BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF009N01

Length=744
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

dbj|BAD18097.1|  putative serine/threonine protein kinase               398   2e-137   Ipomoea batatas [batate]
ref|XP_004159592.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    387   3e-133   
dbj|BAD18102.1|  leucine-rich repeat receptor-like kinase               398   8e-132   Ipomoea batatas [batate]
ref|XP_011045286.1|  PREDICTED: protein NSP-INTERACTING KINASE 3        389   1e-130   Populus euphratica
ref|XP_007044708.1|  Nsp-interacting kinase 3 isoform 1                 392   2e-129   Theobroma cacao [chocolate]
ref|XP_009800027.1|  PREDICTED: protein NSP-INTERACTING KINASE 3        392   2e-129   Nicotiana sylvestris
ref|XP_006378225.1|  hypothetical protein POPTR_0010s05300g             392   2e-129   
emb|CAN75190.1|  hypothetical protein VITISV_035381                     391   3e-129   Vitis vinifera
ref|XP_002315684.2|  hypothetical protein POPTR_0010s05300g             391   3e-129   
ref|XP_010651607.1|  PREDICTED: protein NSP-INTERACTING KINASE 3        391   4e-129   Vitis vinifera
ref|XP_011086598.1|  PREDICTED: protein NSP-INTERACTING KINASE 3        390   1e-128   
ref|XP_009626005.1|  PREDICTED: protein NSP-INTERACTING KINASE 3        390   1e-128   
ref|XP_007044709.1|  Nsp-interacting kinase 3 isoform 2                 384   1e-128   
ref|XP_004297396.1|  PREDICTED: protein NSP-INTERACTING KINASE 3 ...    390   1e-128   Fragaria vesca subsp. vesca
gb|KHN00370.1|  Protein NSP-INTERACTING KINASE 3                        389   2e-128   Glycine soja [wild soybean]
ref|XP_003519642.1|  PREDICTED: protein NSP-INTERACTING KINASE 3 ...    389   2e-128   Glycine max [soybeans]
ref|XP_011463143.1|  PREDICTED: protein NSP-INTERACTING KINASE 3 ...    389   2e-128   Fragaria vesca subsp. vesca
ref|XP_004142972.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    389   2e-128   Cucumis sativus [cucumbers]
ref|XP_008444352.1|  PREDICTED: protein NSP-INTERACTING KINASE 3 ...    389   2e-128   Cucumis melo [Oriental melon]
ref|XP_008444353.1|  PREDICTED: protein NSP-INTERACTING KINASE 3 ...    388   3e-128   Cucumis melo [Oriental melon]
gb|KHN14560.1|  Protein NSP-INTERACTING KINASE 3                        389   3e-128   Glycine soja [wild soybean]
ref|XP_007157369.1|  hypothetical protein PHAVU_002G064400g             389   3e-128   Phaseolus vulgaris [French bean]
ref|XP_003517653.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    389   3e-128   Glycine max [soybeans]
ref|XP_006380012.1|  hypothetical protein POPTR_0008s19310g             388   7e-128   
ref|XP_002312685.1|  leucine-rich repeat family protein                 387   9e-128   
ref|XP_006366916.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    387   1e-127   Solanum tuberosum [potatoes]
ref|XP_002525400.1|  BRASSINOSTEROID INSENSITIVE 1-associated rec...    387   1e-127   
gb|KDP26621.1|  hypothetical protein JCGZ_17779                         387   1e-127   Jatropha curcas
ref|XP_011034116.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    384   2e-126   Populus euphratica
gb|KDO82334.1|  hypothetical protein CISIN_1g006968mg                   384   2e-126   Citrus sinensis [apfelsine]
ref|XP_011034114.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    384   3e-126   Populus euphratica
ref|XP_007222911.1|  hypothetical protein PRUPE_ppa003642mg             381   4e-126   
ref|XP_007222912.1|  hypothetical protein PRUPE_ppa003642mg             381   4e-126   
ref|XP_010248542.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    381   6e-126   Nelumbo nucifera [Indian lotus]
ref|XP_010100426.1|  Protein NSP-INTERACTING KINASE 3                   383   9e-126   Morus notabilis
ref|XP_008221853.1|  PREDICTED: protein NSP-INTERACTING KINASE 3 ...    380   1e-125   Prunus mume [ume]
ref|XP_010251173.1|  PREDICTED: protein NSP-INTERACTING KINASE 3        382   1e-125   Nelumbo nucifera [Indian lotus]
ref|XP_010248541.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    382   1e-125   Nelumbo nucifera [Indian lotus]
gb|KJB61041.1|  hypothetical protein B456_009G337000                    382   2e-125   Gossypium raimondii
gb|KJB61045.1|  hypothetical protein B456_009G337000                    382   2e-125   Gossypium raimondii
gb|EYU28436.1|  hypothetical protein MIMGU_mgv1a002888mg                382   2e-125   Erythranthe guttata [common monkey flower]
ref|XP_008221852.1|  PREDICTED: protein NSP-INTERACTING KINASE 3 ...    381   7e-125   Prunus mume [ume]
ref|XP_008221850.1|  PREDICTED: protein NSP-INTERACTING KINASE 3 ...    381   7e-125   Prunus mume [ume]
ref|XP_010682518.1|  PREDICTED: protein NSP-INTERACTING KINASE 3        379   1e-124   Beta vulgaris subsp. vulgaris [field beet]
emb|CDP13189.1|  unnamed protein product                                379   1e-124   Coffea canephora [robusta coffee]
ref|XP_008389685.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    379   2e-124   Malus domestica [apple tree]
ref|XP_010319667.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    377   2e-124   Solanum lycopersicum
ref|XP_006483905.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    379   2e-124   Citrus sinensis [apfelsine]
ref|XP_006438322.1|  hypothetical protein CICLE_v10030967mg             379   2e-124   Citrus clementina [clementine]
ref|XP_008813583.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    379   2e-124   Phoenix dactylifera
ref|XP_008389688.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    379   3e-124   Malus domestica [apple tree]
ref|XP_008389687.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    379   3e-124   Malus domestica [apple tree]
ref|XP_008340070.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    378   4e-124   
ref|XP_008813582.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    379   4e-124   Phoenix dactylifera
ref|XP_008340072.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    378   4e-124   
ref|XP_008340071.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    378   5e-124   
ref|XP_003613191.1|  Leucine-rich repeat receptor-like kinase           377   7e-124   Medicago truncatula
ref|XP_004237339.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    377   1e-123   Solanum lycopersicum
ref|XP_006841062.1|  hypothetical protein AMTR_s00085p00173590          377   2e-123   Amborella trichopoda
ref|XP_010910388.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    375   4e-123   Elaeis guineensis
ref|XP_010940158.1|  PREDICTED: protein NSP-INTERACTING KINASE 3        375   6e-123   Elaeis guineensis
ref|XP_010023506.1|  PREDICTED: protein NSP-INTERACTING KINASE 3        375   8e-123   Eucalyptus grandis [rose gum]
ref|XP_008812173.1|  PREDICTED: protein NSP-INTERACTING KINASE 3        374   3e-122   Phoenix dactylifera
ref|XP_004489819.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    372   9e-122   Cicer arietinum [garbanzo]
ref|XP_009596637.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    371   1e-121   Nicotiana tomentosiformis
ref|XP_011070875.1|  PREDICTED: protein NSP-INTERACTING KINASE 2-...    371   2e-121   Sesamum indicum [beniseed]
emb|CAN63733.1|  hypothetical protein VITISV_025883                     370   3e-121   Vitis vinifera
ref|XP_009390158.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    371   5e-121   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002269902.1|  PREDICTED: protein NSP-INTERACTING KINASE 1        370   7e-121   Vitis vinifera
ref|XP_009390157.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    371   7e-121   
ref|XP_002532890.1|  BRASSINOSTEROID INSENSITIVE 1-associated rec...    369   9e-121   Ricinus communis
ref|XP_006844161.1|  hypothetical protein AMTR_s00006p00261510          369   1e-120   Amborella trichopoda
ref|XP_010257839.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    368   3e-120   Nelumbo nucifera [Indian lotus]
ref|XP_006593318.1|  PREDICTED: NSP-interacting kinase isoform X2       364   4e-120   Glycine max [soybeans]
ref|XP_003637897.1|  Receptor-like kinase                               363   4e-120   
ref|XP_008446509.1|  PREDICTED: protein NSP-INTERACTING KINASE 2 ...    364   5e-120   Cucumis melo [Oriental melon]
ref|XP_006356418.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    367   5e-120   Solanum tuberosum [potatoes]
ref|XP_002455108.1|  hypothetical protein SORBIDRAFT_03g004450          367   6e-120   
ref|XP_010261784.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    364   9e-120   Nelumbo nucifera [Indian lotus]
emb|CDP00520.1|  unnamed protein product                                367   1e-119   Coffea canephora [robusta coffee]
ref|XP_006643812.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    365   1e-119   
dbj|BAD68255.1|  putative brassinosteroid insensitive 1-associate...    366   2e-119   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004968347.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    366   3e-119   Setaria italica
gb|KJB43139.1|  hypothetical protein B456_007G186300                    361   3e-119   Gossypium raimondii
ref|XP_006603947.1|  PREDICTED: protein NSP-INTERACTING KINASE 1 ...    362   3e-119   
ref|XP_011020829.1|  PREDICTED: protein NSP-INTERACTING KINASE 2-...    365   3e-119   Populus euphratica
ref|XP_008797566.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    365   4e-119   Phoenix dactylifera
ref|XP_010261776.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    365   6e-119   Nelumbo nucifera [Indian lotus]
ref|XP_008446507.1|  PREDICTED: protein NSP-INTERACTING KINASE 1 ...    365   6e-119   Cucumis melo [Oriental melon]
gb|KEH17048.1|  NSP-interacting kinase-like protein                     363   6e-119   Medicago truncatula
ref|XP_008446508.1|  PREDICTED: protein NSP-INTERACTING KINASE 1 ...    364   7e-119   Cucumis melo [Oriental melon]
ref|XP_006574993.1|  PREDICTED: protein NSP-INTERACTING KINASE 2-...    364   8e-119   
gb|KHN07744.1|  Protein NSP-INTERACTING KINASE 2                        364   9e-119   Glycine soja [wild soybean]
ref|XP_002311408.2|  hypothetical protein POPTR_0008s10970g             364   9e-119   Populus trichocarpa [western balsam poplar]
ref|XP_003517902.1|  PREDICTED: protein NSP-INTERACTING KINASE 2-...    364   9e-119   Glycine max [soybeans]
ref|XP_004135130.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    364   1e-118   Cucumis sativus [cucumbers]
ref|XP_010032589.1|  PREDICTED: protein NSP-INTERACTING KINASE 1        364   1e-118   Eucalyptus grandis [rose gum]
ref|NP_001238448.1|  NSP-interacting kinase precursor                   363   1e-118   Glycine max [soybeans]
ref|XP_007153543.1|  hypothetical protein PHAVU_003G044400g             363   2e-118   Phaseolus vulgaris [French bean]
ref|XP_006593317.1|  PREDICTED: NSP-interacting kinase isoform X1       363   2e-118   Glycine max [soybeans]
ref|XP_007033440.1|  NSP-interacting kinase 1                           364   2e-118   
gb|KEH17047.1|  NSP-interacting kinase-like protein                     363   2e-118   Medicago truncatula
ref|XP_010230510.1|  PREDICTED: protein NSP-INTERACTING KINASE 3 ...    362   3e-118   
ref|XP_010230511.1|  PREDICTED: protein NSP-INTERACTING KINASE 3 ...    362   3e-118   
ref|XP_011009019.1|  PREDICTED: protein NSP-INTERACTING KINASE 2-...    363   3e-118   Populus euphratica
ref|XP_009378313.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    363   4e-118   Pyrus x bretschneideri [bai li]
gb|KDP24340.1|  hypothetical protein JCGZ_25636                         362   4e-118   Jatropha curcas
gb|KDO58880.1|  hypothetical protein CISIN_1g036225mg                   362   5e-118   Citrus sinensis [apfelsine]
ref|XP_006482337.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    362   5e-118   Citrus sinensis [apfelsine]
ref|XP_011012715.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    362   5e-118   Populus euphratica
ref|XP_011012714.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    362   5e-118   Populus euphratica
ref|XP_006384231.1|  hypothetical protein POPTR_0004s10790g             362   6e-118   Populus trichocarpa [western balsam poplar]
ref|XP_002305306.2|  hypothetical protein POPTR_0004s10790g             362   6e-118   Populus trichocarpa [western balsam poplar]
gb|ABG73621.1|  leucine-rich repeat receptor-like kinase                362   6e-118   Populus tomentosa [Chinese white poplar]
ref|XP_003569325.2|  PREDICTED: protein NSP-INTERACTING KINASE 3 ...    362   6e-118   Brachypodium distachyon [annual false brome]
ref|XP_010942232.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    362   7e-118   Elaeis guineensis
ref|XP_010230509.1|  PREDICTED: protein NSP-INTERACTING KINASE 3 ...    362   7e-118   Brachypodium distachyon [annual false brome]
gb|KEH21800.1|  NSP-interacting kinase-like protein                     362   8e-118   Medicago truncatula
ref|XP_004490300.1|  PREDICTED: protein NSP-INTERACTING KINASE 2-...    362   9e-118   Cicer arietinum [garbanzo]
gb|KHN30771.1|  Protein NSP-INTERACTING KINASE 1                        362   1e-117   Glycine soja [wild soybean]
gb|KDO70180.1|  hypothetical protein CISIN_1g007025mg                   359   1e-117   Citrus sinensis [apfelsine]
gb|KJB43138.1|  hypothetical protein B456_007G186300                    361   1e-117   Gossypium raimondii
ref|XP_011011496.1|  PREDICTED: protein NSP-INTERACTING KINASE 2-...    361   1e-117   Populus euphratica
ref|XP_003555046.1|  PREDICTED: protein NSP-INTERACTING KINASE 1 ...    361   2e-117   Glycine max [soybeans]
ref|XP_011077619.1|  PREDICTED: protein NSP-INTERACTING KINASE 2        362   2e-117   Sesamum indicum [beniseed]
gb|KDO70181.1|  hypothetical protein CISIN_1g007025mg                   358   2e-117   Citrus sinensis [apfelsine]
ref|XP_004171526.1|  PREDICTED: LOW QUALITY PROTEIN: protein NSP-...    349   2e-117   
ref|XP_009765506.1|  PREDICTED: protein NSP-INTERACTING KINASE 2-...    360   2e-117   Nicotiana sylvestris
ref|XP_008230341.1|  PREDICTED: protein NSP-INTERACTING KINASE 1        360   3e-117   Prunus mume [ume]
ref|XP_009403878.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    360   4e-117   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006430876.1|  hypothetical protein CICLE_v10011302mg             360   4e-117   Citrus clementina [clementine]
tpg|DAA53257.1|  TPA: putative leucine-rich repeat receptor-like ...    353   4e-117   
ref|XP_008379484.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    360   5e-117   
ref|XP_002514536.1|  BRASSINOSTEROID INSENSITIVE 1-associated rec...    358   5e-117   
ref|XP_009625494.1|  PREDICTED: protein NSP-INTERACTING KINASE 2-...    359   7e-117   Nicotiana tomentosiformis
ref|XP_006373507.1|  hypothetical protein POPTR_0017s14360g             358   8e-117   
ref|XP_009403877.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    359   1e-116   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010528022.1|  PREDICTED: protein NSP-INTERACTING KINASE 2        359   1e-116   Tarenaya hassleriana [spider flower]
ref|XP_011021148.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    359   1e-116   Populus euphratica
ref|XP_006437790.1|  hypothetical protein CICLE_v10030970mg             358   1e-116   Citrus clementina [clementine]
ref|XP_011021146.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    358   1e-116   Populus euphratica
ref|XP_007214944.1|  hypothetical protein PRUPE_ppa002897mg             358   2e-116   Prunus persica
ref|XP_007151443.1|  hypothetical protein PHAVU_004G046800g             358   2e-116   Phaseolus vulgaris [French bean]
ref|XP_006484307.1|  PREDICTED: protein NSP-INTERACTING KINASE 2-...    358   2e-116   Citrus sinensis [apfelsine]
dbj|BAK02609.1|  predicted protein                                      358   2e-116   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004238998.1|  PREDICTED: protein NSP-INTERACTING KINASE 1        358   2e-116   Solanum lycopersicum
ref|NP_001140727.1|  uncharacterized LOC100272802                       345   4e-116   
ref|XP_004304172.1|  PREDICTED: protein NSP-INTERACTING KINASE 1        357   4e-116   Fragaria vesca subsp. vesca
gb|KJB80538.1|  hypothetical protein B456_013G102600                    357   4e-116   Gossypium raimondii
ref|XP_007139356.1|  hypothetical protein PHAVU_008G022700g             357   4e-116   Phaseolus vulgaris [French bean]
ref|XP_008465988.1|  PREDICTED: protein NSP-INTERACTING KINASE 2-...    357   4e-116   Cucumis melo [Oriental melon]
ref|XP_010929457.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    357   4e-116   Elaeis guineensis
gb|KHN13790.1|  Protein NSP-INTERACTING KINASE 1                        357   4e-116   Glycine soja [wild soybean]
ref|XP_003552626.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    357   5e-116   Glycine max [soybeans]
gb|KHG05227.1|  nsp-interacting kinase 2 -like protein                  357   5e-116   Gossypium arboreum [tree cotton]
ref|XP_004149504.1|  PREDICTED: protein NSP-INTERACTING KINASE 2-...    357   5e-116   Cucumis sativus [cucumbers]
gb|KEH25223.1|  NSP-interacting kinase-like protein                     357   6e-116   Medicago truncatula
gb|KHN14464.1|  Protein NSP-INTERACTING KINASE 1                        357   6e-116   Glycine soja [wild soybean]
ref|XP_002278965.1|  PREDICTED: protein NSP-INTERACTING KINASE 1        357   8e-116   Vitis vinifera
emb|CBI16897.3|  unnamed protein product                                357   8e-116   Vitis vinifera
ref|XP_006348615.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    357   8e-116   
ref|XP_008341829.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    357   1e-115   Malus domestica [apple tree]
ref|XP_006647834.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    356   1e-115   Oryza brachyantha
ref|XP_009373732.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    356   1e-115   Pyrus x bretschneideri [bai li]
ref|XP_004238646.1|  PREDICTED: protein NSP-INTERACTING KINASE 3        355   2e-115   Solanum lycopersicum
ref|XP_006301740.1|  hypothetical protein CARUB_v10022201mg             356   2e-115   
ref|XP_009803966.1|  PREDICTED: protein NSP-INTERACTING KINASE 2-...    355   2e-115   Nicotiana sylvestris
ref|XP_004507264.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    356   2e-115   Cicer arietinum [garbanzo]
ref|XP_009596697.1|  PREDICTED: protein NSP-INTERACTING KINASE 2-...    355   2e-115   Nicotiana tomentosiformis
dbj|BAB01326.1|  receptor-like kinase                                   356   2e-115   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003531900.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    355   2e-115   Glycine max [soybeans]
ref|XP_009803965.1|  PREDICTED: protein NSP-INTERACTING KINASE 2-...    355   2e-115   Nicotiana sylvestris
ref|XP_009596696.1|  PREDICTED: protein NSP-INTERACTING KINASE 2-...    355   2e-115   Nicotiana tomentosiformis
gb|EEC73926.1|  hypothetical protein OsI_08784                          355   3e-115   Oryza sativa Indica Group [Indian rice]
ref|NP_189183.2|  NSP-interacting kinase 2                              355   3e-115   Arabidopsis thaliana [mouse-ear cress]
ref|NP_974360.1|  NSP-interacting kinase 2                              355   3e-115   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002886588.1|  nsp-interacting kinase 3                           355   3e-115   
gb|EEE57731.1|  hypothetical protein OsJ_08242                          355   3e-115   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010681338.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    355   3e-115   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006344295.1|  PREDICTED: protein NSP-INTERACTING KINASE 2-...    355   5e-115   Solanum tuberosum [potatoes]
emb|CDP02372.1|  unnamed protein product                                355   5e-115   Coffea canephora [robusta coffee]
gb|AAB71968.1|  Putative Serine/Threonine protein kinase                353   5e-115   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001169689.1|  LOC100383570 precursor                             355   6e-115   Zea mays [maize]
ref|NP_176279.1|  NSP-interacting kinase 3                              354   7e-115   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002314905.1|  hypothetical protein POPTR_0010s14410g             354   8e-115   
emb|CDY44608.1|  BnaCnng11570D                                          350   1e-114   Brassica napus [oilseed rape]
emb|CDY61508.1|  BnaCnng37930D                                          350   1e-114   Brassica napus [oilseed rape]
ref|XP_008783060.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    353   1e-114   Phoenix dactylifera
ref|XP_004953781.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    353   2e-114   Setaria italica
ref|XP_008459453.1|  PREDICTED: protein NSP-INTERACTING KINASE 1        353   2e-114   Cucumis melo [Oriental melon]
ref|XP_010418025.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    353   2e-114   Camelina sativa [gold-of-pleasure]
ref|XP_010510906.1|  PREDICTED: protein NSP-INTERACTING KINASE 3 ...    353   2e-114   Camelina sativa [gold-of-pleasure]
ref|XP_004141483.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    353   2e-114   Cucumis sativus [cucumbers]
ref|XP_010549936.1|  PREDICTED: protein NSP-INTERACTING KINASE 1        353   3e-114   Tarenaya hassleriana [spider flower]
ref|XP_010418023.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    353   3e-114   Camelina sativa [gold-of-pleasure]
gb|ABD96908.1|  hypothetical protein                                    353   3e-114   Tarenaya spinosa
ref|XP_010510907.1|  PREDICTED: protein NSP-INTERACTING KINASE 3 ...    353   3e-114   Camelina sativa [gold-of-pleasure]
ref|XP_009803321.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    353   3e-114   Nicotiana sylvestris
ref|XP_010558545.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    353   3e-114   Tarenaya hassleriana [spider flower]
ref|XP_010558548.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    353   3e-114   Tarenaya hassleriana [spider flower]
ref|XP_009803320.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    352   3e-114   Nicotiana sylvestris
ref|XP_003563960.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    352   4e-114   Brachypodium distachyon [annual false brome]
ref|XP_002452616.1|  hypothetical protein SORBIDRAFT_04g029170          352   4e-114   Sorghum bicolor [broomcorn]
gb|AHF18212.1|  brassinosteroid insensitive 1-associated receptor...    352   4e-114   Saccharum hybrid cultivar [sugarcane]
ref|XP_004236956.1|  PREDICTED: protein NSP-INTERACTING KINASE 2        352   4e-114   Solanum lycopersicum
ref|XP_004491764.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    352   5e-114   Cicer arietinum [garbanzo]
ref|XP_006392114.1|  hypothetical protein EUTSA_v10023342mg             352   5e-114   Eutrema salsugineum [saltwater cress]
gb|KDP31451.1|  hypothetical protein JCGZ_11827                         352   6e-114   Jatropha curcas
ref|XP_011099082.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    352   6e-114   Sesamum indicum [beniseed]
ref|XP_007045670.1|  LRR receptor-like serine/threonine-protein k...    360   7e-114   
ref|XP_011099081.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    352   9e-114   Sesamum indicum [beniseed]
ref|XP_002436855.1|  hypothetical protein SORBIDRAFT_10g010010          352   9e-114   Sorghum bicolor [broomcorn]
ref|XP_010473259.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    352   1e-113   Camelina sativa [gold-of-pleasure]
ref|XP_010473260.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    352   1e-113   Camelina sativa [gold-of-pleasure]
ref|XP_009630581.1|  PREDICTED: protein NSP-INTERACTING KINASE 1        351   2e-113   Nicotiana tomentosiformis
dbj|BAJ89901.1|  predicted protein                                      351   2e-113   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002876917.1|  nsp-interacting kinase 2                           351   2e-113   
ref|XP_008807034.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    350   2e-113   Phoenix dactylifera
emb|CDY46185.1|  BnaA01g23070D                                          351   2e-113   Brassica napus [oilseed rape]
ref|XP_010533910.1|  PREDICTED: protein NSP-INTERACTING KINASE 3        351   2e-113   Tarenaya hassleriana [spider flower]
ref|XP_009104018.1|  PREDICTED: protein NSP-INTERACTING KINASE 3 ...    350   3e-113   Brassica rapa
gb|AFO67891.1|  leucine-rich repeat receptor-like kinase                350   3e-113   Brassica rapa subsp. oleifera [biennial turnip rape]
ref|XP_008811184.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    350   3e-113   Phoenix dactylifera
ref|XP_009104025.1|  PREDICTED: protein NSP-INTERACTING KINASE 3 ...    350   3e-113   Brassica rapa
ref|XP_008807033.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    350   3e-113   Phoenix dactylifera
ref|NP_001146634.1|  uncharacterized LOC100280233 precursor             350   3e-113   Zea mays [maize]
ref|XP_006290715.1|  hypothetical protein CARUB_v10016813mg             350   4e-113   Capsella rubella
ref|XP_010905760.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    350   4e-113   Elaeis guineensis
ref|NP_001189971.1|  NSP-interacting kinase 2                           350   4e-113   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004232118.1|  PREDICTED: protein NSP-INTERACTING KINASE 1        350   5e-113   Solanum lycopersicum
ref|NP_197104.1|  NSP-interacting kinase 1                              348   1e-112   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004965216.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    349   1e-112   Setaria italica
gb|AAM65586.1|  receptor protein kinase-like protein                    348   2e-112   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006395648.1|  hypothetical protein EUTSA_v10003811mg             348   2e-112   Eutrema salsugineum [saltwater cress]
ref|XP_010514169.1|  PREDICTED: protein NSP-INTERACTING KINASE 2-...    348   2e-112   Camelina sativa [gold-of-pleasure]
ref|XP_010927979.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    347   3e-112   
ref|XP_004297175.1|  PREDICTED: protein NSP-INTERACTING KINASE 2        347   3e-112   Fragaria vesca subsp. vesca
gb|KFK39862.1|  hypothetical protein AALP_AA3G298400                    348   3e-112   Arabis alpina [alpine rockcress]
emb|CDY61461.1|  BnaC01g43240D                                          348   3e-112   Brassica napus [oilseed rape]
ref|XP_009391272.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    348   4e-112   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009391273.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    348   4e-112   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010927978.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    347   4e-112   Elaeis guineensis
ref|XP_010044332.1|  PREDICTED: protein NSP-INTERACTING KINASE 2        347   4e-112   Eucalyptus grandis [rose gum]
ref|XP_010236002.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    347   6e-112   Brachypodium distachyon [annual false brome]
ref|XP_003572984.2|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    347   6e-112   Brachypodium distachyon [annual false brome]
ref|XP_009396215.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    346   9e-112   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006338306.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    346   1e-111   Solanum tuberosum [potatoes]
ref|XP_010492459.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    347   1e-111   Camelina sativa [gold-of-pleasure]
gb|EYU44266.1|  hypothetical protein MIMGU_mgv1a002951mg                346   1e-111   Erythranthe guttata [common monkey flower]
emb|CDY48073.1|  BnaA06g33550D                                          346   1e-111   Brassica napus [oilseed rape]
ref|XP_010453748.1|  PREDICTED: protein NSP-INTERACTING KINASE 1        346   2e-111   Camelina sativa [gold-of-pleasure]
ref|XP_009152132.1|  PREDICTED: LOW QUALITY PROTEIN: protein NSP-...    347   2e-111   Brassica rapa
ref|XP_008389350.1|  PREDICTED: LOW QUALITY PROTEIN: protein NSP-...    345   2e-111   
ref|XP_008654537.1|  PREDICTED: uncharacterized LOC100272802 isof...    345   2e-111   
ref|XP_009407942.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    345   2e-111   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006287253.1|  hypothetical protein CARUB_v10000442mg             345   4e-111   Capsella rubella
ref|XP_006400129.1|  hypothetical protein EUTSA_v10012948mg             345   5e-111   Eutrema salsugineum [saltwater cress]
ref|XP_010502426.1|  PREDICTED: protein NSP-INTERACTING KINASE 2        345   5e-111   Camelina sativa [gold-of-pleasure]
ref|XP_008243752.1|  PREDICTED: protein NSP-INTERACTING KINASE 2        344   5e-111   
emb|CDX83534.1|  BnaC07g22740D                                          345   6e-111   
ref|XP_009356495.1|  PREDICTED: protein NSP-INTERACTING KINASE 2-...    344   6e-111   Pyrus x bretschneideri [bai li]
ref|XP_010091686.1|  Protein NSP-INTERACTING KINASE 2                   343   8e-111   
ref|XP_002871697.1|  nsp-interacting kinase 1                           343   1e-110   Arabidopsis lyrata subsp. lyrata
ref|XP_009131513.1|  PREDICTED: protein NSP-INTERACTING KINASE 1        343   2e-110   Brassica rapa
ref|XP_009418103.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    341   2e-110   
ref|XP_007221991.1|  hypothetical protein PRUPE_ppa002873mg             342   4e-110   Prunus persica
gb|EMT30099.1|  Putative LRR receptor-like serine/threonine-prote...    341   5e-110   
ref|XP_009417562.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    342   5e-110   Musa acuminata subsp. malaccensis [pisang utan]
gb|EYU28925.1|  hypothetical protein MIMGU_mgv1a003010mg                342   5e-110   Erythranthe guttata [common monkey flower]
ref|XP_009418102.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    341   1e-109   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001168791.1|  uncharacterized LOC100382590                       335   3e-109   Zea mays [maize]
ref|XP_008339771.1|  PREDICTED: protein NSP-INTERACTING KINASE 2-...    340   3e-109   
gb|EMT25229.1|  Putative LRR receptor-like serine/threonine-prote...    342   5e-109   
gb|AFW86330.1|  putative leucine-rich repeat receptor-like protei...    335   9e-109   
gb|KJB60823.1|  hypothetical protein B456_009G327400                    337   3e-108   Gossypium raimondii
gb|EPS73511.1|  hypothetical protein M569_01245                         337   3e-108   Genlisea aurea
gb|KFK25832.1|  hypothetical protein AALP_AA8G167900                    337   4e-108   Arabis alpina [alpine rockcress]
ref|XP_009400102.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    337   5e-108   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010044599.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    335   5e-108   Eucalyptus grandis [rose gum]
ref|XP_009400110.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    337   5e-108   
gb|ACN30679.1|  unknown                                                 336   1e-107   
gb|KCW86687.1|  hypothetical protein EUGRSUZ_B03306                     335   1e-107   
ref|XP_008658830.1|  PREDICTED: uncharacterized LOC100382590 isof...    336   1e-107   
ref|XP_010044597.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    335   2e-107   
ref|XP_010044598.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    335   2e-107   
ref|XP_010044594.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    335   2e-107   
ref|XP_010044596.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    335   2e-107   
ref|XP_010044595.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    335   2e-107   
dbj|BAF79962.1|  receptor-like kinase                                   334   4e-107   
gb|ADD60669.1|  putative somatic embryogenesis protein kinase 1         333   2e-106   
gb|AFO67892.1|  leucine-rich repeat receptor-like kinase                332   2e-106   
ref|XP_009121529.1|  PREDICTED: protein NSP-INTERACTING KINASE 1        332   4e-106   
emb|CDX69484.1|  BnaA10g18330D                                          332   5e-106   
ref|XP_010100900.1|  Protein NSP-INTERACTING KINASE 1                   333   9e-106   
gb|AFW76893.1|  putative leucine-rich repeat receptor-like protei...    325   2e-105   
ref|XP_010277988.1|  PREDICTED: probable LRR receptor-like serine...    328   3e-105   
ref|XP_010914291.1|  PREDICTED: probable LRR receptor-like serine...    330   3e-105   
emb|CDY26481.1|  BnaC09g41870D                                          328   2e-104   
ref|XP_010277987.1|  PREDICTED: probable LRR receptor-like serine...    328   2e-104   
ref|XP_008658828.1|  PREDICTED: uncharacterized LOC100382590 isof...    328   2e-104   
ref|XP_008647815.1|  PREDICTED: BRASSINOSTEROID INSENSITIVE 1-ass...    326   3e-104   
gb|ADD60706.1|  putative somatic embryogenesis protein kinase 1         327   3e-104   
gb|ACN34523.1|  unknown                                                 326   3e-104   
gb|AFW76897.1|  putative leucine-rich repeat receptor-like protei...    327   4e-104   
ref|NP_001147975.1|  BRASSINOSTEROID INSENSITIVE 1-associated rec...    327   5e-104   
ref|XP_008781387.1|  PREDICTED: probable LRR receptor-like serine...    325   3e-103   
ref|XP_010268431.1|  PREDICTED: probable LRR receptor-like serine...    324   1e-102   
ref|XP_010235160.1|  PREDICTED: probable LRR receptor-like serine...    318   1e-102   
ref|NP_001057376.1|  Os06g0274500                                       322   5e-102   
dbj|BAD10033.1|  somatic embryogenesis receptor kinase-like protein     315   2e-101   
ref|XP_002965655.1|  hypothetical protein SELMODRAFT_167872             320   3e-101   
ref|XP_002971685.1|  hypothetical protein SELMODRAFT_172211             319   5e-101   
ref|XP_010687665.1|  PREDICTED: probable LRR receptor-like serine...    319   6e-101   
ref|XP_011069822.1|  PREDICTED: probable LRR receptor-like serine...    318   6e-101   
ref|XP_010687666.1|  PREDICTED: probable LRR receptor-like serine...    318   7e-101   
ref|XP_008664639.1|  PREDICTED: probable LRR receptor-like serine...    317   1e-100   
gb|ADD60682.1|  putative somatic embryogenesis protein kinase 1         318   1e-100   
ref|XP_002325107.1|  leucine-rich repeat family protein                 318   1e-100   
gb|ADD60695.1|  putative somatic embryogenesis protein kinase 1         318   1e-100   
gb|AAC63680.1|  putative LRR receptor protein kinase                    317   2e-100   
ref|XP_010047875.1|  PREDICTED: probable LRR receptor-like serine...    317   2e-100   
ref|XP_011462643.1|  PREDICTED: LOW QUALITY PROTEIN: probable LRR...    317   2e-100   
emb|CDX70667.1|  BnaC03g07510D                                          320   2e-100   
ref|XP_011018089.1|  PREDICTED: probable LRR receptor-like serine...    317   2e-100   
emb|CDX78667.1|  BnaA03g05790D                                          319   3e-100   
ref|NP_179973.2|  leucine-rich repeat protein kinase family protein     317   4e-100   
ref|XP_006845438.1|  hypothetical protein AMTR_s00019p00103320          317   5e-100   
ref|XP_004973571.1|  PREDICTED: probable LRR receptor-like serine...    317   6e-100   
ref|XP_002445573.1|  hypothetical protein SORBIDRAFT_07g021820          317   6e-100   
ref|XP_011033358.1|  PREDICTED: probable LRR receptor-like serine...    316   7e-100   
ref|XP_002880534.1|  leucine-rich repeat family protein                 316   7e-100   
gb|KDO62317.1|  hypothetical protein CISIN_1g039819mg                   313   7e-100   
ref|XP_002309372.1|  leucine-rich repeat family protein                 316   7e-100   
ref|XP_010417134.1|  PREDICTED: probable LRR receptor-like serine...    316   8e-100   
ref|XP_009394555.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    315   9e-100   
ref|XP_010472390.1|  PREDICTED: probable LRR receptor-like serine...    316   9e-100   
gb|EPS59992.1|  hypothetical protein M569_14812                         313   1e-99    
ref|XP_008664637.1|  PREDICTED: probable LRR receptor-like serine...    317   2e-99    
ref|XP_003518230.1|  PREDICTED: probable LRR receptor-like serine...    315   2e-99    
ref|XP_010429349.1|  PREDICTED: probable LRR receptor-like serine...    315   2e-99    
ref|XP_007013912.1|  Leucine-rich repeat protein kinase family pr...    315   2e-99    
gb|KHN30285.1|  Putative LRR receptor-like serine/threonine-prote...    315   2e-99    
ref|XP_008664635.1|  PREDICTED: probable LRR receptor-like serine...    317   3e-99    
ref|XP_008664636.1|  PREDICTED: probable LRR receptor-like serine...    317   3e-99    
ref|XP_006659455.1|  PREDICTED: probable LRR receptor-like serine...    310   3e-99    
gb|KFK32690.1|  hypothetical protein AALP_AA6G276300                    314   4e-99    
ref|XP_007154851.1|  hypothetical protein PHAVU_003G152900g             313   5e-99    
ref|XP_006453537.1|  hypothetical protein CICLE_v10007718mg             314   5e-99    
ref|NP_001061919.1|  Os08g0442700                                       314   7e-99    
emb|CDP02874.1|  unnamed protein product                                313   8e-99    
ref|XP_006474063.1|  PREDICTED: probable LRR receptor-like serine...    313   8e-99    
ref|XP_009417455.1|  PREDICTED: probable LRR receptor-like serine...    313   8e-99    
ref|XP_006295562.1|  hypothetical protein CARUB_v10024669mg             313   1e-98    
emb|CAN63294.1|  hypothetical protein VITISV_040285                     312   2e-98    
ref|XP_003633168.1|  PREDICTED: probable LRR receptor-like serine...    312   2e-98    
ref|XP_008664634.1|  PREDICTED: probable LRR receptor-like serine...    317   2e-98    
ref|XP_009390537.1|  PREDICTED: LOW QUALITY PROTEIN: probable LRR...    312   2e-98    
ref|XP_006404888.1|  hypothetical protein EUTSA_v10000081mg             312   2e-98    
ref|XP_001785606.1|  predicted protein                                  311   4e-98    
emb|CDY39685.1|  BnaA04g14020D                                          311   4e-98    
ref|XP_008664633.1|  PREDICTED: probable LRR receptor-like serine...    317   4e-98    
gb|EYU37129.1|  hypothetical protein MIMGU_mgv1a003448mg                310   4e-98    
ref|XP_009140509.1|  PREDICTED: probable LRR receptor-like serine...    311   4e-98    
gb|EAZ07144.1|  hypothetical protein OsI_29394                          313   5e-98    
gb|KCW86689.1|  hypothetical protein EUGRSUZ_B03306                     310   6e-98    
emb|CDY65182.1|  BnaC04g56200D                                          311   6e-98    
gb|KJB53859.1|  hypothetical protein B456_009G008400                    310   6e-98    
ref|XP_011079354.1|  PREDICTED: probable LRR receptor-like serine...    311   6e-98    
ref|XP_008359493.1|  PREDICTED: probable LRR receptor-like serine...    311   6e-98    
ref|XP_010108365.1|  putative LRR receptor-like serine/threonine-...    311   6e-98    
ref|XP_007225632.1|  hypothetical protein PRUPE_ppa003371mg             309   7e-98    
gb|KCW86690.1|  hypothetical protein EUGRSUZ_B03306                     310   8e-98    
gb|KCW86693.1|  hypothetical protein EUGRSUZ_B03306                     310   8e-98    
gb|KCW86692.1|  hypothetical protein EUGRSUZ_B03306                     310   8e-98    
gb|KCW86691.1|  hypothetical protein EUGRSUZ_B03306                     310   9e-98    
ref|XP_001756895.1|  predicted protein                                  308   9e-98    
ref|XP_010525766.1|  PREDICTED: probable LRR receptor-like serine...    311   9e-98    
ref|XP_009345903.1|  PREDICTED: probable LRR receptor-like serine...    310   2e-97    
gb|EAZ42894.1|  hypothetical protein OsJ_27488                          312   3e-97    
gb|KHN07168.1|  Protein NSP-INTERACTING KINASE 1                        307   3e-97    
ref|XP_008443821.1|  PREDICTED: probable LRR receptor-like serine...    309   3e-97    
ref|XP_008223590.1|  PREDICTED: probable LRR receptor-like serine...    309   3e-97    
ref|XP_004146714.1|  PREDICTED: probable LRR receptor-like serine...    309   3e-97    
ref|XP_009360005.1|  PREDICTED: probable LRR receptor-like serine...    309   3e-97    
gb|KHN17525.1|  Putative LRR receptor-like serine/threonine-prote...    309   4e-97    
gb|EPS72006.1|  hypothetical protein M569_02751                         303   4e-97    
ref|XP_009796362.1|  PREDICTED: probable LRR receptor-like serine...    308   5e-97    
dbj|BAJ91470.1|  predicted protein                                      309   5e-97    
gb|KHG18235.1|  hypothetical protein F383_07279                         308   6e-97    
ref|XP_010548642.1|  PREDICTED: probable LRR receptor-like serine...    308   6e-97    
ref|XP_003549524.2|  PREDICTED: probable LRR receptor-like serine...    308   7e-97    
ref|XP_001763339.1|  predicted protein                                  306   8e-97    
gb|KEH32608.1|  LRR receptor-like kinase                                305   2e-96    
ref|XP_002867342.1|  predicted protein                                  307   2e-96    
ref|XP_008647814.1|  PREDICTED: BRASSINOSTEROID INSENSITIVE 1-ass...    306   2e-96    
ref|XP_003610256.1|  Somatic embryogenesis receptor-like kinase         307   2e-96    
gb|KDP38737.1|  hypothetical protein JCGZ_04090                         306   3e-96    
ref|XP_010432978.1|  PREDICTED: probable LRR receptor-like serine...    307   3e-96    
ref|XP_010447704.1|  PREDICTED: probable LRR receptor-like serine...    307   3e-96    
ref|XP_010438169.1|  PREDICTED: probable LRR receptor-like serine...    307   3e-96    
emb|CDX72249.1|  BnaC07g42710D                                          306   3e-96    
emb|CAB79770.1|  receptor-like kinase homolog                           305   4e-96    
ref|XP_006282454.1|  hypothetical protein CARUB_v10004330mg             306   4e-96    
ref|XP_009137929.1|  PREDICTED: probable LRR receptor-like serine...    306   4e-96    
ref|XP_006343723.1|  PREDICTED: probable LRR receptor-like serine...    305   7e-96    
ref|XP_009611184.1|  PREDICTED: probable LRR receptor-like serine...    305   7e-96    
ref|NP_194781.2|  senescence-associated receptor-like kinase            305   1e-95    
ref|XP_004507770.1|  PREDICTED: probable LRR receptor-like serine...    305   1e-95    
ref|XP_004242632.1|  PREDICTED: probable LRR receptor-like serine...    305   1e-95    
gb|KJB76635.1|  hypothetical protein B456_012G097800                    302   4e-95    
gb|KHG07759.1|  hypothetical protein F383_34545                         303   4e-95    
gb|KFK29623.1|  hypothetical protein AALP_AA7G158000                    302   2e-94    
gb|KJB76636.1|  hypothetical protein B456_012G097800                    301   2e-94    
gb|KJB76637.1|  hypothetical protein B456_012G097800                    301   3e-94    
gb|ADT91694.1|  somatic embryogenesis receptor-like kinase 1            288   9e-94    
ref|XP_002533758.1|  BRASSINOSTEROID INSENSITIVE 1-associated rec...    292   2e-93    
ref|XP_009105842.1|  PREDICTED: somatic embryogenesis receptor ki...    297   1e-92    
gb|AFO67896.1|  leucine-rich repeat receptor-like kinase                297   1e-92    
ref|XP_009380181.1|  PREDICTED: somatic embryogenesis receptor ki...    295   1e-92    
gb|EMS66270.1|  Somatic embryogenesis receptor kinase 1                 291   1e-92    
emb|CDX72833.1|  BnaC06g32810D                                          296   1e-92    
gb|AFQ07900.1|  somatic embryogenesis receptor-like kinase              285   2e-92    
ref|XP_010415894.1|  PREDICTED: somatic embryogenesis receptor ki...    296   2e-92    
ref|XP_006300879.1|  hypothetical protein CARUB_v10019969mg             296   2e-92    
ref|NP_177328.1|  somatic embryogenesis receptor kinase 1               296   2e-92    
ref|XP_010428030.1|  PREDICTED: somatic embryogenesis receptor ki...    296   2e-92    
gb|AAK82463.1|  At1g71830/F14O23_24                                     296   2e-92    
emb|CDY36679.1|  BnaCnng07810D                                          296   3e-92    
gb|ACM89547.1|  somatic embryogenesis receptor kinase                   290   3e-92    
ref|XP_010471192.1|  PREDICTED: somatic embryogenesis receptor ki...    296   3e-92    
gb|AAF43236.1|AC012654_20  Contains similarity to the somatic emb...    295   3e-92    
ref|XP_009104891.1|  PREDICTED: somatic embryogenesis receptor ki...    296   3e-92    
gb|AET86626.2|  somatic embryogenesis receptor kinase 1                 286   3e-92    
ref|XP_001759122.1|  predicted protein                                  295   4e-92    
ref|XP_001767678.1|  predicted protein                                  295   5e-92    
gb|KDP35227.1|  hypothetical protein JCGZ_09386                         295   5e-92    
gb|AIA99455.1|  putative somatic embryogenesis receptor kinase          295   5e-92    
ref|XP_009380182.1|  PREDICTED: somatic embryogenesis receptor ki...    295   6e-92    
ref|XP_002887392.1|  hypothetical protein ARALYDRAFT_895025             295   6e-92    
gb|KFK41603.1|  hypothetical protein AALP_AA2G149900                    295   6e-92    
gb|ADW65656.1|  somatic embryogenesis receptor kinase 1                 286   6e-92    
ref|XP_010530140.1|  PREDICTED: somatic embryogenesis receptor ki...    295   8e-92    
ref|XP_006390738.1|  hypothetical protein EUTSA_v10019435mg             294   9e-92    
emb|CAM31941.1|  hypothetical protein                                   293   1e-91    
ref|XP_002276414.2|  PREDICTED: somatic embryogenesis receptor ki...    294   1e-91    
gb|AFQ07899.1|  somatic embryogenesis receptor-like kinase              283   2e-91    
gb|KDO83985.1|  hypothetical protein CISIN_1g007020mg                   289   2e-91    
ref|NP_001237909.1|  somatic embryogenesis receptor-like kinase-l...    291   2e-91    
ref|XP_009591346.1|  PREDICTED: somatic embryogenesis receptor ki...    287   2e-91    
ref|NP_001052975.1|  Os04g0457800                                       293   2e-91    
ref|XP_004162174.1|  PREDICTED: somatic embryogenesis receptor ki...    290   2e-91    
gb|AEP14552.1|  somatic embryogenesis receptor kinase 2                 292   2e-91    
ref|XP_007020221.1|  Somatic embryogenesis receptor-like kinase 1...    289   2e-91    
gb|AAU88198.1|  somatic embryogenesis protein kinase 1                  293   2e-91    
gb|ACZ56417.1|  somatic embryogenesis receptor-like kinase 1            293   3e-91    
gb|AFS64762.1|  protein kinase                                          282   3e-91    
dbj|BAK05837.1|  predicted protein                                      293   4e-91    
gb|ACY91853.1|  somatic embryogenesis receptor-like kinase 1            293   4e-91    
ref|XP_003575217.1|  PREDICTED: somatic embryogenesis receptor ki...    293   4e-91    
ref|XP_002976976.1|  hypothetical protein SELMODRAFT_443356             293   4e-91    
ref|XP_002980714.1|  hypothetical protein SELMODRAFT_444590             293   4e-91    
gb|AGS80343.1|  somatic embryogenesis receptor kinase 1                 293   4e-91    
ref|XP_010692604.1|  PREDICTED: somatic embryogenesis receptor ki...    292   5e-91    
ref|XP_010274437.1|  PREDICTED: probable LRR receptor-like serine...    292   7e-91    
emb|CDP01160.1|  unnamed protein product                                292   9e-91    
gb|AHI59639.1|  somatic embryogenesis receptor-like kinase              292   1e-90    
ref|XP_004149147.1|  PREDICTED: somatic embryogenesis receptor ki...    291   1e-90    
ref|XP_002310599.2|  hypothetical protein POPTR_0007s06460g             291   1e-90    
ref|XP_010063799.1|  PREDICTED: somatic embryogenesis receptor ki...    291   1e-90    
ref|XP_010274436.1|  PREDICTED: probable LRR receptor-like serine...    292   1e-90    
ref|XP_010063800.1|  PREDICTED: somatic embryogenesis receptor ki...    290   1e-90    
ref|XP_010543171.1|  PREDICTED: somatic embryogenesis receptor ki...    291   1e-90    
ref|XP_002307124.2|  hypothetical protein POPTR_0005s08500g             291   1e-90    
ref|XP_003579889.1|  PREDICTED: somatic embryogenesis receptor ki...    291   1e-90    
ref|XP_010059023.1|  PREDICTED: probable LRR receptor-like serine...    287   1e-90    
ref|XP_006653479.1|  PREDICTED: somatic embryogenesis receptor ki...    291   1e-90    
ref|XP_006584457.1|  PREDICTED: somatic embryogenesis receptor-li...    291   2e-90    
ref|XP_008464350.1|  PREDICTED: somatic embryogenesis receptor ki...    290   2e-90    
ref|NP_001238274.1|  somatic embryogenesis receptor kinase precursor    291   2e-90    
ref|XP_004975833.1|  PREDICTED: somatic embryogenesis receptor ki...    291   2e-90    
gb|AAN64293.1|  somatic embryogenesis receptor kinase 1                 291   2e-90    
gb|AFP25206.1|  somatic embryogenesis receptor-like kinase              291   2e-90    
ref|XP_009339058.1|  PREDICTED: somatic embryogenesis receptor ki...    291   2e-90    
ref|XP_010274434.1|  PREDICTED: probable LRR receptor-like serine...    292   2e-90    
ref|XP_008366148.1|  PREDICTED: somatic embryogenesis receptor ki...    291   2e-90    
ref|XP_002534492.1|  BRASSINOSTEROID INSENSITIVE 1-associated rec...    292   2e-90    
ref|XP_003547599.1|  PREDICTED: BRASSINOSTEROID INSENSITIVE 1-ass...    291   2e-90    
ref|XP_010939572.1|  PREDICTED: somatic embryogenesis receptor ki...    291   2e-90    
ref|XP_009339751.1|  PREDICTED: somatic embryogenesis receptor ki...    291   2e-90    
ref|XP_011021923.1|  PREDICTED: somatic embryogenesis receptor ki...    290   2e-90    
gb|KHN33505.1|  BRASSINOSTEROID INSENSITIVE 1-associated receptor...    290   2e-90    
ref|NP_001275800.1|  somatic embryogenesis receptor-like kinase p...    291   2e-90    
ref|XP_002270847.1|  PREDICTED: somatic embryogenesis receptor ki...    291   3e-90    
ref|XP_010274433.1|  PREDICTED: probable LRR receptor-like serine...    292   3e-90    
ref|XP_010274432.1|  PREDICTED: probable LRR receptor-like serine...    292   3e-90    
ref|XP_008381026.1|  PREDICTED: somatic embryogenesis receptor ki...    291   3e-90    
ref|XP_010245869.1|  PREDICTED: somatic embryogenesis receptor ki...    291   3e-90    
gb|AEC46975.1|  somatic embryogenesis receptor-like kinase              291   3e-90    
dbj|BAD32780.1|  somatic embryogenesis receptor kinase 1                291   3e-90    
gb|AFP25205.1|  somatic embryogenesis receptor-like kinase              291   3e-90    



