BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF009P03

Length=743
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009772211.1|  PREDICTED: probable serine/threonine-protein...    192   5e-53   Nicotiana sylvestris
ref|XP_009607019.1|  PREDICTED: probable serine/threonine-protein...    190   4e-52   Nicotiana tomentosiformis
ref|XP_006359171.1|  PREDICTED: probable serine/threonine-protein...    188   1e-51   Solanum tuberosum [potatoes]
ref|XP_004229357.1|  PREDICTED: probable serine/threonine-protein...    187   5e-51   Solanum lycopersicum
emb|CBI32192.3|  unnamed protein product                                172   3e-47   Vitis vinifera
ref|XP_011087152.1|  PREDICTED: probable serine/threonine-protein...    174   1e-46   Sesamum indicum [beniseed]
ref|XP_011087160.1|  PREDICTED: AP2-associated protein kinase 1 i...    174   2e-46   Sesamum indicum [beniseed]
ref|XP_011087144.1|  PREDICTED: AP2-associated protein kinase 1 i...    174   2e-46   Sesamum indicum [beniseed]
emb|CDP07693.1|  unnamed protein product                                169   3e-46   Coffea canephora [robusta coffee]
ref|XP_004306499.1|  PREDICTED: AP2-associated protein kinase 1 i...    172   5e-46   Fragaria vesca subsp. vesca
ref|XP_010659599.1|  PREDICTED: probable serine/threonine-protein...    171   2e-45   Vitis vinifera
ref|XP_010659600.1|  PREDICTED: probable serine/threonine-protein...    171   2e-45   Vitis vinifera
ref|XP_010659601.1|  PREDICTED: probable serine/threonine-protein...    171   2e-45   Vitis vinifera
ref|XP_011087141.1|  PREDICTED: AP2-associated protein kinase 1 i...    171   3e-45   Sesamum indicum [beniseed]
ref|XP_010095876.1|  putative serine/threonine-protein kinase           170   4e-45   
ref|XP_006439043.1|  hypothetical protein CICLE_v10030862mg             170   4e-45   Citrus clementina [clementine]
ref|XP_006482821.1|  PREDICTED: probable serine/threonine-protein...    170   5e-45   Citrus sinensis [apfelsine]
gb|KDO46087.1|  hypothetical protein CISIN_1g005558mg                   167   5e-45   Citrus sinensis [apfelsine]
ref|XP_006482823.1|  PREDICTED: probable serine/threonine-protein...    170   5e-45   Citrus sinensis [apfelsine]
ref|XP_006439041.1|  hypothetical protein CICLE_v10030862mg             170   5e-45   Citrus clementina [clementine]
gb|KDO46085.1|  hypothetical protein CISIN_1g005558mg                   168   2e-44   Citrus sinensis [apfelsine]
ref|XP_006439040.1|  hypothetical protein CICLE_v10030862mg             168   2e-44   
ref|XP_006482824.1|  PREDICTED: probable serine/threonine-protein...    168   2e-44   Citrus sinensis [apfelsine]
gb|KDO46086.1|  hypothetical protein CISIN_1g005558mg                   168   3e-44   Citrus sinensis [apfelsine]
ref|XP_011468799.1|  PREDICTED: AP2-associated protein kinase 1 i...    166   1e-43   Fragaria vesca subsp. vesca
ref|XP_010265879.1|  PREDICTED: probable serine/threonine-protein...    162   3e-42   Nelumbo nucifera [Indian lotus]
ref|XP_008231319.1|  PREDICTED: AP2-associated protein kinase 1 i...    162   3e-42   Prunus mume [ume]
ref|XP_010265881.1|  PREDICTED: probable serine/threonine-protein...    162   3e-42   Nelumbo nucifera [Indian lotus]
ref|XP_008231320.1|  PREDICTED: AP2-associated protein kinase 1 i...    162   3e-42   Prunus mume [ume]
ref|XP_010027724.1|  PREDICTED: AP2-associated protein kinase 1 i...    161   8e-42   
ref|XP_010027725.1|  PREDICTED: AP2-associated protein kinase 1 i...    160   1e-41   Eucalyptus grandis [rose gum]
ref|XP_008231321.1|  PREDICTED: AP2-associated protein kinase 1 i...    157   2e-40   Prunus mume [ume]
ref|XP_009339572.1|  PREDICTED: AP2-associated protein kinase 1         154   2e-39   Pyrus x bretschneideri [bai li]
ref|XP_010670934.1|  PREDICTED: actin-regulating kinase PRK1-like       145   4e-36   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008392404.1|  PREDICTED: AP2-associated protein kinase 1         145   6e-36   Malus domestica [apple tree]
gb|ABK92707.1|  unknown                                                 138   6e-36   Populus trichocarpa [western balsam poplar]
gb|EYU27100.1|  hypothetical protein MIMGU_mgv1a022935mg                143   1e-35   Erythranthe guttata [common monkey flower]
ref|XP_007220628.1|  hypothetical protein PRUPE_ppa002321mg             143   2e-35   
ref|XP_007052604.1|  Serine/threonine-protein kinase DDB_G0280111...    143   2e-35   
ref|XP_010522378.1|  PREDICTED: probable serine/threonine-protein...    143   2e-35   Tarenaya hassleriana [spider flower]
ref|XP_007052606.1|  Serine/threonine-protein kinase DDB_G0280111...    143   2e-35   
ref|XP_007052605.1|  Serine/threonine-protein kinase DDB_G0280111...    141   1e-34   
ref|XP_002512151.1|  serine/threonine protein kinase, putative          139   3e-34   Ricinus communis
ref|XP_006369447.1|  hypothetical protein POPTR_0001s23520g             138   9e-34   
ref|XP_010522383.1|  PREDICTED: probable serine/threonine-protein...    136   4e-33   Tarenaya hassleriana [spider flower]
ref|XP_004149621.1|  PREDICTED: uncharacterized protein LOC101211119    133   7e-32   Cucumis sativus [cucumbers]
ref|XP_008461768.1|  PREDICTED: probable serine/threonine-protein...    131   4e-31   Cucumis melo [Oriental melon]
ref|XP_007149360.1|  hypothetical protein PHAVU_005G063700g             130   9e-31   Phaseolus vulgaris [French bean]
ref|XP_008805476.1|  PREDICTED: AP2-associated protein kinase 1-like    129   3e-30   Phoenix dactylifera
ref|XP_007149359.1|  hypothetical protein PHAVU_005G063700g             128   3e-30   Phaseolus vulgaris [French bean]
ref|XP_010257450.1|  PREDICTED: serine/threonine-protein kinase p...    127   1e-29   Nelumbo nucifera [Indian lotus]
ref|XP_010678702.1|  PREDICTED: probable serine/threonine-protein...    127   1e-29   Beta vulgaris subsp. vulgaris [field beet]
gb|KDP20398.1|  hypothetical protein JCGZ_05281                         127   1e-29   Jatropha curcas
ref|XP_010257449.1|  PREDICTED: serine/threonine-protein kinase p...    127   1e-29   Nelumbo nucifera [Indian lotus]
ref|XP_010257448.1|  PREDICTED: serine/threonine-protein kinase p...    127   1e-29   Nelumbo nucifera [Indian lotus]
gb|KHG06229.1|  putative serine/threonine-protein kinase                126   3e-29   Gossypium arboreum [tree cotton]
ref|XP_006410418.1|  hypothetical protein EUTSA_v10016354mg             125   3e-29   Eutrema salsugineum [saltwater cress]
gb|KJB22767.1|  hypothetical protein B456_004G065000                    125   7e-29   Gossypium raimondii
gb|KJB22768.1|  hypothetical protein B456_004G065000                    125   7e-29   Gossypium raimondii
ref|XP_006293803.1|  hypothetical protein CARUB_v10022785mg             124   1e-28   Capsella rubella
gb|KJB22766.1|  hypothetical protein B456_004G065000                    123   2e-28   Gossypium raimondii
ref|XP_002314227.1|  hypothetical protein POPTR_0009s02770g             115   2e-27   
ref|XP_010509956.1|  PREDICTED: probable serine/threonine-protein...    120   2e-27   Camelina sativa [gold-of-pleasure]
ref|XP_010913910.1|  PREDICTED: probable serine/threonine-protein...    119   5e-27   Elaeis guineensis
ref|XP_010413940.1|  PREDICTED: probable serine/threonine-protein...    119   1e-26   Camelina sativa [gold-of-pleasure]
emb|CDX79504.1|  BnaC03g18400D                                          118   1e-26   
ref|XP_010469538.1|  PREDICTED: probable serine/threonine-protein...    118   2e-26   Camelina sativa [gold-of-pleasure]
ref|XP_003531422.1|  PREDICTED: probable serine/threonine-protein...    115   1e-25   Glycine max [soybeans]
emb|CDX84704.1|  BnaA03g15260D                                          115   2e-25   
ref|XP_009132906.1|  PREDICTED: probable serine/threonine-protein...    115   2e-25   Brassica rapa
ref|XP_002881248.1|  hypothetical protein ARALYDRAFT_482227             114   3e-25   
ref|XP_003546865.1|  PREDICTED: probable serine/threonine-protein...    112   2e-24   Glycine max [soybeans]
ref|XP_004513162.1|  PREDICTED: probable serine/threonine-protein...    111   3e-24   
ref|NP_850199.1|  protein kinase superfamily protein                    108   3e-23   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008808088.1|  PREDICTED: AP2-associated protein kinase 1-like    107   8e-23   Phoenix dactylifera
ref|XP_009394517.1|  PREDICTED: AP2-associated protein kinase 1 {...    105   5e-22   
ref|NP_001047290.1|  Os02g0591900                                       102   1e-21   
ref|XP_006850020.1|  hypothetical protein AMTR_s00022p00186280          103   3e-21   Amborella trichopoda
gb|AAL60023.1|  putative serine/threonine protein kinase                102   4e-21   Arabidopsis thaliana [mouse-ear cress]
ref|NP_565756.1|  protein kinase superfamily protein                    102   4e-21   Arabidopsis thaliana [mouse-ear cress]
dbj|BAD34080.1|  cyclin G-associated kinase-like protein                102   5e-21   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001159134.1|  uncharacterized protein LOC100304212             96.3    1e-20   
ref|XP_006647439.1|  PREDICTED: probable serine/threonine-protein...    101   1e-20   Oryza brachyantha
gb|AFK34914.1|  unknown                                               95.9    4e-20   Medicago truncatula
ref|XP_008677437.1|  PREDICTED: uncharacterized protein LOC100304...  99.8    4e-20   
ref|XP_004952949.1|  PREDICTED: AP2-associated protein kinase 1-l...  98.2    1e-19   Setaria italica
ref|XP_010943528.1|  PREDICTED: AP2-associated protein kinase 1-like  98.6    1e-19   Elaeis guineensis
ref|XP_004952948.1|  PREDICTED: AP2-associated protein kinase 1-l...  98.2    1e-19   Setaria italica
ref|XP_009395097.1|  PREDICTED: AP2-associated protein kinase 1 {...  98.2    1e-19   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003575255.1|  PREDICTED: probable serine/threonine-protein...  97.8    2e-19   Brachypodium distachyon [annual false brome]
gb|KEH33173.1|  Serine/Threonine kinase family protein                95.9    8e-19   Medicago truncatula
ref|XP_004956476.1|  PREDICTED: probable serine/threonine-protein...  94.4    3e-18   Setaria italica
ref|XP_010542991.1|  PREDICTED: AP2-associated protein kinase 1-l...  93.6    4e-18   Tarenaya hassleriana [spider flower]
ref|XP_010542987.1|  PREDICTED: AP2-associated protein kinase 1-l...  93.6    5e-18   Tarenaya hassleriana [spider flower]
gb|EMT28285.1|  Putative serine/threonine-protein kinase              91.7    2e-17   
gb|EMT09791.1|  Putative serine/threonine-protein kinase              90.1    6e-17   
ref|XP_008671591.1|  PREDICTED: probable serine/threonine-protein...  89.7    8e-17   
tpg|DAA39365.1|  TPA: putative protein kinase superfamily protein     89.4    1e-16   
gb|AFW81246.1|  hypothetical protein ZEAMMB73_183204                  85.5    2e-15   
ref|XP_010237997.1|  PREDICTED: AP2-associated protein kinase 1-like  83.2    1e-14   Brachypodium distachyon [annual false brome]
dbj|BAD26025.1|  putative AAK1 protein                                82.8    2e-14   Oryza sativa Japonica Group [Japonica rice]
gb|EAZ08411.1|  hypothetical protein OsI_30675                        82.8    2e-14   Oryza sativa Indica Group [Indian rice]
ref|XP_010469539.1|  PREDICTED: probable serine/threonine-protein...  79.3    2e-13   Camelina sativa [gold-of-pleasure]
ref|XP_006660487.1|  PREDICTED: AP2-associated protein kinase 1-like  79.3    3e-13   Oryza brachyantha
dbj|BAJ97005.1|  predicted protein                                    77.0    1e-12   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009143925.1|  PREDICTED: probable serine/threonine-protein...  75.5    3e-12   Brassica rapa
ref|XP_009408443.1|  PREDICTED: AP2-associated protein kinase 1 {...  73.6    2e-11   
emb|CBI24810.3|  unnamed protein product                              72.8    3e-11   Vitis vinifera
emb|CAN81086.1|  hypothetical protein VITISV_027167                   71.6    1e-10   Vitis vinifera
emb|CDY12158.1|  BnaC04g11880D                                        70.9    1e-10   Brassica napus [oilseed rape]
emb|CAN62110.1|  hypothetical protein VITISV_038734                   70.5    2e-10   Vitis vinifera
ref|XP_001769351.1|  predicted protein                                60.5    3e-07   
ref|XP_010469540.1|  PREDICTED: probable serine/threonine-protein...  58.5    2e-06   Camelina sativa [gold-of-pleasure]
ref|XP_010235619.1|  PREDICTED: probable serine/threonine-protein...  56.6    6e-06   Brachypodium distachyon [annual false brome]
emb|CAN65496.1|  hypothetical protein VITISV_028322                   55.1    2e-05   Vitis vinifera
ref|XP_002972735.1|  hypothetical protein SELMODRAFT_98319            52.4    2e-04   



>ref|XP_009772211.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0280111 
[Nicotiana sylvestris]
 ref|XP_009772212.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0280111 
[Nicotiana sylvestris]
Length=699

 Score =   192 bits (489),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 114/176 (65%), Positives = 134/176 (76%), Gaps = 4/176 (2%)
 Frame = -2

Query  742  AEITSKFEKLSAICRSQRQEIQELKQALAAKTPSPNRDTLRNQSSPKSQTFST-PPQRET  566
            AEITSKFEKLSAICRSQRQEIQELKQALA  TPSPNRDT R+Q+SP SQ  S  PP+++ 
Sbjct  526  AEITSKFEKLSAICRSQRQEIQELKQALAVSTPSPNRDTSRDQASPGSQPSSVPPPRKDN  585

Query  565  IEGTVWElqqgllnqsssSPDPSAWQAFADDGPKPLTTPPPSNTPRSMRTRNNQPPNTQD  386
            IEGTVWEL+QGL   S  SPD   WQAFADD PK   T   +N PRS+RT+N    N Q 
Sbjct  586  IEGTVWELEQGLFGGSQVSPDSKPWQAFADDDPKQQPTSVNAN-PRSVRTKNGH-QNRQT  643

Query  385  STASAWGFGTDSFTAVPSATSQMNASFSDRNNSQRFGD-KRVDNKSASQPAGWAGF  221
            S  +  GFGTDSF AVP+++SQ+ A+F++  N QRFG+ K V++KSASQPAGWAGF
Sbjct  644  SETNTSGFGTDSFRAVPASSSQIKATFNESKNYQRFGEPKNVNSKSASQPAGWAGF  699



>ref|XP_009607019.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0280111 
[Nicotiana tomentosiformis]
 ref|XP_009607020.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0280111 
[Nicotiana tomentosiformis]
Length=700

 Score =   190 bits (482),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 114/176 (65%), Positives = 132/176 (75%), Gaps = 4/176 (2%)
 Frame = -2

Query  742  AEITSKFEKLSAICRSQRQEIQELKQALAAKTPSPNRDTLRNQSSPKSQTFSTPPQRET-  566
            AEITSKFEKLS ICRSQRQEIQELKQALA  TPS NRDT R+Q+SP SQ  S PP R+  
Sbjct  527  AEITSKFEKLSGICRSQRQEIQELKQALAVSTPSLNRDTARDQASPGSQPSSIPPPRKVN  586

Query  565  IEGTVWElqqgllnqsssSPDPSAWQAFADDGPKPLTTPPPSNTPRSMRTRNNQPPNTQD  386
            IEGTVWEL+QGL   S  SPD   WQAFADD PK   T   +N PRS+RT+N    N Q 
Sbjct  587  IEGTVWELEQGLFGGSQVSPDSKPWQAFADDDPKQQPTSVNAN-PRSVRTKNGH-QNRQT  644

Query  385  STASAWGFGTDSFTAVPSATSQMNASFSDRNNSQRFGD-KRVDNKSASQPAGWAGF  221
            S  +  GFGTDSF AVP+++SQ+ A+F++  NSQRFG+ K V++KSASQPAGWAGF
Sbjct  645  SETNTSGFGTDSFRAVPASSSQIKATFNESKNSQRFGEPKNVNSKSASQPAGWAGF  700



>ref|XP_006359171.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0280111-like 
[Solanum tuberosum]
Length=694

 Score =   188 bits (478),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 114/176 (65%), Positives = 139/176 (79%), Gaps = 9/176 (5%)
 Frame = -2

Query  742  AEITSKFEKLSAICRSQRQEIQELKQALAAKTPSPNRDTLRNQSSPKSQTFSTPPQRETI  563
            AEITSK+EKLSAICRSQRQE+QELKQALAA+TPSPNRD  R+ +SP SQ    PP+++ I
Sbjct  526  AEITSKYEKLSAICRSQRQELQELKQALAARTPSPNRDNTRDHASPGSQ---IPPKKDNI  582

Query  562  EGTVWElqqgllnqsssSPDPSAWQAFADDGPKPLTTPPPSNTPRSMRTRN-NQPPNTQD  386
            EGTVWELQQGL  QS  S D  +WQAFADD PK   TP  S TPRS+RT+N +Q  +T +
Sbjct  583  EGTVWELQQGLFGQSQVSSDSKSWQAFADD-PKQQATPVNS-TPRSVRTKNGHQNRDTSE  640

Query  385  STASAWGFGTDSFTAVPSATSQMNASFSDRNNSQRFGD-KRVDNKSASQPAGWAGF  221
            +  SA  FGTDSF AVP+++SQ+ A+F++  NSQRFG+ K +D+KSASQPAGWAGF
Sbjct  641  TNTSA--FGTDSFRAVPASSSQIKANFNESKNSQRFGEPKNIDSKSASQPAGWAGF  694



>ref|XP_004229357.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0280111 
[Solanum lycopersicum]
Length=698

 Score =   187 bits (475),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 113/176 (64%), Positives = 136/176 (77%), Gaps = 5/176 (3%)
 Frame = -2

Query  742  AEITSKFEKLSAICRSQRQEIQELKQALAAKTPSPNRDTLR-NQSSPKSQTFSTPPQRET  566
            AEITSK+EKLSAICRSQRQE+QELKQALAA+TPSP+ DT R + +SP SQ  STPP+++ 
Sbjct  526  AEITSKYEKLSAICRSQRQELQELKQALAARTPSPHVDTTRDHHASPGSQPSSTPPKKDN  585

Query  565  IEGTVWElqqgllnqsssSPDPSAWQAFADDGPKPLTTPPPSNTPRSMRTRNNQPPNTQD  386
            IEGTVWELQQGL  QS  S D  +WQAFADD PK   TP  S TPRS+RT+N    N + 
Sbjct  586  IEGTVWELQQGLFGQSQVSSDSKSWQAFADD-PKQQATPVNS-TPRSVRTKNGH-QNRET  642

Query  385  STASAWGFGTDSFTAVPSATSQMNASFSDRNNSQRFGD-KRVDNKSASQPAGWAGF  221
            S  +   FGTDSF AVP+ +SQ+ A+F++  NSQRFG+ K +D+KSASQPAGWAGF
Sbjct  643  SETNTSAFGTDSFRAVPAFSSQIKATFNESKNSQRFGEPKNIDSKSASQPAGWAGF  698



>emb|CBI32192.3| unnamed protein product [Vitis vinifera]
Length=366

 Score =   172 bits (435),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 101/180 (56%), Positives = 123/180 (68%), Gaps = 11/180 (6%)
 Frame = -2

Query  742  AEITSKFEKLSAICRSQRQEIQELKQALAAKTPSPNRDTLRNQSSPKSQTFSTPPQRETI  563
            +EITSKFEKLSAICRSQRQEIQELKQALAA+TPSPNRD  +NQ+S   Q+ +TPP  E I
Sbjct  192  SEITSKFEKLSAICRSQRQEIQELKQALAARTPSPNRDASKNQTSTGLQSAATPPHGEKI  251

Query  562  EGTVWElqqgllnqsssSPDPSAWQAFADD--GPKPLTTPPPSNTPRSMRTRN---NQPP  398
            EGTVWE         S +PD   WQAF D+    +PL+     NT +S+RTRN   N+P 
Sbjct  252  EGTVWE--LQQGKSDSPAPDSKPWQAFPDELKQHQPLSR---DNTSKSVRTRNGHHNKPA  306

Query  397  NTQDSTASAWGFGTDSFTAVPSATSQMNASFSDRNNSQRFGD-KRVDNKSASQPAGWAGF  221
                S    WGFGT+SFTA P+A+S  +      NN+Q FGD KR+++K A+QPAGWAGF
Sbjct  307  TEATSGPETWGFGTESFTATPAASSSFSRPTVGGNNAQLFGDSKRIESKPATQPAGWAGF  366



>ref|XP_011087152.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0280111 
isoform X3 [Sesamum indicum]
Length=669

 Score =   174 bits (442),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 110/178 (62%), Positives = 128/178 (72%), Gaps = 8/178 (4%)
 Frame = -2

Query  742  AEITSKFEKLSAICRSQRQEIQELKQALAAKTPSPNRDTLRNQSSPKSQTFSTPPQRETI  563
            AEITSK+EKL+AICRSQRQEIQ+LKQALAA+TPSP+R+  RN +S  SQT STP Q+E I
Sbjct  496  AEITSKYEKLTAICRSQRQEIQDLKQALAARTPSPSREPSRNLASSGSQTSSTPQQKEKI  555

Query  562  EGTVWElqqgllnqsssSPDPSAWQAFADDGPKPLTTPPPSNTPRSMRTRNNQPPN---T  392
            EGTVWELQQG  ++ S SPD   WQAF DD PKP T  P +N  RS +TRN Q  N    
Sbjct  556  EGTVWELQQGFFDRGSPSPDTQQWQAFTDD-PKPQTM-PTNNASRSAQTRNGQQSNQAAE  613

Query  391  QDSTASAWGFGTDSFTAVPSATSQMNASFSDRNNSQRFGD-KRVDNKSASQPAGWAGF  221
              S AS WGFGTDSF    SAT ++N    + NNSQRFG+ K  ++K  SQPAGWAGF
Sbjct  614  LSSGASTWGFGTDSFKV--SATPKINLPVGEFNNSQRFGESKSTESKLESQPAGWAGF  669



>ref|XP_011087160.1| PREDICTED: AP2-associated protein kinase 1 isoform X4 [Sesamum 
indicum]
 ref|XP_011087168.1| PREDICTED: AP2-associated protein kinase 1 isoform X4 [Sesamum 
indicum]
Length=626

 Score =   174 bits (440),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 110/178 (62%), Positives = 128/178 (72%), Gaps = 8/178 (4%)
 Frame = -2

Query  742  AEITSKFEKLSAICRSQRQEIQELKQALAAKTPSPNRDTLRNQSSPKSQTFSTPPQRETI  563
            AEITSK+EKL+AICRSQRQEIQ+LKQALAA+TPSP+R+  RN +S  SQT STP Q+E I
Sbjct  453  AEITSKYEKLTAICRSQRQEIQDLKQALAARTPSPSREPSRNLASSGSQTSSTPQQKEKI  512

