTIGKAYQDEKLGAAAREAKERLDERLKSGHCKSDHKRNCRKTAA--EKGGMVMGDVQ  291
            QR+   ++  DEKL   AREAKERLD++L++   K + KR+  K +   E GG  +  V 
Sbjct  57   QRTKSNQSLLDEKLEGVAREAKERLDKKLRNPR-KPERKRHDSKGSLKCEDGGHGLHSVI  115

Query  290  M---------LKS----KAMKWAKKLGWKASEEEEECAICLDHFKVGETLMQLPCSHRFH  150
                      LK+    K   WA  LGWK+SE+++ C +CL+ F  G+TL+ LPC+HRFH
Sbjct  116  FESMQTERFGLKTGHSRKRFIWAM-LGWKSSEQDQ-CVVCLEAFMAGQTLVHLPCAHRFH  173

Query  149  SRCLLPWLDTNAHCPCCRMGILS  81
            SRCL PWL+ N+HCPCCRMGILS
Sbjct  174  SRCLEPWLENNSHCPCCRMGILS  196



>ref|XP_004287232.1| PREDICTED: RING-H2 finger protein ATL16 [Fragaria vesca subsp. 
vesca]
Length=202

 Score =   162 bits (411),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 99/205 (48%), Positives = 131/205 (64%), Gaps = 27/205 (13%)
 Frame = -2

Query  644  MAGMLPGVECARRRRFHQSGGLSDsttstttssstrrsSFCLYTSNHDSHLsssssssSM  465
            MAGMLPGVECARRRR HQS   S+S     T+  TRRSSFCLY SN+++H    +S+ S+
Sbjct  1    MAGMLPGVECARRRRVHQS---SESPNPANTNGCTRRSSFCLYASNNETH---QTSTFSL  54

Query  464  QRSTIGKA-YQDEKLGAAAREAKERLDERLKSGHCKSDHKRNCRKTAAEKGGMVMGDVQM  288
            QRS + +A Y DEKLG  AR AKERLDERL++      ++ N ++ +     +  G   M
Sbjct  55   QRSKLNQASYMDEKLGVEARVAKERLDERLRTQRKTQPNRLNSKEGSLRSSSVDDGRCTM  114

Query  287  LK------------------SKAMKWAKKLGWKASEEEEECAICLDHFKVGETLMQLPCS  162
            +                   S+   WAK L WK+S+++E CA+CL+ F  GETL+ LPC+
Sbjct  115  IPRELHREVYGSKKTTTKTGSRKFSWAK-LSWKSSDQDE-CAVCLERFMPGETLVHLPCA  172

Query  161  HRFHSRCLLPWLDTNAHCPCCRMGI  87
            HRFHS C++PWL+ NAHCPCCRMG+
Sbjct  173  HRFHSGCMVPWLEKNAHCPCCRMGV  197



>ref|XP_010101184.1| Zinc/RING finger protein 3 [Morus notabilis]
 gb|EXB87680.1| Zinc/RING finger protein 3 [Morus notabilis]
Length=191

 Score =   162 bits (410),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 98/190 (52%), Positives = 128/190 (67%), Gaps = 9/190 (5%)
 Frame = -2

Query  644  MAGMLPGVECARRRRFHQSGGLSDsttstttssstrrsSFCLYTSNHD-SHLsssssssS  468
            MAGMLPGVECARRRR HQSGG SDS ++     + R S FCLYTSN++ +H  +S+    
Sbjct  1    MAGMLPGVECARRRRCHQSGGSSDSLSAPAYGWTRRPS-FCLYTSNNEKTHHITSTFLMG  59

Query  467  MQRSTIGKAYQDEKLGAAAREAKERLDERLKSGHCKSDHKRNCRKTAAEKGGMVMGDVQM  288
               + + +   D+KLG  AREAKERL+ERL++   KS+ KR   K+   KG  +  +V  
Sbjct  60   SMSTQVYQDDDDQKLGVKAREAKERLNERLRAQR-KSESKRQNGKSVG-KGDQLQKEVYG  117

Query  287  LK---SKAMKWAKKLGWKASEEEEECAICLDHFKVGETLMQLPCSHRFHSRCLLPWLDTN  117
             +   S+   WAK L WKAS++E  CAICL+ F+ GE L+ LPC+HRFH  CL+PWL+ N
Sbjct  118  TRKSGSRRFSWAK-LSWKASDQEV-CAICLERFRAGENLVHLPCAHRFHHGCLVPWLENN  175

Query  116  AHCPCCRMGI  87
            +HCPCCRMGI
Sbjct  176  SHCPCCRMGI  185



>gb|KDP30180.1| hypothetical protein JCGZ_16962 [Jatropha curcas]
Length=190

 Score =   159 bits (402),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 108/194 (56%), Positives = 130/194 (67%), Gaps = 19/194 (10%)
 Frame = -2

Query  644  MAGMLPGVECARRRRFHQSGGLSDsttstttssstrrsSFCLYTSNHDSHLsssssssSM  465
            MAGMLPGVECARRRRFHQS         +  S STRRSSFCLYTSNH+S   S +S SS 
Sbjct  1    MAGMLPGVECARRRRFHQSCDTP----CSAVSGSTRRSSFCLYTSNHES---SHTSISSS  53

Query  464  QRSTIGKAYQDEKLGAAAREAKERLDERLKSGHCKSDHKRNCRKTAAEKGGMVMGDVQML  285
             RS I KAY+DE LG  AR+AKERLDERL+    KS  KR+  K   E   + +G++Q  
Sbjct  54   LRSIINKAYEDEMLGVVARQAKERLDERLRIQR-KSSSKRHENKVE-EGKSLAVGELQTE  111

Query  284  --------KSKAMKWAKKLGWKASEEEEECAICLDHFKVGETLMQLPCSHRFHSRCLLPW  129
                     +K  KW+K + W+A+E+EE C ICL+ FK  ETL+ LPC+H+FH RCL PW
Sbjct  112  VYGIKKNGSAKKFKWSK-MSWRATEQEE-CTICLERFKSCETLLHLPCAHKFHCRCLAPW  169

Query  128  LDTNAHCPCCRMGI  87
            L+ NAHCPCCRM I
Sbjct  170  LENNAHCPCCRMQI  183



>gb|KEH38087.1| zinc finger, C3HC4 type (RING finger) protein [Medicago truncatula]
Length=189

 Score =   159 bits (402),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 95/194 (49%), Positives = 132/194 (68%), Gaps = 12/194 (6%)
 Frame = -2

Query  644  MAGMLPGVECARRRRFHQSGGLSDsttstttssstrrsSFCLYTSNHDSHLsssssssSM  465
            MAGMLPGVE ARRRR H+ GG SDS + ++ ++S R S FCLY SNH+S +SSSSS   M
Sbjct  1    MAGMLPGVESARRRRVHKCGGFSDSPSFSSHNTSRRSS-FCLYASNHESRISSSSS---M  56

Query  464  QRSTIGKAYQDEKLGAAAREAKERLDERLKSGHCKSD-HKRNC-----RKTAAEKGGMVM  303
            QR+ + +++QDE +  AAR AK+RLD++ +S     +  K+N      RK + E+    +
Sbjct  57   QRNILYQSHQDENMVGAARAAKQRLDDKFRSQRVSENIRKKNMKCVEGRKESIEELQSEV  116

Query  302  GDVQMLKSKAMKWAKKLGWKASEEEEECAICLDHFKVGETLMQLPCSHRFHSRCLLPWLD  123
               +    +   W+K L WKASE+E+ CA+CL+ FK+G+ L+ LPC+H+FHS CL PWL+
Sbjct  117  YGTKKSGPRKFSWSK-LSWKASEQED-CAVCLESFKIGDKLIPLPCAHKFHSTCLKPWLE  174

Query  122  TNAHCPCCRMGILS  81
             N+HCPCCR  ILS
Sbjct  175  NNSHCPCCRTTILS  188



>emb|CDY36641.1| BnaA07g04160D [Brassica napus]
Length=195

 Score =   158 bits (400),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 94/194 (48%), Positives = 121/194 (62%), Gaps = 9/194 (5%)
 Frame = -2

Query  644  MAGMLPGVECARRRRFHQSGGLSDsttstttssst-----rrsSFCLYTSNHDSHLssss  480
            MAGMLPGVECARRRRFH      D + + + +++T     RR SF LYT+NH+SH +  S
Sbjct  1    MAGMLPGVECARRRRFHGGAPPIDLSNTASVAAATGHVWTRRPSFSLYTTNHESHQAYVS  60

Query  479  sssSMQRSTIGKAYQDEKLGAAAREAKERLDERLKSGHCKSDHKRNCRKTAAEKGGMV--  306
             S    R+       DEKL  AA+EAK+RLDERL++   + + K    K    KG  +  
Sbjct  61   FSERNVRNKSYGVDNDEKLVGAAKEAKDRLDERLRNPRRRQNGKDKATKLEQGKGKSLKD  120

Query  305  -MGDVQMLKSKAMKWAKKLGWKASEEEEECAICLDHFKVGETLMQLPCSHRFHSRCLLPW  129
             + +V  LK    +  K  GW+   E++ECAICLD FK GETL+ LPC+H+FHS CLLPW
Sbjct  121  LLTEVVGLKKSRGRLVKWFGWRV-REQQECAICLDQFKTGETLVHLPCTHKFHSICLLPW  179

Query  128  LDTNAHCPCCRMGI  87
            LDTN +CP CRM I
Sbjct  180  LDTNVYCPYCRMDI  193



>ref|XP_008384706.1| PREDICTED: E3 ubiquitin-protein ligase EL5 [Malus domestica]
Length=199

 Score =   156 bits (395),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 105/208 (50%), Positives = 133/208 (64%), Gaps = 29/208 (14%)
 Frame = -2

Query  644  MAGMLPGVECARRRRFHQSGGLSDsttstttssstrrsSFCLYTSNHDSHLsssssssSM  465
            MAGMLPGVECARRRR HQSG   +S        STRRSSFCLY SNH+SH    +S+SS+
Sbjct  1    MAGMLPGVECARRRRVHQSG---ESPCVGGIHGSTRRSSFCLYASNHESH---HTSTSSL  54

Query  464  QRSTIGKAYQDEKLGAAAREAKERLDERLKSGHCKSDHKRNCRK-----TAAEKGG---M  309
            QRS + +AY DEKLG  AREAK RLDERL++   K   KR+           + GG   +
Sbjct  55   QRSILNQAYMDEKLGVEAREAKGRLDERLRTQR-KPQPKRHTNGGNKGLKCVDGGGRSSV  113

Query  308  VMGDVQ------------MLKSKAMKWAKKLGWKASEEEEECAICLDHFKVGETLMQLPC  165
             +G++                SK   W+K L WK+S+++E CA+CL+  + GETL+ LPC
Sbjct  114  XLGELXKEVYGANKSSSSTSGSKKFSWSK-LTWKSSDQDE-CAVCLERLRPGETLVHLPC  171

Query  164  SHRFHSRCLLPWLDTNAHCPCCRMGILS  81
            +HRFHS C++PWL  NAHCPCCRM I+S
Sbjct  172  AHRFHSGCMVPWLHNNAHCPCCRMEIIS  199



>ref|XP_009119405.1| PREDICTED: RING-H2 finger protein ATL54 [Brassica rapa]
Length=194

 Score =   156 bits (395),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 95/197 (48%), Positives = 123/197 (62%), Gaps = 15/197 (8%)
 Frame = -2

Query  644  MAGMLPGVECARRRRFHQSGGLSDsttstttssst-----rrsSFCLYTSNHDSHLssss  480
            MAGMLPGVECARRRRFH      D + + + +++T     RR SF LYT+NH+SH    +
Sbjct  1    MAGMLPGVECARRRRFHGGAPPIDLSNTASVAAATGHVWTRRPSFSLYTTNHESH---QA  57

Query  479  sssSMQRSTIGKAY---QDEKLGAAAREAKERLDERLKSGHCKSDHKRNCRKTAAEKGGM  309
              S  +R+   K+Y    DEKL  AA+EAK+RLDERL++   + + K    K    K   
Sbjct  58   YVSFSERNVRNKSYGVDNDEKLVGAAKEAKDRLDERLRNPRRRQNGKDKVNKLEQGKIKS  117

Query  308  VMG---DVQMLKSKAMKWAKKLGWKASEEEEECAICLDHFKVGETLMQLPCSHRFHSRCL  138
            +M    +V  LK    +  K  GW+    ++ECAICLD FK GETL+ LPC+H+FHS CL
Sbjct  118  LMDLPTEVVGLKKSRGRLVKWFGWRV-RHQQECAICLDQFKTGETLVHLPCTHKFHSICL  176

Query  137  LPWLDTNAHCPCCRMGI  87
            LPWLDTNA+CP CRM I
Sbjct  177  LPWLDTNAYCPYCRMDI  193



>ref|XP_010049884.1| PREDICTED: RING finger protein 215-like [Eucalyptus grandis]
 gb|KCW82706.1| hypothetical protein EUGRSUZ_C04088 [Eucalyptus grandis]
Length=194

 Score =   155 bits (393),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 95/198 (48%), Positives = 124/198 (63%), Gaps = 14/198 (7%)
 Frame = -2

Query  644  MAGMLPGVECARRRRFHQSGGLSDsttstttssstrrsSFCLYTSNHDSHLsssssssSM  465
            MAGMLPGVE ARRRR HQ GG       T    S RR S  L++ +H+ H     SSS  
Sbjct  1    MAGMLPGVEFARRRRLHQGGGAWSDPPPTAAYGSVRRCSLPLHSRSHEPH--HHGSSSYF  58

Query  464  QRSTIGKAYQDEKLGAAAREAKERLDERLKSGHCKSDHKRNC----------RKTAAEKG  315
            QR  + +  +DEKLG AAREAKERLDE+LK+   KS+ +R+           R T   + 
Sbjct  59   QRGMMNRGCEDEKLGGAAREAKERLDEKLKTQGIKSECRRSNADGRRTREQERDTQLRRE  118

Query  314  GMVMGDVQMLKSKAMKWAKKLGWKASEEEEECAICLDHFKVGETLMQLPCSHRFHSRCLL  135
             +    ++   SK   W K L WKA+++EE CA+CLD F+ GETL+ LPC+HRFHSRCL+
Sbjct  119  VVSRNGLKKGGSKRFSWGK-LSWKATDQEE-CAVCLDLFRAGETLIHLPCTHRFHSRCLV  176

Query  134  PWLDTNAHCPCCRMGILS  81
            PWL++++HCPCCR  + S
Sbjct  177  PWLESHSHCPCCRTAVSS  194



>ref|XP_010942166.1| PREDICTED: E3 ubiquitin-protein ligase EL5 isoform X3 [Elaeis 
guineensis]
Length=193

 Score =   154 bits (390),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 93/202 (46%), Positives = 121/202 (60%), Gaps = 28/202 (14%)
 Frame = -2

Query  644  MAGMLPGVECARRRRFHQSGGLSDsttstttssstrrsSFCLYTSNHDSHLsssssssSM  465
            MAGMLPGVECARRRR  Q G +   + S  +S       FCLYT+ +++HL S+ +    
Sbjct  4    MAGMLPGVECARRRRLRQGGSMDSPSGSRRSS-------FCLYTTGYETHLGSTFT----  52

Query  464  QRSTIGKAYQDEKLGAAAREAKERLDERLK---SGHCKSDHKRNCRKTAAEKGG------  312
            QRS + K   D  LG AAREAKERLDE+L+   S   K  H     +    +GG      
Sbjct  53   QRSGLIKELHDGALGDAAREAKERLDEKLRAQRSLAIKRHHSMGSMRPEKSRGGDEGAAP  112

Query  311  MVMGDVQ--MLKSKA----MKWAKKLGWKASEEEEECAICLDHFKVGETLMQLPCSHRFH  150
            M++G  Q  +  SK       W+K LGWKASE+ E CA+CL+ FK G+ L+ LPC+HRFH
Sbjct  113  MILGKAQREVFSSKKSTRKFSWSK-LGWKASEQAE-CAVCLEEFKTGDILINLPCAHRFH  170

Query  149  SRCLLPWLDTNAHCPCCRMGIL  84
              C +PWL+ N+HCPCCRM + 
Sbjct  171  WNCAVPWLENNSHCPCCRMTVF  192



>ref|XP_010047191.1| PREDICTED: E3 ubiquitin-protein ligase RNF8-like [Eucalyptus 
grandis]
 gb|KCW79016.1| hypothetical protein EUGRSUZ_C00438 [Eucalyptus grandis]
Length=193

 Score =   154 bits (389),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 98/197 (50%), Positives = 131/197 (66%), Gaps = 20/197 (10%)
 Frame = -2

Query  635  MLPGVECARRRRFHQSGGL--SDsttstttssstrrsSFCLYTSNHDSHLsssssssSMQ  462
            MLPGVECARRRRF+QSGG   S    +  T+ +TRRSSFCLYT++H +     +SSS   
Sbjct  1    MLPGVECARRRRFYQSGGQPNSPVVAAAATTVTTRRSSFCLYTTHHAA-----TSSSVQI  55

Query  461  RSTIGKAYQDEK-LGAAAREAKERLDERLKSGHCKSDHKR-----NCRKTAAEKGGMVMG  300
            R+ I +A+ DE+ LG AAREAK+RLDERL++       +R     + R    +   MV G
Sbjct  56   RNIINQAHADEEELGGAAREAKQRLDERLRTQWEPETKRRHNDGESSRARKLQLQTMVHG  115

Query  299  DVQMLK------SKAMKWAKKLGWKASEEEEECAICLDHFKVGETLMQLPCSHRFHSRCL  138
               + +      SK   W+K + W+A++++E CAICL+ F+VGETL  LPC+HRFHSRC 
Sbjct  116  LQSVRRGGSSSNSKRFSWSKMMRWRATDQDE-CAICLERFEVGETLAHLPCAHRFHSRCA  174

Query  137  LPWLDTNAHCPCCRMGI  87
            +PWL+ +AHCPCCRMGI
Sbjct  175  VPWLEAHAHCPCCRMGI  191



>ref|XP_010942164.1| PREDICTED: E3 ubiquitin-protein ligase EL5 isoform X1 [Elaeis 
guineensis]
Length=219

 Score =   155 bits (391),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 93/205 (45%), Positives = 123/205 (60%), Gaps = 27/205 (13%)
 Frame = -2

Query  644  MAGMLPGVECARRRRFHQSGGLSDsttstttssstrrsSFCLYTSNHDSHLsssssssSM  465
            MAGMLPGVECARRRR  Q G +   + S  +S       FCLYT+ +++HL S+ +  ++
Sbjct  23   MAGMLPGVECARRRRLRQGGSMDSPSGSRRSS-------FCLYTTGYETHLGSTFTKYAL  75

Query  464  ---QRSTIGKAYQDEKLGAAAREAKERLDERLK---SGHCKSDHKRNCRKTAAEKGG---  312
               QRS + K   D  LG AAREAKERLDE+L+   S   K  H     +    +GG   
Sbjct  76   NKQQRSGLIKELHDGALGDAAREAKERLDEKLRAQRSLAIKRHHSMGSMRPEKSRGGDEG  135

Query  311  ---MVMGDVQ--MLKSKA----MKWAKKLGWKASEEEEECAICLDHFKVGETLMQLPCSH  159
               M++G  Q  +  SK       W+K LGWKASE+ E CA+CL+ FK G+ L+ LPC+H
Sbjct  136  AAPMILGKAQREVFSSKKSTRKFSWSK-LGWKASEQAE-CAVCLEEFKTGDILINLPCAH  193

Query  158  RFHSRCLLPWLDTNAHCPCCRMGIL  84
            RFH  C +PWL+ N+HCPCCRM + 
Sbjct  194  RFHWNCAVPWLENNSHCPCCRMTVF  218



>ref|XP_009341797.1| PREDICTED: E3 ubiquitin-protein ligase EL5-like [Pyrus x bretschneideri]
Length=200

 Score =   154 bits (389),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 103/209 (49%), Positives = 130/209 (62%), Gaps = 30/209 (14%)
 Frame = -2

Query  644  MAGMLPGVECARRRRFHQSGGLSDsttstttssstrrsSFCLYTSNHDSHLsssssssSM  465
            MAGMLPGVECARRRR HQSG   +S        STRRSSFCLY SNHDSH    + +SS+
Sbjct  1    MAGMLPGVECARRRRVHQSG---ESPCVGAIHGSTRRSSFCLYASNHDSH---HTPTSSL  54

Query  464  QRSTIGKAYQDEKLGAAAREAKERLDERLKSGHCKSDHKRNCRK-----TAAEKGG---M  309
            QRS + +AY DEKLG  AREAK  LDERL++   K   KR+           + GG   +
Sbjct  55   QRSILNQAYMDEKLGVEAREAKGGLDERLRTQR-KPQPKRHTNGGNKGLKCVDGGGRSSV  113

Query  308  VMGDVQ-------------MLKSKAMKWAKKLGWKASEEEEECAICLDHFKVGETLMQLP  168
            V+G++Q                SK   W+K L WK+S+++E CA+CL+  + GE L+ LP
Sbjct  114  VLGELQKEVYGANKSSSSSTSGSKKFSWSK-LTWKSSDQDE-CAVCLERLRPGEALVHLP  171

Query  167  CSHRFHSRCLLPWLDTNAHCPCCRMGILS  81
            C+HRFHS C++PWL  N HCPCCR  I+S
Sbjct  172  CAHRFHSGCMVPWLHNNGHCPCCRTEIIS  200



>ref|XP_010942165.1| PREDICTED: E3 ubiquitin-protein ligase EL5 isoform X2 [Elaeis 
guineensis]
Length=212

 Score =   154 bits (389),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 93/202 (46%), Positives = 121/202 (60%), Gaps = 28/202 (14%)
 Frame = -2

Query  644  MAGMLPGVECARRRRFHQSGGLSDsttstttssstrrsSFCLYTSNHDSHLsssssssSM  465
            MAGMLPGVECARRRR  Q G +   + S  +S       FCLYT+ +++HL S+ +    
Sbjct  23   MAGMLPGVECARRRRLRQGGSMDSPSGSRRSS-------FCLYTTGYETHLGSTFT----  71

Query  464  QRSTIGKAYQDEKLGAAAREAKERLDERLK---SGHCKSDHKRNCRKTAAEKGG------  312
            QRS + K   D  LG AAREAKERLDE+L+   S   K  H     +    +GG      
Sbjct  72   QRSGLIKELHDGALGDAAREAKERLDEKLRAQRSLAIKRHHSMGSMRPEKSRGGDEGAAP  131

Query  311  MVMGDVQ--MLKSKA----MKWAKKLGWKASEEEEECAICLDHFKVGETLMQLPCSHRFH  150
            M++G  Q  +  SK       W+K LGWKASE+ E CA+CL+ FK G+ L+ LPC+HRFH
Sbjct  132  MILGKAQREVFSSKKSTRKFSWSK-LGWKASEQAE-CAVCLEEFKTGDILINLPCAHRFH  189

Query  149  SRCLLPWLDTNAHCPCCRMGIL  84
              C +PWL+ N+HCPCCRM + 
Sbjct  190  WNCAVPWLENNSHCPCCRMTVF  211



>emb|CDY57225.1| BnaCnng31690D [Brassica napus]
Length=195

 Score =   153 bits (386),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 92/194 (47%), Positives = 120/194 (62%), Gaps = 9/194 (5%)
 Frame = -2

Query  644  MAGMLPGVECARRRRFHQSGGLSDsttstttssst-----rrsSFCLYTSNHDSHLssss  480
            MAGMLPGVECARRRRFH      D + + + +++T     RR SF LYT+NH+SH +  S
Sbjct  1    MAGMLPGVECARRRRFHGGAPPIDLSNTASVAAATGHVWTRRPSFSLYTTNHESHQAYVS  60

Query  479  sssSMQRSTIGKAYQDEKLGAAAREAKERLDERLKSGHCKSDHKRNCRKTAAEKGGMVMG  300
             S    R+       DEKL  AA+EAK+RLDERL++   + + K    K    K   +M 
Sbjct  61   FSERNVRNKSYGVDNDEKLVGAAKEAKDRLDERLRNPRRRQNGKDKVNKLEQGKIKSLMD  120

Query  299  ---DVQMLKSKAMKWAKKLGWKASEEEEECAICLDHFKVGETLMQLPCSHRFHSRCLLPW  129
               ++  LK    +  K  GW+   E++ECAICLD  K+GETL+ LPC+H+FHS CLLPW
Sbjct  121  LPTELVGLKKSRGRLVKWFGWRV-REQQECAICLDQLKMGETLVHLPCTHKFHSICLLPW  179

Query  128  LDTNAHCPCCRMGI  87
            LDTN +CP CRM I
Sbjct  180  LDTNGYCPYCRMDI  193



>ref|NP_001238250.1| uncharacterized protein LOC100527583 [Glycine max]
 gb|ACU16694.1| unknown [Glycine max]
Length=202

 Score =   153 bits (386),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 101/196 (52%), Positives = 129/196 (66%), Gaps = 17/196 (9%)
 Frame = -2

Query  644  MAGMLPGVECARRRRFHQSGGLSDsttstttssstrrsSFCLYTSNHDSHLsssssssSM  465
            MAGMLPGVECARRRR H+   L  ++TS T+ +STRRSSFCLYTSNH+      S SSS+
Sbjct  15   MAGMLPGVECARRRRLHRC--LDSNSTSLTSHASTRRSSFCLYTSNHEC---RLSLSSSL  69

Query  464  QRSTIGKAYQDEKLGAAAREAKERLDERLKSGHCKSDHKRNC--------RKTAAEKGGM  309
            QRS + + + DE +G   REAK+RLD++ +  H  S++KR          R   AE    
Sbjct  70   QRSMLYQPHPDENMGGVVREAKQRLDDKFR-AHRNSENKRQNSTKCVEGRRTRIAEFHTE  128

Query  308  VMGDVQMLKSKAMKWAKKLGWKASEEEEECAICLDHFKVGETLMQLPCSHRFHSRCLLPW  129
            V G  +   S+   W K   WKASE+E+ CA+CL+ F+VGETL+ LPC+HRFH RCL PW
Sbjct  129  VYGSKKS-GSRRFSWTK-WSWKASEQED-CAVCLESFRVGETLIHLPCAHRFHDRCLKPW  185

Query  128  LDTNAHCPCCRMGILS  81
            L+ N+HCPCCR  I S
Sbjct  186  LENNSHCPCCRTTIFS  201



>ref|XP_006409544.1| hypothetical protein EUTSA_v10022864mg [Eutrema salsugineum]
 gb|ESQ50997.1| hypothetical protein EUTSA_v10022864mg [Eutrema salsugineum]
Length=193

 Score =   152 bits (384),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 89/194 (46%), Positives = 123/194 (63%), Gaps = 7/194 (4%)
 Frame = -2

Query  644  MAGMLPGVECARRRRFHQSGGLSDsttstttsss-----trrsSFCLYTSNHDSHLssss  480
            MAGMLPGVECARRRRFH  G   D + +   +++     TRR SF LYT+N++SH +  S
Sbjct  1    MAGMLPGVECARRRRFHGGGPPIDLSNTAAVAAAARHVWTRRPSFSLYTTNNESHQAYVS  60

Query  479  sssSMQRS-TIGKAYQDEKLGAAAREAKERLDERLKSGHCKSDHKRNCRKTAAEKGGMVM  303
             S    R+ + G+ + DEKL  AA+EAKERLDERL++   + +      +   +  G + 
Sbjct  61   FSERNVRNKSYGEDHNDEKLDGAAKEAKERLDERLRNPRKRQEKIDKLEQKKGKSHGELP  120

Query  302  GDVQMLKSKAMKWAKKLGWKASEEEEECAICLDHFKVGETLMQLPCSHRFHSRCLLPWLD  123
             +V  LK    K  +  GW+   ++++CAICLD FK GETL+ LPC+H+FHS C+LPWLD
Sbjct  121  REVVGLKKSRGKLIEWFGWRI-RQQQDCAICLDQFKTGETLVHLPCTHKFHSICVLPWLD  179

Query  122  TNAHCPCCRMGILS  81
            T  +CP CRM I +
Sbjct  180  TKVYCPYCRMDIWN  193



>gb|KCW82707.1| hypothetical protein EUGRSUZ_C04088 [Eucalyptus grandis]
Length=193

 Score =   152 bits (384),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 94/198 (47%), Positives = 123/198 (62%), Gaps = 15/198 (8%)
 Frame = -2

Query  644  MAGMLPGVECARRRRFHQSGGLSDsttstttssstrrsSFCLYTSNHDSHLsssssssSM  465
            MAGMLPGVE ARRRR HQ GG       T    S RR S  L++ +H+ H      SSS 
Sbjct  1    MAGMLPGVEFARRRRLHQGGGAWSDPPPTAAYGSVRRCSLPLHSRSHEPH---HHGSSSY  57

Query  464  QRSTIGKAYQDEKLGAAAREAKERLDERLKSGHCKSDHKRNC----------RKTAAEKG  315
             R  + +  +DEKLG AAREAKERLDE+LK+   KS+ +R+           R T   + 
Sbjct  58   FRGMMNRGCEDEKLGGAAREAKERLDEKLKTQGIKSECRRSNADGRRTREQERDTQLRRE  117

Query  314  GMVMGDVQMLKSKAMKWAKKLGWKASEEEEECAICLDHFKVGETLMQLPCSHRFHSRCLL  135
             +    ++   SK   W K L WKA+++EE CA+CLD F+ GETL+ LPC+HRFHSRCL+
Sbjct  118  VVSRNGLKKGGSKRFSWGK-LSWKATDQEE-CAVCLDLFRAGETLIHLPCTHRFHSRCLV  175

Query  134  PWLDTNAHCPCCRMGILS  81
            PWL++++HCPCCR  + S
Sbjct  176  PWLESHSHCPCCRTAVSS  193



>ref|XP_010533079.1| PREDICTED: NEP1-interacting protein 1 [Tarenaya hassleriana]
Length=201

 Score =   151 bits (382),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 98/206 (48%), Positives = 131/206 (64%), Gaps = 23/206 (11%)
 Frame = -2

Query  644  MAGMLPGVECARRRRFHQSGGLSDsttstttsss------trrsSFCLYTSNHDSHLsss  483
            MAGMLPGVECARRRRFH  GG++   + ++ +++      TRR +FCLYT+NHD+H  S 
Sbjct  1    MAGMLPGVECARRRRFH-GGGIASEYSPSSAAAAAAAHGWTRRPAFCLYTTNHDTHHPSI  59