>dbj|BAD18097.1| putative serine/threonine protein kinase [Ipomoea batatas]
Length=232

 Score =   398 bits (1022),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 198/224 (88%), Positives = 206/224 (92%), Gaps = 4/224 (2%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RKRIALG ARGLVYLHEQCDPKIIHRDVKAANILLDE FEAVVGDFGLAKLLDHRESHVS
Sbjct  10   RKRIALGTARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  69

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAV+FG+G NQK V+LD VK
Sbjct  70   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  129

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
             LHQE KL+LMVDKDL  NFDR+ELEEMVQVALLCTQFNP HRPKMSEVLRMLEGDGLAE
Sbjct  130  TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  189

Query  204  KWEASQRAETPR---HGNTVPQRYYDLIEESSLVVEAMELSGPR  82
            KWEASQR +TPR   H NT PQRY D IEESSL+VEAMELSGPR
Sbjct  190  KWEASQRNDTPRYRTHENT-PQRYSDFIEESSLIVEAMELSGPR  232



>ref|XP_004159592.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like, partial [Cucumis 
sativus]
Length=235

 Score =   387 bits (995),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 191/223 (86%), Positives = 203/223 (91%), Gaps = 2/223 (1%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RKRIALG ARGLVYLHEQCDPKIIHRDVKAANILLDE FEAVVGDFGLAKLLDHR+SHV+
Sbjct  13   RKRIALGTARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRDSHVT  72

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKA++FG+G NQK VMLD VK
Sbjct  73   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRGANQKGVMLDWVK  132

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            +LHQE KL++MVDKDL  NFDR+ELEEMVQVALLCTQFNP HRPKMSEVL+MLEGDGLAE
Sbjct  133  KLHQEGKLNMMVDKDLKGNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLKMLEGDGLAE  192

Query  204  KWEASQRAETP--RHGNTVPQRYYDLIEESSLVVEAMELSGPR  82
            KWEASQ  ETP  R     PQRY D IEESSL+VEAMELSGPR
Sbjct  193  KWEASQHIETPRCRPCENPPQRYSDYIEESSLIVEAMELSGPR  235



>dbj|BAD18102.1| leucine-rich repeat receptor-like kinase [Ipomoea batatas]
Length=627

 Score =   398 bits (1022),  Expect = 8e-132, Method: Compositional matrix adjust.
 Identities = 198/224 (88%), Positives = 206/224 (92%), Gaps = 4/224 (2%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RKRIALG ARGLVYLHEQCDPKIIHRDVKAANILLDE FEAVVGDFGLAKLLDHRESHVS
Sbjct  405  RKRIALGTARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  464

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAV+FG+G NQK V+LD VK
Sbjct  465  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVK  524

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
             LHQE KL+LMVDKDL  NFDR+ELEEMVQVALLCTQFNP HRPKMSEVLRMLEGDGLAE
Sbjct  525  TLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  584

Query  204  KWEASQRAETPR---HGNTVPQRYYDLIEESSLVVEAMELSGPR  82
            KWEASQR +TPR   H NT PQRY D IEESSL+VEAMELSGPR
Sbjct  585  KWEASQRNDTPRYRTHENT-PQRYSDFIEESSLIVEAMELSGPR  627



>ref|XP_011045286.1| PREDICTED: protein NSP-INTERACTING KINASE 3 [Populus euphratica]
Length=452

 Score =   389 bits (999),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 193/223 (87%), Positives = 204/223 (91%), Gaps = 2/223 (1%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RKRIALG ARGL+YLHEQCDPKIIHRDVKAANILLDE FEAVVGDFGLAKLLDHR+SHV+
Sbjct  230  RKRIALGTARGLLYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRDSHVT  289

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKA++FG+  NQK VMLD VK
Sbjct  290  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRAANQKGVMLDWVK  349

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            +LH +RKL+LMVDKDL  NFDRIELEEMVQVALLCTQFNP HRPKMSEVL+MLEGDGLAE
Sbjct  350  KLHHDRKLNLMVDKDLRGNFDRIELEEMVQVALLCTQFNPSHRPKMSEVLKMLEGDGLAE  409

Query  204  KWEASQRAETPRHGN--TVPQRYYDLIEESSLVVEAMELSGPR  82
            KWEASQR ETPR  +    PQRY D IEESSLVVEAMELSGPR
Sbjct  410  KWEASQRVETPRFRSCENPPQRYSDYIEESSLVVEAMELSGPR  452



>ref|XP_007044708.1| Nsp-interacting kinase 3 isoform 1 [Theobroma cacao]
 gb|EOY00540.1| Nsp-interacting kinase 3 isoform 1 [Theobroma cacao]
Length=626

 Score =   392 bits (1007),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 192/223 (86%), Positives = 204/223 (91%), Gaps = 2/223 (1%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RKRIALG ARGLVYLHEQCDPKIIHRDVKAANILLDE FEAVVGDFGLAKLLDHR+SHV+
Sbjct  404  RKRIALGTARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRDSHVT  463

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKA++FG+  NQK VMLD VK
Sbjct  464  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRAANQKGVMLDWVK  523

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            +LHQE KLSL+VDKDL  NFDRIELEEMVQVALLCTQFNP HRP+MSEVLRMLEGDGLAE
Sbjct  524  KLHQEGKLSLLVDKDLKGNFDRIELEEMVQVALLCTQFNPSHRPRMSEVLRMLEGDGLAE  583

Query  204  KWEASQRAETP--RHGNTVPQRYYDLIEESSLVVEAMELSGPR  82
            KWEASQ+ ETP  R  +  PQRY D IEESSLV+EAMELSGPR
Sbjct  584  KWEASQKVETPRFRSCDNPPQRYSDFIEESSLVIEAMELSGPR  626



>ref|XP_009800027.1| PREDICTED: protein NSP-INTERACTING KINASE 3 [Nicotiana sylvestris]
Length=626

 Score =   392 bits (1006),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 191/223 (86%), Positives = 204/223 (91%), Gaps = 2/223 (1%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RK IALG ARGLVYLHEQCDPKIIHRDVKAANILLDE FEAVVGDFGLAKLLDHR+SHV+
Sbjct  404  RKNIALGTARGLVYLHEQCDPKIIHRDVKAANILLDEEFEAVVGDFGLAKLLDHRDSHVT  463

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAV+FG+G NQK VMLD VK
Sbjct  464  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVMLDWVK  523

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            +LHQE+KL+LMVDKDL  +FDRIELEEMVQVALLCT F+P HRPKMSEVLRMLEGDGLAE
Sbjct  524  KLHQEKKLNLMVDKDLKNSFDRIELEEMVQVALLCTHFSPSHRPKMSEVLRMLEGDGLAE  583

Query  204  KWEASQRAETPRH--GNTVPQRYYDLIEESSLVVEAMELSGPR  82
            KWEASQ+ ETPR+      P+RY D IEESSLVVEAMELSGPR
Sbjct  584  KWEASQKVETPRYRTSENTPKRYSDYIEESSLVVEAMELSGPR  626



>ref|XP_006378225.1| hypothetical protein POPTR_0010s05300g [Populus trichocarpa]
 gb|ERP56022.1| hypothetical protein POPTR_0010s05300g [Populus trichocarpa]
Length=624

 Score =   392 bits (1006),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 192/223 (86%), Positives = 204/223 (91%), Gaps = 2/223 (1%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RKRIALG ARGL+YLHEQCDPKIIHRDVKAANILLDE FEAVVGDFGLAKLLDHR+SHV+
Sbjct  402  RKRIALGTARGLLYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRDSHVT  461

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLEL+TGQKA++FG+  NQK VMLD VK
Sbjct  462  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELVTGQKALDFGRAANQKGVMLDWVK  521

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            +LH ERKL+LMVDKDL  NFDRIELEEMVQVALLCTQFNP HRPKMSEVL+MLEGDGLAE
Sbjct  522  KLHHERKLNLMVDKDLRGNFDRIELEEMVQVALLCTQFNPSHRPKMSEVLKMLEGDGLAE  581

Query  204  KWEASQRAETPRHGN--TVPQRYYDLIEESSLVVEAMELSGPR  82
            KWEASQR ETPR  +    PQRY D IEESSLVVEAMELSGPR
Sbjct  582  KWEASQRVETPRFRSCENPPQRYSDYIEESSLVVEAMELSGPR  624



>emb|CAN75190.1| hypothetical protein VITISV_035381 [Vitis vinifera]
Length=608

 Score =   391 bits (1004),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 190/223 (85%), Positives = 204/223 (91%), Gaps = 2/223 (1%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RKRIALG ARGL+YLHEQCDPKIIHRDVKAANILLDE FEAVVGDFGLAKLLDHRESHV+
Sbjct  386  RKRIALGTARGLLYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVT  445

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKA++FG+  NQK VMLD VK
Sbjct  446  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRAANQKGVMLDWVK  505

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            +LHQE KL+LMVDKDL  NFDR+ELEEMV+VALLCTQFNP HRPKMSE+LRMLEGDGLAE
Sbjct  506  KLHQEGKLNLMVDKDLKNNFDRVELEEMVKVALLCTQFNPSHRPKMSEILRMLEGDGLAE  565

Query  204  KWEASQRAETPRHGN--TVPQRYYDLIEESSLVVEAMELSGPR  82
            KWEASQ+ ETPR  +    PQRY D IEESSLV+EAMELSGPR
Sbjct  566  KWEASQKVETPRFRSCENPPQRYSDYIEESSLVIEAMELSGPR  608



>ref|XP_002315684.2| hypothetical protein POPTR_0010s05300g [Populus trichocarpa]
 gb|EEF01855.2| hypothetical protein POPTR_0010s05300g [Populus trichocarpa]
Length=628

 Score =   391 bits (1005),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 192/223 (86%), Positives = 204/223 (91%), Gaps = 2/223 (1%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RKRIALG ARGL+YLHEQCDPKIIHRDVKAANILLDE FEAVVGDFGLAKLLDHR+SHV+
Sbjct  406  RKRIALGTARGLLYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRDSHVT  465

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLEL+TGQKA++FG+  NQK VMLD VK
Sbjct  466  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELVTGQKALDFGRAANQKGVMLDWVK  525

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            +LH ERKL+LMVDKDL  NFDRIELEEMVQVALLCTQFNP HRPKMSEVL+MLEGDGLAE
Sbjct  526  KLHHERKLNLMVDKDLRGNFDRIELEEMVQVALLCTQFNPSHRPKMSEVLKMLEGDGLAE  585

Query  204  KWEASQRAETPRHGN--TVPQRYYDLIEESSLVVEAMELSGPR  82
            KWEASQR ETPR  +    PQRY D IEESSLVVEAMELSGPR
Sbjct  586  KWEASQRVETPRFRSCENPPQRYSDYIEESSLVVEAMELSGPR  628



>ref|XP_010651607.1| PREDICTED: protein NSP-INTERACTING KINASE 3 [Vitis vinifera]
 emb|CBI28568.3| unnamed protein product [Vitis vinifera]
Length=626

 Score =   391 bits (1004),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 190/223 (85%), Positives = 204/223 (91%), Gaps = 2/223 (1%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RKRIALG ARGL+YLHEQCDPKIIHRDVKAANILLDE FEAVVGDFGLAKLLDHRESHV+
Sbjct  404  RKRIALGTARGLLYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVT  463

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKA++FG+  NQK VMLD VK
Sbjct  464  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRAANQKGVMLDWVK  523

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            +LHQE KL+LMVDKDL  NFDR+ELEEMV+VALLCTQFNP HRPKMSE+LRMLEGDGLAE
Sbjct  524  KLHQEGKLNLMVDKDLKNNFDRVELEEMVKVALLCTQFNPSHRPKMSEILRMLEGDGLAE  583

Query  204  KWEASQRAETPRHGN--TVPQRYYDLIEESSLVVEAMELSGPR  82
            KWEASQ+ ETPR  +    PQRY D IEESSLV+EAMELSGPR
Sbjct  584  KWEASQKVETPRFRSCENPPQRYSDYIEESSLVIEAMELSGPR  626



>ref|XP_011086598.1| PREDICTED: protein NSP-INTERACTING KINASE 3 [Sesamum indicum]
Length=625

 Score =   390 bits (1001),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 192/223 (86%), Positives = 204/223 (91%), Gaps = 2/223 (1%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RK IALG ARGLVYLHEQCDPKIIHRDVKAANILLDE FEAVVGDFGLAKLLDHR+SHV+
Sbjct  403  RKSIALGTARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRDSHVT  462

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAV+FG+GTNQK V+LD VK
Sbjct  463  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGTNQKGVILDWVK  522

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            +LHQE KL+LMVDKDL  +FDR+ELEEMVQVALLCTQFNP HRPKMSEVLRMLEGDGLAE
Sbjct  523  KLHQEGKLNLMVDKDLKNDFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAE  582

Query  204  KWEASQRAETPRHGNT--VPQRYYDLIEESSLVVEAMELSGPR  82
            KWE SQ  ETPR+ +    PQRY D IEESSLVVEAMELSGPR
Sbjct  583  KWEQSQNIETPRYRSFEHPPQRYSDFIEESSLVVEAMELSGPR  625



>ref|XP_009626005.1| PREDICTED: protein NSP-INTERACTING KINASE 3 [Nicotiana tomentosiformis]
Length=626

 Score =   390 bits (1001),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 191/223 (86%), Positives = 203/223 (91%), Gaps = 2/223 (1%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RK IALG ARGLVYLHEQCDPKIIHRDVKAANILLDE FEAVVGDFGLAKLLDHR+SHV+
Sbjct  404  RKNIALGTARGLVYLHEQCDPKIIHRDVKAANILLDEEFEAVVGDFGLAKLLDHRDSHVT  463

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAV+FG+G NQK VMLD VK
Sbjct  464  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVMLDWVK  523

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
             LHQE+KL+LMVDKDL  +FDRIELEEMVQVALLCT F+P HRPKMSEVLRMLEGDGLAE
Sbjct  524  TLHQEKKLNLMVDKDLKNSFDRIELEEMVQVALLCTHFSPSHRPKMSEVLRMLEGDGLAE  583

Query  204  KWEASQRAETPRH--GNTVPQRYYDLIEESSLVVEAMELSGPR  82
            KWEASQ+ ETPR+      P+RY D IEESSLVVEAMELSGPR
Sbjct  584  KWEASQKVETPRYRTSENTPKRYSDYIEESSLVVEAMELSGPR  626



>ref|XP_007044709.1| Nsp-interacting kinase 3 isoform 2 [Theobroma cacao]
 gb|EOY00541.1| Nsp-interacting kinase 3 isoform 2 [Theobroma cacao]
Length=451

 Score =   384 bits (986),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 192/226 (85%), Positives = 204/226 (90%), Gaps = 5/226 (2%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RKRIALG ARGLVYLHEQCDPKIIHRDVKAANILLDE FEAVVGDFGLAKLLDHR+SHV+
Sbjct  226  RKRIALGTARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRDSHVT  285

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDL--  391
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKA++FG+  NQK VMLD   
Sbjct  286  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRAANQKGVMLDWVL  345

Query  390  -VKRLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDG  214
             VK+LHQE KLSL+VDKDL  NFDRIELEEMVQVALLCTQFNP HRP+MSEVLRMLEGDG
Sbjct  346  SVKKLHQEGKLSLLVDKDLKGNFDRIELEEMVQVALLCTQFNPSHRPRMSEVLRMLEGDG  405

Query  213  LAEKWEASQRAETPRH--GNTVPQRYYDLIEESSLVVEAMELSGPR  82
            LAEKWEASQ+ ETPR    +  PQRY D IEESSLV+EAMELSGPR
Sbjct  406  LAEKWEASQKVETPRFRSCDNPPQRYSDFIEESSLVIEAMELSGPR  451



>ref|XP_004297396.1| PREDICTED: protein NSP-INTERACTING KINASE 3 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=629

 Score =   390 bits (1001),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 193/223 (87%), Positives = 203/223 (91%), Gaps = 2/223 (1%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RKRIALG ARGLVYLHEQCDPKIIHRDVKAANILLDE FEAVVGDFGLAKLLDHRESHV+
Sbjct  407  RKRIALGTARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVT  466

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKA++FG+  NQK VMLD VK
Sbjct  467  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRAANQKGVMLDWVK  526

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            +LHQE KL+LMVDKDL  NFDRIELEEMVQVALLCTQFNP HRPKMSEVL+MLEGDGLAE
Sbjct  527  KLHQEGKLNLMVDKDLKGNFDRIELEEMVQVALLCTQFNPLHRPKMSEVLKMLEGDGLAE  586

Query  204  KWEASQRAETPRHGNT--VPQRYYDLIEESSLVVEAMELSGPR  82
            KWEASQ  ETPR  +    PQRY D I+ESSLVVEAMELSGPR
Sbjct  587  KWEASQGVETPRFRSCEHPPQRYSDFIDESSLVVEAMELSGPR  629



>gb|KHN00370.1| Protein NSP-INTERACTING KINASE 3 [Glycine soja]
Length=624

 Score =   389 bits (1000),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 190/221 (86%), Positives = 202/221 (91%), Gaps = 0/221 (0%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RKRIALG ARGLVYLHEQCDPKIIHRDVKAANILLDE FEAVVGDFGLAKLLDHR+SHV+
Sbjct  404  RKRIALGTARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRDSHVT  463

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELITG KA++FG+  NQK VMLD VK
Sbjct  464  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGHKALDFGRAANQKGVMLDWVK  523

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            +LHQ+ +LS MVDKDL  NFD IELEEMVQVALLCTQFNP HRPKMSEVL+MLEGDGLAE
Sbjct  524  KLHQDGRLSQMVDKDLKGNFDLIELEEMVQVALLCTQFNPSHRPKMSEVLKMLEGDGLAE  583

Query  204  KWEASQRAETPRHGNTVPQRYYDLIEESSLVVEAMELSGPR  82
            +WEASQR ETPR  +  PQRY DLIEESSLVVEAMELSGPR
Sbjct  584  RWEASQRIETPRFRSCEPQRYSDLIEESSLVVEAMELSGPR  624



>ref|XP_003519642.1| PREDICTED: protein NSP-INTERACTING KINASE 3 isoform 1 [Glycine 
max]
Length=624

 Score =   389 bits (1000),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 190/221 (86%), Positives = 202/221 (91%), Gaps = 0/221 (0%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RKRIALG ARGLVYLHEQCDPKIIHRDVKAANILLDE FEAVVGDFGLAKLLDHR+SHV+
Sbjct  404  RKRIALGTARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRDSHVT  463

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELITG KA++FG+  NQK VMLD VK
Sbjct  464  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGHKALDFGRAANQKGVMLDWVK  523

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            +LHQ+ +LS MVDKDL  NFD IELEEMVQVALLCTQFNP HRPKMSEVL+MLEGDGLAE
Sbjct  524  KLHQDGRLSQMVDKDLKGNFDLIELEEMVQVALLCTQFNPSHRPKMSEVLKMLEGDGLAE  583

Query  204  KWEASQRAETPRHGNTVPQRYYDLIEESSLVVEAMELSGPR  82
            +WEASQR ETPR  +  PQRY DLIEESSLVVEAMELSGPR
Sbjct  584  RWEASQRIETPRFRSCEPQRYSDLIEESSLVVEAMELSGPR  624



>ref|XP_011463143.1| PREDICTED: protein NSP-INTERACTING KINASE 3 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=626

 Score =   389 bits (1000),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 193/223 (87%), Positives = 203/223 (91%), Gaps = 2/223 (1%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RKRIALG ARGLVYLHEQCDPKIIHRDVKAANILLDE FEAVVGDFGLAKLLDHRESHV+
Sbjct  404  RKRIALGTARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVT  463

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKA++FG+  NQK VMLD VK
Sbjct  464  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRAANQKGVMLDWVK  523

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            +LHQE KL+LMVDKDL  NFDRIELEEMVQVALLCTQFNP HRPKMSEVL+MLEGDGLAE
Sbjct  524  KLHQEGKLNLMVDKDLKGNFDRIELEEMVQVALLCTQFNPLHRPKMSEVLKMLEGDGLAE  583

Query  204  KWEASQRAETPRHGNT--VPQRYYDLIEESSLVVEAMELSGPR  82
            KWEASQ  ETPR  +    PQRY D I+ESSLVVEAMELSGPR
Sbjct  584  KWEASQGVETPRFRSCEHPPQRYSDFIDESSLVVEAMELSGPR  626



>ref|XP_004142972.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like [Cucumis sativus]
 gb|KGN62304.1| hypothetical protein Csa_2G348900 [Cucumis sativus]
Length=621

 Score =   389 bits (999),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 191/223 (86%), Positives = 203/223 (91%), Gaps = 2/223 (1%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RKRIALG ARGLVYLHEQCDPKIIHRDVKAANILLDE FEAVVGDFGLAKLLDHR+SHV+
Sbjct  399  RKRIALGTARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRDSHVT  458

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKA++FG+G NQK VMLD VK
Sbjct  459  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRGANQKGVMLDWVK  518

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            +LHQE KL++MVDKDL  NFDR+ELEEMVQVALLCTQFNP HRPKMSEVL+MLEGDGLAE
Sbjct  519  KLHQEGKLNMMVDKDLKGNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLKMLEGDGLAE  578

Query  204  KWEASQRAETP--RHGNTVPQRYYDLIEESSLVVEAMELSGPR  82
            KWEASQ  ETP  R     PQRY D IEESSL+VEAMELSGPR
Sbjct  579  KWEASQHIETPRCRPCENPPQRYSDYIEESSLIVEAMELSGPR  621



>ref|XP_008444352.1| PREDICTED: protein NSP-INTERACTING KINASE 3 isoform X1 [Cucumis 
melo]
Length=621

 Score =   389 bits (999),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 191/223 (86%), Positives = 203/223 (91%), Gaps = 2/223 (1%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RKRIALG ARGLVYLHEQCDPKIIHRDVKAANILLDE FEAVVGDFGLAKLLDHR+SHV+
Sbjct  399  RKRIALGTARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRDSHVT  458

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKA++FG+G NQK VMLD VK
Sbjct  459  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRGANQKGVMLDWVK  518

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            +LHQE KL++MVDKDL  NFDR+ELEEMVQVALLCTQFNP HRPKMSEVL+MLEGDGLAE
Sbjct  519  KLHQEGKLNMMVDKDLKGNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLKMLEGDGLAE  578

Query  204  KWEASQRAETP--RHGNTVPQRYYDLIEESSLVVEAMELSGPR  82
            KWEASQ  ETP  R     PQRY D IEESSL+VEAMELSGPR
Sbjct  579  KWEASQHIETPRCRPCENPPQRYSDYIEESSLIVEAMELSGPR  621



>ref|XP_008444353.1| PREDICTED: protein NSP-INTERACTING KINASE 3 isoform X2 [Cucumis 
melo]
Length=609

 Score =   388 bits (997),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 191/223 (86%), Positives = 203/223 (91%), Gaps = 2/223 (1%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RKRIALG ARGLVYLHEQCDPKIIHRDVKAANILLDE FEAVVGDFGLAKLLDHR+SHV+
Sbjct  387  RKRIALGTARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRDSHVT  446

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKA++FG+G NQK VMLD VK
Sbjct  447  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRGANQKGVMLDWVK  506

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            +LHQE KL++MVDKDL  NFDR+ELEEMVQVALLCTQFNP HRPKMSEVL+MLEGDGLAE
Sbjct  507  KLHQEGKLNMMVDKDLKGNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLKMLEGDGLAE  566

Query  204  KWEASQRAETP--RHGNTVPQRYYDLIEESSLVVEAMELSGPR  82
            KWEASQ  ETP  R     PQRY D IEESSL+VEAMELSGPR
Sbjct  567  KWEASQHIETPRCRPCENPPQRYSDYIEESSLIVEAMELSGPR  609



>gb|KHN14560.1| Protein NSP-INTERACTING KINASE 3 [Glycine soja]
Length=623

 Score =   389 bits (998),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 189/221 (86%), Positives = 202/221 (91%), Gaps = 0/221 (0%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RKRIALG ARGLVYLHEQCDPKIIHRDVKAANILLDE FEAVVGDFGLAKLLDHR+SHV+
Sbjct  403  RKRIALGTARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRDSHVT  462

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELITG KA++FG+  NQK VMLD VK
Sbjct  463  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGHKALDFGRAANQKGVMLDWVK  522

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            +LHQ+ +LS MVDKDL  NFD IELEEMVQVALLCTQFNP HRPKMSEVL+MLEGDGLAE
Sbjct  523  KLHQDGRLSQMVDKDLKGNFDLIELEEMVQVALLCTQFNPSHRPKMSEVLKMLEGDGLAE  582

Query  204  KWEASQRAETPRHGNTVPQRYYDLIEESSLVVEAMELSGPR  82
            +WEASQR ETPR  +  PQRY DLIEESSL+VEAMELSGPR
Sbjct  583  RWEASQRIETPRFRSCEPQRYSDLIEESSLIVEAMELSGPR  623



>ref|XP_007157369.1| hypothetical protein PHAVU_002G064400g [Phaseolus vulgaris]
 gb|ESW29363.1| hypothetical protein PHAVU_002G064400g [Phaseolus vulgaris]
Length=623

 Score =   389 bits (998),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 189/221 (86%), Positives = 202/221 (91%), Gaps = 0/221 (0%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RKRIALG ARGLVYLHEQCDPKIIHRDVKAANILLDE FEAVVGDFGLAKLLDHR+SHV+
Sbjct  403  RKRIALGTARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRDSHVT  462

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELITG KA++FG+  NQK VMLD VK
Sbjct  463  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGHKALDFGRAANQKGVMLDWVK  522

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            +LHQ+ +LS MVDKDL  NFD IELEEMVQVALLCTQFNP HRPKMSEVL+MLEGDGLAE
Sbjct  523  KLHQDGRLSQMVDKDLKGNFDLIELEEMVQVALLCTQFNPSHRPKMSEVLKMLEGDGLAE  582

Query  204  KWEASQRAETPRHGNTVPQRYYDLIEESSLVVEAMELSGPR  82
            +WEASQR ETPR  +  PQRY DLIEESSL+VEAMELSGPR
Sbjct  583  RWEASQRIETPRFRSCEPQRYSDLIEESSLIVEAMELSGPR  623



>ref|XP_003517653.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like [Glycine max]
Length=623

 Score =   389 bits (998),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 189/221 (86%), Positives = 202/221 (91%), Gaps = 0/221 (0%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RKRIALG ARGLVYLHEQCDPKIIHRDVKAANILLDE FEAVVGDFGLAKLLDHR+SHV+
Sbjct  403  RKRIALGTARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRDSHVT  462

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELITG KA++FG+  NQK VMLD VK
Sbjct  463  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGHKALDFGRAANQKGVMLDWVK  522

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            +LHQ+ +LS MVDKDL  NFD IELEEMVQVALLCTQFNP HRPKMSEVL+MLEGDGLAE
Sbjct  523  KLHQDGRLSQMVDKDLKGNFDLIELEEMVQVALLCTQFNPSHRPKMSEVLKMLEGDGLAE  582

Query  204  KWEASQRAETPRHGNTVPQRYYDLIEESSLVVEAMELSGPR  82
            +WEASQR ETPR  +  PQRY DLIEESSL+VEAMELSGPR
Sbjct  583  RWEASQRIETPRFRSCEPQRYSDLIEESSLIVEAMELSGPR  623



>ref|XP_006380012.1| hypothetical protein POPTR_0008s19310g [Populus trichocarpa]
 gb|ERP57809.1| hypothetical protein POPTR_0008s19310g [Populus trichocarpa]
Length=622

 Score =   388 bits (996),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 189/223 (85%), Positives = 204/223 (91%), Gaps = 2/223 (1%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RKRIALG ARGL+YLHEQCDPKIIHRDVKAANILLDE FEAVVGDFGLAKLLDHR+SHV+
Sbjct  400  RKRIALGTARGLLYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRDSHVT  459

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHI+PEYLSTGQSSEKTDVFGFGILLLELITGQKA++FG+  NQK VMLD VK
Sbjct  460  TAVRGTVGHISPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRAANQKGVMLDWVK  519

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            +LHQ+RKL+LMVDKDL   FDRIELEEMVQVALLCTQFNP HRPKMSEVL+MLEGDGLAE
Sbjct  520  KLHQDRKLNLMVDKDLRGKFDRIELEEMVQVALLCTQFNPSHRPKMSEVLKMLEGDGLAE  579

Query  204  KWEASQRAETPRHGN--TVPQRYYDLIEESSLVVEAMELSGPR  82
            KWEASQ+ ETPR  +    PQ+Y D IEESSLVVEAMELSGPR
Sbjct  580  KWEASQKVETPRFRSCENPPQKYSDFIEESSLVVEAMELSGPR  622



>ref|XP_002312685.1| leucine-rich repeat family protein [Populus trichocarpa]
 gb|EEE90052.1| leucine-rich repeat family protein [Populus trichocarpa]
Length=625

 Score =   387 bits (995),  Expect = 9e-128, Method: Compositional matrix adjust.
 Identities = 189/223 (85%), Positives = 204/223 (91%), Gaps = 2/223 (1%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RKRIALG ARGL+YLHEQCDPKIIHRDVKAANILLDE FEAVVGDFGLAKLLDHR+SHV+
Sbjct  403  RKRIALGTARGLLYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRDSHVT  462

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHI+PEYLSTGQSSEKTDVFGFGILLLELITGQKA++FG+  NQK VMLD VK
Sbjct  463  TAVRGTVGHISPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRAANQKGVMLDWVK  522

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            +LHQ+RKL+LMVDKDL   FDRIELEEMVQVALLCTQFNP HRPKMSEVL+MLEGDGLAE
Sbjct  523  KLHQDRKLNLMVDKDLRGKFDRIELEEMVQVALLCTQFNPSHRPKMSEVLKMLEGDGLAE  582

Query  204  KWEASQRAETPRHGN--TVPQRYYDLIEESSLVVEAMELSGPR  82
            KWEASQ+ ETPR  +    PQ+Y D IEESSLVVEAMELSGPR
Sbjct  583  KWEASQKVETPRFRSCENPPQKYSDFIEESSLVVEAMELSGPR  625



>ref|XP_006366916.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like [Solanum tuberosum]
Length=622

 Score =   387 bits (994),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 190/223 (85%), Positives = 203/223 (91%), Gaps = 2/223 (1%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RK IA+G ARGLVYLHEQCDPKIIHRDVKAANILLDE FEAVVGDFGLAKLLDHR+SHV+
Sbjct  400  RKGIAVGTARGLVYLHEQCDPKIIHRDVKAANILLDEEFEAVVGDFGLAKLLDHRDSHVT  459

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAV+FG+G NQK VMLD VK
Sbjct  460  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGVNQKGVMLDWVK  519

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            +LH E+KL+LMVDKDL  NFDRIELEEMVQVALLCTQF P +RPKMSEVLRMLEGDGLAE
Sbjct  520  KLHAEKKLNLMVDKDLKNNFDRIELEEMVQVALLCTQFIPTYRPKMSEVLRMLEGDGLAE  579

Query  204  KWEASQRAETPRH--GNTVPQRYYDLIEESSLVVEAMELSGPR  82
            KWEASQ+ ETPR+      P+RY D IEESSLVVEAMELSGPR
Sbjct  580  KWEASQKVETPRYRTSENTPKRYSDYIEESSLVVEAMELSGPR  622



>ref|XP_002525400.1| BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1 precursor, 
putative [Ricinus communis]
 gb|EEF37038.1| BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1 precursor, 
putative [Ricinus communis]
Length=618

 Score =   387 bits (993),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 189/223 (85%), Positives = 205/223 (92%), Gaps = 2/223 (1%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RK+IALG ARGL+YLHEQCDPKIIHRDVKAANILLDE FEAVVGDFGLAKLLDHR+SHV+
Sbjct  396  RKKIALGTARGLLYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRDSHVT  455

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKA++FG+  NQK VMLD VK
Sbjct  456  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRAANQKGVMLDWVK  515

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            +LHQE KL+L+VDKDL  NFDR+ELEEMVQVALLCTQFNP HRPKMSEVL+MLEGDGLAE
Sbjct  516  KLHQEGKLNLLVDKDLKGNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLKMLEGDGLAE  575

Query  204  KWEASQRAETPRHGN--TVPQRYYDLIEESSLVVEAMELSGPR  82
            KWEASQ+ ETPR  +  + PQRY D IEESSLVVEAMELSGPR
Sbjct  576  KWEASQKIETPRFRSCESHPQRYSDFIEESSLVVEAMELSGPR  618



>gb|KDP26621.1| hypothetical protein JCGZ_17779 [Jatropha curcas]
Length=626

 Score =   387 bits (994),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 190/223 (85%), Positives = 203/223 (91%), Gaps = 2/223 (1%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RK+IALG ARGL+YLHEQCDPKIIHRDVKAANILLDE FEAVVGDFGLAKLLDHR+SHV+
Sbjct  404  RKKIALGTARGLLYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRDSHVT  463

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKA++FG+  NQK VMLD VK
Sbjct  464  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRAANQKGVMLDWVK  523

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            +LHQE KL+L+VDKDL  NFDRIELEEMVQVALLCTQFNP HRPKMSEVL+MLEGDGLAE
Sbjct  524  KLHQEGKLNLLVDKDLKGNFDRIELEEMVQVALLCTQFNPSHRPKMSEVLKMLEGDGLAE  583

Query  204  KWEASQRAETP--RHGNTVPQRYYDLIEESSLVVEAMELSGPR  82
            KWEASQ+ ETP  R     PQRY D IEESSLVVEAMELSGPR
Sbjct  584  KWEASQKIETPRLRSCENHPQRYSDFIEESSLVVEAMELSGPR  626



>ref|XP_011034116.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X2 [Populus 
euphratica]
Length=624

 Score =   384 bits (986),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 189/223 (85%), Positives = 202/223 (91%), Gaps = 2/223 (1%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RKRIALG ARGL+YLHEQCDPKIIHRDVKAANILLDE FEAVVGDFGLAKLLDHR+SHV+
Sbjct  402  RKRIALGTARGLLYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRDSHVT  461

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKA++FG+  NQK VMLD VK
Sbjct  462  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRAANQKGVMLDWVK  521

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            +LH +RKL+LMVDKDL   FDRIELEEMVQVALLCTQFNP HRPKMSEVL+MLEGDGLAE
Sbjct  522  KLHHDRKLNLMVDKDLRGKFDRIELEEMVQVALLCTQFNPSHRPKMSEVLKMLEGDGLAE  581

Query  204  KWEASQRAETPRHGN--TVPQRYYDLIEESSLVVEAMELSGPR  82
            KWEASQ+ ETPR  +     Q+Y D IEESSLVVEAMELSGPR
Sbjct  582  KWEASQKVETPRFRSCENPAQKYSDFIEESSLVVEAMELSGPR  624



>gb|KDO82334.1| hypothetical protein CISIN_1g006968mg [Citrus sinensis]
Length=623

 Score =   384 bits (986),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 188/221 (85%), Positives = 203/221 (92%), Gaps = 1/221 (0%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RKRIALG ARGL+YLHEQCDPKIIHRDVKAANILLDE FEAVVGDFGLAKLLDHR+SHV+
Sbjct  404  RKRIALGTARGLLYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRDSHVT  463

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A++FG+  NQ+ VMLD VK
Sbjct  464  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQRALDFGRAANQRGVMLDWVK  523

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            +LHQE KLS MVDKDL  NFDRIELEEMVQVALLCTQFNP HRPKMSEVL+MLEGDGLAE
Sbjct  524  KLHQEGKLSQMVDKDLKGNFDRIELEEMVQVALLCTQFNPLHRPKMSEVLKMLEGDGLAE  583

Query  204  KWEASQRAETPRHGNTVPQRYYDLIEESSLVVEAMELSGPR  82
            KWEASQ+ ETPR+  T  +RY D IEESSLV+EAMELSGPR
Sbjct  584  KWEASQKIETPRY-RTHEKRYSDFIEESSLVIEAMELSGPR  623



>ref|XP_011034114.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X1 [Populus 
euphratica]
 ref|XP_011034115.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X1 [Populus 
euphratica]
Length=627

 Score =   384 bits (985),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 189/223 (85%), Positives = 202/223 (91%), Gaps = 2/223 (1%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RKRIALG ARGL+YLHEQCDPKIIHRDVKAANILLDE FEAVVGDFGLAKLLDHR+SHV+
Sbjct  405  RKRIALGTARGLLYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRDSHVT  464

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKA++FG+  NQK VMLD VK
Sbjct  465  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRAANQKGVMLDWVK  524

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            +LH +RKL+LMVDKDL   FDRIELEEMVQVALLCTQFNP HRPKMSEVL+MLEGDGLAE
Sbjct  525  KLHHDRKLNLMVDKDLRGKFDRIELEEMVQVALLCTQFNPSHRPKMSEVLKMLEGDGLAE  584

Query  204  KWEASQRAETPRHGN--TVPQRYYDLIEESSLVVEAMELSGPR  82
            KWEASQ+ ETPR  +     Q+Y D IEESSLVVEAMELSGPR
Sbjct  585  KWEASQKVETPRFRSCENPAQKYSDFIEESSLVVEAMELSGPR  627



>ref|XP_007222911.1| hypothetical protein PRUPE_ppa003642mg [Prunus persica]
 gb|EMJ24110.1| hypothetical protein PRUPE_ppa003642mg [Prunus persica]
Length=559

 Score =   381 bits (978),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 188/223 (84%), Positives = 203/223 (91%), Gaps = 2/223 (1%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RKRIALG ARGLVYLHEQCDP+IIHRDVKAANILLDE FEAVVGDFGLAKLLDHRESHV+
Sbjct  337  RKRIALGTARGLVYLHEQCDPRIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVT  396

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSS+KTDVFGFGILLLELITGQKA++FG+  NQK VMLD VK
Sbjct  397  TAVRGTVGHIAPEYLSTGQSSDKTDVFGFGILLLELITGQKALDFGRVANQKGVMLDWVK  456

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            +LHQE K++LMVDKDL  NFDR+ELEEMVQVALLCTQFNP HRPKMSEVL+MLEGDGLAE
Sbjct  457  KLHQEGKVNLMVDKDLKGNFDRVELEEMVQVALLCTQFNPLHRPKMSEVLKMLEGDGLAE  516

Query  204  KWEASQRAETPRHGNT--VPQRYYDLIEESSLVVEAMELSGPR  82
            KWEASQ+ ETPR  +     QRY D IEESSLV+EAMELSGPR
Sbjct  517  KWEASQKVETPRFRSCEHPRQRYSDFIEESSLVLEAMELSGPR  559



>ref|XP_007222912.1| hypothetical protein PRUPE_ppa003642mg [Prunus persica]
 gb|EMJ24111.1| hypothetical protein PRUPE_ppa003642mg [Prunus persica]
Length=560

 Score =   381 bits (978),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 188/223 (84%), Positives = 203/223 (91%), Gaps = 2/223 (1%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RKRIALG ARGLVYLHEQCDP+IIHRDVKAANILLDE FEAVVGDFGLAKLLDHRESHV+
Sbjct  338  RKRIALGTARGLVYLHEQCDPRIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVT  397

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSS+KTDVFGFGILLLELITGQKA++FG+  NQK VMLD VK
Sbjct  398  TAVRGTVGHIAPEYLSTGQSSDKTDVFGFGILLLELITGQKALDFGRVANQKGVMLDWVK  457