Query  562  EGTVWElqqgllnqsssSPDPSAWQAFADDGPKPLTTPPPSNTPRSMRTRNNQPPN---T  392
            EGTVWELQQG  ++ S SPD   WQAF DD PKP T  P +N  RS +TRN Q  N    
Sbjct  513  EGTVWELQQGFFDRGSPSPDTQQWQAFTDD-PKPQTM-PTNNASRSAQTRNGQQSNQAAE  570

Query  391  QDSTASAWGFGTDSFTAVPSATSQMNASFSDRNNSQRFGD-KRVDNKSASQPAGWAGF  221
              S AS WGFGTDSF    SAT ++N    + NNSQRFG+ K  ++K  SQPAGWAGF
Sbjct  571  LSSGASTWGFGTDSFKV--SATPKINLPVGEFNNSQRFGESKSTESKLESQPAGWAGF  626



>ref|XP_011087144.1| PREDICTED: AP2-associated protein kinase 1 isoform X2 [Sesamum 
indicum]
Length=690

 Score =   174 bits (441),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 110/178 (62%), Positives = 128/178 (72%), Gaps = 8/178 (4%)
 Frame = -2

Query  742  AEITSKFEKLSAICRSQRQEIQELKQALAAKTPSPNRDTLRNQSSPKSQTFSTPPQRETI  563
            AEITSK+EKL+AICRSQRQEIQ+LKQALAA+TPSP+R+  RN +S  SQT STP Q+E I
Sbjct  517  AEITSKYEKLTAICRSQRQEIQDLKQALAARTPSPSREPSRNLASSGSQTSSTPQQKEKI  576

Query  562  EGTVWElqqgllnqsssSPDPSAWQAFADDGPKPLTTPPPSNTPRSMRTRNNQPPN---T  392
            EGTVWELQQG  ++ S SPD   WQAF DD PKP T  P +N  RS +TRN Q  N    
Sbjct  577  EGTVWELQQGFFDRGSPSPDTQQWQAFTDD-PKPQTM-PTNNASRSAQTRNGQQSNQAAE  634

Query  391  QDSTASAWGFGTDSFTAVPSATSQMNASFSDRNNSQRFGD-KRVDNKSASQPAGWAGF  221
              S AS WGFGTDSF    SAT ++N    + NNSQRFG+ K  ++K  SQPAGWAGF
Sbjct  635  LSSGASTWGFGTDSFKV--SATPKINLPVGEFNNSQRFGESKSTESKLESQPAGWAGF  690



>emb|CDP07693.1| unnamed protein product [Coffea canephora]
Length=384

 Score =   169 bits (428),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 104/182 (57%), Positives = 132/182 (73%), Gaps = 17/182 (9%)
 Frame = -2

Query  742  AEITSKFEKLSAICRSQRQEIQELKQALAAKTPSPNRDTLRNQSSPKSQTFSTPPQRETI  563
            AEITSK+EKLSAICRSQRQEI ELKQALAA+TPSP R++ + Q+S  S   + P  +E +
Sbjct  212  AEITSKYEKLSAICRSQRQEIHELKQALAARTPSPKRESFKTQASFASHPSTAP--KEKV  269

Query  562  EGTVWElqqgllnqsssSPDPSAWQAFADDGPKPLTTPPP----SNTPRSMRTRN---NQ  404
            EGTVWELQQGLL+QSS+SPDP AWQAFADD       PPP    ++  RS+RTRN   N 
Sbjct  270  EGTVWELQQGLLDQSSTSPDPRAWQAFADD-------PPPQTSVNSNSRSVRTRNGRQNN  322

Query  403  PPNTQDSTASAWGFGTDSFTAVPSATSQMNASFSDRNNSQRFGDKR-VDNKSASQPAGWA  227
              +  +S A+ WGFGTD+F A P+A+S +NA   +  NSQRF +++ +++   SQPAGWA
Sbjct  323  HVSEVNSGANTWGFGTDNFKAAPAASSHINAHTVEATNSQRFSERKDIESSQTSQPAGWA  382

Query  226  GF  221
            GF
Sbjct  383  GF  384



>ref|XP_004306499.1| PREDICTED: AP2-associated protein kinase 1 isoform X1 [Fragaria 
vesca subsp. vesca]
 ref|XP_011468798.1| PREDICTED: AP2-associated protein kinase 1 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=682

 Score =   172 bits (437),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 100/179 (56%), Positives = 130/179 (73%), Gaps = 9/179 (5%)
 Frame = -2

Query  742  AEITSKFEKLSAICRSQRQEIQELKQALAAKTPSPNRDTLRNQSSPKSQTFSTPPQRETI  563
            AEITSKFEKLSAICRSQRQE+QELKQ LAA+TPSPN+D +RNQ SP  Q+ +TPPQRE I
Sbjct  508  AEITSKFEKLSAICRSQRQELQELKQTLAARTPSPNKDAMRNQMSPGIQSSATPPQREKI  567

Query  562  EGTVWElqqgllnqsssSPDPSAWQAFADDGPKPLTTPPPSNTPRSMRTRN---NQPPNT  392
            EG ++ELQQ   ++ + SP+  +WQ FA+    PL      N+ +S+RTRN   N+   T
Sbjct  568  EGPIYELQQDKSDRKTPSPETKSWQPFAE----PLQPSSTDNSVKSVRTRNGHQNKQATT  623

Query  391  Q-DSTASAWGFGTDSFTAVPSATSQMNASFSDRNNSQRFGD-KRVDNKSASQPAGWAGF  221
            Q +S   +WGFGT+SF+A P+ ++Q+     + N SQRFGD K +++K ASQPAGWAGF
Sbjct  624  QVNSGFDSWGFGTESFSAAPTGSTQIPRPMGEGNISQRFGDTKAMESKPASQPAGWAGF  682



>ref|XP_010659599.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0276461 
isoform X1 [Vitis vinifera]
Length=711

 Score =   171 bits (434),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 101/180 (56%), Positives = 123/180 (68%), Gaps = 11/180 (6%)
 Frame = -2

Query  742  AEITSKFEKLSAICRSQRQEIQELKQALAAKTPSPNRDTLRNQSSPKSQTFSTPPQRETI  563
            +EITSKFEKLSAICRSQRQEIQELKQALAA+TPSPNRD  +NQ+S   Q+ +TPP  E I
Sbjct  537  SEITSKFEKLSAICRSQRQEIQELKQALAARTPSPNRDASKNQTSTGLQSAATPPHGEKI  596

Query  562  EGTVWElqqgllnqsssSPDPSAWQAFADD--GPKPLTTPPPSNTPRSMRTRN---NQPP  398
            EGTVWE         S +PD   WQAF D+    +PL+     NT +S+RTRN   N+P 
Sbjct  597  EGTVWE--LQQGKSDSPAPDSKPWQAFPDELKQHQPLSR---DNTSKSVRTRNGHHNKPA  651

Query  397  NTQDSTASAWGFGTDSFTAVPSATSQMNASFSDRNNSQRFGD-KRVDNKSASQPAGWAGF  221
                S    WGFGT+SFTA P+A+S  +      NN+Q FGD KR+++K A+QPAGWAGF
Sbjct  652  TEATSGPETWGFGTESFTATPAASSSFSRPTVGGNNAQLFGDSKRIESKPATQPAGWAGF  711



>ref|XP_010659600.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0276461 
isoform X2 [Vitis vinifera]
Length=710

 Score =   171 bits (434),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 101/180 (56%), Positives = 123/180 (68%), Gaps = 11/180 (6%)
 Frame = -2

Query  742  AEITSKFEKLSAICRSQRQEIQELKQALAAKTPSPNRDTLRNQSSPKSQTFSTPPQRETI  563
            +EITSKFEKLSAICRSQRQEIQELKQALAA+TPSPNRD  +NQ+S   Q+ +TPP  E I
Sbjct  536  SEITSKFEKLSAICRSQRQEIQELKQALAARTPSPNRDASKNQTSTGLQSAATPPHGEKI  595

Query  562  EGTVWElqqgllnqsssSPDPSAWQAFADD--GPKPLTTPPPSNTPRSMRTRN---NQPP  398
            EGTVWE         S +PD   WQAF D+    +PL+     NT +S+RTRN   N+P 
Sbjct  596  EGTVWE--LQQGKSDSPAPDSKPWQAFPDELKQHQPLSR---DNTSKSVRTRNGHHNKPA  650

Query  397  NTQDSTASAWGFGTDSFTAVPSATSQMNASFSDRNNSQRFGD-KRVDNKSASQPAGWAGF  221
                S    WGFGT+SFTA P+A+S  +      NN+Q FGD KR+++K A+QPAGWAGF
Sbjct  651  TEATSGPETWGFGTESFTATPAASSSFSRPTVGGNNAQLFGDSKRIESKPATQPAGWAGF  710



>ref|XP_010659601.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0276461 
isoform X3 [Vitis vinifera]
Length=698

 Score =   171 bits (434),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 101/180 (56%), Positives = 123/180 (68%), Gaps = 11/180 (6%)
 Frame = -2

Query  742  AEITSKFEKLSAICRSQRQEIQELKQALAAKTPSPNRDTLRNQSSPKSQTFSTPPQRETI  563
            +EITSKFEKLSAICRSQRQEIQELKQALAA+TPSPNRD  +NQ+S   Q+ +TPP  E I
Sbjct  524  SEITSKFEKLSAICRSQRQEIQELKQALAARTPSPNRDASKNQTSTGLQSAATPPHGEKI  583

Query  562  EGTVWElqqgllnqsssSPDPSAWQAFADD--GPKPLTTPPPSNTPRSMRTRN---NQPP  398
            EGTVWE         S +PD   WQAF D+    +PL+     NT +S+RTRN   N+P 
Sbjct  584  EGTVWE--LQQGKSDSPAPDSKPWQAFPDELKQHQPLSR---DNTSKSVRTRNGHHNKPA  638

Query  397  NTQDSTASAWGFGTDSFTAVPSATSQMNASFSDRNNSQRFGD-KRVDNKSASQPAGWAGF  221
                S    WGFGT+SFTA P+A+S  +      NN+Q FGD KR+++K A+QPAGWAGF
Sbjct  639  TEATSGPETWGFGTESFTATPAASSSFSRPTVGGNNAQLFGDSKRIESKPATQPAGWAGF  698



>ref|XP_011087141.1| PREDICTED: AP2-associated protein kinase 1 isoform X1 [Sesamum 
indicum]
Length=695

 Score =   171 bits (432),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 110/178 (62%), Positives = 128/178 (72%), Gaps = 9/178 (5%)
 Frame = -2

Query  742  AEITSKFEKLSAICRSQRQEIQELKQALAAKTPSPNRDTLRNQSSPKSQTFSTPPQRETI  563
            AEITSK+EKL+AICRSQRQEIQ+LKQALAA+TPSP+R+  RN +S  SQT ST PQ+E I
Sbjct  523  AEITSKYEKLTAICRSQRQEIQDLKQALAARTPSPSREPSRNLASSGSQTSST-PQKEKI  581

Query  562  EGTVWElqqgllnqsssSPDPSAWQAFADDGPKPLTTPPPSNTPRSMRTRNNQPPN---T  392
            EGTVWELQQG  ++ S SPD   WQAF DD PKP T  P +N  RS +TRN Q  N    
Sbjct  582  EGTVWELQQGFFDRGSPSPDTQQWQAFTDD-PKPQTM-PTNNASRSAQTRNGQQSNQAAE  639

Query  391  QDSTASAWGFGTDSFTAVPSATSQMNASFSDRNNSQRFGD-KRVDNKSASQPAGWAGF  221
              S AS WGFGTDSF    SAT ++N    + NNSQRFG+ K  ++K  SQPAGWAGF
Sbjct  640  LSSGASTWGFGTDSFKV--SATPKINLPVGEFNNSQRFGESKSTESKLESQPAGWAGF  695



>ref|XP_010095876.1| putative serine/threonine-protein kinase [Morus notabilis]
 gb|EXC42162.1| putative serine/threonine-protein kinase [Morus notabilis]
Length=652

 Score =   170 bits (431),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 102/179 (57%), Positives = 131/179 (73%), Gaps = 7/179 (4%)
 Frame = -2

Query  742  AEITSKFEKLSAICRSQRQEIQELKQALAAKTPSPNRDTLRNQSSPKSQTFSTPPQRETI  563
            AEITSKFEKLS ICRSQRQEIQELKQA+AA TPSPN+DT RNQ+SP  +  + P Q++ I
Sbjct  476  AEITSKFEKLSTICRSQRQEIQELKQAVAATTPSPNKDTSRNQTSPGVRPSAAPLQKDNI  535

Query  562  EGTVWElqqgllnqsssSPDPSAWQAFADDGPKPLTTPPPSNTPRSMRTRNNQPPNTQ--  389
            EGTV ELQQ   ++++ SP P  WQAF ++       PP SNT +S+RTRN  P N Q  
Sbjct  536  EGTVRELQQEKDSRNTMSPKPRMWQAFPEEPKPQ-QPPPSSNTVKSVRTRNG-PQNKQAT  593

Query  388  --DSTASAWGFGTDSFTAVPSATSQMNASFSDRNNSQRFGDKRV-DNKSASQPAGWAGF  221
              +S   +WGFGT+SFTA+P+ +SQM+ S ++ NNSQ  G+ ++ ++K ASQPAGWAGF
Sbjct  594  QVNSGFDSWGFGTESFTAIPTGSSQMSRSLAEGNNSQHTGEAKIMESKPASQPAGWAGF  652



>ref|XP_006439043.1| hypothetical protein CICLE_v10030862mg [Citrus clementina]
 gb|ESR52283.1| hypothetical protein CICLE_v10030862mg [Citrus clementina]
Length=693

 Score =   170 bits (431),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 100/179 (56%), Positives = 128/179 (72%), Gaps = 13/179 (7%)
 Frame = -2

Query  742  AEITSKFEKLSAICRSQRQEIQELKQALAAKTPSPNRDTLRNQSSPKSQTFSTPP-QRET  566
            AEITSKFEKLSAICRSQRQEIQELKQALAA+ PSPN+D   NQ+SP +++F+TPP QRE 
Sbjct  523  AEITSKFEKLSAICRSQRQEIQELKQALAARLPSPNKDAAINQTSPGNESFATPPLQREK  582

Query  565  IEGTVWElqqgllnqsssSPDPSAWQAFADDGPKPLTTPPPSNTPRSMRTRNNQP-PNTQ  389
            IEGT+WE         + SP+  +WQAFA+D PK    P   NT +S+RTRN     +T 
Sbjct  583  IEGTIWE---LKSEWGTPSPESKSWQAFAED-PK----PQQQNTAQSVRTRNGHLNKHTA  634

Query  388  DSTAS--AWGFGTDSFTAVPSATSQMNASFSDRNNSQRFG-DKRVDNKSASQPAGWAGF  221
             ST+   +WGFGT+SFTA+P+A SQ +   ++ N+SQ  G  K  +N+ ++QPAGWAGF
Sbjct  635  QSTSGFDSWGFGTESFTAIPAANSQRSKPITEGNSSQSIGRSKTTENQPSAQPAGWAGF  693



>ref|XP_006482821.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0276461-like 
isoform X1 [Citrus sinensis]
 ref|XP_006482822.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0276461-like 
isoform X2 [Citrus sinensis]
Length=693

 Score =   170 bits (431),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 100/179 (56%), Positives = 128/179 (72%), Gaps = 13/179 (7%)
 Frame = -2

Query  742  AEITSKFEKLSAICRSQRQEIQELKQALAAKTPSPNRDTLRNQSSPKSQTFSTPP-QRET  566
            AEITSKFEKLSAICRSQRQEIQELKQALAA+ PSPN+D   NQ+SP +++F+TPP QRE 
Sbjct  523  AEITSKFEKLSAICRSQRQEIQELKQALAARLPSPNKDAAINQTSPGNESFATPPLQREK  582

Query  565  IEGTVWElqqgllnqsssSPDPSAWQAFADDGPKPLTTPPPSNTPRSMRTRNNQP-PNTQ  389
            IEGT+WE         + SP+  +WQAFA+D PK    P   NT +S+RTRN     +T 
Sbjct  583  IEGTIWE---LKSEWGTPSPESKSWQAFAED-PK----PQQQNTAQSVRTRNGHLNKHTA  634

Query  388  DSTAS--AWGFGTDSFTAVPSATSQMNASFSDRNNSQRFG-DKRVDNKSASQPAGWAGF  221
             ST+   +WGFGT+SFTA+P+A SQ +   ++ N+SQ  G  K  +N+ ++QPAGWAGF
Sbjct  635  QSTSGFDSWGFGTESFTAIPAANSQRSKPITEGNSSQSIGRSKTTENQPSAQPAGWAGF  693



>gb|KDO46087.1| hypothetical protein CISIN_1g005558mg [Citrus sinensis]
Length=422

 Score =   167 bits (423),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 99/178 (56%), Positives = 127/178 (71%), Gaps = 13/178 (7%)
 Frame = -2

Query  742  AEITSKFEKLSAICRSQRQEIQELKQALAAKTPSPNRDTLRNQSSPKSQTFSTPPQRETI  563
            AEITSKFEKLSAICRSQRQEIQELKQALAA+ PSPN+D   NQ+SP +++F+TPP RE I
Sbjct  254  AEITSKFEKLSAICRSQRQEIQELKQALAARLPSPNKDAAINQTSPGNESFATPP-REKI  312

Query  562  EGTVWElqqgllnqsssSPDPSAWQAFADDGPKPLTTPPPSNTPRSMRTRNNQP-PNTQD  386
            EGT+WE         + SP+  +WQAFA+D PKP       NT +S+RTRN     +T  
Sbjct  313  EGTIWE---LKSEWGTPSPESKSWQAFAED-PKPQQ----QNTAQSVRTRNGHLNKHTAQ  364

Query  385  STAS--AWGFGTDSFTAVPSATSQMNASFSDRNNSQRFG-DKRVDNKSASQPAGWAGF  221
            ST+   +WGFGT+SFTA+P+A SQ +   ++ N+SQ  G  K  +N+ ++QPAGWAGF
Sbjct  365  STSGFDSWGFGTESFTAIPAANSQRSKPITEGNSSQSIGRSKTTENQPSAQPAGWAGF  422



>ref|XP_006482823.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0276461-like 
isoform X3 [Citrus sinensis]
Length=692

 Score =   170 bits (431),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 100/179 (56%), Positives = 128/179 (72%), Gaps = 13/179 (7%)
 Frame = -2

Query  742  AEITSKFEKLSAICRSQRQEIQELKQALAAKTPSPNRDTLRNQSSPKSQTFSTPP-QRET  566
            AEITSKFEKLSAICRSQRQEIQELKQALAA+ PSPN+D   NQ+SP +++F+TPP QRE 
Sbjct  522  AEITSKFEKLSAICRSQRQEIQELKQALAARLPSPNKDAAINQTSPGNESFATPPLQREK  581

Query  565  IEGTVWElqqgllnqsssSPDPSAWQAFADDGPKPLTTPPPSNTPRSMRTRNNQP-PNTQ  389
            IEGT+WE         + SP+  +WQAFA+D PK    P   NT +S+RTRN     +T 
Sbjct  582  IEGTIWE---LKSEWGTPSPESKSWQAFAED-PK----PQQQNTAQSVRTRNGHLNKHTA  633

Query  388  DSTAS--AWGFGTDSFTAVPSATSQMNASFSDRNNSQRFG-DKRVDNKSASQPAGWAGF  221
             ST+   +WGFGT+SFTA+P+A SQ +   ++ N+SQ  G  K  +N+ ++QPAGWAGF
Sbjct  634  QSTSGFDSWGFGTESFTAIPAANSQRSKPITEGNSSQSIGRSKTTENQPSAQPAGWAGF  692



>ref|XP_006439041.1| hypothetical protein CICLE_v10030862mg [Citrus clementina]
 ref|XP_006439042.1| hypothetical protein CICLE_v10030862mg [Citrus clementina]
 gb|ESR52281.1| hypothetical protein CICLE_v10030862mg [Citrus clementina]
 gb|ESR52282.1| hypothetical protein CICLE_v10030862mg [Citrus clementina]
Length=692

 Score =   170 bits (431),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 100/179 (56%), Positives = 128/179 (72%), Gaps = 13/179 (7%)
 Frame = -2

Query  742  AEITSKFEKLSAICRSQRQEIQELKQALAAKTPSPNRDTLRNQSSPKSQTFSTPP-QRET  566
            AEITSKFEKLSAICRSQRQEIQELKQALAA+ PSPN+D   NQ+SP +++F+TPP QRE 
Sbjct  522  AEITSKFEKLSAICRSQRQEIQELKQALAARLPSPNKDAAINQTSPGNESFATPPLQREK  581

Query  565  IEGTVWElqqgllnqsssSPDPSAWQAFADDGPKPLTTPPPSNTPRSMRTRNNQP-PNTQ  389
            IEGT+WE         + SP+  +WQAFA+D PK    P   NT +S+RTRN     +T 
Sbjct  582  IEGTIWE---LKSEWGTPSPESKSWQAFAED-PK----PQQQNTAQSVRTRNGHLNKHTA  633

Query  388  DSTAS--AWGFGTDSFTAVPSATSQMNASFSDRNNSQRFG-DKRVDNKSASQPAGWAGF  221
             ST+   +WGFGT+SFTA+P+A SQ +   ++ N+SQ  G  K  +N+ ++QPAGWAGF
Sbjct  634  QSTSGFDSWGFGTESFTAIPAANSQRSKPITEGNSSQSIGRSKTTENQPSAQPAGWAGF  692



>gb|KDO46085.1| hypothetical protein CISIN_1g005558mg [Citrus sinensis]
Length=690

 Score =   168 bits (426),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 99/178 (56%), Positives = 127/178 (71%), Gaps = 13/178 (7%)
 Frame = -2

Query  742  AEITSKFEKLSAICRSQRQEIQELKQALAAKTPSPNRDTLRNQSSPKSQTFSTPPQRETI  563
            AEITSKFEKLSAICRSQRQEIQELKQALAA+ PSPN+D   NQ+SP +++F+TPP RE I
Sbjct  522  AEITSKFEKLSAICRSQRQEIQELKQALAARLPSPNKDAAINQTSPGNESFATPP-REKI  580

Query  562  EGTVWElqqgllnqsssSPDPSAWQAFADDGPKPLTTPPPSNTPRSMRTRNNQP-PNTQD  386
            EGT+WE         + SP+  +WQAFA+D PK    P   NT +S+RTRN     +T  
Sbjct  581  EGTIWE---LKSEWGTPSPESKSWQAFAED-PK----PQQQNTAQSVRTRNGHLNKHTAQ  632

Query  385  STAS--AWGFGTDSFTAVPSATSQMNASFSDRNNSQRFG-DKRVDNKSASQPAGWAGF  221
            ST+   +WGFGT+SFTA+P+A SQ +   ++ N+SQ  G  K  +N+ ++QPAGWAGF
Sbjct  633  STSGFDSWGFGTESFTAIPAANSQRSKPITEGNSSQSIGRSKTTENQPSAQPAGWAGF  690



>ref|XP_006439040.1| hypothetical protein CICLE_v10030862mg [Citrus clementina]
 ref|XP_006439044.1| hypothetical protein CICLE_v10030862mg [Citrus clementina]
 gb|ESR52280.1| hypothetical protein CICLE_v10030862mg [Citrus clementina]
 gb|ESR52284.1| hypothetical protein CICLE_v10030862mg [Citrus clementina]
Length=690

 Score =   168 bits (425),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 99/178 (56%), Positives = 127/178 (71%), Gaps = 13/178 (7%)
 Frame = -2

Query  742  AEITSKFEKLSAICRSQRQEIQELKQALAAKTPSPNRDTLRNQSSPKSQTFSTPPQRETI  563
            AEITSKFEKLSAICRSQRQEIQELKQALAA+ PSPN+D   NQ+SP +++F+TPP RE I
Sbjct  522  AEITSKFEKLSAICRSQRQEIQELKQALAARLPSPNKDAAINQTSPGNESFATPP-REKI  580