Query  482  ssssSMQRSTIGKAY--QDEKLGAAAREAKERLDERLKSGHCKSDHKRNCRK----TAAE  321
            S S +  R+   KAY  +DEKLG  AREAKERLD RL++       +R   K    + AE
Sbjct  60   SFSRNNVRN---KAYGEEDEKLGEVAREAKERLDGRLRNQRRPEFGRRQSGKDRVSSTAE  116

Query  320  KG------GMVMGDVQMLKSKAMKWAKKLGWKASEEEEECAICLDHFKVGETLMQLPCSH  159
            +G      G +  +V   +      A   GW+A ++++ CAICLD FK GETL+ LPC+H
Sbjct  117  QGRSKAVHGELPTEVVGSRKSXXXIAGWFGWRAGDQQD-CAICLDRFKTGETLVHLPCAH  175

Query  158  RFHSRCLLPWLDTNAHCPCCRMGILS  81
            +FHS+CL+PWLD N HCP CRM I +
Sbjct  176  KFHSKCLVPWLDQNVHCPYCRMDIWN  201



>gb|AFK42549.1| unknown [Lotus japonicus]
Length=183

 Score =   150 bits (380),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 97/189 (51%), Positives = 127/189 (67%), Gaps = 8/189 (4%)
 Frame = -2

Query  644  MAGMLPGVECARRRRFHQSGGLSDsttstttssstrrsSFCLYTSNHDSHLsssssssSM  465
            MAGMLPGVE ARRRRFH+SGG  D       +S+ R S FCLY SN++S     SSSSS+
Sbjct  1    MAGMLPGVESARRRRFHKSGGCLDGPLLAPHNSTRRSS-FCLYASNNES---RISSSSSL  56

Query  464  QRSTIGKAYQDEKLGAAAREAKERLDERLKSGHC-KSDHKRNCRKTAAEKGGMVMGDVQM  288
            QR  + +A+ DE LG AAREAK RLD++ ++    +++     R++  E G    G  + 
Sbjct  57   QRGLLYQAHLDESLGGAAREAKHRLDDKFRAQRVSETNSVEERRRSLGELGTETYGSRKS  116

Query  287  LKSKAMKWAKKLGWKASEEEEECAICLDHFKVGETLMQLPCSHRFHSRCLLPWLDTNAHC  108
              S+   W+K L WKASE+E+ CA+CL+  + GETL+ LPC+HRFHSRCL PWL+ N+HC
Sbjct  117  -GSRRFSWSK-LSWKASEQED-CAVCLETIRNGETLIPLPCAHRFHSRCLKPWLENNSHC  173

Query  107  PCCRMGILS  81
            PCCR  ILS
Sbjct  174  PCCRTTILS  182



>ref|XP_009338416.1| PREDICTED: E3 ubiquitin-protein ligase SDIR1-like [Pyrus x bretschneideri]
Length=199

 Score =   151 bits (381),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 96/205 (47%), Positives = 124/205 (60%), Gaps = 23/205 (11%)
 Frame = -2

Query  644  MAGMLPGVECARRRRFHQSGGLSDsttstttssstrrsSFCLYTSNHDSHLsssssssSM  465
            MAGMLPGVE ARRRR  QSG   +         STRRS FCLY SNH+SH    +S+S +
Sbjct  1    MAGMLPGVESARRRRVRQSG---EPPCVGGIHGSTRRSCFCLYASNHESH---HTSTSPL  54

Query  464  QRSTIGKAYQDEKLGAAAREAKERLDERLKS---GHCKSDHKRNCRKTAAEKGG----MV  306
            QRS + +AY DEKLG  AREAK RLDERL++      K  +  N +   +  GG    +V
Sbjct  55   QRSILNQAYMDEKLGVEAREAKGRLDERLRTQRKSQLKRHNNSNNKGLKSVDGGGRSSVV  114

Query  305  MGDVQMLKSKAMKWAKKLGWKASE----------EEEECAICLDHFKVGETLMQLPCSHR  156
            +G++Q+    A K +                   +++ECA+CL+ F  GETL+ LPC+HR
Sbjct  115  LGELQIEVYGATKSSSSTSGSKKFSWSKLSWKSSDQDECAVCLERFSPGETLVNLPCAHR  174

Query  155  FHSRCLLPWLDTNAHCPCCRMGILS  81
            FHS C++PWL +NAHCPCCRM I S
Sbjct  175  FHSGCMIPWLHSNAHCPCCRMEISS  199



>gb|KHN42853.1| Putative RING finger protein P32A8.03c [Glycine soja]
Length=202

 Score =   151 bits (381),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 100/196 (51%), Positives = 128/196 (65%), Gaps = 17/196 (9%)
 Frame = -2

Query  644  MAGMLPGVECARRRRFHQSGGLSDsttstttssstrrsSFCLYTSNHDSHLsssssssSM  465
            MAGMLPGVECARRRR H+   L  ++TS T+ +STRRSSFCLY SNH+      S SSS+
Sbjct  15   MAGMLPGVECARRRRLHRC--LDSNSTSLTSHASTRRSSFCLYASNHEC---RLSLSSSL  69

Query  464  QRSTIGKAYQDEKLGAAAREAKERLDERLKSGHCKSDHKRNC--------RKTAAEKGGM  309
            QRS + + + DE +G   REAK+RLD++ +  H  S++KR          R   AE    
Sbjct  70   QRSMLYQPHPDENMGGVVREAKQRLDDKFR-AHRNSENKRQNSTKCVEGRRTRIAEFHTE  128

Query  308  VMGDVQMLKSKAMKWAKKLGWKASEEEEECAICLDHFKVGETLMQLPCSHRFHSRCLLPW  129
            V G  +   S+   W K   WKASE+E+ CA+CL+ F+VGETL+ LPC+HRFH RCL PW
Sbjct  129  VYGSKKS-GSRRFSWTK-WSWKASEQED-CAVCLESFRVGETLIHLPCAHRFHDRCLKPW  185

Query  128  LDTNAHCPCCRMGILS  81
            L+ N+HCPCCR  I S
Sbjct  186  LENNSHCPCCRTTIFS  201



>ref|XP_010517354.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like [Camelina 
sativa]
Length=194

 Score =   149 bits (377),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 95/199 (48%), Positives = 123/199 (62%), Gaps = 20/199 (10%)
 Frame = -2

Query  644  MAGMLPGVECARRRRFHQSG----GLSDsttstttssstrrsSFCLYTSNHDSHLsssss  477
            MAGMLPGVECARRRRFH        L+ +  +T     TRR SF LYT+NH+SH    + 
Sbjct  1    MAGMLPGVECARRRRFHGGAPPIESLNTAVAATAGHVWTRRPSFSLYTTNHESH---QAH  57

Query  476  ssSMQRSTIGKAY---QDEKLGAAAREAKERLDERLKSGHCKSDHKRNCRKTAAEKG---  315
             S  +RS   K+Y    DEKL  AA+EAK+RL+ERL+    + + K    K+   KG   
Sbjct  58   VSFSERSVRSKSYGEDNDEKLDGAAKEAKQRLNERLRVPRTRQNGKDKGNKSEQVKGKPH  117

Query  314  GMVMGDVQMLK---SKAMKWAKKLGWKASEEEEECAICLDHFKVGETLMQLPCSHRFHSR  144
            G ++ +V  LK    + M+W K   W+   E+++CAICLD FK GE L+ LPC+H+FHS 
Sbjct  118  GELLTEVVGLKKSRGRLMEWFK---WRV-REQQDCAICLDRFKKGEKLVHLPCAHKFHSI  173

Query  143  CLLPWLDTNAHCPCCRMGI  87
            CLLPWLDTN +CP CR  I
Sbjct  174  CLLPWLDTNVYCPYCRTDI  192



>ref|XP_006473942.1| PREDICTED: uncharacterized protein LOC102616965 [Citrus sinensis]
Length=207

 Score =   150 bits (378),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 111/206 (54%), Positives = 131/206 (64%), Gaps = 26/206 (13%)
 Frame = -2

Query  644  MAGMLPGVECARRRRFHQSGG----LSDsttstttssstrrsS---FCLYTSNHDSHLss  486
            MAGMLPGVECARRRR HQSGG     SD  T T++S S   S    FCLYTS+H+S    
Sbjct  1    MAGMLPGVECARRRRIHQSGGGCSSASDGLTPTSSSMSMSMSRRSSFCLYTSSHES---H  57

Query  485  sssssSMQRSTIGKAYQDEKLGAAAREAKERLDERLKSGHCKSDHKRNCRKTAAEKGGMV  306
             +SS S  RS I +A +DEKL   AREAKERLDERL +    SD   N R+   E   ++
Sbjct  58   HTSSISSLRSIINQACEDEKLAGVAREAKERLDERLGTQRKSSDS--NSRQNGKESSVLM  115

Query  305  MGDVQML-----------KSKAMKWAKKLGWKASEEEEECAICLDHFKVGETLMQLPCSH  159
              +   +            SK   W+K L WKA  E+EECAICL+ FKVG+TL+ LPC+H
Sbjct  116  NINKSTVLHTQVFGSKKSGSKRFSWSK-LSWKA-WEQEECAICLERFKVGDTLVHLPCAH  173

Query  158  RFHSRCLLPWLDTNAH-CPCCRMGIL  84
            RFH+RCLLPWL TNAH CPCCRM IL
Sbjct  174  RFHARCLLPWLGTNAHNCPCCRMQIL  199



>ref|XP_009390573.1| PREDICTED: E3 ubiquitin-protein ligase SDIR1-like [Musa acuminata 
subsp. malaccensis]
Length=178

 Score =   148 bits (373),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 92/188 (49%), Positives = 120/188 (64%), Gaps = 12/188 (6%)
 Frame = -2

Query  644  MAGMLPGVECARRRRFHQSGGLSDsttstttssstrrsSFCLYTSNHDSHLsssssssSM  465
            MAGMLPGVE ARRRR H  GG +DS+T T  SS      +CL+T   ++HLS++ S   M
Sbjct  1    MAGMLPGVEFARRRRLHH-GGSTDSSTGTRRSS------YCLHTIGCEAHLSATGS---M  50

Query  464  QRSTIGKAYQDEKLGAAAREAKERLDERLKSGHCKSDHKRNCRKTAAEKGGMVMGDVQML  285
            QR+ + K   +  LG+ AREAKERLD RLK    +     +   +     G V G+V   
Sbjct  51   QRTILNKEVHEGALGSMAREAKERLDARLKIKRYRGLESNSECGSEQVIPGSVQGEVFSS  110

Query  284  KS-KAMKWAKKLGWKASEEEEECAICLDHFKVGETLMQLPCSHRFHSRCLLPWLDTNAHC  108
            KS +   W+KKLGW ASE+ E CAICL+ FK G+ L++LPC+HRFH  C++PWL +N+HC
Sbjct  111  KSTRKFSWSKKLGWTASEQAE-CAICLEEFKRGDVLLRLPCAHRFHCDCVVPWLRSNSHC  169

Query  107  PCCRMGIL  84
            PCCR  I 
Sbjct  170  PCCRTTIF  177



>ref|XP_009358514.1| PREDICTED: E3 ubiquitin-protein ligase SDIR1-like [Pyrus x bretschneideri]
Length=199

 Score =   148 bits (374),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 96/205 (47%), Positives = 125/205 (61%), Gaps = 23/205 (11%)
 Frame = -2

Query  644  MAGMLPGVECARRRRFHQSGGLSDsttstttssstrrsSFCLYTSNHDSHLsssssssSM  465
            MAGMLPGVE ARRRR  QSG   +         STRRS FCLY SNH+SH    +S+S +
Sbjct  1    MAGMLPGVESARRRRVRQSG---EPPCVGGIHGSTRRSCFCLYASNHESH---HTSTSPL  54

Query  464  QRSTIGKAYQDEKLGAAAREAKERLDERLKS---GHCKSDHKRNCRKTAAEKGG----MV  306
            QRS + +AY DEKLG   REAK RLDERL++      K  +  N +   +  GG     V
Sbjct  55   QRSILNQAYMDEKLGVEVREAKGRLDERLRTQRKSQLKRHNNSNNKGLKSVDGGGRSSAV  114

Query  305  MGDVQM----------LKSKAMKWAKKLGWKASEEEEECAICLDHFKVGETLMQLPCSHR  156
            +G++Q+            S + K++       S +++ECA+CL+ F  GETL+ LPC+HR
Sbjct  115  LGELQIEVSGAKKSSSSTSGSKKFSWSKLSWKSSDQDECAVCLERFSPGETLVNLPCAHR  174

Query  155  FHSRCLLPWLDTNAHCPCCRMGILS  81
            FHS C++PWL +NAHCPCCRM I S
Sbjct  175  FHSGCMIPWLHSNAHCPCCRMEISS  199



>ref|XP_006453710.1| hypothetical protein CICLE_v10009499mg [Citrus clementina]
 ref|XP_006453711.1| hypothetical protein CICLE_v10009499mg [Citrus clementina]
 gb|ESR66950.1| hypothetical protein CICLE_v10009499mg [Citrus clementina]
 gb|ESR66951.1| hypothetical protein CICLE_v10009499mg [Citrus clementina]
 gb|KDO59334.1| hypothetical protein CISIN_1g028568mg [Citrus sinensis]
 gb|KDO59335.1| hypothetical protein CISIN_1g028568mg [Citrus sinensis]
Length=207

 Score =   149 bits (375),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 112/206 (54%), Positives = 133/206 (65%), Gaps = 26/206 (13%)
 Frame = -2

Query  644  MAGMLPGVECARRRRFHQSGG----LSDsttst---ttssstrrsSFCLYTSNHDSHLss  486
            MAGMLPGVECARRRR HQSGG     SD    T    + S +RRSSFCLYTS+H+SH   
Sbjct  1    MAGMLPGVECARRRRIHQSGGGCSSASDGLAPTWSSMSMSMSRRSSFCLYTSSHESH---  57

Query  485  sssssSMQRSTIGKAYQDEKLGAAAREAKERLDERLKSGHCKSDHKRNCRKTAAEKGGMV  306
             +SS S  RS I +A +DE+L   AREAKERLDERL +    SD   N R+   E   ++
Sbjct  58   HTSSISSLRSIINQACEDEQLAGVAREAKERLDERLGTQRKSSDS--NSRQNGKESSVLM  115

Query  305  MGDVQML-----------KSKAMKWAKKLGWKASEEEEECAICLDHFKVGETLMQLPCSH  159
              +   +            SK   W+K L WKA E+EE CAICL+ FKVG+TL+ LPC+H
Sbjct  116  NINKSTVLHTQVFGSKKSGSKRFSWSK-LSWKACEQEE-CAICLERFKVGDTLVHLPCAH  173

Query  158  RFHSRCLLPWLDTNAH-CPCCRMGIL  84
            RFH+RCLLPWL TNAH CPCCRM IL
Sbjct  174  RFHARCLLPWLATNAHNCPCCRMQIL  199



>gb|KFK40025.1| hypothetical protein AALP_AA3G320300 [Arabis alpina]
Length=195

 Score =   147 bits (372),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 90/197 (46%), Positives = 124/197 (63%), Gaps = 15/197 (8%)
 Frame = -2

Query  644  MAGMLPGVECARRRRFHQSGGLSDsttstttsss-----trrsSFCLYTSNHDSHLssss  480
            MAGML GVECARRRRF+      D + + + +++     TRR SF LYT+N++SH    +
Sbjct  1    MAGMLAGVECARRRRFYGGAPPIDLSNTASVAAAAGHVWTRRPSFSLYTTNNESH---QA  57

Query  479  sssSMQRSTIGKAY---QDEKLGAAAREAKERLDERLKSGHCKSDHKRNCRKTAAEKG--  315
              S  +R+   K+Y    +EKL  AA+ AKERLDERL++   + + K    K+   KG  
Sbjct  58   HVSFSERNVRNKSYGEDNNEKLEGAAKVAKERLDERLRNPRRRQNGKEKVVKSEQGKGKP  117

Query  314  -GMVMGDVQMLKSKAMKWAKKLGWKASEEEEECAICLDHFKVGETLMQLPCSHRFHSRCL  138
             G +  +V  LK+   +  +  GW+   E+++CAICLD FK+GETL+ LPCSH+FHS CL
Sbjct  118  HGELPTEVVGLKTSRGRLIQWFGWRV-REQQDCAICLDRFKMGETLVNLPCSHKFHSNCL  176

Query  137  LPWLDTNAHCPCCRMGI  87
            LPWLDTN +CP CR  I
Sbjct  177  LPWLDTNVYCPYCRTDI  193



>ref|XP_010488968.1| PREDICTED: E3 ubiquitin-protein ligase arkadia-like [Camelina 
sativa]
Length=194

 Score =   147 bits (372),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 94/201 (47%), Positives = 125/201 (62%), Gaps = 20/201 (10%)
 Frame = -2

Query  644  MAGMLPGVECARRRRFHQSGGLSDsttstttsss----trrsSFCLYTSNHDSHLsssss  477
            MAGMLPGVECARRRRFH      +S+ +   +++    TRR SF LYT+NH+SH    + 
Sbjct  1    MAGMLPGVECARRRRFHGGAPPIESSNTAVAATAGHVWTRRPSFSLYTTNHESH---QAH  57

Query  476  ssSMQRSTIGKAY---QDEKLGAAAREAKERLDERLKSGHCKSDHKRNCRKTAAEKG---  315
             S  +RS   K+Y    DEKL  AA+EAK+RL+ERL+    + + K    K    KG   
Sbjct  58   VSFSERSVRSKSYGEDNDEKLDGAAKEAKQRLNERLRVPRTRQNGKDKGNKPEQVKGKPH  117

Query  314  GMVMGDVQMLK---SKAMKWAKKLGWKASEEEEECAICLDHFKVGETLMQLPCSHRFHSR  144
            G ++ +V  LK    + M+W K   W+   E+++CAICLD FK GE L+ LPC+H+FHS 
Sbjct  118  GELLTEVVGLKKSRGRLMEWFK---WRV-REQQDCAICLDRFKKGEKLVHLPCAHKFHSI  173

Query  143  CLLPWLDTNAHCPCCRMGILS  81
            CLLPWLDTN +CP CR  I +
Sbjct  174  CLLPWLDTNVYCPYCRTDIWN  194



>ref|XP_010467305.1| PREDICTED: E3 ubiquitin-protein ligase arkadia-like [Camelina 
sativa]
Length=194

 Score =   146 bits (369),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 92/198 (46%), Positives = 121/198 (61%), Gaps = 14/198 (7%)
 Frame = -2

Query  644  MAGMLPGVECARRRRFHQSGGLSDsttstttsss----trrsSFCLYTSNHDSHLsssss  477
            MAGMLPGVECARRRRFH      +S+ +   +++    TRR SF LYT+NH+SH +  S 
Sbjct  1    MAGMLPGVECARRRRFHGGAPPIESSNTAVAATAGHVWTRRPSFSLYTTNHESHQAHVSF  60

Query  476  ssSMQRSTIGKAYQDEKLGAAAREAKERLDERLKSGHCKSDHKRNCRKTAAEKG---GMV  306
            S    RS       DEKL  A +EAK+RL+ERL+    + + K    K    KG   G +
Sbjct  61   SERSVRSKTYGEDNDEKLDGAVKEAKQRLNERLRIPRTRQNGKDKGNKPEQVKGKPHGEL  120

Query  305  MGDVQMLK---SKAMKWAKKLGWKASEEEEECAICLDHFKVGETLMQLPCSHRFHSRCLL  135
            + +V  LK    + M+W K   W+   E+++CAICLD FK GE L+ LPC+H+FHS CLL
Sbjct  121  LTEVVGLKKSRGRLMEWFK---WRV-REQQDCAICLDRFKKGEKLVHLPCAHKFHSICLL  176

Query  134  PWLDTNAHCPCCRMGILS  81
            PWLDTN +CP CR  I +
Sbjct  177  PWLDTNVYCPYCRTDIWN  194



>ref|XP_002883903.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH60162.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
Length=195

 Score =   144 bits (362),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 93/199 (47%), Positives = 122/199 (61%), Gaps = 15/199 (8%)
 Frame = -2

Query  644  MAGMLPGVECARRRRFHQSGGLSDsttstttsss----trrsSFCLYTSNHDSHLsssss  477
            MAGMLPGVECARRRRFH      +ST +   +++    TRR SF LYT+NH+SH    + 
Sbjct  1    MAGMLPGVECARRRRFHGGAPPIESTNTAVAAAAGHVWTRRPSFSLYTTNHESH---QAH  57

Query  476  ssSMQRSTIGKAY---QDEKLGAAAREAKERLDERLK-SGHCKSDHKRNCRKTAAEKG--  315
             S  +RS   K+Y    DEKL  AA+EAK+RL+ERL+     + + K    K    KG  
Sbjct  58   VSFSERSVRNKSYGEDNDEKLDGAAKEAKKRLNERLRIPRRTRQNGKDKGNKLEQGKGKP  117

Query  314  -GMVMGDVQMLKSKAMKWAKKLGWKASEEEEECAICLDHFKVGETLMQLPCSHRFHSRCL  138
             G +  +V  LK    +  +   W+   E+++CAICLD FK GETL+ LPC+H+FHS CL
Sbjct  118  PGALPTEVVGLKKSRGRLIEWFKWRV-REQQDCAICLDQFKKGETLVHLPCAHKFHSLCL  176

Query  137  LPWLDTNAHCPCCRMGILS  81
            LPWLDTN +CP CR  I +
Sbjct  177  LPWLDTNVYCPYCRTDIWN  195



>ref|XP_008336937.1| PREDICTED: E3 ubiquitin-protein ligase EL5-like [Malus domestica]
Length=208

 Score =   144 bits (363),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 97/214 (45%), Positives = 126/214 (59%), Gaps = 25/214 (12%)
 Frame = -2

Query  644  MAGMLPGVECARRRRFHQSGGLSDsttstttssstrrsSFCLYTSNHDSHLsssssssSM  465
            MAGMLPGVE ARRRR  Q G   +         STRRS FCLY SNH+SH    +S+S +
Sbjct  1    MAGMLPGVESARRRRVRQXG---EPPCVGGIHGSTRRSCFCLYASNHESH---HTSTSPL  54

Query  464  QRSTIGKAYQDEKLGAAAREAKERLDERLKS---GHCKSDHKRNCRKTAAEKGG----MV  306
            QRS + +AY DE LG  AREAK RLDERL++      K  +  N +   +  GG    +V
Sbjct  55   QRSILNQAYMDEXLGVEAREAKGRLDERLRTQRKSQLKRHNNSNNKGLKSVDGGGRSSVV  114

Query  305  MGDVQ----------MLKSKAMKWAKKLGWKASEEEEECAICLDHFKVGETLMQLPCSHR  156
            +G++Q             S + K++       S +++ECA+CL+ F  G TL+ LPC+HR
Sbjct  115  LGELQKEVYGAKKSSSSTSGSKKFSWSKLSWKSSDQDECAVCLERFSPGXTLVHLPCAHR  174

Query  155  FHSRCLLPWLDTNAHCPCCRMGILSSPF*WFFNF  54
            FHS C++PWL +NAHCPCCRM I  SP     NF
Sbjct  175  FHSGCMVPWLHSNAHCPCCRMEI--SPSNCIGNF  206



>ref|XP_007138448.1| hypothetical protein PHAVU_009G209800g [Phaseolus vulgaris]
 gb|ESW10442.1| hypothetical protein PHAVU_009G209800g [Phaseolus vulgaris]
Length=188

 Score =   143 bits (360),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 95/194 (49%), Positives = 127/194 (65%), Gaps = 13/194 (7%)
 Frame = -2

Query  644  MAGMLPGVECARRRRFHQSGGLSDsttstttssstrrsSFCLYTSNHDSHLsssssssSM  465
            MAG LPGVECARRRRFH+   L  ++TS  +  STRRSSF LY SNH      SS S+S 
Sbjct  1    MAGTLPGVECARRRRFHRC--LDSNSTSLASHVSTRRSSFGLYASNHG---YCSSLSTSQ  55

Query  464  QRSTIGKAYQDEKLGAAAREAKERLDERLKSGHCKSDHKRNCRKTAAEKGGMVMGDVQM-  288
            QR  + K + +E +  AAREA++RLD++ ++    SD+KR    T  E     + ++   
Sbjct  56   QRDMLYKRHPEEDMVGAAREARQRLDDKFRAQR-MSDNKRQNSTTCVEGERTRITELHTE  114

Query  287  ----LKSKAMKWA-KKLGWKASEEEEECAICLDHFKVGETLMQLPCSHRFHSRCLLPWLD  123
                 KS A K++  +  WKASE+E+ CA+CL+ F+VGETL+ LPC+H+FH RCL PWL+
Sbjct  115  VYGSKKSGARKFSWTRWSWKASEQED-CAVCLESFRVGETLIHLPCAHKFHDRCLKPWLE  173

Query  122  TNAHCPCCRMGILS  81
             N+HCPCCR  ILS
Sbjct  174  NNSHCPCCRTTILS  187



>ref|NP_565376.1| RING/U-box domain-containing protein [Arabidopsis thaliana]
 gb|AAD17402.2| putative RING-H2 zinc finger protein [Arabidopsis thaliana]
 gb|AAM66032.1| putative RING-H2 zinc finger protein [Arabidopsis thaliana]
 gb|AAY57592.1| RING finger family protein [Arabidopsis thaliana]
 gb|ABR46210.1| At2g15580 [Arabidopsis thaliana]
 dbj|BAH19888.1| AT2G15580 [Arabidopsis thaliana]
 gb|AEC06419.1| RING/U-box domain-containing protein [Arabidopsis thaliana]
Length=196

 Score =   142 bits (357),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 92/203 (45%), Positives = 120/203 (59%), Gaps = 26/203 (13%)
 Frame = -2

Query  644  MAGMLPGVECARRRRFHQSGGLSDsttstttssstrr-------sSFCLYTSNHDSHLss  486
            MAGMLPGVECARRRRFH  GG     +S T S +           SF LYT+NH+SH   
Sbjct  1    MAGMLPGVECARRRRFH--GGAPPIESSNTASVAAAAGHVWTRRPSFSLYTTNHESH---  55

Query  485  sssssSMQRSTIGKAY---QDEKLGAAAREAKERLDERLKSGHCKSDHKRNCRKTAAEKG  315
             +  S  +RS   K+Y    DEKL  AA+EAK+RL++RL+       + ++      +  
Sbjct  56   QAHVSFSERSVRNKSYGEDNDEKLDGAAKEAKQRLNKRLRIPPRTRQNGKDKGNKLEQGK  115

Query  314  GMVMGD-----VQMLKSKA--MKWAKKLGWKASEEEEECAICLDHFKVGETLMQLPCSHR  156
            G  +GD     V + KS+   M+W K+       E+++CAICLD FK GETL+ LPC+H+
Sbjct  116  GKPLGDLPTEVVGLKKSRGRLMEWFKR----RVREQQDCAICLDRFKKGETLVHLPCAHK  171

Query  155  FHSRCLLPWLDTNAHCPCCRMGI  87
            FHS CLLPWLDTN +CP CR  I
Sbjct  172  FHSICLLPWLDTNVYCPYCRTDI  194



>ref|XP_010687760.1| PREDICTED: E3 ubiquitin-protein ligase SDIR1 [Beta vulgaris subsp. 
vulgaris]
Length=186

 Score =   142 bits (357),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 90/199 (45%), Positives = 113/199 (57%), Gaps = 24/199 (12%)
 Frame = -2

Query  644  MAGMLPGVECARRRRFHQSGGLSDsttstttssstrrsSFCLYTSNHDSHLsssssssSM  465
            MAGMLPGVE ARRRRFHQS G + +  S ++  S+        +++  SH          
Sbjct  1    MAGMLPGVEAARRRRFHQSSGTNGNGASPSSRRSSFSLFSPNSSTSFLSH----------  50

Query  464  QRSTIGKAYQDEKLGAAAREAKERLDERLK--------SGHCKSDHKRNCR---KTAAEK  318
              S     + DEKLG  AR+AKERL E+L+        +    S+ + N R    T  E 
Sbjct  51   --SANRTYHDDEKLGQLARQAKERLHEKLRAQTKSLIRNNSDLSEERVNGRSRVNTRYEL  108

Query  317  GGMVMGDVQMLKSKAMKWAKKLGWKASEEEEECAICLDHFKVGETLMQLPCSHRFHSRCL  138
               V G  +   +K +    KLGWK S E+EECA+CLD FKVGE L+ LPC+HRFHSRCL
Sbjct  109  KTEVFGSKKNGGAKRLIGWAKLGWK-SGEQEECAVCLDEFKVGENLVNLPCAHRFHSRCL  167

Query  137  LPWLDTNAHCPCCRMGILS  81
            +PWL TNA CPCCR  I S
Sbjct  168  VPWLHTNAQCPCCRTSIFS  186



>gb|KFK40024.1| hypothetical protein AALP_AA3G320300 [Arabis alpina]
Length=202

 Score =   142 bits (357),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 91/204 (45%), Positives = 124/204 (61%), Gaps = 22/204 (11%)
 Frame = -2

Query  644  MAGMLPGVECARRRRFHQSGGLSDsttstttsss-----trrsSFCLYTSNHDSHLssss  480
            MAGML GVECARRRRF+      D + + + +++     TRR SF LYT+N++SH    +
Sbjct  1    MAGMLAGVECARRRRFYGGAPPIDLSNTASVAAAAGHVWTRRPSFSLYTTNNESH---QA  57

Query  479  sssSMQRSTIGKAY---QDEKLGAAAREAKERLDERLKSGHCKSD-------HKRNCRKT  330
              S  +R+   K+Y    +EKL  AA+ AKERLDERL++   + D        K    K+
Sbjct  58   HVSFSERNVRNKSYGEDNNEKLEGAAKVAKERLDERLRNPRRRFDLVTTAQNGKEKVVKS  117

Query  329  AAEKG---GMVMGDVQMLKSKAMKWAKKLGWKASEEEEECAICLDHFKVGETLMQLPCSH  159
               KG   G +  +V  LK+   +  +  GW+   E+++CAICLD FK+GETL+ LPCSH
Sbjct  118  EQGKGKPHGELPTEVVGLKTSRGRLIQWFGWRV-REQQDCAICLDRFKMGETLVNLPCSH  176

Query  158  RFHSRCLLPWLDTNAHCPCCRMGI  87
            +FHS CLLPWLDTN +CP CR  I
Sbjct  177  KFHSNCLLPWLDTNVYCPYCRTDI  200



>gb|KHN48390.1| Putative RING finger protein P32A8.03c [Glycine soja]
Length=189

 Score =   141 bits (355),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 94/194 (48%), Positives = 128/194 (66%), Gaps = 14/194 (7%)
 Frame = -2