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            +LHQE K++LMVDKDL  NFDR+ELEEMVQVALLCTQFNP HRPKMSEVL+MLEGDGLAE
Sbjct  458  KLHQEGKVNLMVDKDLKGNFDRVELEEMVQVALLCTQFNPLHRPKMSEVLKMLEGDGLAE  517

Query  204  KWEASQRAETPRHGNT--VPQRYYDLIEESSLVVEAMELSGPR  82
            KWEASQ+ ETPR  +     QRY D IEESSLV+EAMELSGPR
Sbjct  518  KWEASQKVETPRFRSCEHPRQRYSDFIEESSLVLEAMELSGPR  560



>ref|XP_010248542.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X2 [Nelumbo 
nucifera]
Length=582

 Score =   381 bits (979),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 187/223 (84%), Positives = 202/223 (91%), Gaps = 2/223 (1%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RK IALG ARGL+YLHEQCDPKIIHRDVKAANILLDE FEAVVGDFGLAKLLDHR+SHV+
Sbjct  360  RKSIALGTARGLLYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRDSHVT  419

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TA+RGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKA++FG+  +QK VMLD VK
Sbjct  420  TAIRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRAVSQKGVMLDWVK  479

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            +LHQE KL+LMVDK L  NFDR+ELEEMV+VALLCTQF+P  RPKMSEVLRMLEGDGLAE
Sbjct  480  KLHQEGKLNLMVDKCLNNNFDRVELEEMVKVALLCTQFHPSQRPKMSEVLRMLEGDGLAE  539

Query  204  KWEASQRAETP--RHGNTVPQRYYDLIEESSLVVEAMELSGPR  82
            KWEASQRAETP  R    +PQRY D IEESSLVVEAMELSGPR
Sbjct  540  KWEASQRAETPRLRSSENLPQRYSDYIEESSLVVEAMELSGPR  582



>ref|XP_010100426.1| Protein NSP-INTERACTING KINASE 3 [Morus notabilis]
 gb|EXB82560.1| Protein NSP-INTERACTING KINASE 3 [Morus notabilis]
Length=637

 Score =   383 bits (983),  Expect = 9e-126, Method: Compositional matrix adjust.
 Identities = 186/223 (83%), Positives = 201/223 (90%), Gaps = 2/223 (1%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RKRIALG ARGLVYLHE CDPKIIHRDVKAANILLDE FEAVVGDFGLAKLLDHR+SHV+
Sbjct  415  RKRIALGTARGLVYLHESCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRDSHVT  474

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKA++FG+   QK VMLD VK
Sbjct  475  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRQAKQKGVMLDWVK  534

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            +LHQE KL+LMVDKD+  NFDR+ELEEMVQ+ALLCTQFNP HRPKMS+VL+MLEGDGLAE
Sbjct  535  KLHQEGKLNLMVDKDIKGNFDRVELEEMVQIALLCTQFNPSHRPKMSDVLKMLEGDGLAE  594

Query  204  KWEASQRAETP--RHGNTVPQRYYDLIEESSLVVEAMELSGPR  82
            KWEASQ+ ETP  R     PQRY D IEESSLV+EAMELSGPR
Sbjct  595  KWEASQKVETPRIRSCENPPQRYSDFIEESSLVIEAMELSGPR  637



>ref|XP_008221853.1| PREDICTED: protein NSP-INTERACTING KINASE 3 isoform X3 [Prunus 
mume]
Length=560

 Score =   380 bits (976),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 188/223 (84%), Positives = 203/223 (91%), Gaps = 2/223 (1%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RKRIALG ARGLVYLHEQCDP+IIHRDVKAANILLDE FEAVVGDFGLAKLLDHRESHV+
Sbjct  338  RKRIALGTARGLVYLHEQCDPRIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVT  397

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSS+KTDVFGFGILLLELITGQKA++FG+  NQK VMLD VK
Sbjct  398  TAVRGTVGHIAPEYLSTGQSSDKTDVFGFGILLLELITGQKALDFGRVANQKGVMLDWVK  457

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            +LHQE K++LMVDKDL  NFDR+ELEEMVQVALLCTQFNP HRPKMSEVL+MLEGDGLAE
Sbjct  458  KLHQEGKVNLMVDKDLKGNFDRVELEEMVQVALLCTQFNPLHRPKMSEVLKMLEGDGLAE  517

Query  204  KWEASQRAETPRHGNT--VPQRYYDLIEESSLVVEAMELSGPR  82
            KWEASQ+ ETPR  +     QRY D IEESSLV+EAMELSGPR
Sbjct  518  KWEASQKIETPRFRSCEHPRQRYSDFIEESSLVLEAMELSGPR  560



>ref|XP_010251173.1| PREDICTED: protein NSP-INTERACTING KINASE 3 [Nelumbo nucifera]
 ref|XP_010251174.1| PREDICTED: protein NSP-INTERACTING KINASE 3 [Nelumbo nucifera]
Length=628

 Score =   382 bits (981),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 188/223 (84%), Positives = 201/223 (90%), Gaps = 2/223 (1%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RKRIALG ARGL+YLHEQCDPKIIHRDVKAANILLDE FEAVVGDFGLAKLLDHR+SHV+
Sbjct  406  RKRIALGTARGLLYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRDSHVT  465

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKA++FG+  NQK VMLD VK
Sbjct  466  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRVANQKGVMLDWVK  525

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            +LHQE KL+ MVDK L  NFDR+ELEEMVQVALLCTQF+P  RPKM EVLRMLEGDGLAE
Sbjct  526  KLHQEGKLNQMVDKCLNNNFDRVELEEMVQVALLCTQFHPSQRPKMCEVLRMLEGDGLAE  585

Query  204  KWEASQRAETP--RHGNTVPQRYYDLIEESSLVVEAMELSGPR  82
            KWEASQ+ ETP  R   T+PQRY D IEESSLVVEAMELSGPR
Sbjct  586  KWEASQKVETPRFRSSETMPQRYSDFIEESSLVVEAMELSGPR  628



>ref|XP_010248541.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X1 [Nelumbo 
nucifera]
Length=626

 Score =   382 bits (981),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 187/223 (84%), Positives = 202/223 (91%), Gaps = 2/223 (1%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RK IALG ARGL+YLHEQCDPKIIHRDVKAANILLDE FEAVVGDFGLAKLLDHR+SHV+
Sbjct  404  RKSIALGTARGLLYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRDSHVT  463

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TA+RGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKA++FG+  +QK VMLD VK
Sbjct  464  TAIRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRAVSQKGVMLDWVK  523

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            +LHQE KL+LMVDK L  NFDR+ELEEMV+VALLCTQF+P  RPKMSEVLRMLEGDGLAE
Sbjct  524  KLHQEGKLNLMVDKCLNNNFDRVELEEMVKVALLCTQFHPSQRPKMSEVLRMLEGDGLAE  583

Query  204  KWEASQRAETP--RHGNTVPQRYYDLIEESSLVVEAMELSGPR  82
            KWEASQRAETP  R    +PQRY D IEESSLVVEAMELSGPR
Sbjct  584  KWEASQRAETPRLRSSENLPQRYSDYIEESSLVVEAMELSGPR  626



>gb|KJB61041.1| hypothetical protein B456_009G337000 [Gossypium raimondii]
Length=628

 Score =   382 bits (980),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 188/225 (84%), Positives = 202/225 (90%), Gaps = 4/225 (2%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RKRIALG ARGLVYLHEQCDPKIIHRDVKAANILLDE FEAVVGDFGLAKLLDHR+SHV+
Sbjct  404  RKRIALGTARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRDSHVT  463

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKA++FG+  NQK VMLD VK
Sbjct  464  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRAANQKGVMLDWVK  523

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            +LHQ+ KLSL+VDKDL  NFDRIELEEMVQVALLCTQFNP HRP+MSEVLRMLEGDGLAE
Sbjct  524  KLHQDGKLSLLVDKDLKGNFDRIELEEMVQVALLCTQFNPLHRPRMSEVLRMLEGDGLAE  583

Query  204  KWEASQRAETPR----HGNTVPQRYYDLIEESSLVVEAMELSGPR  82
            KWEASQ  +T +      +  PQRY D IEESSLV+EAMELSGPR
Sbjct  584  KWEASQMIKTLKLRSCDNDNPPQRYSDFIEESSLVLEAMELSGPR  628



>gb|KJB61045.1| hypothetical protein B456_009G337000 [Gossypium raimondii]
Length=625

 Score =   382 bits (980),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 188/225 (84%), Positives = 202/225 (90%), Gaps = 4/225 (2%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RKRIALG ARGLVYLHEQCDPKIIHRDVKAANILLDE FEAVVGDFGLAKLLDHR+SHV+
Sbjct  401  RKRIALGTARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRDSHVT  460

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKA++FG+  NQK VMLD VK
Sbjct  461  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRAANQKGVMLDWVK  520

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            +LHQ+ KLSL+VDKDL  NFDRIELEEMVQVALLCTQFNP HRP+MSEVLRMLEGDGLAE
Sbjct  521  KLHQDGKLSLLVDKDLKGNFDRIELEEMVQVALLCTQFNPLHRPRMSEVLRMLEGDGLAE  580

Query  204  KWEASQRAETPR----HGNTVPQRYYDLIEESSLVVEAMELSGPR  82
            KWEASQ  +T +      +  PQRY D IEESSLV+EAMELSGPR
Sbjct  581  KWEASQMIKTLKLRSCDNDNPPQRYSDFIEESSLVLEAMELSGPR  625



>gb|EYU28436.1| hypothetical protein MIMGU_mgv1a002888mg [Erythranthe guttata]
Length=628

 Score =   382 bits (980),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 186/226 (82%), Positives = 203/226 (90%), Gaps = 5/226 (2%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RK IALG ARGLVYLHEQCDPK+IHRDVKAANILLDE FEAVVGDFGLAKLLDHR+SHV+
Sbjct  403  RKSIALGTARGLVYLHEQCDPKVIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRDSHVT  462

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELITG KAV+FG+G NQK V+LD VK
Sbjct  463  TAVRGTLGHIAPEYLSTGQSSEKTDVFGFGILLLELITGHKAVDFGRGANQKGVILDWVK  522

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            +LHQE KL+LMVDK+L ++FD IELEEMVQVALLCT FNP HRPKMSEVLRMLEGDGLAE
Sbjct  523  KLHQEGKLNLMVDKELKSDFDMIELEEMVQVALLCTHFNPTHRPKMSEVLRMLEGDGLAE  582

Query  204  KWEASQRAETPRHGNT-----VPQRYYDLIEESSLVVEAMELSGPR  82
            KWE SQ+ +TPR+ N+     +PQRY D IEESSLVVE MELSGPR
Sbjct  583  KWEQSQKVDTPRYNNSRSFQNLPQRYSDYIEESSLVVEDMELSGPR  628



>ref|XP_008221852.1| PREDICTED: protein NSP-INTERACTING KINASE 3 isoform X2 [Prunus 
mume]
Length=655

 Score =   381 bits (978),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 188/223 (84%), Positives = 203/223 (91%), Gaps = 2/223 (1%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RKRIALG ARGLVYLHEQCDP+IIHRDVKAANILLDE FEAVVGDFGLAKLLDHRESHV+
Sbjct  433  RKRIALGTARGLVYLHEQCDPRIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVT  492

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSS+KTDVFGFGILLLELITGQKA++FG+  NQK VMLD VK
Sbjct  493  TAVRGTVGHIAPEYLSTGQSSDKTDVFGFGILLLELITGQKALDFGRVANQKGVMLDWVK  552

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            +LHQE K++LMVDKDL  NFDR+ELEEMVQVALLCTQFNP HRPKMSEVL+MLEGDGLAE
Sbjct  553  KLHQEGKVNLMVDKDLKGNFDRVELEEMVQVALLCTQFNPLHRPKMSEVLKMLEGDGLAE  612

Query  204  KWEASQRAETPRHGNT--VPQRYYDLIEESSLVVEAMELSGPR  82
            KWEASQ+ ETPR  +     QRY D IEESSLV+EAMELSGPR
Sbjct  613  KWEASQKIETPRFRSCEHPRQRYSDFIEESSLVLEAMELSGPR  655



>ref|XP_008221850.1| PREDICTED: protein NSP-INTERACTING KINASE 3 isoform X1 [Prunus 
mume]
Length=656

 Score =   381 bits (978),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 188/223 (84%), Positives = 203/223 (91%), Gaps = 2/223 (1%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RKRIALG ARGLVYLHEQCDP+IIHRDVKAANILLDE FEAVVGDFGLAKLLDHRESHV+
Sbjct  434  RKRIALGTARGLVYLHEQCDPRIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVT  493

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSS+KTDVFGFGILLLELITGQKA++FG+  NQK VMLD VK
Sbjct  494  TAVRGTVGHIAPEYLSTGQSSDKTDVFGFGILLLELITGQKALDFGRVANQKGVMLDWVK  553

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            +LHQE K++LMVDKDL  NFDR+ELEEMVQVALLCTQFNP HRPKMSEVL+MLEGDGLAE
Sbjct  554  KLHQEGKVNLMVDKDLKGNFDRVELEEMVQVALLCTQFNPLHRPKMSEVLKMLEGDGLAE  613

Query  204  KWEASQRAETPRHGNT--VPQRYYDLIEESSLVVEAMELSGPR  82
            KWEASQ+ ETPR  +     QRY D IEESSLV+EAMELSGPR
Sbjct  614  KWEASQKIETPRFRSCEHPRQRYSDFIEESSLVLEAMELSGPR  656



>ref|XP_010682518.1| PREDICTED: protein NSP-INTERACTING KINASE 3 [Beta vulgaris subsp. 
vulgaris]
Length=621

 Score =   379 bits (974),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 183/221 (83%), Positives = 201/221 (91%), Gaps = 0/221 (0%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            R+ IALG ARGL+YLHEQCDPKIIHRDVKAANILLDE FEAVVGDFGLAKLLDHRESHV+
Sbjct  401  RRSIALGTARGLLYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVT  460

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGTIGHIAPEYL TGQSSEKTDVFG+GILLLELITGQKA++FG+ +NQK VMLD VK
Sbjct  461  TAVRGTIGHIAPEYLCTGQSSEKTDVFGYGILLLELITGQKAIDFGRASNQKGVMLDWVK  520

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            +LH E KL+ +VDKDL  N+DR+EL EMVQVALLCTQFNP HRPKMS+VLRMLE DGLAE
Sbjct  521  KLHTEGKLNQLVDKDLKNNYDRVELGEMVQVALLCTQFNPLHRPKMSDVLRMLEDDGLAE  580

Query  204  KWEASQRAETPRHGNTVPQRYYDLIEESSLVVEAMELSGPR  82
            KW+ASQR+ETPR  ++ PQRY D IEESSLVVEAMELSGPR
Sbjct  581  KWDASQRSETPRSRSSEPQRYSDYIEESSLVVEAMELSGPR  621



>emb|CDP13189.1| unnamed protein product [Coffea canephora]
Length=624

 Score =   379 bits (974),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 186/223 (83%), Positives = 200/223 (90%), Gaps = 2/223 (1%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RK+IALG ARGLVYLHEQCDPKIIHRDVKAANILLDE FEAVVGDFGLAKLLDHRESHV+
Sbjct  402  RKKIALGTARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVT  461

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKA++FG+G  QK +MLD VK
Sbjct  462  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRGAKQKGIMLDWVK  521

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            +LHQ+ KL LMVDKDL  ++D +ELEEMVQVALLCT FNP +RPKMSEVLRMLEGDGLAE
Sbjct  522  KLHQDAKLELMVDKDLKNDYDNVELEEMVQVALLCTVFNPSNRPKMSEVLRMLEGDGLAE  581

Query  204  KWEASQRAETPRHGNT--VPQRYYDLIEESSLVVEAMELSGPR  82
            KWEASQ  ETPR      +PQRY D IEESSLVVEAMELSGPR
Sbjct  582  KWEASQTIETPRFRTFEHIPQRYSDYIEESSLVVEAMELSGPR  624



>ref|XP_008389685.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X1 [Malus 
domestica]
 ref|XP_008389686.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X1 [Malus 
domestica]
Length=632

 Score =   379 bits (974),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 188/223 (84%), Positives = 202/223 (91%), Gaps = 2/223 (1%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RKRIALG ARGLVYLHEQCDP+IIHRDVKAANILLDE FEAVVGDFGLAKLLDHRESHV+
Sbjct  410  RKRIALGTARGLVYLHEQCDPRIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVT  469

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSS+KTDVFGFGILLLELITGQKA++FG+  NQK VMLD VK
Sbjct  470  TAVRGTVGHIAPEYLSTGQSSDKTDVFGFGILLLELITGQKALDFGRVANQKGVMLDWVK  529

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            +LHQE KL+LMVDKDL  N DR+ELEEMVQVALLCTQFNP +RPKMSEVL+MLEGDGLAE
Sbjct  530  KLHQEGKLNLMVDKDLKGNIDRVELEEMVQVALLCTQFNPLYRPKMSEVLKMLEGDGLAE  589

Query  204  KWEASQRAETPRHGNT--VPQRYYDLIEESSLVVEAMELSGPR  82
            KWEASQ+ ETPR  +     QRY D IEESSLVVEAMELSGPR
Sbjct  590  KWEASQKVETPRFRSCEHPRQRYSDFIEESSLVVEAMELSGPR  632



>ref|XP_010319667.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X2 [Solanum 
lycopersicum]
Length=575

 Score =   377 bits (968),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 187/225 (83%), Positives = 199/225 (88%), Gaps = 4/225 (2%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RK IA+G ARGLVYLHEQCDPKIIHRDVKAANILLDE FEAVVGDFGLAKLLDHR+SHV+
Sbjct  351  RKGIAVGTARGLVYLHEQCDPKIIHRDVKAANILLDEEFEAVVGDFGLAKLLDHRDSHVT  410

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFG+G NQK VMLD VK
Sbjct  411  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGRGANQKGVMLDWVK  470

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            +LH E+KL+LMVDKDL  NFD IELEEMVQVALLCT F P +RPKMSEVLRMLEGDGLAE
Sbjct  471  KLHVEKKLNLMVDKDLKNNFDGIELEEMVQVALLCTHFIPTYRPKMSEVLRMLEGDGLAE  530

Query  204  KWEASQRAETP----RHGNTVPQRYYDLIEESSLVVEAMELSGPR  82
            KWEASQ+ ETP          P+RY D I+ESSLVVEAMELSGPR
Sbjct  531  KWEASQKVETPTPRFTTSENTPKRYSDYIQESSLVVEAMELSGPR  575



>ref|XP_006483905.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like [Citrus sinensis]
Length=623

 Score =   379 bits (972),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 186/221 (84%), Positives = 201/221 (91%), Gaps = 1/221 (0%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RKRIALG ARGL+YLHEQCDPKIIHRDVKAANILLDE FEAVVGDFGLAKLLDHR+SHV+
Sbjct  404  RKRIALGTARGLLYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRDSHVT  463

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A++FG+  NQ+ VMLD VK
Sbjct  464  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQRALDFGRAANQRGVMLDWVK  523

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            +LHQE KLS MVDKDL    DRIELEEMVQVALLCTQFNP HRPKMSEVL+MLEGDGLAE
Sbjct  524  KLHQEGKLSQMVDKDLKGKLDRIELEEMVQVALLCTQFNPLHRPKMSEVLKMLEGDGLAE  583

Query  204  KWEASQRAETPRHGNTVPQRYYDLIEESSLVVEAMELSGPR  82
            KWEASQ+ ETPR+  T  +RY D IEESSLV+EAMELSGPR
Sbjct  584  KWEASQKIETPRY-RTHEKRYSDFIEESSLVIEAMELSGPR  623



>ref|XP_006438322.1| hypothetical protein CICLE_v10030967mg [Citrus clementina]
 gb|ESR51562.1| hypothetical protein CICLE_v10030967mg [Citrus clementina]
Length=623

 Score =   379 bits (972),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 186/221 (84%), Positives = 201/221 (91%), Gaps = 1/221 (0%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RKRIALG ARGL+YLHEQCDPKIIHRDVKAANILLDE FEAVVGDFGLAKLLDHR+SHV+
Sbjct  404  RKRIALGTARGLLYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRDSHVT  463

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A++FG+  NQ+ VMLD VK
Sbjct  464  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQRALDFGRAANQRGVMLDWVK  523

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            +LHQE KLS MVDKDL    DRIELEEMVQVALLCTQFNP HRPKMSEVL+MLEGDGLAE
Sbjct  524  KLHQEGKLSQMVDKDLKGKLDRIELEEMVQVALLCTQFNPLHRPKMSEVLKMLEGDGLAE  583

Query  204  KWEASQRAETPRHGNTVPQRYYDLIEESSLVVEAMELSGPR  82
            KWEASQ+ ETPR+  T  +RY D IEESSLV+EAMELSGPR
Sbjct  584  KWEASQKIETPRY-RTHEKRYSDFIEESSLVIEAMELSGPR  623



>ref|XP_008813583.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X2 [Phoenix 
dactylifera]
Length=643

 Score =   379 bits (974),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 182/223 (82%), Positives = 205/223 (92%), Gaps = 2/223 (1%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RKRIALG ARGL+YLHEQCDPKIIHRDVKAANILLDE FEAVVGDFGLAKLLDH+ESHV+
Sbjct  421  RKRIALGTARGLLYLHEQCDPKIIHRDVKAANILLDEEFEAVVGDFGLAKLLDHQESHVT  480

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A++FG+  NQK VMLD VK
Sbjct  481  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQRALDFGRLANQKGVMLDWVK  540

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            RLHQE KLS+MVDKDL  N+DR+ELEEMVQVALLCTQF+P HRPKMSEV+RMLEGDGLAE
Sbjct  541  RLHQENKLSMMVDKDLRNNYDRVELEEMVQVALLCTQFHPSHRPKMSEVVRMLEGDGLAE  600

Query  204  KWEASQRAETPRHGNT--VPQRYYDLIEESSLVVEAMELSGPR  82
            KWEASQ+ +TP+ G++   P ++ D +E+SSLVVEA+ELSGPR
Sbjct  601  KWEASQKVDTPKSGSSEQAPPKHSDYVEDSSLVVEAIELSGPR  643



>ref|XP_008389688.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X3 [Malus 
domestica]
Length=630

 Score =   379 bits (972),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 188/223 (84%), Positives = 202/223 (91%), Gaps = 2/223 (1%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RKRIALG ARGLVYLHEQCDP+IIHRDVKAANILLDE FEAVVGDFGLAKLLDHRESHV+
Sbjct  408  RKRIALGTARGLVYLHEQCDPRIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVT  467

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSS+KTDVFGFGILLLELITGQKA++FG+  NQK VMLD VK
Sbjct  468  TAVRGTVGHIAPEYLSTGQSSDKTDVFGFGILLLELITGQKALDFGRVANQKGVMLDWVK  527

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            +LHQE KL+LMVDKDL  N DR+ELEEMVQVALLCTQFNP +RPKMSEVL+MLEGDGLAE
Sbjct  528  KLHQEGKLNLMVDKDLKGNIDRVELEEMVQVALLCTQFNPLYRPKMSEVLKMLEGDGLAE  587

Query  204  KWEASQRAETPRHGNT--VPQRYYDLIEESSLVVEAMELSGPR  82
            KWEASQ+ ETPR  +     QRY D IEESSLVVEAMELSGPR
Sbjct  588  KWEASQKVETPRFRSCEHPRQRYSDFIEESSLVVEAMELSGPR  630



>ref|XP_008389687.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X2 [Malus 
domestica]
Length=631

 Score =   379 bits (972),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 188/223 (84%), Positives = 202/223 (91%), Gaps = 2/223 (1%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RKRIALG ARGLVYLHEQCDP+IIHRDVKAANILLDE FEAVVGDFGLAKLLDHRESHV+
Sbjct  409  RKRIALGTARGLVYLHEQCDPRIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVT  468

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSS+KTDVFGFGILLLELITGQKA++FG+  NQK VMLD VK
Sbjct  469  TAVRGTVGHIAPEYLSTGQSSDKTDVFGFGILLLELITGQKALDFGRVANQKGVMLDWVK  528

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            +LHQE KL+LMVDKDL  N DR+ELEEMVQVALLCTQFNP +RPKMSEVL+MLEGDGLAE
Sbjct  529  KLHQEGKLNLMVDKDLKGNIDRVELEEMVQVALLCTQFNPLYRPKMSEVLKMLEGDGLAE  588

Query  204  KWEASQRAETPRHGNT--VPQRYYDLIEESSLVVEAMELSGPR  82
            KWEASQ+ ETPR  +     QRY D IEESSLVVEAMELSGPR
Sbjct  589  KWEASQKVETPRFRSCEHPRQRYSDFIEESSLVVEAMELSGPR  631



>ref|XP_008340070.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X1 [Malus 
domestica]
Length=630

 Score =   378 bits (971),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 187/222 (84%), Positives = 201/222 (91%), Gaps = 1/222 (0%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RKRIALG ARGLVYLHEQCDP+IIHRDVKAANILLDE FEAVVGDFGLAKLLDHRESHVS
Sbjct  409  RKRIALGTARGLVYLHEQCDPRIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  468

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSS+KTDVFGFGILLLELITGQ+A++FG+  NQK VMLD VK
Sbjct  469  TAVRGTVGHIAPEYLSTGQSSDKTDVFGFGILLLELITGQRALDFGRVANQKGVMLDWVK  528

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            +LHQE KL+LMVDKDL    DR+ELEEMVQVALLCTQFNP +RPKMSEVL+MLEGDGLAE
Sbjct  529  KLHQEGKLNLMVDKDLRGKLDRVELEEMVQVALLCTQFNPLYRPKMSEVLKMLEGDGLAE  588

Query  204  KWEASQRAETPRHGNTVP-QRYYDLIEESSLVVEAMELSGPR  82
            KWEASQ+ ETPR     P QRY D IEESSLV+EAMELSGPR
Sbjct  589  KWEASQKVETPRFRPCDPRQRYSDFIEESSLVLEAMELSGPR  630



>ref|XP_008813582.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X1 [Phoenix 
dactylifera]
Length=649

 Score =   379 bits (973),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 182/223 (82%), Positives = 205/223 (92%), Gaps = 2/223 (1%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RKRIALG ARGL+YLHEQCDPKIIHRDVKAANILLDE FEAVVGDFGLAKLLDH+ESHV+
Sbjct  427  RKRIALGTARGLLYLHEQCDPKIIHRDVKAANILLDEEFEAVVGDFGLAKLLDHQESHVT  486

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A++FG+  NQK VMLD VK
Sbjct  487  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQRALDFGRLANQKGVMLDWVK  546

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            RLHQE KLS+MVDKDL  N+DR+ELEEMVQVALLCTQF+P HRPKMSEV+RMLEGDGLAE
Sbjct  547  RLHQENKLSMMVDKDLRNNYDRVELEEMVQVALLCTQFHPSHRPKMSEVVRMLEGDGLAE  606

Query  204  KWEASQRAETPRHGNT--VPQRYYDLIEESSLVVEAMELSGPR  82
            KWEASQ+ +TP+ G++   P ++ D +E+SSLVVEA+ELSGPR
Sbjct  607  KWEASQKVDTPKSGSSEQAPPKHSDYVEDSSLVVEAIELSGPR  649



>ref|XP_008340072.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X3 [Malus 
domestica]
Length=628

 Score =   378 bits (971),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 187/222 (84%), Positives = 201/222 (91%), Gaps = 1/222 (0%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RKRIALG ARGLVYLHEQCDP+IIHRDVKAANILLDE FEAVVGDFGLAKLLDHRESHVS
Sbjct  407  RKRIALGTARGLVYLHEQCDPRIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  466

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSS+KTDVFGFGILLLELITGQ+A++FG+  NQK VMLD VK
Sbjct  467  TAVRGTVGHIAPEYLSTGQSSDKTDVFGFGILLLELITGQRALDFGRVANQKGVMLDWVK  526

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            +LHQE KL+LMVDKDL    DR+ELEEMVQVALLCTQFNP +RPKMSEVL+MLEGDGLAE
Sbjct  527  KLHQEGKLNLMVDKDLRGKLDRVELEEMVQVALLCTQFNPLYRPKMSEVLKMLEGDGLAE  586

Query  204  KWEASQRAETPRHGNTVP-QRYYDLIEESSLVVEAMELSGPR  82
            KWEASQ+ ETPR     P QRY D IEESSLV+EAMELSGPR
Sbjct  587  KWEASQKVETPRFRPCDPRQRYSDFIEESSLVLEAMELSGPR  628



>ref|XP_008340071.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X2 [Malus 
domestica]
Length=629

 Score =   378 bits (970),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 187/222 (84%), Positives = 201/222 (91%), Gaps = 1/222 (0%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RKRIALG ARGLVYLHEQCDP+IIHRDVKAANILLDE FEAVVGDFGLAKLLDHRESHVS
Sbjct  408  RKRIALGTARGLVYLHEQCDPRIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVS  467

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSS+KTDVFGFGILLLELITGQ+A++FG+  NQK VMLD VK
Sbjct  468  TAVRGTVGHIAPEYLSTGQSSDKTDVFGFGILLLELITGQRALDFGRVANQKGVMLDWVK  527

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            +LHQE KL+LMVDKDL    DR+ELEEMVQVALLCTQFNP +RPKMSEVL+MLEGDGLAE
Sbjct  528  KLHQEGKLNLMVDKDLRGKLDRVELEEMVQVALLCTQFNPLYRPKMSEVLKMLEGDGLAE  587

Query  204  KWEASQRAETPRHGNTVP-QRYYDLIEESSLVVEAMELSGPR  82
            KWEASQ+ ETPR     P QRY D IEESSLV+EAMELSGPR
Sbjct  588  KWEASQKVETPRFRPCDPRQRYSDFIEESSLVLEAMELSGPR  629



>ref|XP_003613191.1| Leucine-rich repeat receptor-like kinase [Medicago truncatula]
 gb|ADO15296.1| somatic embryogenesis receptor kinase-like protein 2 [Medicago 
truncatula]
 gb|AES96149.1| LRR receptor-like kinase [Medicago truncatula]
Length=625

 Score =   377 bits (969),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 187/223 (84%), Positives = 198/223 (89%), Gaps = 2/223 (1%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RKRIALG ARGLVYLHEQCDPKIIHRDVKAANILLDE FEAVVGDFGLAKLLDHR++HV+
Sbjct  403  RKRIALGTARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRDTHVT  462

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGTIGHIAPEYLSTGQSSEKTDVFG+GILLLELITG KA++FG+  NQK VMLD VK
Sbjct  463  TAVRGTIGHIAPEYLSTGQSSEKTDVFGYGILLLELITGHKALDFGRAANQKGVMLDWVK  522

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            +LH E KLS MVDKDL  NFD +EL EMVQVALLCTQFNP HRPKMSEVL+MLEGDGLAE
Sbjct  523  KLHLEGKLSQMVDKDLKGNFDIVELGEMVQVALLCTQFNPSHRPKMSEVLKMLEGDGLAE  582

Query  204  KWEASQRAETP--RHGNTVPQRYYDLIEESSLVVEAMELSGPR  82
            KWEASQR ETP  R     PQRY D IEESSL+VEAMELSGPR
Sbjct  583  KWEASQRIETPRFRFCENPPQRYSDFIEESSLIVEAMELSGPR  625



>ref|XP_004237339.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X1 [Solanum 
lycopersicum]
 ref|XP_010319665.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X1 [Solanum 
lycopersicum]
 ref|XP_010319666.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X1 [Solanum 
lycopersicum]
Length=623

 Score =   377 bits (968),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 187/225 (83%), Positives = 199/225 (88%), Gaps = 4/225 (2%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RK IA+G ARGLVYLHEQCDPKIIHRDVKAANILLDE FEAVVGDFGLAKLLDHR+SHV+
Sbjct  399  RKGIAVGTARGLVYLHEQCDPKIIHRDVKAANILLDEEFEAVVGDFGLAKLLDHRDSHVT  458

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFG+G NQK VMLD VK
Sbjct  459  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGRGANQKGVMLDWVK  518

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            +LH E+KL+LMVDKDL  NFD IELEEMVQVALLCT F P +RPKMSEVLRMLEGDGLAE
Sbjct  519  KLHVEKKLNLMVDKDLKNNFDGIELEEMVQVALLCTHFIPTYRPKMSEVLRMLEGDGLAE  578

Query  204  KWEASQRAETP----RHGNTVPQRYYDLIEESSLVVEAMELSGPR  82
            KWEASQ+ ETP          P+RY D I+ESSLVVEAMELSGPR
Sbjct  579  KWEASQKVETPTPRFTTSENTPKRYSDYIQESSLVVEAMELSGPR  623



>ref|XP_006841062.1| hypothetical protein AMTR_s00085p00173590 [Amborella trichopoda]
 gb|ERN02737.1| hypothetical protein AMTR_s00085p00173590 [Amborella trichopoda]
Length=629

 Score =   377 bits (967),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 187/224 (83%), Positives = 204/224 (91%), Gaps = 3/224 (1%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RKRIALG ARGL+YLHEQCDPKIIHRDVKAANILLDE FEAVVGDFGLAKLLDH +SHV+
Sbjct  406  RKRIALGTARGLLYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHHDSHVT  465

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAV+FG+  NQK VMLD VK
Sbjct  466  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRLANQKGVMLDWVK  525

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            +LHQE+KL+LMVDKDL  NFDR+ELEEMV+VALLCTQF+P  RPKMSEV+RMLEGDGLAE
Sbjct  526  KLHQEKKLNLMVDKDLKNNFDRVELEEMVRVALLCTQFHPACRPKMSEVVRMLEGDGLAE  585

Query  204  KWEAS-QRAETPRHGNT--VPQRYYDLIEESSLVVEAMELSGPR  82
            KWEAS Q+ ETPR   +   P++Y DLIEESSLVVEAMELSGPR
Sbjct  586  KWEASQQKVETPRFRGSEFFPRKYSDLIEESSLVVEAMELSGPR  629



>ref|XP_010910388.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like [Elaeis guineensis]
Length=629

 Score =   375 bits (964),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 183/223 (82%), Positives = 201/223 (90%), Gaps = 2/223 (1%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RKRIALG ARGL+YLHEQCDPKIIHRDVKAANILLDE FEAVVGDFGLAKLLDH+ESHV+
Sbjct  407  RKRIALGTARGLLYLHEQCDPKIIHRDVKAANILLDEEFEAVVGDFGLAKLLDHQESHVT  466

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKA++FG+  NQK VMLD VK
Sbjct  467  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRLANQKGVMLDWVK  526

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            +LHQE KL +MVDKDL  N+DR+ELEEMVQVALLCTQF+P HRPKMSEV+RMLEGDGLAE
Sbjct  527  KLHQENKLRVMVDKDLKNNYDRVELEEMVQVALLCTQFHPSHRPKMSEVVRMLEGDGLAE  586

Query  204  KWEASQRAETP--RHGNTVPQRYYDLIEESSLVVEAMELSGPR  82
            KWEASQ+ ETP  R     P +Y D +E+SSLVVEA+ELSGPR
Sbjct  587  KWEASQKIETPKSRSCEQPPPKYLDFVEDSSLVVEAIELSGPR  629



>ref|XP_010940158.1| PREDICTED: protein NSP-INTERACTING KINASE 3 [Elaeis guineensis]
Length=629

 Score =   375 bits (963),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 180/223 (81%), Positives = 203/223 (91%), Gaps = 2/223 (1%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RKRIALG ARGL+YLHEQCDPKIIHRDVKAANILLDE FEAVVGDFGLAKLLDHRESHV+
Sbjct  407  RKRIALGTARGLLYLHEQCDPKIIHRDVKAANILLDEEFEAVVGDFGLAKLLDHRESHVT  466

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFG+LLLELITGQKA++FG+  NQK VMLD VK
Sbjct  467  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGVLLLELITGQKALDFGRLANQKGVMLDWVK  526

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            +LHQE KLS+MVDKDL  N+D +ELEEMVQVALLCTQ++P HRPKMSEV+RMLEGDGLAE
Sbjct  527  KLHQENKLSMMVDKDLKNNYDSVELEEMVQVALLCTQYHPSHRPKMSEVVRMLEGDGLAE  586

Query  204  KWEASQRAETPRHGNT--VPQRYYDLIEESSLVVEAMELSGPR  82
            KWEASQ+ +TP+  ++   P +Y D +EESSLVV+A+ELSGPR
Sbjct  587  KWEASQKTDTPKSLSSEQPPPKYLDFVEESSLVVDAIELSGPR  629



>ref|XP_010023506.1| PREDICTED: protein NSP-INTERACTING KINASE 3 [Eucalyptus grandis]
 gb|KCW59799.1| hypothetical protein EUGRSUZ_H02547 [Eucalyptus grandis]
Length=621

 Score =   375 bits (962),  Expect = 8e-123, Method: Compositional matrix adjust.
 Identities = 186/224 (83%), Positives = 201/224 (90%), Gaps = 4/224 (2%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RKRIALG ARGLVYLHEQCDPKIIHRDVKAANILLDE FEAVVGDFGLAKLLDHR+SHV+
Sbjct  399  RKRIALGTARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRDSHVT  458

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKA++FG+  NQK VMLD V 
Sbjct  459  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRVANQKGVMLDWVN  518

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            +LH++ KL+ +VDKDLG NFDRIELEEMV+V+LLCT+FNP  RPKMSEVLRMLEGDGLAE
Sbjct  519  KLHKDGKLNQLVDKDLGVNFDRIELEEMVKVSLLCTKFNPLERPKMSEVLRMLEGDGLAE  578

Query  204  KWEASQRAETPRH---GNTVPQRYYDLIEESSLVVEAMELSGPR  82
            KWEASQ+ ETPR     N  P RY D IEESSLVVEAMELSGPR
Sbjct  579  KWEASQKVETPRFRSCENPTP-RYSDFIEESSLVVEAMELSGPR  621



>ref|XP_008812173.1| PREDICTED: protein NSP-INTERACTING KINASE 3 [Phoenix dactylifera]
Length=629

 Score =   374 bits (959),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 180/223 (81%), Positives = 202/223 (91%), Gaps = 2/223 (1%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RK IALG ARGL+YLHEQCDPKIIHRDVKAANILLDE FEAVVGDFGLAKLLDHRESHV+
Sbjct  407  RKMIALGTARGLLYLHEQCDPKIIHRDVKAANILLDEEFEAVVGDFGLAKLLDHRESHVT  466

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFG+LLLELITGQKA++FG+  NQK VMLD VK
Sbjct  467  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGVLLLELITGQKALDFGRLANQKGVMLDWVK  526

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            +LHQE KLS+MVDKDL  N+DR+ELEEMVQVALLCTQ++P HRPKMSEV+RMLEGDGLAE
Sbjct  527  KLHQENKLSMMVDKDLKNNYDRVELEEMVQVALLCTQYHPSHRPKMSEVVRMLEGDGLAE  586

Query  204  KWEASQRAETPRHGNT--VPQRYYDLIEESSLVVEAMELSGPR  82
            KWEASQ+ + P+  ++   P RY D +EESSLVV+A+ELSGPR
Sbjct  587  KWEASQKIDAPKSLSSEQPPPRYLDFVEESSLVVDAIELSGPR  629



>ref|XP_004489819.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like [Cicer arietinum]
Length=625

 Score =   372 bits (955),  Expect = 9e-122, Method: Compositional matrix adjust.
 Identities = 184/223 (83%), Positives = 197/223 (88%), Gaps = 2/223 (1%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RKRIALG ARGLVYLHEQCDPKIIHRDVKAANILLDE FEAVVGDFGLAKLLDHR++HV+
Sbjct  403  RKRIALGTARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRDTHVT  462

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELITG KA++FG+  NQK VMLD VK
Sbjct  463  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGHKALDFGRAANQKGVMLDWVK  522

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            +LH E +LS MVDKDL   FD +EL EMVQVALLCTQFNP HRPKMSEVL+MLEGDGLAE
Sbjct  523  KLHLEGRLSQMVDKDLKGIFDIVELGEMVQVALLCTQFNPSHRPKMSEVLKMLEGDGLAE  582

Query  204  KWEASQRAETPRH--GNTVPQRYYDLIEESSLVVEAMELSGPR  82
            +WEASQR ETPR       PQRY D IEESSL+VEAMELSGPR
Sbjct  583  RWEASQRIETPRFRLCENPPQRYSDFIEESSLIVEAMELSGPR  625



>ref|XP_009596637.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like [Nicotiana tomentosiformis]
Length=601

 Score =   371 bits (952),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 187/224 (83%), Positives = 198/224 (88%), Gaps = 4/224 (2%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RK IA G ARGLVYLHEQCDPKIIHRDVKAANILLDE FEAVVGDFGLAKLLDHR+SHV+
Sbjct  379  RKTIAQGTARGLVYLHEQCDPKIIHRDVKAANILLDEEFEAVVGDFGLAKLLDHRDSHVT  438

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQK-VVMLDLV  388
            TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKA++FG+G NQK VVMLD V
Sbjct  439  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAMDFGRGANQKGVVMLDWV  498

Query  387  KRLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLA  208
            K LHQE K +LMVDKDL  NFDRIELEEMV+VALLCTQFNP HRPKMSE LRMLEGDGLA
Sbjct  499  KELHQEGKSNLMVDKDLKNNFDRIELEEMVKVALLCTQFNPSHRPKMSEALRMLEGDGLA  558

Query  207  EKWEASQRAETPRH--GNTVPQRYYDLIEESSLVVEAMELSGPR  82
            EKWEASQ+ E PR+      PQRY + +EESSL VE MELSGPR
Sbjct  559  EKWEASQKLEAPRNRAFEHTPQRYSNYVEESSL-VEPMELSGPR  601



>ref|XP_011070875.1| PREDICTED: protein NSP-INTERACTING KINASE 2-like [Sesamum indicum]
Length=623

 Score =   371 bits (953),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 180/224 (80%), Positives = 202/224 (90%), Gaps = 3/224 (1%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RKRIALG ARGL+YLHEQCDPKIIHRDVKAANILLDEY+EAVVGDFGLAKLLDHR+SHV+
Sbjct  400  RKRIALGAARGLLYLHEQCDPKIIHRDVKAANILLDEYYEAVVGDFGLAKLLDHRDSHVT  459

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A+EFGK  NQK  MLD VK
Sbjct  460  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQRALEFGKAANQKGAMLDWVK  519

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            ++HQE+KL ++VDKDL  N+DRIELEEMVQVALLCTQ+ P HRPKMSEV+RMLEGDGLAE
Sbjct  520  KIHQEKKLDMLVDKDLRNNYDRIELEEMVQVALLCTQYLPNHRPKMSEVVRMLEGDGLAE  579

Query  204  KWEASQRAETPR---HGNTVPQRYYDLIEESSLVVEAMELSGPR  82
            KWEASQRAE  R   +  +  +RY DL ++SSL+V+AMELSGPR
Sbjct  580  KWEASQRAEVTRCRANEFSSSERYSDLTDDSSLLVQAMELSGPR  623



>emb|CAN63733.1| hypothetical protein VITISV_025883 [Vitis vinifera]
Length=609

 Score =   370 bits (950),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 178/224 (79%), Positives = 201/224 (90%), Gaps = 3/224 (1%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RKRIALG ARGL+YLHEQCDPKIIHRDVKAANILLD+Y EAVVGDFGLAKLLDHR+SHV+
Sbjct  386  RKRIALGAARGLLYLHEQCDPKIIHRDVKAANILLDDYCEAVVGDFGLAKLLDHRDSHVT  445

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A+EFGK  NQK  MLD VK
Sbjct  446  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQRALEFGKAANQKGAMLDWVK  505

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            ++HQE+KL ++VDKDL  N+DRIELEEMVQVALLCTQ+ P HRPKMSEV+RMLEGDGLAE
Sbjct  506  KIHQEKKLDMLVDKDLKANYDRIELEEMVQVALLCTQYLPSHRPKMSEVVRMLEGDGLAE  565

Query  204  KWEASQRAETPR---HGNTVPQRYYDLIEESSLVVEAMELSGPR  82
            KWEA+QRAE  R   +  +  +RY DL ++SSL+V+AMELSGPR
Sbjct  566  KWEATQRAEATRCKANEFSSSERYSDLTDDSSLLVQAMELSGPR  609



>ref|XP_009390158.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=659

 Score =   371 bits (953),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 180/223 (81%), Positives = 200/223 (90%), Gaps = 2/223 (1%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RKRIALG ARGL+YLHEQCDPKIIHRDVKAANILLDE FEAVVGDFGLAKLLDHRESHV+
Sbjct  437  RKRIALGTARGLLYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVT  496

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKA++FG+ TNQK VMLD VK
Sbjct  497  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRLTNQKGVMLDWVK  556

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            +LHQE KL +MVDKDL  N++R+ELEEM+QVALLCTQF+P  RPKMSEV+RMLEGDGLAE
Sbjct  557  KLHQENKLYMMVDKDLKNNYNRVELEEMIQVALLCTQFHPSQRPKMSEVVRMLEGDGLAE  616

Query  204  KWEASQRAETP--RHGNTVPQRYYDLIEESSLVVEAMELSGPR  82
            KWEASQR +TP  R    +  +Y D +E+SS VVEA+ELSGPR
Sbjct  617  KWEASQRMDTPKSRSSEQLTPKYIDFMEDSSFVVEAIELSGPR  659