Query  562  EGTVWElqqgllnqsssSPDPSAWQAFADDGPKPLTTPPPSNTPRSMRTRNNQP-PNTQD  386
            EGT+WE         + SP+  +WQAFA+D PK    P   NT +S+RTRN     +T  
Sbjct  581  EGTIWE---LKSEWGTPSPESKSWQAFAED-PK----PQQQNTAQSVRTRNGHLNKHTAQ  632

Query  385  STAS--AWGFGTDSFTAVPSATSQMNASFSDRNNSQRFG-DKRVDNKSASQPAGWAGF  221
            ST+   +WGFGT+SFTA+P+A SQ +   ++ N+SQ  G  K  +N+ ++QPAGWAGF
Sbjct  633  STSGFDSWGFGTESFTAIPAANSQRSKPITEGNSSQSIGRSKTTENQPSAQPAGWAGF  690



>ref|XP_006482824.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0276461-like 
isoform X4 [Citrus sinensis]
Length=691

 Score =   168 bits (425),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 99/178 (56%), Positives = 127/178 (71%), Gaps = 13/178 (7%)
 Frame = -2

Query  742  AEITSKFEKLSAICRSQRQEIQELKQALAAKTPSPNRDTLRNQSSPKSQTFSTPPQRETI  563
            AEITSKFEKLSAICRSQRQEIQELKQALAA+ PSPN+D   NQ+SP +++F+TPP RE I
Sbjct  523  AEITSKFEKLSAICRSQRQEIQELKQALAARLPSPNKDAAINQTSPGNESFATPP-REKI  581

Query  562  EGTVWElqqgllnqsssSPDPSAWQAFADDGPKPLTTPPPSNTPRSMRTRNNQP-PNTQD  386
            EGT+WE         + SP+  +WQAFA+D PK    P   NT +S+RTRN     +T  
Sbjct  582  EGTIWE---LKSEWGTPSPESKSWQAFAED-PK----PQQQNTAQSVRTRNGHLNKHTAQ  633

Query  385  STAS--AWGFGTDSFTAVPSATSQMNASFSDRNNSQRFG-DKRVDNKSASQPAGWAGF  221
            ST+   +WGFGT+SFTA+P+A SQ +   ++ N+SQ  G  K  +N+ ++QPAGWAGF
Sbjct  634  STSGFDSWGFGTESFTAIPAANSQRSKPITEGNSSQSIGRSKTTENQPSAQPAGWAGF  691



>gb|KDO46086.1| hypothetical protein CISIN_1g005558mg [Citrus sinensis]
Length=691

 Score =   168 bits (425),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 99/178 (56%), Positives = 127/178 (71%), Gaps = 13/178 (7%)
 Frame = -2

Query  742  AEITSKFEKLSAICRSQRQEIQELKQALAAKTPSPNRDTLRNQSSPKSQTFSTPPQRETI  563
            AEITSKFEKLSAICRSQRQEIQELKQALAA+ PSPN+D   NQ+SP +++F+TPP RE I
Sbjct  523  AEITSKFEKLSAICRSQRQEIQELKQALAARLPSPNKDAAINQTSPGNESFATPP-REKI  581

Query  562  EGTVWElqqgllnqsssSPDPSAWQAFADDGPKPLTTPPPSNTPRSMRTRNNQP-PNTQD  386
            EGT+WE         + SP+  +WQAFA+D PK    P   NT +S+RTRN     +T  
Sbjct  582  EGTIWE---LKSEWGTPSPESKSWQAFAED-PK----PQQQNTAQSVRTRNGHLNKHTAQ  633

Query  385  STAS--AWGFGTDSFTAVPSATSQMNASFSDRNNSQRFG-DKRVDNKSASQPAGWAGF  221
            ST+   +WGFGT+SFTA+P+A SQ +   ++ N+SQ  G  K  +N+ ++QPAGWAGF
Sbjct  634  STSGFDSWGFGTESFTAIPAANSQRSKPITEGNSSQSIGRSKTTENQPSAQPAGWAGF  691



>ref|XP_011468799.1| PREDICTED: AP2-associated protein kinase 1 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=681

 Score =   166 bits (420),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 99/179 (55%), Positives = 129/179 (72%), Gaps = 10/179 (6%)
 Frame = -2

Query  742  AEITSKFEKLSAICRSQRQEIQELKQALAAKTPSPNRDTLRNQSSPKSQTFSTPPQRETI  563
            AEITSKFEKLSAICRSQRQE+QELKQ LAA+TPSPN+D +RNQ SP  Q+ +TPP RE I
Sbjct  508  AEITSKFEKLSAICRSQRQELQELKQTLAARTPSPNKDAMRNQMSPGIQSSATPP-REKI  566

Query  562  EGTVWElqqgllnqsssSPDPSAWQAFADDGPKPLTTPPPSNTPRSMRTRN---NQPPNT  392
            EG ++ELQQ   ++ + SP+  +WQ FA+    PL      N+ +S+RTRN   N+   T
Sbjct  567  EGPIYELQQDKSDRKTPSPETKSWQPFAE----PLQPSSTDNSVKSVRTRNGHQNKQATT  622

Query  391  Q-DSTASAWGFGTDSFTAVPSATSQMNASFSDRNNSQRFGD-KRVDNKSASQPAGWAGF  221
            Q +S   +WGFGT+SF+A P+ ++Q+     + N SQRFGD K +++K ASQPAGWAGF
Sbjct  623  QVNSGFDSWGFGTESFSAAPTGSTQIPRPMGEGNISQRFGDTKAMESKPASQPAGWAGF  681



>ref|XP_010265879.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0280111 
isoform X1 [Nelumbo nucifera]
 ref|XP_010265880.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0280111 
isoform X1 [Nelumbo nucifera]
Length=701

 Score =   162 bits (411),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 107/182 (59%), Positives = 125/182 (69%), Gaps = 18/182 (10%)
 Frame = -2

Query  742  AEITSKFEKLSAICRSQRQEIQELKQALAAKTPSPNRDTLRNQSSPKSQTFSTPPQRETI  563
            AEITSK+EKLSAICRSQR EIQELKQALAA+TPSPN+D  +  S  +    ST PQRE I
Sbjct  530  AEITSKYEKLSAICRSQRLEIQELKQALAARTPSPNKDYSKTTSGSQQ---STTPQREKI  586

Query  562  EGTVWElqqgllnqsssSPDPSAWQAFADDGPKPLTTPPPS---NTPRSMRTRNN----Q  404
            EGTVWELQQGL   SS SPD   W AF+DD     T P PS   NTPRS+RT N     Q
Sbjct  587  EGTVWELQQGLFANSSPSPDSKPWNAFSDD-----TKPQPSLKNNTPRSVRTTNGRQKKQ  641

Query  403  PPNTQDSTASAWGFGTDSFTAVPSATSQMNASFSDRNNSQRFGDKR-VDNKSASQPAGWA  227
             P+ +      WGFG+D+FTAVPS+T Q+  + S  ++ +R GD R V+ K ASQPAGWA
Sbjct  642  APD-ESHGLETWGFGSDNFTAVPSST-QVTQTSSQVHSFERIGDSRSVERKKASQPAGWA  699

Query  226  GF  221
            GF
Sbjct  700  GF  701



>ref|XP_008231319.1| PREDICTED: AP2-associated protein kinase 1 isoform X1 [Prunus 
mume]
Length=699

 Score =   162 bits (410),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 97/178 (54%), Positives = 126/178 (71%), Gaps = 7/178 (4%)
 Frame = -2

Query  742  AEITSKFEKLSAICRSQRQEIQELKQALAAKTPSPNRDTLRNQSSPKSQTFSTPPQRETI  563
             EITSKFEKLSAICRSQRQE+QELKQ LAA+T SPN+D  RNQ+SP +   + P QRE I
Sbjct  525  GEITSKFEKLSAICRSQRQELQELKQTLAARTLSPNKDASRNQTSPGNLPSANPLQREKI  584

Query  562  EGTVWElqqgllnqsssSPDPSAWQAFADDGPKPLTTPPPSNTPRSMRTRNNQ--PPNTQ  389
            EG+ WE  QG  ++S+ SP+P+ WQ F ++ PK        NT +S+RTRN       TQ
Sbjct  585  EGSFWE--QGKSDRSTPSPEPNPWQPFVEE-PKSQQPSSTDNTMKSVRTRNGHQNKQTTQ  641

Query  388  DSTA-SAWGFGTDSFTAVPSATSQMNASFSDRNNSQRFGDKRV-DNKSASQPAGWAGF  221
             +T   +WGFG +SFTAVP+ ++Q++    + NNSQRFG+ +V ++K ASQPAGWAGF
Sbjct  642  VNTGFDSWGFGAESFTAVPTGSTQISRPMGEGNNSQRFGEAKVMESKPASQPAGWAGF  699



>ref|XP_010265881.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0280111 
isoform X2 [Nelumbo nucifera]
Length=700

 Score =   162 bits (410),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 107/182 (59%), Positives = 125/182 (69%), Gaps = 18/182 (10%)
 Frame = -2

Query  742  AEITSKFEKLSAICRSQRQEIQELKQALAAKTPSPNRDTLRNQSSPKSQTFSTPPQRETI  563
            AEITSK+EKLSAICRSQR EIQELKQALAA+TPSPN+D  +  S  +    ST PQRE I
Sbjct  529  AEITSKYEKLSAICRSQRLEIQELKQALAARTPSPNKDYSKTTSGSQQ---STTPQREKI  585

Query  562  EGTVWElqqgllnqsssSPDPSAWQAFADDGPKPLTTPPPS---NTPRSMRTRNN----Q  404
            EGTVWELQQGL   SS SPD   W AF+DD     T P PS   NTPRS+RT N     Q
Sbjct  586  EGTVWELQQGLFANSSPSPDSKPWNAFSDD-----TKPQPSLKNNTPRSVRTTNGRQKKQ  640

Query  403  PPNTQDSTASAWGFGTDSFTAVPSATSQMNASFSDRNNSQRFGDKR-VDNKSASQPAGWA  227
             P+ +      WGFG+D+FTAVPS+T Q+  + S  ++ +R GD R V+ K ASQPAGWA
Sbjct  641  APD-ESHGLETWGFGSDNFTAVPSST-QVTQTSSQVHSFERIGDSRSVERKKASQPAGWA  698

Query  226  GF  221
            GF
Sbjct  699  GF  700



>ref|XP_008231320.1| PREDICTED: AP2-associated protein kinase 1 isoform X2 [Prunus 
mume]
Length=698

 Score =   162 bits (410),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 97/178 (54%), Positives = 126/178 (71%), Gaps = 7/178 (4%)
 Frame = -2

Query  742  AEITSKFEKLSAICRSQRQEIQELKQALAAKTPSPNRDTLRNQSSPKSQTFSTPPQRETI  563
             EITSKFEKLSAICRSQRQE+QELKQ LAA+T SPN+D  RNQ+SP +   + P QRE I
Sbjct  524  GEITSKFEKLSAICRSQRQELQELKQTLAARTLSPNKDASRNQTSPGNLPSANPLQREKI  583

Query  562  EGTVWElqqgllnqsssSPDPSAWQAFADDGPKPLTTPPPSNTPRSMRTRNNQ--PPNTQ  389
            EG+ WE  QG  ++S+ SP+P+ WQ F ++ PK        NT +S+RTRN       TQ
Sbjct  584  EGSFWE--QGKSDRSTPSPEPNPWQPFVEE-PKSQQPSSTDNTMKSVRTRNGHQNKQTTQ  640

Query  388  DSTA-SAWGFGTDSFTAVPSATSQMNASFSDRNNSQRFGDKRV-DNKSASQPAGWAGF  221
             +T   +WGFG +SFTAVP+ ++Q++    + NNSQRFG+ +V ++K ASQPAGWAGF
Sbjct  641  VNTGFDSWGFGAESFTAVPTGSTQISRPMGEGNNSQRFGEAKVMESKPASQPAGWAGF  698



>ref|XP_010027724.1| PREDICTED: AP2-associated protein kinase 1 isoform X1 [Eucalyptus 
grandis]
Length=703

 Score =   161 bits (407),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 95/183 (52%), Positives = 122/183 (67%), Gaps = 11/183 (6%)
 Frame = -2

Query  739  EITSKFEKLSAICRSQRQEIQELKQALAAKTPSPNRDTLRNQ------SSPKSQTFSTPP  578
            E+TSK+EKLSAICRSQRQEIQELKQ+LAA+ PSP+RD +RNQ      SS  + TF    
Sbjct  522  EMTSKYEKLSAICRSQRQEIQELKQSLAARAPSPSRDAMRNQTPTRIESSAAAMTFRLIQ  581

Query  577  QRETIEGTVWElqqgllnqsssSPDPSAWQAFADDGPKPLTTPPPSNTPRSMRTRNNQPP  398
              E    T W+  Q  + ++  SP+P++WQAFADD PKP        T RS+RTRN Q  
Sbjct  582  PSEETRKTNWDTHQEKVEKNFQSPEPTSWQAFADD-PKPRQPLSRDTTSRSVRTRNGQQS  640

Query  397  NTQDSTAS---AWGFGTDSFTAVPSATSQMNASFSDRNNSQRFGDKRV-DNKSASQPAGW  230
                  AS    WGFG++SFTA+P+A+SQ++    + + SQRFGD +  +NKS+SQPAGW
Sbjct  641  KQGTQAASKNETWGFGSESFTAMPNASSQISKPIREGSTSQRFGDSKFRENKSSSQPAGW  700

Query  229  AGF  221
            AGF
Sbjct  701  AGF  703



>ref|XP_010027725.1| PREDICTED: AP2-associated protein kinase 1 isoform X2 [Eucalyptus 
grandis]
 gb|KCW54314.1| hypothetical protein EUGRSUZ_I00278 [Eucalyptus grandis]
Length=697

 Score =   160 bits (405),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 91/177 (51%), Positives = 122/177 (69%), Gaps = 5/177 (3%)
 Frame = -2

Query  739  EITSKFEKLSAICRSQRQEIQELKQALAAKTPSPNRDTLRNQSSPKSQTFSTPPQRETIE  560
            E+TSK+EKLSAICRSQRQEIQELKQ+LAA+ PSP+RD +RNQ+  + ++ +     E   
Sbjct  522  EMTSKYEKLSAICRSQRQEIQELKQSLAARAPSPSRDAMRNQTPTRIESSAAAMPSEETR  581

Query  559  GTVWElqqgllnqsssSPDPSAWQAFADDGPKPLTTPPPSNTPRSMRTRNNQPPNTQDST  380
             T W+  Q  + ++  SP+P++WQAFADD PKP        T RS+RTRN Q        
Sbjct  582  KTNWDTHQEKVEKNFQSPEPTSWQAFADD-PKPRQPLSRDTTSRSVRTRNGQQSKQGTQA  640

Query  379  AS---AWGFGTDSFTAVPSATSQMNASFSDRNNSQRFGDKRV-DNKSASQPAGWAGF  221
            AS    WGFG++SFTA+P+A+SQ++    + + SQRFGD +  +NKS+SQPAGWAGF
Sbjct  641  ASKNETWGFGSESFTAMPNASSQISKPIREGSTSQRFGDSKFRENKSSSQPAGWAGF  697



>ref|XP_008231321.1| PREDICTED: AP2-associated protein kinase 1 isoform X3 [Prunus 
mume]
Length=697

 Score =   157 bits (397),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 97/178 (54%), Positives = 125/178 (70%), Gaps = 8/178 (4%)
 Frame = -2

Query  742  AEITSKFEKLSAICRSQRQEIQELKQALAAKTPSPNRDTLRNQSSPKSQTFSTPPQRETI  563
             EITSKFEKLSAICRSQRQE+QELKQ LAA+T SPN+D  RNQ+SP +   S  P RE I
Sbjct  524  GEITSKFEKLSAICRSQRQELQELKQTLAARTLSPNKDASRNQTSPGNLP-SANPLREKI  582

Query  562  EGTVWElqqgllnqsssSPDPSAWQAFADDGPKPLTTPPPSNTPRSMRTRNNQ--PPNTQ  389
            EG+ WE  QG  ++S+ SP+P+ WQ F ++ PK        NT +S+RTRN       TQ
Sbjct  583  EGSFWE--QGKSDRSTPSPEPNPWQPFVEE-PKSQQPSSTDNTMKSVRTRNGHQNKQTTQ  639

Query  388  DSTA-SAWGFGTDSFTAVPSATSQMNASFSDRNNSQRFGDKRV-DNKSASQPAGWAGF  221
             +T   +WGFG +SFTAVP+ ++Q++    + NNSQRFG+ +V ++K ASQPAGWAGF
Sbjct  640  VNTGFDSWGFGAESFTAVPTGSTQISRPMGEGNNSQRFGEAKVMESKPASQPAGWAGF  697



>ref|XP_009339572.1| PREDICTED: AP2-associated protein kinase 1 [Pyrus x bretschneideri]
Length=688

 Score =   154 bits (390),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 98/183 (54%), Positives = 123/183 (67%), Gaps = 17/183 (9%)
 Frame = -2

Query  742  AEITSKFEKLSAICRSQRQEIQELKQALAAKTPSPNRDTLRNQSSPKSQTFSTPPQRETI  563
            AEITSKFEKLSAICRSQRQE+QELKQ LAA+TPSPN+D  RNQ+SP  Q     P RE I
Sbjct  514  AEITSKFEKLSAICRSQRQELQELKQMLAARTPSPNKDASRNQTSPGKQPSPNLPHREKI  573

Query  562  EGTVWElqqgllnqsssSPDPSAWQAFADDGPKPLTTPPPSNTP---RSMRTRNNQPPNT  392
            EG +W+       +S+ SP+   WQ FA++ PKP   P PS+T    +S RTRN    N 
Sbjct  574  EGNIWK---LQQGKSTPSPESKPWQPFAEE-PKP---PQPSSTANAFKSARTRNGH-QNK  625

Query  391  QDSTASA----WGFGTDSFTAVPSATSQMNASFSDRNNSQRFGD-KRVDN-KSASQPAGW  230
            Q +  +A    WGFG DSF+A  + ++Q++   S+ NNSQR G+ K ++N K ASQPAGW
Sbjct  626  QGTQVNAGFDSWGFGADSFSAASTESAQISRPMSEGNNSQRLGEAKGMENSKPASQPAGW  685

Query  229  AGF  221
            AGF
Sbjct  686  AGF  688



>ref|XP_010670934.1| PREDICTED: actin-regulating kinase PRK1-like [Beta vulgaris subsp. 
vulgaris]
Length=656

 Score =   145 bits (365),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 86/176 (49%), Positives = 122/176 (69%), Gaps = 5/176 (3%)
 Frame = -2

Query  742  AEITSKFEKLSAICRSQRQEIQELKQALAAKTPSPNRDTLRNQSSPKSQTFSTPPQRETI  563
            AE+TSK++KL+AICRSQR E++ELKQALAA++ SP R+  RNQSS + Q  +T  QR  I
Sbjct  484  AEMTSKYDKLTAICRSQRHELKELKQALAARSSSPKREAARNQSSSRYQ--ATNSQRVKI  541

Query  562  EGTVWElqqgllnqsssSPDPSAWQAFADDGPKPLTTPPPSNTPRSMRTRNNQPPNTQDS  383
            EGTVWELQ+GL +++S++P+P  WQAFA+D   P +   PS + ++    +++   +  S
Sbjct  542  EGTVWELQEGLFDKNSTNPEPKTWQAFANDTSTPTSIGHPSKSVKNRSGHSSKQDASVGS  601

Query  382  TASAWGFGTDSFTAVPSATSQMNASFSDRNNSQRFGD--KRVDNKSASQPAGWAGF  221
            T + WGFG D+F AV +A+S++    +  + S RFGD  K     +ASQPAGWAGF
Sbjct  602  TKNGWGFGNDNFAAVSAASSRIIRPGAG-STSLRFGDSNKLASKNTASQPAGWAGF  656



>ref|XP_008392404.1| PREDICTED: AP2-associated protein kinase 1 [Malus domestica]
Length=681

 Score =   145 bits (365),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 97/183 (53%), Positives = 122/183 (67%), Gaps = 23/183 (13%)
 Frame = -2

Query  742  AEITSKFEKLSAICRSQRQEIQELKQALAAKTPSPNRDTLRNQSSPKSQTFSTPPQRETI  563
            AEITSKFEKLSAICRSQRQE+QELKQ LAA+TPSPN+D  RNQ+SP  Q   +PP RE I
Sbjct  513  AEITSKFEKLSAICRSQRQELQELKQTLAARTPSPNKDASRNQTSPGKQP--SPPHRENI  570

Query  562  EGTVWElqqgllnqsssSPDPSAWQAFADDGPKPLTTPPPSNTP---RSMRTRNNQPPNT  392
                W+       +S+ SP+   WQ FA++ PKP   P PS+T    +S RTRN    N 
Sbjct  571  ----WK---LQQGKSTPSPESKPWQPFAEE-PKP---PQPSSTANAFKSARTRNGH-QNK  618

Query  391  QDSTASA----WGFGTDSFTAVPSATSQMNASFSDRNNSQRFGD-KRVDN-KSASQPAGW  230
            Q +  +A    WGFG DSF+A  + ++Q++   S+ NNSQR G+ K ++N K ASQPAGW
Sbjct  619  QGTQVNAGFDSWGFGADSFSAASTGSTQISRPMSEGNNSQRLGEAKGMENSKPASQPAGW  678

Query  229  AGF  221
            AGF
Sbjct  679  AGF  681



>gb|ABK92707.1| unknown [Populus trichocarpa]
Length=226

 Score =   138 bits (348),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 87/177 (49%), Positives = 116/177 (66%), Gaps = 23/177 (13%)
 Frame = -2

Query  742  AEITSKFEKLSAICRSQRQEIQELKQALAAKTPSPNRDTLRNQSSPKSQTFSTPPQRETI  563
            AEITSKFEKLSAICRSQRQEIQELKQ LAA+TPSPN    + Q+S + Q  ++PPQ    
Sbjct  70   AEITSKFEKLSAICRSQRQEIQELKQTLAARTPSPN----KYQASSRIQPSASPPQ----  121

Query  562  EGTVWElqqgllnqsssSPDPSAWQAFADDGPKPLTTPPPSNTPRSMRTRN---NQPPNT  392
            E + W         S+ SP+  +WQAFADD           N+P+S+RTRN   N+    
Sbjct  122  EKSDW---------STPSPESKSWQAFADDNKSRQKPVSKGNSPQSVRTRNAHQNKQAAE  172

Query  391  QDSTASAWGFGTDSFTAVPSATSQMNASFSDRNNSQRFGDKRVDNKSASQPAGWAGF  221
              S   +WGFG++SFTAVP+A+SQ++ S ++ ++    G K +++K A+QPAGWAGF
Sbjct  173  LTSNIDSWGFGSESFTAVPAASSQISGSNTEAHSG---GSKIMESKPATQPAGWAGF  226



>gb|EYU27100.1| hypothetical protein MIMGU_mgv1a022935mg [Erythranthe guttata]
Length=634

 Score =   143 bits (361),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 94/175 (54%), Positives = 117/175 (67%), Gaps = 21/175 (12%)
 Frame = -2

Query  739  EITSKFEKLSAICRSQRQEIQELKQALAAKTPSPNRDTLRNQSSPKSQTFSTPPQRETIE  560
            EITSK+EKLSAICRSQRQEIQELKQ+LAA+TPSP+RD+ RN  SP           E IE
Sbjct  479  EITSKYEKLSAICRSQRQEIQELKQSLAARTPSPSRDSSRNLVSPN----------EKIE  528

Query  559  GTVWElqqgllnqsssSPDPSAWQAFADDGPKPLTTPPPSNTPRSMRTRNNQPPNTQDST  380
            GTVWELQQGL ++SS S D   WQAF+DD         PS+ P+S+RTRN  P N Q   
Sbjct  529  GTVWELQQGLFDRSSKSSDSQQWQAFSDD--------KPSSAPKSVRTRNT-PQNNQKVE  579