Query  644  MAGMLPGVECARRRRFHQSGGLSDsttstt-tssstrrsSFCLYTSNHDSHLsssssssS  468
            MAGMLPGVECARRR   +    SDS +++  + +STRRSSFCLY SNHD       SSSS
Sbjct  1    MAGMLPGVECARRR---RFRRCSDSNSTSLGSHASTRRSSFCLYASNHDQ--CRLFSSSS  55

Query  467  MQRSTIGKAYQDEKLGAAAREAKERLDERLKSGHCKSDHKRNCRK-TAAEKGGMVMGDVQ  291
            +QRS + +A+ DE +G  AREAK+RLD++ ++     + ++N  K    ++  +++   +
Sbjct  56   LQRSMLYQAHPDENMGGVAREAKQRLDDKFRAQRMSENKRQNNTKCVEGKRTSIIVLHTE  115

Query  290  MLKSKA-----MKWAKKLGWKASEEEEECAICLDHFKVGETLMQLPCSHRFHSRCLLPWL  126
               SK        W K   WKASE+EE CA+CL+ F+VGETL+ LPC+HRFH RCL PWL
Sbjct  116  EYGSKKSGSRRFSWTK-WSWKASEQEE-CAVCLESFRVGETLIHLPCAHRFHDRCLKPWL  173

Query  125  DTNAHCPCCRMGIL  84
            + N++CPCCR  IL
Sbjct  174  ENNSYCPCCRTTIL  187



>ref|XP_006298616.1| hypothetical protein CARUB_v10014703mg [Capsella rubella]
 gb|EOA31514.1| hypothetical protein CARUB_v10014703mg [Capsella rubella]
Length=194

 Score =   140 bits (354),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 92/200 (46%), Positives = 121/200 (61%), Gaps = 18/200 (9%)
 Frame = -2

Query  644  MAGMLPGVECARRRRFHQSGGLSDsttstttsss-------trrsSFCLYTSNHDSHLss  486
            MAGMLPGVECARRRRFH  GG     +S   + +       TRR SF LYT+N++SH + 
Sbjct  1    MAGMLPGVECARRRRFH--GGAPPIESSNAAAVAAAVGHVWTRRPSFSLYTTNNESHQAH  58

Query  485  sssssSMQRSTIGKAYQDEKLGAAAREAKERLDERLKSGHCKSD--HKRNCRKTAAEKGG  312
             S S    RS       DEKL  AA+EAK+RL+ERL+    + +   K N +    +  G
Sbjct  59   VSFSERSFRSKSYGEDSDEKLDGAAKEAKQRLNERLRIPRTRQNGKDKGNYKGIKGKLHG  118

Query  311  MVMGDVQMLK---SKAMKWAKKLGWKASEEEEECAICLDHFKVGETLMQLPCSHRFHSRC  141
             ++ +V  LK    + M+W K   W+   E+++CAICLD FK GETL+ LPC+H+FH  C
Sbjct  119  ELLTEVVGLKKSRGRLMEWFK---WRV-REQQDCAICLDQFKKGETLVHLPCAHKFHYVC  174

Query  140  LLPWLDTNAHCPCCRMGILS  81
            LLPWLDTN +CP CR  I +
Sbjct  175  LLPWLDTNVYCPYCRTDIWN  194



>ref|XP_009401071.1| PREDICTED: E3 ubiquitin-protein ligase RNF103-like isoform X1 
[Musa acuminata subsp. malaccensis]
Length=189

 Score =   140 bits (353),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 96/199 (48%), Positives = 123/199 (62%), Gaps = 26/199 (13%)
 Frame = -2

Query  644  MAGMLPGVECARRRRFHQSGGLSDsttstttssstrrsSFCLYTSNHDSHLsssssssSM  465
            MAGMLPGVECARRRRF Q+GG  DS TS +  S+     F L T+ HD H    SSS SM
Sbjct  3    MAGMLPGVECARRRRF-QNGGSVDSLTSCSRRSA-----FPLCTTGHDMH---PSSSISM  53

Query  464  QRSTIGKAYQDEKLGAAAREAKERLDERLKSGHCKSDHKRNCRKTAAEKG------GMVM  303
            QRS + K   +E LG  AREA+ERLD RL+    K  +   C K    +G        ++
Sbjct  54   QRSIMNKEIHEEALGHTAREARERLDARLR---IKRHNSLGCMKLGKSEGCSHGRLHRIL  110

Query  302  GDVQ--MLKSKA----MKWAKKLGWKASEEEEECAICLDHFKVGETLMQLPCSHRFHSRC  141
            G VQ  +  SK       W+K L WKASE+ + CA+CL+ F+ G+ L+ LPC+HRFH  C
Sbjct  111  GSVQRQVFSSKKSTRKFSWSK-LRWKASEQAD-CAVCLEDFQEGDMLVHLPCAHRFHWNC  168

Query  140  LLPWLDTNAHCPCCRMGIL  84
            +LPWL++++HCPCCRM I 
Sbjct  169  VLPWLESSSHCPCCRMTIF  187



>ref|XP_009380804.1| PREDICTED: E3 ubiquitin-protein ligase ZNRF3 [Musa acuminata 
subsp. malaccensis]
Length=186

 Score =   135 bits (340),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 90/200 (45%), Positives = 118/200 (59%), Gaps = 27/200 (14%)
 Frame = -2

Query  644  MAGMLPGVECARRRRFHQSGGLSDsttstttssstrrsSFCLYTSNHDSHLsssssssSM  465
            MAGMLPGVECARRR FH  G +  ST+S  +S       FCLY + H++HLSSSS     
Sbjct  1    MAGMLPGVECARRRGFHLGGPVDSSTSSRRSS-------FCLYRTGHEAHLSSSS----T  49

Query  464  QRSTIGKAYQDEKLGAAAREAKERLDERLKS------GHCKSDHKRNCRKTAAEKGGMVM  303
            +RST+ +    E LG  AREAKERLD RL+       G  K      C +    +   ++
Sbjct  50   KRSTLSREIHGEALGHVAREAKERLDARLQIKRHNSLGSVKQTKNEGCGQGHKHR---IL  106

Query  302  GDVQ------MLKSKAMKWAKKLGWKASEEEEECAICLDHFKVGETLMQLPCSHRFHSRC  141
            G VQ        KS       KLGW+ S E+ +CA+CL+ F+ G+ L+ LPC HRFH  C
Sbjct  107  GSVQREVFSSSKKSSRKFSWSKLGWR-SAEQADCAVCLEEFETGDILVHLPCDHRFHWDC  165

Query  140  LLPWLDTNAHCPCCRMGILS  81
            +LPWL++++HCPCCR  I+S
Sbjct  166  VLPWLESSSHCPCCRTTIVS  185



>ref|XP_011078577.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Sesamum indicum]
Length=217

 Score =   136 bits (342),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 100/221 (45%), Positives = 130/221 (59%), Gaps = 36/221 (16%)
 Frame = -2

Query  644  MAGMLPGVECARRRRFHQSGGLS---DsttstttssstrrsSFCLYTSNHDSHLssssss  474
            MAGMLPGVE ARRRRFH+S  +S   D + +T+ ++ TRRSSFCLY   HD H  S+S+S
Sbjct  1    MAGMLPGVEAARRRRFHKSNLISYGSDLSPNTSAATFTRRSSFCLYAPTHDFH--SNSNS  58

Query  473  sSMQRSTIGKAYQDEKLGAAAREAKERLDERLKSGHCKSDHKRNCRKTAAEKGG------  312
                  ++ +   + +LGAAAREAK+RLDERL+         R    T + + G      
Sbjct  59   LRNPGGSLQQVCDESRLGAAAREAKKRLDERLQQQWRSVQTNRIESTTPSFRHGSGSVED  118

Query  311  --MVMGDVQM----LK---SKAMKWAKKLGWKASEEEEECAICLDHFK------------  195
              +V  +++     LK   SK + W K L WK+SE+EE CA+CL+ FK            
Sbjct  119  RPIVQSNLRTEAPKLKKNGSKKLNWLK-LSWKSSEQEE-CAVCLEQFKDGQGRGAGRGRG  176

Query  194  --VGETLMQLPCSHRFHSRCLLPWLDTNAHCPCCRMGILSS  78
               GETLMQL C HRFH+ CL+PWL+   HCPCCRM I SS
Sbjct  177  RGHGETLMQLHCGHRFHTSCLVPWLEAKGHCPCCRMEIPSS  217



>ref|XP_010942167.1| PREDICTED: E3 ubiquitin-protein ligase EL5 isoform X4 [Elaeis 
guineensis]
Length=176

 Score =   129 bits (324),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 73/166 (44%), Positives = 101/166 (61%), Gaps = 20/166 (12%)
 Frame = -2

Query  527  FCLYTSNHDSHLsssssssSM---QRSTIGKAYQDEKLGAAAREAKERLDERLKSGH---  366
            FCLYT+ +++HL S+ +  ++   QRS + K   D  LG AAREAKERLDE+L++     
Sbjct  12   FCLYTTGYETHLGSTFTKYALNKQQRSGLIKELHDGALGDAAREAKERLDEKLRAQRSLA  71

Query  365  CKSDHKRNCRKTAAEKGG------MVMGDVQ--MLKSKA----MKWAKKLGWKASEEEEE  222
             K  H     +    +GG      M++G  Q  +  SK       W+K LGWKASE+ E 
Sbjct  72   IKRHHSMGSMRPEKSRGGDEGAAPMILGKAQREVFSSKKSTRKFSWSK-LGWKASEQAE-  129

Query  221  CAICLDHFKVGETLMQLPCSHRFHSRCLLPWLDTNAHCPCCRMGIL  84
            CA+CL+ FK G+ L+ LPC+HRFH  C +PWL+ N+HCPCCRM + 
Sbjct  130  CAVCLEEFKTGDILINLPCAHRFHWNCAVPWLENNSHCPCCRMTVF  175



>ref|XP_010942168.1| PREDICTED: E3 ubiquitin-protein ligase EL5 isoform X5 [Elaeis 
guineensis]
Length=169

 Score =   128 bits (322),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 73/163 (45%), Positives = 98/163 (60%), Gaps = 21/163 (13%)
 Frame = -2

Query  527  FCLYTSNHDSHLsssssssSMQRSTIGKAYQDEKLGAAAREAKERLDERLKSGH---CKS  357
            FCLYT+ +++HL S+      QRS + K   D  LG AAREAKERLDE+L++      K 
Sbjct  12   FCLYTTGYETHLGSTF----TQRSGLIKELHDGALGDAAREAKERLDEKLRAQRSLAIKR  67

Query  356  DHKRNCRKTAAEKGG------MVMGDVQ--MLKSKA----MKWAKKLGWKASEEEEECAI  213
             H     +    +GG      M++G  Q  +  SK       W+K LGWKASE+ E CA+
Sbjct  68   HHSMGSMRPEKSRGGDEGAAPMILGKAQREVFSSKKSTRKFSWSK-LGWKASEQAE-CAV  125

Query  212  CLDHFKVGETLMQLPCSHRFHSRCLLPWLDTNAHCPCCRMGIL  84
            CL+ FK G+ L+ LPC+HRFH  C +PWL+ N+HCPCCRM + 
Sbjct  126  CLEEFKTGDILINLPCAHRFHWNCAVPWLENNSHCPCCRMTVF  168



>ref|XP_009401072.1| PREDICTED: E3 ubiquitin-protein ligase RNF103-like isoform X2 
[Musa acuminata subsp. malaccensis]
Length=188

 Score =   129 bits (324),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 93/199 (47%), Positives = 120/199 (60%), Gaps = 27/199 (14%)
 Frame = -2

Query  644  MAGMLPGVECARRRRFHQSGGLSDsttstttssstrrsSFCLYTSNHDSHLsssssssSM  465
            MAGMLPGVECARRRRF Q+GG  DS TS +  S+     F L T+ HD H     SSS  
Sbjct  3    MAGMLPGVECARRRRF-QNGGSVDSLTSCSRRSA-----FPLCTTGHDMH----PSSSIS  52

Query  464  QRSTIGKAYQDEKLGAAAREAKERLDERLKSGHCKSDHKRNCRKTAAEKG------GMVM  303
             RS + K   +E LG  AREA+ERLD RL+    K  +   C K    +G        ++
Sbjct  53   MRSIMNKEIHEEALGHTAREARERLDARLR---IKRHNSLGCMKLGKSEGCSHGRLHRIL  109

Query  302  GDVQ--MLKSKA----MKWAKKLGWKASEEEEECAICLDHFKVGETLMQLPCSHRFHSRC  141
            G VQ  +  SK       W+K L WKASE+ + CA+CL+ F+ G+ L+ LPC+HRFH  C
Sbjct  110  GSVQRQVFSSKKSTRKFSWSK-LRWKASEQAD-CAVCLEDFQEGDMLVHLPCAHRFHWNC  167

Query  140  LLPWLDTNAHCPCCRMGIL  84
            +LPWL++++HCPCCRM I 
Sbjct  168  VLPWLESSSHCPCCRMTIF  186



>gb|EYU34927.1| hypothetical protein MIMGU_mgv1a013960mg [Erythranthe guttata]
Length=205

 Score =   127 bits (320),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 92/211 (44%), Positives = 121/211 (57%), Gaps = 29/211 (14%)
 Frame = -2

Query  644  MAGMLPGVECARRRRFHQSGGLSDsttstttssstrrsSFCLYTSNHDSHLsssssssSM  465
            MAGMLPGVE ARRRRFH S   +    S++T S+ R       T+ H  H +SS++ SS+
Sbjct  1    MAGMLPGVESARRRRFHNSSNFTSHELSSSTYSTWRS----YTTTTHHFHSNSSATRSSL  56

Query  464  QRSTIGKAYQDEKLGAAAREAKERLDERLKSGHC---------KSDHK--RNCRKTAAEK  318
             R   G    D +L AAA +AK+RLD RL   H           +DH+  R  R +   +
Sbjct  57   IRQQ-GLCDDDSRLSAAAIQAKKRLDLRLHLPHTHRIDQFRSTNTDHEQERPTRSSINNR  115

Query  317  GGM-VMGDVQMLK-------SKAMKWAKKLGWKASEEEEECAICLDHFKV---GETLMQL  171
                +  D Q+L        SK + W K + WK+SE++E CA+CL+ F     G TLMQ+
Sbjct  116  PPTNLQDDNQVLPNKLKRSGSKRLNWLK-MSWKSSEQDE-CAVCLEQFVKAGGGGTLMQV  173

Query  170  PCSHRFHSRCLLPWLDTNAHCPCCRMGILSS  78
            PC HRFH+ CL+PWL+ NAHCPCCRM I SS
Sbjct  174  PCGHRFHTNCLMPWLEANAHCPCCRMEIPSS  204



>ref|XP_006587140.1| PREDICTED: E3 ubiquitin-protein ligase RNF149-like [Glycine max]
Length=155

 Score =   120 bits (300),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 59/134 (44%), Positives = 86/134 (64%), Gaps = 8/134 (6%)
 Frame = -2

Query  467  MQRSTIGKAYQDEKLGAAAREAKERLDERLKSGHCKSDHKRNCRK-TAAEKGGMVMGDVQ  291
             QRS + +A+ DE +G  AREAK+RLD++ ++     + ++N  K    ++  +++   +
Sbjct  22   FQRSMLYQAHPDENMGGVAREAKQRLDDKFRAQRMSENKRQNNTKCVEGKRTSIIVLHTE  81

Query  290  MLKSKA-----MKWAKKLGWKASEEEEECAICLDHFKVGETLMQLPCSHRFHSRCLLPWL  126
               SK        W K   WKASE+EE CA+CL+ F+VGETL+ LPC+HRFH RCL PWL
Sbjct  82   EYGSKKSGSRRFSWTK-WSWKASEQEE-CAVCLESFRVGETLIHLPCAHRFHDRCLKPWL  139

Query  125  DTNAHCPCCRMGIL  84
            + N++CPCCR  IL
Sbjct  140  ENNSYCPCCRTTIL  153



>ref|XP_010047193.1| PREDICTED: RING-H2 finger protein ATL52-like [Eucalyptus grandis]
Length=164

 Score =   113 bits (282),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 75/194 (39%), Positives = 100/194 (52%), Gaps = 43/194 (22%)
 Frame = -2

Query  635  MLPGVECARRRRFHQSGGLSDsttstttssstrrsSFCLYTSNHDSHLsssssssSMQRS  456
            ML GVE ARRRRF  +   +                    TS+  S            R+
Sbjct  1    MLLGVEYARRRRFSLTHHAA--------------------TSSLQS------------RN  28

Query  455  TIGKAYQDEK-LGAAAREAKERLDERLKSGHCKSDHKR-----NCRKTAAEKGGMVMGDV  294
             I +AY DE+ LG  AREAK RLDERL++       +R     N R    +   MV G  
Sbjct  29   IINQAYGDEEELGGVAREAKHRLDERLRTQRKPETMRRHHDGENLRARELQLQTMVHGGQ  88

Query  293  QMLKSKAMKWAKKLGWKA-----SEEEEECAICLDHFKVGETLMQLPCSHRFHSRCLLPW  129
             + +       K+  W       + + ++CAICL+ F+VGETL+ LPC+HRFHSRC++PW
Sbjct  89   SVGRGGGSSNLKRFSWGKMMRGRAMDHDDCAICLERFEVGETLVHLPCAHRFHSRCVVPW  148

Query  128  LDTNAHCPCCRMGI  87
            L+ +AHCPCCRMGI
Sbjct  149  LEAHAHCPCCRMGI  162



>emb|CBI25596.3| unnamed protein product [Vitis vinifera]
Length=118

 Score =   107 bits (266),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 68/101 (67%), Positives = 79/101 (78%), Gaps = 4/101 (4%)
 Frame = -2

Query  644  MAGMLPGVECARRRRFHQSGGLSDsttstttssstrrsSFCLYTSNHDSHLsssssssSM  465
            MAGMLPGVECARRRRFHQSGG SD + +      TRRSSFCLYTSNH++H   ++SSSSM
Sbjct  1    MAGMLPGVECARRRRFHQSGGCSD-SPTVAVHGCTRRSSFCLYTSNHENH--HATSSSSM  57

Query  464  QRSTIGKAYQDEKLGAAAREAKERLDERLKSGHCKSDHKRN  342
            QRS + +AY DEKLG  AREAKERLDERL++   KS+  RN
Sbjct  58   QRSVLNQAYSDEKLGGVAREAKERLDERLRTQR-KSEPTRN  97



>gb|EPS73396.1| hypothetical protein M569_01360, partial [Genlisea aurea]
Length=198

 Score =   107 bits (268),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 79/210 (38%), Positives = 104/210 (50%), Gaps = 36/210 (17%)
 Frame = -2

Query  644  MAGMLPGVECARRRRFHQSGGLSDsttstttssstrrsSFCLYTSNHDSHLsssssssSM  465
            MAG LPGVE ARRRR H +   S  TT+  ++       FCLY ++HD H      S S 
Sbjct  1    MAGSLPGVEAARRRRIHSTNLFSPGTTAGASTRRPS---FCLYATSHDFH------SISS  51

Query  464  QRSTIG---KAYQDEKLGAAAREAKERLDERLKSGHCKSDHKRNCRKTAAEKGGMVMGDV  294
             R+ +G   +   +  L  AAREAK RLD++L S      +       +   GG      
Sbjct  52   SRTPMGCHSRLCDESLLNDAAREAKRRLDQKLHS----YTYILFVFVISLTSGGDADAAS  107

Query  293  QMLKSKAMKWAKKL------------GWKASEEEEECAICLDHFKV-------GETLMQL  171
                 +    A+K              WK+SE+ + CA+CL+ F         GE +MQL
Sbjct  108  DKAADRNRTEAEKRRGAKMRHSWFRSNWKSSEQAD-CAVCLEAFATADGGDGDGEAVMQL  166

Query  170  PCSHRFHSRCLLPWLDTNAHCPCCRMGILS  81
            PC HRFH +CL PWL+ NA CPCCRM +LS
Sbjct  167  PCGHRFHGQCLRPWLERNADCPCCRMKLLS  196



>ref|XP_009613107.1| PREDICTED: E3 ubiquitin-protein ligase SDIR1-like [Nicotiana 
tomentosiformis]
Length=197

 Score =   103 bits (258),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 57/133 (43%), Positives = 83/133 (62%), Gaps = 8/133 (6%)
 Frame = -2

Query  464  QRSTIGK-AYQDEKLGAAAREAKERLDERLKSGHCKSDHKRNCRKTAAEKGGMVMGDVQM  288
            QR +IG   Y+DE+LG  AREAK+RLD +L+      + + N  +    +   +  + +M
Sbjct  68   QRISIGSHGYKDEELGEKAREAKQRLDHKLR--RTSKEERVNDVENGQVESNTLQKNSEM  125

Query  287  L--KSKAMKWAKKL--GWKASEEEEECAICLDHFKVGETLMQLPCSHRFHSRCLLPWLDT  120
            L  K   +K   ++   WK SE+ E C ICLD FKVG+ LM L C H+FHS CL+PWL+ 
Sbjct  126  LRLKQNGIKTFSRVVKQWKDSEKYE-CTICLDQFKVGDNLMHLQCDHKFHSCCLVPWLEN  184

Query  119  NAHCPCCRMGILS  81
            +A+CPCCR+ I++
Sbjct  185  HAYCPCCRVEIVT  197



>ref|XP_006359528.1| PREDICTED: uncharacterized protein LOC102590043 [Solanum tuberosum]
Length=162

 Score =   101 bits (252),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 51/129 (40%), Positives = 74/129 (57%), Gaps = 1/129 (1%)
 Frame = -2

Query  464  QRSTIGKAYQDEKLGAAAREAKERLDERLKSGHCKSDHKRNCRKTAAEKGGMVMGDVQML  285
            QRS     Y +E LG  AREAK+RLD +L+    K +  ++      E   +   ++  L
Sbjct  34   QRSIGSHGYNNEDLGEKAREAKQRLDHKLRRTRSKDERFKDVEDGQVESNTLQKKEIAGL  93

Query  284  KSKAMK-WAKKLGWKASEEEEECAICLDHFKVGETLMQLPCSHRFHSRCLLPWLDTNAHC  108
            K   +K +++ +      E +EC ICL  FKVG+ LM L C H+FHS CL+PWL+  A C
Sbjct  94   KKNGIKTFSRVIKQWNDIENDECTICLGQFKVGDNLMHLQCDHKFHSCCLVPWLENYACC  153

Query  107  PCCRMGILS  81
            PCCR+ I++
Sbjct  154  PCCRIEIVT  162



>ref|XP_009788592.1| PREDICTED: RING-H2 finger protein ATL81-like isoform X1 [Nicotiana 
sylvestris]
Length=163

 Score =   100 bits (249),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 56/133 (42%), Positives = 82/133 (62%), Gaps = 8/133 (6%)
 Frame = -2

Query  464  QRSTIGK-AYQDEKLGAAAREAKERLDERLKSGHCKSDHKRNCRKTAAEKGGMVMGDVQM  288
            QR ++G   Y++E+LG  AREAK+RLD +L+      + K N  +    +   +  + +M
Sbjct  34   QRISVGSHGYKNEELGEKAREAKQRLDHKLRRR--SKEEKVNDVENGQLESNTLQKNSEM  91

Query  287  --LKSKAMKWAKKL--GWKASEEEEECAICLDHFKVGETLMQLPCSHRFHSRCLLPWLDT  120
              LK   +K   ++   WK SE+ E C ICLD FK+G+ LM L C H+FHS CL+PWL+ 
Sbjct  92   FRLKQNGIKTFSRVVKQWKDSEKVE-CTICLDQFKIGDNLMHLQCDHKFHSCCLVPWLEN  150

Query  119  NAHCPCCRMGILS  81
            +A+CPCCRM I +
Sbjct  151  HAYCPCCRMEIAT  163



>ref|XP_003564209.1| PREDICTED: uncharacterized protein LOC100830912 [Brachypodium 
distachyon]
Length=215

 Score =   101 bits (252),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 76/213 (36%), Positives = 100/213 (47%), Gaps = 32/213 (15%)
 Frame = -2

Query  644  MAGMLPGVECARRRRFHQSGGLSDsttstttssstrrsSFCLYTSNHDSHLsssssssSM  465
            MAGMLPGVECARRRR  Q GG +D      T   +    FCLY + H    S+ SS    
Sbjct  1    MAGMLPGVECARRRRMWQGGGGADPLAPGATRRFS----FCLYAAGHGHAASAVSSGGKQ  56

Query  464  QRSTIGKAYQDEKLGAAAREAKERLDERLKSGH-----CKSDHKRNCRKTA---------  327
            +   +        L + AREAK+RLD++L+S +      K  H     K +         
Sbjct  57   RSGVMEPTMHGWALDSNAREAKQRLDQKLRSSNRADAAIKRHHSTGSIKLSRANNGSGGG  116

Query  326  ---AEKGGMVMGDVQMLKSKA------MKWA-KKLGWKASEEEEECAICLDHFKVGETLM  177
                      MG  + + SK       M+W  + L W+A+E+ E CA+CL+ F  G+ L 
Sbjct  117  EGSNTTAAAAMGVQREVYSKKGVMRRLMRWGGRPLRWEAAEQAE-CAVCLEEFAAGDVLA  175

Query  176  QLPCSHRFHSRCLLPWLDTNA---HCPCCRMGI  87
             LPC HRFH  C LPWL        CP CR  +
Sbjct  176  HLPCGHRFHWSCALPWLQAQGASHSCPFCRAAV  208



>ref|XP_004242708.1| PREDICTED: RING-box protein 2-like [Solanum lycopersicum]
Length=158

 Score = 99.8 bits (247),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 49/129 (38%), Positives = 73/129 (57%), Gaps = 1/129 (1%)
 Frame = -2

Query  464  QRSTIGKAYQDEKLGAAAREAKERLDERLKSGHCKSDHKRNCRKTAAEKGGMVMGDVQML  285
            QRS     Y +E LG   REAK+RLD +L+    K +  ++      E   +   ++  +
Sbjct  30   QRSIGSHGYNNEDLGEKTREAKQRLDHKLRRTRSKDERFKDVEDGQVESSTLQKKEMSGV  89

Query  284  KSKAMK-WAKKLGWKASEEEEECAICLDHFKVGETLMQLPCSHRFHSRCLLPWLDTNAHC  108
            K   +K +++ +  +   E +EC ICL  FKVG+ LM L C H+FHS CL+PWL+    C
Sbjct  90   KQNGIKTFSRVIKQRNDIENDECTICLGKFKVGDNLMHLLCDHKFHSCCLVPWLENYVCC  149

Query  107  PCCRMGILS  81
            PCCR+ IL+
Sbjct  150  PCCRIEILT  158



>dbj|BAJ89879.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ87038.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ97687.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK04979.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=212

 Score = 97.1 bits (240),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 83/208 (40%), Positives = 108/208 (52%), Gaps = 31/208 (15%)
 Frame = -2

Query  644  MAGMLPGVECARRRRFHQSGGLSDsttstttssstrrsSFCLYTSNHDSHLsssssss-S  468
            MAGMLPGVECARRRR  Q         +   ++ TRR SFCLY + H +  +  + SS +
Sbjct  6    MAGMLPGVECARRRRMWQG----GGAGADQAAAGTRRLSFCLYAAGHGAAHAVGTGSSGN  61

Query  467  MQRSTIGKAYQDEKLGAAAREAKERLDERLKSGHCKSD------HKRNCRKTAAEKGG--  312
             QRS +   +    L + AREAKERLD++LKS     D      H     K +   GG  
Sbjct  62   KQRSGLMDGWA---LDSNAREAKERLDQKLKSKSNAPDAVIKRHHSTGSIKVSRANGGGS  118

Query  311  --MVMGDVQM-------LKSKAMKWAKKLGWKASEEEEECAICLDHFKVGETLMQLPCSH  159
               V   VQ        +  + M+W++ L W A+E+ E CA+CLD F  G+ L  LPC H
Sbjct  119  SAAVATGVQREVYSKKGVMRRLMRWSR-LRWDAAEQAE-CAVCLDEFAAGDVLAHLPCGH  176

Query  158  RFHSRCLLPWLDTNA----HCPCCRMGI  87
            RFH  C LPWL+  A     CP CR  +
Sbjct  177  RFHWGCALPWLEGAAAASHSCPFCRAKV  204



>ref|NP_001150294.1| protein binding protein [Zea mays]
 gb|ACG38543.1| protein binding protein [Zea mays]
Length=208

 Score = 96.7 bits (239),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 75/204 (37%), Positives = 99/204 (49%), Gaps = 31/204 (15%)
 Frame = -2

Query  644  MAGMLPGVECARRRRFHQSGGLSDsttstttssstrrsSFCLYTSNHDSHLsssssssSM  465
            MAGMLPGVECARRRR  Q    +          + RRSSFCLY + H        + +S 
Sbjct  1    MAGMLPGVECARRRRVRQG--GAGMGAEAAGGGTGRRSSFCLYAAGHGG------AGNSG  52

Query  464  QRSTIGKAYQDEKLGAAAREAKERLDERLKS------------GHCK--SDHKRNCRKTA  327
            +RS          L + AREAKERLD++L++            G  K    H+       
Sbjct  53   KRSGGVVHGXGWTLDSNAREAKERLDQKLRTKREAAIKRHHSTGSIKLGVPHRSAGADER  112

Query  326  AEKGGMVMGDVQM-------LKSKAMKWAKKLGWKASEEEEECAICLDHFKVGETLMQLP  168
             E     M  VQ        +  + M+W++   W A+E+ E CA+CLD F+ G+ L  L 
Sbjct  113  GESSAPAMAGVQREVYSKKGVMRRLMRWSRPR-WAAAEQAE-CAVCLDEFRAGDVLAHLR  170

Query  167  CSHRFHSRCLLPWLDTNAHCPCCR  96
            C HRFH  C LPWL+  + CP CR
Sbjct  171  CGHRFHWACALPWLEGTSRCPFCR  194



>ref|XP_010256161.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Nelumbo nucifera]
Length=163

 Score = 95.1 bits (235),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 68/196 (35%), Positives = 99/196 (51%), Gaps = 41/196 (21%)
 Frame = -2

Query  644  MAGMLPGVECARRRRFHQSGGLSDsttstttssstrrsSFCLYTSNHDSHLsssssssSM  465
            MAGMLPGVE ARRRR +     +DS                  + +H S L        +
Sbjct  1    MAGMLPGVELARRRRVYHHHQYNDSN-----------------SRDHPSLLRDR-----L  38