>ref|XP_002269902.1| PREDICTED: protein NSP-INTERACTING KINASE 1 [Vitis vinifera]
 emb|CBI27432.3| unnamed protein product [Vitis vinifera]
Length=625

 Score =   370 bits (949),  Expect = 7e-121, Method: Compositional matrix adjust.
 Identities = 178/224 (79%), Positives = 201/224 (90%), Gaps = 3/224 (1%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RKRIALG ARGL+YLHEQCDPKIIHRDVKAANILLD+Y EAVVGDFGLAKLLDHR+SHV+
Sbjct  402  RKRIALGAARGLLYLHEQCDPKIIHRDVKAANILLDDYCEAVVGDFGLAKLLDHRDSHVT  461

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A+EFGK  NQK  MLD VK
Sbjct  462  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQRALEFGKAANQKGAMLDWVK  521

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            ++HQE+KL ++VDKDL  N+DRIELEEMVQVALLCTQ+ P HRPKMSEV+RMLEGDGLAE
Sbjct  522  KIHQEKKLDMLVDKDLKANYDRIELEEMVQVALLCTQYLPSHRPKMSEVVRMLEGDGLAE  581

Query  204  KWEASQRAETPR---HGNTVPQRYYDLIEESSLVVEAMELSGPR  82
            KWEA+QRAE  R   +  +  +RY DL ++SSL+V+AMELSGPR
Sbjct  582  KWEATQRAEATRCKANEFSSSERYSDLTDDSSLLVQAMELSGPR  625



>ref|XP_009390157.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009390159.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009390160.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=665

 Score =   371 bits (952),  Expect = 7e-121, Method: Compositional matrix adjust.
 Identities = 180/223 (81%), Positives = 200/223 (90%), Gaps = 2/223 (1%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RKRIALG ARGL+YLHEQCDPKIIHRDVKAANILLDE FEAVVGDFGLAKLLDHRESHV+
Sbjct  443  RKRIALGTARGLLYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVT  502

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKA++FG+ TNQK VMLD VK
Sbjct  503  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRLTNQKGVMLDWVK  562

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            +LHQE KL +MVDKDL  N++R+ELEEM+QVALLCTQF+P  RPKMSEV+RMLEGDGLAE
Sbjct  563  KLHQENKLYMMVDKDLKNNYNRVELEEMIQVALLCTQFHPSQRPKMSEVVRMLEGDGLAE  622

Query  204  KWEASQRAETP--RHGNTVPQRYYDLIEESSLVVEAMELSGPR  82
            KWEASQR +TP  R    +  +Y D +E+SS VVEA+ELSGPR
Sbjct  623  KWEASQRMDTPKSRSSEQLTPKYIDFMEDSSFVVEAIELSGPR  665



>ref|XP_002532890.1| BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1 precursor, 
putative [Ricinus communis]
 gb|EEF29495.1| BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1 precursor, 
putative [Ricinus communis]
Length=624

 Score =   369 bits (948),  Expect = 9e-121, Method: Compositional matrix adjust.
 Identities = 178/224 (79%), Positives = 202/224 (90%), Gaps = 3/224 (1%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RKRIALG ARGL+YLHEQCDPKIIHRDVKAANILLD+Y EAVVGDFGLAKLLDH++SHV+
Sbjct  401  RKRIALGAARGLLYLHEQCDPKIIHRDVKAANILLDDYCEAVVGDFGLAKLLDHQDSHVT  460

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A+EFGK  NQK  MLD VK
Sbjct  461  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQRALEFGKAANQKGAMLDWVK  520

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            ++HQE+KL ++VDKDL +N+DRIELEEMVQVALLCTQF P HRPKMSEV+RMLEGDGLAE
Sbjct  521  KIHQEKKLEMLVDKDLKSNYDRIELEEMVQVALLCTQFLPSHRPKMSEVVRMLEGDGLAE  580

Query  204  KWEASQRAETPR---HGNTVPQRYYDLIEESSLVVEAMELSGPR  82
            +WEASQRAE+ +   H  +   RY DL ++SSL+V+AMELSGPR
Sbjct  581  RWEASQRAESTKSKLHEFSSSDRYSDLTDDSSLLVQAMELSGPR  624



>ref|XP_006844161.1| hypothetical protein AMTR_s00006p00261510 [Amborella trichopoda]
 gb|ERN05836.1| hypothetical protein AMTR_s00006p00261510 [Amborella trichopoda]
Length=620

 Score =   369 bits (947),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 178/223 (80%), Positives = 200/223 (90%), Gaps = 2/223 (1%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RKRIALG ARGL+YLHEQCDPKIIHRDVKAANILLD+Y EAVVGDFGLAKLLDHR+SHV+
Sbjct  398  RKRIALGAARGLLYLHEQCDPKIIHRDVKAANILLDDYCEAVVGDFGLAKLLDHRDSHVT  457

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKA+EFGK  NQK  MLD VK
Sbjct  458  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKALEFGKAANQKGAMLDWVK  517

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            ++HQE+KL L+VDKDL  N+DRIELEEMVQVALLCTQ+ P HRPKMSEV+RMLEGDGLAE
Sbjct  518  KIHQEKKLDLLVDKDLKINYDRIELEEMVQVALLCTQYLPGHRPKMSEVVRMLEGDGLAE  577

Query  204  KWEASQRAETP--RHGNTVPQRYYDLIEESSLVVEAMELSGPR  82
            +WEASQR++T   R  +   +RY DL ++SSL+ +AMELSGPR
Sbjct  578  RWEASQRSDTSKFRGSDLSSERYSDLTDDSSLLAQAMELSGPR  620



>ref|XP_010257839.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Nelumbo nucifera]
Length=624

 Score =   368 bits (945),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 178/224 (79%), Positives = 202/224 (90%), Gaps = 3/224 (1%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RKRIALG ARGL+YLHEQCDPKIIHRDVKAANILLD+Y EAVVGDFGLAKLLDH++SHV+
Sbjct  401  RKRIALGAARGLLYLHEQCDPKIIHRDVKAANILLDDYCEAVVGDFGLAKLLDHQDSHVT  460

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A+EFGK  NQK  MLD VK
Sbjct  461  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQRALEFGKAANQKGAMLDWVK  520

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            ++HQE+KL ++VDKDL  N+DRIELEEMVQVALLCTQ+ P HRPKMSEV+RMLEGDGLAE
Sbjct  521  KIHQEKKLDMLVDKDLKDNYDRIELEEMVQVALLCTQYLPGHRPKMSEVVRMLEGDGLAE  580

Query  204  KWEASQRAETPR---HGNTVPQRYYDLIEESSLVVEAMELSGPR  82
            +WEASQRAET +   H  +  +RY DL ++SSL+V+AMELSGPR
Sbjct  581  RWEASQRAETTKCKPHEFSSSERYSDLTDDSSLLVQAMELSGPR  624



>ref|XP_006593318.1| PREDICTED: NSP-interacting kinase isoform X2 [Glycine max]
Length=510

 Score =   364 bits (935),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 179/227 (79%), Positives = 201/227 (89%), Gaps = 9/227 (4%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RK+IALG ARGL+YLHEQCDPKIIHRDVKAANILLD+Y EAVVGDFGLAKLLDH++SHV+
Sbjct  287  RKQIALGAARGLLYLHEQCDPKIIHRDVKAANILLDDYCEAVVGDFGLAKLLDHQDSHVT  346

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A+EFGK  NQK  MLD V+
Sbjct  347  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQRALEFGKAANQKGAMLDWVR  406

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            +LHQE+KL L+VDKDL TN+DRIELEE+VQVALLCTQ+ P HRPKMSEV+RMLEGDGLAE
Sbjct  407  KLHQEKKLELLVDKDLKTNYDRIELEEIVQVALLCTQYLPGHRPKMSEVVRMLEGDGLAE  466

Query  204  KWEASQRAETPRHGNTVPQ------RYYDLIEESSLVVEAMELSGPR  82
            KWEASQ A+T    N  PQ      RY DL ++SSL+V+AMELSGPR
Sbjct  467  KWEASQSADT---SNCKPQELSSSDRYSDLTDDSSLLVQAMELSGPR  510



>ref|XP_003637897.1| Receptor-like kinase [Medicago truncatula]
Length=496

 Score =   363 bits (933),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 174/224 (78%), Positives = 200/224 (89%), Gaps = 3/224 (1%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RKRIALG  RGL+YLHEQCDPKIIHRDVKAANILLD+Y EAVVGDFGLAKLLDHR+SHV+
Sbjct  273  RKRIALGAGRGLLYLHEQCDPKIIHRDVKAANILLDDYCEAVVGDFGLAKLLDHRDSHVT  332

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELI+GQ+A+EFGK  NQK  MLD VK
Sbjct  333  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELISGQRALEFGKAANQKGAMLDWVK  392

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            ++HQE+K+ ++VDKDL   +DRIEL+E+VQVALLCTQ+ P HRPKMSEV+RMLEGDGLAE
Sbjct  393  KIHQEKKIDVLVDKDLKNKYDRIELDEIVQVALLCTQYLPSHRPKMSEVVRMLEGDGLAE  452

Query  204  KWEASQRAETPR-HGN--TVPQRYYDLIEESSLVVEAMELSGPR  82
            KWEASQRAE+ R  GN  +  +RY DL ++SSL+ +AMELSGPR
Sbjct  453  KWEASQRAESTRSRGNELSSSERYSDLTDDSSLLAQAMELSGPR  496



>ref|XP_008446509.1| PREDICTED: protein NSP-INTERACTING KINASE 2 isoform X3 [Cucumis 
melo]
Length=510

 Score =   364 bits (934),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 176/224 (79%), Positives = 200/224 (89%), Gaps = 3/224 (1%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RKRIALG ARGL+YLHEQCDPKIIHRDVKAANILLD+Y EAVVGDFGLAKLLDHR+SHV+
Sbjct  287  RKRIALGAARGLLYLHEQCDPKIIHRDVKAANILLDDYCEAVVGDFGLAKLLDHRDSHVT  346

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFG+GILLLELITGQ+A+EFGK  NQK  MLD VK
Sbjct  347  TAVRGTVGHIAPEYLSTGQSSEKTDVFGYGILLLELITGQRALEFGKAVNQKGAMLDWVK  406

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            ++HQE+KL L+VDKDL +N+DRIELEEMVQVALLCTQ+ P  RPKMSEV+RMLEGDGLAE
Sbjct  407  KIHQEKKLELLVDKDLRSNYDRIELEEMVQVALLCTQYLPTTRPKMSEVVRMLEGDGLAE  466

Query  204  KWEASQRAETPRHG---NTVPQRYYDLIEESSLVVEAMELSGPR  82
            KWEASQRA+  R+     +  +RY DL ++SSL+ +AMELSGPR
Sbjct  467  KWEASQRADANRYRVNEFSSSERYSDLTDDSSLLAQAMELSGPR  510



>ref|XP_006356418.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006356419.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X2 [Solanum 
tuberosum]
 ref|XP_006356420.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X3 [Solanum 
tuberosum]
Length=600

 Score =   367 bits (941),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 182/224 (81%), Positives = 198/224 (88%), Gaps = 4/224 (2%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RK+IA G ARGLVYLHEQCDPKIIHRDVKAANILLDE FEAVVGDFGLAKLLDH +SHV+
Sbjct  378  RKKIAQGTARGLVYLHEQCDPKIIHRDVKAANILLDEEFEAVVGDFGLAKLLDHHDSHVT  437

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQK-VVMLDLV  388
            TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKA++FG+G NQK VVMLD V
Sbjct  438  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAMDFGRGANQKGVVMLDWV  497

Query  387  KRLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLA  208
            + LHQE KL+LMVD +L  NFD+IELEEMV+VALLCT FNP HRPKMSE LRMLEGDGLA
Sbjct  498  RNLHQEEKLNLMVDSNLKNNFDQIELEEMVKVALLCTHFNPSHRPKMSEALRMLEGDGLA  557

Query  207  EKWEASQRAETPRH--GNTVPQRYYDLIEESSLVVEAMELSGPR  82
            EKWEASQ+ ETPR+      PQRY + +E+SSL VE MELSGPR
Sbjct  558  EKWEASQKLETPRNRAFEHTPQRYSNFVEDSSL-VEPMELSGPR  600



>ref|XP_002455108.1| hypothetical protein SORBIDRAFT_03g004450 [Sorghum bicolor]
 gb|EES00228.1| hypothetical protein SORBIDRAFT_03g004450 [Sorghum bicolor]
Length=615

 Score =   367 bits (942),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 173/224 (77%), Positives = 205/224 (92%), Gaps = 3/224 (1%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RKRIALG ARGL+YLHEQCDPKIIHRDVKA+N+LLDEYFEA+VGDFGLAKLLDHRESHV+
Sbjct  392  RKRIALGTARGLLYLHEQCDPKIIHRDVKASNVLLDEYFEAIVGDFGLAKLLDHRESHVT  451

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFG+LL+ELITGQKA++FG+  NQK  +LD VK
Sbjct  452  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGVLLVELITGQKALDFGRVANQKGGVLDWVK  511

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            +LHQE++L++MVDKDLG+N+DR+ELEEMVQVALLCTQ++P HRP+MSEV+RMLEGDGLAE
Sbjct  512  KLHQEKQLNMMVDKDLGSNYDRVELEEMVQVALLCTQYHPSHRPRMSEVIRMLEGDGLAE  571

Query  204  KWEASQRAETPRHGNT--VPQRYYDL-IEESSLVVEAMELSGPR  82
            KWEASQ  +TP+  ++  +P +Y D   +ESSL +EAMELSGPR
Sbjct  572  KWEASQNVDTPKSVSSEILPPKYMDFAADESSLGLEAMELSGPR  615



>ref|XP_010261784.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X2 [Nelumbo 
nucifera]
Length=550

 Score =   364 bits (935),  Expect = 9e-120, Method: Compositional matrix adjust.
 Identities = 175/224 (78%), Positives = 200/224 (89%), Gaps = 3/224 (1%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RKRIALG ARGL+YLHEQCDPKIIHRDVKAANILLD+Y EAVVGDFGLAKLLDHR+SHV+
Sbjct  327  RKRIALGAARGLLYLHEQCDPKIIHRDVKAANILLDDYCEAVVGDFGLAKLLDHRDSHVT  386

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A++FGK  NQK  MLD VK
Sbjct  387  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQRALDFGKAANQKGAMLDWVK  446

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            ++HQE+KL  +VDKD+  N+DR+ELEEMVQVALLCTQ+ P HRPKMSEV+RMLEGDGLAE
Sbjct  447  KIHQEKKLDALVDKDMKNNYDRVELEEMVQVALLCTQYLPGHRPKMSEVVRMLEGDGLAE  506

Query  204  KWEASQRAETPR---HGNTVPQRYYDLIEESSLVVEAMELSGPR  82
            +WEASQRAE  +   H  +  +RY DL ++SSL+V+AMELSGPR
Sbjct  507  RWEASQRAEATKCKPHEFSSSERYSDLTDDSSLLVQAMELSGPR  550



>emb|CDP00520.1| unnamed protein product [Coffea canephora]
Length=623

 Score =   367 bits (941),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 178/224 (79%), Positives = 200/224 (89%), Gaps = 3/224 (1%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RKRIALG ARGL+YLHEQCDPKIIHRDVKAANILLD+Y EAVVGDFGLAKLLDHR+SHV+
Sbjct  400  RKRIALGAARGLLYLHEQCDPKIIHRDVKAANILLDDYCEAVVGDFGLAKLLDHRDSHVT  459

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A+EFGK  NQK  MLD VK
Sbjct  460  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQRALEFGKAANQKGAMLDWVK  519

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            ++HQE+KL L+VDKDL  ++DRIELEEM QVALLCTQ+ P HRPKMSEV+RMLEGDGLAE
Sbjct  520  KIHQEKKLELLVDKDLKNSYDRIELEEMAQVALLCTQYLPSHRPKMSEVVRMLEGDGLAE  579

Query  204  KWEASQRAETPR---HGNTVPQRYYDLIEESSLVVEAMELSGPR  82
            KWEASQRAE  R   +  +  +RY DL ++SSL+V+AMELSGPR
Sbjct  580  KWEASQRAEATRCRANEFSSSERYSDLTDDSSLLVQAMELSGPR  623



>ref|XP_006643812.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like [Oryza brachyantha]
Length=590

 Score =   365 bits (938),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 173/224 (77%), Positives = 204/224 (91%), Gaps = 3/224 (1%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RKRIALG ARGL+YLHEQCDPKIIHRDVKA+N+LLDEYFEA+VGDFGLAKLLDHRESHV+
Sbjct  367  RKRIALGTARGLLYLHEQCDPKIIHRDVKASNVLLDEYFEAIVGDFGLAKLLDHRESHVT  426

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFG+LL+ELITGQKA++FG+  NQK  +LD VK
Sbjct  427  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGVLLVELITGQKALDFGRIANQKGGVLDWVK  486

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            +LHQE++LS+MVDKDLG+N+DR+ELEEMVQVALLCTQ+ P HRP+MSEV+RMLEGDGLAE
Sbjct  487  KLHQEKQLSMMVDKDLGSNYDRVELEEMVQVALLCTQYYPSHRPRMSEVIRMLEGDGLAE  546

Query  204  KWEASQRAETPRHGNT--VPQRYYDL-IEESSLVVEAMELSGPR  82
            KWEASQ  +TP+  ++  +P ++ D   +ESSL +EAMELSGPR
Sbjct  547  KWEASQNVDTPKSVSSELLPPKFMDFAADESSLGLEAMELSGPR  590



>dbj|BAD68255.1| putative brassinosteroid insensitive 1-associated receptor kinase 
1 [Oryza sativa Japonica Group]
 dbj|BAE96298.1| SERK like protein kinase [Oryza sativa Japonica Group]
 gb|EAZ10713.1| hypothetical protein OsJ_00547 [Oryza sativa Japonica Group]
 dbj|BAG94399.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC70017.1| hypothetical protein OsI_00578 [Oryza sativa Indica Group]
Length=628

 Score =   366 bits (940),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 173/224 (77%), Positives = 204/224 (91%), Gaps = 3/224 (1%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RKRIALG ARGL+YLHEQCDPKIIHRDVKA+N+LLDEYFEA+VGDFGLAKLLDHRESHV+
Sbjct  405  RKRIALGTARGLLYLHEQCDPKIIHRDVKASNVLLDEYFEAIVGDFGLAKLLDHRESHVT  464

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFG+LL+ELITGQKA++FG+  NQK  +LD VK
Sbjct  465  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGVLLVELITGQKALDFGRLANQKGGVLDWVK  524

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            +LHQE++LS+MVDKDLG+N+DR+ELEEMVQVALLCTQ+ P HRP+MSEV+RMLEGDGLAE
Sbjct  525  KLHQEKQLSMMVDKDLGSNYDRVELEEMVQVALLCTQYYPSHRPRMSEVIRMLEGDGLAE  584

Query  204  KWEASQRAETPRHGNT--VPQRYYDL-IEESSLVVEAMELSGPR  82
            KWEASQ  +TP+  ++  +P ++ D   +ESSL +EAMELSGPR
Sbjct  585  KWEASQNVDTPKSVSSELLPPKFMDFAADESSLGLEAMELSGPR  628



>ref|XP_004968347.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like [Setaria italica]
Length=633

 Score =   366 bits (939),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 173/224 (77%), Positives = 204/224 (91%), Gaps = 3/224 (1%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RKRIALG ARGL+YLHEQCDPKIIHRDVKA+N+LLDEYFEA+VGDFGLAKLLDH+ESHV+
Sbjct  410  RKRIALGTARGLLYLHEQCDPKIIHRDVKASNVLLDEYFEAIVGDFGLAKLLDHQESHVT  469

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFG+LL+ELITGQKA++FG+  NQK  +LD VK
Sbjct  470  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGVLLVELITGQKALDFGRVANQKGGVLDWVK  529

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            +LHQE++LS+MVDKDLG+N+DR+ELEEMVQVALLCTQ+ P HRP+MSEV+RMLEGDGLAE
Sbjct  530  KLHQEKQLSMMVDKDLGSNYDRVELEEMVQVALLCTQYYPSHRPRMSEVIRMLEGDGLAE  589

Query  204  KWEASQRAETPRHGNT--VPQRYYDL-IEESSLVVEAMELSGPR  82
            KWEASQ  +TP+  ++  +P +Y D   +ESSL +EAMELSGPR
Sbjct  590  KWEASQNVDTPKSVSSELLPPKYMDFAADESSLGLEAMELSGPR  633



>gb|KJB43139.1| hypothetical protein B456_007G186300 [Gossypium raimondii]
Length=475

 Score =   361 bits (926),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 174/225 (77%), Positives = 198/225 (88%), Gaps = 4/225 (2%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RKRIALG  RGL+YLHEQCDPKIIHRDVKAANILLD+Y EAVVGDFGLAKLLDH +SHV+
Sbjct  251  RKRIALGAGRGLLYLHEQCDPKIIHRDVKAANILLDDYCEAVVGDFGLAKLLDHHDSHVT  310

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSS+KTDVFGFGILLLELITGQ+A+EFGK  NQK  MLD V+
Sbjct  311  TAVRGTVGHIAPEYLSTGQSSDKTDVFGFGILLLELITGQRALEFGKAANQKGAMLDWVR  370

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            ++H E+KL ++VDKDL  N+DRIELEEMVQVALLCTQ+ P HRPKMSEV+RMLEGDGLAE
Sbjct  371  KIHHEKKLEVLVDKDLKNNYDRIELEEMVQVALLCTQYLPGHRPKMSEVVRMLEGDGLAE  430

Query  204  KWEASQRAET----PRHGNTVPQRYYDLIEESSLVVEAMELSGPR  82
            +WEASQRAE+    P H  +   RY DL ++SSL+V+AMELSGPR
Sbjct  431  RWEASQRAESTKCKPPHEFSSSDRYSDLTDDSSLLVQAMELSGPR  475



>ref|XP_006603947.1| PREDICTED: protein NSP-INTERACTING KINASE 1 isoform X2 [Glycine 
max]
Length=510

 Score =   362 bits (929),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 178/227 (78%), Positives = 201/227 (89%), Gaps = 9/227 (4%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RK+IALG ARGL+YLHEQCDPKIIHRDVKAANILLD+Y EAVVGDFGLAKLLDH++SHV+
Sbjct  287  RKQIALGAARGLLYLHEQCDPKIIHRDVKAANILLDDYCEAVVGDFGLAKLLDHQDSHVT  346

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A+EFGK  NQK  MLD V+
Sbjct  347  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQRALEFGKAANQKGAMLDWVR  406

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            +LHQE+KL L+VDKDL TN+DRIELEE+VQVALLCTQ+ P HRPKMSEV+RMLEGDGLAE
Sbjct  407  KLHQEKKLELLVDKDLKTNYDRIELEEIVQVALLCTQYLPGHRPKMSEVVRMLEGDGLAE  466

Query  204  KWEASQRAETPRHGNTVPQ------RYYDLIEESSLVVEAMELSGPR  82
            KWEASQ A+T +     PQ      RY DL ++SSL+V+AMELSGPR
Sbjct  467  KWEASQSADTTK---CKPQELSSSDRYSDLTDDSSLLVQAMELSGPR  510



>ref|XP_011020829.1| PREDICTED: protein NSP-INTERACTING KINASE 2-like [Populus euphratica]
Length=622

 Score =   365 bits (938),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 177/224 (79%), Positives = 201/224 (90%), Gaps = 3/224 (1%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RKRIALG ARGL+YLHEQCDPKIIHRDVKAANILLD+Y EAVVGDFGLAKLLDHR+SHV+
Sbjct  399  RKRIALGAARGLLYLHEQCDPKIIHRDVKAANILLDDYCEAVVGDFGLAKLLDHRDSHVT  458

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELI+G +A+EFGK TNQK  +LD VK
Sbjct  459  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELISGLRALEFGKSTNQKGALLDWVK  518

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            ++HQE+KL L+VDKDL  N+DRIELEE+VQVALLCTQ+ P HRPKMSEV+RMLEGDGLAE
Sbjct  519  KIHQEKKLELLVDKDLKNNYDRIELEEIVQVALLCTQYLPSHRPKMSEVVRMLEGDGLAE  578

Query  204  KWEASQRAETPR---HGNTVPQRYYDLIEESSLVVEAMELSGPR  82
            KWEASQRAE  R   +  +  +RY DL ++SSL+V+AMELSGPR
Sbjct  579  KWEASQRAEETRSRANEFSSSERYSDLTDDSSLLVQAMELSGPR  622



>ref|XP_008797566.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Phoenix dactylifera]
Length=624

 Score =   365 bits (937),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 176/224 (79%), Positives = 199/224 (89%), Gaps = 3/224 (1%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RKRIALG ARGL+YLHEQCDPKIIHRDVKAANILLD+Y EAVVGDFGLAKLLDHRESHV+
Sbjct  401  RKRIALGAARGLLYLHEQCDPKIIHRDVKAANILLDDYCEAVVGDFGLAKLLDHRESHVT  460

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELITG +A+EFGK  NQK  MLD VK
Sbjct  461  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGLRAMEFGKAANQKGAMLDWVK  520

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            ++HQE+KL ++VDKDL  ++DRIELEE VQVALLCTQ+ P HRPKMSEV+RMLEGDGLAE
Sbjct  521  KIHQEKKLDMLVDKDLKNDYDRIELEETVQVALLCTQYLPSHRPKMSEVVRMLEGDGLAE  580

Query  204  KWEASQRAETPRHGN---TVPQRYYDLIEESSLVVEAMELSGPR  82
            +WEASQRAE P+      +  +RY DL ++SSL+V+AMELSGPR
Sbjct  581  RWEASQRAEAPKFKMPEVSSSERYSDLTDDSSLLVQAMELSGPR  624



>ref|XP_010261776.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X1 [Nelumbo 
nucifera]
Length=623

 Score =   365 bits (936),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 175/224 (78%), Positives = 200/224 (89%), Gaps = 3/224 (1%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RKRIALG ARGL+YLHEQCDPKIIHRDVKAANILLD+Y EAVVGDFGLAKLLDHR+SHV+
Sbjct  400  RKRIALGAARGLLYLHEQCDPKIIHRDVKAANILLDDYCEAVVGDFGLAKLLDHRDSHVT  459

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A++FGK  NQK  MLD VK
Sbjct  460  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQRALDFGKAANQKGAMLDWVK  519

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            ++HQE+KL  +VDKD+  N+DR+ELEEMVQVALLCTQ+ P HRPKMSEV+RMLEGDGLAE
Sbjct  520  KIHQEKKLDALVDKDMKNNYDRVELEEMVQVALLCTQYLPGHRPKMSEVVRMLEGDGLAE  579

Query  204  KWEASQRAETPR---HGNTVPQRYYDLIEESSLVVEAMELSGPR  82
            +WEASQRAE  +   H  +  +RY DL ++SSL+V+AMELSGPR
Sbjct  580  RWEASQRAEATKCKPHEFSSSERYSDLTDDSSLLVQAMELSGPR  623



>ref|XP_008446507.1| PREDICTED: protein NSP-INTERACTING KINASE 1 isoform X1 [Cucumis 
melo]
Length=624

 Score =   365 bits (936),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 176/224 (79%), Positives = 200/224 (89%), Gaps = 3/224 (1%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RKRIALG ARGL+YLHEQCDPKIIHRDVKAANILLD+Y EAVVGDFGLAKLLDHR+SHV+
Sbjct  401  RKRIALGAARGLLYLHEQCDPKIIHRDVKAANILLDDYCEAVVGDFGLAKLLDHRDSHVT  460

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFG+GILLLELITGQ+A+EFGK  NQK  MLD VK
Sbjct  461  TAVRGTVGHIAPEYLSTGQSSEKTDVFGYGILLLELITGQRALEFGKAVNQKGAMLDWVK  520

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            ++HQE+KL L+VDKDL +N+DRIELEEMVQVALLCTQ+ P  RPKMSEV+RMLEGDGLAE
Sbjct  521  KIHQEKKLELLVDKDLRSNYDRIELEEMVQVALLCTQYLPTTRPKMSEVVRMLEGDGLAE  580

Query  204  KWEASQRAETPRH---GNTVPQRYYDLIEESSLVVEAMELSGPR  82
            KWEASQRA+  R+     +  +RY DL ++SSL+ +AMELSGPR
Sbjct  581  KWEASQRADANRYRVNEFSSSERYSDLTDDSSLLAQAMELSGPR  624



>gb|KEH17048.1| NSP-interacting kinase-like protein [Medicago truncatula]
Length=558

 Score =   363 bits (931),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 174/224 (78%), Positives = 200/224 (89%), Gaps = 3/224 (1%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RKRIALG  RGL+YLHEQCDPKIIHRDVKAANILLD+Y EAVVGDFGLAKLLDHR+SHV+
Sbjct  335  RKRIALGAGRGLLYLHEQCDPKIIHRDVKAANILLDDYCEAVVGDFGLAKLLDHRDSHVT  394

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELI+GQ+A+EFGK  NQK  MLD VK
Sbjct  395  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELISGQRALEFGKAANQKGAMLDWVK  454

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            ++HQE+K+ ++VDKDL   +DRIEL+E+VQVALLCTQ+ P HRPKMSEV+RMLEGDGLAE
Sbjct  455  KIHQEKKIDVLVDKDLKNKYDRIELDEIVQVALLCTQYLPSHRPKMSEVVRMLEGDGLAE  514

Query  204  KWEASQRAETPR-HGN--TVPQRYYDLIEESSLVVEAMELSGPR  82
            KWEASQRAE+ R  GN  +  +RY DL ++SSL+ +AMELSGPR
Sbjct  515  KWEASQRAESTRSRGNELSSSERYSDLTDDSSLLAQAMELSGPR  558



>ref|XP_008446508.1| PREDICTED: protein NSP-INTERACTING KINASE 1 isoform X2 [Cucumis 
melo]
Length=622

 Score =   364 bits (935),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 176/224 (79%), Positives = 200/224 (89%), Gaps = 3/224 (1%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RKRIALG ARGL+YLHEQCDPKIIHRDVKAANILLD+Y EAVVGDFGLAKLLDHR+SHV+
Sbjct  399  RKRIALGAARGLLYLHEQCDPKIIHRDVKAANILLDDYCEAVVGDFGLAKLLDHRDSHVT  458

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFG+GILLLELITGQ+A+EFGK  NQK  MLD VK
Sbjct  459  TAVRGTVGHIAPEYLSTGQSSEKTDVFGYGILLLELITGQRALEFGKAVNQKGAMLDWVK  518

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            ++HQE+KL L+VDKDL +N+DRIELEEMVQVALLCTQ+ P  RPKMSEV+RMLEGDGLAE
Sbjct  519  KIHQEKKLELLVDKDLRSNYDRIELEEMVQVALLCTQYLPTTRPKMSEVVRMLEGDGLAE  578

Query  204  KWEASQRAETPRH---GNTVPQRYYDLIEESSLVVEAMELSGPR  82
            KWEASQRA+  R+     +  +RY DL ++SSL+ +AMELSGPR
Sbjct  579  KWEASQRADANRYRVNEFSSSERYSDLTDDSSLLAQAMELSGPR  622



>ref|XP_006574993.1| PREDICTED: protein NSP-INTERACTING KINASE 2-like isoform X1 [Glycine 
max]
 ref|XP_006574994.1| PREDICTED: protein NSP-INTERACTING KINASE 2-like isoform X2 [Glycine 
max]
Length=621

 Score =   364 bits (935),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 175/224 (78%), Positives = 200/224 (89%), Gaps = 3/224 (1%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RKRIALG  RGL+YLHEQCDPKIIHRDVKAANILLD+Y EAVVGDFGLAKLLDHR+SHV+
Sbjct  398  RKRIALGAGRGLLYLHEQCDPKIIHRDVKAANILLDDYCEAVVGDFGLAKLLDHRDSHVT  457

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELI+GQ+A+EFGK  NQK  MLD VK
Sbjct  458  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELISGQRALEFGKAANQKGAMLDWVK  517

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            ++HQE+K+ L+VDKDL  N+DRIEL+E+VQVALLCTQ+ P HRPKMSEV+RMLEGDGLAE
Sbjct  518  KIHQEKKIDLLVDKDLKNNYDRIELDEIVQVALLCTQYLPSHRPKMSEVVRMLEGDGLAE  577

Query  204  KWEASQRAETPR-HGN--TVPQRYYDLIEESSLVVEAMELSGPR  82
            KWEASQ AE+ R  GN  +  +RY DL ++SSL+ +AMELSGPR
Sbjct  578  KWEASQSAESTRSRGNELSSSERYSDLTDDSSLLAQAMELSGPR  621



>gb|KHN07744.1| Protein NSP-INTERACTING KINASE 2 [Glycine soja]
Length=621

 Score =   364 bits (935),  Expect = 9e-119, Method: Compositional matrix adjust.
 Identities = 175/224 (78%), Positives = 200/224 (89%), Gaps = 3/224 (1%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RKRIALG  RGL+YLHEQCDPKIIHRDVKAANILLD+Y EAVVGDFGLAKLLDHR+SHV+
Sbjct  398  RKRIALGAGRGLLYLHEQCDPKIIHRDVKAANILLDDYCEAVVGDFGLAKLLDHRDSHVT  457

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELI+GQ+A+EFGK  NQK  MLD VK
Sbjct  458  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELISGQRALEFGKAANQKGAMLDWVK  517

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            ++HQE+K+ L+VDKDL  N+DRIEL+E+VQVALLCTQ+ P HRPKMSEV+RMLEGDGLAE
Sbjct  518  KIHQEKKIDLLVDKDLKNNYDRIELDEIVQVALLCTQYLPSHRPKMSEVVRMLEGDGLAE  577

Query  204  KWEASQRAETPR-HGN--TVPQRYYDLIEESSLVVEAMELSGPR  82
            KWEASQ AE+ R  GN  +  +RY DL ++SSL+ +AMELSGPR
Sbjct  578  KWEASQSAESTRSRGNELSSSERYSDLTDDSSLLAQAMELSGPR  621



>ref|XP_002311408.2| hypothetical protein POPTR_0008s10970g [Populus trichocarpa]
 gb|EEE88775.2| hypothetical protein POPTR_0008s10970g [Populus trichocarpa]
Length=622

 Score =   364 bits (935),  Expect = 9e-119, Method: Compositional matrix adjust.
 Identities = 177/224 (79%), Positives = 201/224 (90%), Gaps = 3/224 (1%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RKRIALG ARGL+YLHEQCDPKIIHRDVKAANILLD+Y EAVVGDFGLAKLLDH++SHV+
Sbjct  399  RKRIALGAARGLLYLHEQCDPKIIHRDVKAANILLDDYCEAVVGDFGLAKLLDHQDSHVT  458

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELI+G +A+EFGK TNQK  +LD VK
Sbjct  459  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELISGLRALEFGKSTNQKGALLDWVK  518

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            ++HQE+KL L+VDKDL  N+DRIELEE+VQVALLCTQ+ P HRPKMSEV+RMLEGDGLAE
Sbjct  519  KIHQEKKLELLVDKDLKNNYDRIELEEIVQVALLCTQYLPSHRPKMSEVVRMLEGDGLAE  578

Query  204  KWEASQRA-ETPRHGN--TVPQRYYDLIEESSLVVEAMELSGPR  82
            KWEASQRA ET    N  +  +RY DL ++SSL+V+AMELSGPR
Sbjct  579  KWEASQRAEETKSRANEFSSSERYSDLTDDSSLLVQAMELSGPR  622



>ref|XP_003517902.1| PREDICTED: protein NSP-INTERACTING KINASE 2-like [Glycine max]
Length=621

 Score =   364 bits (935),  Expect = 9e-119, Method: Compositional matrix adjust.
 Identities = 175/224 (78%), Positives = 201/224 (90%), Gaps = 3/224 (1%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RKRIALG  RGL+YLHEQCDPKIIHRDVKAANILLD+Y EAVVGDFGLAKLLDHR+SHV+
Sbjct  398  RKRIALGAGRGLLYLHEQCDPKIIHRDVKAANILLDDYCEAVVGDFGLAKLLDHRDSHVT  457

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELI+GQ+A+EFGK  NQK  MLD VK
Sbjct  458  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELISGQRALEFGKAANQKGAMLDWVK  517

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            ++HQE+K+ L+VDKDL  N+DRIEL+E+VQVALLCTQ+ P +RPKMSEV+RMLEGDGLAE
Sbjct  518  KIHQEKKIDLLVDKDLKNNYDRIELDEIVQVALLCTQYLPSYRPKMSEVVRMLEGDGLAE  577

Query  204  KWEASQRAETPR-HGN--TVPQRYYDLIEESSLVVEAMELSGPR  82
            KWEASQRAE+ R  GN  +  +RY DL ++SSL+ +AMELSGPR
Sbjct  578  KWEASQRAESTRSRGNELSSSERYSDLTDDSSLLAQAMELSGPR  621



>ref|XP_004135130.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Cucumis sativus]
 ref|XP_004155284.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Cucumis sativus]
 gb|KGN52017.1| hypothetical protein Csa_5G608050 [Cucumis sativus]
Length=623

 Score =   364 bits (934),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 175/224 (78%), Positives = 200/224 (89%), Gaps = 3/224 (1%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RKRIALG ARGL+YLHEQCDPKIIHRDVKAANILLD+Y EAVVGDFGLAKLLDHR+SHV+
Sbjct  400  RKRIALGAARGLLYLHEQCDPKIIHRDVKAANILLDDYCEAVVGDFGLAKLLDHRDSHVT  459

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFG+GILLLELITGQ+A+EFGK  NQK  MLD VK
Sbjct  460  TAVRGTVGHIAPEYLSTGQSSEKTDVFGYGILLLELITGQRALEFGKAVNQKGAMLDWVK  519

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            ++HQE+KL ++VDKDL +N+DRIELEEMVQVALLCTQ+ P  RPKMSEV+RMLEGDGLAE
Sbjct  520  KIHQEKKLEILVDKDLRSNYDRIELEEMVQVALLCTQYLPTTRPKMSEVVRMLEGDGLAE  579

Query  204  KWEASQRAETPRH---GNTVPQRYYDLIEESSLVVEAMELSGPR  82
            KWEASQRA+  R+     +  +RY DL ++SSL+ +AMELSGPR
Sbjct  580  KWEASQRADANRYRVNEFSSSERYSDLTDDSSLLAQAMELSGPR  623



>ref|XP_010032589.1| PREDICTED: protein NSP-INTERACTING KINASE 1 [Eucalyptus grandis]
 gb|KCW52001.1| hypothetical protein EUGRSUZ_J01441 [Eucalyptus grandis]
 gb|KCW52002.1| hypothetical protein EUGRSUZ_J01441 [Eucalyptus grandis]
Length=629

 Score =   364 bits (935),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 175/224 (78%), Positives = 201/224 (90%), Gaps = 3/224 (1%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RKRIALG ARGL+YLHEQCDPKIIHRDVKAANILLD+Y EAVVGDFGLAKLLDH++SHV+
Sbjct  406  RKRIALGAARGLLYLHEQCDPKIIHRDVKAANILLDDYCEAVVGDFGLAKLLDHQDSHVT  465

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A+EFGK  NQK  MLD VK
Sbjct  466  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQRALEFGKAANQKGAMLDWVK  525

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            ++HQE+KL ++VDKDL +N+DRIELEE+VQVALLCTQ+ P HRPKMSEV+RMLEGDGLAE
Sbjct  526  KIHQEKKLEMLVDKDLRSNYDRIELEEIVQVALLCTQYLPAHRPKMSEVVRMLEGDGLAE  585

Query  204  KWEASQRAETPR---HGNTVPQRYYDLIEESSLVVEAMELSGPR  82
            +WEASQR E+ +   H  +   RY DL ++SSL+V+AMELSGPR
Sbjct  586  RWEASQRVESNKGKPHEFSSSDRYSDLTDDSSLLVQAMELSGPR  629



>ref|NP_001238448.1| NSP-interacting kinase precursor [Glycine max]
 gb|ACM89473.1| NSP-interacting kinase [Glycine max]
Length=600

 Score =   363 bits (932),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 179/227 (79%), Positives = 201/227 (89%), Gaps = 9/227 (4%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RK+IALG ARGL+YLHEQCDPKIIHRDVKAANILLD+Y EAVVGDFGLAKLLDH++SHV+
Sbjct  377  RKQIALGAARGLLYLHEQCDPKIIHRDVKAANILLDDYCEAVVGDFGLAKLLDHQDSHVT  436

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A+EFGK  NQK  MLD V+
Sbjct  437  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQRALEFGKAANQKGAMLDWVR  496

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            +LHQE+KL L+VDKDL TN+DRIELEE+VQVALLCTQ+ P HRPKMSEV+RMLEGDGLAE
Sbjct  497  KLHQEKKLELLVDKDLKTNYDRIELEEIVQVALLCTQYLPGHRPKMSEVVRMLEGDGLAE  556

Query  204  KWEASQRAETPRHGNTVPQ------RYYDLIEESSLVVEAMELSGPR  82
            KWEASQ A+T    N  PQ      RY DL ++SSL+V+AMELSGPR
Sbjct  557  KWEASQSADT---SNCKPQELSSSDRYSDLTDDSSLLVQAMELSGPR  600



>ref|XP_007153543.1| hypothetical protein PHAVU_003G044400g [Phaseolus vulgaris]
 gb|ESW25537.1| hypothetical protein PHAVU_003G044400g [Phaseolus vulgaris]
Length=621

 Score =   363 bits (933),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 175/224 (78%), Positives = 201/224 (90%), Gaps = 3/224 (1%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RKRIALG  RGL+YLHEQCDPKIIHRDVKAANILLD+Y EAVVGDFGLAKLLDHR+SHV+
Sbjct  398  RKRIALGAGRGLLYLHEQCDPKIIHRDVKAANILLDDYCEAVVGDFGLAKLLDHRDSHVT  457

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELI+GQ+A+EFGK  NQK  MLD VK
Sbjct  458  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELISGQRALEFGKAANQKGAMLDWVK  517

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            ++HQE+K+ L+VDKDL  ++DRIEL+E+VQVALLCTQ+ P HRPKMSEV+RMLEGDGLAE
Sbjct  518  KIHQEKKIDLLVDKDLKNHYDRIELDEIVQVALLCTQYLPSHRPKMSEVVRMLEGDGLAE  577

Query  204  KWEASQRAETPR-HGN--TVPQRYYDLIEESSLVVEAMELSGPR  82
            KWEASQRAE+ R  GN  +  +RY DL ++SSL+ +AMELSGPR
Sbjct  578  KWEASQRAESTRSRGNELSSSERYSDLTDDSSLLTQAMELSGPR  621



>ref|XP_006593317.1| PREDICTED: NSP-interacting kinase isoform X1 [Glycine max]
 gb|KHN02661.1| Protein NSP-INTERACTING KINASE 1 [Glycine soja]
Length=624

 Score =   363 bits (933),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 179/227 (79%), Positives = 201/227 (89%), Gaps = 9/227 (4%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RK+IALG ARGL+YLHEQCDPKIIHRDVKAANILLD+Y EAVVGDFGLAKLLDH++SHV+
Sbjct  401  RKQIALGAARGLLYLHEQCDPKIIHRDVKAANILLDDYCEAVVGDFGLAKLLDHQDSHVT  460

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A+EFGK  NQK  MLD V+
Sbjct  461  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQRALEFGKAANQKGAMLDWVR  520

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            +LHQE+KL L+VDKDL TN+DRIELEE+VQVALLCTQ+ P HRPKMSEV+RMLEGDGLAE
Sbjct  521  KLHQEKKLELLVDKDLKTNYDRIELEEIVQVALLCTQYLPGHRPKMSEVVRMLEGDGLAE  580

Query  204  KWEASQRAETPRHGNTVPQ------RYYDLIEESSLVVEAMELSGPR  82
            KWEASQ A+T    N  PQ      RY DL ++SSL+V+AMELSGPR
Sbjct  581  KWEASQSADT---SNCKPQELSSSDRYSDLTDDSSLLVQAMELSGPR  624



>ref|XP_007033440.1| NSP-interacting kinase 1 [Theobroma cacao]
 gb|EOY04366.1| NSP-interacting kinase 1 [Theobroma cacao]
Length=649

 Score =   364 bits (935),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 176/224 (79%), Positives = 200/224 (89%), Gaps = 3/224 (1%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RKRIALG ARGL+YLHEQCDPKIIHRDVKAANILLD+Y EAVVGDFGLAKLLDH++SHV+
Sbjct  406  RKRIALGAARGLLYLHEQCDPKIIHRDVKAANILLDDYCEAVVGDFGLAKLLDHQDSHVT  465

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A+EFGK  NQK  MLD V+
Sbjct  466  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQRALEFGKAANQKGAMLDWVR  525

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            ++HQE+KL  +VDKDL +N+DRIELEEMVQVALLCTQ+ P HRPKMSEV+RMLEGDGLAE
Sbjct  526  KIHQEKKLEGLVDKDLKSNYDRIELEEMVQVALLCTQYLPGHRPKMSEVVRMLEGDGLAE  585

Query  204  KWEASQRAETPR---HGNTVPQRYYDLIEESSLVVEAMELSGPR  82
            +WEASQRAE  +   H  +   RY DL ++SSL+V+AMELSGPR
Sbjct  586  RWEASQRAEATKCKPHEFSSSDRYSDLTDDSSLLVQAMELSGPR  629