Query  379  ASAWGFGTDSFTAVP-SATSQMNASFSDRNNSQRFGDKRVD-NKSASQPAGWAGF  221
             ++WGF T+SF  VP +A+S ++      N SQRF +++ +  K  + PAGWAGF
Sbjct  580  TNSWGFETESFKVVPNAASSNVSVPVGGLNVSQRFVEQKSNKGKLDAPPAGWAGF  634



>ref|XP_007220628.1| hypothetical protein PRUPE_ppa002321mg [Prunus persica]
 gb|EMJ21827.1| hypothetical protein PRUPE_ppa002321mg [Prunus persica]
Length=687

 Score =   143 bits (361),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 86/178 (48%), Positives = 116/178 (65%), Gaps = 18/178 (10%)
 Frame = -2

Query  742  AEITSKFEKLSAICRSQRQEIQELKQALAAKTPSPNRDTLRNQSSPKSQTFSTPPQRETI  563
             EITSKFEKLSAICRSQRQE+QELKQ LAA+TPSPN+D  RNQ+SP        P    +
Sbjct  524  GEITSKFEKLSAICRSQRQELQELKQTLAARTPSPNKDASRNQTSP-----GILPSANLL  578

Query  562  EGTVWElqqgllnqsssSPDPSAWQAFADDGPKPLTTPPPSNTPRSMRTRN---NQPPNT  392
            +G          ++S+ SP+P+ WQ F ++ PK        NT +S+RTRN   N+    
Sbjct  579  QG--------KSDRSTPSPEPNPWQPFVEE-PKSQQPSSTDNTMKSVRTRNGHQNKQSTK  629

Query  391  QDSTASAWGFGTDSFTAVPSATSQMNASFSDRNNSQRFGDKRV-DNKSASQPAGWAGF  221
             ++   +WGFG +SFTAVP+ ++Q++    + NNSQ FG+ +V ++K ASQPAGWAGF
Sbjct  630  VNTGFDSWGFGAESFTAVPTGSTQISRPMGEGNNSQHFGEAKVMESKPASQPAGWAGF  687



>ref|XP_007052604.1| Serine/threonine-protein kinase DDB_G0280111 isoform 1 [Theobroma 
cacao]
 gb|EOX96761.1| Serine/threonine-protein kinase DDB_G0280111 isoform 1 [Theobroma 
cacao]
Length=688

 Score =   143 bits (361),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 89/179 (50%), Positives = 114/179 (64%), Gaps = 7/179 (4%)
 Frame = -2

Query  742  AEITSKFEKLSAICRSQRQEIQELKQALAAKTPSPNRDTLRNQSSPKSQTFSTPPQRETI  563
             E+TSKFEKLSAICRSQRQEIQELKQALAA+TPSPN+ T   Q+ P S   +   QRE +
Sbjct  512  VEMTSKFEKLSAICRSQRQEIQELKQALAARTPSPNKSTSIKQNLPGSH-HAGSVQREKV  570

Query  562  EGTVWElqqgllnq-sssSPDPSAWQAFADDGPKPLTTPPPSNTPRSMRTRN---NQPPN  395
            EG +WE  Q    + +++SP+   WQAF++D      +    N  RS+RTRN   N+   
Sbjct  571  EGKLWEFPQEKSAEWTTASPEAKPWQAFSEDAKLQQQSLSKDNV-RSVRTRNGHSNKHVA  629

Query  394  TQDSTASAWGFGTDSFTAVPSATSQMNASFSDRNNSQRFGDKRV-DNKSASQPAGWAGF  221
               S    W FGTDSFTA P+A+ Q     S+ ++SQRFG+  + +N   SQPAGWAGF
Sbjct  630  EATSGLDTWSFGTDSFTAAPAASPQRLKPMSEGSSSQRFGESMIKENHPTSQPAGWAGF  688



>ref|XP_010522378.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0276461 
isoform X1 [Tarenaya hassleriana]
 ref|XP_010522379.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0276461 
isoform X1 [Tarenaya hassleriana]
 ref|XP_010522380.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0276461 
isoform X1 [Tarenaya hassleriana]
 ref|XP_010522382.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0276461 
isoform X1 [Tarenaya hassleriana]
Length=649

 Score =   143 bits (360),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 97/190 (51%), Positives = 120/190 (63%), Gaps = 22/190 (12%)
 Frame = -2

Query  742  AEITSKFEKLSAICRSQRQEIQELKQALAAKTPSPNRDTLRNQSSPKSQTFS----TPPQ  575
            AEIT+KFEKLSAICRSQRQE+QELKQ LA+KT S +     ++ SP+++T S    T PQ
Sbjct  466  AEITAKFEKLSAICRSQRQELQELKQTLASKTASSS-----SRESPQTRTSSGARATSPQ  520

Query  574  RETIEGTVWElqqgllnqsssSPDPSAWQAFADDGPKP-LTTPPPSN---TPRSMRTRNN  407
            RE IEGT+WELQQ   + ++   D   WQAF+DD PKP L T    N   T +S  TRN+
Sbjct  521  REKIEGTMWELQQDRSDWATGKSDLKPWQAFSDD-PKPNLQTASKGNNTSTNQSFGTRNS  579

Query  406  QPPNTQDSTA-------SAWGFGTDSFTAVPSATSQMNASFSDRNNSQRFGDKRV-DNKS  251
            QP      TA        +WGF TDSF A P++ S         N SQRFG+ RV DN+ 
Sbjct  580  QPSKQTTLTAVPTSQGFDSWGFETDSFRATPTSASATQRPLGSGNTSQRFGNSRVRDNQQ  639

Query  250  ASQPAGWAGF  221
            A+QPAGW+GF
Sbjct  640  AAQPAGWSGF  649



>ref|XP_007052606.1| Serine/threonine-protein kinase DDB_G0280111 isoform 3 [Theobroma 
cacao]
 gb|EOX96763.1| Serine/threonine-protein kinase DDB_G0280111 isoform 3 [Theobroma 
cacao]
Length=679

 Score =   143 bits (361),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 89/179 (50%), Positives = 114/179 (64%), Gaps = 7/179 (4%)
 Frame = -2

Query  742  AEITSKFEKLSAICRSQRQEIQELKQALAAKTPSPNRDTLRNQSSPKSQTFSTPPQRETI  563
             E+TSKFEKLSAICRSQRQEIQELKQALAA+TPSPN+ T   Q+ P S   +   QRE +
Sbjct  503  VEMTSKFEKLSAICRSQRQEIQELKQALAARTPSPNKSTSIKQNLPGSH-HAGSVQREKV  561

Query  562  EGTVWElqqgllnq-sssSPDPSAWQAFADDGPKPLTTPPPSNTPRSMRTRN---NQPPN  395
            EG +WE  Q    + +++SP+   WQAF++D      +    N  RS+RTRN   N+   
Sbjct  562  EGKLWEFPQEKSAEWTTASPEAKPWQAFSEDAKLQQQSLSKDNV-RSVRTRNGHSNKHVA  620

Query  394  TQDSTASAWGFGTDSFTAVPSATSQMNASFSDRNNSQRFGDKRV-DNKSASQPAGWAGF  221
               S    W FGTDSFTA P+A+ Q     S+ ++SQRFG+  + +N   SQPAGWAGF
Sbjct  621  EATSGLDTWSFGTDSFTAAPAASPQRLKPMSEGSSSQRFGESMIKENHPTSQPAGWAGF  679



>ref|XP_007052605.1| Serine/threonine-protein kinase DDB_G0280111 isoform 2 [Theobroma 
cacao]
 gb|EOX96762.1| Serine/threonine-protein kinase DDB_G0280111 isoform 2 [Theobroma 
cacao]
Length=678

 Score =   141 bits (355),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 88/179 (49%), Positives = 113/179 (63%), Gaps = 8/179 (4%)
 Frame = -2

Query  742  AEITSKFEKLSAICRSQRQEIQELKQALAAKTPSPNRDTLRNQSSPKSQTFSTPPQRETI  563
             E+TSKFEKLSAICRSQRQEIQELKQALAA+TPSPN+ T   Q+ P S    +   RE +
Sbjct  503  VEMTSKFEKLSAICRSQRQEIQELKQALAARTPSPNKSTSIKQNLPGSHHAGSV--REKV  560

Query  562  EGTVWElqqgllnq-sssSPDPSAWQAFADDGPKPLTTPPPSNTPRSMRTRN---NQPPN  395
            EG +WE  Q    + +++SP+   WQAF++D      +    N  RS+RTRN   N+   
Sbjct  561  EGKLWEFPQEKSAEWTTASPEAKPWQAFSEDAKLQQQSLSKDNV-RSVRTRNGHSNKHVA  619

Query  394  TQDSTASAWGFGTDSFTAVPSATSQMNASFSDRNNSQRFGDKRV-DNKSASQPAGWAGF  221
               S    W FGTDSFTA P+A+ Q     S+ ++SQRFG+  + +N   SQPAGWAGF
Sbjct  620  EATSGLDTWSFGTDSFTAAPAASPQRLKPMSEGSSSQRFGESMIKENHPTSQPAGWAGF  678



>ref|XP_002512151.1| serine/threonine protein kinase, putative [Ricinus communis]
 gb|EEF50185.1| serine/threonine protein kinase, putative [Ricinus communis]
Length=622

 Score =   139 bits (350),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 90/178 (51%), Positives = 120/178 (67%), Gaps = 26/178 (15%)
 Frame = -2

Query  742  AEITSKFEKLSAICRSQRQEIQELKQALAAKTPSPNRDTLRNQSSPKSQTFSTPPQRETI  563
            AE+TSK+EKLSAICRSQRQEIQELKQ +AA+TPSPN    + Q+SPK+Q     P   T+
Sbjct  467  AEMTSKYEKLSAICRSQRQEIQELKQVVAARTPSPN----KYQASPKTQ-----PSTNTL  517

Query  562  EG-TVWElqqgllnqsssSPDPSAWQAFADDGPKPLTTPP-PSNTPRSMRTRN-NQPPNT  392
            +G + W         S  SPD   W AFADD  KP   PP   N+P+S+RTRN NQ    
Sbjct  518  QGESDW---------SIPSPDQKPWHAFADDS-KPQQQPPSKGNSPQSVRTRNANQ---R  564

Query  391  QDSTASAWGFGTDSFTAVPSATSQMNASFSDRNNSQRF-GDKRVDNKSASQPAGWAGF  221
            + + + +WGFG DSFTA P+A++Q +   ++ N+SQ F G K +++++A+QPAGWAGF
Sbjct  565  KQAESESWGFGADSFTAAPAASTQTSRPINEGNSSQHFSGTKIMESQAATQPAGWAGF  622



>ref|XP_006369447.1| hypothetical protein POPTR_0001s23520g [Populus trichocarpa]
 gb|ERP66016.1| hypothetical protein POPTR_0001s23520g [Populus trichocarpa]
Length=666

 Score =   138 bits (348),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 87/177 (49%), Positives = 116/177 (66%), Gaps = 23/177 (13%)
 Frame = -2

Query  742  AEITSKFEKLSAICRSQRQEIQELKQALAAKTPSPNRDTLRNQSSPKSQTFSTPPQRETI  563
            AEITSKFEKLSAICRSQRQEIQELKQ LAA+TPSPN    + Q+S + Q  ++PPQ    
Sbjct  510  AEITSKFEKLSAICRSQRQEIQELKQTLAARTPSPN----KYQASSRIQPSASPPQ----  561

Query  562  EGTVWElqqgllnqsssSPDPSAWQAFADDGPKPLTTPPPSNTPRSMRTRN---NQPPNT  392
            E + W         S+ SP+  +WQAFADD           N+P+S+RTRN   N+    
Sbjct  562  EKSDW---------STPSPESKSWQAFADDNKSRQKPVSKGNSPQSVRTRNAHQNKQAAE  612

Query  391  QDSTASAWGFGTDSFTAVPSATSQMNASFSDRNNSQRFGDKRVDNKSASQPAGWAGF  221
              S   +WGFG++SFTAVP+A+SQ++ S ++ ++    G K +++K A+QPAGWAGF
Sbjct  613  LTSNIDSWGFGSESFTAVPAASSQISGSNTEAHSG---GSKIMESKPATQPAGWAGF  666



>ref|XP_010522383.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0276461 
isoform X2 [Tarenaya hassleriana]
Length=648

 Score =   136 bits (343),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 96/190 (51%), Positives = 119/190 (63%), Gaps = 23/190 (12%)
 Frame = -2

Query  742  AEITSKFEKLSAICRSQRQEIQELKQALAAKTPSPNRDTLRNQSSPKSQTFS----TPPQ  575
            AEIT+KFEKLSAICRSQRQE+QELKQ LA+KT S +     ++ SP+++T S    T P 
Sbjct  466  AEITAKFEKLSAICRSQRQELQELKQTLASKTASSS-----SRESPQTRTSSGARATSP-  519

Query  574  RETIEGTVWElqqgllnqsssSPDPSAWQAFADDGPKP-LTTPPPSN---TPRSMRTRNN  407
            RE IEGT+WELQQ   + ++   D   WQAF+DD PKP L T    N   T +S  TRN+
Sbjct  520  REKIEGTMWELQQDRSDWATGKSDLKPWQAFSDD-PKPNLQTASKGNNTSTNQSFGTRNS  578

Query  406  QPPNTQDSTA-------SAWGFGTDSFTAVPSATSQMNASFSDRNNSQRFGDKRV-DNKS  251
            QP      TA        +WGF TDSF A P++ S         N SQRFG+ RV DN+ 
Sbjct  579  QPSKQTTLTAVPTSQGFDSWGFETDSFRATPTSASATQRPLGSGNTSQRFGNSRVRDNQQ  638

Query  250  ASQPAGWAGF  221
            A+QPAGW+GF
Sbjct  639  AAQPAGWSGF  648



>ref|XP_004149621.1| PREDICTED: uncharacterized protein LOC101211119 [Cucumis sativus]
 ref|XP_004170535.1| PREDICTED: uncharacterized LOC101211119 [Cucumis sativus]
 gb|KGN58620.1| hypothetical protein Csa_3G702580 [Cucumis sativus]
Length=676

 Score =   133 bits (335),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 83/179 (46%), Positives = 115/179 (64%), Gaps = 21/179 (12%)
 Frame = -2

Query  742  AEITSKFEKLSAICRSQRQEIQELKQALAAKTPSPNRDTLRNQSSPKSQTFSTPPQRETI  563
            +EITSKFEKLSAICRSQRQEIQELKQALAA++PSPN+  ++NQ+S ++Q  + P  ++  
Sbjct  514  SEITSKFEKLSAICRSQRQEIQELKQALAARSPSPNKLEMKNQNSREAQPSAVPRLQKA-  572

Query  562  EGTVWElqqgllnqsssSPDPSAWQAFADDGP--KPLTTPPPSNTPRSMRTRNNQPPNT-  392
                        + ++ SPD  AWQAFA++ P  +P+T   P    +SMRTR+ Q     
Sbjct  573  ------------DVTTPSPDAKAWQAFAEESPNQQPVT---PEKGVKSMRTRSVQRKQAS  617

Query  391  -QDSTASAWGFGTDSFTAVPSATSQMNASFSDRNNSQRFGDKR-VDNKSASQPAGWAGF  221
             +++   +WGFG +SFTAV + +S  +    +RN+SQR G      N  +SQPAGWAGF
Sbjct  618  PENTGFESWGFGAESFTAVSAGSSNKSGLTGERNSSQRTGGGEPKSNDISSQPAGWAGF  676



>ref|XP_008461768.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0276461 
[Cucumis melo]
Length=665

 Score =   131 bits (329),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 81/177 (46%), Positives = 111/177 (63%), Gaps = 17/177 (10%)
 Frame = -2

Query  742  AEITSKFEKLSAICRSQRQEIQELKQALAAKTPSPNRDTLRNQSSPKSQTFSTPPQRETI  563
            +EITSKFEKLSAICRSQRQEIQELKQALAA++PSPN+  ++N +S ++Q  S  P+ +  
Sbjct  503  SEITSKFEKLSAICRSQRQEIQELKQALAARSPSPNKLEMKNHNSREAQP-SAMPRLQKA  561

Query  562  EGTVWElqqgllnqsssSPDPSAWQAFADDGPKPLTTPPPSNTPRSMRTRNNQPPNT--Q  389
            + T              SPD  AWQAFA++ P   +  P     +SMRTR+ Q      +
Sbjct  562  DVTT------------PSPDAKAWQAFAEESPNQQSVTPEKGV-KSMRTRSLQKKQASPE  608

Query  388  DSTASAWGFGTDSFTAVPSATSQMNASFSDRNNSQRFGDKR-VDNKSASQPAGWAGF  221
            ++   +WGFG +SF+AV + +S  +    +RN+SQR G      N+ +SQPAGWAGF
Sbjct  609  NTGFESWGFGAESFSAVSAGSSNKSGLTGERNSSQRTGGGEPKSNEVSSQPAGWAGF  665



>ref|XP_007149360.1| hypothetical protein PHAVU_005G063700g [Phaseolus vulgaris]
 gb|ESW21354.1| hypothetical protein PHAVU_005G063700g [Phaseolus vulgaris]
Length=674

 Score =   130 bits (327),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 87/178 (49%), Positives = 114/178 (64%), Gaps = 20/178 (11%)
 Frame = -2

Query  742  AEITSKFEKLSAICRSQRQEIQELKQALAAKTPSPNRDTLRNQSSPKSQTFSTPPQRETI  563
            AEITSKF+KLSAICRSQRQE+Q+LKQALAA+TPSP+R+ L+  +SP + T S P Q++  
Sbjct  513  AEITSKFDKLSAICRSQRQELQDLKQALAARTPSPSREGLK--TSP-AVTSSQPMQQDRT  569

Query  562  EGTVWElqqgllnqsssSPDPSAWQAFADDGPKPLTTPPPSNTPRSMRT---RNNQPPNT  392
            E   W+             +P +WQAF ++ P+   +    NT +S RT   R N+ P  
Sbjct  570  E---WKTPSS---------EPKSWQAFPEE-PQQQKSLSAENTTKSARTNNGRQNKQPVP  616

Query  391  QDSTASAWGFGTDSFTAVPSATSQMNASFSDRNNSQRFGD-KRVDNKSASQPAGWAGF  221
              +T  +WGFGTDSF+AVPS +SQM    S    SQ FG+ K  ++K  SQPAGWAGF
Sbjct  617  LATTFDSWGFGTDSFSAVPSGSSQMQRPSSAGGKSQGFGEAKAFESKPTSQPAGWAGF  674



>ref|XP_008805476.1| PREDICTED: AP2-associated protein kinase 1-like [Phoenix dactylifera]
 ref|XP_008805477.1| PREDICTED: AP2-associated protein kinase 1-like [Phoenix dactylifera]
Length=702

 Score =   129 bits (324),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 101/184 (55%), Positives = 118/184 (64%), Gaps = 16/184 (9%)
 Frame = -2

Query  739  EITSKFEKLSAICRSQRQEIQELKQALAAKTPSP-NRDTLRNQSSPKSQTFSTPPQRETI  563
            EITSK+EKLSAICRSQRQEIQELK+ALAA T SP  +D  + Q+SP S    TPP RE I
Sbjct  524  EITSKYEKLSAICRSQRQEIQELKRALAAATSSPAGKDGSKAQTSPGSTQSDTPP-REKI  582

Query  562  EGTVWElqqgllnqsss--SPDPSAWQAFADDGPKPLTTPPPSNTPRSMRT----RNNQP  401
             G+VWELQQG+   S +  SPDP  WQAFA++ PK   T P S  PRS+RT      ++ 
Sbjct  583  -GSVWELQQGMFADSPATPSPDPKPWQAFAEE-PKVQGT-PKSIHPRSVRTVRAANGSRD  639

Query  400  PNTQDSTASA---WGFGTDSFTAVPSATSQMNASFSDRNNSQRFGDKRVDNKS-ASQPAG  233
               Q +T SA   WGF  DSF AVPS +     S    N SQRFG  R   K+ A+QPAG
Sbjct  640  TTKQAATYSANEPWGFDNDSFRAVPSGSEVPRTSVQG-NTSQRFGGGREMKKAEANQPAG  698

Query  232  WAGF  221
            WAGF
Sbjct  699  WAGF  702



>ref|XP_007149359.1| hypothetical protein PHAVU_005G063700g [Phaseolus vulgaris]
 gb|ESW21353.1| hypothetical protein PHAVU_005G063700g [Phaseolus vulgaris]
Length=673

 Score =   128 bits (322),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 87/178 (49%), Positives = 113/178 (63%), Gaps = 21/178 (12%)
 Frame = -2

Query  742  AEITSKFEKLSAICRSQRQEIQELKQALAAKTPSPNRDTLRNQSSPKSQTFSTPPQRETI  563
            AEITSKF+KLSAICRSQRQE+Q+LKQALAA+TPSP+R+ L+  +SP + T S P Q    
Sbjct  513  AEITSKFDKLSAICRSQRQELQDLKQALAARTPSPSREGLK--TSP-AVTSSQPMQ----  565

Query  562  EGTVWElqqgllnqsssSPDPSAWQAFADDGPKPLTTPPPSNTPRSMRT---RNNQPPNT  392
            + T W+             +P +WQAF ++ P+   +    NT +S RT   R N+ P  
Sbjct  566  DRTEWKTPSS---------EPKSWQAFPEE-PQQQKSLSAENTTKSARTNNGRQNKQPVP  615

Query  391  QDSTASAWGFGTDSFTAVPSATSQMNASFSDRNNSQRFGD-KRVDNKSASQPAGWAGF  221
              +T  +WGFGTDSF+AVPS +SQM    S    SQ FG+ K  ++K  SQPAGWAGF
Sbjct  616  LATTFDSWGFGTDSFSAVPSGSSQMQRPSSAGGKSQGFGEAKAFESKPTSQPAGWAGF  673



>ref|XP_010257450.1| PREDICTED: serine/threonine-protein kinase ppk30-like isoform 
X3 [Nelumbo nucifera]
Length=707

 Score =   127 bits (319),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 93/179 (52%), Positives = 115/179 (64%), Gaps = 11/179 (6%)
 Frame = -2

Query  742  AEITSKFEKLSAICRSQRQEIQELKQALAAKTPSPNRDTLRNQSSPKSQTFSTPPQRETI  563
            AEI SK+EKLSAICRSQ+ EIQEL+QALAAKT  PN++  +NQ+S  +   S PPQRE I
Sbjct  535  AEIKSKYEKLSAICRSQQHEIQELRQALAAKT-VPNKEASKNQNSFGNCQSSNPPQREKI  593

Query  562  EGTVWElqqgllnqsssSPDPSAWQAFADDGPKPLTTPPPSNTPRSMRT----RNNQPPN  395
            EGTV ELQQG+L  SS  PD   W+AF D+  KP  TPP S++PRS+RT    +N Q P+
Sbjct  594  EGTVRELQQGILASSSPIPDSKPWRAFFDE-TKP-QTPPKSSSPRSVRTTNGHQNKQAPS  651

Query  394  TQDSTASAWGFGTDSFTAVPSATSQMNASFSDRNNSQRFGD-KRVDNKSASQPAGWAGF  221
             +    + W F  +SF   PS+T      +    N Q   D K V+ K AS PAGWAGF
Sbjct  652  GRHGPET-WNFEPNSFKEFPSSTQV--TQYGQVLNFQLVADSKSVERKQASLPAGWAGF  707



>ref|XP_010678702.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0280111 
[Beta vulgaris subsp. vulgaris]
Length=664

 Score =   127 bits (318),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 93/182 (51%), Positives = 113/182 (62%), Gaps = 21/182 (12%)
 Frame = -2

Query  742  AEITSKFEKLSAICRSQRQEIQELKQALAAKTPSPNRDTLRNQSSPKSQTFSTPPQRETI  563
            AEIT+K+EKL+AICRSQRQE+QELKQALAA+TP P +++ RNQ  P S   +TP QR   
Sbjct  496  AEITAKYEKLTAICRSQRQELQELKQALAARTPPPIKESTRNQ--PSSSNEATPSQRVKN  553