Query  464  QRSTIGKAYQDEKLGAAAREAKERLDERLKSGHCKS--------DHKRNCRKTAAEKGGM  309
            Q S+         L  AA +A+ RL+E+L  G  +S        + + + +   A++   
Sbjct  39   QPSS------PSDLDEAALKARRRLEEKLGLGRLRSRSSKQKPNEGRSSNQPVRAKESQS  92

Query  308  VMGDVQMLKSKAMKWAKKLGWKASEEEEECAICLDHFKVGETLMQLPCSHRFHSRCLLPW  129
            +MG  ++ K     W  KLG + SE +  CA+CLD F+  + +M LPCSHR+HS CL+PW
Sbjct  93   LMGVTKLEK----LWLPKLGRRNSEGDV-CAVCLDGFQNQQQVMNLPCSHRYHSDCLIPW  147

Query  128  LDTNAHCPCCRMGILS  81
            L T++HCP CR  + S
Sbjct  148  LTTHSHCPYCRTHVQS  163



>gb|KHG09461.1| Chaperone DnaJ [Gossypium arboreum]
Length=117

 Score = 93.6 bits (231),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 66/134 (49%), Positives = 85/134 (63%), Gaps = 19/134 (14%)
 Frame = -2

Query  644  MAGMLPGVECARRRRFHQSGGLSDsttstttssstrrsSFCLYTSNHDSHLsssssssSM  465
            MAGMLPGVECARRRR H +G LSD + S      TR+SSFCLYT+N D+H      S   
Sbjct  1    MAGMLPGVECARRRRIHPTGALSD-SPSPPPYRFTRKSSFCLYTTNQDTH------SCLQ  53

Query  464  QRSTIGKAYQDEKLGAAAREAKERLDERLKSGHCKSDHKRNCRKTAAEKGGMVMGDVQML  285
            QRS + +A +DE+LG  AREAK+RLDERL+S        +  R+ + E G  + G++Q  
Sbjct  54   QRSILDEACEDEELGGIAREAKKRLDERLRS--------QPKRQNSNESG--MKGELQS-  102

Query  284  KSKAMKWAKKLGWK  243
            K K++ W  KL WK
Sbjct  103  KRKSVSWP-KLSWK  115



>gb|KJB63341.1| hypothetical protein B456_010G056400 [Gossypium raimondii]
Length=117

 Score = 92.0 bits (227),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 63/134 (47%), Positives = 83/134 (62%), Gaps = 19/134 (14%)
 Frame = -2

Query  644  MAGMLPGVECARRRRFHQSGGLSDsttstttssstrrsSFCLYTSNHDSHLsssssssSM  465
            MAGMLPGVECARRRR H +G LSD + +       R+SSFCLYT+N D+H      S   
Sbjct  1    MAGMLPGVECARRRRIHLTGALSD-SPTPPPYRFPRKSSFCLYTTNQDTH------SCLQ  53

Query  464  QRSTIGKAYQDEKLGAAAREAKERLDERLKSGHCKSDHKRNCRKTAAEKGGMVMGDVQML  285
            QRS + +A +DE+LG  AREAK+RLDERL+S           ++  +++ GM  G++Q  
Sbjct  54   QRSILDEACEDEELGGIAREAKKRLDERLRS---------QPKRQNSDENGM-KGELQS-  102

Query  284  KSKAMKWAKKLGWK  243
            K K + W  KL WK
Sbjct  103  KKKIVSWP-KLSWK  115



>gb|EPS73395.1| hypothetical protein M569_01359 [Genlisea aurea]
Length=113

 Score = 90.9 bits (224),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 48/116 (41%), Positives = 60/116 (52%), Gaps = 21/116 (18%)
 Frame = -2

Query  440  YQDEKLGAAAREAKERLDERLKSGHCKSDHKRNCRKTAAEKGGMVMGDVQMLKSKAMKWA  261
            Y + +L  AAREAK RLD+RL+                 +      G  + L +    W 
Sbjct  16   YDESRLDTAAREAKRRLDQRLQ--------------VQPQSRSYNNGGWRQLSNVGSSWN  61

Query  260  KKLGWKASEEEEECAICLDHFKVGETLMQLPCSHRFHSRCLLPWLDTNAHCPCCRM  93
                   S E++ CA+CL+ F     LMQLPC HRFH+ CL PWLDTNA CPCCRM
Sbjct  62   -------SSEQDSCAVCLEQFDGYGALMQLPCGHRFHAHCLRPWLDTNADCPCCRM  110



>ref|XP_002532496.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF29872.1| conserved hypothetical protein [Ricinus communis]
Length=137

 Score = 90.9 bits (224),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 50/62 (81%), Gaps = 2/62 (3%)
 Frame = -2

Query  272  MKWAKKLGWKASEEEEECAICLDHFKVGETLMQLPCSHRFHSRCLLPWLDTNAHCPCCRM  93
              WAK L WKA++++E C ICL+ FK GETL+ LPC+H++H RCL+PWL+ NAHCPCCRM
Sbjct  73   FNWAK-LSWKAADQDE-CTICLERFKSGETLVHLPCAHKYHCRCLVPWLENNAHCPCCRM  130

Query  92   GI  87
             I
Sbjct  131  EI  132



>gb|ADE77485.1| unknown [Picea sitchensis]
Length=209

 Score = 90.9 bits (224),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 69/215 (32%), Positives = 94/215 (44%), Gaps = 40/215 (19%)
 Frame = -2

Query  635  MLPGVECARRRRFHQSGGLSDsttstttssstrrsSFCLYTSNHDSHLsssssssSMQRS  456
            MLPGVECARRRR +Q    SD T     +         LY    D   SSS  +  +   
Sbjct  1    MLPGVECARRRRVYQGTAYSDDTQRRACN-------LSLYEPFSDRRSSSSLMTRPINLY  53

Query  455  TIGKAYQDEKLGAAAREAKERLDERLKSGHCKSDHKRNC----RKTAAEKGGMVMGDVQ-  291
               +   D KL     EA+ERL+ RL++    +    +      +     GG++    Q 
Sbjct  54   ETDQNGND-KLNGVVLEARERLEGRLRASSTVNKRPSHIMLVNNRDRYTIGGLITETRQP  112

Query  290  ---------------------MLKSKAMKWAKKLG--W----KASEEEEECAICLDHFKV  192
                                 +L+ +      K G  W      + EEE+CA+CLD FK+
Sbjct  113  SELVREGVQPASVATSKSCIALLRKEIYTPETKRGKSWLKLKSRTLEEEDCAVCLDCFKL  172

Query  191  GETLMQLPCSHRFHSRCLLPWLDTNAHCPCCRMGI  87
             + L+ LPC H+FH  CL+PWLD N HCP CR  I
Sbjct  173  NQVLIHLPCGHKFHLSCLIPWLDKNQHCPYCRAKI  207



>ref|XP_006359530.1| PREDICTED: uncharacterized protein LOC102590705 [Solanum tuberosum]
Length=110

 Score = 84.0 bits (206),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 53/103 (51%), Positives = 73/103 (71%), Gaps = 6/103 (6%)
 Frame = -2

Query  644  MAGMLPGVECARRRRFHQSGGLSDsttstttssstrrsSFCLYTSNHDSHLsssssssSM  465
            MAGML GVECARRR+FH++ GL DS+ +T++S+       CLYTS+H+ +L+S  S    
Sbjct  1    MAGMLAGVECARRRKFHKNSGLLDSSYNTSSSTRRSF--LCLYTSSHEHNLTSRFSK---  55

Query  464  QRSTIGKAYQDEKLGAAAREAKERLDERLKSGHCKSDHKRNCR  336
            +R+   + Y+DEKLG  AREAK+RLDERL S   KS +KR+ +
Sbjct  56   ERNATSQEYEDEKLGEVAREAKQRLDERL-SSQWKSQNKRSAK  97



>ref|XP_009613105.1| PREDICTED: uncharacterized protein LOC104106295 [Nicotiana tomentosiformis]
Length=109

 Score = 83.6 bits (205),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 55/103 (53%), Positives = 70/103 (68%), Gaps = 7/103 (7%)
 Frame = -2

Query  644  MAGMLPGVECARRRRFHQSGGLSDsttstttssstrrsSFCLYTSNHDSHLsssssssSM  465
            MAGML GVECARRR+FH++ GL DS++  +++  +     CLYTS+H+  LSSS S    
Sbjct  1    MAGMLAGVECARRRKFHKNSGLLDSSSGFSSTRKSF---LCLYTSSHEHILSSSFSK---  54

Query  464  QRSTIGKAYQDEKLGAAAREAKERLDERLKSGHCKSDHKRNCR  336
            +RS   + YQDEKLG  AREAK+RLDERL S   KS  KR  +
Sbjct  55   ERSATNQEYQDEKLGEVAREAKQRLDERL-SAQWKSQDKRGVK  96



>ref|XP_004242707.1| PREDICTED: uncharacterized protein LOC101251003 [Solanum lycopersicum]
Length=110

 Score = 83.2 bits (204),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 51/100 (51%), Positives = 70/100 (70%), Gaps = 6/100 (6%)
 Frame = -2

Query  644  MAGMLPGVECARRRRFHQSGGLSDsttstttssstrrsSFCLYTSNHDSHLsssssssSM  465
            MAGML GVECARRR+FH++ G+ DS+ + ++S+       CLYTS+H+ +L+S  S    
Sbjct  1    MAGMLAGVECARRRKFHKNNGMFDSSYNISSSTRRSF--LCLYTSSHEHNLTSRLS---Q  55

Query  464  QRSTIGKAYQDEKLGAAAREAKERLDERLKSGHCKSDHKR  345
            +R+   + Y+DEKLG  AREAK+RLDERL S   KS +KR
Sbjct  56   ERNATSQEYEDEKLGEVAREAKQRLDERL-SSQWKSQNKR  94



>ref|NP_001048401.1| Os02g0798200 [Oryza sativa Japonica Group]
 dbj|BAD36054.1| RING-H2 zinc finger protein-like [Oryza sativa Japonica Group]
 dbj|BAF10315.1| Os02g0798200 [Oryza sativa Japonica Group]
 dbj|BAG87941.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96719.1| unnamed protein product [Oryza sativa Japonica Group]
Length=210

 Score = 84.3 bits (207),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 74/207 (36%), Positives = 100/207 (48%), Gaps = 26/207 (13%)
 Frame = -2

Query  644  MAGMLPGVECARRRRFHQSGGLSDsttstttssstrrsSFCLYTSNHDSHLsssssssSM  465
            MAGMLPGVECARR                     TRR S CLY   HD H    SS+   
Sbjct  4    MAGMLPGVECARR--------RRLRQGGGEAPCGTRRPSLCLYAGGHD-HALLGSSACKQ  54

Query  464  QRSTIGKAYQDE-KLGAAAREAKERLDERLKSGH------CKSDHKRNCRKTAAEKGGMV  306
            QRS   +       L +  REAKERLD++L+S         K  +K     T+++ G   
Sbjct  55   QRSACEEQQPGWWTLDSNVREAKERLDQKLRSQRESAVVVVKRHNKAQVAGTSSDGGEQS  114

Query  305  MGDVQMLKSKAMK--------WAKKLGWKASEEEEE-CAICLDHFKVGETLMQLPCSHRF  153
                   + +           W ++LG + + EEEE CA+CL+  + GE +  LPC+HRF
Sbjct  115  TATTAAPQWEVYTRKEGRRRMWFRRLGRRPTPEEEEECAVCLEELRAGEAVAHLPCTHRF  174

Query  152  HSRCLLPWLDTNAHCPCCRMGI-LSSP  75
            H  C +PW+ T + CP CR  + L+SP
Sbjct  175  HWGCAVPWVQTASRCPVCRAAVYLTSP  201



>dbj|BAC22255.1| RING-H2 zinc finger protein-like [Oryza sativa Japonica Group]
 dbj|BAD72564.1| RING-H2 zinc finger protein-like [Oryza sativa Japonica Group]
Length=268

 Score = 83.6 bits (205),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 79/213 (37%), Positives = 106/213 (50%), Gaps = 32/213 (15%)
 Frame = -2

Query  644  MAGMLPGVECARRRRFHQSGGLSDsttstttssstrrsSFCLYTSNHDSHLsssssssS-  468
            MA MLPGVECARRR      G      +      TRRSSFC++ + H    +   ++++ 
Sbjct  48   MAAMLPGVECARRR--RLRQGGGAGADAAAAGGGTRRSSFCVHAAGHGGGQTCGGAAANH  105

Query  467  --MQRSTIGKAYQDEKLGAAAREAKERLDERLKSG--------HCKSDHKRN--------  342
               QRS++ +      L + AREAKERLD++L+S         H     K N        
Sbjct  106  SGKQRSSVMELIHGWSLDSNAREAKERLDQKLRSQRESVIKRHHSTGSIKLNRGATGGGG  165

Query  341  --CRKTAAEKGGMVMGDVQMLKS---KAMKWAKKLGWKASEEEEECAICLDHFKVGETLM  177
               R TA    G V  +V   K    + M+W++ L W A+E+ E CA+CLD F  G+ L 
Sbjct  166  GGGRSTATAAMG-VQREVYSRKGVMRRLMRWSR-LRWDAAEQAE-CAVCLDEFAAGDVLA  222

Query  176  QLPCSHRFHSRCLLPWLDTNA---HCPCCRMGI  87
             LPC HRFH  C LPWL+  A    CP CR  +
Sbjct  223  HLPCGHRFHWACALPWLEAGAAPRSCPFCRAAV  255



>gb|EEC80129.1| hypothetical protein OsI_21911 [Oryza sativa Indica Group]
Length=221

 Score = 82.8 bits (203),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 78/213 (37%), Positives = 105/213 (49%), Gaps = 32/213 (15%)
 Frame = -2

Query  644  MAGMLPGVECARRRRFHQSGGLSDsttstttssstrrsSFCLYTSNHDSHLsssssssS-  468
            MA MLPGVECARR       G      +      TRRSSFC++ + H    +   ++++ 
Sbjct  1    MAAMLPGVECARR--RRLRQGGGAGADAAAAGGGTRRSSFCVHAAGHGGGQTCGGAAANH  58

Query  467  --MQRSTIGKAYQDEKLGAAAREAKERLDERLKSG--------HCKSDHKRN--------  342
               QRS++ +      L + AREAKERLD++L+S         H     K N        
Sbjct  59   SGKQRSSVMELIHGWSLDSNAREAKERLDQKLRSQRESVIKRHHSTGSIKLNRGATGGGG  118

Query  341  --CRKTAAEKGGMVMGDVQMLKS---KAMKWAKKLGWKASEEEEECAICLDHFKVGETLM  177
               R TA    G V  +V   K    + M+W++ L W A+E+ E CA+CLD F  G+ L 
Sbjct  119  GGGRSTATAAMG-VQREVYSRKGVMRRLMRWSR-LRWDAAEQAE-CAVCLDEFAAGDVLA  175

Query  176  QLPCSHRFHSRCLLPWLDTNA---HCPCCRMGI  87
             LPC HRFH  C LPWL+  A    CP CR  +
Sbjct  176  HLPCGHRFHWACALPWLEAGAAPRSCPFCRAAV  208



>gb|KDP30179.1| hypothetical protein JCGZ_16961 [Jatropha curcas]
Length=92

 Score = 79.7 bits (195),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 59/91 (65%), Positives = 66/91 (73%), Gaps = 7/91 (8%)
 Frame = -2

Query  644  MAGMLPGVECARRRRFHQSGGLSDsttstttssstrrsSFCLYTSNHDSHLsssssssSM  465
            MAGMLPGVECARRRRFHQS   S        SSSTRRSSFCLYTSNH+S  +S SSS   
Sbjct  1    MAGMLPGVECARRRRFHQSCDTS----WAAVSSSTRRSSFCLYTSNHESSQTSISSSLG-  55

Query  464  QRSTIGKAYQDEKLGAAAREAKERLDERLKS  372
              S   +AY+ EKLG  AR+AKERLDERL++
Sbjct  56   --SITKEAYEAEKLGEVARQAKERLDERLRN  84



>gb|EEE57984.1| hypothetical protein OsJ_08735 [Oryza sativa Japonica Group]
Length=231

 Score = 82.0 bits (201),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 76/227 (33%), Positives = 103/227 (45%), Gaps = 45/227 (20%)
 Frame = -2

Query  644  MAGMLPGVECARRRRFHQSGGLSDsttstttssstrrsSFCLYTSNHDSHLsssssssSM  465
            MAGMLPGVECARR                     TRR S CLY   HD  L  SS+    
Sbjct  4    MAGMLPGVECARR--------RRLRQGGGEAPCGTRRPSLCLYAGGHDHALLGSSACKDN  55

Query  464  QRSTI---------GKAYQDEK------------LGAAAREAKERLDERLKSGH------  366
             RS I         G   Q ++            L +  REAKERLD++L+S        
Sbjct  56   HRSDIEFEIAVFGIGIMLQQQRSACEEQQPGWWTLDSNVREAKERLDQKLRSQRESAVVV  115

Query  365  CKSDHKRNCRKTAAEKGGMVMGDVQMLKSKAMK--------WAKKLGWKASEEEEE-CAI  213
             K  +K     T+++ G          + +           W ++LG + + EEEE CA+
Sbjct  116  VKRHNKAQVAGTSSDGGEQSTATTAAPQWEVYTRKEGRRRMWFRRLGRRPTPEEEEECAV  175

Query  212  CLDHFKVGETLMQLPCSHRFHSRCLLPWLDTNAHCPCCRMGI-LSSP  75
            CL+  + GE +  LPC+HRFH  C +PW+ T + CP CR  + L+SP
Sbjct  176  CLEELRAGEAVAHLPCTHRFHWGCAVPWVQTASRCPVCRAAVYLTSP  222



>ref|XP_006848840.1| hypothetical protein AMTR_s00026p00191500 [Amborella trichopoda]
 gb|ERN10421.1| hypothetical protein AMTR_s00026p00191500 [Amborella trichopoda]
Length=99

 Score = 77.8 bits (190),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 41/92 (45%), Positives = 55/92 (60%), Gaps = 7/92 (8%)
 Frame = -2

Query  341  CRKTAAEKGGMVMGDVQMLKS--KAMKWAKKLGWKASEEEEECAICLDHFKVGETLMQLP  168
            C     EK G     +++L S  K   WA+   W+ S +EE CA+CL+ FKVGE L+ +P
Sbjct  8    CSIKLGEKIGSGDLHIEVLSSEKKRFNWAR-FSWEGSRKEE-CAVCLEGFKVGEVLVNMP  65

Query  167  CSHRFHSRCLLPWLDTNAHCPCCRMGILSSPF  72
            CSH FH  CL+PWL  ++ CPCCR  +   PF
Sbjct  66   CSHTFHFNCLVPWLQAHSVCPCCRTHV---PF  94



>ref|XP_003570314.1| PREDICTED: probable E3 ubiquitin-protein ligase HIP1 isoform 
X1 [Brachypodium distachyon]
Length=213

 Score = 79.3 bits (194),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 71/209 (34%), Positives = 100/209 (48%), Gaps = 31/209 (15%)
 Frame = -2

Query  644  MAGMLPGVECARRRRFHQSGGLSDsttstttssstrrsSFCLY--TSNHDSHLsssssss  471
            MAGMLPGVE ARRRR   + G S          + R SS C Y  ++ H+ H    S+  
Sbjct  4    MAGMLPGVESARRRRLRPAAGSS---AEAPCGGTRRPSSLCFYAASNGHEHHAHLGSAGF  60

Query  470  SMQRSTIGKAYQDEKLGAAAREAKERLDERLKS-------------------GHCKSDHK  348
              QR+   +      L + AREAKERLD++L+S                       SDH+
Sbjct  61   PKQRN---EEAWTTTLDSNAREAKERLDQKLRSQRESVVKRRHSTGSLRLPAASTSSDHR  117

Query  347  RNCRKTAAEKGGMVMGDVQMLKSKAMK--WAKKLGWKASEEEEECAICLDHFKVGETLMQ  174
                  AA     +  +V   K    +  WA++      +EEEECA+CL+ F+ G+ L +
Sbjct  118  PAREPPAAAAASALQREVFSKKGDGRRFLWARRR--HQQQEEEECAVCLEDFRAGDLLAR  175

Query  173  LPCSHRFHSRCLLPWLDTNAHCPCCRMGI  87
            LPC+HRFH  C + W+   + CP CR  +
Sbjct  176  LPCAHRFHWPCAVRWVRAASRCPVCRAAV  204



>ref|NP_001236714.1| uncharacterized protein LOC100500350 [Glycine max]
 gb|ACU15402.1| unknown [Glycine max]
Length=100

 Score = 75.5 bits (184),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 52/101 (51%), Positives = 63/101 (62%), Gaps = 17/101 (17%)
 Frame = -2

Query  644  MAGMLPGVECARRRRFHQSGGLSDsttstttssstrrsSFCLYTSNHDSHLsssssssSM  465
            M+GMLPGVECARRRR H S G            ST   SFCLYT+ +       SSSS +
Sbjct  1    MSGMLPGVECARRRRLHNSAG----------DDSTSNRSFCLYTTRN-----LQSSSSLL  45

Query  464  QRSTIGKAYQDEKLGAAAREAKERLDERLKSGHCKSD-HKR  345
            +RS + +AY DE LG AAREAK RLD++  + H KS+ HKR
Sbjct  46   ERSMLNRAYPDENLGGAAREAKRRLDQKFMA-HIKSESHKR  85



>ref|XP_006600145.1| PREDICTED: uncharacterized protein LOC100500350 isoform X1 [Glycine 
max]
 gb|KHN18597.1| hypothetical protein glysoja_007010 [Glycine soja]
Length=98

 Score = 75.1 bits (183),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 52/101 (51%), Positives = 63/101 (62%), Gaps = 17/101 (17%)
 Frame = -2

Query  644  MAGMLPGVECARRRRFHQSGGLSDsttstttssstrrsSFCLYTSNHDSHLsssssssSM  465
            M+GMLPGVECARRRR H S G            ST   SFCLYT+ +       SSSS +
Sbjct  1    MSGMLPGVECARRRRLHNSAG----------DDSTSNRSFCLYTTRN-----LQSSSSLL  45

Query  464  QRSTIGKAYQDEKLGAAAREAKERLDERLKSGHCKSD-HKR  345
            +RS + +AY DE LG AAREAK RLD++  + H KS+ HKR
Sbjct  46   ERSMLNRAYPDENLGGAAREAKRRLDQKFMA-HIKSESHKR  85



>ref|XP_010235924.1| PREDICTED: probable E3 ubiquitin-protein ligase HIP1 isoform 
X2 [Brachypodium distachyon]
Length=212

 Score = 77.4 bits (189),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 70/211 (33%), Positives = 99/211 (47%), Gaps = 36/211 (17%)
 Frame = -2

Query  644  MAGMLPGVECARRRRFHQSGGLSDsttstttssstrrsSFCLYTSN----HDSHLsssss  477
            MAGMLPGVE ARRRR   + G S          + R SS C Y ++    H +HL S+  
Sbjct  4    MAGMLPGVESARRRRLRPAAGSS---AEAPCGGTRRPSSLCFYAASNGHEHHAHLGSAGF  60

Query  476  ssSMQRSTIGKAYQDEKLGAAAREAKERLDERLKS-------------------GHCKSD  354
                + +          L + AREAKERLD++L+S                       SD
Sbjct  61   PKRNEEAWT------TTLDSNAREAKERLDQKLRSQRESVVKRRHSTGSLRLPAASTSSD  114

Query  353  HKRNCRKTAAEKGGMVMGDVQMLKSKAMK--WAKKLGWKASEEEEECAICLDHFKVGETL  180
            H+      AA     +  +V   K    +  WA++      +EEEECA+CL+ F+ G+ L
Sbjct  115  HRPAREPPAAAAASALQREVFSKKGDGRRFLWARRR--HQQQEEEECAVCLEDFRAGDLL  172

Query  179  MQLPCSHRFHSRCLLPWLDTNAHCPCCRMGI  87
             +LPC+HRFH  C + W+   + CP CR  +
Sbjct  173  ARLPCAHRFHWPCAVRWVRAASRCPVCRAAV  203



>gb|AEW08590.1| hypothetical protein CL647Contig1_04, partial [Pinus radiata]
 gb|AFG56101.1| hypothetical protein CL647Contig1_04, partial [Pinus taeda]
 gb|AFG56102.1| hypothetical protein CL647Contig1_04, partial [Pinus taeda]
 gb|AFG56103.1| hypothetical protein CL647Contig1_04, partial [Pinus taeda]
 gb|AFG56104.1| hypothetical protein CL647Contig1_04, partial [Pinus taeda]
 gb|AFG56105.1| hypothetical protein CL647Contig1_04, partial [Pinus taeda]
 gb|AFG56106.1| hypothetical protein CL647Contig1_04, partial [Pinus taeda]
 gb|AFG56107.1| hypothetical protein CL647Contig1_04, partial [Pinus taeda]
 gb|AFG56108.1| hypothetical protein CL647Contig1_04, partial [Pinus taeda]
 gb|AFG56109.1| hypothetical protein CL647Contig1_04, partial [Pinus taeda]
 gb|AFG56110.1| hypothetical protein CL647Contig1_04, partial [Pinus taeda]
 gb|AFG56111.1| hypothetical protein CL647Contig1_04, partial [Pinus taeda]
 gb|AFG56112.1| hypothetical protein CL647Contig1_04, partial [Pinus taeda]
 gb|AFG56113.1| hypothetical protein CL647Contig1_04, partial [Pinus taeda]
 gb|AFG56114.1| hypothetical protein CL647Contig1_04, partial [Pinus taeda]
 gb|AFG56115.1| hypothetical protein CL647Contig1_04, partial [Pinus taeda]
 gb|AFG56116.1| hypothetical protein CL647Contig1_04, partial [Pinus taeda]
Length=67

 Score = 73.9 bits (180),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 42/60 (70%), Gaps = 3/60 (5%)
 Frame = -2

Query  257  KLGWK---ASEEEEECAICLDHFKVGETLMQLPCSHRFHSRCLLPWLDTNAHCPCCRMGI  87
            K  WK   ++  +E+C +CL+ F+  + L+ LPC+HRFHS CL+PWL+ + HCPCCR  I
Sbjct  3    KYSWKKLMSTSTQEDCPVCLEPFQTNQVLIHLPCTHRFHSSCLVPWLNRHCHCPCCRTKI  62



>gb|ACN41012.1| unknown [Picea sitchensis]
Length=265

 Score = 76.3 bits (186),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 33/85 (39%), Positives = 48/85 (56%), Gaps = 3/85 (4%)
 Frame = -2

Query  332  TAAEKGGMVMGDVQMLKSKAMKWAKKLGWK---ASEEEEECAICLDHFKVGETLMQLPCS  162
            T   K  + + + Q    K      K  WK   ++  +EEC +CL+ F+  + L+ LPC+
Sbjct  176  TGLSKASIDLLERQTFTPKHKNICGKYSWKKLISTSTQEECPVCLESFQTSQVLIHLPCT  235

Query  161  HRFHSRCLLPWLDTNAHCPCCRMGI  87
            H FHS CL+PWL+ + HCPCCR  I
Sbjct  236  HIFHSGCLVPWLNRHCHCPCCRTRI  260



>ref|XP_004964679.1| PREDICTED: E3 ubiquitin-protein ligase EL5-like, partial [Setaria 
italica]
Length=211

 Score = 75.9 bits (185),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 52/160 (33%), Positives = 77/160 (48%), Gaps = 32/160 (20%)
 Frame = -2

Query  464  QRSTIGKAYQDEKLGAAAREAKERLDERLKS---GHCKSDHKRNCRKTAA----------  324
            +RS++ +      L + AREAKERLD++L+S      K  H     K +           
Sbjct  47   KRSSVMEMLHGWTLDSHAREAKERLDQKLRSKREAAIKRHHSTGSIKLSRPHHHGGAGAA  106

Query  323  ------EKG----GMVMGDVQM-------LKSKAMKWAKKLGWKASEEEEECAICLDHFK  195
                  E+G       M  VQ        +  + M+W++   W A+E+ E CA+CLD F+
Sbjct  107  GAAGADERGESSAASAMCGVQREVYSRKGVMRRLMRWSRPR-WAAAEQAE-CAVCLDDFR  164

Query  194  VGETLMQLPCSHRFHSRCLLPWLDTNAHCPCCRMGILSSP  75
             G+ L  LPC HRFH  C  PWL+  + CP CR  + ++P
Sbjct  165  AGDVLAHLPCGHRFHWACAAPWLEGTSRCPFCRAAVDANP  204



>gb|AGU28437.1| RING/U-box superfamily protein, partial [Sinapis alba]
Length=108

 Score = 73.6 bits (179),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 43/98 (44%), Positives = 57/98 (58%), Gaps = 4/98 (4%)
 Frame = -2

Query  437  QDEKLGAAAREAKERLDERLKSGHCKSDHKRNCRKTAAEKGGMVMG---DVQMLKSKAMK  267
             DEKL  AA+EAK+RLDERL++   + +      K    KG  +     +V  LK    K
Sbjct  8    NDEKLVGAAKEAKDRLDERLRNPRRRKNGIDKVNKLENGKGKSLKDLPTEVVGLKKSQGK  67

Query  266  WAKKLGWKASEEEEECAICLDHFKVGETLMQLPCSHRF  153
              K  GW+   E++ECAICLD FK GETL+ LPC+H+ 
Sbjct  68   LVKWFGWRV-REQQECAICLDQFKTGETLVHLPCTHKM  104



>ref|XP_008777376.1| PREDICTED: RING finger protein 165-like [Phoenix dactylifera]
Length=166

 Score = 73.2 bits (178),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 56/196 (29%), Positives = 86/196 (44%), Gaps = 37/196 (19%)
 Frame = -2

Query  635  MLPGVECARRRRFH-QSGGLSDsttstttssstrrsSFCLYTSNHDSHLsssssssSMQR  459
            MLPGVE AR+RR H  SGG + +   +    +  R  +   T+  +S             
Sbjct  2    MLPGVELARKRRVHCHSGGETPAARRSPADPTDMRLPYLRPTAMDES-------------  48

Query  458  STIGKAYQDEKLGAAAREAKERLDERLKSGHCKSDHKRNCRKTAAEKGGMVMGDVQMLKS  279
                           A  A+ RL+E+L+              +++          +  ++
Sbjct  49   ---------------AFAARIRLEEKLRGVAGPPLPAAAATTSSSSSSFSFSPRRRQREA  93