>gb|KEH17047.1| NSP-interacting kinase-like protein [Medicago truncatula]
Length=621

 Score =   363 bits (932),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 174/224 (78%), Positives = 200/224 (89%), Gaps = 3/224 (1%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RKRIALG  RGL+YLHEQCDPKIIHRDVKAANILLD+Y EAVVGDFGLAKLLDHR+SHV+
Sbjct  398  RKRIALGAGRGLLYLHEQCDPKIIHRDVKAANILLDDYCEAVVGDFGLAKLLDHRDSHVT  457

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELI+GQ+A+EFGK  NQK  MLD VK
Sbjct  458  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELISGQRALEFGKAANQKGAMLDWVK  517

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            ++HQE+K+ ++VDKDL   +DRIEL+E+VQVALLCTQ+ P HRPKMSEV+RMLEGDGLAE
Sbjct  518  KIHQEKKIDVLVDKDLKNKYDRIELDEIVQVALLCTQYLPSHRPKMSEVVRMLEGDGLAE  577

Query  204  KWEASQRAETPR-HGN--TVPQRYYDLIEESSLVVEAMELSGPR  82
            KWEASQRAE+ R  GN  +  +RY DL ++SSL+ +AMELSGPR
Sbjct  578  KWEASQRAESTRSRGNELSSSERYSDLTDDSSLLAQAMELSGPR  621



>ref|XP_010230510.1| PREDICTED: protein NSP-INTERACTING KINASE 3 isoform X3 [Brachypodium 
distachyon]
Length=603

 Score =   362 bits (930),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 171/225 (76%), Positives = 205/225 (91%), Gaps = 4/225 (2%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RK IALG ARGL+YLHEQCDPKIIHRDVKA+N+LLDEYFEA+VGDFGLAKLLDH+ESHV+
Sbjct  379  RKMIALGTARGLLYLHEQCDPKIIHRDVKASNVLLDEYFEAIVGDFGLAKLLDHQESHVT  438

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFG+LL+ELITGQKA++FG+  NQK  +LD+VK
Sbjct  439  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGVLLVELITGQKALDFGRLANQKGGVLDMVK  498

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            +LH E++LS+MVDKDLG+N+DR+ELEEMVQVALLCTQ++P HRP+MSEV+RMLEGDGLAE
Sbjct  499  KLHHEKQLSMMVDKDLGSNYDRVELEEMVQVALLCTQYHPSHRPRMSEVIRMLEGDGLAE  558

Query  204  KWEASQRAETPRHGNT--VPQRYYDL--IEESSLVVEAMELSGPR  82
            KWEASQ  +TP+  ++  +P ++ DL   +ESSL +EAMELSGPR
Sbjct  559  KWEASQNVDTPKSVSSELIPPKFMDLAAADESSLGLEAMELSGPR  603



>ref|XP_010230511.1| PREDICTED: protein NSP-INTERACTING KINASE 3 isoform X4 [Brachypodium 
distachyon]
Length=601

 Score =   362 bits (930),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 171/225 (76%), Positives = 205/225 (91%), Gaps = 4/225 (2%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RK IALG ARGL+YLHEQCDPKIIHRDVKA+N+LLDEYFEA+VGDFGLAKLLDH+ESHV+
Sbjct  377  RKMIALGTARGLLYLHEQCDPKIIHRDVKASNVLLDEYFEAIVGDFGLAKLLDHQESHVT  436

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFG+LL+ELITGQKA++FG+  NQK  +LD+VK
Sbjct  437  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGVLLVELITGQKALDFGRLANQKGGVLDMVK  496

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            +LH E++LS+MVDKDLG+N+DR+ELEEMVQVALLCTQ++P HRP+MSEV+RMLEGDGLAE
Sbjct  497  KLHHEKQLSMMVDKDLGSNYDRVELEEMVQVALLCTQYHPSHRPRMSEVIRMLEGDGLAE  556

Query  204  KWEASQRAETPRHGNT--VPQRYYDL--IEESSLVVEAMELSGPR  82
            KWEASQ  +TP+  ++  +P ++ DL   +ESSL +EAMELSGPR
Sbjct  557  KWEASQNVDTPKSVSSELIPPKFMDLAAADESSLGLEAMELSGPR  601



>ref|XP_011009019.1| PREDICTED: protein NSP-INTERACTING KINASE 2-like [Populus euphratica]
Length=622

 Score =   363 bits (931),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 175/224 (78%), Positives = 200/224 (89%), Gaps = 3/224 (1%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RKR+ALG  RGL+YLHEQCDPKIIHRDVKAANILLD+Y EAVVGDFGLAKLLDHR+SHV+
Sbjct  399  RKRVALGAGRGLLYLHEQCDPKIIHRDVKAANILLDDYCEAVVGDFGLAKLLDHRDSHVT  458

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELI+G +A+EFGK TNQK  +LD VK
Sbjct  459  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELISGLRALEFGKSTNQKGALLDWVK  518

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            ++HQE+KL L+VDKDL  N+DRIELEE+VQVALLCTQ+ P HRPKMSEV+RMLEGDGLAE
Sbjct  519  KIHQEKKLELLVDKDLKNNYDRIELEEIVQVALLCTQYLPSHRPKMSEVVRMLEGDGLAE  578

Query  204  KWEASQRAETPR---HGNTVPQRYYDLIEESSLVVEAMELSGPR  82
            KWEASQRAE  R   +  +  +RY DL ++SSL+V+AMELSGPR
Sbjct  579  KWEASQRAEETRSRANEFSSSERYSDLTDDSSLLVQAMELSGPR  622



>ref|XP_009378313.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Pyrus x bretschneideri]
Length=636

 Score =   363 bits (931),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 175/226 (77%), Positives = 202/226 (89%), Gaps = 7/226 (3%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RKRIALG  RGL+YLHEQCDPKIIHRDVKAANILLD+Y EAVVGDFGLAKLLDH++SHV+
Sbjct  413  RKRIALGAGRGLLYLHEQCDPKIIHRDVKAANILLDDYCEAVVGDFGLAKLLDHQDSHVT  472

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A+EFGK +NQK  +LD VK
Sbjct  473  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQRALEFGKASNQKGAILDWVK  532

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            R+HQE+KL ++VDKDL TN+DRIELEEMVQVALLCTQ+ P HRPKMSEV+RMLEGDGL E
Sbjct  533  RIHQEKKLEMLVDKDLKTNYDRIELEEMVQVALLCTQYLPSHRPKMSEVVRMLEGDGLVE  592

Query  204  KWEASQRAETPRHGNTVPQ-----RYYDLIEESSLVVEAMELSGPR  82
            +WEASQ+AE+ +  +  P+     RY DL ++SSL+V+AMELSGPR
Sbjct  593  RWEASQKAESTK--SKAPEFSSSDRYSDLTDDSSLLVQAMELSGPR  636



>gb|KDP24340.1| hypothetical protein JCGZ_25636 [Jatropha curcas]
Length=624

 Score =   362 bits (930),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 175/224 (78%), Positives = 199/224 (89%), Gaps = 3/224 (1%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RKRIALG ARGL+YLHEQCDPKIIHRDVKAANILLD+Y EAVVGDFGLAKLLDH++SHV+
Sbjct  401  RKRIALGAARGLLYLHEQCDPKIIHRDVKAANILLDDYCEAVVGDFGLAKLLDHQDSHVT  460

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A+EFGK  NQK  +LD VK
Sbjct  461  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQRALEFGKAANQKGAILDWVK  520

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            ++HQE+KL ++VDKDL  N+DRIELEE+VQVALLCTQF P HRPKMSEV+RMLEGDGLAE
Sbjct  521  KIHQEKKLEMLVDKDLKANYDRIELEEIVQVALLCTQFLPSHRPKMSEVVRMLEGDGLAE  580

Query  204  KWEASQRAETPR---HGNTVPQRYYDLIEESSLVVEAMELSGPR  82
            +WEASQR E  +   H  +   RY DL ++SSL+V+AMELSGPR
Sbjct  581  RWEASQRVEATKPKPHEFSSSDRYSDLTDDSSLLVQAMELSGPR  624



>gb|KDO58880.1| hypothetical protein CISIN_1g036225mg [Citrus sinensis]
Length=622

 Score =   362 bits (930),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 175/224 (78%), Positives = 199/224 (89%), Gaps = 3/224 (1%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RKRIALG ARGL+YLHEQCDPKIIHRDVKAANILLD+  EAVVGDFGLAKLLDH++SHV+
Sbjct  399  RKRIALGAARGLLYLHEQCDPKIIHRDVKAANILLDDCCEAVVGDFGLAKLLDHQDSHVT  458

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A+E+GK  NQK  MLD VK
Sbjct  459  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQRALEYGKAANQKGAMLDWVK  518

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            ++HQE+KL ++VDKDL  N+DRIELEEMVQVALLCTQ+ P HRPKMSEV+RMLEGDGLAE
Sbjct  519  KIHQEKKLEMLVDKDLKNNYDRIELEEMVQVALLCTQYLPAHRPKMSEVVRMLEGDGLAE  578

Query  204  KWEASQRAETPR---HGNTVPQRYYDLIEESSLVVEAMELSGPR  82
            +WEASQRAE  +   H  +   RY DL ++SSL+V+AMELSGPR
Sbjct  579  RWEASQRAEATKSKPHEFSSSDRYSDLTDDSSLLVQAMELSGPR  622



>ref|XP_006482337.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Citrus sinensis]
Length=622

 Score =   362 bits (930),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 175/224 (78%), Positives = 199/224 (89%), Gaps = 3/224 (1%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RKRIALG ARGL+YLHEQCDPKIIHRDVKAANILLD+  EAVVGDFGLAKLLDH++SHV+
Sbjct  399  RKRIALGAARGLLYLHEQCDPKIIHRDVKAANILLDDCCEAVVGDFGLAKLLDHQDSHVT  458

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A+E+GK  NQK  MLD VK
Sbjct  459  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQRALEYGKAANQKGAMLDWVK  518

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            ++HQE+KL ++VDKDL  N+DRIELEEMVQVALLCTQ+ P HRPKMSEV+RMLEGDGLAE
Sbjct  519  KIHQEKKLEMLVDKDLKNNYDRIELEEMVQVALLCTQYLPAHRPKMSEVVRMLEGDGLAE  578

Query  204  KWEASQRAETPR---HGNTVPQRYYDLIEESSLVVEAMELSGPR  82
            +WEASQRAE  +   H  +   RY DL ++SSL+V+AMELSGPR
Sbjct  579  RWEASQRAEATKSKPHEFSSSDRYSDLTDDSSLLVQAMELSGPR  622



>ref|XP_011012715.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X2 [Populus 
euphratica]
Length=626

 Score =   362 bits (930),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 176/224 (79%), Positives = 199/224 (89%), Gaps = 3/224 (1%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RKRIALG ARGL+YLHEQCDPKIIHRDVKAANILLD+Y EAVVGDFGLAKLLDH++SHV+
Sbjct  403  RKRIALGAARGLLYLHEQCDPKIIHRDVKAANILLDDYCEAVVGDFGLAKLLDHQDSHVT  462

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A+EFGK  NQK  MLD VK
Sbjct  463  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQRAIEFGKAANQKGAMLDWVK  522

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            ++HQE+KL ++VDKD+  N+DRIELEEMVQVALL TQ+ P HRPKMSEV+RMLEGDGLAE
Sbjct  523  KIHQEKKLEMLVDKDIKGNYDRIELEEMVQVALLSTQYLPNHRPKMSEVVRMLEGDGLAE  582

Query  204  KWEASQRAETPR---HGNTVPQRYYDLIEESSLVVEAMELSGPR  82
            +WEASQRAE  +   H  +   RY DL ++SSL+V+AMELSGPR
Sbjct  583  RWEASQRAEATKSKPHEFSSSDRYSDLTDDSSLLVQAMELSGPR  626



>ref|XP_011012714.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X1 [Populus 
euphratica]
Length=627

 Score =   362 bits (930),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 176/224 (79%), Positives = 199/224 (89%), Gaps = 3/224 (1%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RKRIALG ARGL+YLHEQCDPKIIHRDVKAANILLD+Y EAVVGDFGLAKLLDH++SHV+
Sbjct  404  RKRIALGAARGLLYLHEQCDPKIIHRDVKAANILLDDYCEAVVGDFGLAKLLDHQDSHVT  463

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A+EFGK  NQK  MLD VK
Sbjct  464  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQRAIEFGKAANQKGAMLDWVK  523

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            ++HQE+KL ++VDKD+  N+DRIELEEMVQVALL TQ+ P HRPKMSEV+RMLEGDGLAE
Sbjct  524  KIHQEKKLEMLVDKDIKGNYDRIELEEMVQVALLSTQYLPNHRPKMSEVVRMLEGDGLAE  583

Query  204  KWEASQRAETPR---HGNTVPQRYYDLIEESSLVVEAMELSGPR  82
            +WEASQRAE  +   H  +   RY DL ++SSL+V+AMELSGPR
Sbjct  584  RWEASQRAEATKSKPHEFSSSDRYSDLTDDSSLLVQAMELSGPR  627



>ref|XP_006384231.1| hypothetical protein POPTR_0004s10790g [Populus trichocarpa]
 gb|ERP62028.1| hypothetical protein POPTR_0004s10790g [Populus trichocarpa]
Length=626

 Score =   362 bits (930),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 175/224 (78%), Positives = 199/224 (89%), Gaps = 3/224 (1%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RKRIALG ARGL+YLHEQCDPKIIHRDVKAANILLD+Y EAVVGDFGLAKLLDH++SHV+
Sbjct  403  RKRIALGAARGLLYLHEQCDPKIIHRDVKAANILLDDYCEAVVGDFGLAKLLDHQDSHVT  462

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A+EFGK  NQK  MLD VK
Sbjct  463  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQRAIEFGKAANQKGAMLDWVK  522

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            ++HQE+KL ++VDKD+  N+DRIELEEMVQVALL TQ+ P HRPKMSEV+RMLEGDGLAE
Sbjct  523  KIHQEKKLEMLVDKDIKGNYDRIELEEMVQVALLSTQYLPSHRPKMSEVVRMLEGDGLAE  582

Query  204  KWEASQRAETPR---HGNTVPQRYYDLIEESSLVVEAMELSGPR  82
            +WEASQRAE  +   H  +   RY DL ++SSL+V+AMELSGPR
Sbjct  583  RWEASQRAEATKSKPHEFSSSDRYSDLTDDSSLLVQAMELSGPR  626



>ref|XP_002305306.2| hypothetical protein POPTR_0004s10790g [Populus trichocarpa]
 gb|EEE85817.2| hypothetical protein POPTR_0004s10790g [Populus trichocarpa]
Length=627

 Score =   362 bits (930),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 175/224 (78%), Positives = 199/224 (89%), Gaps = 3/224 (1%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RKRIALG ARGL+YLHEQCDPKIIHRDVKAANILLD+Y EAVVGDFGLAKLLDH++SHV+
Sbjct  404  RKRIALGAARGLLYLHEQCDPKIIHRDVKAANILLDDYCEAVVGDFGLAKLLDHQDSHVT  463

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A+EFGK  NQK  MLD VK
Sbjct  464  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQRAIEFGKAANQKGAMLDWVK  523

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            ++HQE+KL ++VDKD+  N+DRIELEEMVQVALL TQ+ P HRPKMSEV+RMLEGDGLAE
Sbjct  524  KIHQEKKLEMLVDKDIKGNYDRIELEEMVQVALLSTQYLPSHRPKMSEVVRMLEGDGLAE  583

Query  204  KWEASQRAETPR---HGNTVPQRYYDLIEESSLVVEAMELSGPR  82
            +WEASQRAE  +   H  +   RY DL ++SSL+V+AMELSGPR
Sbjct  584  RWEASQRAEATKSKPHEFSSSDRYSDLTDDSSLLVQAMELSGPR  627



>gb|ABG73621.1| leucine-rich repeat receptor-like kinase [Populus tomentosa]
Length=622

 Score =   362 bits (929),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 176/224 (79%), Positives = 200/224 (89%), Gaps = 3/224 (1%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RKRIALG ARGL+YLHEQCDPKIIHRDVKAANILLD+Y EAVVGDFGLAKLLDHR+SHV+
Sbjct  399  RKRIALGAARGLLYLHEQCDPKIIHRDVKAANILLDDYCEAVVGDFGLAKLLDHRDSHVT  458

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELI+G +A+EFGK TNQK  +LD VK
Sbjct  459  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELISGLRALEFGKSTNQKGALLDWVK  518

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            ++H E+KL L+VDKDL  N+DRIELEE+VQVALLCTQ+ P HRPKMSEV+RMLEGDGLAE
Sbjct  519  KIHLEKKLELLVDKDLKNNYDRIELEEIVQVALLCTQYLPSHRPKMSEVVRMLEGDGLAE  578

Query  204  KWEASQRAETPR---HGNTVPQRYYDLIEESSLVVEAMELSGPR  82
            KWEASQRAE  R   +  +  +RY DL ++SSL+V+AMELSGPR
Sbjct  579  KWEASQRAEESRSRANEFSSSERYSDLTDDSSLLVQAMELSGPR  622



>ref|XP_003569325.2| PREDICTED: protein NSP-INTERACTING KINASE 3 isoform X2 [Brachypodium 
distachyon]
Length=631

 Score =   362 bits (930),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 171/225 (76%), Positives = 205/225 (91%), Gaps = 4/225 (2%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RK IALG ARGL+YLHEQCDPKIIHRDVKA+N+LLDEYFEA+VGDFGLAKLLDH+ESHV+
Sbjct  407  RKMIALGTARGLLYLHEQCDPKIIHRDVKASNVLLDEYFEAIVGDFGLAKLLDHQESHVT  466

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFG+LL+ELITGQKA++FG+  NQK  +LD+VK
Sbjct  467  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGVLLVELITGQKALDFGRLANQKGGVLDMVK  526

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            +LH E++LS+MVDKDLG+N+DR+ELEEMVQVALLCTQ++P HRP+MSEV+RMLEGDGLAE
Sbjct  527  KLHHEKQLSMMVDKDLGSNYDRVELEEMVQVALLCTQYHPSHRPRMSEVIRMLEGDGLAE  586

Query  204  KWEASQRAETPRHGNT--VPQRYYDL--IEESSLVVEAMELSGPR  82
            KWEASQ  +TP+  ++  +P ++ DL   +ESSL +EAMELSGPR
Sbjct  587  KWEASQNVDTPKSVSSELIPPKFMDLAAADESSLGLEAMELSGPR  631



>ref|XP_010942232.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Elaeis guineensis]
Length=624

 Score =   362 bits (929),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 174/224 (78%), Positives = 199/224 (89%), Gaps = 3/224 (1%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RKRIALG ARGL+YLHEQCDPKIIHRDVKAANILLD+Y EAVVGDFGLAKLLDHR+SHV+
Sbjct  401  RKRIALGAARGLLYLHEQCDPKIIHRDVKAANILLDDYCEAVVGDFGLAKLLDHRDSHVT  460

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELITG +AVEFGK  NQK  MLD VK
Sbjct  461  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGLRAVEFGKAANQKGAMLDWVK  520

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            ++HQE+KL ++VDKDL +++DRIELEE V+VALLCTQ+ P HRPKMSEV+RMLEGDGLAE
Sbjct  521  KIHQEKKLDMLVDKDLKSDYDRIELEETVRVALLCTQYLPGHRPKMSEVVRMLEGDGLAE  580

Query  204  KWEASQRAETPRHGN---TVPQRYYDLIEESSLVVEAMELSGPR  82
            +WEASQR E P+      +  +RY DL ++SSL+V+AMELSGPR
Sbjct  581  RWEASQRVEAPKFKMPEVSSSERYSDLTDDSSLLVQAMELSGPR  624



>ref|XP_010230509.1| PREDICTED: protein NSP-INTERACTING KINASE 3 isoform X1 [Brachypodium 
distachyon]
Length=633

 Score =   362 bits (930),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 171/225 (76%), Positives = 205/225 (91%), Gaps = 4/225 (2%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RK IALG ARGL+YLHEQCDPKIIHRDVKA+N+LLDEYFEA+VGDFGLAKLLDH+ESHV+
Sbjct  409  RKMIALGTARGLLYLHEQCDPKIIHRDVKASNVLLDEYFEAIVGDFGLAKLLDHQESHVT  468

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFG+LL+ELITGQKA++FG+  NQK  +LD+VK
Sbjct  469  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGVLLVELITGQKALDFGRLANQKGGVLDMVK  528

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            +LH E++LS+MVDKDLG+N+DR+ELEEMVQVALLCTQ++P HRP+MSEV+RMLEGDGLAE
Sbjct  529  KLHHEKQLSMMVDKDLGSNYDRVELEEMVQVALLCTQYHPSHRPRMSEVIRMLEGDGLAE  588

Query  204  KWEASQRAETPRHGNT--VPQRYYDL--IEESSLVVEAMELSGPR  82
            KWEASQ  +TP+  ++  +P ++ DL   +ESSL +EAMELSGPR
Sbjct  589  KWEASQNVDTPKSVSSELIPPKFMDLAAADESSLGLEAMELSGPR  633



>gb|KEH21800.1| NSP-interacting kinase-like protein [Medicago truncatula]
Length=626

 Score =   362 bits (929),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 172/224 (77%), Positives = 200/224 (89%), Gaps = 3/224 (1%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RK IALG ARGL+YLHEQCDPKIIHRDVKAANILLD Y+EAVVGDFGLAKLLDH++SHV+
Sbjct  403  RKNIALGAARGLLYLHEQCDPKIIHRDVKAANILLDNYYEAVVGDFGLAKLLDHQDSHVT  462

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A+EFGK  NQK  MLD VK
Sbjct  463  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQRALEFGKAANQKGAMLDWVK  522

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            ++HQE+KL L+VDKDL +N+D+IELEEMVQVALLCTQ+ P HRPKMSEV+RMLEGDGLAE
Sbjct  523  KIHQEKKLELLVDKDLKSNYDKIELEEMVQVALLCTQYLPSHRPKMSEVVRMLEGDGLAE  582

Query  204  KWEASQRAETPR---HGNTVPQRYYDLIEESSLVVEAMELSGPR  82
            +WEASQ+ +T +     +++  RY DL ++S L+V+AMELSGPR
Sbjct  583  RWEASQKTDTSKFKHQESSLSDRYSDLTDDSLLLVQAMELSGPR  626



>ref|XP_004490300.1| PREDICTED: protein NSP-INTERACTING KINASE 2-like [Cicer arietinum]
Length=622

 Score =   362 bits (928),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 175/224 (78%), Positives = 200/224 (89%), Gaps = 3/224 (1%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RKRIALG  RGL+YLHEQCDPKIIHRDVKAANILLDE  EAVVGDFGLAKLLDHR+SHV+
Sbjct  399  RKRIALGAGRGLLYLHEQCDPKIIHRDVKAANILLDEDCEAVVGDFGLAKLLDHRDSHVT  458

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSS+KTDVFGFGILLLELI+GQ+A+EFGK  NQK  MLD VK
Sbjct  459  TAVRGTVGHIAPEYLSTGQSSDKTDVFGFGILLLELISGQRALEFGKAANQKGAMLDWVK  518

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            ++HQE+K+ L+VDKDL  N+DRIEL+E+VQVALLCTQ+ P HRPKMSEV+RMLEGDGLAE
Sbjct  519  KIHQEKKIDLLVDKDLKNNYDRIELDEIVQVALLCTQYLPSHRPKMSEVVRMLEGDGLAE  578

Query  204  KWEASQRAETPR-HGN--TVPQRYYDLIEESSLVVEAMELSGPR  82
            KWEASQRAE+ R  GN  +  +RY DL ++SSL+ +AMELSGPR
Sbjct  579  KWEASQRAESTRSRGNELSSSERYSDLTDDSSLLAQAMELSGPR  622



>gb|KHN30771.1| Protein NSP-INTERACTING KINASE 1 [Glycine soja]
Length=619

 Score =   362 bits (928),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 178/227 (78%), Positives = 201/227 (89%), Gaps = 9/227 (4%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RK+IALG ARGL+YLHEQCDPKIIHRDVKAANILLD+Y EAVVGDFGLAKLLDH++SHV+
Sbjct  396  RKQIALGAARGLLYLHEQCDPKIIHRDVKAANILLDDYCEAVVGDFGLAKLLDHQDSHVT  455

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A+EFGK  NQK  MLD V+
Sbjct  456  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQRALEFGKAANQKGAMLDWVR  515

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            +LHQE+KL L+VDKDL TN+DRIELEE+VQVALLCTQ+ P HRPKMSEV+RMLEGDGLAE
Sbjct  516  KLHQEKKLELLVDKDLKTNYDRIELEEIVQVALLCTQYLPGHRPKMSEVVRMLEGDGLAE  575

Query  204  KWEASQRAETPRHGNTVPQ------RYYDLIEESSLVVEAMELSGPR  82
            KWEASQ A+T +     PQ      RY DL ++SSL+V+AMELSGPR
Sbjct  576  KWEASQSADTTK---CKPQELSSSDRYSDLTDDSSLLVQAMELSGPR  619



>gb|KDO70180.1| hypothetical protein CISIN_1g007025mg [Citrus sinensis]
Length=552

 Score =   359 bits (922),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 174/224 (78%), Positives = 198/224 (88%), Gaps = 3/224 (1%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RKRIALG ARGL+YLHEQCDPKIIHRDVKAANILLDEY+EAVVGDFGLAKLLDH +SHV+
Sbjct  329  RKRIALGAARGLLYLHEQCDPKIIHRDVKAANILLDEYYEAVVGDFGLAKLLDHCDSHVT  388

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELI+G +A+EFGK  NQK  MLD VK
Sbjct  389  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELISGLRALEFGKTANQKGAMLDWVK  448

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            ++HQE+KL ++VDKDL  N+DRIELEEMVQVALLCTQ+ P  RPKMSEV+RMLEGDGLAE
Sbjct  449  KIHQEKKLEMLVDKDLKNNYDRIELEEMVQVALLCTQYLPSLRPKMSEVVRMLEGDGLAE  508

Query  204  KWEASQRAETPR---HGNTVPQRYYDLIEESSLVVEAMELSGPR  82
            KW ASQ+AE  R   +  +  +RY DL ++SSL+V+AMELSGPR
Sbjct  509  KWAASQKAEATRSRANEFSSSERYSDLTDDSSLLVQAMELSGPR  552



>gb|KJB43138.1| hypothetical protein B456_007G186300 [Gossypium raimondii]
Length=625

 Score =   361 bits (927),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 174/225 (77%), Positives = 198/225 (88%), Gaps = 4/225 (2%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RKRIALG  RGL+YLHEQCDPKIIHRDVKAANILLD+Y EAVVGDFGLAKLLDH +SHV+
Sbjct  401  RKRIALGAGRGLLYLHEQCDPKIIHRDVKAANILLDDYCEAVVGDFGLAKLLDHHDSHVT  460

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSS+KTDVFGFGILLLELITGQ+A+EFGK  NQK  MLD V+
Sbjct  461  TAVRGTVGHIAPEYLSTGQSSDKTDVFGFGILLLELITGQRALEFGKAANQKGAMLDWVR  520

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            ++H E+KL ++VDKDL  N+DRIELEEMVQVALLCTQ+ P HRPKMSEV+RMLEGDGLAE
Sbjct  521  KIHHEKKLEVLVDKDLKNNYDRIELEEMVQVALLCTQYLPGHRPKMSEVVRMLEGDGLAE  580

Query  204  KWEASQRAET----PRHGNTVPQRYYDLIEESSLVVEAMELSGPR  82
            +WEASQRAE+    P H  +   RY DL ++SSL+V+AMELSGPR
Sbjct  581  RWEASQRAESTKCKPPHEFSSSDRYSDLTDDSSLLVQAMELSGPR  625



>ref|XP_011011496.1| PREDICTED: protein NSP-INTERACTING KINASE 2-like [Populus euphratica]
Length=622

 Score =   361 bits (927),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 175/224 (78%), Positives = 199/224 (89%), Gaps = 3/224 (1%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RKRIALG ARGL+YLHEQCDPKIIHRDVKAANILLD Y EAVVGDFGLAKLLDHR+SHV+
Sbjct  399  RKRIALGAARGLLYLHEQCDPKIIHRDVKAANILLDGYCEAVVGDFGLAKLLDHRDSHVT  458

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELI+G +A+EFGK TNQK  +LD VK
Sbjct  459  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELISGLRALEFGKSTNQKGALLDWVK  518

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            ++HQE+KL L+VDKDL  N+DRIELEE+VQVALLC Q+ P HRPKMSEV+RMLEGDGLAE
Sbjct  519  KIHQEKKLELLVDKDLKNNYDRIELEEIVQVALLCIQYLPSHRPKMSEVVRMLEGDGLAE  578

Query  204  KWEASQRAETPR---HGNTVPQRYYDLIEESSLVVEAMELSGPR  82
            KWEASQRAE  R   +  +  +RY D+ ++SSL+V+AMELSGPR
Sbjct  579  KWEASQRAEETRSRANEFSSSERYSDMTDDSSLLVQAMELSGPR  622



>ref|XP_003555046.1| PREDICTED: protein NSP-INTERACTING KINASE 1 isoformX1 [Glycine 
max]
Length=624

 Score =   361 bits (927),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 178/227 (78%), Positives = 201/227 (89%), Gaps = 9/227 (4%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RK+IALG ARGL+YLHEQCDPKIIHRDVKAANILLD+Y EAVVGDFGLAKLLDH++SHV+
Sbjct  401  RKQIALGAARGLLYLHEQCDPKIIHRDVKAANILLDDYCEAVVGDFGLAKLLDHQDSHVT  460

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A+EFGK  NQK  MLD V+
Sbjct  461  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQRALEFGKAANQKGAMLDWVR  520

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            +LHQE+KL L+VDKDL TN+DRIELEE+VQVALLCTQ+ P HRPKMSEV+RMLEGDGLAE
Sbjct  521  KLHQEKKLELLVDKDLKTNYDRIELEEIVQVALLCTQYLPGHRPKMSEVVRMLEGDGLAE  580

Query  204  KWEASQRAETPRHGNTVPQ------RYYDLIEESSLVVEAMELSGPR  82
            KWEASQ A+T +     PQ      RY DL ++SSL+V+AMELSGPR
Sbjct  581  KWEASQSADTTK---CKPQELSSSDRYSDLTDDSSLLVQAMELSGPR  624



>ref|XP_011077619.1| PREDICTED: protein NSP-INTERACTING KINASE 2 [Sesamum indicum]
Length=648

 Score =   362 bits (928),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 176/224 (79%), Positives = 198/224 (88%), Gaps = 3/224 (1%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RKRIALG ARGL+YLHEQCDPKIIHRDVKAANILLD+Y EAVVGDFGLAKLLDHR+SHV+
Sbjct  425  RKRIALGAARGLLYLHEQCDPKIIHRDVKAANILLDDYCEAVVGDFGLAKLLDHRDSHVT  484

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A+EFGK  NQK  MLD VK
Sbjct  485  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQRALEFGKAANQKGAMLDWVK  544

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            ++HQE+KL ++VDK+   N+D +ELEEMVQVALLCTQF P HRPKMSEV+RMLEGDGLAE
Sbjct  545  KIHQEKKLDVLVDKNFRNNYDPVELEEMVQVALLCTQFLPIHRPKMSEVVRMLEGDGLAE  604

Query  204  KWEASQRAETPR---HGNTVPQRYYDLIEESSLVVEAMELSGPR  82
            KWEASQRAE  R   +  +   RY DL ++SSL+V+AMELSGPR
Sbjct  605  KWEASQRAEATRCRANEFSSSGRYSDLTDDSSLLVQAMELSGPR  648



>gb|KDO70181.1| hypothetical protein CISIN_1g007025mg [Citrus sinensis]
Length=549

 Score =   358 bits (920),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 174/224 (78%), Positives = 198/224 (88%), Gaps = 3/224 (1%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RKRIALG ARGL+YLHEQCDPKIIHRDVKAANILLDEY+EAVVGDFGLAKLLDH +SHV+
Sbjct  326  RKRIALGAARGLLYLHEQCDPKIIHRDVKAANILLDEYYEAVVGDFGLAKLLDHCDSHVT  385

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELI+G +A+EFGK  NQK  MLD VK
Sbjct  386  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELISGLRALEFGKTANQKGAMLDWVK  445

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            ++HQE+KL ++VDKDL  N+DRIELEEMVQVALLCTQ+ P  RPKMSEV+RMLEGDGLAE
Sbjct  446  KIHQEKKLEMLVDKDLKNNYDRIELEEMVQVALLCTQYLPSLRPKMSEVVRMLEGDGLAE  505

Query  204  KWEASQRAETPR---HGNTVPQRYYDLIEESSLVVEAMELSGPR  82
            KW ASQ+AE  R   +  +  +RY DL ++SSL+V+AMELSGPR
Sbjct  506  KWAASQKAEATRSRANEFSSSERYSDLTDDSSLLVQAMELSGPR  549



>ref|XP_004171526.1| PREDICTED: LOW QUALITY PROTEIN: protein NSP-INTERACTING KINASE 
2-like, partial [Cucumis sativus]
Length=287

 Score =   349 bits (896),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 169/224 (75%), Positives = 197/224 (88%), Gaps = 3/224 (1%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RKRIA+G ARGL+YLHEQCDPKIIHRDVKAANILLD+Y EAVVGDFGLAKLLDH++SHV+
Sbjct  64   RKRIAIGAARGLLYLHEQCDPKIIHRDVKAANILLDDYCEAVVGDFGLAKLLDHQDSHVT  123

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A+EFGK  NQK  +LD VK
Sbjct  124  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQRALEFGKAANQKGGILDWVK  183

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            R+H E+KL ++VDKDL  N+DR+ELEEMVQVALLCTQ+ P HRP MSEV+RMLEG+GLA 
Sbjct  184  RIHLEKKLEVLVDKDLKANYDRVELEEMVQVALLCTQYLPGHRPXMSEVVRMLEGEGLAV  243

Query  204  KWEASQRAETPR---HGNTVPQRYYDLIEESSLVVEAMELSGPR  82
            +WEASQR ++ +   H  +   RY DL ++SSL+V+AMELSGPR
Sbjct  244  RWEASQRVDSTKCKPHDFSSSDRYSDLTDDSSLLVQAMELSGPR  287



>ref|XP_009765506.1| PREDICTED: protein NSP-INTERACTING KINASE 2-like [Nicotiana sylvestris]
Length=624

 Score =   360 bits (925),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 172/224 (77%), Positives = 202/224 (90%), Gaps = 3/224 (1%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RKRIALG ARGL+YLHEQCDPKIIHRDVKAANILLD+Y EAVVGDFGLAKLLDHR+SHV+
Sbjct  401  RKRIALGAARGLLYLHEQCDPKIIHRDVKAANILLDDYCEAVVGDFGLAKLLDHRDSHVT  460

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSS+KTDVFGFGILLLELI+GQ+A+EFGK  NQK  MLD VK
Sbjct  461  TAVRGTVGHIAPEYLSTGQSSDKTDVFGFGILLLELISGQRALEFGKAANQKGAMLDWVK  520

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            ++HQE+KL L+V+KDL  N+DRIE+EE+VQVAL+CTQ++P  RPKMSEV+RMLEGDGLAE
Sbjct  521  KIHQEKKLDLLVNKDLKDNYDRIEVEELVQVALICTQYHPSQRPKMSEVVRMLEGDGLAE  580

Query  204  KWEASQRAETPR---HGNTVPQRYYDLIEESSLVVEAMELSGPR  82
            KWEASQ+AE+ R   +  +  +RY DL ++SSL+V+AMELSGPR
Sbjct  581  KWEASQKAESTRCRANEFSSSERYSDLTDDSSLLVQAMELSGPR  624



>ref|XP_008230341.1| PREDICTED: protein NSP-INTERACTING KINASE 1 [Prunus mume]
Length=623

 Score =   360 bits (925),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 174/224 (78%), Positives = 199/224 (89%), Gaps = 3/224 (1%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RKRIALG  RGL+YLHEQCDPKIIHRDVKAANILLD+Y EAVVGDFGLAKLLDH++SHV+
Sbjct  400  RKRIALGAGRGLLYLHEQCDPKIIHRDVKAANILLDDYCEAVVGDFGLAKLLDHQDSHVT  459

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A+EFGK TNQK  +LD VK
Sbjct  460  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQRALEFGKATNQKGAILDWVK  519

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            ++HQE+KL ++VDKDL TN+DRIELEEMVQVALLCTQ+ P HRPKMSEV+RMLEGDGL E
Sbjct  520  KIHQEKKLEVLVDKDLKTNYDRIELEEMVQVALLCTQYLPGHRPKMSEVVRMLEGDGLVE  579

Query  204  KWEASQRAETPRHGN---TVPQRYYDLIEESSLVVEAMELSGPR  82
            +WEASQR E+ +      +   RY DL ++SSL+V+AMELSGPR
Sbjct  580  RWEASQRVESTKSKAPEFSSSDRYSDLTDDSSLLVQAMELSGPR  623



>ref|XP_009403878.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=607

 Score =   360 bits (923),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 174/223 (78%), Positives = 199/223 (89%), Gaps = 2/223 (1%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RK+IALG ARGL YLHEQCDPKIIHRDVKAANILLDE FEAVVGDFGLAKLLDH+ESHV+
Sbjct  385  RKKIALGTARGLFYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHQESHVT  444

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKA++FG+  NQK VMLD VK
Sbjct  445  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRLANQKGVMLDWVK  504

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            +LHQE +L++MVDKDL  N+DR+ELEEMVQVALLCTQF+P HRPKMSEV+RMLEGDGL E
Sbjct  505  KLHQENRLNIMVDKDLKNNYDRVELEEMVQVALLCTQFHPSHRPKMSEVVRMLEGDGLVE  564

Query  204  KWEASQRAETPRHGNTVPQ--RYYDLIEESSLVVEAMELSGPR  82
             W+A Q+ +TP+  +   Q  +Y D +E+SSLV+EA+ELSGPR
Sbjct  565  SWDALQKMDTPKCRSLERQSPKYVDFMEDSSLVLEAIELSGPR  607



>ref|XP_006430876.1| hypothetical protein CICLE_v10011302mg [Citrus clementina]
 gb|ESR44116.1| hypothetical protein CICLE_v10011302mg [Citrus clementina]
Length=622

 Score =   360 bits (924),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 174/224 (78%), Positives = 198/224 (88%), Gaps = 3/224 (1%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RKRIALG ARGL+YLHEQCDPKIIHRDVKAANILLD+  EAVVGDFGLAKLLDH++SHV+
Sbjct  399  RKRIALGAARGLLYLHEQCDPKIIHRDVKAANILLDDCCEAVVGDFGLAKLLDHQDSHVT  458

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A+E+GK  NQK  MLD VK
Sbjct  459  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQRALEYGKAANQKGAMLDWVK  518

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            ++H E+KL ++VDKDL  N+DRIELEEMVQVALLCTQ+ P HRPKMSEV+RMLEGDGLAE
Sbjct  519  KIHHEKKLEMLVDKDLKNNYDRIELEEMVQVALLCTQYLPAHRPKMSEVVRMLEGDGLAE  578

Query  204  KWEASQRAETPR---HGNTVPQRYYDLIEESSLVVEAMELSGPR  82
            +WEASQRAE  +   H  +   RY DL ++SSL+V+AMELSGPR
Sbjct  579  RWEASQRAEATKSKPHEFSSSDRYSDLTDDSSLLVQAMELSGPR  622



>tpg|DAA53257.1| TPA: putative leucine-rich repeat receptor-like protein kinase 
family protein [Zea mays]
Length=428

 Score =   353 bits (907),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 169/224 (75%), Positives = 201/224 (90%), Gaps = 3/224 (1%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RKRIALG ARGL+YLHEQCDPKIIHRDVKA+N+LLDEYFEA+VGDFGLAKLLDHRESHV+
Sbjct  205  RKRIALGTARGLLYLHEQCDPKIIHRDVKASNVLLDEYFEAIVGDFGLAKLLDHRESHVT  264

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFG+LL+ELITGQKA++FG+  NQK  +LD VK
Sbjct  265  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGVLLVELITGQKALDFGRVANQKGGVLDWVK  324

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            +LHQE++L  MVDKDLG+++DR+ELEEMVQV+LLCTQ++P HRP+MSEV+RMLEGDGLAE
Sbjct  325  KLHQEKQLGTMVDKDLGSSYDRVELEEMVQVSLLCTQYHPSHRPRMSEVIRMLEGDGLAE  384

Query  204  KWEASQRAETPRHGNT--VPQRYYDL-IEESSLVVEAMELSGPR  82
            +WEASQ  +TP   ++  + Q+Y D   +E SL +EAMELSGPR
Sbjct  385  RWEASQNVDTPESVSSELLLQKYMDFAADECSLGLEAMELSGPR  428



>ref|XP_008379484.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Malus domestica]
Length=625

 Score =   360 bits (923),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 174/226 (77%), Positives = 200/226 (88%), Gaps = 7/226 (3%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RKRIALG  RGL+YLHEQCDPKIIHRDVKAANILLD+Y EAVVGDFGLAKLLDH++SHV+
Sbjct  402  RKRIALGAGRGLLYLHEQCDPKIIHRDVKAANILLDDYCEAVVGDFGLAKLLDHQDSHVT  461

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A+EFGK  NQK  +LD VK
Sbjct  462  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQRALEFGKAANQKGAILDWVK  521

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            R+H E+KL ++VDKDL TN+DRIELEEMVQVALLCTQ+ P HRPKMSEV+RMLEGDGL E
Sbjct  522  RIHHEKKLEMLVDKDLKTNYDRIELEEMVQVALLCTQYLPSHRPKMSEVVRMLEGDGLVE  581

Query  204  KWEASQRAETPRHGNTVPQ-----RYYDLIEESSLVVEAMELSGPR  82
            +WEASQ+AE+ +  +  P+     RY DL ++SSL+V+AMELSGPR
Sbjct  582  RWEASQKAESAK--SKAPEFSSSDRYSDLTDDSSLLVQAMELSGPR  625



>ref|XP_002514536.1| BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1 precursor, 
putative [Ricinus communis]
 gb|EEF47642.1| BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1 precursor, 
putative [Ricinus communis]
Length=576

 Score =   358 bits (919),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 173/224 (77%), Positives = 198/224 (88%), Gaps = 3/224 (1%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RKRIALG ARGL+YLHEQCDPKIIHRDVKAANILLDEY EAVVGDFGLAKLLDHR+SHV+
Sbjct  353  RKRIALGTARGLLYLHEQCDPKIIHRDVKAANILLDEYCEAVVGDFGLAKLLDHRDSHVT  412

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLEL+ G +A+EFGK  NQK  MLD +K
Sbjct  413  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELVHGLRALEFGKSANQKGAMLDWIK  472

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            ++HQ++KL L+VDK+L  N+D IELEE+V+VALLCTQF P HRPKMSEV+RMLEGDGLAE
Sbjct  473  KIHQDKKLELLVDKNLKNNYDPIELEEIVRVALLCTQFIPGHRPKMSEVVRMLEGDGLAE  532

Query  204  KWEASQRAETPR---HGNTVPQRYYDLIEESSLVVEAMELSGPR  82
            KWEASQRAE  R   +  +  +RY DL ++SSL+V+AMELSGPR
Sbjct  533  KWEASQRAEATRSRANEFSSSERYSDLTDDSSLLVQAMELSGPR  576



>ref|XP_009625494.1| PREDICTED: protein NSP-INTERACTING KINASE 2-like [Nicotiana tomentosiformis]
Length=624

 Score =   359 bits (922),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 172/224 (77%), Positives = 201/224 (90%), Gaps = 3/224 (1%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RKRIALG ARGL+YLHEQCDPKIIHRDVKAANILLD+Y EAVVGDFGLAKLLDH +SHV+
Sbjct  401  RKRIALGAARGLLYLHEQCDPKIIHRDVKAANILLDDYCEAVVGDFGLAKLLDHSDSHVT  460

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSS+KTDVFGFGILLLELI+GQ+A+EFGK  NQK  MLD VK
Sbjct  461  TAVRGTVGHIAPEYLSTGQSSDKTDVFGFGILLLELISGQRALEFGKAANQKGAMLDWVK  520

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            ++ QE+KL L+V+KDL  N+DRIE+EEMVQVAL+CTQ++P HRPKMSEV+RMLEGDGLAE
Sbjct  521  KIQQEKKLDLLVNKDLKDNYDRIEVEEMVQVALICTQYHPSHRPKMSEVVRMLEGDGLAE  580

Query  204  KWEASQRAETPR---HGNTVPQRYYDLIEESSLVVEAMELSGPR  82
            KWEASQ+AE+ R   +  +  +RY DL ++SSL+V+AMELSGPR
Sbjct  581  KWEASQKAESTRCRANEFSSSERYSDLTDDSSLLVQAMELSGPR  624



>ref|XP_006373507.1| hypothetical protein POPTR_0017s14360g [Populus trichocarpa]
 gb|ERP51304.1| hypothetical protein POPTR_0017s14360g [Populus trichocarpa]
Length=596