Query  562  EGTVWElqqgllnqsssSPDPSAWQAFADDGPKPLTTPPPSNTPR--SMRTRNNQPPNTQ  389
            E TV ELQ      S SS +   WQAFA        + P S   R  S+RT+N    N Q
Sbjct  554  EVTVRELQGLSDKSSKSS-ETKPWQAFA--------SSPTSIADRSKSVRTKNGH-SNKQ  603

Query  388  DS----TASAWGFGTDSFTAVPSATSQMNASFSDRNNSQRFGD--KRVDNKSASQPAGWA  227
            D+    T   WGFG DSFTA PSA+S+++    + N SQRF D  K     +ASQPAGWA
Sbjct  604  DASGGTTQDKWGFGDDSFTAAPSASSRISRP-GEGNTSQRFADSNKLASKNTASQPAGWA  662

Query  226  GF  221
            GF
Sbjct  663  GF  664



>gb|KDP20398.1| hypothetical protein JCGZ_05281 [Jatropha curcas]
Length=669

 Score =   127 bits (318),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 87/181 (48%), Positives = 111/181 (61%), Gaps = 25/181 (14%)
 Frame = -2

Query  742  AEITSKFEKLSAICRSQRQEIQELKQALAAKTPSPNRDTLRNQSSPKSQTFSTPPQRETI  563
            AE+T K+EKLSAICRSQRQEIQELKQA+AA TP PN    + Q+SPK Q  +T  Q E+ 
Sbjct  507  AEMTLKYEKLSAICRSQRQEIQELKQAVAAGTP-PN----KYQTSPKIQPLTTTQQGESD  561

Query  562  EGTVWElqqgllnqsssSPDPSAWQAFADDGPKPLTTPPPSNTPRSMRTRN-NQPPNTQD  386
              T              SP+  AWQAFA D     ++   SN+P S+RTRN NQ      
Sbjct  562  WST-------------PSPETKAWQAFAVDPKTHQSSLSKSNSPLSVRTRNANQKKLAAQ  608

Query  385  STA--SAWGFGTDSFTAVPSATSQ----MNASFSDRNNSQRFGDKRVDNKSASQPAGWAG  224
            +++   +WGFG DSF+AVP A++Q    +N   S R++ Q  G K V+ + ASQPAGWAG
Sbjct  609  ASSEFESWGFGADSFSAVPGASTQTSRLINEGNSSRSSQQLAGTKVVEGQPASQPAGWAG  668

Query  223  F  221
            F
Sbjct  669  F  669



>ref|XP_010257449.1| PREDICTED: serine/threonine-protein kinase ppk30-like isoform 
X2 [Nelumbo nucifera]
Length=708

 Score =   127 bits (319),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 93/179 (52%), Positives = 115/179 (64%), Gaps = 11/179 (6%)
 Frame = -2

Query  742  AEITSKFEKLSAICRSQRQEIQELKQALAAKTPSPNRDTLRNQSSPKSQTFSTPPQRETI  563
            AEI SK+EKLSAICRSQ+ EIQEL+QALAAKT  PN++  +NQ+S  +   S PPQRE I
Sbjct  536  AEIKSKYEKLSAICRSQQHEIQELRQALAAKT-VPNKEASKNQNSFGNCQSSNPPQREKI  594

Query  562  EGTVWElqqgllnqsssSPDPSAWQAFADDGPKPLTTPPPSNTPRSMRT----RNNQPPN  395
            EGTV ELQQG+L  SS  PD   W+AF D+  KP  TPP S++PRS+RT    +N Q P+
Sbjct  595  EGTVRELQQGILASSSPIPDSKPWRAFFDE-TKP-QTPPKSSSPRSVRTTNGHQNKQAPS  652

Query  394  TQDSTASAWGFGTDSFTAVPSATSQMNASFSDRNNSQRFGD-KRVDNKSASQPAGWAGF  221
             +    + W F  +SF   PS+T      +    N Q   D K V+ K AS PAGWAGF
Sbjct  653  GRHGPET-WNFEPNSFKEFPSSTQV--TQYGQVLNFQLVADSKSVERKQASLPAGWAGF  708



>ref|XP_010257448.1| PREDICTED: serine/threonine-protein kinase ppk30-like isoform 
X1 [Nelumbo nucifera]
Length=709

 Score =   127 bits (319),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 93/179 (52%), Positives = 115/179 (64%), Gaps = 11/179 (6%)
 Frame = -2

Query  742  AEITSKFEKLSAICRSQRQEIQELKQALAAKTPSPNRDTLRNQSSPKSQTFSTPPQRETI  563
            AEI SK+EKLSAICRSQ+ EIQEL+QALAAKT  PN++  +NQ+S  +   S PPQRE I
Sbjct  537  AEIKSKYEKLSAICRSQQHEIQELRQALAAKT-VPNKEASKNQNSFGNCQSSNPPQREKI  595

Query  562  EGTVWElqqgllnqsssSPDPSAWQAFADDGPKPLTTPPPSNTPRSMRT----RNNQPPN  395
            EGTV ELQQG+L  SS  PD   W+AF D+  KP  TPP S++PRS+RT    +N Q P+
Sbjct  596  EGTVRELQQGILASSSPIPDSKPWRAFFDE-TKP-QTPPKSSSPRSVRTTNGHQNKQAPS  653

Query  394  TQDSTASAWGFGTDSFTAVPSATSQMNASFSDRNNSQRFGD-KRVDNKSASQPAGWAGF  221
             +    + W F  +SF   PS+T      +    N Q   D K V+ K AS PAGWAGF
Sbjct  654  GRHGPET-WNFEPNSFKEFPSSTQV--TQYGQVLNFQLVADSKSVERKQASLPAGWAGF  709



>gb|KHG06229.1| putative serine/threonine-protein kinase [Gossypium arboreum]
Length=653

 Score =   126 bits (316),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 84/180 (47%), Positives = 110/180 (61%), Gaps = 15/180 (8%)
 Frame = -2

Query  742  AEITSKFEKLSAICRSQRQEIQELKQALAAKTPSPNRDTLRNQSSPKSQTFSTPPQRETI  563
            AE+TSKFEKLSAICRSQRQEIQELKQ LAA+TPSPN+ T R  +SP S         E +
Sbjct  483  AEMTSKFEKLSAICRSQRQEIQELKQTLAARTPSPNKSTSRYHNSPGSLG-------EKV  535

Query  562  EGTVWElqqgllnq-sssSPDPSAWQAFADDGPKPLTTPPPSNTPRSMRTRNNQPPNTQD  386
            EGT  E  Q       ++SP+   WQAF +D       P   +  +S+RTRN    N   
Sbjct  536  EGTFSEFAQEKAGNWKTASPEAKPWQAFPEDAKPQQQQPLSKDNVQSVRTRNGH-SNMHA  594

Query  385  STAS----AWGFGTDSFTAVPSATSQ-MNASFSDRNNSQRFGDKRVDNKSASQPAGWAGF  221
            + A+     WGFG D+FTA P+A+SQ + ++ ++ ++SQR   K  ++   SQPAGWAGF
Sbjct  595  AQATFGMETWGFGADNFTAAPTASSQRLKSTINEGSSSQR-ESKIKESNPVSQPAGWAGF  653



>ref|XP_006410418.1| hypothetical protein EUTSA_v10016354mg [Eutrema salsugineum]
 gb|ESQ51871.1| hypothetical protein EUTSA_v10016354mg [Eutrema salsugineum]
Length=674

 Score =   125 bits (315),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 89/189 (47%), Positives = 126/189 (67%), Gaps = 16/189 (8%)
 Frame = -2

Query  742  AEITSKFEKLSAICRSQRQEIQELKQALAAK--TPSPNRDTLRNQSSPKSQTFSTPPQRE  569
            AEIT+KFEKLSAICRSQRQE+Q+LK  LA+K  T SP+RD  +NQSSP   + S+ P R+
Sbjct  487  AEITAKFEKLSAICRSQRQELQDLKHTLASKTVTSSPSRDFSQNQSSPGMCSISSTPSRD  546

Query  568  TIEGTVWElqqgllnqsssSPDPSAWQAFADDGPKPL---TTPPPSNT-PRSMRTRNNQP  401
             +EGT+WELQQ   N S+ S DP++WQ F+D+ PKP+    +   +NT  +S+RT++   
Sbjct  547  KVEGTMWELQQDRSNWSTGSSDPNSWQPFSDE-PKPVLESVSKGNNNTFNQSVRTKSKPA  605

Query  400  PNTQDSTASA---WGFGTDSFTAVPSATSQMNA-----SFSDRNNSQRFGDKRV-DNKSA  248
             +     +     WGF T+SF A  ++++  +A     S S  N +QRFG+ ++ DN+ A
Sbjct  606  SSAPAPASQGTEPWGFETESFRAAATSSASASASSTQRSVSSGNTAQRFGNSKMRDNQKA  665

Query  247  SQPAGWAGF  221
            +QPAGWAGF
Sbjct  666  AQPAGWAGF  674



>gb|KJB22767.1| hypothetical protein B456_004G065000 [Gossypium raimondii]
 gb|KJB22769.1| hypothetical protein B456_004G065000 [Gossypium raimondii]
Length=661

 Score =   125 bits (313),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 82/179 (46%), Positives = 104/179 (58%), Gaps = 13/179 (7%)
 Frame = -2

Query  742  AEITSKFEKLSAICRSQRQEIQELKQALAAKTPSPNRDTLRNQSSPKSQTFSTPPQRETI  563
            AE+T KFEKLSAICRSQRQEIQELKQ LAA+TPSPN+ T R  +SP S         E +
Sbjct  491  AEMTMKFEKLSAICRSQRQEIQELKQTLAARTPSPNKSTSRYHNSPGSLG-------EKV  543

Query  562  EGTVWElqqgllnq-sssSPDPSAWQAFADDGPKPLTTPPPSNTPRSMRTRNNQPPNTQD  386
            EGT  E  Q       ++SP+   WQAF +D       P   +  +S+RTRN    N   
Sbjct  544  EGTFSEFTQEKAGNWKTASPEAKPWQAFPEDAKPQQQQPLSKDNVQSVRTRNGH-SNMHA  602

Query  385  STAS----AWGFGTDSFTAVPSATSQMNASFSDRNNSQRFGDKRVDNKSASQPAGWAGF  221
            + A+     WGFG D+FTA P+A+SQ   S  +  +S +   K  ++   SQPAGWAGF
Sbjct  603  AQATFGMETWGFGADNFTAAPTASSQRLKSMINEGSSSQRESKIKESNPVSQPAGWAGF  661



>gb|KJB22768.1| hypothetical protein B456_004G065000 [Gossypium raimondii]
Length=662

 Score =   125 bits (313),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 82/179 (46%), Positives = 104/179 (58%), Gaps = 13/179 (7%)
 Frame = -2

Query  742  AEITSKFEKLSAICRSQRQEIQELKQALAAKTPSPNRDTLRNQSSPKSQTFSTPPQRETI  563
            AE+T KFEKLSAICRSQRQEIQELKQ LAA+TPSPN+ T R  +SP S         E +
Sbjct  492  AEMTMKFEKLSAICRSQRQEIQELKQTLAARTPSPNKSTSRYHNSPGSLG-------EKV  544

Query  562  EGTVWElqqgllnq-sssSPDPSAWQAFADDGPKPLTTPPPSNTPRSMRTRNNQPPNTQD  386
            EGT  E  Q       ++SP+   WQAF +D       P   +  +S+RTRN    N   
Sbjct  545  EGTFSEFTQEKAGNWKTASPEAKPWQAFPEDAKPQQQQPLSKDNVQSVRTRNGH-SNMHA  603

Query  385  STAS----AWGFGTDSFTAVPSATSQMNASFSDRNNSQRFGDKRVDNKSASQPAGWAGF  221
            + A+     WGFG D+FTA P+A+SQ   S  +  +S +   K  ++   SQPAGWAGF
Sbjct  604  AQATFGMETWGFGADNFTAAPTASSQRLKSMINEGSSSQRESKIKESNPVSQPAGWAGF  662



>ref|XP_006293803.1| hypothetical protein CARUB_v10022785mg [Capsella rubella]
 gb|EOA26701.1| hypothetical protein CARUB_v10022785mg [Capsella rubella]
Length=672

 Score =   124 bits (311),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 89/186 (48%), Positives = 121/186 (65%), Gaps = 13/186 (7%)
 Frame = -2

Query  742  AEITSKFEKLSAICRSQRQEIQELKQAL--AAKTPSPNRDTLRNQSSPKSQTFSTPPQRE  569
            AEIT+KFEKLSAICRSQRQE+Q+LKQ L   + +PSP+RD+ +NQ SP   + S+ P RE
Sbjct  488  AEITAKFEKLSAICRSQRQELQDLKQTLASKSASPSPSRDSSQNQPSPGMHSISSTPPRE  547

Query  568  TIEGTVWElqqgllnqsssSPDPSAWQAFADDGPKPLT---TPPPSNTP-RSMRTRNNQP  401
             +EGT+WELQ+   + S+ S DP++WQ F+ DG KP+    +   SNT  +S+RTR+   
Sbjct  548  KMEGTMWELQKDRSDWSTGSSDPNSWQPFS-DGVKPVLESASKGNSNTMNQSVRTRSKPA  606

Query  400  PNTQDSTASAWGFGTDSFTAV---PSAT--SQMNASFSDRNNSQRFGDKRV-DNKSASQP  239
                     AWGF T+SF A    P+AT  S    S    N++QR+G  ++ DN+  +QP
Sbjct  607  SAAGTQGFDAWGFETESFRAATPSPAATSASATQRSMGSGNSAQRYGSSKMRDNQKTAQP  666

Query  238  AGWAGF  221
            AGWAGF
Sbjct  667  AGWAGF  672



>gb|KJB22766.1| hypothetical protein B456_004G065000 [Gossypium raimondii]
Length=658

 Score =   123 bits (309),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 81/179 (45%), Positives = 103/179 (58%), Gaps = 16/179 (9%)
 Frame = -2

Query  742  AEITSKFEKLSAICRSQRQEIQELKQALAAKTPSPNRDTLRNQSSPKSQTFSTPPQRETI  563
            AE+T KFEKLSAICRSQRQEIQELKQ LAA+TPSPN+ T R  +SP S           +
Sbjct  491  AEMTMKFEKLSAICRSQRQEIQELKQTLAARTPSPNKSTSRYHNSPGS----------LV  540

Query  562  EGTVWElqqgllnq-sssSPDPSAWQAFADDGPKPLTTPPPSNTPRSMRTRNNQPPNTQD  386
            EGT  E  Q       ++SP+   WQAF +D       P   +  +S+RTRN    N   
Sbjct  541  EGTFSEFTQEKAGNWKTASPEAKPWQAFPEDAKPQQQQPLSKDNVQSVRTRNGH-SNMHA  599

Query  385  STAS----AWGFGTDSFTAVPSATSQMNASFSDRNNSQRFGDKRVDNKSASQPAGWAGF  221
            + A+     WGFG D+FTA P+A+SQ   S  +  +S +   K  ++   SQPAGWAGF
Sbjct  600  AQATFGMETWGFGADNFTAAPTASSQRLKSMINEGSSSQRESKIKESNPVSQPAGWAGF  658



>ref|XP_002314227.1| hypothetical protein POPTR_0009s02770g [Populus trichocarpa]
 gb|EEE88182.1| hypothetical protein POPTR_0009s02770g [Populus trichocarpa]
Length=210

 Score =   115 bits (288),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 76/177 (43%), Positives = 97/177 (55%), Gaps = 35/177 (20%)
 Frame = -2

Query  742  AEITSKFEKLSAICRSQRQEIQELKQALAAKTPSPNRDTLRNQSSPKSQTFSTPPQRETI  563
            AEITSKFEKLSAICRSQRQEIQELKQ LA++TPSPN+     Q      T S        
Sbjct  66   AEITSKFEKLSAICRSQRQEIQELKQTLASRTPSPNK---YQQEKSDWSTLSL-------  115

Query  562  EGTVWElqqgllnqsssSPDPSAWQAFADDGPKPLTTPPPSNTPRSMRTRN---NQPPNT  392
                               +  +WQAFADD           N+P+S+RTRN   N+    
Sbjct  116  -------------------ETKSWQAFADDKKSQKQHLSKGNSPQSVRTRNAHQNKQAAE  156

Query  391  QDSTASAWGFGTDSFTAVPSATSQMNASFSDRNNSQRFGDKRVDNKSASQPAGWAGF  221
              S   +WGFG+++FTAVP+ +SQ+  S ++ +     G K   +K A+QPAGWAGF
Sbjct  157  LTSDFDSWGFGSENFTAVPATSSQIPVSNTEVSVG---GYKITVSKPATQPAGWAGF  210



>ref|XP_010509956.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0276461 
[Camelina sativa]
 ref|XP_010509957.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0276461 
[Camelina sativa]
Length=673

 Score =   120 bits (302),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 81/186 (44%), Positives = 114/186 (61%), Gaps = 12/186 (6%)
 Frame = -2

Query  742  AEITSKFEKLSAICRSQRQEIQELKQAL--AAKTPSPNRDTLRNQSSPKSQTFSTPPQRE  569
            AEIT+KF+KLSAICRSQRQE+Q+LKQ L   + +PSP+RD+ +N  SP   + S+ P RE
Sbjct  488  AEITAKFDKLSAICRSQRQELQDLKQTLASKSASPSPSRDSSQNHPSPGMHSVSSTPSRE  547

Query  568  TIEGTVWElqqgllnqsssSPDPSAWQAFADDGPKPLTTPPPSN---TPRSMRTRNNQPP  398
             +EG +WELQ+   + S+ S DP++WQ F+DD    L +    N   + +S+RT++    
Sbjct  548  KMEGNMWELQKDRSDWSTGSSDPNSWQPFSDDAKPVLESASKGNSNTSNQSVRTKSKPAS  607

Query  397  NTQDSTASAWGFGTDSFTA-----VPSATSQMNASFSDRNNSQRFGDKRV--DNKSASQP  239
                    AWGF T+SF A     V ++TS    S    N SQR+G  +   +N+  +QP
Sbjct  608  AAGTQGFEAWGFETESFRAATPSSVATSTSATQRSMGSGNTSQRYGSTKAMRENQKTAQP  667

Query  238  AGWAGF  221
            AGWAGF
Sbjct  668  AGWAGF  673



>ref|XP_010913910.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0280111 
[Elaeis guineensis]
Length=702

 Score =   119 bits (299),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 91/184 (49%), Positives = 111/184 (60%), Gaps = 16/184 (9%)
 Frame = -2

Query  739  EITSKFEKLSAICRSQRQEIQELKQALAAKTPS-PNRDTLRNQSSPKSQTFSTPPQRETI  563
            EITSK+EKLSAICRSQRQEIQELK+ LAA T S   +D+ + Q+SP S    TPP RE I
Sbjct  524  EITSKYEKLSAICRSQRQEIQELKRTLAATTSSHAGKDSSKAQASPGSTQSDTPP-REKI  582

Query  562  EGTVWElqqgllnqsss--SPDPSAWQAFADDGPKPLTTPPPSNTPRSMRT-------RN  410
             G+VWELQQG+   S +  SPDP  WQ FA++    + + P    PRS+RT       R+
Sbjct  583  -GSVWELQQGMFADSPATPSPDPKPWQPFAEE--SKVQSTPKGIHPRSVRTVRAANGSRD  639

Query  409  NQPPNTQDSTASAWGFGTDSFTAVPSATSQMNASFSDRNNSQRFGDKRVDNKS-ASQPAG  233
            +    T  S    WGF  DSF A+PS +     S    N+SQRFG      K+  SQPAG
Sbjct  640  DTKQTTTYSANEPWGFDDDSFKAIPSGSGVSGTSVQG-NSSQRFGGGGETKKAETSQPAG  698

Query  232  WAGF  221
            WAGF
Sbjct  699  WAGF  702



>ref|XP_010413940.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0276461 
[Camelina sativa]
Length=671

 Score =   119 bits (297),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 83/184 (45%), Positives = 116/184 (63%), Gaps = 10/184 (5%)
 Frame = -2

Query  742  AEITSKFEKLSAICRSQRQEIQELKQALAAKTPSPN--RDTLRNQSSPKSQTFSTPPQRE  569
            AEIT+KFEKLSAICRSQRQE+Q+LKQ LA+K+ SP+  RD+ +NQ SP   + S+ P RE
Sbjct  488  AEITAKFEKLSAICRSQRQELQDLKQTLASKSASPSPSRDSSQNQPSPGMHSVSSTPSRE  547

Query  568  TIEGTVWElqqgllnqsssSPDPSAWQAFADDGPKPLTTPPPSNTPRSMRTRNNQPPNTQ  389
             +EG +WELQ+   + S+ S DP++WQ F+DD    L +    N   +   R    P + 
Sbjct  548  KMEGNMWELQKDRSDWSTGSSDPNSWQPFSDDAKPVLESASKGNNTSNQSVRTKSKPASA  607

Query  388  DSTAS--AWGFGTDSFTAVPSATSQMNASFSDR-----NNSQRFGDKRV-DNKSASQPAG  233
              T    AWGF T+SF A   +++  +AS + R     N SQR+G  ++ +N+  +QPAG
Sbjct  608  AGTQGFEAWGFETESFRAATPSSAATSASATQRSMGSGNTSQRYGSTKMRENQKTAQPAG  667

Query  232  WAGF  221
            WAGF
Sbjct  668  WAGF  671



>emb|CDX79504.1| BnaC03g18400D [Brassica napus]
Length=607

 Score =   118 bits (296),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 83/179 (46%), Positives = 118/179 (66%), Gaps = 7/179 (4%)
 Frame = -2

Query  742  AEITSKFEKLSAICRSQRQEIQELKQAL--AAKTPSPNRDTLRNQSSPKSQTFSTPPQRE  569
            AEIT+KFEKLSAICRSQRQE+Q+LKQ L   + + SP+RD   NQ+SP  ++ S+ P R+
Sbjct  431  AEITAKFEKLSAICRSQRQELQDLKQTLASKSASASPSRDLSHNQTSPGMRSVSSTPSRD  490

Query  568  TIEGTVWElqqgllnq-sssSPDPSAWQAFADDGPKPLTTPPPSNTPRSMRTRNNQPPNT  392
             +EG+VW+LQQ   +  S+ S DP++WQ F+D+ PKP+    PS + R+     +  P  
Sbjct  491  RVEGSVWDLQQTDRSDWSTGSSDPNSWQPFSDE-PKPVLE-TPSKSVRTKSKPASSAPAP  548

Query  391  QDSTASAWGFGTDSFTAVPSATSQMN-ASFSDRNNSQRFGDKRV-DNKSASQPAGWAGF  221
                   WGF T+SF A  ++++     S S  N+SQRFG+ ++ DN+ A+QPAGWAGF
Sbjct  549  ASQGFEPWGFETESFRAAATSSASATPKSVSSGNSSQRFGNTKMRDNQKAAQPAGWAGF  607



>ref|XP_010469538.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0276461 
isoform X1 [Camelina sativa]
Length=672

 Score =   118 bits (295),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 83/185 (45%), Positives = 117/185 (63%), Gaps = 11/185 (6%)
 Frame = -2

Query  742  AEITSKFEKLSAICRSQRQEIQELKQAL--AAKTPSPNRDTLRNQSSPKSQTFSTPPQRE  569
            AEIT+KFEKLSAICRSQRQE+Q+LKQ L   + +PSP+RD+ +N  SP   + S+ P RE
Sbjct  488  AEITAKFEKLSAICRSQRQELQDLKQTLASKSASPSPSRDSSQNHPSPGMHSVSSTPSRE  547

Query  568  TIEGTVWElqqgllnqsssSPDPSAWQAFADDGPKPLTTPPPSN---TPRSMRTRNNQPP  398
              EG +WELQ+   + S+ S DP++WQ F+DD    L +    N   + +S+RTR+    
Sbjct  548  KKEGNMWELQKDRSDWSTGSSDPNSWQPFSDDAKPVLESASKGNNSTSNQSVRTRSKPAS  607