Query  278  KAMKWAKKLGW--KASEEEEECAICLDHFKVGETLMQLPCSHRFHSRCLLPWLDTNAHCP  105
               K   K G   +     E CA+CL+ F+  +++M+LPCSH++HS CLLPWL  +AHCP
Sbjct  94   SDGKTKPKSGGLKRTGSRTELCAVCLEDFQSKQSVMRLPCSHKYHSDCLLPWLAAHAHCP  153

Query  104  CCRMGILSSPF*WFFN  57
            CCR  +       FFN
Sbjct  154  CCRTPV------PFFN  163



>dbj|BAJ86795.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ87151.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=205

 Score = 73.6 bits (179),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 63/205 (31%), Positives = 93/205 (45%), Gaps = 30/205 (15%)
 Frame = -2

Query  644  MAGMLPGVECARRRRFHQSGGLSDsttstttssstrrsSFCLYTSNHDSHLsssssssSM  465
            MAGMLPGVE AR               +     +  R    L T  HD H    S+  + 
Sbjct  4    MAGMLPGVEFAR---------RRRLRPAAEAPCAGPRRPSSLGTFGHD-HAHLGSAGFAK  53

Query  464  QRSTIGKAYQDEKLGAAAREAKERLDERLKSGHCKSDHKRNCRKT--------------A  327
            QRS   +     +L + AREAKERLD++L+S       +R+   +              A
Sbjct  54   QRSGACEEAWTTQLDSIAREAKERLDQKLRSQRESMAKRRHSTGSLRLPAPSSTDGDHPA  113

Query  326  AEKGGMVMGDVQMLKSKAMKWAKKLGW-----KASEEEEECAICLDHFKVGETLMQLPCS  162
             +  G   G  + L +K     ++  W     +  +++ ECA+CL+ F+ G+ L  LPC+
Sbjct  114  NDTAGAASGLQRELFTKKGG-GRRFSWGRRKEQEQQQQAECAVCLEEFRAGDVLAHLPCA  172

Query  161  HRFHSRCLLPWLDTNAHCPCCRMGI  87
            HRFH  C +PW+   A CP CR  +
Sbjct  173  HRFHWACAVPWVQAAARCPFCRAAV  197



>gb|AFK38133.1| unknown [Lotus japonicus]
Length=152

 Score = 72.4 bits (176),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 43/117 (37%), Positives = 70/117 (60%), Gaps = 12/117 (10%)
 Frame = -2

Query  425  LGAAAREAKERLDERLKSGHC----KSDHKRNCRKTAAEKGGMVMGDVQMLKSKAMKWAK  258
            L   A +A++RL ++L  GH     +SD   N ++ + +K    +G  ++L+S    W  
Sbjct  43   LDETAIQARQRLQKKL--GHFFSSFRSDDNPN-KEVSLQKKDAGLGR-KLLESS---WLL  95

Query  257  KLGWKASEEEEECAICLDHFKVGETLMQLPCSHRFHSRCLLPWLDTNAHCPCCRMGI  87
            + G K  +E + CA+CL+ F+  + +M L CSH++HS CLLPWL+ + HCPCCR  +
Sbjct  96   R-GTKFKKERKVCAVCLEDFQQKQQVMNLSCSHKYHSACLLPWLEAHPHCPCCRTSV  151



>gb|EMS68646.1| RING-H2 finger protein ATL80 [Triticum urartu]
Length=157

 Score = 72.4 bits (176),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 41/141 (29%), Positives = 66/141 (47%), Gaps = 14/141 (10%)
 Frame = -2

Query  467  MQRSTIGKAYQDEKLGAAAREAKERLDERLKSGHCKSDHKRNCRKT--------------  330
            + RS +G+     +L   AREAKERLD +L+S       +R+   +              
Sbjct  9    LVRSGVGEEAWATQLDGIAREAKERLDHKLRSQRESVVKRRHSTGSLRLPVPSSTPSDHP  68

Query  329  AAEKGGMVMGDVQMLKSKAMKWAKKLGWKASEEEEECAICLDHFKVGETLMQLPCSHRFH  150
            A +  G      + + +K          +  + + ECA+CL+ F+ G+ L  LPC+HRFH
Sbjct  69   AKDTAGAASALQREVCTKRGGLRGGRRKEEQQHQAECAVCLEEFRAGDVLAHLPCAHRFH  128

Query  149  SRCLLPWLDTNAHCPCCRMGI  87
              C +PW+   + CP CR  +
Sbjct  129  WACAVPWVQAASRCPFCRAAV  149



>ref|XP_008443904.1| PREDICTED: uncharacterized protein LOC103487385 isoform X1 [Cucumis 
melo]
Length=123

 Score = 71.6 bits (174),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 51/97 (53%), Positives = 62/97 (64%), Gaps = 4/97 (4%)
 Frame = -2

Query  644  MAGMLPGVECARRRRFHQSGGLSDsttstttssstrrsSFCLYTSNHDSHLsssssssSM  465
            MAGMLPGVECARRRR HQ+   SD +        TRRS  CLYTSNH++ L    S+ SM
Sbjct  1    MAGMLPGVECARRRRCHQNKIWSD-SPQVDAQVLTRRSVLCLYTSNHEALL---VSNPSM  56

Query  464  QRSTIGKAYQDEKLGAAAREAKERLDERLKSGHCKSD  354
            QR  + +A  +++L   AREAK RLDERL     KS+
Sbjct  57   QRRLLMEAGGEDELDGIAREAKRRLDERLWRTQRKSE  93



>gb|KEH43812.1| zinc finger, C3HC4 type (RING finger) protein [Medicago truncatula]
Length=161

 Score = 72.4 bits (176),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 58/187 (31%), Positives = 86/187 (46%), Gaps = 29/187 (16%)
 Frame = -2

Query  644  MAGMLPGVECARRRRFHQSGGLSDsttstttssstrrsSFCLYTSNHDSHLsssssssSM  465
            MAG LPGV  + R+R        +                  Y +  DS+L  S  +   
Sbjct  1    MAGRLPGVGLSPRKRSEHYHNRHEH-----------------YATYRDSYLKESLDAPWT  43

Query  464  QRSTIGKAYQDEKLGAAAREAKERLDERLKSGHCKSDHKRNCRKTAAEKGGMVMGDVQML  285
              +T         L   A +AK+RL ++L  GH  S   R+      ++G         L
Sbjct  44   SMTTT--------LDETAFKAKQRLQKKL--GHFFSS-SRSSEHNPKKEGKEFQKKDAGL  92

Query  284  KSKAMKWAKKL-GWKASEEEEECAICLDHFKVGETLMQLPCSHRFHSRCLLPWLDTNAHC  108
              K ++ +  L G K  +E + CA+CL+ F+  E +M L CSH++HS CLLPWL+T+ HC
Sbjct  93   GRKLLESSWLLRGNKFKKERKICAVCLEDFQQDEEVMNLSCSHKYHSACLLPWLETHPHC  152

Query  107  PCCRMGI  87
            P CR  +
Sbjct  153  PYCRTIV  159



>ref|NP_001189531.1| RING/U-box domain-containing protein [Arabidopsis thaliana]
 gb|AEC06420.1| RING/U-box domain-containing protein [Arabidopsis thaliana]
Length=130

 Score = 71.2 bits (173),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 57/140 (41%), Positives = 76/140 (54%), Gaps = 34/140 (24%)
 Frame = -2

Query  644  MAGMLPGVECARRRRFHQSGGLSDsttstttssstrr-------sSFCLYTSNHDSHLss  486
            MAGMLPGVECARRRRFH  GG     +S T S +           SF LYT+NH+SH   
Sbjct  1    MAGMLPGVECARRRRFH--GGAPPIESSNTASVAAAAGHVWTRRPSFSLYTTNHESH---  55

Query  485  sssssSMQRSTIGKAY---QDEKLGAAAREAKERLDERLKSGHCKSDHKRNCRKTAAEKG  315
             +  S  +RS   K+Y    DEKL  AA+EAK+RL++RL          R   +T++ K 
Sbjct  56   QAHVSFSERSVRNKSYGEDNDEKLDGAAKEAKQRLNKRL----------RIPPRTSSGK-  104

Query  314  GMVMGDVQMLKSKAMKWAKK  255
                    M+K+K + W+K+
Sbjct  105  --------MVKTKGINWSKE  116



>ref|XP_008224255.1| PREDICTED: E3 ubiquitin-protein ligase ZNRF3-like isoform X1 
[Prunus mume]
Length=153

 Score = 71.2 bits (173),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 41/113 (36%), Positives = 60/113 (53%), Gaps = 11/113 (10%)
 Frame = -2

Query  425  LGAAAREAKERLDERLKSGHCKSDHKRNCRKTAAEKGGMVMGDVQMLKSKAMKWAKKLGW  246
            L  A  +A+ RL++RL  G+C+     + RK AA      MG       ++  +   +  
Sbjct  51   LDEATHKARRRLEKRL--GYCRPS---SSRKDAA------MGSNSKGLGRSWGFFSVISR  99

Query  245  KASEEEEECAICLDHFKVGETLMQLPCSHRFHSRCLLPWLDTNAHCPCCRMGI  87
              + + E CAICL+ F+ GE  M L C+H+FHS CLLPWL  +  CP CR  +
Sbjct  100  NVTADREVCAICLESFEAGEQAMDLSCAHKFHSNCLLPWLHAHPDCPYCRTPV  152



>gb|ACJ83283.1| unknown [Medicago truncatula]
 gb|ACJ84549.1| unknown [Medicago truncatula]
 gb|AFK48681.1| unknown [Medicago truncatula]
Length=161

 Score = 71.2 bits (173),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 58/187 (31%), Positives = 85/187 (45%), Gaps = 29/187 (16%)
 Frame = -2

Query  644  MAGMLPGVECARRRRFHQSGGLSDsttstttssstrrsSFCLYTSNHDSHLsssssssSM  465
            MAG LPGV  + R+R        +                  Y +  DS+L  S  +   
Sbjct  1    MAGRLPGVGLSPRKRSEHYHNRHEH-----------------YATYRDSYLKESLDAPWT  43

Query  464  QRSTIGKAYQDEKLGAAAREAKERLDERLKSGHCKSDHKRNCRKTAAEKGGMVMGDVQML  285
              +T         L   A +AK+RL ++L  GH  S   R+      ++G         L
Sbjct  44   SMTTT--------LDETAFKAKQRLQKKL--GHFFSS-SRSSEHNPKKEGKEFQKKDAGL  92

Query  284  KSKAMKWAKKL-GWKASEEEEECAICLDHFKVGETLMQLPCSHRFHSRCLLPWLDTNAHC  108
              K ++ +  L G K  +E + CA+CL+ F   E +M L CSH++HS CLLPWL+T+ HC
Sbjct  93   GRKLLESSWLLRGNKFKKERKICAVCLEDFLQDEEVMNLSCSHKYHSACLLPWLETHPHC  152

Query  107  PCCRMGI  87
            P CR  +
Sbjct  153  PYCRTIV  159



>ref|XP_008224257.1| PREDICTED: E3 ubiquitin-protein ligase SGR9, amyloplastic-like 
isoform X2 [Prunus mume]
Length=152

 Score = 70.9 bits (172),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 41/113 (36%), Positives = 60/113 (53%), Gaps = 12/113 (11%)
 Frame = -2

Query  425  LGAAAREAKERLDERLKSGHCKSDHKRNCRKTAAEKGGMVMGDVQMLKSKAMKWAKKLGW  246
            L  A  +A+ RL++RL  G+C+     + RK AA      MG       ++  +   +  
Sbjct  51   LDEATHKARRRLEKRL--GYCRP----SSRKDAA------MGSNSKGLGRSWGFFSVISR  98

Query  245  KASEEEEECAICLDHFKVGETLMQLPCSHRFHSRCLLPWLDTNAHCPCCRMGI  87
              + + E CAICL+ F+ GE  M L C+H+FHS CLLPWL  +  CP CR  +
Sbjct  99   NVTADREVCAICLESFEAGEQAMDLSCAHKFHSNCLLPWLHAHPDCPYCRTPV  151



>ref|XP_004496688.1| PREDICTED: E3 ubiquitin-protein ligase RNF128-like [Cicer arietinum]
Length=165

 Score = 70.9 bits (172),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 45/123 (37%), Positives = 73/123 (59%), Gaps = 12/123 (10%)
 Frame = -2

Query  425  LGAAAREAKERLDERL-----KSGHCKSDHKRNCRKTAA--EKGGMVMGDVQMLKSKAMK  267
            L   A +AK+RL ++L      SG  + + K+  ++T +  EK  + +G  ++L+S    
Sbjct  48   LDENAFKAKQRLRKKLGYFLSSSGSSEQNPKKEGKETKSTFEKKDVGLGR-KLLEST---  103

Query  266  WAKKLGWKASEEEEECAICLDHFKVGETLMQLPCSHRFHSRCLLPWLDTNAHCPCCRMGI  87
            W  + G +  +E++ CA+CL+ F+  + +M L CSH++HS CLLPWL  N HCPCCR  +
Sbjct  104  WLLR-GNRLKKEKKVCAVCLEDFQQHKEVMNLSCSHKYHSACLLPWLRANPHCPCCRTMV  162

Query  86   LSS  78
              S
Sbjct  163  EPS  165



>ref|XP_011078578.1| PREDICTED: uncharacterized protein LOC105162272 [Sesamum indicum]
Length=144

 Score = 70.1 bits (170),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 50/103 (49%), Positives = 66/103 (64%), Gaps = 5/103 (5%)
 Frame = -2

Query  644  MAGMLPGVECARRRRFHQSGGLSDsttstttssstrrsSFCLYTSNHDSHLsssssssSM  465
            MAGMLPGVE ARRRRFH S  +         ++ST RSSFCLY +N+   L+   SSS+ 
Sbjct  1    MAGMLPGVEAARRRRFHHSNPIDG----AGAATSTTRSSFCLYATNYSHQLNIYPSSSTE  56

Query  464  QRSTIGKAYQDEKLGAAAREAKERLDERLKSGHCKSDHKRNCR  336
            +++      +DEKL A AREAK RLD+RL++ H +S  KR  +
Sbjct  57   RKTGEEVECEDEKLDATAREAKWRLDQRLQT-HLRSKIKRGTK  98



>ref|XP_007223664.1| hypothetical protein PRUPE_ppa012817mg [Prunus persica]
 gb|EMJ24863.1| hypothetical protein PRUPE_ppa012817mg [Prunus persica]
Length=153

 Score = 70.1 bits (170),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 41/113 (36%), Positives = 59/113 (52%), Gaps = 11/113 (10%)
 Frame = -2

Query  425  LGAAAREAKERLDERLKSGHCKSDHKRNCRKTAAEKGGMVMGDVQMLKSKAMKWAKKLGW  246
            L  A  +A+ RL++RL  G+C+     + RK AA      MG       ++  +   +  
Sbjct  51   LDEATHKARRRLEKRL--GYCRPS---SSRKDAA------MGSNSKGLGRSWGFFSVISR  99

Query  245  KASEEEEECAICLDHFKVGETLMQLPCSHRFHSRCLLPWLDTNAHCPCCRMGI  87
                E + CAICL+ F+ GE  M L C+H+FHS CLLPWL  +  CP CR  +
Sbjct  100  NVRAERDVCAICLESFEAGEQAMDLSCAHKFHSNCLLPWLHAHPDCPYCRTPV  152



>emb|CAN74781.1| hypothetical protein VITISV_025062 [Vitis vinifera]
Length=164

 Score = 69.7 bits (169),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 37/126 (29%), Positives = 65/126 (52%), Gaps = 23/126 (18%)
 Frame = -2

Query  425  LGAAAREAKERLDERLK-------------SGHCKSDHKRNCRKTAAEKGGMVMGDVQML  285
            +G  A  A++RLD +L              +G  +S+HK   ++ ++  G  ++G     
Sbjct  46   MGETALMARQRLDRKLAHYRASSRSSKQGANGSRESNHKERTKRNSS-TGSXILGR----  100

Query  284  KSKAMKWAKKLGWKASEEEEECAICLDHFKVGETLMQLPCSHRFHSRCLLPWLDTNAHCP  105
                  W  +L   +    E C++CL+ F+  + +M+L CSH++HS CL+PWL ++ HCP
Sbjct  101  -----PWKLQLNTGSKSNGEMCSVCLEDFEGEQQMMELSCSHKYHSNCLMPWLASHPHCP  155

Query  104  CCRMGI  87
             CR  +
Sbjct  156  TCRNPV  161



>ref|XP_007223663.1| hypothetical protein PRUPE_ppa012817mg [Prunus persica]
 gb|EMJ24862.1| hypothetical protein PRUPE_ppa012817mg [Prunus persica]
Length=152

 Score = 69.7 bits (169),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 41/113 (36%), Positives = 59/113 (52%), Gaps = 12/113 (11%)
 Frame = -2

Query  425  LGAAAREAKERLDERLKSGHCKSDHKRNCRKTAAEKGGMVMGDVQMLKSKAMKWAKKLGW  246
            L  A  +A+ RL++RL  G+C+     + RK AA      MG       ++  +   +  
Sbjct  51   LDEATHKARRRLEKRL--GYCRP----SSRKDAA------MGSNSKGLGRSWGFFSVISR  98

Query  245  KASEEEEECAICLDHFKVGETLMQLPCSHRFHSRCLLPWLDTNAHCPCCRMGI  87
                E + CAICL+ F+ GE  M L C+H+FHS CLLPWL  +  CP CR  +
Sbjct  99   NVRAERDVCAICLESFEAGEQAMDLSCAHKFHSNCLLPWLHAHPDCPYCRTPV  151



>ref|NP_001056975.2| Os06g0180800 [Oryza sativa Japonica Group]
 dbj|BAF18889.2| Os06g0180800, partial [Oryza sativa Japonica Group]
Length=130

 Score = 68.9 bits (167),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/67 (48%), Positives = 42/67 (63%), Gaps = 5/67 (7%)
 Frame = -2

Query  278  KAMKWAKKLGWKASEEEEECAICLDHFKVGETLMQLPCSHRFHSRCLLPWLDTNA---HC  108
            + M+W++ L W A+E+ E CA+CLD F  G+ L  LPC HRFH  C LPWL+  A    C
Sbjct  53   RLMRWSR-LRWDAAEQAE-CAVCLDEFAAGDVLAHLPCGHRFHWACALPWLEAGAAPRSC  110

Query  107  PCCRMGI  87
            P CR  +
Sbjct  111  PFCRAAV  117



>ref|XP_002452986.1| hypothetical protein SORBIDRAFT_04g036095 [Sorghum bicolor]
 gb|EES05962.1| hypothetical protein SORBIDRAFT_04g036095 [Sorghum bicolor]
Length=226

 Score = 70.5 bits (171),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 71/210 (34%), Positives = 105/210 (50%), Gaps = 38/210 (18%)
 Frame = -2

Query  644  MAGMLPGVECARRRRFHQSGGLSDsttstttssstrrsSFCLYTSNHDSHLsssssssSM  465
            MAGMLPGVE ARRRR  QS          + S + RR S CLY     S  S++++++S 
Sbjct  15   MAGMLPGVESARRRRVRQS----------SESGAARRPSLCLYAGGLGSSSSAAAAAASS  64

Query  464  Q---------RSTIGKAYQDEKLGAAAREAKERLDERLKSGHCKSDHKRNCRKTAA----  324
            +          + +  A+    LG+ AREAKERLD +L+        KR  R+ A     
Sbjct  65   KVWSGACGDTTAAMACAWMTT-LGSDAREAKERLDHKLRGHRQPVVLKRTTRRAAPAEAT  123

Query  323  ----EKGGMVMGDVQMLKSKAMK----------WAKKLGWKASEEEEECAICLDHFKVGE  186
                ++   V+   ++L S + K          W ++     SE E ECA+CL+  + G+
Sbjct  124  ATTRQRRPAVLLHREVLPSLSSKPRKGGGCRFSWRRRPPAAESEAEAECAVCLEELRAGD  183

Query  185  TLMQLPCSHRFHSRCLLPWLDTNAHCPCCR  96
             + +LPC+HRFH  C +PW+   + CP CR
Sbjct  184  VVARLPCAHRFHWSCAVPWVQAVSRCPVCR  213



>ref|XP_009124562.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like [Brassica 
rapa]
Length=243

 Score = 70.5 bits (171),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 47/133 (35%), Positives = 67/133 (50%), Gaps = 19/133 (14%)
 Frame = -2

Query  431  EKLGAAAREAKERLDERLKSGHCKSDHKRNCRKTAAE--KGGMVMGD---VQM-------  288
            E+L  A   A+ERL ERL+ G   S + R  R T +E  +     G+   +Q+       
Sbjct  104  ERLPGAVLLARERLFERLR-GVSLSSNSRTNRVTLSENQRESSFYGEPEGIQVSYECNKK  162

Query  287  ---LKSKAMKWAKKLGWKASE---EEEECAICLDHFKVGETLMQLPCSHRFHSRCLLPWL  126
               L   A+    +L + ++E   E  +C+ICL+ F  G+ L+ LPC+H FHS CL PWL
Sbjct  163  PLGLTQGAINGLHRLTFSSAEVKTERSDCSICLESFTNGDMLISLPCTHSFHSSCLNPWL  222

Query  125  DTNAHCPCCRMGI  87
                 CP CR  I
Sbjct  223  KACGDCPYCRRAI  235



>gb|AFW73878.1| putative RING zinc finger domain superfamily protein [Zea mays]
Length=188

 Score = 69.7 bits (169),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 42/130 (32%), Positives = 59/130 (45%), Gaps = 20/130 (15%)
 Frame = -2

Query  425  LGAAAREAKERLDERL---------KSGHCKSDHKRNCRK-TAAEKGGMVMGDVQMLKSK  276
            LG+ AREAKERLD++L         KSG     H   C   T       V+   +  K  
Sbjct  54   LGSGAREAKERLDQKLRAQRQPVVLKSGGLHRHHSSACSSDTGVLLRREVVSSPKPNKKG  113

Query  275  AMKWAKKLGW----------KASEEEEECAICLDHFKVGETLMQLPCSHRFHSRCLLPWL  126
                  + GW            +  E  CA+CL+  + G+ + +LPC+HRFH  C +PW+
Sbjct  114  GGGGGGRFGWCRLLAGGRRGPPAAAEAGCAVCLEELRAGDVVARLPCAHRFHWSCAVPWV  173

Query  125  DTNAHCPCCR  96
               + CP CR
Sbjct  174  QAASRCPVCR  183



>ref|XP_002283255.1| PREDICTED: RING-H2 finger protein ATL33 [Vitis vinifera]
Length=164

 Score = 68.9 bits (167),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 37/126 (29%), Positives = 65/126 (52%), Gaps = 23/126 (18%)
 Frame = -2

Query  425  LGAAAREAKERLDERLK-------------SGHCKSDHKRNCRKTAAEKGGMVMGDVQML  285
            +G  A  A++RLD +L              +G  +S+HK   ++ ++  G  ++G     
Sbjct  46   MGETALMARQRLDRKLAHYRASSRSSKQGANGSRESNHKERTKRNSS-IGSKILGR----  100

Query  284  KSKAMKWAKKLGWKASEEEEECAICLDHFKVGETLMQLPCSHRFHSRCLLPWLDTNAHCP  105
                  W  +L   +    E C++CL+ F+  + +M+L CSH++HS CL+PWL ++ HCP
Sbjct  101  -----PWKLQLNTGSKSNGEMCSVCLEDFEGEQQMMELSCSHKYHSNCLMPWLASHPHCP  155

Query  104  CCRMGI  87
             CR  +
Sbjct  156  TCRNPV  161



>ref|XP_006838971.1| hypothetical protein AMTR_s00002p00271240 [Amborella trichopoda]
 gb|ERN01540.1| hypothetical protein AMTR_s00002p00271240 [Amborella trichopoda]
Length=140

 Score = 68.6 bits (166),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 28/53 (53%), Positives = 36/53 (68%), Gaps = 0/53 (0%)
 Frame = -2

Query  233  EEEECAICLDHFKVGETLMQLPCSHRFHSRCLLPWLDTNAHCPCCRMGILSSP  75
            E+E C +CLD  + GE L +LPCSH +HS CLLPWL  ++HCP CR  +   P
Sbjct  85   EKEVCGVCLDELESGEGLTRLPCSHSYHSHCLLPWLSRSSHCPYCRAHVPLVP  137



>ref|XP_007143303.1| hypothetical protein PHAVU_007G061000g [Phaseolus vulgaris]
 gb|ESW15297.1| hypothetical protein PHAVU_007G061000g [Phaseolus vulgaris]
Length=159

 Score = 68.6 bits (166),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 43/133 (32%), Positives = 67/133 (50%), Gaps = 14/133 (11%)
 Frame = -2

Query  461  RSTIGKAYQDEKLGAAAREAKERLDERLKSGHCKSDHKRNCRKTAAEKGGMVMGDVQMLK  282
            + ++   +    L   A +A++RL ++L  GH  S ++    +   +KGG V       K
Sbjct  31   KESLHPPWTPTVLDETALKARQRLHQKL--GHFFSSYR--SEENPRKKGGKVRESSNQKK  86

Query  281  SKAMKWAKKL--------GWKASEEEEECAICLDHFKVGETLMQLPCSHRFHSRCLLPWL  126
               +   +KL        G K  EE + CA+CL+     + +M L CSH++HS CLLPWL
Sbjct  87   DGGL--GRKLLESSWLLRGNKVKEERKVCAVCLEDLGEEQHVMNLSCSHKYHSACLLPWL  144

Query  125  DTNAHCPCCRMGI  87
             T+ HCP CR  +
Sbjct  145  ATHPHCPYCRTAV  157



>gb|EYU34925.1| hypothetical protein MIMGU_mgv1a016123mg [Erythranthe guttata]
Length=133

 Score = 67.8 bits (164),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 55/104 (53%), Positives = 69/104 (66%), Gaps = 5/104 (5%)
 Frame = -2

Query  647  DMAGMLPGVECARRRRFHQS-GGLSDsttstttssstrrsSFCLYTSNHDSHLsssssss  471
            +MAGMLPGVE ARRRRFH+S    S          STRRSSFCLY SN +  +    S S
Sbjct  19   NMAGMLPGVESARRRRFHRSCLDNSGGDGGYGGGGSTRRSSFCLYVSNCNELI--VGSPS  76

Query  470  SMQRSTIGK-AYQDEKLGAAAREAKERLDERLKSGHCKSDHKRN  342
            SM+R++I K  + D KL AAA EAK+RLD +L++ H KS+ KR+
Sbjct  77   SMERNSIRKGVFDDAKLDAAASEAKKRLDHKLQT-HWKSEIKRS  119



>gb|EMT12553.1| Putative RING finger protein [Aegilops tauschii]
Length=157

 Score = 68.2 bits (165),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 42/66 (64%), Gaps = 6/66 (9%)
 Frame = -2

Query  272  MKWAKKLGWKASEEEEECAICLDHFKVGETLMQLPCSHRFHSRCLLPWLDTNA----HCP  105
            M+W++ L W+A+E+ E CA+CLD F  G+ L  LPC HRFH  C LPWL+  A     CP
Sbjct  84   MRWSR-LRWEAAEQAE-CAVCLDEFAAGDVLAHLPCGHRFHWGCALPWLEGAAAASHSCP  141

Query  104  CCRMGI  87
             CR  +
Sbjct  142  FCRAAV  147



>ref|XP_010932806.1| PREDICTED: RING-H2 finger protein ATL22-like [Elaeis guineensis]
Length=163

 Score = 68.6 bits (166),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  221  CAICLDHFKVGETLMQLPCSHRFHSRCLLPWLDTNAHCPCCRMGILS  81
            CA+CL+ F   +++M+LPCSH++HS CLLPWL  ++HCPCCR  + S
Sbjct  114  CAVCLEDFGSKQSVMRLPCSHKYHSDCLLPWLAAHSHCPCCRTLVPS  160



>ref|XP_004146704.1| PREDICTED: uncharacterized protein LOC101215379 [Cucumis sativus]
 ref|XP_004162453.1| PREDICTED: uncharacterized protein LOC101226302 [Cucumis sativus]
 gb|KGN65212.1| hypothetical protein Csa_1G265120 [Cucumis sativus]
Length=130

 Score = 67.8 bits (164),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 61/146 (42%), Positives = 80/146 (55%), Gaps = 23/146 (16%)
 Frame = -2

Query  644  MAGMLPGVECARRRRFHQSGGLSDsttstttssstrrsSFCLYTSNHDSHLsssssssSM  465
            MAG LPGVECARRRR HQ+   SD +        TRRS  CLYTSN+++ L    S+ SM
Sbjct  1    MAGTLPGVECARRRRCHQNSIWSD-SPLIAAQVLTRRSVLCLYTSNNEALL---FSNPSM  56

Query  464  QRSTIGKAYQDEKLGAAAREAKERLDERLKSGHCKSDHKRNCRKTAAEKGGMVMGDVQML  285
            +R  + +A  +++L   AREAK RLDERL     KS+   N R              +M+
Sbjct  57   ERRLLMEAEGEDELDGIAREAKRRLDERLLRTQRKSED--NGR--------------EMM  100

Query  284  KSKAMKWAKKLGWKASEEEEECAICL  207
            + K   W +KL W    EE++C  CL
Sbjct  101  RRK-FSW-RKLNWIGV-EEDKCGQCL  123



>emb|CDY61552.1| BnaA05g35870D [Brassica napus]
Length=239

 Score = 69.3 bits (168),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 46/133 (35%), Positives = 67/133 (50%), Gaps = 19/133 (14%)
 Frame = -2

Query  431  EKLGAAAREAKERLDERLKSGHCKSDHKRNCRKTAAE--KGGMVMGD---VQM-------  288
            E+L  A   A+ERL ERL+ G   S + R  R + +E  +     G+   +Q+       
Sbjct  104  ERLPGAVLLARERLFERLR-GVSLSSNSRTNRVSLSENQRESSFYGEPEGIQVSYECNKK  162

Query  287  ---LKSKAMKWAKKLGWKASE---EEEECAICLDHFKVGETLMQLPCSHRFHSRCLLPWL  126
               L   A+    +L + ++E   E  +C+ICL+ F  G+ L+ LPC+H FHS CL PWL
Sbjct  163  PLGLTQGAINGLHRLTFSSAEVKTERSDCSICLESFTNGDMLISLPCTHSFHSSCLNPWL  222

Query  125  DTNAHCPCCRMGI  87
                 CP CR  I
Sbjct  223  KACGDCPYCRRAI  235



>ref|XP_008443905.1| PREDICTED: uncharacterized protein LOC103487385 isoform X2 [Cucumis 
melo]
Length=122