 Score =   358 bits (920),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 173/224 (77%), Positives = 197/224 (88%), Gaps = 3/224 (1%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RKRIALG ARGL+YLHEQCDPKIIHRDVKAANILLD+Y EAVVGDFGLAKLLDH++SHV+
Sbjct  373  RKRIALGAARGLLYLHEQCDPKIIHRDVKAANILLDDYCEAVVGDFGLAKLLDHQDSHVT  432

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSS+KTDVFGFGILLLELITGQ+A+EFGK  NQK  MLD VK
Sbjct  433  TAVRGTVGHIAPEYLSTGQSSDKTDVFGFGILLLELITGQRALEFGKAANQKGAMLDWVK  492

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            ++HQE+KL ++VDKDL  N+DRIELEEMVQVALLCTQ+ P  RPKM EV++MLEGDGLAE
Sbjct  493  KIHQEKKLEMLVDKDLKGNYDRIELEEMVQVALLCTQYLPSQRPKMYEVVKMLEGDGLAE  552

Query  204  KWEASQRAETPR---HGNTVPQRYYDLIEESSLVVEAMELSGPR  82
             WEASQRAE  +   H  +   RY DL ++SSL+V+AMELSGPR
Sbjct  553  SWEASQRAEATKSKPHEFSSSDRYSDLTDDSSLLVQAMELSGPR  596



>ref|XP_009403877.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=626

 Score =   359 bits (921),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 174/223 (78%), Positives = 199/223 (89%), Gaps = 2/223 (1%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RK+IALG ARGL YLHEQCDPKIIHRDVKAANILLDE FEAVVGDFGLAKLLDH+ESHV+
Sbjct  404  RKKIALGTARGLFYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHQESHVT  463

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKA++FG+  NQK VMLD VK
Sbjct  464  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRLANQKGVMLDWVK  523

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            +LHQE +L++MVDKDL  N+DR+ELEEMVQVALLCTQF+P HRPKMSEV+RMLEGDGL E
Sbjct  524  KLHQENRLNIMVDKDLKNNYDRVELEEMVQVALLCTQFHPSHRPKMSEVVRMLEGDGLVE  583

Query  204  KWEASQRAETPRHGNTVPQ--RYYDLIEESSLVVEAMELSGPR  82
             W+A Q+ +TP+  +   Q  +Y D +E+SSLV+EA+ELSGPR
Sbjct  584  SWDALQKMDTPKCRSLERQSPKYVDFMEDSSLVLEAIELSGPR  626



>ref|XP_010528022.1| PREDICTED: protein NSP-INTERACTING KINASE 2 [Tarenaya hassleriana]
Length=637

 Score =   359 bits (922),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 173/228 (76%), Positives = 199/228 (87%), Gaps = 7/228 (3%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RKRIALG ARGL+YLHEQCDPKIIHRDVKAANILLD++ EAVVGDFGLAKLLDHRESHV+
Sbjct  410  RKRIALGAARGLLYLHEQCDPKIIHRDVKAANILLDDFCEAVVGDFGLAKLLDHRESHVT  469

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELI+G +A+EFGK  NQK  MLD VK
Sbjct  470  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELISGLRALEFGKAANQKGAMLDWVK  529

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            ++HQE+KL L+VDKDL  N+DRIE+EEMVQVALLCTQ+ P HRPKMSEV+RMLEGDGLAE
Sbjct  530  KVHQEKKLELIVDKDLKNNYDRIEVEEMVQVALLCTQYLPSHRPKMSEVVRMLEGDGLAE  589

Query  204  KWEASQRAETPRHGN-------TVPQRYYDLIEESSLVVEAMELSGPR  82
            KWEASQ+  +  H +       +  +RY DL ++S+L+V+AMELSGPR
Sbjct  590  KWEASQQRNSETHRSYSRPNEFSSSERYSDLTDDSTLLVQAMELSGPR  637



>ref|XP_011021148.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X2 [Populus 
euphratica]
Length=626

 Score =   359 bits (921),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 173/224 (77%), Positives = 197/224 (88%), Gaps = 3/224 (1%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RKRIALG ARGL+YLHEQCDPKIIHRDVKAANILLD+Y EAVVGDFGLAKLLDH++SHV+
Sbjct  403  RKRIALGAARGLLYLHEQCDPKIIHRDVKAANILLDDYCEAVVGDFGLAKLLDHQDSHVT  462

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSS+KTDVFGFGILLLELITGQ+A+EFGK  NQK  MLD VK
Sbjct  463  TAVRGTVGHIAPEYLSTGQSSDKTDVFGFGILLLELITGQRALEFGKAANQKGAMLDWVK  522

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            ++HQE+KL ++VDKDL  N+DRIELEEMVQVALLCTQ+ P  RPKM EV++MLEGDGLAE
Sbjct  523  KIHQEKKLEMLVDKDLKGNYDRIELEEMVQVALLCTQYLPSQRPKMYEVVKMLEGDGLAE  582

Query  204  KWEASQRAETPR---HGNTVPQRYYDLIEESSLVVEAMELSGPR  82
             WEASQRAE  +   H  +   RY DL ++SSL+V+AMELSGPR
Sbjct  583  SWEASQRAEATKSKPHEFSSSDRYSDLTDDSSLLVQAMELSGPR  626



>ref|XP_006437790.1| hypothetical protein CICLE_v10030970mg [Citrus clementina]
 gb|ESR51030.1| hypothetical protein CICLE_v10030970mg [Citrus clementina]
Length=621

 Score =   358 bits (920),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 174/224 (78%), Positives = 198/224 (88%), Gaps = 3/224 (1%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RKRIALG ARGL+YLHEQCDPKIIHRDVKAANILLDEY+EAVVGDFGLAKLLDH +SHV+
Sbjct  398  RKRIALGAARGLLYLHEQCDPKIIHRDVKAANILLDEYYEAVVGDFGLAKLLDHCDSHVT  457

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELI+G +A+EFGK  NQK  MLD VK
Sbjct  458  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELISGLRALEFGKTANQKGAMLDWVK  517

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            ++HQE+KL ++VDKDL  N+DRIELEEMVQVALLCTQ+ P  RPKMSEV+RMLEGDGLAE
Sbjct  518  KIHQEKKLEMLVDKDLKNNYDRIELEEMVQVALLCTQYLPSLRPKMSEVVRMLEGDGLAE  577

Query  204  KWEASQRAETPR---HGNTVPQRYYDLIEESSLVVEAMELSGPR  82
            KW ASQ+AE  R   +  +  +RY DL ++SSL+V+AMELSGPR
Sbjct  578  KWAASQKAEATRSRANEFSSSERYSDLTDDSSLLVQAMELSGPR  621



>ref|XP_011021146.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X1 [Populus 
euphratica]
Length=627

 Score =   358 bits (920),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 173/224 (77%), Positives = 197/224 (88%), Gaps = 3/224 (1%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RKRIALG ARGL+YLHEQCDPKIIHRDVKAANILLD+Y EAVVGDFGLAKLLDH++SHV+
Sbjct  404  RKRIALGAARGLLYLHEQCDPKIIHRDVKAANILLDDYCEAVVGDFGLAKLLDHQDSHVT  463

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSS+KTDVFGFGILLLELITGQ+A+EFGK  NQK  MLD VK
Sbjct  464  TAVRGTVGHIAPEYLSTGQSSDKTDVFGFGILLLELITGQRALEFGKAANQKGAMLDWVK  523

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            ++HQE+KL ++VDKDL  N+DRIELEEMVQVALLCTQ+ P  RPKM EV++MLEGDGLAE
Sbjct  524  KIHQEKKLEMLVDKDLKGNYDRIELEEMVQVALLCTQYLPSQRPKMYEVVKMLEGDGLAE  583

Query  204  KWEASQRAETPR---HGNTVPQRYYDLIEESSLVVEAMELSGPR  82
             WEASQRAE  +   H  +   RY DL ++SSL+V+AMELSGPR
Sbjct  584  SWEASQRAEATKSKPHEFSSSDRYSDLTDDSSLLVQAMELSGPR  627



>ref|XP_007214944.1| hypothetical protein PRUPE_ppa002897mg [Prunus persica]
 gb|EMJ16143.1| hypothetical protein PRUPE_ppa002897mg [Prunus persica]
Length=623

 Score =   358 bits (920),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 173/224 (77%), Positives = 198/224 (88%), Gaps = 3/224 (1%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RKRIALG  RGL+YLHEQCDPKIIHRDVKAANILLD+Y EAVVGDFGLAKLLDH++SHV+
Sbjct  400  RKRIALGAGRGLLYLHEQCDPKIIHRDVKAANILLDDYCEAVVGDFGLAKLLDHQDSHVT  459

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A+EFGK TNQK  +LD VK
Sbjct  460  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQRALEFGKATNQKGAILDWVK  519

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            ++HQE+KL ++VDKDL TN+DRIELEEMVQVALLCTQ+ P  RPKMSEV+RMLEGDGL E
Sbjct  520  KIHQEKKLEMLVDKDLKTNYDRIELEEMVQVALLCTQYLPGQRPKMSEVVRMLEGDGLVE  579

Query  204  KWEASQRAETPRHGN---TVPQRYYDLIEESSLVVEAMELSGPR  82
            +WEASQR E+ +      +   RY DL ++SSL+V+AMELSGPR
Sbjct  580  RWEASQRVESTKSKAPEFSSSDRYSDLTDDSSLLVQAMELSGPR  623



>ref|XP_007151443.1| hypothetical protein PHAVU_004G046800g [Phaseolus vulgaris]
 gb|ESW23437.1| hypothetical protein PHAVU_004G046800g [Phaseolus vulgaris]
Length=626

 Score =   358 bits (920),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 173/225 (77%), Positives = 200/225 (89%), Gaps = 4/225 (2%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RK+IA+G ARGL+YLHEQCDPKIIHRDVKAANILLD+Y EAVVGDFGLAKLLDH++SHV+
Sbjct  402  RKQIAIGAARGLLYLHEQCDPKIIHRDVKAANILLDDYCEAVVGDFGLAKLLDHQDSHVT  461

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A+EFGK  NQK  MLD V+
Sbjct  462  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQRALEFGKAANQKGAMLDWVR  521

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            ++HQE+KL L+VDKDL  N+DRIELEE+VQVALLCTQ+ P HRP+MSEV+RMLEGDGLAE
Sbjct  522  KIHQEKKLELLVDKDLMNNYDRIELEEIVQVALLCTQYLPGHRPRMSEVVRMLEGDGLAE  581

Query  204  KWEASQRAETPR----HGNTVPQRYYDLIEESSLVVEAMELSGPR  82
            KWEASQ A+T +    H  +   RY DL ++SSL+V+AMELSGPR
Sbjct  582  KWEASQSADTTKCNKPHELSSSDRYSDLTDDSSLLVQAMELSGPR  626



>ref|XP_006484307.1| PREDICTED: protein NSP-INTERACTING KINASE 2-like [Citrus sinensis]
 gb|KDO70177.1| hypothetical protein CISIN_1g007025mg [Citrus sinensis]
Length=621

 Score =   358 bits (919),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 174/224 (78%), Positives = 198/224 (88%), Gaps = 3/224 (1%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RKRIALG ARGL+YLHEQCDPKIIHRDVKAANILLDEY+EAVVGDFGLAKLLDH +SHV+
Sbjct  398  RKRIALGAARGLLYLHEQCDPKIIHRDVKAANILLDEYYEAVVGDFGLAKLLDHCDSHVT  457

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELI+G +A+EFGK  NQK  MLD VK
Sbjct  458  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELISGLRALEFGKTANQKGAMLDWVK  517

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            ++HQE+KL ++VDKDL  N+DRIELEEMVQVALLCTQ+ P  RPKMSEV+RMLEGDGLAE
Sbjct  518  KIHQEKKLEMLVDKDLKNNYDRIELEEMVQVALLCTQYLPSLRPKMSEVVRMLEGDGLAE  577

Query  204  KWEASQRAETPR---HGNTVPQRYYDLIEESSLVVEAMELSGPR  82
            KW ASQ+AE  R   +  +  +RY DL ++SSL+V+AMELSGPR
Sbjct  578  KWAASQKAEATRSRANEFSSSERYSDLTDDSSLLVQAMELSGPR  621



>dbj|BAK02609.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=632

 Score =   358 bits (920),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 169/225 (75%), Positives = 204/225 (91%), Gaps = 4/225 (2%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RK IALG ARGL+YLHEQCDPKIIHRDVKA+N+LLDEYFEA+VGDFGLAKLLDH+E+HV+
Sbjct  408  RKMIALGTARGLLYLHEQCDPKIIHRDVKASNVLLDEYFEAIVGDFGLAKLLDHQETHVT  467

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFG+LL+ELITGQKA++FG+  NQK  +LDLVK
Sbjct  468  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGVLLVELITGQKALDFGRLANQKGGVLDLVK  527

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            +LHQE++L++MVDKDLG+N+DR+ELEEMVQVALLCTQ+ P HRP+MSEV+RMLEGDGLAE
Sbjct  528  KLHQEKQLNMMVDKDLGSNYDRVELEEMVQVALLCTQYYPSHRPRMSEVIRMLEGDGLAE  587

Query  204  KWEASQRAETPRHGNT--VPQRYYDL--IEESSLVVEAMELSGPR  82
            KWEASQ  +TP+  ++  +P ++ D    +ESS+ +EAMELSGPR
Sbjct  588  KWEASQNVDTPKSVSSELLPLKFTDFAGADESSVGLEAMELSGPR  632



>ref|XP_004238998.1| PREDICTED: protein NSP-INTERACTING KINASE 1 [Solanum lycopersicum]
Length=621

 Score =   358 bits (919),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 174/224 (78%), Positives = 200/224 (89%), Gaps = 3/224 (1%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RKRIALG ARGL+YLHEQCDPKIIHRDVKAANILLD+  EAVVGDFGLAKLLDHR+SHV+
Sbjct  398  RKRIALGAARGLLYLHEQCDPKIIHRDVKAANILLDDDCEAVVGDFGLAKLLDHRDSHVT  457

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSS+KTDVFGFGILLLELI+GQ+A+EFGK  NQK VMLD VK
Sbjct  458  TAVRGTVGHIAPEYLSTGQSSDKTDVFGFGILLLELISGQRALEFGKAANQKGVMLDWVK  517

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            ++H E+KL L+V KDL   +DRIELEEMVQVAL+CTQ++P HRPKMSEV+RMLEGDGLAE
Sbjct  518  KIHLEKKLDLLVSKDLKDKYDRIELEEMVQVALICTQYHPSHRPKMSEVVRMLEGDGLAE  577

Query  204  KWEASQRAETPR---HGNTVPQRYYDLIEESSLVVEAMELSGPR  82
            KWEASQRAE+ R   +  +  +RY DL ++SSL+V+AMELSGPR
Sbjct  578  KWEASQRAESTRCRANEFSSSERYSDLTDDSSLLVQAMELSGPR  621



>ref|NP_001140727.1| uncharacterized LOC100272802 [Zea mays]
 gb|ACF84475.1| unknown [Zea mays]
 gb|ACR35282.1| unknown [Zea mays]
 gb|AFW80156.1| putative leucine-rich repeat receptor-like protein kinase family 
protein [Zea mays]
Length=251

 Score =   345 bits (884),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 166/227 (73%), Positives = 203/227 (89%), Gaps = 6/227 (3%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RKR+ALG ARGL+YLHEQCDPKIIHRDVKA+N+LLDEYFEA+VGDFGLAKLLDHRESHV+
Sbjct  25   RKRVALGTARGLLYLHEQCDPKIIHRDVKASNVLLDEYFEAIVGDFGLAKLLDHRESHVT  84

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFG+LL+EL+TGQKA++FG+  NQK  +LD VK
Sbjct  85   TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGVLLVELVTGQKALDFGRVANQKGGVLDWVK  144

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGD-GLA  208
            +LHQE++L +MVDKDLG+++D +ELEEMVQ+ALLCTQ++P HRP+MSEV+RMLEG+ GLA
Sbjct  145  KLHQEKQLGVMVDKDLGSSYDGVELEEMVQLALLCTQYHPSHRPRMSEVIRMLEGEPGLA  204

Query  207  EKWEASQ-RAETPRHGNT--VPQRYYDL--IEESSLVVEAMELSGPR  82
            E+WEASQ   +TP+  ++  +P +Y D    +ESSL +EAMELSGPR
Sbjct  205  ERWEASQSNVDTPKSVSSELLPPKYVDFAAADESSLGLEAMELSGPR  251



>ref|XP_004304172.1| PREDICTED: protein NSP-INTERACTING KINASE 1 [Fragaria vesca subsp. 
vesca]
Length=622

 Score =   357 bits (917),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 172/223 (77%), Positives = 198/223 (89%), Gaps = 2/223 (1%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RKRIALG ARGL+YLHEQCDPKIIHRDVKAAN+LLD+Y EAVVGDF LAKLLDH++SHV+
Sbjct  400  RKRIALGAARGLLYLHEQCDPKIIHRDVKAANVLLDDYCEAVVGDFDLAKLLDHQDSHVT  459

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGTIGHIAPEYLSTGQSS+KTDVFGFGILLLELITGQ A+EF K TNQK  +LD VK
Sbjct  460  TAVRGTIGHIAPEYLSTGQSSDKTDVFGFGILLLELITGQTALEFAKSTNQKGAILDWVK  519

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            +LHQE+KL ++VDKDL TN+DRIELEEM+QVALLCTQ+ P HRP+MSEV+RMLEGDGL E
Sbjct  520  KLHQEKKLEMLVDKDLNTNYDRIELEEMIQVALLCTQYLPGHRPRMSEVVRMLEGDGLVE  579

Query  204  KWEASQRAETPRHGN--TVPQRYYDLIEESSLVVEAMELSGPR  82
            +WEASQRAE+ +     +   RY DL ++SSL+V+AMELSGPR
Sbjct  580  RWEASQRAESTKSKAYFSSSDRYSDLTDDSSLLVQAMELSGPR  622



>gb|KJB80538.1| hypothetical protein B456_013G102600 [Gossypium raimondii]
Length=624

 Score =   357 bits (917),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 172/224 (77%), Positives = 199/224 (89%), Gaps = 3/224 (1%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RKRIALG ARGL+YLHEQCDPKIIHRDVKAANILLD+Y EA+VGDFGLAKLLDHR+SHV+
Sbjct  401  RKRIALGTARGLLYLHEQCDPKIIHRDVKAANILLDDYCEAIVGDFGLAKLLDHRDSHVT  460

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELI+G +A+EFGK  NQK  +LD V+
Sbjct  461  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELISGLRALEFGKTANQKGAILDWVR  520

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            ++HQE+KL ++VDKDL  N+DRIELEEMVQVALLCTQ+ P  RPKMSEV+RMLEGDGLAE
Sbjct  521  KVHQEKKLDMLVDKDLKNNYDRIELEEMVQVALLCTQYLPSQRPKMSEVVRMLEGDGLAE  580

Query  204  KWEASQRAETPR---HGNTVPQRYYDLIEESSLVVEAMELSGPR  82
            KWEASQ+AE  R   +  +  +RY DL ++SSL+V+AMELSGPR
Sbjct  581  KWEASQKAEATRSRANEFSSSERYSDLTDDSSLLVQAMELSGPR  624



>ref|XP_007139356.1| hypothetical protein PHAVU_008G022700g [Phaseolus vulgaris]
 ref|XP_007139357.1| hypothetical protein PHAVU_008G022700g [Phaseolus vulgaris]
 gb|ESW11350.1| hypothetical protein PHAVU_008G022700g [Phaseolus vulgaris]
 gb|ESW11351.1| hypothetical protein PHAVU_008G022700g [Phaseolus vulgaris]
Length=623

 Score =   357 bits (917),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 172/224 (77%), Positives = 199/224 (89%), Gaps = 3/224 (1%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RK IALG ARGL+YLHEQCDPKIIHRDVKAANILLD+Y EAVVGDFGLAKLLDH++SHV+
Sbjct  400  RKHIALGAARGLLYLHEQCDPKIIHRDVKAANILLDDYCEAVVGDFGLAKLLDHQDSHVT  459

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A+EFGK  N K  MLD VK
Sbjct  460  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQRALEFGKSANNKGAMLDWVK  519

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            ++HQE+KL ++VDKDL +N+DRIELEEMVQVALLCTQ+ P HRPKMSEV+RMLEGDGLAE
Sbjct  520  KIHQEKKLEILVDKDLKSNYDRIELEEMVQVALLCTQYLPGHRPKMSEVVRMLEGDGLAE  579

Query  204  KWEASQRAETPRHG---NTVPQRYYDLIEESSLVVEAMELSGPR  82
            +WEASQR +T ++    ++   RY DL ++S L+V+AMELSGPR
Sbjct  580  RWEASQRVDTTKYKPQESSSSDRYSDLTDDSLLLVQAMELSGPR  623



>ref|XP_008465988.1| PREDICTED: protein NSP-INTERACTING KINASE 2-like [Cucumis melo]
Length=623

 Score =   357 bits (917),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 171/223 (77%), Positives = 197/223 (88%), Gaps = 2/223 (1%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RKRIALG ARGL+YLHEQCDPKIIHRDVKAANILLD++ EAVVGDFGLAKLLDHR+SHV+
Sbjct  401  RKRIALGAARGLLYLHEQCDPKIIHRDVKAANILLDDFCEAVVGDFGLAKLLDHRDSHVT  460

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELI+GQ+A+EFGK  NQK  +LD VK
Sbjct  461  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELISGQRALEFGKAANQKGAILDWVK  520

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            ++HQE+KL ++VDKDL +N+DRIELEE+V+VALLC Q+ P HRPKMSEV+RMLEGDGLAE
Sbjct  521  KIHQEKKLEMLVDKDLRSNYDRIELEEIVRVALLCIQYLPSHRPKMSEVVRMLEGDGLAE  580

Query  204  KWEASQRAETPRH--GNTVPQRYYDLIEESSLVVEAMELSGPR  82
            KWEASQRAE  R        +RY DL ++SSL  +A+ELSGPR
Sbjct  581  KWEASQRAEASRSRANEFSSERYSDLTDDSSLFAQAIELSGPR  623



>ref|XP_010929457.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Elaeis guineensis]
Length=624

 Score =   357 bits (917),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 174/226 (77%), Positives = 198/226 (88%), Gaps = 7/226 (3%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RKRIALG ARGL+YLHEQCDPKIIHRDVKAANILLD+Y EAVVGDFGLAKLLDHR+SHV+
Sbjct  401  RKRIALGAARGLLYLHEQCDPKIIHRDVKAANILLDDYCEAVVGDFGLAKLLDHRDSHVT  460

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGIL+LELITG +A+EFGK  NQK  MLD VK
Sbjct  461  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILILELITGLRAMEFGKAANQKGAMLDWVK  520

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            ++HQE+KL ++VDKDL  ++DRIELEEMVQVALLCTQ+ P  RPKMSEV+RMLEGDGLAE
Sbjct  521  KIHQEKKLDMLVDKDLKNDYDRIELEEMVQVALLCTQYLPGQRPKMSEVVRMLEGDGLAE  580

Query  204  KWEASQRAETPRHGNTVP-----QRYYDLIEESSLVVEAMELSGPR  82
            +WEASQR E   H   +P     +RY DL ++SSL+V+AMELSGPR
Sbjct  581  RWEASQRVEA--HKFKMPEFSSSERYSDLTDDSSLLVQAMELSGPR  624



>gb|KHN13790.1| Protein NSP-INTERACTING KINASE 1 [Glycine soja]
Length=623

 Score =   357 bits (917),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 172/224 (77%), Positives = 197/224 (88%), Gaps = 3/224 (1%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RK IALG  RGL+YLHEQCDPKIIHRDVKAANILLD+Y+EAVVGDFGLAKLLDH++SHV+
Sbjct  400  RKHIALGAGRGLLYLHEQCDPKIIHRDVKAANILLDDYYEAVVGDFGLAKLLDHQDSHVT  459

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A+EFGK  N K  MLD VK
Sbjct  460  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQRALEFGKSANNKGAMLDWVK  519

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            ++HQE+KL ++VDKDL  N+DRIELEEMVQVALLCTQ+ P HRPKMSEV+RMLEGDGLAE
Sbjct  520  KIHQEKKLDMLVDKDLKNNYDRIELEEMVQVALLCTQYLPGHRPKMSEVVRMLEGDGLAE  579

Query  204  KWEASQRAETPR---HGNTVPQRYYDLIEESSLVVEAMELSGPR  82
            KWEASQR +T +     ++   RY DL ++S L+V+AMELSGPR
Sbjct  580  KWEASQRVDTTKCKPQESSSSDRYSDLTDDSLLLVQAMELSGPR  623



>ref|XP_003552626.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X1 [Glycine 
max]
 ref|XP_006602982.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X2 [Glycine 
max]
Length=623

 Score =   357 bits (917),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 172/224 (77%), Positives = 197/224 (88%), Gaps = 3/224 (1%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RK IALG  RGL+YLHEQCDPKIIHRDVKAANILLD+Y+EAVVGDFGLAKLLDH++SHV+
Sbjct  400  RKHIALGAGRGLLYLHEQCDPKIIHRDVKAANILLDDYYEAVVGDFGLAKLLDHQDSHVT  459

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A+EFGK  N K  MLD VK
Sbjct  460  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQRALEFGKSANNKGAMLDWVK  519

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            ++HQE+KL ++VDKDL  N+DRIELEEMVQVALLCTQ+ P HRPKMSEV+RMLEGDGLAE
Sbjct  520  KIHQEKKLDMLVDKDLKNNYDRIELEEMVQVALLCTQYLPGHRPKMSEVVRMLEGDGLAE  579

Query  204  KWEASQRAETPR---HGNTVPQRYYDLIEESSLVVEAMELSGPR  82
            KWEASQR +T +     ++   RY DL ++S L+V+AMELSGPR
Sbjct  580  KWEASQRVDTTKCKPQESSSSDRYSDLTDDSLLLVQAMELSGPR  623



>gb|KHG05227.1| nsp-interacting kinase 2 -like protein [Gossypium arboreum]
Length=624

 Score =   357 bits (917),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 172/224 (77%), Positives = 199/224 (89%), Gaps = 3/224 (1%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RKRIALG ARGL+YLHEQCDPKIIHRDVKAANILLD+Y EA+VGDFGLAKLLDHR+SHV+
Sbjct  401  RKRIALGTARGLLYLHEQCDPKIIHRDVKAANILLDDYCEAIVGDFGLAKLLDHRDSHVT  460

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELI+G +A+EFGK  NQK  +LD V+
Sbjct  461  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELISGLRALEFGKTANQKGAILDWVR  520

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            ++HQE+KL ++VDKDL  N+DRIELEEMVQVALLCTQ+ P  RPKMSEV+RMLEGDGLAE
Sbjct  521  KVHQEKKLDMLVDKDLKNNYDRIELEEMVQVALLCTQYLPSQRPKMSEVVRMLEGDGLAE  580

Query  204  KWEASQRAETPR---HGNTVPQRYYDLIEESSLVVEAMELSGPR  82
            KWEASQ+AE  R   +  +  +RY DL ++SSL+V+AMELSGPR
Sbjct  581  KWEASQKAEATRSRANEFSSSERYSDLTDDSSLLVQAMELSGPR  624



>ref|XP_004149504.1| PREDICTED: protein NSP-INTERACTING KINASE 2-like [Cucumis sativus]
 ref|XP_004164846.1| PREDICTED: protein NSP-INTERACTING KINASE 2-like [Cucumis sativus]
Length=623

 Score =   357 bits (917),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 171/224 (76%), Positives = 200/224 (89%), Gaps = 3/224 (1%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RKRIALG ARGL+YLHEQCDPKIIHRDVKAANILLD++ EAVVGDFGLAKLLDHR+SHV+
Sbjct  400  RKRIALGAARGLLYLHEQCDPKIIHRDVKAANILLDDFCEAVVGDFGLAKLLDHRDSHVT  459

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELI+GQ+A+EFGK  NQK  +LD VK
Sbjct  460  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELISGQRALEFGKAANQKGAILDWVK  519

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            ++HQE+KL ++VDKDL +N+DRIELEE+V+VALLC Q+ P HRPKMSEV+RMLEGDGLAE
Sbjct  520  KIHQEKKLEMLVDKDLRSNYDRIELEEIVRVALLCIQYLPSHRPKMSEVVRMLEGDGLAE  579

Query  204  KWEASQRAETPR---HGNTVPQRYYDLIEESSLVVEAMELSGPR  82
            KWEASQRAE  R   +  +  +RY DL ++SSL V+A++LSGPR
Sbjct  580  KWEASQRAEASRSRANEFSSSERYSDLTDDSSLFVQAIQLSGPR  623



>gb|KEH25223.1| NSP-interacting kinase-like protein [Medicago truncatula]
Length=625

 Score =   357 bits (916),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 171/225 (76%), Positives = 198/225 (88%), Gaps = 4/225 (2%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RK+IALG ARGL+YLHEQCDPKIIHRDVKAANILLD+Y EA+VGDFGLAKLLDH++SHV+
Sbjct  401  RKQIALGAARGLLYLHEQCDPKIIHRDVKAANILLDDYCEAIVGDFGLAKLLDHKDSHVT  460

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELITG +A+EFGK  NQK VMLD VK
Sbjct  461  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGLRALEFGKAANQKGVMLDWVK  520

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            ++HQE+KL L+VDKDL  N+D+ ELEE+VQVALLCTQ+ P HRPKMSEV+RMLEGDGLAE
Sbjct  521  KIHQEKKLDLLVDKDLKNNYDKNELEEIVQVALLCTQYLPAHRPKMSEVVRMLEGDGLAE  580

Query  204  KWEASQRAETPRHGN----TVPQRYYDLIEESSLVVEAMELSGPR  82
            KWEASQRA+    G     +   R+ DL ++SSL+++AMELSGPR
Sbjct  581  KWEASQRADNTTKGKPYELSSSDRFSDLTDDSSLLIQAMELSGPR  625



>gb|KHN14464.1| Protein NSP-INTERACTING KINASE 1 [Glycine soja]
Length=623

 Score =   357 bits (916),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 171/224 (76%), Positives = 198/224 (88%), Gaps = 3/224 (1%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RK IALG  RGL+YLHEQCDPKIIHRDVKAANILLD+Y+EAVVGDFGLAKLLDH++SHV+
Sbjct  400  RKHIALGAGRGLLYLHEQCDPKIIHRDVKAANILLDDYYEAVVGDFGLAKLLDHQDSHVT  459

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A+EFGK  N K  MLD VK
Sbjct  460  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQRALEFGKSANNKGAMLDWVK  519

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            ++HQE+KL ++VDKDL +N+DRIELEEMVQVALLCTQ+ P HRPKMSEV+RMLEGDGLAE
Sbjct  520  KIHQEKKLEMLVDKDLKSNYDRIELEEMVQVALLCTQYLPGHRPKMSEVVRMLEGDGLAE  579

Query  204  KWEASQRAETPR---HGNTVPQRYYDLIEESSLVVEAMELSGPR  82
            +WEASQR +T +     ++   RY DL ++S L+V+AMELSGPR
Sbjct  580  RWEASQRVDTTKCKPQESSSSDRYSDLTDDSLLLVQAMELSGPR  623



>ref|XP_002278965.1| PREDICTED: protein NSP-INTERACTING KINASE 1 [Vitis vinifera]
Length=624

 Score =   357 bits (915),  Expect = 8e-116, Method: Compositional matrix adjust.
 Identities = 172/224 (77%), Positives = 199/224 (89%), Gaps = 3/224 (1%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RKRIALG ARGL+YLHEQCDPKIIHRDVKAANILLD+Y EAVVGDFGLAKLLDH++SHV+
Sbjct  401  RKRIALGAARGLLYLHEQCDPKIIHRDVKAANILLDDYCEAVVGDFGLAKLLDHQDSHVT  460

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A+EFGK  NQK  MLD VK
Sbjct  461  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQRALEFGKAANQKGAMLDWVK  520

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            ++HQE++L ++VDKDL   +DR+ELEEMVQVALLCTQ+ P HRPKMSEV++MLEGDGLAE
Sbjct  521  KIHQEKRLEILVDKDLKHFYDRVELEEMVQVALLCTQYLPGHRPKMSEVVQMLEGDGLAE  580

Query  204  KWEASQRAETPR---HGNTVPQRYYDLIEESSLVVEAMELSGPR  82
            +WEASQR E  +   H  +  +RY DL ++SSL+V+AMELSGPR
Sbjct  581  RWEASQRGEVTKCKPHELSSSERYSDLTDDSSLLVQAMELSGPR  624



>emb|CBI16897.3| unnamed protein product [Vitis vinifera]
Length=622

 Score =   357 bits (915),  Expect = 8e-116, Method: Compositional matrix adjust.
 Identities = 172/224 (77%), Positives = 199/224 (89%), Gaps = 3/224 (1%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RKRIALG ARGL+YLHEQCDPKIIHRDVKAANILLD+Y EAVVGDFGLAKLLDH++SHV+
Sbjct  399  RKRIALGAARGLLYLHEQCDPKIIHRDVKAANILLDDYCEAVVGDFGLAKLLDHQDSHVT  458

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A+EFGK  NQK  MLD VK
Sbjct  459  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQRALEFGKAANQKGAMLDWVK  518

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            ++HQE++L ++VDKDL   +DR+ELEEMVQVALLCTQ+ P HRPKMSEV++MLEGDGLAE
Sbjct  519  KIHQEKRLEILVDKDLKHFYDRVELEEMVQVALLCTQYLPGHRPKMSEVVQMLEGDGLAE  578

Query  204  KWEASQRAETPR---HGNTVPQRYYDLIEESSLVVEAMELSGPR  82
            +WEASQR E  +   H  +  +RY DL ++SSL+V+AMELSGPR
Sbjct  579  RWEASQRGEVTKCKPHELSSSERYSDLTDDSSLLVQAMELSGPR  622



>ref|XP_006348615.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Solanum tuberosum]
Length=621

 Score =   357 bits (915),  Expect = 8e-116, Method: Compositional matrix adjust.
 Identities = 172/224 (77%), Positives = 200/224 (89%), Gaps = 3/224 (1%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RKRIALG ARGL+YLHEQCDPKIIHRDVKAANILLD+  EAVVGDFGLAKLLDHR+SHV+
Sbjct  398  RKRIALGAARGLLYLHEQCDPKIIHRDVKAANILLDDDCEAVVGDFGLAKLLDHRDSHVT  457

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSS+KTDVFGFGILLLELI+GQ+A+EFGK  NQK +MLD VK
Sbjct  458  TAVRGTVGHIAPEYLSTGQSSDKTDVFGFGILLLELISGQRALEFGKAANQKGIMLDWVK  517

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            ++H E+KL L+V KDL   +DRIELEEMVQVAL+CTQ++P HRPK+SEV+RMLEGDGLAE
Sbjct  518  KIHLEKKLDLLVSKDLKDKYDRIELEEMVQVALICTQYHPSHRPKISEVVRMLEGDGLAE  577

Query  204  KWEASQRAETPR---HGNTVPQRYYDLIEESSLVVEAMELSGPR  82
            KWEASQRAE+ R   +  +  +RY DL ++SSL+V+AMELSGPR
Sbjct  578  KWEASQRAESTRCRANEFSSSERYSDLTDDSSLLVQAMELSGPR  621



>ref|XP_008341829.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Malus domestica]
Length=636

 Score =   357 bits (915),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 171/224 (76%), Positives = 197/224 (88%), Gaps = 3/224 (1%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RKRIALG  RGL+YLHEQCDPKIIHRDVKAANILLD+Y EAVVGDFGLAKLLDH++SHV+
Sbjct  413  RKRIALGAGRGLLYLHEQCDPKIIHRDVKAANILLDDYCEAVVGDFGLAKLLDHQDSHVT  472

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A+EFGK  NQK  +LD VK
Sbjct  473  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQRALEFGKAANQKGAILDWVK  532

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            ++HQE+ L ++VDKDL TN+DRIELEEMVQVALLCTQ+ P HRPKMSEV+RMLEGDGL E
Sbjct  533  KIHQEKTLEMLVDKDLKTNYDRIELEEMVQVALLCTQYLPGHRPKMSEVVRMLEGDGLVE  592

Query  204  KWEASQRAETPRHGN---TVPQRYYDLIEESSLVVEAMELSGPR  82
            +WEASQ+ E+ +      +   RY DL ++SSL+V+AMELSGPR
Sbjct  593  RWEASQKVESTKSKAPEFSSSDRYSDLTDDSSLLVQAMELSGPR  636



>ref|XP_006647834.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Oryza brachyantha]
Length=626

 Score =   356 bits (914),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 173/226 (77%), Positives = 201/226 (89%), Gaps = 7/226 (3%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RKRIALG ARGL+YLHEQCDPKIIHRDVKAANILLD+Y EA+VGDFGLAKLLDHR+SHV+
Sbjct  403  RKRIALGAARGLLYLHEQCDPKIIHRDVKAANILLDDYCEAIVGDFGLAKLLDHRDSHVT  462

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ A+EFGK +NQK  MLD VK
Sbjct  463  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQTALEFGKSSNQKGAMLDWVK  522

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            ++HQE+KL ++VDK L +N+DR+ELEEMVQVALLCTQ+ P HRP+MSEV+RMLEGDGLAE
Sbjct  523  KMHQEKKLDVLVDKGLRSNYDRVELEEMVQVALLCTQYLPGHRPRMSEVVRMLEGDGLAE  582

Query  204  KWEASQRAETPRHGNTVPQR-----YYDLIEESSLVVEAMELSGPR  82
            +WEASQRA++  H   VP+      Y DL ++SSL+V+A+ELSGPR
Sbjct  583  RWEASQRADS--HKFKVPEFTFGRCYSDLTDDSSLLVQAVELSGPR  626



>ref|XP_009373732.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Pyrus x bretschneideri]
Length=636

 Score =   356 bits (914),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 171/224 (76%), Positives = 197/224 (88%), Gaps = 3/224 (1%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RKRIALG  RGL+YLHEQCDPKIIHRDVKAANILLD+Y EAVVGDFGLAKLLDH++SHV+
Sbjct  413  RKRIALGAGRGLLYLHEQCDPKIIHRDVKAANILLDDYCEAVVGDFGLAKLLDHQDSHVT  472

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A+EFGK  NQK  +LD VK
Sbjct  473  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQRALEFGKAANQKGAILDWVK  532

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            ++HQE+ L ++VDKDL TN+DRIELEEMVQVALLCTQ+ P HRPKMSEV+RMLEGDGL E
Sbjct  533  KIHQEKTLEMLVDKDLTTNYDRIELEEMVQVALLCTQYLPGHRPKMSEVVRMLEGDGLVE  592

Query  204  KWEASQRAETPRHGN---TVPQRYYDLIEESSLVVEAMELSGPR  82
            +WEASQ+ E+ +      +   RY DL ++SSL+V+AMELSGPR
Sbjct  593  RWEASQKVESTKSKAPEFSSSDRYSDLTDDSSLLVQAMELSGPR  636



>ref|XP_004238646.1| PREDICTED: protein NSP-INTERACTING KINASE 3 [Solanum lycopersicum]
Length=603

 Score =   355 bits (912),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 178/224 (79%), Positives = 195/224 (87%), Gaps = 4/224 (2%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RK+IA G ARGLVYLHEQCDPKIIHRDVKAANILLDE FEAVVGDFGLAKLLDH +SHV+
Sbjct  381  RKKIAQGTARGLVYLHEQCDPKIIHRDVKAANILLDEEFEAVVGDFGLAKLLDHCDSHVT  440

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQK-VVMLDLV  388
            TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKA++FG+G NQK VVMLD V
Sbjct  441  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAMDFGRGANQKGVVMLDWV  500

Query  387  KRLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLA  208
            ++LHQE KL+LMVD +L  +F+RIELEEMV+VALLCT FNPCHRPKMSE LRMLEGDGLA
Sbjct  501  RKLHQEDKLNLMVDSNLRNSFERIELEEMVKVALLCTHFNPCHRPKMSEALRMLEGDGLA  560

Query  207  EKWEASQRAET--PRHGNTVPQRYYDLIEESSLVVEAMELSGPR  82
            E+W ASQ  ET   R     PQ Y D +++SSL VE MELSGPR
Sbjct  561  EQWAASQNLETRRKRAFEPTPQTYSDYVQDSSL-VEPMELSGPR  603



>ref|XP_006301740.1| hypothetical protein CARUB_v10022201mg [Capsella rubella]
 gb|EOA34638.1| hypothetical protein CARUB_v10022201mg [Capsella rubella]
Length=634

 Score =   356 bits (914),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 176/231 (76%), Positives = 197/231 (85%), Gaps = 10/231 (4%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RK+IA+G ARGLVYLHEQCDPKIIHRDVKAANILLDE FEAVVGDFGLAKLLDHR+SHV+
Sbjct  404  RKKIAVGTARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRDSHVT  463

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKA++FG+ ++QK VMLD VK
Sbjct  464  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRSSHQKGVMLDWVK  523

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            +LHQE KL  ++DKDL   FDR+ELEE+VQVALLCTQFNP HRPKMSEV++MLEGDGLAE
Sbjct  524  KLHQEGKLKQLIDKDLSDKFDRVELEEIVQVALLCTQFNPSHRPKMSEVMKMLEGDGLAE  583

Query  204  KWEASQRAETPRHGNTVPQ---------RYY-DLIEESSLVVEAMELSGPR  82
            +WEASQ          +P          RYY D I+ESSLVVEA+ELSGPR
Sbjct  584  RWEASQTGNGDSQPPPLPPGMVSSSPRVRYYSDYIQESSLVVEAIELSGPR  634



>ref|XP_009803966.1| PREDICTED: protein NSP-INTERACTING KINASE 2-like isoform X2 [Nicotiana 
sylvestris]
Length=602

 Score =   355 bits (911),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 173/227 (76%), Positives = 198/227 (87%), Gaps = 6/227 (3%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RK IALG ARGL+YLHEQCDPKIIHRDVKAANILLD+Y EAVVGDFGLAKLLDH +SHV+
Sbjct  376  RKSIALGAARGLLYLHEQCDPKIIHRDVKAANILLDDYCEAVVGDFGLAKLLDHHDSHVT  435

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSS+KTDVFGFGILLLELITGQ+A+EFGK  NQK  MLD VK
Sbjct  436  TAVRGTVGHIAPEYLSTGQSSDKTDVFGFGILLLELITGQRALEFGKAANQKGAMLDWVK  495

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            ++HQE+KL ++VDKD+  N+DRIELEEMVQVALLCTQ++P  RPKMSEV+RMLEGDGLAE
Sbjct  496  KIHQEKKLDMLVDKDMKNNYDRIELEEMVQVALLCTQYHPSQRPKMSEVVRMLEGDGLAE  555

Query  204  KWEASQRAETPRHGN-----TVPQRYYDLIE-ESSLVVEAMELSGPR  82
            KWEASQRAE     +     +  +RY DL + +SSL+V+AMELSGPR
Sbjct  556  KWEASQRAEPNTRCSRANEFSSSERYSDLTDNDSSLLVQAMELSGPR  602



>ref|XP_004507264.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Cicer arietinum]
Length=626

 Score =   356 bits (913),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 171/226 (76%), Positives = 198/226 (88%), Gaps = 5/226 (2%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RK+IALG ARGL+YLHEQCDPKIIHRDVKAANILLD+Y EAVVGDFGLAKLLDH++SHV+
Sbjct  401  RKQIALGAARGLLYLHEQCDPKIIHRDVKAANILLDDYCEAVVGDFGLAKLLDHKDSHVT  460

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELITG +A+EFGK  NQK  MLD VK
Sbjct  461  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGLRALEFGKAANQKGAMLDWVK  520

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            ++HQE+KL L+VDKDL  N+DRIEL+EMVQVALLCTQ+ P HRPKMSEV+RMLEGDGLA+
Sbjct  521  KIHQEKKLELLVDKDLKNNYDRIELDEMVQVALLCTQYLPGHRPKMSEVVRMLEGDGLAD  580

Query  204  KWEASQR-----AETPRHGNTVPQRYYDLIEESSLVVEAMELSGPR  82
            KWEASQ+      +  +H  +   RY DL ++SSL+++AMELSGPR
Sbjct  581  KWEASQKNVDNTTKCKQHELSSSDRYSDLTDDSSLLIQAMELSGPR  626



>ref|XP_009596697.1| PREDICTED: protein NSP-INTERACTING KINASE 2-like isoform X2 [Nicotiana 
tomentosiformis]
Length=603

 Score =   355 bits (911),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 173/227 (76%), Positives = 198/227 (87%), Gaps = 6/227 (3%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RK IALG ARGL+YLHEQCDPKIIHRDVKAANILLD+Y EAVVGDFGLAKLLDH +SHV+
Sbjct  377  RKSIALGAARGLLYLHEQCDPKIIHRDVKAANILLDDYCEAVVGDFGLAKLLDHHDSHVT  436

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSS+KTDVFGFGILLLELITGQ+A+EFGK  NQK  MLD VK
Sbjct  437  TAVRGTVGHIAPEYLSTGQSSDKTDVFGFGILLLELITGQRALEFGKAANQKGAMLDWVK  496