Query  397  NTQDSTASAWGFGTDSFTAVPSATSQMNASFSDR-----NNSQRFGDKRV-DNKSASQPA  236
                    AWGF T+SF A   +++  +AS + R     N SQR+G  ++ +N+ A+QPA
Sbjct  608  GAGTQGFEAWGFETESFRAATPSSAATSASATQRNMGTGNTSQRYGSTKMRENQKAAQPA  667

Query  235  GWAGF  221
            GWAGF
Sbjct  668  GWAGF  672



>ref|XP_003531422.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0280111-like 
[Glycine max]
 gb|KHN29185.1| Putative serine/threonine-protein kinase [Glycine soja]
Length=662

 Score =   115 bits (289),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 79/177 (45%), Positives = 104/177 (59%), Gaps = 31/177 (18%)
 Frame = -2

Query  742  AEITSKFEKLSAICRSQRQEIQELKQALAAKTPSPNRDTLRNQSSPKSQTFSTPPQRETI  563
            AEITSK+EKLSAICRSQRQE+Q+LKQALAA+TPSP+R+ L+   SP              
Sbjct  514  AEITSKYEKLSAICRSQRQELQDLKQALAARTPSPSREGLK--ISP--------------  557

Query  562  EGTVWElqqgllnqsssSPDPSAWQAFADDGPKPLTTPPPSNTPRSMRTRN---NQPPNT  392
                        + S+S+    +WQAF ++ P+   +    NT +S+R +N   N+ P  
Sbjct  558  --------AVTSSASASASSDKSWQAFPEE-PQQQRSLSAENTSKSVRVKNGQQNKQPVP  608

Query  391  QDSTASAWGFGTDSFTAVPSATSQMNASFSDRNNSQRFGDKRVDNKSASQPAGWAGF  221
              +   +WGFGTDSF+AVP+ + QM    S    SQ FG+    NKS SQPAGWAGF
Sbjct  609  LATDFDSWGFGTDSFSAVPAGSPQMQRPSSAGTKSQAFGEA---NKSTSQPAGWAGF  662



>emb|CDX84704.1| BnaA03g15260D [Brassica napus]
Length=612

 Score =   115 bits (287),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 85/179 (47%), Positives = 116/179 (65%), Gaps = 7/179 (4%)
 Frame = -2

Query  742  AEITSKFEKLSAICRSQRQEIQELKQAL--AAKTPSPNRDTLRNQSSPKSQTFSTPPQRE  569
            AEIT+KFEKLSAICRSQRQE+QELKQ L   + + SP+RD   NQ+SP  ++ S+ P R+
Sbjct  436  AEITAKFEKLSAICRSQRQELQELKQTLASKSASASPSRDLSHNQTSPGMRSVSSTPSRD  495

Query  568  TIEGTVWElqqgllnq-sssSPDPSAWQAFADDGPKPLTTPPPSNTPRSMRTRNNQPPNT  392
              EG+VW+LQQ   +  S+ S DP++WQ F+D+ PKP+    PS + R+     +  P  
Sbjct  496  RAEGSVWDLQQTDRSDWSTGSSDPNSWQPFSDE-PKPVLE-SPSKSVRTKSKPASSAPAP  553

Query  391  QDSTASAWGFGTDSF-TAVPSATSQMNASFSDRNNSQRFGDKRV-DNKSASQPAGWAGF  221
                   WGF T+SF  A  S+ S    S S  N+SQRFG+ ++ +N+ A+QPAGWAGF
Sbjct  554  ASQGFEPWGFETESFRAAATSSASATQRSASSGNSSQRFGNTKMRENQKAAQPAGWAGF  612



>ref|XP_009132906.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0280111 
[Brassica rapa]
Length=612

 Score =   115 bits (287),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 85/179 (47%), Positives = 116/179 (65%), Gaps = 7/179 (4%)
 Frame = -2

Query  742  AEITSKFEKLSAICRSQRQEIQELKQAL--AAKTPSPNRDTLRNQSSPKSQTFSTPPQRE  569
            AEIT+KFEKLSAICRSQRQE+QELKQ L   + + SP+RD   NQ+SP  ++ S+ P R+
Sbjct  436  AEITAKFEKLSAICRSQRQELQELKQTLASKSASASPSRDLSHNQTSPGMRSVSSTPSRD  495

Query  568  TIEGTVWElqqgllnq-sssSPDPSAWQAFADDGPKPLTTPPPSNTPRSMRTRNNQPPNT  392
              EG+VW+LQQ   +  S+ S DP++WQ F+D+ PKP+    PS + R+     +  P  
Sbjct  496  RAEGSVWDLQQTDRSDWSTGSSDPNSWQPFSDE-PKPVLE-SPSKSVRTKSKPASSAPAP  553

Query  391  QDSTASAWGFGTDSF-TAVPSATSQMNASFSDRNNSQRFGDKRV-DNKSASQPAGWAGF  221
                   WGF T+SF  A  S+ S    S S  N+SQRFG+ ++ +N+ A+QPAGWAGF
Sbjct  554  ASQGFEPWGFETESFRAAATSSASATQRSASSGNSSQRFGNTKMRENQKAAQPAGWAGF  612



>ref|XP_002881248.1| hypothetical protein ARALYDRAFT_482227 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57507.1| hypothetical protein ARALYDRAFT_482227 [Arabidopsis lyrata subsp. 
lyrata]
Length=660

 Score =   114 bits (286),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 81/185 (44%), Positives = 118/185 (64%), Gaps = 11/185 (6%)
 Frame = -2

Query  742  AEITSKFEKLSAICRSQRQEIQELKQAL--AAKTPSPNRDTLRNQSSPKSQTFSTPPQRE  569
            AEIT+KFEKLSAICRSQRQE+Q+LKQ+L   + +PSP+RD+ ++Q SP   + S+ P R+
Sbjct  476  AEITAKFEKLSAICRSQRQELQDLKQSLASKSASPSPSRDSSQSQPSPGMHSMSSTPSRD  535

Query  568  TIEGTVWElqqgllnqsssSPDPSAWQAFADDGPKPLTTPPPSN---TPRSMRTRNNQPP  398
             IEGT+WELQQ   N S+ S D ++WQ F+D+    + +    N     +S+RTR+    
Sbjct  536  KIEGTMWELQQDRSNWSTGSSDTNSWQPFSDEAKPVMESASKGNNNTINQSVRTRSKPAS  595

Query  397  NTQDSTASAWGFGTDSF-----TAVPSATSQMNASFSDRNNSQRFGDKRV-DNKSASQPA  236
                    AWGF T+SF     ++  +A++   +  S  N SQR+G+ ++ DN+  +QPA
Sbjct  596  AAGTQGFEAWGFETESFRAAATSSATTASATQRSMGSGNNTSQRYGNSKMRDNQKTAQPA  655

Query  235  GWAGF  221
            GWAGF
Sbjct  656  GWAGF  660



>ref|XP_003546865.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0280111-like 
isoform X1 [Glycine max]
 ref|XP_006598247.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0280111-like 
isoform X2 [Glycine max]
Length=660

 Score =   112 bits (280),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 73/177 (41%), Positives = 97/177 (55%), Gaps = 33/177 (19%)
 Frame = -2

Query  742  AEITSKFEKLSAICRSQRQEIQELKQALAAKTPSPNRDTLRNQSSPKSQTFSTPPQRETI  563
            AEITSK+EKLSAICRSQRQE+Q+LKQAL A+TPSP RD L+   +  S   ++       
Sbjct  514  AEITSKYEKLSAICRSQRQELQDLKQALTARTPSPIRDGLKTSPAVTSSASAS-------  566

Query  562  EGTVWElqqgllnqsssSPDPSAWQAFADDGPKPLTTPPPSNTPRSMRTRN---NQPPNT  392
                                  +W AF ++ P+   +    NT +S+R +N   N+ P  
Sbjct  567  -------------------ANKSWHAFPEE-PQQQKSFSAENTSKSVRVKNGQQNKQPVA  606

Query  391  QDSTASAWGFGTDSFTAVPSATSQMNASFSDRNNSQRFGDKRVDNKSASQPAGWAGF  221
              +   +WGFG+DSF+AVP+ +  M    S    SQ FG+    NKS SQPAGWAGF
Sbjct  607  LATDFDSWGFGSDSFSAVPAGSPHMQRPSSAGTKSQAFGEA---NKSTSQPAGWAGF  660



>ref|XP_004513162.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0280111-like 
isoform X1 [Cicer arietinum]
 ref|XP_004513163.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0280111-like 
isoform X2 [Cicer arietinum]
 ref|XP_004513164.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0280111-like 
isoform X3 [Cicer arietinum]
 ref|XP_004513165.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0280111-like 
isoform X4 [Cicer arietinum]
 ref|XP_004513166.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0280111-like 
isoform X5 [Cicer arietinum]
 ref|XP_004513167.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0280111-like 
isoform X6 [Cicer arietinum]
 ref|XP_004513168.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0280111-like 
isoform X7 [Cicer arietinum]
 ref|XP_004513169.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0280111-like 
isoform X8 [Cicer arietinum]
Length=681

 Score =   111 bits (278),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 77/182 (42%), Positives = 107/182 (59%), Gaps = 30/182 (16%)
 Frame = -2

Query  742  AEITSKFEKLSAICRSQRQEIQELKQALAAKTPSPNRDTLRNQ-SSPKSQTFSTPPQRET  566
            AEIT+K+EKL+AICRSQRQE+Q+LKQALAA+TPSPNR+  R       S +     +R+T
Sbjct  522  AEITAKYEKLTAICRSQRQELQDLKQALAARTPSPNREGFRVSPGVASSASLQDRNERKT  581

Query  565  IEGTVWElqqgllnqsssSPDPSAWQAFADD--GPKPLTTPPPSNTPRSMRTRNNQPPNT  392
                              + +P +WQAF +D  G K L+     N  +S+R+RN Q  N 
Sbjct  582  -----------------PNSEPKSWQAFPEDAEGVKSLSA---DNAFKSVRSRNGQ-QNM  620

Query  391  Q----DSTASAWGFGTDSFTAVPSATSQMNASFSDRNNSQRFGD-KRVDNKSASQPAGWA  227
            Q     S   +WGFGTD+F+AV + + QM     + + +  FG+ K  ++KS +QPAGWA
Sbjct  621  QATQPASDFDSWGFGTDTFSAVHAGSPQMPRP-GEGSKAHVFGEAKAFESKSNTQPAGWA  679

Query  226  GF  221
            GF
Sbjct  680  GF  681



>ref|NP_850199.1| protein kinase superfamily protein [Arabidopsis thaliana]
 gb|AAN64167.1| putative serine/threonine protein kinase [Arabidopsis thaliana]
 gb|AEC08752.1| protein kinase superfamily protein [Arabidopsis thaliana]
Length=670

 Score =   108 bits (271),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 80/186 (43%), Positives = 117/186 (63%), Gaps = 12/186 (6%)
 Frame = -2

Query  742  AEITSKFEKLSAICRSQRQEIQELKQAL--AAKTPSPNRDTLRNQSSPKSQTFSTPPQRE  569
            AEIT+KFEKLSAICRSQRQE+Q+LKQ L   + +PSP+RD+ +NQ SP   + S+ P R+
Sbjct  485  AEITAKFEKLSAICRSQRQELQDLKQTLASKSASPSPSRDSSQNQPSPGMHSMSSTPSRD  544

Query  568  TIEGTVWElqqgllnqsssSPDPSAWQAFADDGPKPLTTPPPSN---TPRSMRTRNNQPP  398
             +EGT+WELQQ   N S+ S D ++WQ F+D+    + +    N     +S+RTR+    
Sbjct  545  KMEGTMWELQQDRSNWSTGSSDTNSWQPFSDEAKPVMESASKGNNNTINQSVRTRSKPAS  604

Query  397  NTQDSTASAWGFGTDSFTAVPSATSQMNASFSDR------NNSQRFGDKRV-DNKSASQP  239
                     WGF T+SF A  ++ +  +AS + R      + SQR+G+ ++ +N+  +QP
Sbjct  605  AAGTQGFEPWGFETESFRAAATSAAATSASGTQRSMGSGNSTSQRYGNSKMRENQKTAQP  664

Query  238  AGWAGF  221
            AGWAGF
Sbjct  665  AGWAGF  670



>ref|XP_008808088.1| PREDICTED: AP2-associated protein kinase 1-like [Phoenix dactylifera]
 ref|XP_008808089.1| PREDICTED: AP2-associated protein kinase 1-like [Phoenix dactylifera]
Length=698

 Score =   107 bits (268),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 86/183 (47%), Positives = 107/183 (58%), Gaps = 22/183 (12%)
 Frame = -2

Query  742  AEITSKFEKLSAICRSQRQEIQELKQALAAKTPSPNRDTLRNQSSPKSQTFSTPPQRETI  563
            AEITSK+EKLSAICRSQRQEIQELK+ALAA TPSP+               S   Q++ I
Sbjct  529  AEITSKYEKLSAICRSQRQEIQELKRALAAATPSPSSKDSSKSHISLGSLQSGTLQKDKI  588

Query  562  EGTVWElqqgllnqsssSP--DPSAWQAFADDGPKPLTTPPPSNTPRSMRTRNNQPPNTQ  389
            EGTVWELQQG+L  SS SP  +P  WQAF+ +         P    R+  T N     T+
Sbjct  589  EGTVWELQQGMLANSSPSPSQEPKPWQAFSGE---------PKAQSRAAGTTNGHQNLTK  639

Query  388  DSTAS----AWGFGTDSFTAVPSATSQMNASFSDRNNSQRF---GDKRVDNKSASQPAGW  230
             S A+     WGF  +SFTA P   +Q++ + +  N SQR    G K+V+    SQP+GW
Sbjct  640  QSAAAPSSDVWGFNLESFTAAPFG-AQVSRTSAQANTSQRLSGGGTKKVE---TSQPSGW  695

Query  229  AGF  221
            AGF
Sbjct  696  AGF  698



>ref|XP_009394517.1| PREDICTED: AP2-associated protein kinase 1 {ECO:0000303|PubMed:11877457}-like 
[Musa acuminata subsp. malaccensis]
 ref|XP_009394519.1| PREDICTED: AP2-associated protein kinase 1 {ECO:0000303|PubMed:11877457}-like 
[Musa acuminata subsp. malaccensis]
 ref|XP_009394520.1| PREDICTED: AP2-associated protein kinase 1 {ECO:0000303|PubMed:11877457}-like 
[Musa acuminata subsp. malaccensis]
Length=704

 Score =   105 bits (262),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 87/185 (47%), Positives = 107/185 (58%), Gaps = 17/185 (9%)
 Frame = -2

Query  739  EITSKFEKLSAICRSQRQEIQELKQALAAKTPSPNRDTLRNQSSPKSQTFSTPPQRETIE  560
            E+TSK EKLSAICRSQRQEIQELK+A+AA +PSP     + Q SP S    TPP RE IE
Sbjct  525  EMTSKCEKLSAICRSQRQEIQELKRAVAAASPSPPNKESKPQISPGSSQSDTPP-REKIE  583

Query  559  GTVWElqqgl--lnqsssSPDPSAWQAFADDGPKPLTTPPPSNTPRSMRT-------RNN  407
            G + ELQ+GL   N S+ SPDP  W AF D     +   P S+ P+S+RT       RNN
Sbjct  584  GNLPELQRGLFPNNPSTPSPDPKPWSAFGD---TMVQDTPKSSHPKSVRTIRGTNSNRNN  640

Query  406  QPPNTQDSTASAWGFGTDSFTAVPSATSQMNASFSDRNNSQRFGD---KRVDNKSASQPA  236
                +  S    WGF  DSF A  S +SQ+     + N SQRFG     +V     ++P+
Sbjct  641  IKQPSASSADEPWGFNQDSFRA-DSHSSQVPKPSFEGNTSQRFGGGGPGKVKAVETNRPS  699

Query  235  GWAGF  221
            GW GF
Sbjct  700  GWTGF  704



>ref|NP_001047290.1| Os02g0591900 [Oryza sativa Japonica Group]
 dbj|BAF09204.1| Os02g0591900, partial [Oryza sativa Japonica Group]
Length=379

 Score =   102 bits (253),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 77/184 (42%), Positives = 100/184 (54%), Gaps = 29/184 (16%)
 Frame = -2

Query  742  AEITSKFEKLSAICRSQRQEIQELKQALAAKTPSPNRDTLRNQSSPKSQTFSTPPQRETI  563
            AE+T+KFEKLSAICRSQRQEIQELK+ LA  TP  ++ + R          S P ++E I
Sbjct  215  AEMTAKFEKLSAICRSQRQEIQELKRTLAETTPPSSKVSSRLPD-------SGPQRKEKI  267

Query  562  EGTVWElqqgllnqsssSPDPSAWQAFADDGPKPLTTPPPSNTPRSMRTRNNQPPNTQDS  383
            EGTVWEL+QG+L  S  S +   WQAF          P P + P  +R + +   N   +
Sbjct  268  EGTVWELEQGMLANSLPSSEAKTWQAF----------PDPKSQPAQVRPKVDHSTNGAQN  317

Query  382  TA---------SAWGFGTDSFTAVPSAT-SQMNASFSDRNNSQRFGDKRVDNKSASQPAG  233
             A           WGFG DSF   P +T +Q+N   +  ++SQRF       K   QP+G
Sbjct  318  LARNANSRQSPDGWGFGPDSFRTSPGSTAAQINRPTAQGSSSQRFSSGAA--KKVEQPSG  375

Query  232  WAGF  221
            WAGF
Sbjct  376  WAGF  379



>ref|XP_006850020.1| hypothetical protein AMTR_s00022p00186280 [Amborella trichopoda]
 gb|ERN11601.1| hypothetical protein AMTR_s00022p00186280 [Amborella trichopoda]
Length=706

 Score =   103 bits (256),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 81/196 (41%), Positives = 107/196 (55%), Gaps = 24/196 (12%)
 Frame = -2

Query  742  AEITSKFEKLSAICRSQRQEIQELKQALAAKTPSPNRDTLRNQSSPKSQTFSTP------  581
            AE+ SK+EKL+AICRSQRQEIQELKQA+AA +   N     +  S   Q+  +P      
Sbjct  513  AEVASKYEKLTAICRSQRQEIQELKQAIAAGSNRDNSKVGASSQSQAQQSHKSPGSWQSG  572

Query  580  PQRETIEGTVWElqqglln--qsssSPDPSAWQAFADDGPKPLTTPPPSNT-PRSMRTRN  410
             QR+ IEG++WELQ+G+     S+ SPD   WQAF D  P  +  PP  N+ P+   TR 
Sbjct  573  AQRDKIEGSIWELQEGMQTNNTSNISPDSKPWQAFTDT-PAKIQPPPSKNSNPKQTSTRP  631

Query  409  NQPPNTQD-----STASAWGFGTDSFTAVPSATSQMNASFSDRNNSQRFG--------DK  269
                 T+      S+A AWGFG D F A       +  + +  + SQRF          K
Sbjct  632  TNGHQTKQTASLYSSADAWGFGQDGFVAANKDGPHITKTSTQASISQRFAPPNPHIAQPK  691

Query  268  RVDNKSASQPAGWAGF  221
             +D+ S +QPAGWAGF
Sbjct  692  SMDD-SRTQPAGWAGF  706



>gb|AAL60023.1| putative serine/threonine protein kinase [Arabidopsis thaliana]
Length=650

 Score =   102 bits (255),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 80/183 (44%), Positives = 115/183 (63%), Gaps = 26/183 (14%)
 Frame = -2

Query  742  AEITSKFEKLSAICRSQRQEIQELKQAL--AAKTPSPNRDTLRNQSSPKSQTFSTPPQRE  569
            AEIT+KFEKLSAICRSQRQE+Q+LKQ L   + +PSP+RD+ +NQ SP   + S+ P R+
Sbjct  485  AEITAKFEKLSAICRSQRQELQDLKQTLASKSASPSPSRDSSQNQPSPGMHSMSSTPSRD  544

Query  568  TIEGTVWElqqgllnqsssSPDPSAWQAFADDGPKPLTTPPPSNTPRSMRTRNNQPPNTQ  389
             +EGT+WELQQ   N S+ S D ++WQ F+D+  KP+          S  T+  +P    
Sbjct  545  KMEGTMWELQQDRSNWSTGSSDTNSWQPFSDEA-KPVMESA------SKGTQGFEP----  593

Query  388  DSTASAWGFGTDSFTAVPSATSQMNASFSDR------NNSQRFGDKRV-DNKSASQPAGW  230
                  WGF T+SF A  ++ +  +AS + R      + SQR+G+ ++ +N+  +QPAGW
Sbjct  594  ------WGFETESFRAAATSAAATSASGTQRSMGSGNSTSQRYGNSKMRENQKTAQPAGW  647

Query  229  AGF  221
            AGF
Sbjct  648  AGF  650



>ref|NP_565756.1| protein kinase superfamily protein [Arabidopsis thaliana]
 gb|AAB91980.2| putative serine/threonine protein kinase [Arabidopsis thaliana]
 gb|AAM14904.1| putative serine threonine protein kinase [Arabidopsis thaliana]
 gb|AAM67308.1| putative serine/threonine protein kinase [Arabidopsis thaliana]
 gb|AAN12961.1| putative serine/threonine kinase [Arabidopsis thaliana]
 gb|AEC08751.1| protein kinase superfamily protein [Arabidopsis thaliana]
Length=650

 Score =   102 bits (255),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 80/183 (44%), Positives = 115/183 (63%), Gaps = 26/183 (14%)
 Frame = -2

Query  742  AEITSKFEKLSAICRSQRQEIQELKQAL--AAKTPSPNRDTLRNQSSPKSQTFSTPPQRE  569
            AEIT+KFEKLSAICRSQRQE+Q+LKQ L   + +PSP+RD+ +NQ SP   + S+ P R+
Sbjct  485  AEITAKFEKLSAICRSQRQELQDLKQTLASKSASPSPSRDSSQNQPSPGMHSMSSTPSRD  544

Query  568  TIEGTVWElqqgllnqsssSPDPSAWQAFADDGPKPLTTPPPSNTPRSMRTRNNQPPNTQ  389
             +EGT+WELQQ   N S+ S D ++WQ F+D+  KP+          S  T+  +P    
Sbjct  545  KMEGTMWELQQDRSNWSTGSSDTNSWQPFSDEA-KPVMESA------SKGTQGFEP----  593

Query  388  DSTASAWGFGTDSFTAVPSATSQMNASFSDR------NNSQRFGDKRV-DNKSASQPAGW  230
                  WGF T+SF A  ++ +  +AS + R      + SQR+G+ ++ +N+  +QPAGW
Sbjct  594  ------WGFETESFRAAATSAAATSASGTQRSMGSGNSTSQRYGNSKMRENQKTAQPAGW  647

Query  229  AGF  221
            AGF
Sbjct  648  AGF  650



>dbj|BAD34080.1| cyclin G-associated kinase-like protein [Oryza sativa Japonica 
Group]
 dbj|BAG93141.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC73506.1| hypothetical protein OsI_07872 [Oryza sativa Indica Group]
 gb|EEE57282.1| hypothetical protein OsJ_07336 [Oryza sativa Japonica Group]
Length=667

 Score =   102 bits (254),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 77/184 (42%), Positives = 100/184 (54%), Gaps = 29/184 (16%)
 Frame = -2

Query  742  AEITSKFEKLSAICRSQRQEIQELKQALAAKTPSPNRDTLRNQSSPKSQTFSTPPQRETI  563
            AE+T+KFEKLSAICRSQRQEIQELK+ LA  TP  ++ + R          S P ++E I
Sbjct  503  AEMTAKFEKLSAICRSQRQEIQELKRTLAETTPPSSKVSSRLPD-------SGPQRKEKI  555