 Score = 67.0 bits (162),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 51/97 (53%), Positives = 60/97 (62%), Gaps = 5/97 (5%)
 Frame = -2

Query  644  MAGMLPGVECARRRRFHQSGGLSDsttstttssstrrsSFCLYTSNHDSHLsssssssSM  465
            MAGMLPGVECARRRR HQ+   SD +        TRRS  CLYTSNH++ L    S+ SM
Sbjct  1    MAGMLPGVECARRRRCHQNKIWSD-SPQVDAQVLTRRSVLCLYTSNHEALL---VSNPSM  56

Query  464  QRSTIGKAYQDEKLGAAAREAKERLDERLKSGHCKSD  354
            +R  +    +DE L   AREAK RLDERL     KS+
Sbjct  57   RRLLMEAGGEDE-LDGIAREAKRRLDERLWRTQRKSE  92



>ref|XP_010534845.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Tarenaya hassleriana]
 ref|XP_010534846.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Tarenaya hassleriana]
Length=351

 Score = 70.1 bits (170),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 39/56 (70%), Gaps = 0/56 (0%)
 Frame = -2

Query  263  AKKLGWKASEEEEECAICLDHFKVGETLMQLPCSHRFHSRCLLPWLDTNAHCPCCR  96
             K L W   EE  +C++CLD F++G    ++PC HRFH++CLLPWL+ ++ CP CR
Sbjct  208  VKALPWLKIEETCQCSVCLDDFEIGTEAREMPCKHRFHNQCLLPWLELHSSCPVCR  263



>gb|EIE89746.1| hypothetical protein RO3G_14457 [Rhizopus delemar RA 99-880]
Length=131

 Score = 67.0 bits (162),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 37/60 (62%), Gaps = 0/60 (0%)
 Frame = -2

Query  260  KKLGWKASEEEEECAICLDHFKVGETLMQLPCSHRFHSRCLLPWLDTNAHCPCCRMGILS  81
            ++L  K   +E +CA+C D F V E ++QLPC H FH  C+ PWL  N+ CP CR  +L 
Sbjct  55   RELTEKEKSQEADCAVCKDAFDVTEKVIQLPCEHIFHDDCIKPWLKLNSTCPVCRKSVLP  114



>ref|XP_002988817.1| hypothetical protein SELMODRAFT_447476 [Selaginella moellendorffii]
 gb|EFJ10079.1| hypothetical protein SELMODRAFT_447476 [Selaginella moellendorffii]
Length=406

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 41/120 (34%), Positives = 61/120 (51%), Gaps = 17/120 (14%)
 Frame = -2

Query  437  QDEKLGAAAREAKERLDERLKSGHCK-SDHKRNCRKTAAE-KGGMVMGDVQMLKSKAMKW  264
            +DE    AA EA+ERL+ RL++   + + H  N   T    K     G  Q+L  K    
Sbjct  302  RDEASRTAANEARERLEARLRAPELRITRHGSNTVPTPTPTKKKFGSGKHQILSHK----  357

Query  263  AKKLGWKASEEEEECAICLDHFKVGETLMQLPCSHRFHSRCLLPWLDTNAHCPCCRMGIL  84
                     +E  +C ICL+  ++G T + LPC H FH  C+ PW++ + HCPCCR  ++
Sbjct  358  ---------DERPDCPICLE--EIGRTSLLLPCRHGFHKECIEPWIERSNHCPCCRASVV  406



>emb|CDY16531.1| BnaA08g02360D [Brassica napus]
Length=224

 Score = 68.2 bits (165),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 38/134 (28%), Positives = 63/134 (47%), Gaps = 8/134 (6%)
 Frame = -2

Query  464  QRSTIGKAYQDEKLGAAAREAKERLDERLKSGHCKSDHKRNCRKTAAEKGGMVMG-----  300
            + +++G     E+L  +   A+ RL +RL+     ++       +     G+ +      
Sbjct  89   ESNSLGNLNGSERLPGSVLLARARLVQRLRGVSLTTNRSVQMESSFHSTDGVQVSYECNK  148

Query  299  DVQMLKSKAMKWAKKLGWKAS---EEEEECAICLDHFKVGETLMQLPCSHRFHSRCLLPW  129
                L   A+    +L + ++    E  +C+ICL+ F  G+ L+ LPC+H FHS CL PW
Sbjct  149  KPHGLTQGAINGLHRLTFSSAGVETERRDCSICLESFTNGDMLISLPCTHSFHSSCLNPW  208

Query  128  LDTNAHCPCCRMGI  87
            L     CPCCR  I
Sbjct  209  LIACGDCPCCRRAI  222



>ref|XP_001771508.1| predicted protein [Physcomitrella patens]
 gb|EDQ63708.1| predicted protein, partial [Physcomitrella patens]
Length=78

 Score = 65.1 bits (157),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 28/76 (37%), Positives = 44/76 (58%), Gaps = 2/76 (3%)
 Frame = -2

Query  314  GMVMGDVQMLKSKAMKWAKKLGWKASEEEEECAICLDHFKVGETLMQLPCSHRFHSRCLL  135
            GM    +  +K +   +  K    +  ++E+C++CLD F  G+ L+ LPC+H+FH  CL 
Sbjct  5    GMSKDAIDAIKRET--YGSKKASHSDLDQEDCSVCLDKFITGQKLLALPCNHKFHPNCLT  62

Query  134  PWLDTNAHCPCCRMGI  87
            PWL+ +  CP CR  I
Sbjct  63   PWLEGHEQCPYCRARI  78



>ref|XP_009395681.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Musa acuminata 
subsp. malaccensis]
Length=172

 Score = 67.0 bits (162),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 36/48 (75%), Gaps = 0/48 (0%)
 Frame = -2

Query  221  CAICLDHFKVGETLMQLPCSHRFHSRCLLPWLDTNAHCPCCRMGILSS  78
            CA+CLD  +  + + +LPCSH++H+ C+LPWL  ++HCPCCR  + SS
Sbjct  121  CAVCLDEVQAKQRVTRLPCSHKYHTECVLPWLAAHSHCPCCRSQVPSS  168



>ref|XP_002640470.1| Hypothetical protein CBG13603 [Caenorhabditis briggsae]
Length=502

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 43/69 (62%), Gaps = 3/69 (4%)
 Frame = -2

Query  281  SKAMKWAKKLGWKASEEEEECAICLDHFKVGETLMQLPCSHRFHSRCLLPWLDTNAHCPC  102
            +   K+AKK G    EE++ C +CL++F+ GE++ +LPC+H FH  C+  WLD N  CP 
Sbjct  420  TNETKYAKKEG---EEEDDTCTVCLNNFEAGESIRKLPCNHLFHPECIYKWLDINKKCPM  476

Query  101  CRMGILSSP  75
            CR  I   P
Sbjct  477  CREEIDRKP  485



>emb|CAP32377.2| Protein CBR-TOE-4 [Caenorhabditis briggsae]
Length=540

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 43/69 (62%), Gaps = 3/69 (4%)
 Frame = -2

Query  281  SKAMKWAKKLGWKASEEEEECAICLDHFKVGETLMQLPCSHRFHSRCLLPWLDTNAHCPC  102
            +   K+AKK G    EE++ C +CL++F+ GE++ +LPC+H FH  C+  WLD N  CP 
Sbjct  458  TNETKYAKKEG---EEEDDTCTVCLNNFEAGESIRKLPCNHLFHPECIYKWLDINKKCPM  514

Query  101  CRMGILSSP  75
            CR  I   P
Sbjct  515  CREEIDRKP  523



>gb|ACU20614.1| unknown [Glycine max]
Length=188

 Score = 67.0 bits (162),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = -2

Query  233  EEEECAICLDHFKVGETLMQLPCSHRFHSRCLLPWLDTNAHCPCCRM  93
            E  +C++CLD F+VG    ++PC HRFHS C+LPWL+ ++ CP CR+
Sbjct  77   ENSQCSVCLDDFEVGSEAKEMPCKHRFHSGCILPWLELHSSCPVCRL  123



>ref|XP_006338779.1| PREDICTED: E3 ubiquitin-protein ligase RNF126-like [Solanum tuberosum]
Length=149

 Score = 66.2 bits (160),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = -2

Query  245  KASEEEEECAICLDHFKVGETLMQLPCSHRFHSRCLLPWLDTNAHCPCCR  96
            K  EEE ECAICL  F+VGE   ++PC HR+HS C+  WL+ +  CP CR
Sbjct  40   KIIEEESECAICLSEFQVGEKAKEMPCKHRYHSNCINQWLEIHGSCPVCR  89



>gb|KFK35098.1| hypothetical protein AALP_AA5G235100 [Arabis alpina]
Length=266

 Score = 67.8 bits (164),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 34/52 (65%), Gaps = 0/52 (0%)
 Frame = -2

Query  239  SEEEEECAICLDHFKVGETLMQLPCSHRFHSRCLLPWLDTNAHCPCCRMGIL  84
            +E+E+ C +CL+ F+  ET+M  PC H FH  C+LPWL T   CP CR  IL
Sbjct  167  NEDEKRCTVCLEDFEPKETVMLTPCKHMFHEECILPWLKTKGQCPVCRFIIL  218



>ref|XP_011030369.1| PREDICTED: uncharacterized protein LOC105129834 [Populus euphratica]
Length=283

 Score = 67.8 bits (164),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 47/80 (59%), Gaps = 1/80 (1%)
 Frame = -2

Query  314  GMVMGDVQMLKSKAMK-WAKKLGWKASEEEEECAICLDHFKVGETLMQLPCSHRFHSRCL  138
            G+    +Q L+S+      K +   +S+   +C+ICL+ F  G+ L++LPC HRFHS CL
Sbjct  202  GLTQDALQCLQSEVFSCLGKGIEGGSSQVSPDCSICLESFSEGDELIRLPCDHRFHSACL  261

Query  137  LPWLDTNAHCPCCRMGILSS  78
             PW+ T   CP CR  I+ S
Sbjct  262  DPWVRTCGDCPYCRRDIVLS  281



>ref|XP_006369739.1| hypothetical protein POPTR_0001s30420g [Populus trichocarpa]
 gb|ERP66308.1| hypothetical protein POPTR_0001s30420g [Populus trichocarpa]
Length=283

 Score = 67.4 bits (163),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 46/80 (58%), Gaps = 1/80 (1%)
 Frame = -2

Query  314  GMVMGDVQMLKSKAMK-WAKKLGWKASEEEEECAICLDHFKVGETLMQLPCSHRFHSRCL  138
            G+    +Q L+S+      K +   +S    +C+ICL+ F  G+ L++LPC HRFHS CL
Sbjct  202  GLTQDALQCLQSEVFSCLGKGIEGGSSPVSRDCSICLESFSEGDELIRLPCDHRFHSACL  261

Query  137  LPWLDTNAHCPCCRMGILSS  78
             PW+ T   CP CR  I+ S
Sbjct  262  DPWVRTCGDCPYCRRDIVVS  281



>ref|XP_002527484.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF34882.1| conserved hypothetical protein [Ricinus communis]
Length=282

 Score = 67.4 bits (163),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 47/80 (59%), Gaps = 1/80 (1%)
 Frame = -2

Query  314  GMVMGDVQMLKSKAMK-WAKKLGWKASEEEEECAICLDHFKVGETLMQLPCSHRFHSRCL  138
            G+   D++ L+ +    W K +    S+   +C+ICL+ FK G+ L+ LPC+HRFHS CL
Sbjct  199  GLTPEDLECLQLEIFSSWEKGVEGIVSQASWDCSICLESFKDGDKLICLPCNHRFHSSCL  258

Query  137  LPWLDTNAHCPCCRMGILSS  78
             PW+ T   CP CR  I  S
Sbjct  259  DPWVRTCGDCPYCRRDIAVS  278



>ref|XP_007215930.1| hypothetical protein PRUPE_ppa011057mg [Prunus persica]
 gb|EMJ17129.1| hypothetical protein PRUPE_ppa011057mg [Prunus persica]
Length=225

 Score = 66.2 bits (160),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 36/115 (31%), Positives = 57/115 (50%), Gaps = 13/115 (11%)
 Frame = -2

Query  416  AAREAKERLDERLKSGHCKSDHKRNCRKTAAEKGGMVMGDVQMLKSKAMKWAKKLGWKAS  237
            AA  ++  LD RL +    ++ KR  +K   E    +    + L  K   + +     A+
Sbjct  117  AAAPSRLELDSRLSN----TEQKRALQKLKKE----IYKPFRRLSQKVNLYYRDTVVNAN  168

Query  236  EEEEE-----CAICLDHFKVGETLMQLPCSHRFHSRCLLPWLDTNAHCPCCRMGI  87
            E E +     CA+CL+ F+  + +M  PC H FH  C++PW+ +N HCP CR  I
Sbjct  169  EMENDENSKRCAVCLEDFEPRQEVMLTPCRHMFHEECIVPWVKSNGHCPVCRFAI  223



>gb|ADE77028.1| unknown [Picea sitchensis]
Length=234

 Score = 66.2 bits (160),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 25/49 (51%), Positives = 35/49 (71%), Gaps = 0/49 (0%)
 Frame = -2

Query  221  CAICLDHFKVGETLMQLPCSHRFHSRCLLPWLDTNAHCPCCRMGILSSP  75
            C ICLD F+  + L++LPC+HRFHS CL+PW+ ++A CP CR  +   P
Sbjct  146  CPICLDEFEAKQQLLRLPCNHRFHSDCLMPWIKSHALCPICRFDLSGRP  194



>ref|XP_003609511.1| hypothetical protein MTR_4g116480 [Medicago truncatula]
 gb|ACJ86079.1| unknown [Medicago truncatula]
 gb|AES91708.1| E3 ubiquitin-protein ligase RING1-like protein, putative [Medicago 
truncatula]
 gb|AFK40841.1| unknown [Medicago truncatula]
Length=96

 Score = 63.5 bits (153),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 44/97 (45%), Positives = 55/97 (57%), Gaps = 14/97 (14%)
 Frame = -2

Query  635  MLPGVECARRRRFHQSGGLSDsttstttssstrrsSFCLYTSNHDSHLsssssssSMQRS  456
            MLPGVECARRRR ++S   SDST  +          FCLYT N  S  SS +S     + 
Sbjct  1    MLPGVECARRRRLYKSKVESDSTKRS----------FCLYTRNLKSTTSSPTSFLRQNQY  50

Query  455  TIGKAYQDEKLGAAAREAKERLDERLKSGHCKSDHKR  345
                +Y DEKLG +AREAK RLDE+  +     ++KR
Sbjct  51   ----SYPDEKLGGSAREAKRRLDEKFTASMKSENYKR  83



>ref|XP_002961734.1| hypothetical protein SELMODRAFT_69832, partial [Selaginella moellendorffii]
 gb|EFJ36994.1| hypothetical protein SELMODRAFT_69832, partial [Selaginella moellendorffii]
Length=82

 Score = 63.2 bits (152),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 25/52 (48%), Positives = 35/52 (67%), Gaps = 0/52 (0%)
 Frame = -2

Query  242  ASEEEEECAICLDHFKVGETLMQLPCSHRFHSRCLLPWLDTNAHCPCCRMGI  87
              EE+ +C++CL+ F  G+TL+ LPC H+FH  CL PWL+ +  CP CR  I
Sbjct  31   PQEEQVDCSVCLEQFLAGQTLLCLPCKHKFHPACLTPWLEQHEQCPYCRARI  82



>gb|EMT02218.1| RING finger protein 126 [Aegilops tauschii]
Length=202

 Score = 65.5 bits (158),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 40/62 (65%), Gaps = 0/62 (0%)
 Frame = -2

Query  278  KAMKWAKKLGWKASEEEEECAICLDHFKVGETLMQLPCSHRFHSRCLLPWLDTNAHCPCC  99
            +A+   + +G    E+   CA+CL+ +  GE   +LPC HRFHS+C++PWL+ ++ CP C
Sbjct  38   EALPTVEVVGGCNEEDAASCAVCLEDYACGERARELPCRHRFHSQCIVPWLEMHSSCPVC  97

Query  98   RM  93
            R 
Sbjct  98   RF  99



>gb|KHN24008.1| E3 ubiquitin-protein ligase RING1 [Glycine soja]
Length=344

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 24/49 (49%), Positives = 36/49 (73%), Gaps = 0/49 (0%)
 Frame = -2

Query  233  EEEECAICLDHFKVGETLMQLPCSHRFHSRCLLPWLDTNAHCPCCRMGI  87
            E  +C++CLD F+VG    ++PC HRFHS C+LPWL+ ++ CP CR+ +
Sbjct  233  ENSQCSVCLDDFEVGSEAKEMPCKHRFHSGCILPWLELHSSCPVCRLQL  281



>ref|XP_002156770.2| PREDICTED: RING finger protein 150-like [Hydra vulgaris]
Length=362

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 44/69 (64%), Gaps = 2/69 (3%)
 Frame = -2

Query  278  KAMKWAKKLGWKAS--EEEEECAICLDHFKVGETLMQLPCSHRFHSRCLLPWLDTNAHCP  105
            KA+   K L + A+  EE++ CA+CL+ +K GETL +LPC H FH  C+ PWL  +  CP
Sbjct  221  KAISKLKTLPFSAATHEEDDTCAVCLESYKDGETLRELPCIHLFHKSCIDPWLLYHRTCP  280

Query  104  CCRMGILSS  78
             C+  IL S
Sbjct  281  MCKSNILKS  289



>ref|XP_007155113.1| hypothetical protein PHAVU_003G174500g [Phaseolus vulgaris]
 gb|ESW27107.1| hypothetical protein PHAVU_003G174500g [Phaseolus vulgaris]
Length=107

 Score = 63.5 bits (153),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 47/99 (47%), Positives = 65/99 (66%), Gaps = 11/99 (11%)
 Frame = -2

Query  644  MAGMLPGVECARRRRFHQSGGLSDsttstttssstrrsSFCLYTSNHDSHLsssssssSM  465
            M+GMLPGVECARRRR H S          ++  S+ RSS CLYT+ +    +SSSSSS +
Sbjct  1    MSGMLPGVECARRRRLHNS----------SSRDSSTRSSLCLYTARNLQSPASSSSSSLL  50

Query  464  QRSTIGKAYQDEKLGAAAREAKERLDERLKSGHCKSDHK  348
            +R+T+ +A  DE LG AA EAK RLDE+  + H  ++++
Sbjct  51   ERNTVNQANPDENLGGAALEAKRRLDEKFAT-HLAAENR  88



>gb|AAC69859.1| RING-H2 finger protein RHY1a, partial [Arabidopsis thaliana]
Length=101

 Score = 63.2 bits (152),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 30/72 (42%), Positives = 41/72 (57%), Gaps = 3/72 (4%)
 Frame = -2

Query  293  QMLKSKAMKWAKKLGWKASE---EEEECAICLDHFKVGETLMQLPCSHRFHSRCLLPWLD  123
            Q L   A+    +  + ++E   E  +C+ICL+ F  G+ L+ LPC+H FHS CL PWL 
Sbjct  27   QGLTQDAINCLHRQTFSSAEVKSEMRDCSICLESFTKGDMLISLPCTHSFHSSCLNPWLR  86

Query  122  TNAHCPCCRMGI  87
                CPCCR  I
Sbjct  87   ACGDCPCCRRAI  98



>ref|NP_001190129.1| RING/U-box domain-containing protein [Arabidopsis thaliana]
 gb|AEE79823.1| RING/U-box domain-containing protein [Arabidopsis thaliana]
Length=266

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 34/51 (67%), Gaps = 0/51 (0%)
 Frame = -2

Query  236  EEEEECAICLDHFKVGETLMQLPCSHRFHSRCLLPWLDTNAHCPCCRMGIL  84
            E+++ C++CL+ F+  ET+M  PC H FH  C++PWL T   CP CR  IL
Sbjct  167  EDDKRCSVCLEDFEPKETVMLTPCKHMFHEECIVPWLKTKGQCPVCRFVIL  217



>ref|XP_001770862.1| predicted protein [Physcomitrella patens]
 gb|EDQ64386.1| predicted protein, partial [Physcomitrella patens]
Length=56

 Score = 62.0 bits (149),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 24/49 (49%), Positives = 35/49 (71%), Gaps = 0/49 (0%)
 Frame = -2

Query  233  EEEECAICLDHFKVGETLMQLPCSHRFHSRCLLPWLDTNAHCPCCRMGI  87
            ++E+C +CL+ F  G+ L+ LPC+HRFH  CL+PWL+ +  CP CR  I
Sbjct  1    DQEDCPVCLEKFLAGQGLLALPCNHRFHPNCLIPWLEGHEQCPYCRARI  49



>gb|KFK35972.1| hypothetical protein AALP_AA4G061800 [Arabis alpina]
Length=251

 Score = 65.5 bits (158),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/76 (38%), Positives = 39/76 (51%), Gaps = 5/76 (7%)
 Frame = -2

Query  314  GMVMGDVQMLKSKAMKWAKKLGWKASEEEEECAICLDHFKVGETLMQLPCSHRFHSRCLL  135
            G+  GD+  L  +              E  +C+ICL+ F  G+ L+ LPC+H FHS CL+
Sbjct  177  GLTQGDISCLDRQTFSEVD-----VKTEMRDCSICLESFTKGDILITLPCTHSFHSSCLV  231

Query  134  PWLDTNAHCPCCRMGI  87
            PWL     CP CR  I
Sbjct  232  PWLRACGDCPYCRRAI  247



>ref|XP_010516527.1| PREDICTED: RING finger protein 165-like isoform X1 [Camelina 
sativa]
Length=267

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 34/51 (67%), Gaps = 0/51 (0%)
 Frame = -2

Query  236  EEEEECAICLDHFKVGETLMQLPCSHRFHSRCLLPWLDTNAHCPCCRMGIL  84
            EE++ C++CL+ F+  ET+M  PC H FH  C++PWL +   CP CR  IL
Sbjct  169  EEDKRCSVCLEDFEPKETVMLTPCKHMFHEECIVPWLKSKGQCPVCRFVIL  219



>ref|XP_006392629.1| hypothetical protein EUTSA_v10012351mg, partial [Eutrema salsugineum]
 gb|ESQ29915.1| hypothetical protein EUTSA_v10012351mg, partial [Eutrema salsugineum]
Length=389

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = -2

Query  236  EEEEECAICLDHFKVGETLMQLPCSHRFHSRCLLPWLDTNAHCPCCR  96
            EE  +C++CLD F +G    Q+PC H+FH  CLLPWL+ ++ CP CR
Sbjct  279  EETLQCSVCLDDFDIGTEAKQMPCEHKFHGECLLPWLELHSSCPVCR  325



>ref|XP_006393209.1| hypothetical protein EUTSA_v10011738mg [Eutrema salsugineum]
 gb|ESQ30495.1| hypothetical protein EUTSA_v10011738mg [Eutrema salsugineum]
Length=247

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 40/76 (53%), Gaps = 5/76 (7%)
 Frame = -2

Query  314  GMVMGDVQMLKSKAMKWAKKLGWKASEEEEECAICLDHFKVGETLMQLPCSHRFHSRCLL  135
            G+  G +  L  +    A+      + E  +C+ICL+ F  G+ L+ LPCSH FHS CL 
Sbjct  175  GLTQGAINCLHRQTYSSAE-----VNNERRDCSICLESFAKGDILISLPCSHSFHSSCLN  229

Query  134  PWLDTNAHCPCCRMGI  87
            PWL     CP CR  I
Sbjct  230  PWLKACGDCPYCRRAI  245



>ref|XP_005810331.1| PREDICTED: E3 ubiquitin-protein ligase RNF115-like [Xiphophorus 
maculatus]
Length=314

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 25/46 (54%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = -2

Query  224  ECAICLDHFKVGETLMQLPCSHRFHSRCLLPWLDTNAHCPCCRMGI  87
            EC +C + F VGE + QLPC+H FHS C++PWL+ +  CP CRMG+
Sbjct  242  ECPVCKEDFAVGEPVRQLPCNHFFHSECIVPWLEMHDTCPVCRMGL  287



>ref|XP_010504828.1| PREDICTED: E3 ubiquitin-protein ligase ATL4-like isoform X1 [Camelina 
sativa]
Length=269

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 34/51 (67%), Gaps = 0/51 (0%)
 Frame = -2

Query  236  EEEEECAICLDHFKVGETLMQLPCSHRFHSRCLLPWLDTNAHCPCCRMGIL  84
            EE++ C++CL+ F+  ET+M  PC H FH  C++PWL +   CP CR  IL
Sbjct  171  EEDKRCSVCLEDFEPKETVMLTPCKHMFHEECIVPWLKSKGQCPVCRFVIL  221



>ref|XP_010427777.1| PREDICTED: RING-H2 finger protein ATL5-like isoform X1 [Camelina 
sativa]
Length=267

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 34/51 (67%), Gaps = 0/51 (0%)
 Frame = -2

Query  236  EEEEECAICLDHFKVGETLMQLPCSHRFHSRCLLPWLDTNAHCPCCRMGIL  84
            EE++ C++CL+ F+  ET+M  PC H FH  C++PWL +   CP CR  IL
Sbjct  169  EEDKRCSVCLEDFEPKETVMLTPCKHMFHEECIVPWLKSKGQCPVCRFVIL  219



>ref|XP_009136274.1| PREDICTED: uncharacterized protein LOC103860423 [Brassica rapa]
Length=109

 Score = 62.8 bits (151),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 44/95 (46%), Positives = 57/95 (60%), Gaps = 13/95 (14%)
 Frame = -2

Query  644  MAGMLPGVECARRRRFHQSGGLSDsttstttssstrrs-----SFCLYTSNHDSHLssss  480
            MAGMLPGV CARRRRFH      D + + + +++T +      SF LYT+N+D    S S
Sbjct  1    MAGMLPGVACARRRRFHGGAPPIDLSNTASVAAATGQVWTRRPSFSLYTTNNDQAYVSFS  60

Query  479  sssSMQRSTIGKAY---QDEKLGAAAREAKERLDE  384
                 +R+   K+Y    DEKL  AA+EAKERLDE
Sbjct  61   -----ERNVRNKSYSDDNDEKLVGAAKEAKERLDE  90



>ref|XP_004502170.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like isoform X1 
[Cicer arietinum]
 ref|XP_004502171.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like isoform X2 
[Cicer arietinum]
Length=367

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = -2

Query  233  EEEECAICLDHFKVGETLMQLPCSHRFHSRCLLPWLDTNAHCPCCRM  93
            E  +C++CLD F+VG    ++PC HRFHS C+LPWL+ ++ CP CR 
Sbjct  241  ENLQCSVCLDDFEVGSEAKEMPCKHRFHSACILPWLELHSSCPVCRF  287



>ref|XP_010538621.1| PREDICTED: E3 ubiquitin-protein ligase RLIM [Tarenaya hassleriana]
Length=245

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/67 (42%), Positives = 41/67 (61%), Gaps = 0/67 (0%)
 Frame = -2

Query  287  LKSKAMKWAKKLGWKASEEEEECAICLDHFKVGETLMQLPCSHRFHSRCLLPWLDTNAHC  108
            L   A+    +  + +SE + +C+ICL+ F+ G+ L+ L CSH FHS CL+PWL T   C
Sbjct  179  LTRDAINGLHRREFISSEVKTDCSICLESFRDGDVLISLLCSHSFHSSCLVPWLRTCGEC  238

Query  107  PCCRMGI  87
            P CR  +
Sbjct  239  PYCRRAV  245



>dbj|BAJ91076.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=377

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 40/62 (65%), Gaps = 0/62 (0%)
 Frame = -2

Query  278  KAMKWAKKLGWKASEEEEECAICLDHFKVGETLMQLPCSHRFHSRCLLPWLDTNAHCPCC  99
            +A+   + +G    E+   CA+CL+ +  GE   +LPC HRFHS+C++PWL+ ++ CP C
Sbjct  205  EALPTVEVVGCGNEEDAASCAVCLEDYASGERARELPCRHRFHSQCIVPWLEMHSSCPVC  264

Query  98   RM  93
            R 
Sbjct  265  RF  266



>ref|XP_002878235.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH54494.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
Length=237

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 34/51 (67%), Gaps = 0/51 (0%)
 Frame = -2

Query  236  EEEEECAICLDHFKVGETLMQLPCSHRFHSRCLLPWLDTNAHCPCCRMGIL  84
            E+++ C++CL+ F+  ET+M  PC H FH  C++PWL T   CP CR  IL
Sbjct  139  EDDKRCSVCLEDFEPKETVMLTPCKHMFHEECIIPWLKTKGQCPVCRFVIL  189



>ref|XP_002525456.1| zinc finger protein, putative [Ricinus communis]
 gb|EEF36946.1| zinc finger protein, putative [Ricinus communis]
Length=348

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 39/59 (66%), Gaps = 0/59 (0%)
 Frame = -2

Query  269  KWAKKLGWKASEEEEECAICLDHFKVGETLMQLPCSHRFHSRCLLPWLDTNAHCPCCRM  93
            K  K +   A E+  EC++CL+ F++G    ++PC H+FHS C+LPWL+ ++ CP CR 
Sbjct  206  KAVKAMPTIAVEQNAECSVCLEEFEIGGEAKEMPCKHKFHSACILPWLELHSSCPVCRF  264



>ref|XP_009104168.1| PREDICTED: RING-H2 finger protein ATL52-like [Brassica rapa]
Length=261

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 37/58 (64%), Gaps = 1/58 (2%)
 Frame = -2

Query  251  GWKASEEEEE-CAICLDHFKVGETLMQLPCSHRFHSRCLLPWLDTNAHCPCCRMGILS  81
            G+   E++E+ C +CL+ F+  ET+M  PC H FH  C++PWL +   CP CR  IL+
Sbjct  157  GYSGEEDDEKRCTVCLEDFEPKETVMVTPCKHMFHEECIVPWLKSKGQCPLCRFVILN  214



>ref|NP_191431.1| RING/U-box domain-containing protein [Arabidopsis thaliana]
 emb|CAB88289.1| putative protein [Arabidopsis thaliana]
 gb|AEE79822.1| RING/U-box domain-containing protein [Arabidopsis thaliana]
Length=238

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 34/51 (67%), Gaps = 0/51 (0%)
 Frame = -2

Query  236  EEEEECAICLDHFKVGETLMQLPCSHRFHSRCLLPWLDTNAHCPCCRMGIL  84
            E+++ C++CL+ F+  ET+M  PC H FH  C++PWL T   CP CR  IL
Sbjct  139  EDDKRCSVCLEDFEPKETVMLTPCKHMFHEECIVPWLKTKGQCPVCRFVIL  189