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            ++HQE+KL ++VDKD+  N+DRIELEEMVQVALLCTQ++P  RP+MSEV+RMLEGDGLAE
Sbjct  497  KIHQEKKLDMLVDKDMKNNYDRIELEEMVQVALLCTQYHPSQRPRMSEVVRMLEGDGLAE  556

Query  204  KWEASQRAETPRHGN-----TVPQRYYDLIE-ESSLVVEAMELSGPR  82
            KWEASQRAE     +     +  +RY DL E +SSL+V+AMELSGPR
Sbjct  557  KWEASQRAEPNTRCSRANEFSSSERYSDLTENDSSLLVQAMELSGPR  603



>dbj|BAB01326.1| receptor-like kinase [Arabidopsis thaliana]
Length=630

 Score =   356 bits (913),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 174/227 (77%), Positives = 198/227 (87%), Gaps = 6/227 (3%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RKRIALG  RGL+YLHEQCDPKIIHRDVKAANILLD+YFEAVVGDFGLAKLLDH ESHV+
Sbjct  404  RKRIALGAGRGLLYLHEQCDPKIIHRDVKAANILLDDYFEAVVGDFGLAKLLDHEESHVT  463

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELITG +A+EFGK  NQ+  +LD VK
Sbjct  464  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGLRALEFGKAANQRGAILDWVK  523

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            +L QE+KL  +VDKDL +N+DRIE+EEMVQVALLCTQ+ P HRPKMSEV+RMLEGDGL E
Sbjct  524  KLQQEKKLEQIVDKDLKSNYDRIEVEEMVQVALLCTQYLPIHRPKMSEVVRMLEGDGLVE  583

Query  204  KWEA-SQRAETPRHGN-----TVPQRYYDLIEESSLVVEAMELSGPR  82
            KWEA SQRAET R  +     +  +RY DL ++SS++V+AMELSGPR
Sbjct  584  KWEASSQRAETNRSYSKPNEFSSSERYSDLTDDSSVLVQAMELSGPR  630



>ref|XP_003531900.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Glycine max]
Length=623

 Score =   355 bits (912),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 170/224 (76%), Positives = 197/224 (88%), Gaps = 3/224 (1%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RK IALG  RGL+YLHEQCDPKIIHRDVKAANILLD+Y+EAVVGDFGLAKLLDH++SHV+
Sbjct  400  RKHIALGAGRGLLYLHEQCDPKIIHRDVKAANILLDDYYEAVVGDFGLAKLLDHQDSHVT  459

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A+EFGK  N K  MLD VK
Sbjct  460  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQRALEFGKSANNKGAMLDWVK  519

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            ++HQE+KL ++VDKDL +N+DRIE EEMVQVALLCTQ+ P HRPKMSEV+RMLEGDGLAE
Sbjct  520  KIHQEKKLEMLVDKDLKSNYDRIEFEEMVQVALLCTQYLPGHRPKMSEVVRMLEGDGLAE  579

Query  204  KWEASQRAETPR---HGNTVPQRYYDLIEESSLVVEAMELSGPR  82
            +WEASQR +T +     ++   RY DL ++S L+V+AMELSGPR
Sbjct  580  RWEASQRVDTTKCKPQESSSSDRYSDLTDDSLLLVQAMELSGPR  623



>ref|XP_009803965.1| PREDICTED: protein NSP-INTERACTING KINASE 2-like isoform X1 [Nicotiana 
sylvestris]
Length=620

 Score =   355 bits (912),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 173/227 (76%), Positives = 198/227 (87%), Gaps = 6/227 (3%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RK IALG ARGL+YLHEQCDPKIIHRDVKAANILLD+Y EAVVGDFGLAKLLDH +SHV+
Sbjct  394  RKSIALGAARGLLYLHEQCDPKIIHRDVKAANILLDDYCEAVVGDFGLAKLLDHHDSHVT  453

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSS+KTDVFGFGILLLELITGQ+A+EFGK  NQK  MLD VK
Sbjct  454  TAVRGTVGHIAPEYLSTGQSSDKTDVFGFGILLLELITGQRALEFGKAANQKGAMLDWVK  513

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            ++HQE+KL ++VDKD+  N+DRIELEEMVQVALLCTQ++P  RPKMSEV+RMLEGDGLAE
Sbjct  514  KIHQEKKLDMLVDKDMKNNYDRIELEEMVQVALLCTQYHPSQRPKMSEVVRMLEGDGLAE  573

Query  204  KWEASQRAETPRHGN-----TVPQRYYDLIE-ESSLVVEAMELSGPR  82
            KWEASQRAE     +     +  +RY DL + +SSL+V+AMELSGPR
Sbjct  574  KWEASQRAEPNTRCSRANEFSSSERYSDLTDNDSSLLVQAMELSGPR  620



>ref|XP_009596696.1| PREDICTED: protein NSP-INTERACTING KINASE 2-like isoform X1 [Nicotiana 
tomentosiformis]
Length=621

 Score =   355 bits (912),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 173/227 (76%), Positives = 198/227 (87%), Gaps = 6/227 (3%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RK IALG ARGL+YLHEQCDPKIIHRDVKAANILLD+Y EAVVGDFGLAKLLDH +SHV+
Sbjct  395  RKSIALGAARGLLYLHEQCDPKIIHRDVKAANILLDDYCEAVVGDFGLAKLLDHHDSHVT  454

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSS+KTDVFGFGILLLELITGQ+A+EFGK  NQK  MLD VK
Sbjct  455  TAVRGTVGHIAPEYLSTGQSSDKTDVFGFGILLLELITGQRALEFGKAANQKGAMLDWVK  514

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            ++HQE+KL ++VDKD+  N+DRIELEEMVQVALLCTQ++P  RP+MSEV+RMLEGDGLAE
Sbjct  515  KIHQEKKLDMLVDKDMKNNYDRIELEEMVQVALLCTQYHPSQRPRMSEVVRMLEGDGLAE  574

Query  204  KWEASQRAETPRHGN-----TVPQRYYDLIE-ESSLVVEAMELSGPR  82
            KWEASQRAE     +     +  +RY DL E +SSL+V+AMELSGPR
Sbjct  575  KWEASQRAEPNTRCSRANEFSSSERYSDLTENDSSLLVQAMELSGPR  621



>gb|EEC73926.1| hypothetical protein OsI_08784 [Oryza sativa Indica Group]
Length=627

 Score =   355 bits (912),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 172/226 (76%), Positives = 201/226 (89%), Gaps = 7/226 (3%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            R+RIALG ARGL+YLHEQCDPKIIHRDVKAANILLD+Y EA+VGDFGLAKLLDHR+SHV+
Sbjct  404  RQRIALGAARGLLYLHEQCDPKIIHRDVKAANILLDDYCEAIVGDFGLAKLLDHRDSHVT  463

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ A+EFGK +NQK  MLD VK
Sbjct  464  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQTALEFGKSSNQKGAMLDWVK  523

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            ++HQE+KL ++VDK L +N+DR+ELEEMVQVALLCTQ+ P HRP+MSEV+RMLEGDGLAE
Sbjct  524  KMHQEKKLDVLVDKGLRSNYDRVELEEMVQVALLCTQYLPGHRPRMSEVVRMLEGDGLAE  583

Query  204  KWEASQRAETPRHGNTVPQR-----YYDLIEESSLVVEAMELSGPR  82
            +WEASQRA++  H   VP+      Y DL ++SSL+V+A+ELSGPR
Sbjct  584  RWEASQRADS--HKFKVPEFTFGRCYSDLTDDSSLLVQAVELSGPR  627



>ref|NP_189183.2| NSP-interacting kinase 2 [Arabidopsis thaliana]
 sp|Q8RY65.1|NIK2_ARATH RecName: Full=Protein NSP-INTERACTING KINASE 2; AltName: Full=LRR 
receptor-like serine/threonine-protein kinase NIK2; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAL91629.1| AT3g25560/MWL2_18 [Arabidopsis thaliana]
 gb|AAO11535.1| At3g25560/MWL2_18 [Arabidopsis thaliana]
 gb|ACN59323.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AEE77026.1| NSP-interacting kinase 2 [Arabidopsis thaliana]
Length=635

 Score =   355 bits (912),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 174/227 (77%), Positives = 198/227 (87%), Gaps = 6/227 (3%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RKRIALG  RGL+YLHEQCDPKIIHRDVKAANILLD+YFEAVVGDFGLAKLLDH ESHV+
Sbjct  409  RKRIALGAGRGLLYLHEQCDPKIIHRDVKAANILLDDYFEAVVGDFGLAKLLDHEESHVT  468

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELITG +A+EFGK  NQ+  +LD VK
Sbjct  469  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGLRALEFGKAANQRGAILDWVK  528

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            +L QE+KL  +VDKDL +N+DRIE+EEMVQVALLCTQ+ P HRPKMSEV+RMLEGDGL E
Sbjct  529  KLQQEKKLEQIVDKDLKSNYDRIEVEEMVQVALLCTQYLPIHRPKMSEVVRMLEGDGLVE  588

Query  204  KWEA-SQRAETPRHGN-----TVPQRYYDLIEESSLVVEAMELSGPR  82
            KWEA SQRAET R  +     +  +RY DL ++SS++V+AMELSGPR
Sbjct  589  KWEASSQRAETNRSYSKPNEFSSSERYSDLTDDSSVLVQAMELSGPR  635



>ref|NP_974360.1| NSP-interacting kinase 2 [Arabidopsis thaliana]
 gb|AEE77027.1| NSP-interacting kinase 2 [Arabidopsis thaliana]
Length=636

 Score =   355 bits (912),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 174/227 (77%), Positives = 198/227 (87%), Gaps = 6/227 (3%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RKRIALG  RGL+YLHEQCDPKIIHRDVKAANILLD+YFEAVVGDFGLAKLLDH ESHV+
Sbjct  410  RKRIALGAGRGLLYLHEQCDPKIIHRDVKAANILLDDYFEAVVGDFGLAKLLDHEESHVT  469

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELITG +A+EFGK  NQ+  +LD VK
Sbjct  470  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGLRALEFGKAANQRGAILDWVK  529

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            +L QE+KL  +VDKDL +N+DRIE+EEMVQVALLCTQ+ P HRPKMSEV+RMLEGDGL E
Sbjct  530  KLQQEKKLEQIVDKDLKSNYDRIEVEEMVQVALLCTQYLPIHRPKMSEVVRMLEGDGLVE  589

Query  204  KWEA-SQRAETPRHGN-----TVPQRYYDLIEESSLVVEAMELSGPR  82
            KWEA SQRAET R  +     +  +RY DL ++SS++V+AMELSGPR
Sbjct  590  KWEASSQRAETNRSYSKPNEFSSSERYSDLTDDSSVLVQAMELSGPR  636



>ref|XP_002886588.1| nsp-interacting kinase 3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH62847.1| nsp-interacting kinase 3 [Arabidopsis lyrata subsp. lyrata]
Length=629

 Score =   355 bits (912),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 175/231 (76%), Positives = 196/231 (85%), Gaps = 10/231 (4%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RK+IA+G ARGLVYLHEQCDPKIIHRDVKAANILLDE FEAVVGDFGLAKLLDHR+SHV+
Sbjct  399  RKKIAVGTARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRDSHVT  458

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKA++FG+  +QK VMLD VK
Sbjct  459  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRSAHQKGVMLDWVK  518

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            +LHQE KL  ++DKDL   FDR+ELEE+VQVALLCTQFNP HRPKMSEV++MLEGDGLAE
Sbjct  519  KLHQEGKLKQLIDKDLNDKFDRVELEEIVQVALLCTQFNPSHRPKMSEVMKMLEGDGLAE  578

Query  204  KWEASQRAETPRHGNTVPQ---------RYY-DLIEESSLVVEAMELSGPR  82
            +WEA+Q          +P          RYY D I+ESSLVVEA+ELSGPR
Sbjct  579  RWEATQNGTAEHQPPPLPPGMVSSSPRVRYYSDYIQESSLVVEAIELSGPR  629



>gb|EEE57731.1| hypothetical protein OsJ_08242 [Oryza sativa Japonica Group]
Length=627

 Score =   355 bits (912),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 172/226 (76%), Positives = 201/226 (89%), Gaps = 7/226 (3%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            R+RIALG ARGL+YLHEQCDPKIIHRDVKAANILLD+Y EA+VGDFGLAKLLDHR+SHV+
Sbjct  404  RQRIALGAARGLLYLHEQCDPKIIHRDVKAANILLDDYCEAIVGDFGLAKLLDHRDSHVT  463

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ A+EFGK +NQK  MLD VK
Sbjct  464  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQTALEFGKSSNQKGAMLDWVK  523

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            ++HQE+KL ++VDK L +N+DR+ELEEMVQVALLCTQ+ P HRP+MSEV+RMLEGDGLAE
Sbjct  524  KMHQEKKLDVLVDKGLRSNYDRVELEEMVQVALLCTQYLPGHRPRMSEVVRMLEGDGLAE  583

Query  204  KWEASQRAETPRHGNTVPQR-----YYDLIEESSLVVEAMELSGPR  82
            +WEASQRA++  H   VP+      Y DL ++SSL+V+A+ELSGPR
Sbjct  584  RWEASQRADS--HKFKVPEFTFGRCYSDLTDDSSLLVQAVELSGPR  627



>ref|XP_010681338.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Beta vulgaris 
subsp. vulgaris]
Length=627

 Score =   355 bits (911),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 173/224 (77%), Positives = 198/224 (88%), Gaps = 3/224 (1%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RKRIALG ARGL+YLHEQCDPKIIHRDVKAANILLD+  EAVVGDFGLAKLLDHR+SHV+
Sbjct  404  RKRIALGAARGLLYLHEQCDPKIIHRDVKAANILLDDDCEAVVGDFGLAKLLDHRDSHVT  463

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A++FGK  NQK  MLD VK
Sbjct  464  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQRAIDFGKAANQKGAMLDWVK  523

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            +++QE+KL ++VDKDL  N+D IELEE+VQVALLCTQF P  RP+MSEV+RMLEGDGLAE
Sbjct  524  KINQEKKLEMLVDKDLKNNYDSIELEEIVQVALLCTQFLPNQRPRMSEVVRMLEGDGLAE  583

Query  204  KWEASQRAETPRHGNT---VPQRYYDLIEESSLVVEAMELSGPR  82
            KWEASQRA++ R   T     +RY DL ++SSL+V+AMELSGPR
Sbjct  584  KWEASQRADSTRSRVTEFSSSERYSDLTDDSSLLVQAMELSGPR  627



>ref|XP_006344295.1| PREDICTED: protein NSP-INTERACTING KINASE 2-like [Solanum tuberosum]
Length=620

 Score =   355 bits (910),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 171/225 (76%), Positives = 196/225 (87%), Gaps = 4/225 (2%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RK IALG ARGL+YLHEQCDPKIIHRDVKAANILLD+Y EAVVGDFGLAKLLDH +SHV+
Sbjct  396  RKGIALGSARGLLYLHEQCDPKIIHRDVKAANILLDDYCEAVVGDFGLAKLLDHHDSHVT  455

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSS+KTDVFGFGILLLELITGQ+A+EFGK  NQK  MLD V+
Sbjct  456  TAVRGTVGHIAPEYLSTGQSSDKTDVFGFGILLLELITGQRALEFGKAANQKGAMLDWVR  515

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            ++ QE+KL ++VDKD+   +D IELEEMVQVALLCTQ++P HRPKMSEV+RMLEGDGLAE
Sbjct  516  KIQQEKKLDMLVDKDMKNEYDTIELEEMVQVALLCTQYHPSHRPKMSEVVRMLEGDGLAE  575

Query  204  KWEASQRAETPRHGN----TVPQRYYDLIEESSLVVEAMELSGPR  82
            KWEASQRAE  R       +  +RY DL ++SSL+V+AMELSGPR
Sbjct  576  KWEASQRAEPTRCSRANEFSSSERYSDLTDDSSLLVQAMELSGPR  620



>emb|CDP02372.1| unnamed protein product [Coffea canephora]
Length=624

 Score =   355 bits (910),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 169/224 (75%), Positives = 197/224 (88%), Gaps = 3/224 (1%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RKRIA+G ARGL+YLHEQCDPKIIHRDVKAANILLD+Y EAVVGDFGLAKLLDH++SHV+
Sbjct  401  RKRIAIGAARGLLYLHEQCDPKIIHRDVKAANILLDDYCEAVVGDFGLAKLLDHQDSHVT  460

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A+EF K  NQK  MLD VK
Sbjct  461  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQRALEFNKAANQKGAMLDWVK  520

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            R+HQE+KL ++VDKDL  N+D IE+EEMVQVALLCTQ+ P HRPKMSEV++MLEGDGLAE
Sbjct  521  RIHQEKKLDILVDKDLRNNYDCIEVEEMVQVALLCTQYLPSHRPKMSEVIQMLEGDGLAE  580

Query  204  KWEASQRAETPRHGN---TVPQRYYDLIEESSLVVEAMELSGPR  82
            +WE SQR E+ ++     +  +RY DL ++SSL+ +AMELSGPR
Sbjct  581  RWEVSQRLESSKYRTQELSASERYSDLTDDSSLLAQAMELSGPR  624



>gb|AAB71968.1| Putative Serine/Threonine protein kinase [Arabidopsis thaliana]
Length=588

 Score =   353 bits (907),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 175/231 (76%), Positives = 196/231 (85%), Gaps = 10/231 (4%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RK+IA+G ARGLVYLHEQCDPKIIHRDVKAANILLDE FEAVVGDFGLAKLLDHR+SHV+
Sbjct  358  RKKIAVGTARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRDSHVT  417

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKA++FG+  +QK VMLD VK
Sbjct  418  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRSAHQKGVMLDWVK  477

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            +LHQE KL  ++DKDL   FDR+ELEE+VQVALLCTQFNP HRPKMSEV++MLEGDGLAE
Sbjct  478  KLHQEGKLKQLIDKDLNDKFDRVELEEIVQVALLCTQFNPSHRPKMSEVMKMLEGDGLAE  537

Query  204  KWEASQRAETPRHGNTVPQ---------RYY-DLIEESSLVVEAMELSGPR  82
            +WEA+Q          +P          RYY D I+ESSLVVEA+ELSGPR
Sbjct  538  RWEATQNGTGEHQPPPLPPGMVSSSPRVRYYSDYIQESSLVVEAIELSGPR  588



>ref|NP_001169689.1| LOC100383570 precursor [Zea mays]
 gb|ACN34528.1| unknown [Zea mays]
 tpg|DAA53256.1| TPA: putative leucine-rich repeat receptor-like protein kinase 
family protein [Zea mays]
Length=634

 Score =   355 bits (910),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 169/224 (75%), Positives = 201/224 (90%), Gaps = 3/224 (1%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RKRIALG ARGL+YLHEQCDPKIIHRDVKA+N+LLDEYFEA+VGDFGLAKLLDHRESHV+
Sbjct  411  RKRIALGTARGLLYLHEQCDPKIIHRDVKASNVLLDEYFEAIVGDFGLAKLLDHRESHVT  470

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFG+LL+ELITGQKA++FG+  NQK  +LD VK
Sbjct  471  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGVLLVELITGQKALDFGRVANQKGGVLDWVK  530

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            +LHQE++L  MVDKDLG+++DR+ELEEMVQV+LLCTQ++P HRP+MSEV+RMLEGDGLAE
Sbjct  531  KLHQEKQLGTMVDKDLGSSYDRVELEEMVQVSLLCTQYHPSHRPRMSEVIRMLEGDGLAE  590

Query  204  KWEASQRAETPRHGNT--VPQRYYDL-IEESSLVVEAMELSGPR  82
            +WEASQ  +TP   ++  + Q+Y D   +E SL +EAMELSGPR
Sbjct  591  RWEASQNVDTPESVSSELLLQKYMDFAADECSLGLEAMELSGPR  634



>ref|NP_176279.1| NSP-interacting kinase 3 [Arabidopsis thaliana]
 sp|Q93ZS4.1|NIK3_ARATH RecName: Full=Protein NSP-INTERACTING KINASE 3; AltName: Full=LRR 
receptor-like serine/threonine-protein kinase NIK3; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAL07143.1| putative receptor kinase [Arabidopsis thaliana]
 gb|AAN12912.1| putative receptor kinase [Arabidopsis thaliana]
 gb|ACN59261.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AEE33734.1| NSP-interacting kinase 3 [Arabidopsis thaliana]
Length=632

 Score =   354 bits (909),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 175/231 (76%), Positives = 196/231 (85%), Gaps = 10/231 (4%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RK+IA+G ARGLVYLHEQCDPKIIHRDVKAANILLDE FEAVVGDFGLAKLLDHR+SHV+
Sbjct  402  RKKIAVGTARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRDSHVT  461

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKA++FG+  +QK VMLD VK
Sbjct  462  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRSAHQKGVMLDWVK  521

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            +LHQE KL  ++DKDL   FDR+ELEE+VQVALLCTQFNP HRPKMSEV++MLEGDGLAE
Sbjct  522  KLHQEGKLKQLIDKDLNDKFDRVELEEIVQVALLCTQFNPSHRPKMSEVMKMLEGDGLAE  581

Query  204  KWEASQRAETPRHGNTVPQ---------RYY-DLIEESSLVVEAMELSGPR  82
            +WEA+Q          +P          RYY D I+ESSLVVEA+ELSGPR
Sbjct  582  RWEATQNGTGEHQPPPLPPGMVSSSPRVRYYSDYIQESSLVVEAIELSGPR  632



>ref|XP_002314905.1| hypothetical protein POPTR_0010s14410g [Populus trichocarpa]
 gb|EEF01076.1| hypothetical protein POPTR_0010s14410g [Populus trichocarpa]
Length=627

 Score =   354 bits (909),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 172/224 (77%), Positives = 196/224 (88%), Gaps = 3/224 (1%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RKR+ALG  RGL+YLHEQCDPKIIHRDVKAANILLD+Y EAVVGDFGLAKLLDH++SHV+
Sbjct  404  RKRVALGAGRGLLYLHEQCDPKIIHRDVKAANILLDDYCEAVVGDFGLAKLLDHQDSHVT  463

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELI+G +A+EFGK TNQK  +LD VK
Sbjct  464  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELISGLRALEFGKSTNQKGALLDWVK  523

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            ++HQE+KL L+VDKDL  N+D IEL+E VQVALLCTQ  P HRPKMSEV+RMLEGDGLAE
Sbjct  524  KIHQEKKLELLVDKDLKNNYDPIELDETVQVALLCTQNLPSHRPKMSEVVRMLEGDGLAE  583

Query  204  KWEASQRAETPRHGN---TVPQRYYDLIEESSLVVEAMELSGPR  82
            KWEASQRAE  R      +  +RY DL ++SSL+V+AMELSGPR
Sbjct  584  KWEASQRAEATRTRTIEFSSSERYSDLTDDSSLLVQAMELSGPR  627



>emb|CDY44608.1| BnaCnng11570D [Brassica napus]
Length=507

 Score =   350 bits (898),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 171/222 (77%), Positives = 196/222 (88%), Gaps = 5/222 (2%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RK+IA+G ARGLVYLHEQCDPKIIHRDVKAANILLDE FEAVVGDFGLAKLLDHR+SHV+
Sbjct  290  RKKIAVGTARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRDSHVT  349

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKA++FG+ ++QK VMLD VK
Sbjct  350  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRSSHQKGVMLDWVK  409

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            +LHQE KL  ++DKDL   +D +ELEE+VQVALLCTQFNP +RPKMSEV++MLEGDGLA+
Sbjct  410  KLHQEGKLKQLIDKDLNDKYDTVELEEIVQVALLCTQFNPSNRPKMSEVMKMLEGDGLAD  469

Query  204  KWEASQRAETPRHGNTVPQRYY-DLIEESSLVVEAMELSGPR  82
            +WEASQ         ++P  YY D I+ESSLVVEA+ELSGPR
Sbjct  470  RWEASQSGGA----KSLPPPYYSDYIQESSLVVEAIELSGPR  507



>emb|CDY61508.1| BnaCnng37930D [Brassica napus]
Length=507

 Score =   350 bits (898),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 171/222 (77%), Positives = 196/222 (88%), Gaps = 5/222 (2%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RK+IA+G ARGLVYLHEQCDPKIIHRDVKAANILLDE FEAVVGDFGLAKLLDHR+SHV+
Sbjct  290  RKKIAVGTARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRDSHVT  349

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKA++FG+ ++QK VMLD VK
Sbjct  350  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRSSHQKGVMLDWVK  409

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            +LHQE KL  ++DKDL   +D +ELEE+VQVALLCTQFNP +RPKMSEV++MLEGDGLA+
Sbjct  410  KLHQEGKLKQLIDKDLNDKYDTVELEEIVQVALLCTQFNPSNRPKMSEVMKMLEGDGLAD  469

Query  204  KWEASQRAETPRHGNTVPQRYY-DLIEESSLVVEAMELSGPR  82
            +WEASQ         ++P  YY D I+ESSLVVEA+ELSGPR
Sbjct  470  RWEASQSGGA----KSLPPPYYSDYIQESSLVVEAIELSGPR  507



>ref|XP_008783060.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Phoenix dactylifera]
Length=624

 Score =   353 bits (907),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 173/226 (77%), Positives = 196/226 (87%), Gaps = 7/226 (3%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RKRIALG ARGL+YLHEQCDPKIIHRDVKAANILLD+Y EAVVGDFGLAKLLDHR+SHV+
Sbjct  401  RKRIALGAARGLLYLHEQCDPKIIHRDVKAANILLDDYCEAVVGDFGLAKLLDHRDSHVT  460

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELITG +A+EFGK  NQK  MLD VK
Sbjct  461  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGLRAMEFGKAANQKGAMLDWVK  520

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            ++HQE+ L ++VDKDL  ++DRIELEEMVQVALLCT + P  RPKMSEV+RMLEGDGLAE
Sbjct  521  KIHQEKNLDMLVDKDLKNDYDRIELEEMVQVALLCTLYLPGQRPKMSEVVRMLEGDGLAE  580

Query  204  KWEASQRAETPRHGNTVP-----QRYYDLIEESSLVVEAMELSGPR  82
            +WEASQR E   H   +P     +RY DL ++SSL+V+AMELSGPR
Sbjct  581  RWEASQRVEA--HKFKMPEFSSSERYSDLTDDSSLLVQAMELSGPR  624



>ref|XP_004953781.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X1 [Setaria 
italica]
 ref|XP_004953782.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X2 [Setaria 
italica]
 ref|XP_004953783.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X3 [Setaria 
italica]
Length=624

 Score =   353 bits (906),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 173/226 (77%), Positives = 198/226 (88%), Gaps = 7/226 (3%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RKRIALG ARGL+YLHEQCDPKIIHRDVKAANILLD+  EA+VGDFGLAKLLDHRESHV+
Sbjct  401  RKRIALGAARGLLYLHEQCDPKIIHRDVKAANILLDDCCEAIVGDFGLAKLLDHRESHVT  460

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ A+EFGK +NQK  MLD VK
Sbjct  461  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQTALEFGKSSNQKGAMLDWVK  520

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            ++HQE++L ++VDK LG+ +DRIELEEMVQVALLCTQF P HRPKMSEV+RMLEGDGLAE
Sbjct  521  KMHQEKQLDILVDKGLGSKYDRIELEEMVQVALLCTQFLPGHRPKMSEVVRMLEGDGLAE  580

Query  204  KWEASQRAETPRHGNTVPQR-----YYDLIEESSLVVEAMELSGPR  82
            +WEASQ  ++  H   VP+      Y DL ++SSL+V+A+ELSGPR
Sbjct  581  RWEASQHTDS--HKFKVPEFTFSRCYSDLTDDSSLLVQAVELSGPR  624



>ref|XP_008459453.1| PREDICTED: protein NSP-INTERACTING KINASE 1 [Cucumis melo]
Length=626

 Score =   353 bits (906),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 170/224 (76%), Positives = 198/224 (88%), Gaps = 3/224 (1%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RKRIA+G ARGL+YLHEQCDPKIIHRDVKAANILLD+Y EAVVGDFGLAKLLDH++SHV+
Sbjct  403  RKRIAIGAARGLLYLHEQCDPKIIHRDVKAANILLDDYCEAVVGDFGLAKLLDHQDSHVT  462

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A+EFGK  NQK  +LD VK
Sbjct  463  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQRALEFGKAANQKGGILDWVK  522

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            R+H E+KL ++VDKDL  N+DR+ELEEMVQVALLCTQ+ P HRPKMSEV+RMLEG+GLA 
Sbjct  523  RIHLEKKLEVLVDKDLKANYDRVELEEMVQVALLCTQYLPGHRPKMSEVVRMLEGEGLAV  582

Query  204  KWEASQRAETPR---HGNTVPQRYYDLIEESSLVVEAMELSGPR  82
            +WEASQR ++ +   H  +   RY DL ++SSL+V+AMELSGPR
Sbjct  583  RWEASQRVDSTKCKPHDFSSSDRYSDLTDDSSLLVQAMELSGPR  626



>ref|XP_010418025.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X2 [Camelina 
sativa]
Length=633

 Score =   353 bits (906),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 174/231 (75%), Positives = 197/231 (85%), Gaps = 10/231 (4%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RK+IA+G ARGLVYLHEQCDPKIIHRDVKAANILLDE FEAVVGDFGLAKLLDHR+SHV+
Sbjct  403  RKKIAVGTARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRDSHVT  462

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKA++FG+ ++QK VMLD VK
Sbjct  463  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRSSHQKGVMLDWVK  522

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            +LHQE KL  ++DK+L   FDR+ELEE+VQVALLCTQFNP HRPKMSEV++MLEGDGLAE
Sbjct  523  KLHQEGKLKQLIDKELNDKFDRVELEEIVQVALLCTQFNPSHRPKMSEVMKMLEGDGLAE  582

Query  204  KWEASQRAETPRHGNTVPQ---------RYY-DLIEESSLVVEAMELSGPR  82
            +WEA+Q          +P          RYY D I+ESSLVVEA+ELSGPR
Sbjct  583  RWEATQNGTGESQPPPLPPGMMSSSPRVRYYSDYIQESSLVVEAIELSGPR  633



>ref|XP_010510906.1| PREDICTED: protein NSP-INTERACTING KINASE 3 isoform X1 [Camelina 
sativa]
Length=636

 Score =   353 bits (907),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 174/231 (75%), Positives = 197/231 (85%), Gaps = 10/231 (4%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RK+IA+G ARGLVYLHEQCDPKIIHRDVKAANILLDE FEAVVGDFGLAKLLDHR+SHV+
Sbjct  406  RKKIAVGTARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRDSHVT  465

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKA++FG+ ++QK VMLD VK
Sbjct  466  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRSSHQKGVMLDWVK  525

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            +LHQE KL  ++DK+L   FDR+ELEE+VQVALLCTQFNP HRPKMSEV++MLEGDGLAE
Sbjct  526  KLHQEGKLKQLIDKELNDKFDRVELEEIVQVALLCTQFNPSHRPKMSEVMKMLEGDGLAE  585

Query  204  KWEASQRAETPRHGNTVPQ---------RYY-DLIEESSLVVEAMELSGPR  82
            +WEA+Q          +P          RYY D I+ESSLVVEA+ELSGPR
Sbjct  586  RWEATQNGTGESQPPPLPPGMMSSSPRVRYYSDYIQESSLVVEAIELSGPR  636



>ref|XP_004141483.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Cucumis sativus]
 gb|KGN52542.1| hypothetical protein Csa_5G642730 [Cucumis sativus]
Length=626

 Score =   353 bits (905),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 170/224 (76%), Positives = 198/224 (88%), Gaps = 3/224 (1%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RKRIA+G ARGL+YLHEQCDPKIIHRDVKAANILLD+Y EAVVGDFGLAKLLDH++SHV+
Sbjct  403  RKRIAIGAARGLLYLHEQCDPKIIHRDVKAANILLDDYCEAVVGDFGLAKLLDHQDSHVT  462

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A+EFGK  NQK  +LD VK
Sbjct  463  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQRALEFGKAANQKGGILDWVK  522

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            R+H E+KL ++VDKDL  N+DR+ELEEMVQVALLCTQ+ P HRPKMSEV+RMLEG+GLA 
Sbjct  523  RIHLEKKLEVLVDKDLKANYDRVELEEMVQVALLCTQYLPGHRPKMSEVVRMLEGEGLAV  582

Query  204  KWEASQRAETPR---HGNTVPQRYYDLIEESSLVVEAMELSGPR  82
            +WEASQR ++ +   H  +   RY DL ++SSL+V+AMELSGPR
Sbjct  583  RWEASQRVDSTKCKPHDFSSSDRYSDLTDDSSLLVQAMELSGPR  626



>ref|XP_010549936.1| PREDICTED: protein NSP-INTERACTING KINASE 1 [Tarenaya hassleriana]
 gb|ABD96874.1| hypothetical protein [Cleome spinosa]
Length=634

 Score =   353 bits (906),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 170/227 (75%), Positives = 198/227 (87%), Gaps = 6/227 (3%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RKRIA+G ARGLVYLHEQCDPKIIHRDVKAANILLD+Y EAVVGDFGLAKLLDH++SHV+
Sbjct  408  RKRIAIGAARGLVYLHEQCDPKIIHRDVKAANILLDDYCEAVVGDFGLAKLLDHQDSHVT  467

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A+EF K  NQK  ML+ VK
Sbjct  468  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQRALEFSKAANQKGAMLEWVK  527

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            ++HQ++KL ++VDKDL  N+D IELEEMV+VALLCTQ+ P HRPKMSEV+RMLEGDGLAE
Sbjct  528  KIHQDKKLEVLVDKDLKGNYDGIELEEMVKVALLCTQYLPGHRPKMSEVVRMLEGDGLAE  587

Query  204  KWEASQRAETPRHGNTVPQ------RYYDLIEESSLVVEAMELSGPR  82
            +WEASQR E+    ++ P       RY DL ++S+L+V+AMELSGPR
Sbjct  588  RWEASQRTESTSKCSSRPNELSSSDRYSDLTDDSTLLVQAMELSGPR  634



>ref|XP_010418023.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X1 [Camelina 
sativa]
Length=636

 Score =   353 bits (906),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 174/231 (75%), Positives = 197/231 (85%), Gaps = 10/231 (4%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RK+IA+G ARGLVYLHEQCDPKIIHRDVKAANILLDE FEAVVGDFGLAKLLDHR+SHV+
Sbjct  406  RKKIAVGTARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRDSHVT  465

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKA++FG+ ++QK VMLD VK
Sbjct  466  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRSSHQKGVMLDWVK  525

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            +LHQE KL  ++DK+L   FDR+ELEE+VQVALLCTQFNP HRPKMSEV++MLEGDGLAE
Sbjct  526  KLHQEGKLKQLIDKELNDKFDRVELEEIVQVALLCTQFNPSHRPKMSEVMKMLEGDGLAE  585

Query  204  KWEASQRAETPRHGNTVPQ---------RYY-DLIEESSLVVEAMELSGPR  82
            +WEA+Q          +P          RYY D I+ESSLVVEA+ELSGPR
Sbjct  586  RWEATQNGTGESQPPPLPPGMMSSSPRVRYYSDYIQESSLVVEAIELSGPR  636



>gb|ABD96908.1| hypothetical protein [Cleome spinosa]
Length=630

 Score =   353 bits (905),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 173/231 (75%), Positives = 198/231 (86%), Gaps = 10/231 (4%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RKRIA+G ARGLVYLHEQCDPKIIHRDVKAANILLD+Y EAVVGDFGLAKLLDHRESHV+
Sbjct  400  RKRIAIGAARGLVYLHEQCDPKIIHRDVKAANILLDDYCEAVVGDFGLAKLLDHRESHVT  459

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A+EFGK  NQK  +LD VK
Sbjct  460  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQRALEFGKSANQKGAILDWVK  519

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            ++HQE+KL ++VDKDL  N+D +ELEE VQVALLCTQ+ P HRPKMSEV+RMLEGDGLAE
Sbjct  520  KIHQEKKLEVLVDKDLKNNYDHLELEETVQVALLCTQYLPGHRPKMSEVVRMLEGDGLAE  579

Query  204  KWEASQRAETP--------RHGN--TVPQRYYDLIEESSLVVEAMELSGPR  82
            +WEASQR ++         R  N  +   RY DL ++S+L+V+AMELSGPR
Sbjct  580  RWEASQRTDSTAKCSSSSSRRLNELSSSDRYSDLTDDSTLLVQAMELSGPR  630



>ref|XP_010510907.1| PREDICTED: protein NSP-INTERACTING KINASE 3 isoform X2 [Camelina 
sativa]
Length=633

 Score =   353 bits (905),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 174/231 (75%), Positives = 197/231 (85%), Gaps = 10/231 (4%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RK+IA+G ARGLVYLHEQCDPKIIHRDVKAANILLDE FEAVVGDFGLAKLLDHR+SHV+
Sbjct  403  RKKIAVGTARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRDSHVT  462

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKA++FG+ ++QK VMLD VK
Sbjct  463  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRSSHQKGVMLDWVK  522

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            +LHQE KL  ++DK+L   FDR+ELEE+VQVALLCTQFNP HRPKMSEV++MLEGDGLAE
Sbjct  523  KLHQEGKLKQLIDKELNDKFDRVELEEIVQVALLCTQFNPSHRPKMSEVMKMLEGDGLAE  582

Query  204  KWEASQRAETPRHGNTVPQ---------RYY-DLIEESSLVVEAMELSGPR  82
            +WEA+Q          +P          RYY D I+ESSLVVEA+ELSGPR
Sbjct  583  RWEATQNGTGESQPPPLPPGMMSSSPRVRYYSDYIQESSLVVEAIELSGPR  633



>ref|XP_009803321.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X2 [Nicotiana 
sylvestris]
Length=622

 Score =   353 bits (905),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 169/225 (75%), Positives = 197/225 (88%), Gaps = 4/225 (2%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RKRIALG ARGL+YLHEQCDPKIIHRDVKAANILLD+Y EAVVGDFGLAKLLDH+++HV+
Sbjct  398  RKRIALGAARGLLYLHEQCDPKIIHRDVKAANILLDDYCEAVVGDFGLAKLLDHQDTHVT  457

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELITG +A+EFGK  NQK  MLD VK
Sbjct  458  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGMRAIEFGKAANQKGAMLDWVK  517

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            ++HQE+KL ++VDKDL +N+DRIELEEMVQVALLCTQ+ P HRPKMSE++RMLEGDGLAE
Sbjct  518  KIHQEKKLDILVDKDLKSNYDRIELEEMVQVALLCTQYLPGHRPKMSEIVRMLEGDGLAE  577

Query  204  KWEASQRAETPRHGNT----VPQRYYDLIEESSLVVEAMELSGPR  82
            +WEASQ+ +      T      +R+ DL ++S L+V+AMELSGPR
Sbjct  578  RWEASQKFDGSNKYKTKELSSSERFSDLTDDSLLLVQAMELSGPR  622



>ref|XP_010558545.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010558546.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X1 [Tarenaya 
hassleriana]
Length=637

 Score =   353 bits (906),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 173/231 (75%), Positives = 198/231 (86%), Gaps = 10/231 (4%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RKRIA+G ARGLVYLHEQCDPKIIHRDVKAANILLD+Y EAVVGDFGLAKLLDHRESHV+
Sbjct  407  RKRIAIGAARGLVYLHEQCDPKIIHRDVKAANILLDDYCEAVVGDFGLAKLLDHRESHVT  466

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A+EFGK  NQK  +LD VK
Sbjct  467  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQRALEFGKSANQKGAILDWVK  526

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            ++HQE+KL ++VDKDL  N+D +ELEE VQVALLCTQ+ P HRPKMSEV+RMLEGDGLAE
Sbjct  527  KIHQEKKLEVLVDKDLKNNYDHLELEETVQVALLCTQYLPGHRPKMSEVVRMLEGDGLAE  586

Query  204  KWEASQRAETP--------RHGN--TVPQRYYDLIEESSLVVEAMELSGPR  82
            +WEASQR ++         R  N  +   RY DL ++S+L+V+AMELSGPR
Sbjct  587  RWEASQRTDSTAKCSSSSSRRLNELSSSDRYSDLTDDSTLLVQAMELSGPR  637



>ref|XP_010558548.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X2 [Tarenaya 
hassleriana]
Length=636

 Score =   353 bits (905),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 173/231 (75%), Positives = 198/231 (86%), Gaps = 10/231 (4%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RKRIA+G ARGLVYLHEQCDPKIIHRDVKAANILLD+Y EAVVGDFGLAKLLDHRESHV+
Sbjct  406  RKRIAIGAARGLVYLHEQCDPKIIHRDVKAANILLDDYCEAVVGDFGLAKLLDHRESHVT  465

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A+EFGK  NQK  +LD VK
Sbjct  466  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQRALEFGKSANQKGAILDWVK  525

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            ++HQE+KL ++VDKDL  N+D +ELEE VQVALLCTQ+ P HRPKMSEV+RMLEGDGLAE
Sbjct  526  KIHQEKKLEVLVDKDLKNNYDHLELEETVQVALLCTQYLPGHRPKMSEVVRMLEGDGLAE  585

Query  204  KWEASQRAETP--------RHGN--TVPQRYYDLIEESSLVVEAMELSGPR  82
            +WEASQR ++         R  N  +   RY DL ++S+L+V+AMELSGPR
Sbjct  586  RWEASQRTDSTAKCSSSSSRRLNELSSSDRYSDLTDDSTLLVQAMELSGPR  636



>ref|XP_009803320.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X1 [Nicotiana 
sylvestris]
Length=625

 Score =   352 bits (904),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 169/225 (75%), Positives = 197/225 (88%), Gaps = 4/225 (2%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RKRIALG ARGL+YLHEQCDPKIIHRDVKAANILLD+Y EAVVGDFGLAKLLDH+++HV+
Sbjct  401  RKRIALGAARGLLYLHEQCDPKIIHRDVKAANILLDDYCEAVVGDFGLAKLLDHQDTHVT  460

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELITG +A+EFGK  NQK  MLD VK
Sbjct  461  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGMRAIEFGKAANQKGAMLDWVK  520

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            ++HQE+KL ++VDKDL +N+DRIELEEMVQVALLCTQ+ P HRPKMSE++RMLEGDGLAE
Sbjct  521  KIHQEKKLDILVDKDLKSNYDRIELEEMVQVALLCTQYLPGHRPKMSEIVRMLEGDGLAE  580

Query  204  KWEASQRAETPRHGNT----VPQRYYDLIEESSLVVEAMELSGPR  82
            +WEASQ+ +      T      +R+ DL ++S L+V+AMELSGPR
Sbjct  581  RWEASQKFDGSNKYKTKELSSSERFSDLTDDSLLLVQAMELSGPR  625



>ref|XP_003563960.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Brachypodium 
distachyon]
Length=629

 Score =   352 bits (904),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 170/226 (75%), Positives = 202/226 (89%), Gaps = 7/226 (3%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RKRIALG ARGL+YLHEQCDPKIIHRDVKAAN+LLD+Y +A+VGDFGLAKLLDH++SHV+
Sbjct  406  RKRIALGAARGLLYLHEQCDPKIIHRDVKAANVLLDDYCDAIVGDFGLAKLLDHQDSHVT  465

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ A+EFGK +NQK  MLD VK
Sbjct  466  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQTALEFGKASNQKGAMLDWVK  525

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            ++HQE+KL ++VDK L +++DRIELEEMVQVALLCTQ+ P HRP+MSEV+RMLEGDGLAE
Sbjct  526  KMHQEKKLDVLVDKGLRSSYDRIELEEMVQVALLCTQYLPGHRPRMSEVVRMLEGDGLAE  585

Query  204  KWEASQRAETPRHGNTVPQR-----YYDLIEESSLVVEAMELSGPR  82
            +W+ASQRA++  H  TVP+      Y DL ++SSL+V+A+ELSGPR
Sbjct  586  RWQASQRADS--HKFTVPEFTFSRCYSDLTDDSSLLVQAVELSGPR  629



>ref|XP_002452616.1| hypothetical protein SORBIDRAFT_04g029170 [Sorghum bicolor]
 gb|EES05592.1| hypothetical protein SORBIDRAFT_04g029170 [Sorghum bicolor]
Length=626

 Score =   352 bits (904),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 173/226 (77%), Positives = 198/226 (88%), Gaps = 7/226 (3%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RKRIALG ARGL+YLHEQCDPKIIHRDVKAANILLD+  EA+VGDFGLAKLLDHRESHV+
Sbjct  403  RKRIALGAARGLLYLHEQCDPKIIHRDVKAANILLDDCCEAIVGDFGLAKLLDHRESHVT  462

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ A+EFGK +NQK  MLD VK
Sbjct  463  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQTALEFGKSSNQKGAMLDWVK  522

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            ++HQE++L ++VDK LG+ +DRIELEEMVQVALLCTQF P HRPKMSEV+RMLEGDGLAE
Sbjct  523  KMHQEKQLDILVDKGLGSKYDRIELEEMVQVALLCTQFLPGHRPKMSEVVRMLEGDGLAE  582

Query  204  KWEASQRAETPRHGNTVPQRYY-----DLIEESSLVVEAMELSGPR  82
            +WEASQ  E+  H   VP+  +     DL ++SSL+V+A+ELSGPR
Sbjct  583  RWEASQHTES--HKFKVPEFSFSRCHSDLTDDSSLLVQAVELSGPR  626