Query  562  EGTVWElqqgllnqsssSPDPSAWQAFADDGPKPLTTPPPSNTPRSMRTRNNQPPNTQDS  383
            EGTVWEL+QG+L  S  S +   WQAF          P P + P  +R + +   N   +
Sbjct  556  EGTVWELEQGMLANSLPSSEAKTWQAF----------PDPKSQPAQVRPKVDHSTNGAQN  605

Query  382  TA---------SAWGFGTDSFTAVPSAT-SQMNASFSDRNNSQRFGDKRVDNKSASQPAG  233
             A           WGFG DSF   P +T +Q+N   +  ++SQRF       K   QP+G
Sbjct  606  LARNANSRQSPDGWGFGPDSFRTSPGSTAAQINRPTAQGSSSQRFSSGAA--KKVEQPSG  663

Query  232  WAGF  221
            WAGF
Sbjct  664  WAGF  667



>ref|NP_001159134.1| uncharacterized protein LOC100304212 [Zea mays]
 gb|ACN25170.1| unknown [Zea mays]
Length=163

 Score = 96.3 bits (238),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 73/177 (41%), Positives = 97/177 (55%), Gaps = 19/177 (11%)
 Frame = -2

Query  736  ITSKFEKLSAICRSQRQEIQELKQALAAKTPSPNRDTLRNQSSPKSQTFSTPPQRETIEG  557
            +T+K+EKLSAICRSQRQEIQELK+ LA  TP  N+ + R Q S          ++E I+G
Sbjct  1    MTAKYEKLSAICRSQRQEIQELKRTLAEATPPSNKVSSRTQDSG-------SQRKEKIQG  53

Query  556  TVW--ElqqgllnqsssSPDPSAWQAFADDGPKPLTTPPPSNTPRSMRTRNNQPPNTQDS  383
            T+W  E      N SS+S D   WQAF    P   T   P     +  ++N     T  +
Sbjct  54   TLWELEQGMLASNTSSASSDVKTWQAF----PDTQTQARPKVDHGTNGSQNITKNTTSGA  109

Query  382  TASAWGFGTDSF---TAVPSATSQMNASFSDRNNSQRFGDKRVDNKSASQPAGWAGF  221
            +  AWGFGTDSF   +A   A +Q+N + +  ++SQRF       K   QP+GWAGF
Sbjct  110  SPDAWGFGTDSFRTSSAPVKAATQINRA-AQGSSSQRFNSGVA--KKVEQPSGWAGF  163



>ref|XP_006647439.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0276461-like 
[Oryza brachyantha]
Length=666

 Score =   101 bits (251),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 77/184 (42%), Positives = 103/184 (56%), Gaps = 27/184 (15%)
 Frame = -2

Query  742  AEITSKFEKLSAICRSQRQEIQELKQALAAKTPSPNRDTLRNQSSPKSQTFSTPPQRETI  563
            AE+T+K+EKL+AICRSQRQEIQELK+ LA  TP P+     +   P+S +     ++E I
Sbjct  500  AEMTAKYEKLTAICRSQRQEIQELKRTLAETTPPPSNKV--SSRIPESGSL----RKEKI  553

Query  562  EGTVWElqqgllnqsssSPDPSA--WQAFADDGPKPLTTPPP--------SNTPRSMRTR  413
            EGTVWEL+QG+L  +SS P   A  WQAF +   +P    P          N  R+  +R
Sbjct  554  EGTVWELEQGMLANNSSLPSSEAKTWQAFPEPKSQPAQVRPKVDHTANGGQNLGRNTNSR  613

Query  412  NNQPPNTQDSTASAWGFGTDSFTAVPSATSQMNASFSDRNNSQRFGDKRVDNKSASQPAG  233
              QPP         WGFG DSF    +A +Q+N + +  ++S RF       K   QP+G
Sbjct  614  --QPP-------EGWGFGPDSFRTSGTAAAQINRATAQGSSSHRFSSGAA--KKVEQPSG  662

Query  232  WAGF  221
            WAGF
Sbjct  663  WAGF  666



>gb|AFK34914.1| unknown [Medicago truncatula]
Length=223

 Score = 95.9 bits (237),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 71/180 (39%), Positives = 105/180 (58%), Gaps = 23/180 (13%)
 Frame = -2

Query  742  AEITSKFEKLSAICRSQRQEIQELKQALAAKTPSPNRDTLRNQSSPKSQTFSTPPQRETI  563
            +EIT+K+EKL+AICRSQRQE+Q+LKQ LAAKTPSP+R+  R  +SP   + ++   R   
Sbjct  61   SEITAKYEKLTAICRSQRQELQDLKQTLAAKTPSPSREGFR--TSPGVASSASSQDR---  115

Query  562  EGTVWElqqgllnqsssSPDPSAWQAFADDGPKPLTTPPPSNTPRSMRTRNNQ--PPNTQ  389
              + W+               S+WQ F+++  +P  +    N  +S+R+RN Q   P TQ
Sbjct  116  --SEWKTPSSEPK--------SSWQPFSEES-EPFKSLSADNASKSVRSRNGQQSKPATQ  164

Query  388  -DSTASAWGFGTDSFTA--VPSATSQMNASFSDRNNSQRFGD-KRVDNKSASQPAGWAGF  221
              +   +WGFG D+F+A    S + QM     + + +  F + K  ++KS SQPAGWAGF
Sbjct  165  PAADFDSWGFGADTFSAARAGSGSPQMPRP-GEGSTAHVFREAKGFESKSTSQPAGWAGF  223



>ref|XP_008677437.1| PREDICTED: uncharacterized protein LOC100304212 isoform X1 [Zea 
mays]
 gb|AFW62790.1| putative protein kinase superfamily protein [Zea mays]
Length=666

 Score = 99.8 bits (247),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 76/179 (42%), Positives = 101/179 (56%), Gaps = 19/179 (11%)
 Frame = -2

Query  742  AEITSKFEKLSAICRSQRQEIQELKQALAAKTPSPNRDTLRNQSSPKSQTFSTPPQRETI  563
            AE+T+K+EKLSAICRSQRQEIQELK+ LA  TP  N+ + R Q S          ++E I
Sbjct  502  AEMTAKYEKLSAICRSQRQEIQELKRTLAEATPPSNKVSSRTQDSGSQ-------RKEKI  554

Query  562  EGTVWElq--qgllnqsssSPDPSAWQAFADDGPKPLTTPPPSNTPRSMRTRNNQPPNTQ  389
            +GT+WEL+      N SS+S D   WQAF    P   T   P     +  ++N     T 
Sbjct  555  QGTLWELEQGMLASNTSSASSDVKTWQAF----PDTQTQARPKVDHGTNGSQNITKNTTS  610

Query  388  DSTASAWGFGTDSF---TAVPSATSQMNASFSDRNNSQRFGDKRVDNKSASQPAGWAGF  221
             ++  AWGFGTDSF   +A   A +Q+N + +  ++SQRF       K   QP+GWAGF
Sbjct  611  GASPDAWGFGTDSFRTSSAPVKAATQINRA-AQGSSSQRFNSGVA--KKVEQPSGWAGF  666



>ref|XP_004952949.1| PREDICTED: AP2-associated protein kinase 1-like isoform X2 [Setaria 
italica]
Length=609

 Score = 98.2 bits (243),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 75/180 (42%), Positives = 101/180 (56%), Gaps = 20/180 (11%)
 Frame = -2

Query  739  EITSKFEKLSAICRSQRQEIQELKQALAAKTPSPNRDTLRNQSSPKSQTFSTPPQRETIE  560
            E+T+K+EKLSAICRSQRQE+QELK+ LA  TP  N+ + R Q S        P ++E IE
Sbjct  443  EMTAKYEKLSAICRSQRQELQELKRTLAETTPPSNKVSSRTQDSG-------PQRKEKIE  495

Query  559  GTVWElqqglln--qsssSPDPSAWQAFADDGPKPLTTPPPSNTP--RSMRTRNNQPPNT  392
            GTVWEL+ G+L     S+S D   WQ F D   +    P   +    R   T++  P  +
Sbjct  496  GTVWELEHGMLASNSKSASSDAKTWQVFPDTKTQAQARPKVDHATNGRQNLTKSTNPGPS  555

Query  391  QDSTASAWGFGTDSF---TAVPSATSQMNASFSDRNNSQRFGDKRVDNKSASQPAGWAGF  221
             D    AWGFGTD++    A  S  +Q+N + +  ++SQRF       K   QP+GWAGF
Sbjct  556  PD----AWGFGTDNYRTSAAAASTATQINRTTAQGSSSQRFSTGVA--KKVEQPSGWAGF  609



>ref|XP_010943528.1| PREDICTED: AP2-associated protein kinase 1-like [Elaeis guineensis]
Length=698

 Score = 98.6 bits (244),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 79/176 (45%), Positives = 106/176 (60%), Gaps = 10/176 (6%)
 Frame = -2

Query  739  EITSKFEKLSAICRSQRQEIQELKQALAAKT-PSPNRDTLRNQSSPKSQTFSTPPQRETI  563
            EITSK+EKLSAICRSQRQEIQELK+ALA  T   P++D+ ++  SP S    T  Q++ I
Sbjct  530  EITSKYEKLSAICRSQRQEIQELKRALAGATPSPPSKDSSKSHVSPGSLQPGT-LQKDKI  588

Query  562  EGTVWElqqglln--qsssSPDPSAWQAFADDGPKPLTTPPPSNTPRSMRTRNNQPPNTQ  389
            EGTVWELQQG+L     S SP+P  WQAF+ +          +N  +++  +     +  
Sbjct  589  EGTVWELQQGMLENSSPSPSPEPKPWQAFSGETKVQSIAAGMTNGHQNLTKQ-----SVA  643

Query  388  DSTASAWGFGTDSFTAVPSATSQMNASFSDRNNSQRFGDKRVDNKSASQPAGWAGF  221
              ++  WGF  +SFTA PS  +Q++ +    N S+RFG         SQPAGWAGF
Sbjct  644  GLSSDVWGFNLESFTAAPSG-AQVSRTSIQANTSRRFGSGGTKKVETSQPAGWAGF  698



>ref|XP_004952948.1| PREDICTED: AP2-associated protein kinase 1-like isoform X1 [Setaria 
italica]
Length=670

 Score = 98.2 bits (243),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 75/180 (42%), Positives = 101/180 (56%), Gaps = 20/180 (11%)
 Frame = -2

Query  739  EITSKFEKLSAICRSQRQEIQELKQALAAKTPSPNRDTLRNQSSPKSQTFSTPPQRETIE  560
            E+T+K+EKLSAICRSQRQE+QELK+ LA  TP  N+ + R Q        S P ++E IE
Sbjct  504  EMTAKYEKLSAICRSQRQELQELKRTLAETTPPSNKVSSRTQD-------SGPQRKEKIE  556

Query  559  GTVWElqqglln--qsssSPDPSAWQAFADDGPKPLTTPPPSNTP--RSMRTRNNQPPNT  392
            GTVWEL+ G+L     S+S D   WQ F D   +    P   +    R   T++  P  +
Sbjct  557  GTVWELEHGMLASNSKSASSDAKTWQVFPDTKTQAQARPKVDHATNGRQNLTKSTNPGPS  616

Query  391  QDSTASAWGFGTDSF---TAVPSATSQMNASFSDRNNSQRFGDKRVDNKSASQPAGWAGF  221
             D    AWGFGTD++    A  S  +Q+N + +  ++SQRF       K   QP+GWAGF
Sbjct  617  PD----AWGFGTDNYRTSAAAASTATQINRTTAQGSSSQRFSTGVA--KKVEQPSGWAGF  670



>ref|XP_009395097.1| PREDICTED: AP2-associated protein kinase 1 {ECO:0000303|PubMed:11877461}-like 
[Musa acuminata subsp. malaccensis]
 ref|XP_009395098.1| PREDICTED: AP2-associated protein kinase 1 {ECO:0000303|PubMed:11877461}-like 
[Musa acuminata subsp. malaccensis]
Length=670

 Score = 98.2 bits (243),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 81/180 (45%), Positives = 104/180 (58%), Gaps = 33/180 (18%)
 Frame = -2

Query  739  EITSKFEKLSAICRSQRQEIQELKQALAAKTPS-PNRDTLRNQSSPKSQTFSTPPQRETI  563
            EITS++EKLSA+CRSQRQEIQELK ALAA +PS P +D+ +N   P S    TPP R  I
Sbjct  517  EITSRYEKLSAVCRSQRQEIQELKHALAAVSPSPPGKDSTKNHEHPGSLQSITPP-RMKI  575

Query  562  EGTVWElqqglln-qsssSPDPSAWQAFADDGPKPLTTPPPSNTPRSMRTRNNQPPNTQD  386
            EGTVWELQQG+++   S  P+   W AF             +N  +++ +  N  P+T  
Sbjct  576  EGTVWELQQGMMHPSPSPRPETKTWNAFG-----------ATNGHQNVMSAVN--PST--  620

Query  385  STASAWGFGTDSFTA-----VPSATSQMNASFSDRNNSQRFGDKRVDNKSASQPAGWAGF  221
                 WGF   SFTA     +  +++Q NAS   R NS     K+ D   A+QPAGWAGF
Sbjct  621  ---DLWGFNLGSFTASSGSQISGSSAQGNASM--RTNSG--ATKKAD---ANQPAGWAGF  670



>ref|XP_003575255.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0276461 
isoform X1 [Brachypodium distachyon]
 ref|XP_010235617.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0276461 
isoform X1 [Brachypodium distachyon]
 ref|XP_010235618.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0276461 
isoform X1 [Brachypodium distachyon]
Length=672

 Score = 97.8 bits (242),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 80/183 (44%), Positives = 103/183 (56%), Gaps = 25/183 (14%)
 Frame = -2

Query  742  AEITSKFEKLSAICRSQRQEIQELKQALAAKTPSPNRDTLRNQSSPKSQTFSTPPQRETI  563
            AE+T+K+EKLSAICRSQRQEIQELK+ +A  TP P+           SQ      ++E I
Sbjct  506  AEMTAKYEKLSAICRSQRQEIQELKRTVAETTPPPSIKVSSRIPESGSQ------RKEKI  559

Query  562  EGTVWElqqgllnqsssSPDPSA--WQAFADDGPKPLTTPPPSNTPRSMRTRNNQPPNTQ  389
            EGTVWEL+QG+L   SS P   A  WQAF +   +       +   R   TRN     + 
Sbjct  560  EGTVWELEQGMLAGKSSLPSSEAKTWQAFPEAKVQARPKVDHATNGRQNLTRNTNAGPSP  619

Query  388  DSTASAWGFGTDSFTAVPS----ATSQMNASFSDRNNSQRF---GDKRVDNKSASQPAGW  230
            D    AWGFG DSF  +PS    A +Q+N + +  ++SQRF     K+VD     QP+GW
Sbjct  620  D----AWGFGPDSF-GMPSGSTAAAAQINRTSAQGSSSQRFSTGAAKKVD-----QPSGW  669

Query  229  AGF  221
            AGF
Sbjct  670  AGF  672



>gb|KEH33173.1| Serine/Threonine kinase family protein [Medicago truncatula]
Length=678

 Score = 95.9 bits (237),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 71/180 (39%), Positives = 105/180 (58%), Gaps = 23/180 (13%)
 Frame = -2

Query  742  AEITSKFEKLSAICRSQRQEIQELKQALAAKTPSPNRDTLRNQSSPKSQTFSTPPQRETI  563
            +EIT+K+EKL+AICRSQRQE+Q+LKQ LAAKTPSP+R+  R  +SP   + ++   R   
Sbjct  516  SEITAKYEKLTAICRSQRQELQDLKQTLAAKTPSPSREGFR--TSPGVASSASSQDR---  570

Query  562  EGTVWElqqgllnqsssSPDPSAWQAFADDGPKPLTTPPPSNTPRSMRTRNNQ--PPNTQ  389
              + W+               S+WQ F+++  +P  +    N  +S+R+RN Q   P TQ
Sbjct  571  --SEWKTPSSEPK--------SSWQPFSEES-EPFKSLSADNASKSVRSRNGQQSKPATQ  619

Query  388  -DSTASAWGFGTDSFTA--VPSATSQMNASFSDRNNSQRFGD-KRVDNKSASQPAGWAGF  221
              +   +WGFG D+F+A    S + QM     + + +  F + K  ++KS SQPAGWAGF
Sbjct  620  PAADFDSWGFGADTFSAARAGSGSPQMPRP-GEGSTAHVFREAKGFESKSTSQPAGWAGF  678



>ref|XP_004956476.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0280111-like 
[Setaria italica]
Length=699

 Score = 94.4 bits (233),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 84/189 (44%), Positives = 101/189 (53%), Gaps = 20/189 (11%)
 Frame = -2

Query  739  EITSKFEKLSAICRSQRQEIQELKQALAAKTPSPNRDTLRNQS----SPKSQTFSTPPQR  572
            EI+ KF+KLSAIC SQR+EIQELKQALA  + +P     R  S    SP S +  TPP R
Sbjct  515  EISLKFDKLSAICSSQRREIQELKQALATASVTPPAKQFRENSKVELSPPSTSLDTPP-R  573

Query  571  ETIEGTVWElqqgllnq--sssSPDPSAWQAFADDGPKPLTTPPPSNTPRSMRTRNNQPP  398
            E IEGT  EL+QGL      + SPDP  W AF DD PKP      S  PRS+RT      
Sbjct  574  EKIEGTPPELRQGLFTSRPGTPSPDPKPWSAFPDD-PKP-QAAVKSAHPRSVRTLRASNS  631

Query  397  N--------TQDSTASAWGFGTDSFTAVPSATSQMNASFSDRNNSQRFGDKRVDNK--SA  248
            N           S+A  + FG DSF A PS T     S +  N +Q   ++  + K   +
Sbjct  632  NKASSLGQPNASSSADPFAFGQDSFKAAPSGTVPPKLS-NMGNTTQLLNNQNAEEKKDGS  690

Query  247  SQPAGWAGF  221
             QPAGW GF
Sbjct  691  YQPAGWTGF  699



>ref|XP_010542991.1| PREDICTED: AP2-associated protein kinase 1-like isoform X2 [Tarenaya 
hassleriana]
Length=632

 Score = 93.6 bits (231),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 75/182 (41%), Positives = 96/182 (53%), Gaps = 37/182 (20%)
 Frame = -2

Query  742  AEITSKFEKLSAICRSQRQEIQELKQALAAKT-PSPNRDTLRNQSSPKSQTFSTPPQRET  566
            AE+T+KFEKLS IC++QRQE+ ELKQ LAAKT  SP+RD+ + Q S  ++  ST P+   
Sbjct  480  AEMTAKFEKLSCICKTQRQELHELKQRLAAKTSASPSRDSPQIQISSGAR--STLPE---  534

Query  565  IEGTVWElqqgllnqsssSPDPSAWQAFADDGPKP-LTTPPPSNTP---RSMRTRNNQPP  398
             + + W               P AW+AF+D+ PKP L T    N     +S+ TRN+QP 
Sbjct  535  -DRSDWASGNSA---------PKAWKAFSDE-PKPGLQTASKGNNISNNQSVITRNSQPS  583

Query  397  NTQDSTASAWGFGTDSF---TAVPSATSQMNASFSDRNNSQRFGDKRVDNKSASQPAGWA  227
             T       WGF TDSF   T + S+ S M       NN             A QPAGWA
Sbjct  584  KTASQGFDPWGFETDSFRAATTLSSSASAMQRPLGSDNN-------------APQPAGWA  630

Query  226  GF  221
            GF
Sbjct  631  GF  632



>ref|XP_010542987.1| PREDICTED: AP2-associated protein kinase 1-like isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010542988.1| PREDICTED: AP2-associated protein kinase 1-like isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010542989.1| PREDICTED: AP2-associated protein kinase 1-like isoform X1 [Tarenaya 
hassleriana]
Length=633

 Score = 93.6 bits (231),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 75/182 (41%), Positives = 96/182 (53%), Gaps = 37/182 (20%)
 Frame = -2

Query  742  AEITSKFEKLSAICRSQRQEIQELKQALAAKT-PSPNRDTLRNQSSPKSQTFSTPPQRET  566
            AE+T+KFEKLS IC++QRQE+ ELKQ LAAKT  SP+RD+ + Q S  ++  ST P+   
Sbjct  481  AEMTAKFEKLSCICKTQRQELHELKQRLAAKTSASPSRDSPQIQISSGAR--STLPE---  535

Query  565  IEGTVWElqqgllnqsssSPDPSAWQAFADDGPKP-LTTPPPSNTP---RSMRTRNNQPP  398
             + + W               P AW+AF+D+ PKP L T    N     +S+ TRN+QP 
Sbjct  536  -DRSDWASGNSA---------PKAWKAFSDE-PKPGLQTASKGNNISNNQSVITRNSQPS  584

Query  397  NTQDSTASAWGFGTDSF---TAVPSATSQMNASFSDRNNSQRFGDKRVDNKSASQPAGWA  227
             T       WGF TDSF   T + S+ S M       NN             A QPAGWA
Sbjct  585  KTASQGFDPWGFETDSFRAATTLSSSASAMQRPLGSDNN-------------APQPAGWA  631

Query  226  GF  221
            GF
Sbjct  632  GF  633



>gb|EMT28285.1| Putative serine/threonine-protein kinase [Aegilops tauschii]
Length=668

 Score = 91.7 bits (226),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 78/180 (43%), Positives = 103/180 (57%), Gaps = 24/180 (13%)
 Frame = -2

Query  742  AEITSKFEKLSAICRSQRQEIQELKQALAAKTPSPNRDTLRNQSSPKSQTFSTPPQR-ET  566
            AE+T+K+EKLSAICRSQRQEIQELK+ +A  TP P+       S   S+T     QR E 
Sbjct  507  AEMTAKYEKLSAICRSQRQEIQELKRTVAETTPPPS-------SKVSSRTPELGSQRKER  559

Query  565  IEGTVWElqqgllnqsssSPDPSA--WQAFADDGPKPLTTPPPSNTPRSMRTRNNQPPNT  392
            IEGTVWEL+QG+L+ +SS+P   A  WQ+F +   +       +   R   TRN     +
Sbjct  560  IEGTVWELEQGMLSGNSSAPSSEAKTWQSFPEAKAQTRPKVDHATNGRQNLTRNTNAGPS  619

Query  391  QDSTASAWGFGTDSFTAVPSATSQMNASFSDRNNSQRF---GDKRVDNKSASQPAGWAGF  221
             D    AWGFGT S     +  +QMN + +  ++SQR      K+VD     QP+GWAGF
Sbjct  620  PD----AWGFGTSS--GSNATATQMNRTNAQGSSSQRLSMGAAKKVD-----QPSGWAGF  668



>gb|EMT09791.1| Putative serine/threonine-protein kinase [Aegilops tauschii]
Length=685

 Score = 90.1 bits (222),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 82/189 (43%), Positives = 106/189 (56%), Gaps = 20/189 (11%)
 Frame = -2

Query  739  EITSKFEKLSAICRSQRQEIQELKQALA-AKTPSPNRDT---LRNQSSPKSQTFSTPPQR  572
            EI+ KF++LSAIC SQR+EIQELKQALA A  P+P ++    L+ + SP S +  TPP R
Sbjct  501  EISLKFDRLSAICSSQRREIQELKQALATASAPAPVKELKENLKAEFSPPSTSLDTPP-R  559

Query  571  ETIEGTVWElqqgllnqs--ssSPDPSAWQAFADDGPKPLTTPPPSNTPRSMRTRNNQPP  398
            E I GT  EL+QGL   S  + SPDP  W AF ++ PK       S  PRS+RT      
Sbjct  560  EKIAGTPPELRQGLFTSSPGTPSPDPKPWSAFPEE-PKA-QAAVKSARPRSVRTLRASQS  617

Query  397  NTQ--------DSTASAWGFGTDSFTAVPSAT--SQMNASFSDRNNSQRFGDKRVDNKSA  248
            N          +S A  + FG DSF AVPS T  S+M ++  + + S       V+  + 
Sbjct  618  NKAGSLSQSKTNSGADPFAFGQDSFKAVPSGTVPSEM-SNLGNASQSLNTLKAEVEKDAP  676