>ref|XP_006407223.1| hypothetical protein EUTSA_v10021230mg [Eutrema salsugineum]
 gb|ESQ48676.1| hypothetical protein EUTSA_v10021230mg [Eutrema salsugineum]
Length=299

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = -2

Query  245  KASEEEEECAICLDHFKVGETLMQLPCSHRFHSRCLLPWLDTNAHCPCCR  96
            K  E   +C +CLD F++G    ++PC HRFHS CLLPWL+ ++ CP CR
Sbjct  200  KIDESLLQCTVCLDDFEIGMVAKEMPCKHRFHSDCLLPWLELHSSCPVCR  249



>emb|CDX67761.1| BnaA07g18010D [Brassica napus]
Length=261

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 37/58 (64%), Gaps = 1/58 (2%)
 Frame = -2

Query  251  GWKASEEEEE-CAICLDHFKVGETLMQLPCSHRFHSRCLLPWLDTNAHCPCCRMGILS  81
            G+   E++E+ C +CL+ F+  ET+M  PC H FH  C++PWL +   CP CR  IL+
Sbjct  157  GYSGEEDDEKRCTVCLEDFEPKETVMVTPCKHMFHEECIVPWLKSKGQCPLCRFVILN  214



>gb|EMS59452.1| E3 ubiquitin-protein ligase RING1-like protein [Triticum urartu]
Length=258

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 40/62 (65%), Gaps = 0/62 (0%)
 Frame = -2

Query  278  KAMKWAKKLGWKASEEEEECAICLDHFKVGETLMQLPCSHRFHSRCLLPWLDTNAHCPCC  99
            +A+   + +G    E+   CA+CL+ +  GE   +LPC HRFHS+C++PWL+ ++ CP C
Sbjct  92   EALPTVEVVGGCNEEDAASCAVCLEDYASGERARELPCRHRFHSQCIVPWLEMHSSCPVC  151

Query  98   RM  93
            R 
Sbjct  152  RF  153



>ref|XP_006489448.1| PREDICTED: RING-H2 finger protein ATL45-like [Citrus sinensis]
Length=203

 Score = 64.3 bits (155),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 53/192 (28%), Positives = 88/192 (46%), Gaps = 34/192 (18%)
 Frame = -2

Query  647  DMAGMLPGVECARRRRFHQSGGLSDsttstttssstrrsSFCLYTSNH--DSHLssssss  474
            +MAGMLPGV   +RR+                          + +  H  DS  S     
Sbjct  40   NMAGMLPGVGVPQRRK--------------------------IISKQHRQDSPCSRCEIP  73

Query  473  sSMQRSTIGKAYQDEKLGAAAREAKERLDERLKSGHCKSDHKRNCRKTAAEKGGMVMGDV  294
             +  R  +     D  L   A  A++RL+++L S H +S      +  ++ K GM    +
Sbjct  74   LTELREPLATCISD--LDENALRARQRLEQKLASLHPRSRPGEVPQNKSSGKEGMKDTRL  131

Query  293  --QMLKSKAMKWAKKLGWKASEEEEECAICLDHFKVGETLMQLPCSHRFHSRCLLPWLDT  120
              ++L    ++  K  G K++ +   C++CL+ F+  + + +LPCSH++HS C+LPWL  
Sbjct  132  GSKLLWGSHLRHLKLRGSKSNTKI--CSVCLEEFQEEQPVTRLPCSHKYHSDCVLPWLAA  189

Query  119  NAHCPCCRMGIL  84
            +  CP CR   L
Sbjct  190  HPQCPYCRRPAL  201



>gb|KDQ14563.1| hypothetical protein BOTBODRAFT_32695 [Botryobasidium botryosum 
FD-172 SS1]
Length=363

 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 36/52 (69%), Gaps = 0/52 (0%)
 Frame = -2

Query  230  EEECAICLDHFKVGETLMQLPCSHRFHSRCLLPWLDTNAHCPCCRMGILSSP  75
             ++CA+C D+F+V + ++ LPC+H +H  C+LPW+ TN  CP CR  ++  P
Sbjct  261  NKQCAVCTDNFEVSQEVITLPCTHPYHDECILPWIRTNGTCPVCRHALVPQP  312



>gb|KHF98124.1| E3 ubiquitin-protein ligase RLIM [Gossypium arboreum]
Length=302

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 40/67 (60%), Gaps = 4/67 (6%)
 Frame = -2

Query  296  VQMLKSKAMKWAKKLGWKASEEEEECAICLDHFKVGETLMQLPCSHRFHSRCLLPWLDTN  117
            +++ +S+ +   +K     S E  +C+ICL+ F  G+ L QLPC HRFH  CL PWL T 
Sbjct  237  LEIFRSQDINVERK----TSRESRDCSICLESFGEGDVLTQLPCGHRFHFACLDPWLRTC  292

Query  116  AHCPCCR  96
              CP CR
Sbjct  293  GDCPYCR  299



>gb|KJB79429.1| hypothetical protein B456_013G049100 [Gossypium raimondii]
Length=302

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = -2

Query  245  KASEEEEECAICLDHFKVGETLMQLPCSHRFHSRCLLPWLDTNAHCPCCR  96
            K S E  +C+ICL+ F  G+ L QLPC HRFH  CL PWL T   CP CR
Sbjct  250  KTSRESRDCSICLESFGEGDVLTQLPCGHRFHFACLDPWLRTCGDCPYCR  299



>ref|XP_006420021.1| hypothetical protein CICLE_v10005915mg [Citrus clementina]
 gb|ESR33261.1| hypothetical protein CICLE_v10005915mg [Citrus clementina]
Length=203

 Score = 63.9 bits (154),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 53/192 (28%), Positives = 88/192 (46%), Gaps = 34/192 (18%)
 Frame = -2

Query  647  DMAGMLPGVECARRRRFHQSGGLSDsttstttssstrrsSFCLYTSNH--DSHLssssss  474
            +MAGMLPGV   +RR+                          + +  H  DS  S     
Sbjct  40   NMAGMLPGVGVPQRRK--------------------------IISKQHRQDSPCSRCEIP  73

Query  473  sSMQRSTIGKAYQDEKLGAAAREAKERLDERLKSGHCKSDHKRNCRKTAAEKGGMVMGDV  294
             +  R  +     D  L   A  A++RL+++L S H +S      +  ++ K GM    +
Sbjct  74   LTELREPLATCISD--LDENALRARQRLEQKLASLHPRSRPGEVPQNKSSGKEGMKDTRL  131

Query  293  --QMLKSKAMKWAKKLGWKASEEEEECAICLDHFKVGETLMQLPCSHRFHSRCLLPWLDT  120
              ++L    ++  K  G K++ +   C++CL+ F+  + + +LPCSH++HS C+LPWL  
Sbjct  132  GSKLLWGSHLRHLKLRGSKSNTKI--CSVCLEEFQEEQPVTRLPCSHKYHSDCVLPWLAA  189

Query  119  NAHCPCCRMGIL  84
            +  CP CR   L
Sbjct  190  HPQCPYCRRPAL  201



>ref|XP_009116555.1| PREDICTED: RING finger protein 165-like isoform X3 [Brassica 
rapa]
Length=241

 Score = 64.7 bits (156),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 38/133 (29%), Positives = 66/133 (50%), Gaps = 23/133 (17%)
 Frame = -2

Query  410  REAKERLDERLKSGHCKSDHKRNCRKTAA----EKGGMV----------MGDVQMLKSKA  273
            R+  E L + + + H  + H+ N R  AA    EK  ++          +   Q+L++ +
Sbjct  62   RQHLEALRQAVHNRHDSTRHESNSRSAAASQAKEKEDILKYLTKETYNPVPKSQLLRNLS  121

Query  272  MKWAKK---LGWKASEE------EEECAICLDHFKVGETLMQLPCSHRFHSRCLLPWLDT  120
            + +  K   LG   + +      E+ C++CL+ F+  ET+M  PC H FH  C++PWL +
Sbjct  122  LYYKNKNSGLGSSRNPQGYSGGDEKRCSVCLEDFEPKETVMLTPCKHMFHEECIVPWLKS  181

Query  119  NAHCPCCRMGILS  81
               CP CR  I++
Sbjct  182  KGQCPVCRFVIIT  194



>ref|XP_010504829.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like isoform 
X2 [Camelina sativa]
Length=241

 Score = 64.7 bits (156),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 34/51 (67%), Gaps = 0/51 (0%)
 Frame = -2

Query  236  EEEEECAICLDHFKVGETLMQLPCSHRFHSRCLLPWLDTNAHCPCCRMGIL  84
            EE++ C++CL+ F+  ET+M  PC H FH  C++PWL +   CP CR  IL
Sbjct  143  EEDKRCSVCLEDFEPKETVMLTPCKHMFHEECIVPWLKSKGQCPVCRFVIL  193



>ref|NP_564556.1| RING/U-box superfamily protein [Arabidopsis thaliana]
 gb|AAO42846.1| At1g49850 [Arabidopsis thaliana]
 dbj|BAE99918.1| RING-H2 finger protein RHY1a [Arabidopsis thaliana]
 gb|AEE32483.1| RING/U-box superfamily protein [Arabidopsis thaliana]
Length=250

 Score = 64.7 bits (156),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 30/72 (42%), Positives = 41/72 (57%), Gaps = 3/72 (4%)
 Frame = -2

Query  293  QMLKSKAMKWAKKLGWKASE---EEEECAICLDHFKVGETLMQLPCSHRFHSRCLLPWLD  123
            Q L   A+    +  + ++E   E  +C+ICL+ F  G+ L+ LPC+H FHS CL PWL 
Sbjct  176  QGLTQDAINCLHRQTFSSAEVKSEMRDCSICLESFTKGDMLISLPCTHSFHSSCLNPWLR  235

Query  122  TNAHCPCCRMGI  87
                CPCCR  I
Sbjct  236  ACGDCPCCRRAI  247



>ref|XP_009107257.1| PREDICTED: RING-H2 finger protein ATL72 [Brassica rapa]
 ref|XP_009107258.1| PREDICTED: RING-H2 finger protein ATL72 [Brassica rapa]
 ref|XP_009107259.1| PREDICTED: RING-H2 finger protein ATL72 [Brassica rapa]
 ref|XP_009107260.1| PREDICTED: RING-H2 finger protein ATL72 [Brassica rapa]
 ref|XP_009107261.1| PREDICTED: RING-H2 finger protein ATL72 [Brassica rapa]
 ref|XP_009107262.1| PREDICTED: RING-H2 finger protein ATL72 [Brassica rapa]
 ref|XP_009107263.1| PREDICTED: RING-H2 finger protein ATL72 [Brassica rapa]
 ref|XP_009107265.1| PREDICTED: RING-H2 finger protein ATL72 [Brassica rapa]
 ref|XP_009107266.1| PREDICTED: RING-H2 finger protein ATL72 [Brassica rapa]
 ref|XP_009107267.1| PREDICTED: RING-H2 finger protein ATL72 [Brassica rapa]
 ref|XP_009107268.1| PREDICTED: RING-H2 finger protein ATL72 [Brassica rapa]
 ref|XP_009107269.1| PREDICTED: RING-H2 finger protein ATL72 [Brassica rapa]
Length=221

 Score = 64.3 bits (155),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 37/134 (28%), Positives = 62/134 (46%), Gaps = 8/134 (6%)
 Frame = -2

Query  464  QRSTIGKAYQDEKLGAAAREAKERLDERLKSGHCKSDHKRNCRKTAAEKGGMVMG-----  300
            + +++G     E+L  +   A+ RL +RL+     ++       +     G+ +      
Sbjct  86   ESNSLGNLNGSERLPGSVLLARARLVQRLRGVSLTTNRSVQMESSFHSTDGVQVSYECNK  145

Query  299  DVQMLKSKAMKWAKKLGWKAS---EEEEECAICLDHFKVGETLMQLPCSHRFHSRCLLPW  129
                L   A+    +L + ++    E  +C+ICL+ F  G+ L+ LPC+H FHS CL PW
Sbjct  146  KPHGLTQGAINGLHRLTFSSAGVETERRDCSICLESFTNGDMLISLPCTHSFHSSCLNPW  205

Query  128  LDTNAHCPCCRMGI  87
            L     CP CR  I
Sbjct  206  LIACGDCPYCRRAI  219



>ref|XP_006290435.1| hypothetical protein CARUB_v10019384mg [Capsella rubella]
 gb|EOA23333.1| hypothetical protein CARUB_v10019384mg [Capsella rubella]
Length=237

 Score = 64.7 bits (156),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 34/51 (67%), Gaps = 0/51 (0%)
 Frame = -2

Query  236  EEEEECAICLDHFKVGETLMQLPCSHRFHSRCLLPWLDTNAHCPCCRMGIL  84
            EE++ C++CL+ F+  ET+M  PC H FH  C++PWL +   CP CR  IL
Sbjct  139  EEDKRCSVCLEDFEPKETVMVTPCKHMFHEECIVPWLKSKGQCPVCRFVIL  189



>gb|AAG51778.1|AC079674_11 RING-H2 finger protein RHY1a; 24780-23662 [Arabidopsis thaliana]
Length=248

 Score = 64.7 bits (156),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 30/72 (42%), Positives = 41/72 (57%), Gaps = 3/72 (4%)
 Frame = -2

Query  293  QMLKSKAMKWAKKLGWKASE---EEEECAICLDHFKVGETLMQLPCSHRFHSRCLLPWLD  123
            Q L   A+    +  + ++E   E  +C+ICL+ F  G+ L+ LPC+H FHS CL PWL 
Sbjct  174  QGLTQDAINCLHRQTFSSAEVKSEMRDCSICLESFTKGDMLISLPCTHSFHSSCLNPWLR  233

Query  122  TNAHCPCCRMGI  87
                CPCCR  I
Sbjct  234  ACGDCPCCRRAI  245



>ref|NP_564693.1| RING/U-box domain-containing protein [Arabidopsis thaliana]
 gb|AAL11572.1|AF424578_1 At1g55530/T5A14_7 [Arabidopsis thaliana]
 gb|AAD10644.1| Unknown protein [Arabidopsis thaliana]
 gb|AAK62663.1| At1g55530/T5A14_7 [Arabidopsis thaliana]
 gb|AAN18071.1| At1g55530/T5A14_7 [Arabidopsis thaliana]
 gb|AEE33259.1| RING/U-box domain-containing protein [Arabidopsis thaliana]
Length=351

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = -2

Query  236  EEEEECAICLDHFKVGETLMQLPCSHRFHSRCLLPWLDTNAHCPCCR  96
            EE  +C++CLD F++G     +PC+H+FHS CLLPWL+ ++ CP CR
Sbjct  218  EETLQCSVCLDDFEIGTEAKLMPCTHKFHSDCLLPWLELHSSCPVCR  264



>ref|NP_001239785.1| uncharacterized protein LOC100805406 [Glycine max]
 ref|XP_006590330.1| PREDICTED: uncharacterized protein LOC100805406 isoform X1 [Glycine 
max]
 gb|ACU23096.1| unknown [Glycine max]
 gb|KHN21933.1| E3 ubiquitin-protein ligase SDIR1 [Glycine soja]
Length=274

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 34/55 (62%), Gaps = 0/55 (0%)
 Frame = -2

Query  251  GWKASEEEEECAICLDHFKVGETLMQLPCSHRFHSRCLLPWLDTNAHCPCCRMGI  87
            G K SE+E  C ICLD  K GE +  LPC H+FH+ C+ PWL     CP C++ I
Sbjct  202  GAKGSEDELTCTICLDQVKRGELVRSLPCLHQFHANCIDPWLRQQGTCPVCKLRI  256



>emb|CDM82953.1| unnamed protein product [Triticum aestivum]
Length=372

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 40/62 (65%), Gaps = 0/62 (0%)
 Frame = -2

Query  278  KAMKWAKKLGWKASEEEEECAICLDHFKVGETLMQLPCSHRFHSRCLLPWLDTNAHCPCC  99
            +A+   + +G    E+   CA+CL+ +  GE   +LPC HRFHS+C++PWL+ ++ CP C
Sbjct  207  EALPTVEVVGGCNEEDAASCAVCLEDYASGERARELPCRHRFHSQCIVPWLEMHSSCPVC  266

Query  98   RM  93
            R 
Sbjct  267  RF  268



>ref|XP_010516528.1| PREDICTED: E3 ubiquitin-protein ligase ATL4-like isoform X2 [Camelina 
sativa]
Length=239

 Score = 64.3 bits (155),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 34/51 (67%), Gaps = 0/51 (0%)
 Frame = -2

Query  236  EEEEECAICLDHFKVGETLMQLPCSHRFHSRCLLPWLDTNAHCPCCRMGIL  84
            EE++ C++CL+ F+  ET+M  PC H FH  C++PWL +   CP CR  IL
Sbjct  141  EEDKRCSVCLEDFEPKETVMLTPCKHMFHEECIVPWLKSKGQCPVCRFVIL  191



>ref|XP_002964809.1| hypothetical protein SELMODRAFT_9360, partial [Selaginella moellendorffii]
 gb|EFJ33647.1| hypothetical protein SELMODRAFT_9360, partial [Selaginella moellendorffii]
Length=57

 Score = 60.8 bits (146),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 38/56 (68%), Gaps = 5/56 (9%)
 Frame = -2

Query  248  WKAS-----EEEEECAICLDHFKVGETLMQLPCSHRFHSRCLLPWLDTNAHCPCCR  96
            W++S     EE+ +C++CL+ F  G+TL+ LPC H+FH  CL PWL+ +  CP CR
Sbjct  1    WRSSSKGPEEEQVDCSVCLEQFLAGQTLLCLPCKHKFHPACLTPWLEQHEQCPYCR  56



>ref|XP_010427778.1| PREDICTED: E3 ubiquitin-protein ligase ATL4-like isoform X2 [Camelina 
sativa]
Length=239

 Score = 64.3 bits (155),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 34/51 (67%), Gaps = 0/51 (0%)
 Frame = -2

Query  236  EEEEECAICLDHFKVGETLMQLPCSHRFHSRCLLPWLDTNAHCPCCRMGIL  84
            EE++ C++CL+ F+  ET+M  PC H FH  C++PWL +   CP CR  IL
Sbjct  141  EEDKRCSVCLEDFEPKETVMLTPCKHMFHEECIVPWLKSKGQCPVCRFVIL  191



>emb|CDY20854.1| BnaC05g26380D [Brassica napus]
Length=242

 Score = 64.3 bits (155),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 43/146 (29%), Positives = 65/146 (45%), Gaps = 28/146 (19%)
 Frame = -2

Query  455  TIGKAYQD-EKLGAAAREAKERLDERLKSGHCK----------SDHKRNCRKTAAEKG--  315
            T G ++ + E+L  A   A+ERL ERL+               S+++R        +G  
Sbjct  94   TEGNSFGNLERLPGAVLLARERLFERLRGVSLSSNSRSNRVSLSENQRESSFYGEPEGIQ  153

Query  314  ----------GMVMGDVQMLKSKAMKWAKKLGWKASEEEEECAICLDHFKVGETLMQLPC  165
                      G+ +G +  L  +    A+        +  +C+ICL+ F  G+ L+ LPC
Sbjct  154  VSYECNKKPLGLTLGAINGLHRQTFSSAE-----VKTDRRDCSICLESFTNGDMLISLPC  208

Query  164  SHRFHSRCLLPWLDTNAHCPCCRMGI  87
            +H FHS CL PWL     CP CR  I
Sbjct  209  THSFHSSCLNPWLKACGDCPYCRRAI  234



>gb|AES71855.2| zinc finger, C3HC4 type (RING finger) protein [Medicago truncatula]
Length=356

 Score = 65.5 bits (158),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 24/46 (52%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = -2

Query  233  EEEECAICLDHFKVGETLMQLPCSHRFHSRCLLPWLDTNAHCPCCR  96
            E  +C++CLD F+VG    ++PC HRFHS C+LPWL+ ++ CP CR
Sbjct  233  ENLQCSVCLDDFEVGSEAKEMPCKHRFHSACILPWLELHSSCPVCR  278



>ref|XP_003601604.1| RING finger protein [Medicago truncatula]
Length=352

 Score = 65.5 bits (158),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 24/46 (52%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = -2

Query  233  EEEECAICLDHFKVGETLMQLPCSHRFHSRCLLPWLDTNAHCPCCR  96
            E  +C++CLD F+VG    ++PC HRFHS C+LPWL+ ++ CP CR
Sbjct  229  ENLQCSVCLDDFEVGSEAKEMPCKHRFHSACILPWLELHSSCPVCR  274



>ref|XP_009778983.1| PREDICTED: RING-H2 finger protein ATL79-like [Nicotiana sylvestris]
Length=151

 Score = 62.8 bits (151),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = -2

Query  236  EEEEECAICLDHFKVGETLMQLPCSHRFHSRCLLPWLDTNAHCPCCR  96
            E EEECAICL  F+VGE   ++PC HR+HS C+  WL+ +  CP CR
Sbjct  73   EHEEECAICLLEFQVGEKTKEMPCKHRYHSNCINKWLERHGSCPVCR  119



>ref|XP_009339205.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Pyrus x bretschneideri]
 ref|XP_009339206.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Pyrus x bretschneideri]
 ref|XP_009339207.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Pyrus x bretschneideri]
Length=375

 Score = 65.5 bits (158),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 24/49 (49%), Positives = 35/49 (71%), Gaps = 0/49 (0%)
 Frame = -2

Query  233  EEEECAICLDHFKVGETLMQLPCSHRFHSRCLLPWLDTNAHCPCCRMGI  87
            E  +C++CLD F+VG    ++PC H+FHS C+LPWLD ++ CP CR  +
Sbjct  238  ENMQCSVCLDDFEVGVEAKEMPCKHKFHSGCILPWLDLHSSCPVCRFQL  286



>ref|XP_009801324.1| PREDICTED: RING finger protein 165-like [Nicotiana sylvestris]
Length=195

 Score = 63.5 bits (153),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 32/67 (48%), Positives = 39/67 (58%), Gaps = 3/67 (4%)
 Frame = -2

Query  284  KSKAMKWAKKLGWKASEEE---EECAICLDHFKVGETLMQLPCSHRFHSRCLLPWLDTNA  114
            K +A    K+LG  A +EE   EEC ICLD   +GE +  +PCSH  HS CLL W   N+
Sbjct  127  KEEAAALIKELGKVAVKEEDYTEECPICLDKPSIGEEITYMPCSHFCHSHCLLMWFQKNS  186

Query  113  HCPCCRM  93
             CP CR 
Sbjct  187  SCPFCRF  193



>ref|XP_003565656.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Brachypodium 
distachyon]
Length=404

 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 24/43 (56%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = -2

Query  221  CAICLDHFKVGETLMQLPCSHRFHSRCLLPWLDTNAHCPCCRM  93
            CA+CLD +  GE   +LPC HRFHS+C+LPWL  ++ CP CR 
Sbjct  247  CAVCLDDYAPGECARELPCRHRFHSKCILPWLQMHSSCPVCRF  289



>gb|AAM64325.1| RING-H2 finger protein RHY1a [Arabidopsis thaliana]
Length=250

 Score = 64.3 bits (155),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 30/72 (42%), Positives = 41/72 (57%), Gaps = 3/72 (4%)
 Frame = -2

Query  293  QMLKSKAMKWAKKLGWKASE---EEEECAICLDHFKVGETLMQLPCSHRFHSRCLLPWLD  123
            Q L   A+    +  + ++E   E  +C+ICL+ F  G+ L+ LPC+H FHS CL PWL 
Sbjct  176  QGLTQDAINCLHRQTFSSAEVKSEMRDCSICLESFTKGDMLISLPCTHSFHSSCLNPWLR  235

Query  122  TNAHCPCCRMGI  87
                CPCCR  I
Sbjct  236  ACGDCPCCRRAI  247



>ref|XP_006446837.1| hypothetical protein CICLE_v10016257mg [Citrus clementina]
 gb|ESR60077.1| hypothetical protein CICLE_v10016257mg [Citrus clementina]
Length=248

 Score = 64.3 bits (155),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 40/66 (61%), Gaps = 0/66 (0%)
 Frame = -2

Query  284  KSKAMKWAKKLGWKASEEEEECAICLDHFKVGETLMQLPCSHRFHSRCLLPWLDTNAHCP  105
            + +A    K++  +  E+   CA+CL+ F+  E +M  PC+H FH  C++PW+ +NA CP
Sbjct  137  RDQATNVYKEMQKQKEEDAMRCAVCLEDFEPKEKVMLTPCNHMFHEDCIVPWVKSNAQCP  196

Query  104  CCRMGI  87
             CR  +
Sbjct  197  VCRFSL  202



>ref|XP_006446836.1| hypothetical protein CICLE_v10016257mg [Citrus clementina]
 gb|ESR60076.1| hypothetical protein CICLE_v10016257mg [Citrus clementina]
Length=270

 Score = 64.7 bits (156),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 40/66 (61%), Gaps = 0/66 (0%)
 Frame = -2

Query  284  KSKAMKWAKKLGWKASEEEEECAICLDHFKVGETLMQLPCSHRFHSRCLLPWLDTNAHCP  105
            + +A    K++  +  E+   CA+CL+ F+  E +M  PC+H FH  C++PW+ +NA CP
Sbjct  159  RDQATNVYKEMQKQKEEDAMRCAVCLEDFEPKEKVMLTPCNHMFHEDCIVPWVKSNAQCP  218

Query  104  CCRMGI  87
             CR  +
Sbjct  219  VCRFSL  224



>ref|XP_009365274.1| PREDICTED: uncharacterized protein LOC103955128 [Pyrus x bretschneideri]
Length=222

 Score = 63.9 bits (154),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 33/53 (62%), Gaps = 0/53 (0%)
 Frame = -2

Query  245  KASEEEEECAICLDHFKVGETLMQLPCSHRFHSRCLLPWLDTNAHCPCCRMGI  87
            +  E  + CAICL+ F+  + +M  PC H FH  C++PW+ +N HCP CR  I
Sbjct  168  ETDENSKRCAICLEDFEPKQEVMLTPCKHMFHEECIVPWVKSNGHCPVCRFSI  220



>gb|EAR93534.3| RING-H2 zinc finger protein [Tetrahymena thermophila SB210]
Length=166

 Score = 63.2 bits (152),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 29/77 (38%), Positives = 40/77 (52%), Gaps = 2/77 (3%)
 Frame = -2

Query  317  GGMVMGDVQMLKSKAMKWAKKLGWKASEEEEECAICLDHFKVGETLMQLPCSHRFHSRCL  138
              M M +   L  + +   KK+  K     + CAIC+  FK GE + +LPC H FH  C+
Sbjct  78   NNMQMDEEGRLPDEIVDKVKKM--KMGTSNQSCAICVTPFKKGEIIRKLPCKHIFHDSCI  135

Query  137  LPWLDTNAHCPCCRMGI  87
            LPW    ++CP CR  I
Sbjct  136  LPWFSKKSNCPNCRFDI  152



>ref|XP_003557291.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Brachypodium 
distachyon]
Length=338

 Score = 65.5 bits (158),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 33/97 (34%), Positives = 49/97 (51%), Gaps = 10/97 (10%)
 Frame = -2

Query  386  ERLKSGHCKSDHKRNCRKTAAEKGGMVMGDVQMLKSKAMKWAKKLGWKASEEEEECAICL  207
            E+L     ++D  R     AA+     + DV          A      A++   +CA+C+
Sbjct  159  EQLIQQLAENDPNRYGTPPAAKSAVAALPDV----------AVSATMMAADGGAQCAVCM  208

Query  206  DHFKVGETLMQLPCSHRFHSRCLLPWLDTNAHCPCCR  96
            D F++G +  QLPC H FH  C+LPWLD ++ CP CR
Sbjct  209  DDFELGASAKQLPCKHVFHKDCILPWLDLHSSCPVCR  245



>emb|CEG75181.1| hypothetical protein RMATCC62417_10268 [Rhizopus microsporus]
Length=394

 Score = 65.5 bits (158),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 26/59 (44%), Positives = 36/59 (61%), Gaps = 0/59 (0%)
 Frame = -2

Query  260  KKLGWKASEEEEECAICLDHFKVGETLMQLPCSHRFHSRCLLPWLDTNAHCPCCRMGIL  84
            + L  K   +E +CA+C D F+  E ++QLPC H FH  C+ PWL  N+ CP CR  +L
Sbjct  293  RGLTEKEKSQEADCAVCKDAFEATEQVIQLPCEHIFHDDCIKPWLKLNSTCPVCRHSVL  351



>ref|XP_008228952.1| PREDICTED: RING finger protein 215 [Prunus mume]
Length=225

 Score = 63.9 bits (154),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = -2

Query  236  EEEEECAICLDHFKVGETLMQLPCSHRFHSRCLLPWLDTNAHCPCCRMGI  87
            E  + CA+CL+ F+  + +M  PC H FH  C++PW+ +N HCP CR  I
Sbjct  174  ENSKRCAVCLEDFEPRQEVMLTPCKHMFHEECIVPWVKSNGHCPVCRFAI  223



>emb|CDW53059.1| zf-RING 3 and zf-RING 2 domain containing protein [Trichuris 
trichiura]
Length=259

 Score = 64.3 bits (155),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 26/73 (36%), Positives = 42/73 (58%), Gaps = 0/73 (0%)
 Frame = -2

Query  302  GDVQMLKSKAMKWAKKLGWKASEEEEECAICLDHFKVGETLMQLPCSHRFHSRCLLPWLD  123
            G    L ++ +        ++ EE  +C++C + F+ G T+ +LPC+HRFH  C++PWL 
Sbjct  162  GGAPPLTAEEINSIPVEKVESGEEAIQCSVCFEEFQEGSTVRRLPCNHRFHDPCIVPWLQ  221

Query  122  TNAHCPCCRMGIL  84
             +  CP CR  IL
Sbjct  222  LHNSCPVCRKEIL  234



>ref|XP_006445556.1| hypothetical protein CICLE_v10015642mg [Citrus clementina]
 ref|XP_006488959.1| PREDICTED: E3 ubiquitin-protein ligase CIP8-like [Citrus sinensis]
 gb|ESR58796.1| hypothetical protein CICLE_v10015642mg [Citrus clementina]
 gb|KDO54518.1| hypothetical protein CISIN_1g017208mg [Citrus sinensis]
 gb|KDO54519.1| hypothetical protein CISIN_1g017208mg [Citrus sinensis]
Length=375

 Score = 65.5 bits (158),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 24/55 (44%), Positives = 39/55 (71%), Gaps = 0/55 (0%)
 Frame = -2

Query  236  EEEEECAICLDHFKVGETLMQLPCSHRFHSRCLLPWLDTNAHCPCCRMGILSSPF  72
            EE  +C++CLD F++G    ++PC H+FHS+C+LPWL+ ++ CP CR  + +  F
Sbjct  239  EETLQCSVCLDDFEIGTEAKEMPCKHKFHSQCILPWLELHSSCPVCRCQLPADEF  293



>ref|XP_006468973.1| PREDICTED: E3 ubiquitin-protein ligase RNF115-like isoform X2 
[Citrus sinensis]
Length=248

 Score = 64.3 bits (155),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 40/66 (61%), Gaps = 0/66 (0%)
 Frame = -2

Query  284  KSKAMKWAKKLGWKASEEEEECAICLDHFKVGETLMQLPCSHRFHSRCLLPWLDTNAHCP  105
            + +A    K++  +  E+   CA+CL+ F+  E +M  PC+H FH  C++PW+ +NA CP
Sbjct  137  RDQATNVYKEMQKQKEEDAMRCAVCLEDFEPKEKVMLTPCNHMFHEDCIVPWVKSNAQCP  196

Query  104  CCRMGI  87
             CR  +
Sbjct  197  VCRFSL  202



>ref|XP_006468972.1| PREDICTED: E3 ubiquitin-protein ligase RNF115-like isoform X1 
[Citrus sinensis]
Length=270

 Score = 64.7 bits (156),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 40/66 (61%), Gaps = 0/66 (0%)
 Frame = -2

Query  284  KSKAMKWAKKLGWKASEEEEECAICLDHFKVGETLMQLPCSHRFHSRCLLPWLDTNAHCP  105
            + +A    K++  +  E+   CA+CL+ F+  E +M  PC+H FH  C++PW+ +NA CP
Sbjct  159  RDQATNVYKEMQKQKEEDAMRCAVCLEDFEPKEKVMLTPCNHMFHEDCIVPWVKSNAQCP  218

Query  104  CCRMGI  87
             CR  +
Sbjct  219  VCRFSL  224



>ref|XP_009116553.1| PREDICTED: E3 ubiquitin-protein ligase RNF12-A-like isoform X1 
[Brassica rapa]
Length=299

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 38/133 (29%), Positives = 66/133 (50%), Gaps = 23/133 (17%)
 Frame = -2

Query  410  REAKERLDERLKSGHCKSDHKRNCRKTAA----EKGGMV----------MGDVQMLKSKA  273
            R+  E L + + + H  + H+ N R  AA    EK  ++          +   Q+L++ +
Sbjct  120  RQHLEALRQAVHNRHDSTRHESNSRSAAASQAKEKEDILKYLTKETYNPVPKSQLLRNLS  179

Query  272  MKWAKK---LGWKASEE------EEECAICLDHFKVGETLMQLPCSHRFHSRCLLPWLDT  120
            + +  K   LG   + +      E+ C++CL+ F+  ET+M  PC H FH  C++PWL +
Sbjct  180  LYYKNKNSGLGSSRNPQGYSGGDEKRCSVCLEDFEPKETVMLTPCKHMFHEECIVPWLKS  239

Query  119  NAHCPCCRMGILS  81
               CP CR  I++
Sbjct  240  KGQCPVCRFVIIT  252



>emb|CDY26096.1| BnaC06g11000D [Brassica napus]
Length=294

 Score = 64.7 bits (156),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 35/53 (66%), Gaps = 0/53 (0%)
 Frame = -2

Query  245  KASEEEEECAICLDHFKVGETLMQLPCSHRFHSRCLLPWLDTNAHCPCCRMGI  87
            K  E   +C++CLD F+VG    Q+PC H FH+ CLLPWL+ ++ CP CR  +
Sbjct  164  KIQEPSLQCSVCLDDFEVGAEAKQMPCKHNFHADCLLPWLELHSSCPVCRYQL  216



>ref|XP_009116554.1| PREDICTED: E3 ubiquitin-protein ligase At3g02290-like isoform 
X2 [Brassica rapa]
Length=264

 Score = 64.3 bits (155),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 38/133 (29%), Positives = 66/133 (50%), Gaps = 23/133 (17%)
 Frame = -2

Query  410  REAKERLDERLKSGHCKSDHKRNCRKTAA----EKGGMV----------MGDVQMLKSKA  273
            R+  E L + + + H  + H+ N R  AA    EK  ++          +   Q+L++ +
Sbjct  85   RQHLEALRQAVHNRHDSTRHESNSRSAAASQAKEKEDILKYLTKETYNPVPKSQLLRNLS  144

Query  272  MKWAKK---LGWKASEE------EEECAICLDHFKVGETLMQLPCSHRFHSRCLLPWLDT  120
            + +  K   LG   + +      E+ C++CL+ F+  ET+M  PC H FH  C++PWL +
Sbjct  145  LYYKNKNSGLGSSRNPQGYSGGDEKRCSVCLEDFEPKETVMLTPCKHMFHEECIVPWLKS  204

Query  119  NAHCPCCRMGILS  81
               CP CR  I++
Sbjct  205  KGQCPVCRFVIIT  217



>ref|XP_009497252.1| hypothetical protein H696_05127 [Fonticula alba]
 gb|KCV68198.1| hypothetical protein H696_05127 [Fonticula alba]
Length=786

 Score = 65.9 bits (159),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 27/59 (46%), Positives = 35/59 (59%), Gaps = 0/59 (0%)
 Frame = -2

Query  251  GWKASEEEEECAICLDHFKVGETLMQLPCSHRFHSRCLLPWLDTNAHCPCCRMGILSSP  75
            G   ++++  CAICL  ++ GET  +LPC H FH RC+  WL  N HCP C   I S P
Sbjct  431  GGDLADDDALCAICLGDYEPGETFRRLPCKHHFHMRCIDQWLPVNKHCPLCMQSIDSVP  489



>gb|EEE65206.1| hypothetical protein OsJ_20345 [Oryza sativa Japonica Group]
Length=221

 Score = 63.9 bits (154),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 68/189 (36%), Positives = 92/189 (49%), Gaps = 29/189 (15%)
 Frame = -2

Query  644  MAGMLPGVECARRRRFHQSGGLSDsttstttssstrrsSFCLYTSNHDSHLsssssssS-  468
            MA MLPGVECARR       G      +      TRRSSFC++ + H    +   ++++ 
Sbjct  1    MAAMLPGVECARR--RRLRQGGGAGADAAAAGGGTRRSSFCVHAAGHGGGQTCGGAAANH  58

Query  467  --MQRSTIGKAYQDEKLGAAAREAKERLDERLKSG--------HCKSDHKRN--------  342
               QRS++ +      L + AREAKERLD++L+S         H     K N        
Sbjct  59   SGKQRSSVMELIHGWSLDSNAREAKERLDQKLRSQRESVIKRHHSTGSIKLNRGATGGGG  118

Query  341  --CRKTAAEKGGMVMGDVQMLKS---KAMKWAKKLGWKASEEEEECAICLDHFKVGETLM  177
               R TA    G V  +V   K    + M+W++ L W A+E+ E CA+CLD F  GE L 
Sbjct  119  GGGRSTATAAMG-VQREVYSRKGVMRRLMRWSR-LRWDAAEQAE-CAVCLDEFAAGEVLA  175

Query  176  QLPCSHRFH  150
             LPC HRF 
Sbjct  176  HLPCGHRFQ  184



>ref|NP_001055887.2| Os05g0488800 [Oryza sativa Japonica Group]
 dbj|BAF17801.2| Os05g0488800, partial [Oryza sativa Japonica Group]
Length=323

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 25/52 (48%), Positives = 35/52 (67%), Gaps = 0/52 (0%)
 Frame = -2

Query  236  EEEEECAICLDHFKVGETLMQLPCSHRFHSRCLLPWLDTNAHCPCCRMGILS  81
            EE   C++CLD  +VG    Q+PC H+FHS C+LPWL+ ++ CP CR  + S
Sbjct  194  EEVVSCSVCLDDLEVGSQAKQMPCEHKFHSSCILPWLELHSSCPVCRFELPS  245



>gb|AAT77283.1| hypothetical protein [Oryza sativa Japonica Group]
 dbj|BAH00840.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE64176.1| hypothetical protein OsJ_19008 [Oryza sativa Japonica Group]
Length=323

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 25/52 (48%), Positives = 35/52 (67%), Gaps = 0/52 (0%)
 Frame = -2

Query  236  EEEEECAICLDHFKVGETLMQLPCSHRFHSRCLLPWLDTNAHCPCCRMGILS  81
            EE   C++CLD  +VG    Q+PC H+FHS C+LPWL+ ++ CP CR  + S
Sbjct  194  EEVVSCSVCLDDLEVGSQAKQMPCEHKFHSSCILPWLELHSSCPVCRFELPS  245



>ref|XP_001013779.2| hypothetical protein TTHERM_00426010 [Tetrahymena thermophila]
Length=168

 Score = 62.8 bits (151),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 29/77 (38%), Positives = 40/77 (52%), Gaps = 2/77 (3%)
 Frame = -2

Query  317  GGMVMGDVQMLKSKAMKWAKKLGWKASEEEEECAICLDHFKVGETLMQLPCSHRFHSRCL  138
              M M +   L  + +   KK+  K     + CAIC+  FK GE + +LPC H FH  C+
Sbjct  80   NNMQMDEEGRLPDEIVDKVKKM--KMGTSNQSCAICVTPFKKGEIIRKLPCKHIFHDSCI  137

Query  137  LPWLDTNAHCPCCRMGI  87
            LPW    ++CP CR  I
Sbjct  138  LPWFSKKSNCPNCRFDI  154



>gb|AFG53317.1| hypothetical protein 0_8445_01, partial [Pinus taeda]
 gb|AFG53318.1| hypothetical protein 0_8445_01, partial [Pinus taeda]
Length=146

 Score = 62.4 bits (150),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 22/46 (48%), Positives = 32/46 (70%), Gaps = 0/46 (0%)
 Frame = -2

Query  233  EEEECAICLDHFKVGETLMQLPCSHRFHSRCLLPWLDTNAHCPCCR  96
            +  +CA+C D F+VG  + Q+PC H +HS C+LPWL+ +  CP CR
Sbjct  13   DSTQCAVCKDEFEVGTEVRQMPCKHMYHSVCILPWLEQHNSCPVCR  58



>ref|XP_002940130.1| PREDICTED: RING finger protein 44-like [Xenopus (Silurana) tropicalis]
Length=156

 Score = 62.8 bits (151),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 43/141 (30%), Positives = 63/141 (45%), Gaps = 10/141 (7%)
 Frame = -2

Query  500  SHLsssssssSMQRSTIGKAYQDEKLGAAAREAKERLDERLKSGHCKSDHKRNCRKTAAE  321
            SHL     ++++ + ++     +E   AAAR   E L++     H ++      R T A 
Sbjct  26   SHLCEIPENNNLAQDSLSNGVHEE---AAARTCTETLED---VSHTQTSQAN--RITEAN  77

Query  320  KGGMVMGDVQMLKSKAMKWAKKLGWKASEEEEECAICLDHFKVGETLMQLPCSHRFHSRC  141
                  G +  LK K       L     E+E+ C ICL  +K GE    LPC+H FH+RC
Sbjct  78   TRARTRGQILRLKQKIASLP--LRVVGEEDEDFCIICLSDYKSGEEAYSLPCNHHFHARC  135

Query  140  LLPWLDTNAHCPCCRMGILSS  78
            L  WL     CP CR    ++
Sbjct  136  LTEWLIERPVCPLCREPFFAN  156



>gb|AFG53307.1| hypothetical protein 0_8445_01, partial [Pinus taeda]
 gb|AFG53308.1| hypothetical protein 0_8445_01, partial [Pinus taeda]
 gb|AFG53309.1| hypothetical protein 0_8445_01, partial [Pinus taeda]
 gb|AFG53310.1| hypothetical protein 0_8445_01, partial [Pinus taeda]
 gb|AFG53311.1| hypothetical protein 0_8445_01, partial [Pinus taeda]
 gb|AFG53312.1| hypothetical protein 0_8445_01, partial [Pinus taeda]
 gb|AFG53313.1| hypothetical protein 0_8445_01, partial [Pinus taeda]
 gb|AFG53314.1| hypothetical protein 0_8445_01, partial [Pinus taeda]
 gb|AFG53315.1| hypothetical protein 0_8445_01, partial [Pinus taeda]
 gb|AFG53316.1| hypothetical protein 0_8445_01, partial [Pinus taeda]
 gb|AFG53319.1| hypothetical protein 0_8445_01, partial [Pinus taeda]
 gb|AFG53320.1| hypothetical protein 0_8445_01, partial [Pinus taeda]
Length=146

 Score = 62.4 bits (150),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 22/46 (48%), Positives = 32/46 (70%), Gaps = 0/46 (0%)
 Frame = -2

Query  233  EEEECAICLDHFKVGETLMQLPCSHRFHSRCLLPWLDTNAHCPCCR  96
            +  +CA+C D F+VG  + Q+PC H +HS C+LPWL+ +  CP CR
Sbjct  13   DSTQCAVCKDEFEVGTEVRQMPCKHMYHSVCILPWLEQHNSCPVCR  58



>gb|EAY98500.1| hypothetical protein OsI_20412 [Oryza sativa Indica Group]
Length=323

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 25/52 (48%), Positives = 35/52 (67%), Gaps = 0/52 (0%)
 Frame = -2

Query  236  EEEEECAICLDHFKVGETLMQLPCSHRFHSRCLLPWLDTNAHCPCCRMGILS  81
            EE   C++CLD  +VG    Q+PC H+FHS C+LPWL+ ++ CP CR  + S
Sbjct  194  EEVVSCSVCLDDLEVGSQAKQMPCEHKFHSSCILPWLELHSSCPVCRFELPS  245



>gb|KDR18580.1| E3 ubiquitin-protein ligase [Zootermopsis nevadensis]
Length=145

 Score = 62.4 bits (150),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 23/44 (52%), Positives = 30/44 (68%), Gaps = 0/44 (0%)
 Frame = -2

Query  227  EECAICLDHFKVGETLMQLPCSHRFHSRCLLPWLDTNAHCPCCR  96
            E+C +CL  + VGET+  +PC H FHS C+LPWL+    CP CR
Sbjct  66   EQCPVCLKEYTVGETVKVMPCKHSFHSSCILPWLEKTNSCPLCR  109



>emb|CEP10883.1| hypothetical protein [Parasitella parasitica]
Length=512

 Score = 65.5 bits (158),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 25/61 (41%), Positives = 38/61 (62%), Gaps = 0/61 (0%)
 Frame = -2

Query  260  KKLGWKASEEEEECAICLDHFKVGETLMQLPCSHRFHSRCLLPWLDTNAHCPCCRMGILS  81
            ++L  +  + E +CA+C D F+  E ++QLPC H FH  C+ PWL  N+ CP CR  +L 
Sbjct  299  RELTEQEKDREADCAVCKDQFEPKEQVIQLPCEHIFHDECIKPWLKLNSTCPVCRHSVLP  358

Query  80   S  78
            +
Sbjct  359  A  359



>emb|CDY49247.1| BnaA09g55260D [Brassica napus]
Length=272

 Score = 64.3 bits (155),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 38/133 (29%), Positives = 66/133 (50%), Gaps = 23/133 (17%)
 Frame = -2

Query  410  REAKERLDERLKSGHCKSDHKRNCRKTAA----EKGGMV----------MGDVQMLKSKA  273
            R+  E L + + + H  + H+ N R  AA    EK  ++          +   Q+L++ +
Sbjct  93   RQHLEALRQAVHNRHDSTRHESNSRSAAASQDKEKEDILKYLTKETYNPVPKSQLLRNLS  152

Query  272  MKWAKK---LGWKASEE------EEECAICLDHFKVGETLMQLPCSHRFHSRCLLPWLDT  120
            + +  K   LG   + +      E+ C++CL+ F+  ET+M  PC H FH  C++PWL +
Sbjct  153  LYYKNKNSGLGSSRNPQGYSGGDEKRCSVCLEDFEPKETVMLTPCKHMFHEECIVPWLKS  212

Query  119  NAHCPCCRMGILS  81
               CP CR  I++
Sbjct  213  KGQCPVCRFVIIT  225



>ref|XP_011033689.1| PREDICTED: E3 ubiquitin-protein ligase TTC3 [Populus euphratica]
Length=268

 Score = 64.3 bits (155),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 24/64 (38%), Positives = 40/64 (63%), Gaps = 0/64 (0%)
 Frame = -2

Query  284  KSKAMKWAKKLGWKASEEEEECAICLDHFKVGETLMQLPCSHRFHSRCLLPWLDTNAHCP  105
            + +A+  AK    +  ++ + CAICL+ F+  E++M  PC+H FH  C++PW+ +N  CP
Sbjct  157  RDRAIDAAKDRARETEDDGKRCAICLEDFEPKESVMVTPCNHMFHEECIVPWVKSNGKCP  216

Query  104  CCRM  93
             CR 
Sbjct  217  VCRF  220



>ref|XP_006402756.1| hypothetical protein EUTSA_v10006182mg [Eutrema salsugineum]
 gb|ESQ44209.1| hypothetical protein EUTSA_v10006182mg [Eutrema salsugineum]
Length=260

 Score = 64.3 bits (155),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 34/51 (67%), Gaps = 0/51 (0%)
 Frame = -2

Query  236  EEEEECAICLDHFKVGETLMQLPCSHRFHSRCLLPWLDTNAHCPCCRMGIL  84
            EE++ C++CL+ F+  ET+M  PC H FH  C++PWL +   CP CR  IL
Sbjct  162  EEDKRCSVCLEDFEPKETVMLTPCQHMFHEECIVPWLKSKGQCPLCRSVIL  212



>ref|XP_002894222.1| ring-H2 finger protein RHY1a [Arabidopsis lyrata subsp. lyrata]
 gb|EFH70481.1| ring-H2 finger protein RHY1a [Arabidopsis lyrata subsp. lyrata]
Length=248

 Score = 63.9 bits (154),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 49/162 (30%), Positives = 73/162 (45%), Gaps = 26/162 (16%)
 Frame = -2

Query  497  HLsssssssSMQRSTIGKAYQDEKLGAAAREAKERLDERLKSGHCKSDHKRNCRKTAAEK  318
            +L++ S+ +  Q S+       E+L  A   A+ RL ERL+ G   S + R  R +  + 
Sbjct  85   YLNTDSTDTETQSSSFVNLNGSERLPGAVLLARARLFERLR-GVSLSSNSRGNRVSVGDD  143

Query  317  GG-----MVMGDV-----------------QMLKSKAMKWAKKLGWKASE---EEEECAI  213
                    V GD                  Q L   A+    +  ++++E   E  +C+I
Sbjct  144  QRESSFHSVDGDPIFQLEGLQVTYECNKKPQGLTQDAINCLHRQTFRSAEVKTEMRDCSI  203

Query  212  CLDHFKVGETLMQLPCSHRFHSRCLLPWLDTNAHCPCCRMGI  87
            CL+ F  G+ L+ LPC+H FHS CL PWL     CP CR  I
Sbjct  204  CLESFTKGDMLISLPCTHSFHSSCLNPWLKACGDCPYCRRAI  245



>gb|KHJ49254.1| zinc finger, C3HC4 type [Trichuris suis]
Length=260

 Score = 64.3 bits (155),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 26/73 (36%), Positives = 42/73 (58%), Gaps = 0/73 (0%)
 Frame = -2

Query  302  GDVQMLKSKAMKWAKKLGWKASEEEEECAICLDHFKVGETLMQLPCSHRFHSRCLLPWLD  123
            G    L ++ +        ++ EE  +C++C + F+ G T+ +LPC+HRFH  C++PWL 
Sbjct  163  GGAPPLTAEEINSIPVEKVESGEETIQCSVCFEEFQEGSTVRRLPCNHRFHDPCIVPWLQ  222

Query  122  TNAHCPCCRMGIL  84
             +  CP CR  IL
Sbjct  223  LHNSCPVCRKEIL  235



>ref|XP_002285765.1| PREDICTED: E3 ubiquitin-protein ligase CIP8 [Vitis vinifera]
 ref|XP_002285766.1| PREDICTED: E3 ubiquitin-protein ligase CIP8 [Vitis vinifera]
Length=368

 Score = 65.1 bits (157),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 23/49 (47%), Positives = 35/49 (71%), Gaps = 0/49 (0%)
 Frame = -2

Query  233  EEEECAICLDHFKVGETLMQLPCSHRFHSRCLLPWLDTNAHCPCCRMGI  87
            E  +C++CLD F++G    ++PC H+FHS C+LPWL+ ++ CP CR  I
Sbjct  236  ENLQCSVCLDDFEIGAEAREMPCKHKFHSGCILPWLELHSSCPVCRFQI  284



>emb|CDY08249.1| BnaA05g13700D [Brassica napus]
Length=335

 Score = 64.7 bits (156),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = -2

Query  245  KASEEEEECAICLDHFKVGETLMQLPCSHRFHSRCLLPWLDTNAHCPCCR  96
            K  E   +C++CLD F+VG    Q+PC H FH+ CLLPWL+ ++ CP CR
Sbjct  202  KIQEPSLQCSVCLDDFEVGVEAKQMPCKHNFHADCLLPWLELHSSCPVCR  251



>gb|KDO43107.1| hypothetical protein CISIN_1g043965mg [Citrus sinensis]
Length=342

 Score = 64.7 bits (156),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 34/51 (67%), Gaps = 0/51 (0%)
 Frame = -2

Query  224  ECAICLDHFKVGETLMQLPCSHRFHSRCLLPWLDTNAHCPCCRMGILSSPF  72
            +CA+CL+ F++G    ++PC H+FH  C++PWL+  + CP CR  + S  F
Sbjct  215  QCAVCLEEFEIGNEAKEMPCKHKFHGECIMPWLEVRSSCPVCRFQVPSDDF  265



>dbj|BAJ88158.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=275

 Score = 64.3 bits (155),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 29/54 (54%), Positives = 34/54 (63%), Gaps = 0/54 (0%)
 Frame = -2

Query  236  EEEEECAICLDHFKVGETLMQLPCSHRFHSRCLLPWLDTNAHCPCCRMGILSSP  75
            E   EC+ICLD F  G+ L++L C HRFHS CL PW+   A CP CR  I S P
Sbjct  221  EASPECSICLDGFYDGDELIRLRCGHRFHSTCLEPWVRKCADCPYCRTNIRSRP  274



>ref|XP_009144743.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Brassica rapa]
Length=334

 Score = 64.7 bits (156),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = -2

Query  245  KASEEEEECAICLDHFKVGETLMQLPCSHRFHSRCLLPWLDTNAHCPCCR  96
            K  E   +C++CLD F+VG    Q+PC H FH+ CLLPWL+ ++ CP CR
Sbjct  202  KIQEPSLQCSVCLDDFEVGVEAKQMPCKHNFHADCLLPWLELHSSCPVCR  251



>gb|EMT16443.1| RING finger protein 115 [Aegilops tauschii]
Length=454

 Score = 65.1 bits (157),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 25/52 (48%), Positives = 34/52 (65%), Gaps = 0/52 (0%)
 Frame = -2

Query  236  EEEEECAICLDHFKVGETLMQLPCSHRFHSRCLLPWLDTNAHCPCCRMGILS  81
            EE   C++CLD   +G    QLPC H+FHS C+LPWL+ ++ CP CR  + S
Sbjct  317  EEVVSCSVCLDDLDIGSQAKQLPCEHKFHSPCILPWLELHSSCPVCRFELPS  368



>ref|XP_001994123.1| GH17353 [Drosophila grimshawi]
 gb|EDV94859.1| GH17353 [Drosophila grimshawi]
Length=1665

 Score = 65.5 bits (158),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 25/53 (47%), Positives = 35/53 (66%), Gaps = 0/53 (0%)
 Frame = -2

Query  245   KASEEEEECAICLDHFKVGETLMQLPCSHRFHSRCLLPWLDTNAHCPCCRMGI  87
             +  E+ E+CAICL  F++   + +LPC H FH+ C+  WL TN HCP CR+ I
Sbjct  1588  ETDEDAEKCAICLSLFEIENDVRRLPCMHLFHTDCVDQWLVTNKHCPICRVDI  1640



>ref|XP_006829824.1| hypothetical protein AMTR_s00119p00089020 [Amborella trichopoda]
 gb|ERM97240.1| hypothetical protein AMTR_s00119p00089020 [Amborella trichopoda]
Length=337

 Score = 64.7 bits (156),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = -2

Query  233  EEEECAICLDHFKVGETLMQLPCSHRFHSRCLLPWLDTNAHCPCCRM  93
            E E C+IC++ F+VG    +LPC H+FHS C+LPWL+ ++ CP CR 
Sbjct  214  ESERCSICIEDFEVGAEARELPCKHKFHSGCILPWLELHSSCPVCRF  260



>ref|XP_008455287.1| PREDICTED: E3 ubiquitin-protein ligase RNF12 isoform X2 [Cucumis 
melo]
Length=242

 Score = 63.5 bits (153),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 22/67 (33%), Positives = 41/67 (61%), Gaps = 0/67 (0%)
 Frame = -2

Query  284  KSKAMKWAKKLGWKASEEEEECAICLDHFKVGETLMQLPCSHRFHSRCLLPWLDTNAHCP  105
            ++  + + ++    + EE + CA+CL+ F+  E +M  PC+H FH +C++PW+ +N  CP
Sbjct  124  ENNRVNYNERHNNNSDEEGKGCAVCLEDFQPKEEVMTTPCNHMFHEQCIVPWVKSNGQCP  183

Query  104  CCRMGIL  84
             CR  + 
Sbjct  184  VCRFTLF  190



>gb|KFD57597.1| hypothetical protein M513_01700 [Trichuris suis]
 gb|KFD72374.1| hypothetical protein M514_01700 [Trichuris suis]
Length=273

 Score = 63.9 bits (154),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 37/54 (69%), Gaps = 0/54 (0%)
 Frame = -2

Query  245  KASEEEEECAICLDHFKVGETLMQLPCSHRFHSRCLLPWLDTNAHCPCCRMGIL  84
            ++ EE  +C++C + F+ G T+ +LPC+HRFH  C++PWL  +  CP CR  IL
Sbjct  195  ESGEETIQCSVCFEEFQEGSTVRRLPCNHRFHDPCIVPWLQLHNSCPVCRKEIL  248



>gb|ACG42033.1| RHC1A [Zea mays]
Length=321

 Score = 64.7 bits (156),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = -2

Query  221  CAICLDHFKVGETLMQLPCSHRFHSRCLLPWLDTNAHCPCCRMGILS  81
            C++CLD  ++G    Q+PC HRFHS C+LPWL+ ++ CP CR  + S
Sbjct  197  CSVCLDDLELGSPAKQMPCGHRFHSSCILPWLELHSSCPVCRFELPS  243



>ref|XP_008455285.1| PREDICTED: E3 ubiquitin-protein ligase RNF12 isoform X1 [Cucumis 
melo]
Length=263

 Score = 63.9 bits (154),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 22/54 (41%), Positives = 35/54 (65%), Gaps = 0/54 (0%)
 Frame = -2

Query  245  KASEEEEECAICLDHFKVGETLMQLPCSHRFHSRCLLPWLDTNAHCPCCRMGIL  84
             + EE + CA+CL+ F+  E +M  PC+H FH +C++PW+ +N  CP CR  + 
Sbjct  158  NSDEEGKGCAVCLEDFQPKEEVMTTPCNHMFHEQCIVPWVKSNGQCPVCRFTLF  211



>gb|ETN59409.1| hypothetical protein AND_008994 [Anopheles darlingi]
Length=1792

 Score = 65.5 bits (158),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 26/57 (46%), Positives = 36/57 (63%), Gaps = 0/57 (0%)
 Frame = -2

Query  257   KLGWKASEEEEECAICLDHFKVGETLMQLPCSHRFHSRCLLPWLDTNAHCPCCRMGI  87
             +L  ++ E+ E+C ICL  F+V   + +LPC H FH  C+  WL TN HCP CR+ I
Sbjct  1726  RLVSESDEDSEKCTICLSQFEVDNDVRRLPCMHLFHKDCVDQWLVTNKHCPICRVDI  1782



>ref|XP_004289814.1| PREDICTED: uncharacterized protein LOC101294809 [Fragaria vesca 
subsp. vesca]
Length=269

 Score = 63.9 bits (154),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 35/53 (66%), Gaps = 0/53 (0%)
 Frame = -2

Query  242  ASEEEEECAICLDHFKVGETLMQLPCSHRFHSRCLLPWLDTNAHCPCCRMGIL  84
             SE   +C+ICL++F  GE L+ LPC+HRFH+ CL PW+     CP CR  I+
Sbjct  207  VSEVSRDCSICLENFMNGEELICLPCAHRFHTTCLGPWVQIRGDCPYCRRAIV  259



>ref|XP_011185017.1| PREDICTED: uncharacterized protein LOC105213700 isoform X2 [Bactrocera 
cucurbitae]
Length=1660

 Score = 65.5 bits (158),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 25/53 (47%), Positives = 36/53 (68%), Gaps = 0/53 (0%)
 Frame = -2

Query  245   KASEEEEECAICLDHFKVGETLMQLPCSHRFHSRCLLPWLDTNAHCPCCRMGI  87
             ++ E+ E+CAICL  F++   + +LPC H FH+ C+  WL TN HCP CR+ I
Sbjct  1594  ESDEDAEKCAICLSLFEIENDVRRLPCMHLFHTDCVDQWLVTNKHCPICRVDI  1646



>ref|NP_001140503.1| uncharacterized LOC100272564 [Zea mays]
 ref|XP_008654525.1| PREDICTED: uncharacterized LOC100272564 isoform X1 [Zea mays]
 ref|XP_008654527.1| PREDICTED: uncharacterized LOC100272564 isoform X1 [Zea mays]
 gb|ACF83956.1| unknown [Zea mays]
 gb|AFW82347.1| putative RING zinc finger domain superfamily protein isoform 
1 [Zea mays]
 gb|AFW82348.1| putative RING zinc finger domain superfamily protein isoform 
2 [Zea mays]
Length=312

 Score = 64.3 bits (155),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = -2

Query  221  CAICLDHFKVGETLMQLPCSHRFHSRCLLPWLDTNAHCPCCRMGILS  81
            C++CLD  ++G    Q+PC HRFHS C+LPWL+ ++ CP CR  + S
Sbjct  195  CSVCLDDLELGSPAKQMPCGHRFHSSCILPWLELHSSCPVCRFELPS  241



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1219970116365