Query  247  SQPAGWAGF  221
             QPAGW GF
Sbjct  677  YQPAGWTGF  685



>ref|XP_008671591.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0276461 
[Zea mays]
Length=640

 Score = 89.7 bits (221),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 78/189 (41%), Positives = 99/189 (52%), Gaps = 21/189 (11%)
 Frame = -2

Query  739  EITSKFEKLSAICRSQRQEIQELKQALAAKTPSPNRDTLRNQSS----PKSQTFSTPPQR  572
            EI+ KF+KLSAIC SQR+EIQELKQALAA   +P     R  SS    P S++  TPP R
Sbjct  457  EISLKFDKLSAICSSQRREIQELKQALAAAYVTPPAKQFRENSSVEVTPPSKSLDTPP-R  515

Query  571  ETIEGTVWElqqgllnqsssSPDPSA--WQAFADDGPKPLTTPPPSNTPRSMRTRNNQPP  398
            E IEGT  EL+QGL   S  +P P    W AF ++ PK       S  PRS+RT      
Sbjct  516  EKIEGTPPELRQGLFTSSPGTPSPDLKTWSAFLEE-PKS-QAAVKSVHPRSVRTLRASNS  573

Query  397  NTQDSTASA--------WGFGTDSFTAVPSATSQMNASFSDRNNSQRFGDKRVDNK--SA  248
            N   S   +        + FG DSF A PS T  +    S+  N+ +  +  ++ K   +
Sbjct  574  NKASSLGQSNISSSTDPFAFGQDSFKAAPSGT--VLPLLSNMGNTSQLSNLNIEEKKDGS  631

Query  247  SQPAGWAGF  221
             QP GW GF
Sbjct  632  YQPDGWTGF  640



>tpg|DAA39365.1| TPA: putative protein kinase superfamily protein [Zea mays]
Length=603

 Score = 89.4 bits (220),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 78/189 (41%), Positives = 99/189 (52%), Gaps = 21/189 (11%)
 Frame = -2

Query  739  EITSKFEKLSAICRSQRQEIQELKQALAAKTPSPNRDTLRNQSS----PKSQTFSTPPQR  572
            EI+ KF+KLSAIC SQR+EIQELKQALAA   +P     R  SS    P S++  TPP R
Sbjct  420  EISLKFDKLSAICSSQRREIQELKQALAAAYVTPPAKQFRENSSVEVTPPSKSLDTPP-R  478

Query  571  ETIEGTVWElqqgllnqsssSPDPSA--WQAFADDGPKPLTTPPPSNTPRSMRTRNNQPP  398
            E IEGT  EL+QGL   S  +P P    W AF ++ PK       S  PRS+RT      
Sbjct  479  EKIEGTPPELRQGLFTSSPGTPSPDLKTWSAFLEE-PKS-QAAVKSVHPRSVRTLRASNS  536

Query  397  NTQDSTASA--------WGFGTDSFTAVPSATSQMNASFSDRNNSQRFGDKRVDNK--SA  248
            N   S   +        + FG DSF A PS T  +    S+  N+ +  +  ++ K   +
Sbjct  537  NKASSLGQSNISSSTDPFAFGQDSFKAAPSGT--VLPLLSNMGNTSQLSNLNIEEKKDGS  594

Query  247  SQPAGWAGF  221
             QP GW GF
Sbjct  595  YQPDGWTGF  603



>gb|AFW81246.1| hypothetical protein ZEAMMB73_183204 [Zea mays]
Length=509

 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 69/162 (43%), Positives = 93/162 (57%), Gaps = 18/162 (11%)
 Frame = -2

Query  742  AEITSKFEKLSAICRSQRQEIQELKQALAAKTPSPNRDTLRNQSSPKSQTFSTPPQRETI  563
            AE+T+K EKLSAICRSQRQEIQELK  L   TP  N+ + R Q S          ++E I
Sbjct  215  AEMTTKHEKLSAICRSQRQEIQELKLTLVEPTPPSNKVSSRTQDSGSQ-------RKEKI  267

Query  562  EGTVWElqqgllnqsssSPDPSA----WQAFADDGPKPLTTPPPSNTPRSMRTRNNQPPN  395
            +GTVWEL+QG+L  +S+S   S+    WQAF    P   T   P     +  ++N     
Sbjct  268  QGTVWELEQGMLAIASNSSSASSDAKTWQAF----PDTKTQARPKVDHATNGSQNITKNT  323

Query  394  TQDSTASAWGFGTDSF---TAVPSATSQMNASFSDRNNSQRF  278
            T  ++  AWGFGTD+F        AT+Q+N + + R++SQRF
Sbjct  324  TSGASPDAWGFGTDNFRTPATTLRATTQINRAAAQRSSSQRF  365



>ref|XP_010237997.1| PREDICTED: AP2-associated protein kinase 1-like [Brachypodium 
distachyon]
Length=697

 Score = 83.2 bits (204),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 79/187 (42%), Positives = 97/187 (52%), Gaps = 21/187 (11%)
 Frame = -2

Query  739  EITSKFEKLSAICRSQRQEIQELKQALA-AKTPSPNRDTLRNQS---SPKSQTFSTPPQR  572
            EI+ KF+KLSAIC SQR+EIQELKQALA A    P ++   N     SP++ +  TPP R
Sbjct  518  EISLKFDKLSAICSSQRREIQELKQALATASATLPVKEFKENSKGVVSPQTASLDTPP-R  576

Query  571  ETIEGTVWElqqgllnqs--ssSPDPSAWQAFADDGPKPLTTPPPSNTPRSMRTRNNQPP  398
            E I GT  EL+QGL   S  + SPDP  W AF ++ PK       S  PRS+RT      
Sbjct  577  EKIAGTPPELRQGLFTSSPGTPSPDPKPWSAFPEE-PKA-QAAMKSAHPRSVRTLRASNS  634

Query  397  NTQDST--------ASAWGFGTDSFTAVPSATSQMNASFSDRNNSQRFGDKRVDNKSASQ  242
            N   S         A  + FG DSF AVPS  S +  +    N  +      V   +  Q
Sbjct  635  NKVSSLGQSKTNPGADPFAFGQDSFKAVPSEMSNLGNASQSPNTLK----AEVKKDAPYQ  690

Query  241  PAGWAGF  221
            PAGW GF
Sbjct  691  PAGWTGF  697



>dbj|BAD26025.1| putative AAK1 protein [Oryza sativa Japonica Group]
Length=703

 Score = 82.8 bits (203),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 81/200 (41%), Positives = 100/200 (50%), Gaps = 28/200 (14%)
 Frame = -2

Query  739  EITSKFEKLSAICRSQRQEIQELKQALAAKTPSPNRDTLRNQS----SPKSQTFSTPPQR  572
            EI  KF+KLS IC SQR+EIQELKQALA  + + +    +  S    SP S +  TPP R
Sbjct  505  EIALKFDKLSGICSSQRREIQELKQALATASATQSVKEFKENSKAELSPPSTSLDTPP-R  563

Query  571  ETIEGTVWElqqgllnqs--ssSPDPSAWQAFADDGPKPLTTPPPSNTPRSMRTRNNQPP  398
            E IEGT  EL+QGL   S  + SPDP  W AF ++             PRS+RT      
Sbjct  564  EKIEGTPPELRQGLFTSSPGTPSPDPKPWSAFPEEPKAQAAVTVKGAHPRSVRTLRASNS  623

Query  397  N--------TQDSTASAWGFGTDSFTAVPSAT--SQM----NASFSDR-----NNSQRFG  275
            N           S+A  + FG DSF A PS    S+M    N S S +     N SQ   
Sbjct  624  NKASSLGQSNTSSSADPFAFGQDSFKAAPSRALPSKMSNLGNGSQSSKMSNLGNGSQSLN  683

Query  274  DKRVDNK--SASQPAGWAGF  221
              + + K  S+ QPAGW GF
Sbjct  684  ALKAEAKQDSSYQPAGWTGF  703



>gb|EAZ08411.1| hypothetical protein OsI_30675 [Oryza sativa Indica Group]
Length=703

 Score = 82.8 bits (203),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 81/200 (41%), Positives = 100/200 (50%), Gaps = 28/200 (14%)
 Frame = -2

Query  739  EITSKFEKLSAICRSQRQEIQELKQALAAKTPSPNRDTLRNQS----SPKSQTFSTPPQR  572
            EI  KF+KLS IC SQR+EIQELKQALA  + + +    +  S    SP S +  TPP R
Sbjct  505  EIALKFDKLSGICSSQRREIQELKQALATASATQSVKEFKENSKAELSPPSTSLDTPP-R  563

Query  571  ETIEGTVWElqqgllnqs--ssSPDPSAWQAFADDGPKPLTTPPPSNTPRSMRTRNNQPP  398
            E IEGT  EL+QGL   S  + SPDP  W AF ++             PRS+RT      
Sbjct  564  EKIEGTPPELRQGLFTSSPGTPSPDPKPWSAFPEEPKAQAAVTVKGAHPRSVRTLRASNS  623

Query  397  N--------TQDSTASAWGFGTDSFTAVPSAT--SQM----NASFSDR-----NNSQRFG  275
            N           S+A  + FG DSF A PS    S+M    N S S +     N SQ   
Sbjct  624  NKASSLGQSNTSSSADPFAFGQDSFKAAPSRALPSKMSNLGNGSQSSKMSNLGNGSQSLN  683

Query  274  DKRVDNK--SASQPAGWAGF  221
              + + K  S+ QPAGW GF
Sbjct  684  ALKAEAKQDSSYQPAGWTGF  703



>ref|XP_010469539.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0276461 
isoform X2 [Camelina sativa]
Length=598

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 48/87 (55%), Positives = 66/87 (76%), Gaps = 2/87 (2%)
 Frame = -2

Query  742  AEITSKFEKLSAICRSQRQEIQELKQAL--AAKTPSPNRDTLRNQSSPKSQTFSTPPQRE  569
            AEIT+KFEKLSAICRSQRQE+Q+LKQ L   + +PSP+RD+ +N  SP   + S+ P RE
Sbjct  488  AEITAKFEKLSAICRSQRQELQDLKQTLASKSASPSPSRDSSQNHPSPGMHSVSSTPSRE  547

Query  568  TIEGTVWElqqgllnqsssSPDPSAWQ  488
             +EG++WELQ+   + S+ S DP++WQ
Sbjct  548  KMEGSMWELQKDRSDWSTESSDPNSWQ  574



>ref|XP_006660487.1| PREDICTED: AP2-associated protein kinase 1-like [Oryza brachyantha]
Length=710

 Score = 79.3 bits (194),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 79/200 (40%), Positives = 101/200 (51%), Gaps = 28/200 (14%)
 Frame = -2

Query  739  EITSKFEKLSAICRSQRQEIQELKQALAAKTPSPNRDTLRN----QSSPKSQTFSTPPQR  572
            EI+ KF+KLSAIC SQR+EIQELKQALA  + + +    +     + SP   +  TPP R
Sbjct  512  EISLKFDKLSAICSSQRREIQELKQALATASATQSAKEFKENPKAELSPPITSLDTPP-R  570

Query  571  ETIEGTVWElqqgllnqs--ssSPDPSAWQAFADDGPKPLTTPPPSNTPRSMRTRNNQPP  398
            E IEGT  EL+QGL   S  + SPDP  W AF ++          S  PRS+RT      
Sbjct  571  EKIEGTPPELRQGLFTSSPGTPSPDPKPWSAFPEEPKAQAAVTVKSAHPRSVRTLRASNS  630

Query  397  N--------TQDSTASAWGFGTDSFTAVPS--ATSQM----NASFSDRNNSQRFGDKRVD  260
            N           S+A  + FG DSF A PS  A S+M    N S S + ++   G   ++
Sbjct  631  NKASSLGQSNTSSSADPFAFGQDSFKAAPSQAAPSKMSNLGNGSQSSKMSNLGNGSPSLN  690

Query  259  NKSAS-------QPAGWAGF  221
               A        QPAGW GF
Sbjct  691  ALKAEARQDSPYQPAGWTGF  710



>dbj|BAJ97005.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=693

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 78/189 (41%), Positives = 99/189 (52%), Gaps = 20/189 (11%)
 Frame = -2

Query  739  EITSKFEKLSAICRSQRQEIQELKQALAAKTPS----PNRDTLRNQSSPKSQTFSTPPQR  572
            EI+ KF++LSAIC SQR+EIQELKQALA  + +      ++ L+ + SP S +  TPP R
Sbjct  509  EISLKFDRLSAICSSQRREIQELKQALAIASAAAPVKELKENLKAEFSPPSTSLDTPP-R  567

Query  571  ETIEGTVWElqqgllnqsssSPDPSA--WQAFADDGPKPLTTPPPSNTPRSMRTRNNQPP  398
            E I GT  EL+QGL   S  +P P    W AF ++ PK       S  PRS+RT      
Sbjct  568  EKIAGTPPELRQGLFTSSPGTPSPDLKPWSAFPEE-PKA-QAAVKSAHPRSVRTLRASNS  625

Query  397  NTQ--------DSTASAWGFGTDSFTAVPSATSQMNASFSDRNNSQRFGDKRVDNKSAS-  245
            N          +S A  + FG DSF AVPS T   +   +  N SQ     + D K    
Sbjct  626  NKAGSLSQSKTNSGADPFAFGQDSFKAVPSGTVP-SEILNLGNASQSLNTLKADVKKDEP  684

Query  244  -QPAGWAGF  221
             QPAGW GF
Sbjct  685  YQPAGWTGF  693



>ref|XP_009143925.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0276461 
[Brassica rapa]
Length=583

 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 65/194 (34%), Positives = 90/194 (46%), Gaps = 74/194 (38%)
 Frame = -2

Query  742  AEITSKFEKLSAICRSQRQEIQELKQALAAKTP--SPNRDTLRNQSSPKSQTFSTPPQRE  569
            AEIT+KFEKLS ICRSQRQE+Q+LKQ LA+KT   SP+RD      SP  ++ S+ P R+
Sbjct  444  AEITAKFEKLSVICRSQRQELQDLKQTLASKTVTSSPSRD------SPGMRSTSSTPSRD  497

Query  568  TIEGTVWElqqgllnqsssSPDPSAWQAFADDGPKPLTTPPPSNTPRSMRTRNNQPPNTQ  389
                                                          +     NN+   ++
Sbjct  498  ----------------------------------------------KGNNNSNNESVRSK  511

Query  388  DSTASA-----------WGFGTDSF------TAVPSATSQMNASFSDRNNSQRFGDKRV-  263
              TAS            WGF T+SF      +   S T+Q + SF   ++SQR G+ ++ 
Sbjct  512  SKTASLAPAPASQGFEPWGFETESFRAASQSSGSASTTAQRSVSFG--SSSQRLGNTKMR  569

Query  262  DNKSASQPAGWAGF  221
            +N+ A+QPAGWAGF
Sbjct  570  ENQKAAQPAGWAGF  583



>ref|XP_009408443.1| PREDICTED: AP2-associated protein kinase 1 {ECO:0000303|PubMed:11877457}-like, 
partial [Musa acuminata subsp. malaccensis]
Length=632

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 52/110 (47%), Positives = 72/110 (65%), Gaps = 7/110 (6%)
 Frame = -2

Query  742  AEITSKFEKLSAICRSQRQEIQELKQALAAKTPS-PNRDTLRNQSSPKSQTFSTPPQRET  566
             ++TSK+EKLSAICRSQRQEIQELK AL+A +PS P++D  ++ + P S   +  P R+ 
Sbjct  513  VDMTSKYEKLSAICRSQRQEIQELKSALSALSPSLPSKDRSKSHNHPGSLESAALP-RDK  571

Query  565  IEGTVWElqqgll---nqsssSPDPSAWQAFADDGPKPLTTPPPSNTPRS  425
            +EG+VW+LQQG++   + SS  P+   W AF   G   +   P SN P S
Sbjct  572  MEGSVWDLQQGMMSNPSASSHRPELKTWNAF--HGEPKIQAAPRSNHPIS  619



>emb|CBI24810.3| unnamed protein product [Vitis vinifera]
Length=1100

 Score = 72.8 bits (177),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 39/85 (46%), Positives = 49/85 (58%), Gaps = 7/85 (8%)
 Frame = -2

Query  445   PSNTPRSMRTRN---NQPPNTQDSTASAWGFGTDSFTAVPSATSQMNASFSDRNNSQRFG  275
             P N  +S+RTRN   N+P     S    WGFGT SFTA P+A+S ++      NN   FG
Sbjct  932   PDNNSKSVRTRNGHHNKPATEATSGPETWGFGTQSFTATPAASSNISKPPVGGNNVHLFG  991

Query  274   D-KRVDNKSASQPAGWAGF*ASALC  203
             D K+++ K A QPA WA    SALC
Sbjct  992   DSKKIEGKLAPQPAEWA---VSALC  1013



>emb|CAN81086.1| hypothetical protein VITISV_027167 [Vitis vinifera]
Length=1756

 Score = 71.6 bits (174),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 36/78 (46%), Positives = 46/78 (59%), Gaps = 4/78 (5%)
 Frame = -2

Query  445   PSNTPRSMRTRN---NQPPNTQDSTASAWGFGTDSFTAVPSATSQMNASFSDRNNSQRFG  275
             P N  +S+RTRN   N+P     S    WGFGT SFTA P+A+S ++      NN   FG
Sbjct  1316  PDNNSKSVRTRNGHHNKPATEATSGPETWGFGTQSFTATPAASSNISKPPVGGNNVHLFG  1375

Query  274   D-KRVDNKSASQPAGWAG  224
             D K+++ K A QPA WAG
Sbjct  1376  DSKKIEGKLAPQPAEWAG  1393



>emb|CDY12158.1| BnaC04g11880D [Brassica napus]
Length=577

 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 64/182 (35%), Positives = 90/182 (49%), Gaps = 57/182 (31%)
 Frame = -2

Query  742  AEITSKFEKLSAICRSQRQEIQELKQALAAKTP--SPNRDTLRNQSSPKSQTFSTPPQRE  569
            AEIT+KFEKLSAICRSQRQE+Q+LKQ +A+KT   SP+R       SP  ++ S+ P R 
Sbjct  445  AEITAKFEKLSAICRSQRQELQDLKQTIASKTVSSSPSR------YSPGMRSTSSTPSR-  497

Query  568  TIEGTVWElqqgllnqsssSPDPSAWQAFADDGPKPLTTPPPSNTPRSMRTRNNQPPNTQ  389
                                          D G          N   S+R+++   P + 
Sbjct  498  ------------------------------DKG----------NNNESVRSKSK--PASA  515

Query  388  DSTASAWGFGTDSFTAVPSATSQMNASFSDR-----NNSQRFGDKRV-DNKSASQPAGWA  227
                  WGF T+SF A  S +S    + + R     ++SQR G+ ++ +N+ A+QPAGWA
Sbjct  516  SQGFERWGFETESFRAAASPSSASATTTAQRSVSSGSSSQRLGNTKMRENQKAAQPAGWA  575

Query  226  GF  221
            GF
Sbjct  576  GF  577



>emb|CAN62110.1| hypothetical protein VITISV_038734 [Vitis vinifera]
Length=1625

 Score = 70.5 bits (171),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 35/79 (44%), Positives = 49/79 (62%), Gaps = 4/79 (5%)
 Frame = -2

Query  445   PSNTPRSMRTRN---NQPPNTQDSTASAWGFGTDSFTAVPSATSQMNASFSDRNNSQRFG  275
             P N  +S+RT+N   N+P     S    WGFGT+SFTA P+A+S ++      NN+Q F 
Sbjct  1547  PDNNSKSVRTQNGHHNKPATEGTSGPETWGFGTESFTATPAASSNISRPSIGGNNAQLFV  1606

Query  274   D-KRVDNKSASQPAGWAGF  221
             D K+++ K A+QP  WAGF
Sbjct  1607  DSKKIEGKLATQPVEWAGF  1625



>ref|XP_001769351.1| predicted protein [Physcomitrella patens]
 gb|EDQ65720.1| predicted protein [Physcomitrella patens]
Length=666

 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 66/192 (34%), Positives = 89/192 (46%), Gaps = 40/192 (21%)
 Frame = -2

Query  736  ITSKFEKLSAICRSQRQEIQELKQAL---AAKTPSPNRDTLRNQSSPKSQTFSTPPQRET  566
            I SKFEKL+ ICRSQRQEIQ+LK  L   A K  SP +    +  + K Q F      ET
Sbjct  495  IASKFEKLTVICRSQRQEIQDLKSQLGSGAGKNTSPTQQHSSSSRAKKLQAFEQGV--ET  552

Query  565  IEGTVWElqqgllnqsssSPDPSAWQAFADDGPKPLTTPPPSNTPR----SMRTRNNQPP  398
              GT+W+LQ+GL   S++    S+W AF D   +  +T PP   PR    S+   + + P
Sbjct  553  QGGTIWDLQEGLSTNSAN--QQSSWAAFEDPPKQVNSTRPPQGNPRASTDSLFNSSGKIP  610

Query  397  N------TQDSTAS-----AWGFGTDSFTAVPSATSQMNASFSDRNNSQRFGDKRVD--N  257
            +       QD  AS      W    +   +V +A                F   +V+   
Sbjct  611  DRKRSVRQQDVRASNPGGERWSMAQERSPSVGTA----------------FNGAKVEPPT  654

Query  256  KSASQPAGWAGF  221
               +QPAGWAGF
Sbjct  655  NRMNQPAGWAGF  666



>ref|XP_010469540.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0276461 
isoform X3 [Camelina sativa]
Length=550

 Score = 58.5 bits (140),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 34/57 (60%), Positives = 44/57 (77%), Gaps = 2/57 (4%)
 Frame = -2

Query  742  AEITSKFEKLSAICRSQRQEIQELKQAL--AAKTPSPNRDTLRNQSSPKSQTFSTPP  578
            AEIT+KFEKLSAICRSQRQE+Q+LKQ L   + +PSP+RD+ +N  SP   + S+ P
Sbjct  488  AEITAKFEKLSAICRSQRQELQDLKQTLASKSASPSPSRDSSQNHPSPGMHSVSSTP  544



>ref|XP_010235619.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0276461 
isoform X2 [Brachypodium distachyon]
Length=612

 Score = 56.6 bits (135),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 26/35 (74%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = -2

Query  742  AEITSKFEKLSAICRSQRQEIQELKQALAAKTPSP  638
            AE+T+K+EKLSAICRSQRQEIQELK+ +A  TP P
Sbjct  506  AEMTAKYEKLSAICRSQRQEIQELKRTVAETTPPP  540



>emb|CAN65496.1| hypothetical protein VITISV_028322 [Vitis vinifera]
Length=1137

 Score = 55.1 bits (131),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 31/76 (41%), Positives = 42/76 (55%), Gaps = 8/76 (11%)
 Frame = -2

Query  445   PSNTPRSMRTRNNQPPNTQDSTASAWGFGTDSFTAVPSATSQMNASFSDRNNSQRFGD-K  269
             P    +  R R N  P T       WGFGT+SF A P+A+S ++      NN+Q F D K
Sbjct  1069  PKWPSQQTRHRRNFCPET-------WGFGTESFRATPAASSNISRPSIGGNNAQLFVDSK  1121

Query  268   RVDNKSASQPAGWAGF  221
             +++ K A+QP  WAGF
Sbjct  1122  KIEGKLATQPTEWAGF  1137



>ref|XP_002972735.1| hypothetical protein SELMODRAFT_98319 [Selaginella moellendorffii]
 gb|EFJ25956.1| hypothetical protein SELMODRAFT_98319 [Selaginella moellendorffii]
Length=543

 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/33 (73%), Positives = 26/33 (79%), Gaps = 0/33 (0%)
 Frame = -2

Query  739  EITSKFEKLSAICRSQRQEIQELKQALAAKTPS  641
            E   K+EKL+AICRSQRQEI ELK ALAA T S
Sbjct  466  EFAGKYEKLTAICRSQRQEIHELKSALAAATVS  498



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1347639082210