>gb|AHF18212.1| brassinosteroid insensitive 1-associated receptor kinase 1 [Saccharum 
hybrid cultivar]
Length=626

 Score =   352 bits (904),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 173/226 (77%), Positives = 198/226 (88%), Gaps = 7/226 (3%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RKRIALG ARGL+YLHEQCDPKIIHRDVKAANILLD+  EA+VGDFGLAKLLDHRESHV+
Sbjct  403  RKRIALGAARGLLYLHEQCDPKIIHRDVKAANILLDDCCEAIVGDFGLAKLLDHRESHVT  462

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ A+EFGK +NQK  MLD VK
Sbjct  463  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQTALEFGKSSNQKGAMLDWVK  522

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            ++HQE++L ++VDK LG+ +DRIELEEMVQVALLCTQF P HRPKMSEV+RMLEGDGLAE
Sbjct  523  KMHQEKQLDILVDKGLGSKYDRIELEEMVQVALLCTQFLPGHRPKMSEVVRMLEGDGLAE  582

Query  204  KWEASQRAETPRHGNTVPQRYY-----DLIEESSLVVEAMELSGPR  82
            +WEASQ  E+  H   VP+  +     DL ++SSL+V+A+ELSGPR
Sbjct  583  RWEASQHTES--HKFKVPEFSFSRCHSDLTDDSSLLVQAVELSGPR  626



>ref|XP_004236956.1| PREDICTED: protein NSP-INTERACTING KINASE 2 [Solanum lycopersicum]
Length=620

 Score =   352 bits (903),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 168/225 (75%), Positives = 196/225 (87%), Gaps = 4/225 (2%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RK IALG ARGL+YLHEQCDPKIIHRDVKAANILLD+Y EAVVGDFGLAKLLDH +SHV+
Sbjct  396  RKGIALGAARGLLYLHEQCDPKIIHRDVKAANILLDDYCEAVVGDFGLAKLLDHHDSHVT  455

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSS+KTDVFGFGILLLELITG++A+EFGK  NQK  MLD V+
Sbjct  456  TAVRGTVGHIAPEYLSTGQSSDKTDVFGFGILLLELITGERALEFGKAANQKGAMLDWVR  515

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            ++ QE++L ++VDKD+   +D IELEEMVQVALLCTQ++P HRPKMSEV+RMLEGDGLAE
Sbjct  516  KIQQEKRLDMLVDKDMKNEYDTIELEEMVQVALLCTQYHPSHRPKMSEVVRMLEGDGLAE  575

Query  204  KWEASQRAETPRHGN----TVPQRYYDLIEESSLVVEAMELSGPR  82
            KWEASQ AE  R+      +  +RY DL ++SSL+V+AMELSGPR
Sbjct  576  KWEASQTAEPTRYSRANEFSSSERYSDLTDDSSLLVQAMELSGPR  620



>ref|XP_004491764.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Cicer arietinum]
Length=629

 Score =   352 bits (903),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 170/227 (75%), Positives = 198/227 (87%), Gaps = 6/227 (3%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RK IALG ARGL+YLHEQCDPKIIHRDVKAANILLD Y+EAVVGDFGLAKLLDH++SHV+
Sbjct  403  RKNIALGAARGLLYLHEQCDPKIIHRDVKAANILLDNYYEAVVGDFGLAKLLDHQDSHVT  462

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A+EFGK  NQK  MLD VK
Sbjct  463  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQRALEFGKAANQKGAMLDWVK  522

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            ++HQE+KL L+VDKDL +N+D+ ELEEMVQVALLCTQ+ P +RPKMSEV+RMLEGDGLAE
Sbjct  523  KIHQEKKLELLVDKDLKSNYDKNELEEMVQVALLCTQYLPSNRPKMSEVVRMLEGDGLAE  582

Query  204  KWEASQR------AETPRHGNTVPQRYYDLIEESSLVVEAMELSGPR  82
            +WEA Q+      A+   H +++  RY DL ++S L+V+AMELSGPR
Sbjct  583  RWEAYQKTTDNSNAKYKPHESSLSDRYSDLTDDSLLLVQAMELSGPR  629



>ref|XP_006392114.1| hypothetical protein EUTSA_v10023342mg [Eutrema salsugineum]
 gb|ESQ29400.1| hypothetical protein EUTSA_v10023342mg [Eutrema salsugineum]
Length=634

 Score =   352 bits (904),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 175/231 (76%), Positives = 196/231 (85%), Gaps = 10/231 (4%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RK+IA+G ARGLVYLHEQCDPKIIHRDVKAANILLDE FEAVVGDFGLAKLLDHR+SHV+
Sbjct  404  RKKIAVGTARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRDSHVT  463

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKA++FG+ ++QK VMLD VK
Sbjct  464  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRSSHQKGVMLDWVK  523

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            +LHQE KL  ++DKDL   FDR+ELEE+VQVALLCTQFNP  RPKMSEV++MLEGDGLAE
Sbjct  524  KLHQEGKLKQLIDKDLNDKFDRVELEEIVQVALLCTQFNPSFRPKMSEVMKMLEGDGLAE  583

Query  204  KWEASQRAETPRHGNTVPQ---------RYY-DLIEESSLVVEAMELSGPR  82
            +WEASQ          +P          RYY D I+ESSLVVEA+ELSGPR
Sbjct  584  RWEASQNGAAESLPPPLPSGMVSSSPRVRYYSDYIQESSLVVEAIELSGPR  634



>gb|KDP31451.1| hypothetical protein JCGZ_11827 [Jatropha curcas]
Length=621

 Score =   352 bits (903),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 171/226 (76%), Positives = 198/226 (88%), Gaps = 7/226 (3%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RKRIALG ARGL+YLHEQCDPKIIHRDVKAANILLD+Y EAVVGDFGLAKLLDHRESH++
Sbjct  398  RKRIALGAARGLLYLHEQCDPKIIHRDVKAANILLDDYCEAVVGDFGLAKLLDHRESHIT  457

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            T V+GT+GHIAPEYLSTGQSSEKTDVFGFG+LL+ELI+G +A+EFGK + QK  MLD VK
Sbjct  458  TTVKGTVGHIAPEYLSTGQSSEKTDVFGFGMLLVELISGLRALEFGKSSKQKGAMLDWVK  517

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            +++ E+KL L+VDKDL  N+DRIELEEMV+VALLCTQ+ P HRPKMSEV+RMLEGDGLAE
Sbjct  518  KINHEKKLELLVDKDLKNNYDRIELEEMVRVALLCTQYYPTHRPKMSEVVRMLEGDGLAE  577

Query  204  KWEASQRAETPRHGNTV-----PQRYYDLIEESSLVVEAMELSGPR  82
            KWEASQRAE    G+ V      +RY DL ++SSL+V+AMELSGPR
Sbjct  578  KWEASQRAEAT--GSRVAEFSSSERYSDLTDDSSLLVQAMELSGPR  621



>ref|XP_011099082.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X2 [Sesamum 
indicum]
Length=627

 Score =   352 bits (903),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 171/224 (76%), Positives = 197/224 (88%), Gaps = 3/224 (1%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RKRIALG ARGL+YLHEQCDPKIIHRDVKAANILLD+Y EAVVGDFGLAKLLDH++SHV+
Sbjct  404  RKRIALGAARGLLYLHEQCDPKIIHRDVKAANILLDDYCEAVVGDFGLAKLLDHQDSHVT  463

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A++FGK  NQK  +LD VK
Sbjct  464  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQRALQFGKSANQKGAVLDWVK  523

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            +LHQE+KL  +VDKDL  N+DRIELEEMVQVALLCTQ+ P  RPKMSEV+RMLEGDGLAE
Sbjct  524  KLHQEKKLEDLVDKDLKNNYDRIELEEMVQVALLCTQYLPGLRPKMSEVVRMLEGDGLAE  583

Query  204  KWEASQRAETPRHGN---TVPQRYYDLIEESSLVVEAMELSGPR  82
            +WEASQR E+ +      +  +RY DL ++SSL+ +A+ELSGPR
Sbjct  584  RWEASQRLESNKLKTQELSSSERYSDLTDDSSLLAQAIELSGPR  627



>ref|XP_007045670.1| LRR receptor-like serine/threonine-protein kinase [Theobroma 
cacao]
 gb|EOY01502.1| LRR receptor-like serine/threonine-protein kinase [Theobroma 
cacao]
Length=926

 Score =   360 bits (923),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 173/224 (77%), Positives = 198/224 (88%), Gaps = 3/224 (1%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RKRIALG ARGL+YLHEQCDPKIIHRDVKAANILLD+Y EA+VGDFGLAKLLDHR+SHV+
Sbjct  703  RKRIALGAARGLLYLHEQCDPKIIHRDVKAANILLDDYCEAIVGDFGLAKLLDHRDSHVT  762

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELI+G +A+EFGK  NQK  MLD V+
Sbjct  763  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELISGLRALEFGKTANQKGAMLDWVR  822

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            ++H E+KL ++VDKDL  N+DRIELEEM QVALLCTQ+ P HRPKMSEV+RMLEGDGLAE
Sbjct  823  KIHLEKKLEMLVDKDLKNNYDRIELEEMAQVALLCTQYLPSHRPKMSEVVRMLEGDGLAE  882

Query  204  KWEASQRAETPR---HGNTVPQRYYDLIEESSLVVEAMELSGPR  82
            KWEASQRAE  R   +  +  +RY DL ++SSL+V+AMELSGPR
Sbjct  883  KWEASQRAEATRSRANEFSSSERYSDLTDDSSLLVQAMELSGPR  926



>ref|XP_011099081.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X1 [Sesamum 
indicum]
Length=631

 Score =   352 bits (902),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 171/224 (76%), Positives = 197/224 (88%), Gaps = 3/224 (1%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RKRIALG ARGL+YLHEQCDPKIIHRDVKAANILLD+Y EAVVGDFGLAKLLDH++SHV+
Sbjct  408  RKRIALGAARGLLYLHEQCDPKIIHRDVKAANILLDDYCEAVVGDFGLAKLLDHQDSHVT  467

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A++FGK  NQK  +LD VK
Sbjct  468  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQRALQFGKSANQKGAVLDWVK  527

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            +LHQE+KL  +VDKDL  N+DRIELEEMVQVALLCTQ+ P  RPKMSEV+RMLEGDGLAE
Sbjct  528  KLHQEKKLEDLVDKDLKNNYDRIELEEMVQVALLCTQYLPGLRPKMSEVVRMLEGDGLAE  587

Query  204  KWEASQRAETPRHGN---TVPQRYYDLIEESSLVVEAMELSGPR  82
            +WEASQR E+ +      +  +RY DL ++SSL+ +A+ELSGPR
Sbjct  588  RWEASQRLESNKLKTQELSSSERYSDLTDDSSLLAQAIELSGPR  631



>ref|XP_002436855.1| hypothetical protein SORBIDRAFT_10g010010 [Sorghum bicolor]
 gb|EER88222.1| hypothetical protein SORBIDRAFT_10g010010 [Sorghum bicolor]
Length=629

 Score =   352 bits (902),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 173/226 (77%), Positives = 197/226 (87%), Gaps = 7/226 (3%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RKRIALG  RGL+YLHEQCDPKIIHRDVKAANILLD+Y EA+VGDFGLAKLLDHR+SHV+
Sbjct  406  RKRIALGAGRGLLYLHEQCDPKIIHRDVKAANILLDDYCEAIVGDFGLAKLLDHRDSHVT  465

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ A+EFGK  NQK  MLD VK
Sbjct  466  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQTALEFGKAANQKGAMLDWVK  525

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            ++HQE+KL ++VDK L   +DRIELEEMVQVALLCTQ+ P HRPKMSEV+RMLEGDGLAE
Sbjct  526  KMHQEKKLDVLVDKGLRGGYDRIELEEMVQVALLCTQYLPGHRPKMSEVVRMLEGDGLAE  585

Query  204  KWEASQRAETPRHGNTVP-----QRYYDLIEESSLVVEAMELSGPR  82
            +WEASQRA++  H   VP     + Y DL ++SSL+V+A+ELSGPR
Sbjct  586  RWEASQRADS--HKFKVPDFTFSRCYSDLTDDSSLLVQAVELSGPR  629



>ref|XP_010473259.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X1 [Camelina 
sativa]
Length=636

 Score =   352 bits (902),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 173/231 (75%), Positives = 196/231 (85%), Gaps = 10/231 (4%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RK+IA+G ARGLVYLHEQCDPKIIHRDVKAANILLDE FEAVVGDFGLAKLLDHR+SHV+
Sbjct  406  RKKIAVGTARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRDSHVT  465

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKA++FG+ ++QK VMLD V 
Sbjct  466  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRSSHQKGVMLDWVT  525

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            +LHQE KL  ++DK+L   FDR+ELEE+VQVALLCTQFNP HRPKMSEV++MLEGDGLAE
Sbjct  526  KLHQEGKLKQLIDKELNDKFDRVELEEIVQVALLCTQFNPSHRPKMSEVMKMLEGDGLAE  585

Query  204  KWEASQRAETPRHGNTVPQ---------RYY-DLIEESSLVVEAMELSGPR  82
            +WEA+Q          +P          RYY D I+ESSLVVEA+ELSGPR
Sbjct  586  RWEATQNGTGESQPPPLPPGMMSSSPRVRYYSDYIQESSLVVEAIELSGPR  636



>ref|XP_010473260.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X2 [Camelina 
sativa]
Length=633

 Score =   352 bits (902),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 173/231 (75%), Positives = 196/231 (85%), Gaps = 10/231 (4%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RK+IA+G ARGLVYLHEQCDPKIIHRDVKAANILLDE FEAVVGDFGLAKLLDHR+SHV+
Sbjct  403  RKKIAVGTARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRDSHVT  462

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKA++FG+ ++QK VMLD V 
Sbjct  463  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRSSHQKGVMLDWVT  522

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            +LHQE KL  ++DK+L   FDR+ELEE+VQVALLCTQFNP HRPKMSEV++MLEGDGLAE
Sbjct  523  KLHQEGKLKQLIDKELNDKFDRVELEEIVQVALLCTQFNPSHRPKMSEVMKMLEGDGLAE  582

Query  204  KWEASQRAETPRHGNTVPQ---------RYY-DLIEESSLVVEAMELSGPR  82
            +WEA+Q          +P          RYY D I+ESSLVVEA+ELSGPR
Sbjct  583  RWEATQNGTGESQPPPLPPGMMSSSPRVRYYSDYIQESSLVVEAIELSGPR  633



>ref|XP_009630581.1| PREDICTED: protein NSP-INTERACTING KINASE 1 [Nicotiana tomentosiformis]
Length=625

 Score =   351 bits (900),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 168/225 (75%), Positives = 197/225 (88%), Gaps = 4/225 (2%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RKRIALG ARGL+YLHEQCDPKIIHRDVKAANILLD+Y EAVVGDFGLAKLLDH+++HV+
Sbjct  401  RKRIALGAARGLLYLHEQCDPKIIHRDVKAANILLDDYCEAVVGDFGLAKLLDHQDTHVT  460

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELITG +A+EFGK  NQK  MLD VK
Sbjct  461  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGMRAIEFGKAANQKGAMLDWVK  520

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            ++HQE+KL ++VDK+L +N+DRIELEEMVQVALLCTQ+ P HRPKMSE++RMLEGDGLAE
Sbjct  521  KIHQEKKLDILVDKELKSNYDRIELEEMVQVALLCTQYLPGHRPKMSEIVRMLEGDGLAE  580

Query  204  KWEASQRAETPRHGNT----VPQRYYDLIEESSLVVEAMELSGPR  82
            +WEASQ+ +      T      +R+ DL ++S L+V+AMELSGPR
Sbjct  581  RWEASQKFDGSNKYKTKELSSSERFSDLTDDSLLLVQAMELSGPR  625



>dbj|BAJ89901.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=625

 Score =   351 bits (900),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 170/226 (75%), Positives = 201/226 (89%), Gaps = 7/226 (3%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RKRIALG ARGL+YLHEQCDPKIIHRDVKAAN+LLD+  EA+VGDFGLAKLLDH++SHV+
Sbjct  402  RKRIALGAARGLLYLHEQCDPKIIHRDVKAANVLLDDCCEAIVGDFGLAKLLDHQDSHVT  461

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ A+EFGK +NQK  MLD VK
Sbjct  462  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQTALEFGKASNQKGAMLDWVK  521

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            ++HQE+KL ++VDK L +++DRIELEEMVQVALLCTQ+ P HRP+MSEV+RMLEGDGLAE
Sbjct  522  KMHQEKKLDMLVDKGLRSSYDRIELEEMVQVALLCTQYLPGHRPRMSEVVRMLEGDGLAE  581

Query  204  KWEASQRAETPRHGNTVPQR-----YYDLIEESSLVVEAMELSGPR  82
            +W+ASQRA++  H  TVP+      Y DL ++SSL+V+A+ELSGPR
Sbjct  582  RWQASQRADS--HKFTVPEFTFSRCYSDLTDDSSLLVQAVELSGPR  625



>ref|XP_002876917.1| nsp-interacting kinase 2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH53176.1| nsp-interacting kinase 2 [Arabidopsis lyrata subsp. lyrata]
Length=636

 Score =   351 bits (900),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 173/227 (76%), Positives = 196/227 (86%), Gaps = 6/227 (3%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RKRIALG  RGL+YLHEQCDPKIIHRDVKAANILLD Y EAVVGDFGLAKLLDH ESHV+
Sbjct  410  RKRIALGAGRGLLYLHEQCDPKIIHRDVKAANILLDHYCEAVVGDFGLAKLLDHEESHVT  469

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELITG +A+EFGK  NQ+  +LD VK
Sbjct  470  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGLRALEFGKAANQRGAILDWVK  529

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            +L QE+KL  +VDKDL +N+DRIE+EEMVQVALLCTQ+ P HRPKMSEV+RMLEGDGL E
Sbjct  530  KLQQEKKLEQIVDKDLKSNYDRIEVEEMVQVALLCTQYLPIHRPKMSEVVRMLEGDGLVE  589

Query  204  KWEA-SQRAETPRHGN-----TVPQRYYDLIEESSLVVEAMELSGPR  82
            KWEA SQRAET R  +     +  +RY DL ++SS++V+AMELSGPR
Sbjct  590  KWEASSQRAETNRSYSKPNEFSSSERYSDLTDDSSVLVQAMELSGPR  636



>ref|XP_008807034.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X2 [Phoenix 
dactylifera]
Length=604

 Score =   350 bits (898),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 172/226 (76%), Positives = 195/226 (86%), Gaps = 7/226 (3%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RKRIALG ARGL+YLHEQCDPKIIHRDVKAANILLD+  EA+VGDFGLAKLLDHR+SHV+
Sbjct  381  RKRIALGAARGLLYLHEQCDPKIIHRDVKAANILLDDCCEAIVGDFGLAKLLDHRDSHVT  440

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ A+EFGK  NQK  MLD VK
Sbjct  441  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQTALEFGKAANQKGAMLDWVK  500

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            ++HQE+KL  +VDKDL  N+DRIELEEMVQVALLCTQ+ P HRPKMSEV+RMLEGDGLAE
Sbjct  501  KIHQEKKLDTLVDKDLRDNYDRIELEEMVQVALLCTQYLPGHRPKMSEVVRMLEGDGLAE  560

Query  204  KWEASQRAETPRHGNTVPQR-----YYDLIEESSLVVEAMELSGPR  82
            +WEASQR +   H   +P+      + DL ++SSL+ +AMELSGPR
Sbjct  561  RWEASQRVDA--HMFKLPEFSSERCFSDLTDDSSLLAQAMELSGPR  604



>emb|CDY46185.1| BnaA01g23070D [Brassica napus]
Length=636

 Score =   351 bits (900),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 173/231 (75%), Positives = 197/231 (85%), Gaps = 10/231 (4%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RK+IA+G ARGLVYLHEQCDPKIIHRDVKAANILLDE FEAVVGDFGLAKLLDHR+SHV+
Sbjct  406  RKKIAVGTARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRDSHVT  465

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKA++FG+ ++QK VMLD VK
Sbjct  466  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRSSHQKGVMLDWVK  525

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            +LHQE KL  ++DKDL   +DR+ELEE+VQVALLCTQFNP +RPKMSEV++MLEGDGLA+
Sbjct  526  KLHQEGKLKQLIDKDLNDKYDRVELEEIVQVALLCTQFNPSNRPKMSEVMKMLEGDGLAD  585

Query  204  KWEASQRAETPRHGNTVPQ---------RYY-DLIEESSLVVEAMELSGPR  82
            +WEASQ          +P          RYY D I+ESSLVVEA+ELSGPR
Sbjct  586  RWEASQSGGAKSLPPPLPSGMVSSSPRVRYYSDYIQESSLVVEAIELSGPR  636



>ref|XP_010533910.1| PREDICTED: protein NSP-INTERACTING KINASE 3 [Tarenaya hassleriana]
Length=640

 Score =   351 bits (900),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 174/237 (73%), Positives = 198/237 (84%), Gaps = 16/237 (7%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RK+IALG ARGLVYLHEQCDPKIIHRDVKAANILLDE FEA+VGDFGLAKLLDHR+SHV+
Sbjct  404  RKKIALGTARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAIVGDFGLAKLLDHRDSHVT  463

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            T VRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKA++FG+ ++QK VMLD VK
Sbjct  464  TVVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRSSHQKGVMLDWVK  523

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            +LHQE KL+ +VDKDL   FDR+ELEE+VQVALLCTQFNP HRPKMSEVL+MLEGDGLAE
Sbjct  524  KLHQEGKLNQIVDKDLKGKFDRVELEEIVQVALLCTQFNPLHRPKMSEVLKMLEGDGLAE  583

Query  204  KWEASQRAETPRHG----------------NTVPQRYYDLIEESSLVVEAMELSGPR  82
            +WEASQ     R+                 ++ P  Y + I++SSLVVEA+ELSGPR
Sbjct  584  RWEASQSQSQNRNAEQMLMRLRSRSWCEPSSSPPVMYSEYIQDSSLVVEAIELSGPR  640



>ref|XP_009104018.1| PREDICTED: protein NSP-INTERACTING KINASE 3 isoform X1 [Brassica 
rapa]
Length=636

 Score =   350 bits (899),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 173/231 (75%), Positives = 197/231 (85%), Gaps = 10/231 (4%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RK+IA+G ARGLVYLHEQCDPKIIHRDVKAANILLDE FEAVVGDFGLAKLLDHR+SHV+
Sbjct  406  RKKIAVGTARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRDSHVT  465

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKA++FG+ ++QK VMLD VK
Sbjct  466  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRSSHQKGVMLDWVK  525

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            +LHQE KL  ++DKDL   +DR+ELEE+VQVALLCTQFNP +RPKMSEV++MLEGDGLA+
Sbjct  526  KLHQEGKLKQLIDKDLNDKYDRVELEEIVQVALLCTQFNPSNRPKMSEVMKMLEGDGLAD  585

Query  204  KWEASQRAETPRHGNTVPQ---------RYY-DLIEESSLVVEAMELSGPR  82
            +WEASQ          +P          RYY D I+ESSLVVEA+ELSGPR
Sbjct  586  RWEASQSGGAKSLPPPLPSGMVSSSPRVRYYSDYIQESSLVVEAIELSGPR  636



>gb|AFO67891.1| leucine-rich repeat receptor-like kinase (mitochondrion) [Brassica 
rapa subsp. oleifera]
Length=635

 Score =   350 bits (899),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 173/231 (75%), Positives = 197/231 (85%), Gaps = 10/231 (4%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RK+IA+G ARGLVYLHEQCDPKIIHRDVKAANILLDE FEAVVGDFGLAKLLDHR+SHV+
Sbjct  405  RKKIAVGTARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRDSHVT  464

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKA++FG+ ++QK VMLD VK
Sbjct  465  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRSSHQKGVMLDWVK  524

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            +LHQE KL  ++DKDL   +DR+ELEE+VQVALLCTQFNP +RPKMSEV++MLEGDGLA+
Sbjct  525  KLHQEGKLKQLIDKDLNDKYDRVELEEIVQVALLCTQFNPSNRPKMSEVMKMLEGDGLAD  584

Query  204  KWEASQRAETPRHGNTVPQ---------RYY-DLIEESSLVVEAMELSGPR  82
            +WEASQ          +P          RYY D I+ESSLVVEA+ELSGPR
Sbjct  585  RWEASQSGGAKSLPPPLPSGMVSSSPRVRYYSDYIQESSLVVEAIELSGPR  635



>ref|XP_008811184.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Phoenix dactylifera]
Length=635

 Score =   350 bits (899),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 172/226 (76%), Positives = 195/226 (86%), Gaps = 7/226 (3%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RKRIALG ARGL+YLHEQCDPKIIHRDVKAANILLD+Y EA+VGDFGLAKLLDH +SHV+
Sbjct  412  RKRIALGAARGLLYLHEQCDPKIIHRDVKAANILLDDYCEAIVGDFGLAKLLDHGDSHVT  471

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAV GT+GHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ A+EFGK  NQK  MLD VK
Sbjct  472  TAVWGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQTALEFGKAANQKGAMLDWVK  531

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            ++HQE+KL+ +VDKDL  N+DRIELEEM+QVALLCTQ+ P HRPKMSEV+RMLEGDGLAE
Sbjct  532  KIHQEKKLATLVDKDLRNNYDRIELEEMIQVALLCTQYLPGHRPKMSEVVRMLEGDGLAE  591

Query  204  KWEASQRAETPRHGNTVPQR-----YYDLIEESSLVVEAMELSGPR  82
            +WEASQR E   H N +P+        DL ++S L+V+AMELSGPR
Sbjct  592  RWEASQRVEA--HKNKLPEFSSEHCSSDLTDDSLLLVQAMELSGPR  635



>ref|XP_009104025.1| PREDICTED: protein NSP-INTERACTING KINASE 3 isoform X2 [Brassica 
rapa]
Length=635

 Score =   350 bits (899),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 173/231 (75%), Positives = 197/231 (85%), Gaps = 10/231 (4%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RK+IA+G ARGLVYLHEQCDPKIIHRDVKAANILLDE FEAVVGDFGLAKLLDHR+SHV+
Sbjct  405  RKKIAVGTARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRDSHVT  464

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKA++FG+ ++QK VMLD VK
Sbjct  465  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRSSHQKGVMLDWVK  524

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            +LHQE KL  ++DKDL   +DR+ELEE+VQVALLCTQFNP +RPKMSEV++MLEGDGLA+
Sbjct  525  KLHQEGKLKQLIDKDLNDKYDRVELEEIVQVALLCTQFNPSNRPKMSEVMKMLEGDGLAD  584

Query  204  KWEASQRAETPRHGNTVPQ---------RYY-DLIEESSLVVEAMELSGPR  82
            +WEASQ          +P          RYY D I+ESSLVVEA+ELSGPR
Sbjct  585  RWEASQSGGAKSLPPPLPSGMVSSSPRVRYYSDYIQESSLVVEAIELSGPR  635



>ref|XP_008807033.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X1 [Phoenix 
dactylifera]
Length=624

 Score =   350 bits (898),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 172/226 (76%), Positives = 195/226 (86%), Gaps = 7/226 (3%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RKRIALG ARGL+YLHEQCDPKIIHRDVKAANILLD+  EA+VGDFGLAKLLDHR+SHV+
Sbjct  401  RKRIALGAARGLLYLHEQCDPKIIHRDVKAANILLDDCCEAIVGDFGLAKLLDHRDSHVT  460

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ A+EFGK  NQK  MLD VK
Sbjct  461  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQTALEFGKAANQKGAMLDWVK  520

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            ++HQE+KL  +VDKDL  N+DRIELEEMVQVALLCTQ+ P HRPKMSEV+RMLEGDGLAE
Sbjct  521  KIHQEKKLDTLVDKDLRDNYDRIELEEMVQVALLCTQYLPGHRPKMSEVVRMLEGDGLAE  580

Query  204  KWEASQRAETPRHGNTVPQR-----YYDLIEESSLVVEAMELSGPR  82
            +WEASQR +   H   +P+      + DL ++SSL+ +AMELSGPR
Sbjct  581  RWEASQRVDA--HMFKLPEFSSERCFSDLTDDSSLLAQAMELSGPR  624



>ref|NP_001146634.1| uncharacterized LOC100280233 precursor [Zea mays]
 ref|XP_008643516.1| PREDICTED: uncharacterized LOC100280233 isoform X1 [Zea mays]
 ref|XP_008643517.1| PREDICTED: uncharacterized LOC100280233 isoform X1 [Zea mays]
 ref|XP_008643518.1| PREDICTED: uncharacterized LOC100280233 isoform X1 [Zea mays]
 gb|ACL54438.1| unknown [Zea mays]
 gb|AFW73243.1| putative leucine-rich repeat receptor-like protein kinase family 
protein isoform 1 [Zea mays]
 gb|AFW73244.1| putative leucine-rich repeat receptor-like protein kinase family 
protein isoform 2 [Zea mays]
 gb|AFW73245.1| putative leucine-rich repeat receptor-like protein kinase family 
protein isoform 3 [Zea mays]
 gb|AFW73246.1| putative leucine-rich repeat receptor-like protein kinase family 
protein isoform 4 [Zea mays]
Length=626

 Score =   350 bits (898),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 172/226 (76%), Positives = 197/226 (87%), Gaps = 7/226 (3%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RKRIALG ARGL+YLHEQCDPKIIHRDVKAANILLD+  EA+VGDFGLAKLLDHRESHV+
Sbjct  403  RKRIALGAARGLLYLHEQCDPKIIHRDVKAANILLDDCCEAIVGDFGLAKLLDHRESHVT  462

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ A+EFGK +NQK  MLD VK
Sbjct  463  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQTALEFGKSSNQKGAMLDWVK  522

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            ++HQE++L ++VDK LG+ +DRIELEEMVQVALLCTQF P HRPKMSEV+RMLEGDGLAE
Sbjct  523  KMHQEKQLDILVDKGLGSKYDRIELEEMVQVALLCTQFLPGHRPKMSEVVRMLEGDGLAE  582

Query  204  KWEASQRAETPRHGNTVPQRYY-----DLIEESSLVVEAMELSGPR  82
            +WEA Q  E+  H   VP+  +     DL ++SSL+V+A+ELSGPR
Sbjct  583  RWEALQHTES--HKFKVPEFSFSRCHSDLTDDSSLLVQAVELSGPR  626



>ref|XP_006290715.1| hypothetical protein CARUB_v10016813mg [Capsella rubella]
 gb|EOA23613.1| hypothetical protein CARUB_v10016813mg [Capsella rubella]
Length=651

 Score =   350 bits (899),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 172/227 (76%), Positives = 196/227 (86%), Gaps = 6/227 (3%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RKRIALG  RGL+YLHEQCDPKIIHRDVKAANILLD+Y E VVGDFGLAKLLDH ESHV+
Sbjct  425  RKRIALGAGRGLLYLHEQCDPKIIHRDVKAANILLDDYCEGVVGDFGLAKLLDHEESHVT  484

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELITG +A+EFGK  NQ+  +LD VK
Sbjct  485  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGLRALEFGKAANQRGAILDWVK  544

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            +L QE+KL  +VDKDL +N+DRIE+EEMVQVALLCTQ+ P HRPKMSEV+RMLEGDGL E
Sbjct  545  KLQQEKKLEQIVDKDLKSNYDRIEVEEMVQVALLCTQYLPVHRPKMSEVVRMLEGDGLVE  604

Query  204  KWEA-SQRAETPRHGN-----TVPQRYYDLIEESSLVVEAMELSGPR  82
            KWEA SQRAET R  +     +  +RY DL ++SS++V+AMELSGPR
Sbjct  605  KWEASSQRAETNRSYSKPNEFSSSERYSDLTDDSSVLVQAMELSGPR  651



>ref|XP_010905760.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Elaeis guineensis]
Length=635

 Score =   350 bits (898),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 172/224 (77%), Positives = 195/224 (87%), Gaps = 3/224 (1%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RKRI+LG ARGL+YLHEQCDPKIIHRDVKAANILLD+Y EA+VGDFGLAKLLDHR+SHV+
Sbjct  412  RKRISLGAARGLLYLHEQCDPKIIHRDVKAANILLDDYCEAIVGDFGLAKLLDHRDSHVT  471

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ A+EFGK  NQK  MLD VK
Sbjct  472  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQTALEFGKAANQKGAMLDWVK  531

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            R+HQE+KL  +VDK L  ++DRIELEEMVQVALLCTQ+ P HRPKMSEV+RMLEGDGLAE
Sbjct  532  RIHQEKKLDTIVDKVLRNHYDRIELEEMVQVALLCTQYLPGHRPKMSEVVRMLEGDGLAE  591

Query  204  KWEASQRAETPR---HGNTVPQRYYDLIEESSLVVEAMELSGPR  82
            +WEASQR E  +   H  +  +   DL ++SSL+V+AMELSGPR
Sbjct  592  RWEASQRVEAYKCKLHEFSSERCSSDLTDDSSLLVQAMELSGPR  635



>ref|NP_001189971.1| NSP-interacting kinase 2 [Arabidopsis thaliana]
 gb|AEE77028.1| NSP-interacting kinase 2 [Arabidopsis thaliana]
Length=647

 Score =   350 bits (899),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 172/225 (76%), Positives = 196/225 (87%), Gaps = 6/225 (3%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RKRIALG  RGL+YLHEQCDPKIIHRDVKAANILLD+YFEAVVGDFGLAKLLDH ESHV+
Sbjct  409  RKRIALGAGRGLLYLHEQCDPKIIHRDVKAANILLDDYFEAVVGDFGLAKLLDHEESHVT  468

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELITG +A+EFGK  NQ+  +LD VK
Sbjct  469  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGLRALEFGKAANQRGAILDWVK  528

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            +L QE+KL  +VDKDL +N+DRIE+EEMVQVALLCTQ+ P HRPKMSEV+RMLEGDGL E
Sbjct  529  KLQQEKKLEQIVDKDLKSNYDRIEVEEMVQVALLCTQYLPIHRPKMSEVVRMLEGDGLVE  588

Query  204  KWEA-SQRAETPRHGN-----TVPQRYYDLIEESSLVVEAMELSG  88
            KWEA SQRAET R  +     +  +RY DL ++SS++V+AMELSG
Sbjct  589  KWEASSQRAETNRSYSKPNEFSSSERYSDLTDDSSVLVQAMELSG  633



>ref|XP_004232118.1| PREDICTED: protein NSP-INTERACTING KINASE 1 [Solanum lycopersicum]
Length=626

 Score =   350 bits (897),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 168/225 (75%), Positives = 197/225 (88%), Gaps = 4/225 (2%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RKRIA+G ARGL+YLHEQCDPKIIHRDVKAANILLD++ EAVVGDFGLAKLLDH++SHV+
Sbjct  402  RKRIAIGAARGLLYLHEQCDPKIIHRDVKAANILLDDFCEAVVGDFGLAKLLDHQDSHVT  461

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELITG +A+EFGK  NQK VMLD V+
Sbjct  462  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGMRAIEFGKAANQKGVMLDWVR  521

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            ++HQE+KL ++VDKDL  N+DRIELEEMVQVALLCTQ+ P HRPKMSE++RMLEGDGLAE
Sbjct  522  KIHQEKKLDVLVDKDLRINYDRIELEEMVQVALLCTQYLPGHRPKMSEIVRMLEGDGLAE  581

Query  204  KWEASQRAETPRHGNT----VPQRYYDLIEESSLVVEAMELSGPR  82
            +WEASQ+ +      T      +R+ DL ++S L+V+AMELSGPR
Sbjct  582  RWEASQKFDGSNKYKTKELSSSERFSDLTDDSLLLVQAMELSGPR  626



>ref|NP_197104.1| NSP-interacting kinase 1 [Arabidopsis thaliana]
 sp|Q9LFS4.1|NIK1_ARATH RecName: Full=Protein NSP-INTERACTING KINASE 1; AltName: Full=LRR 
receptor-like serine/threonine-protein kinase NIK1; Flags: 
Precursor [Arabidopsis thaliana]
 emb|CAC01799.1| receptor protein kinase-like protein [Arabidopsis thaliana]
 gb|AAL66960.1| putative receptor protein kinase [Arabidopsis thaliana]
 gb|AAN86199.1| putative receptor protein kinase [Arabidopsis thaliana]
 gb|ACN59368.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AED92233.1| NSP-interacting kinase 1 [Arabidopsis thaliana]
Length=638

 Score =   348 bits (894),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 172/230 (75%), Positives = 201/230 (87%), Gaps = 9/230 (4%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RKRIA+G ARGLVYLHEQCDPKIIHRDVKAANILLD+Y EAVVGDFGLAKLLDH++SHV+
Sbjct  409  RKRIAIGAARGLVYLHEQCDPKIIHRDVKAANILLDDYCEAVVGDFGLAKLLDHQDSHVT  468

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLEL+TGQ+A EFGK  NQK VMLD VK
Sbjct  469  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELVTGQRAFEFGKAANQKGVMLDWVK  528

Query  384  RLHQERKLSLMVDKDL--GTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGL  211
            ++HQE+KL L+VDK+L    ++D IEL+EMV+VALLCTQ+ P HRPKMSEV+RMLEGDGL
Sbjct  529  KIHQEKKLELLVDKELLKKKSYDEIELDEMVRVALLCTQYLPGHRPKMSEVVRMLEGDGL  588

Query  210  AEKWEASQRAET-PRHGNTVPQ------RYYDLIEESSLVVEAMELSGPR  82
            AEKWEASQR+++  +  N + +      RY DL ++SSL+V+AMELSGPR
Sbjct  589  AEKWEASQRSDSVSKCSNRINELMSSSDRYSDLTDDSSLLVQAMELSGPR  638



>ref|XP_004965216.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Setaria italica]
Length=661

 Score =   349 bits (896),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 172/226 (76%), Positives = 196/226 (87%), Gaps = 7/226 (3%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RKRIALG  RGL+YLHEQCDPKIIHRDVKAANILLD+Y EA+VGDFGLAKLLDHR+SHV+
Sbjct  438  RKRIALGAGRGLLYLHEQCDPKIIHRDVKAANILLDDYCEAIVGDFGLAKLLDHRDSHVT  497

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ A+EFGK  NQK  MLD VK
Sbjct  498  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQTALEFGKAANQKGAMLDWVK  557

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            ++HQE+KL ++VDK L   +DRIELEEMVQVALLCTQ+ P HRPKMSEV+RMLEGDGLAE
Sbjct  558  KMHQEKKLDVLVDKGLKGGYDRIELEEMVQVALLCTQYLPGHRPKMSEVVRMLEGDGLAE  617

Query  204  KWEASQRAETPRHGNTVPQR-----YYDLIEESSLVVEAMELSGPR  82
            +WEASQ A++  H   VP+      Y DL ++SSL+V+A+ELSGPR
Sbjct  618  RWEASQCADS--HKFKVPEFSFRRCYSDLTDDSSLLVQAVELSGPR  661



>gb|AAM65586.1| receptor protein kinase-like protein [Arabidopsis thaliana]
Length=629

 Score =   348 bits (893),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 172/230 (75%), Positives = 201/230 (87%), Gaps = 9/230 (4%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RKRIA+G ARGLVYLHEQCDPKIIHRDVKAANILLD+Y EAVVGDFGLAKLLDH++SHV+
Sbjct  400  RKRIAIGAARGLVYLHEQCDPKIIHRDVKAANILLDDYCEAVVGDFGLAKLLDHQDSHVT  459

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLEL+TGQ+A EFGK  NQK VMLD VK
Sbjct  460  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELVTGQRAFEFGKAANQKGVMLDWVK  519

Query  384  RLHQERKLSLMVDKDL--GTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGL  211
            ++HQE+KL L+VDK+L    ++D IEL+EMV+VALLCTQ+ P HRPKMSEV+RMLEGDGL
Sbjct  520  KIHQEKKLELLVDKELLKKKSYDEIELDEMVRVALLCTQYLPGHRPKMSEVVRMLEGDGL  579

Query  210  AEKWEASQRAET-PRHGNTVPQ------RYYDLIEESSLVVEAMELSGPR  82
            AEKWEASQR+++  +  N + +      RY DL ++SSL+V+AMELSGPR
Sbjct  580  AEKWEASQRSDSVSKCSNRINELMSSSDRYSDLTDDSSLLVQAMELSGPR  629



>ref|XP_006395648.1| hypothetical protein EUTSA_v10003811mg [Eutrema salsugineum]
 gb|ESQ32934.1| hypothetical protein EUTSA_v10003811mg [Eutrema salsugineum]
Length=643

 Score =   348 bits (894),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 171/227 (75%), Positives = 196/227 (86%), Gaps = 6/227 (3%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RKRIALG  RGL+YLHEQCDPKIIHRDVKAANILLDE+FEAVVGDFGLAKLLDH ESHV+
Sbjct  417  RKRIALGAGRGLLYLHEQCDPKIIHRDVKAANILLDEFFEAVVGDFGLAKLLDHEESHVT  476

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELITG +A+EFGK  NQ+  +LD VK
Sbjct  477  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGLRALEFGKAANQRGAILDWVK  536

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            +L QE+KL  ++DKDL  ++DRIE+EEMVQVALLCTQ+ P HRPKMSEV+RMLEGDGL E
Sbjct  537  KLQQEKKLEQIIDKDLKMHYDRIEVEEMVQVALLCTQYLPIHRPKMSEVVRMLEGDGLVE  596

Query  204  KWEA-SQRAETPRHGN-----TVPQRYYDLIEESSLVVEAMELSGPR  82
            KWEA SQR ET R  +     +  +RY DL ++SS++V+AMELSGPR
Sbjct  597  KWEASSQRTETNRSYSKPNEFSSSERYSDLTDDSSVLVQAMELSGPR  643



>ref|XP_010514169.1| PREDICTED: protein NSP-INTERACTING KINASE 2-like [Camelina sativa]
Length=646

 Score =   348 bits (894),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 171/227 (75%), Positives = 196/227 (86%), Gaps = 6/227 (3%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RKRIALG  RGL+YLHEQCDPKIIHRDVKAANILLD+Y E VVGDFGLAKLLDH+ESHV+
Sbjct  420  RKRIALGAGRGLLYLHEQCDPKIIHRDVKAANILLDDYCEGVVGDFGLAKLLDHKESHVT  479

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELITG +A+EFGK  NQ+  +LD VK
Sbjct  480  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGLRALEFGKAANQRGAILDWVK  539

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            +L QE+KL  +VDKDL +N+D IE+EEMVQVALLCTQ+ P HRPKMSEV+RMLEGDGL E
Sbjct  540  KLQQEKKLEQIVDKDLKSNYDGIEVEEMVQVALLCTQYLPVHRPKMSEVVRMLEGDGLVE  599

Query  204  KWEA-SQRAETPRHGN-----TVPQRYYDLIEESSLVVEAMELSGPR  82
            KWEA SQRAET R  +     +  +RY DL ++SS++V+AMELSGPR
Sbjct  600  KWEASSQRAETNRSYSKPNEFSSSERYSDLTDDSSVLVQAMELSGPR  646



>ref|XP_010927979.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X2 [Elaeis 
guineensis]
Length=591

 Score =   347 bits (889),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 170/226 (75%), Positives = 195/226 (86%), Gaps = 7/226 (3%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RKRIALG ARGL+YLHEQCDPKIIHRDVKAANILLD+  EA+VGDFGLAKLLDHR+SHV+
Sbjct  368  RKRIALGAARGLLYLHEQCDPKIIHRDVKAANILLDDCCEAIVGDFGLAKLLDHRDSHVT  427

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ A+EFGK  NQK  MLD VK
Sbjct  428  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQTALEFGKAANQKGAMLDWVK  487

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            ++HQ++KL ++VDKDL   +DRIELEEMVQVALLCTQ+ P HRPKMSEV+RMLEGDGLAE
Sbjct  488  KIHQDKKLDMLVDKDLRDKYDRIELEEMVQVALLCTQYLPGHRPKMSEVVRMLEGDGLAE  547

Query  204  KWEASQRAETPRHGNTVPQR-----YYDLIEESSLVVEAMELSGPR  82
            +WEASQR +   H   +P+      + DL ++SSL+ +AMELSGPR
Sbjct  548  RWEASQRVDA--HMFKLPEFSSERCFSDLTDDSSLLAQAMELSGPR  591



>ref|XP_004297175.1| PREDICTED: protein NSP-INTERACTING KINASE 2 [Fragaria vesca subsp. 
vesca]
Length=624

 Score =   347 bits (891),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 166/225 (74%), Positives = 196/225 (87%), Gaps = 4/225 (2%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RKRIA+G ARGL+YLHEQCDPKIIHRDVKAANILLD+Y+EAVVGDFGLAKLLDH ESH++
Sbjct  400  RKRIAIGAARGLLYLHEQCDPKIIHRDVKAANILLDDYYEAVVGDFGLAKLLDHHESHIT  459

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGIL+LELI+GQ+A+EFGK  NQK  +LD VK
Sbjct  460  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILVLELISGQRALEFGKAANQKGAILDWVK  519

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            ++ QE+K  ++VDK+L  ++D IELEEM+QVALLCTQ  P  RPKMSEV+RMLEGDGLAE
Sbjct  520  KIQQEKKFDMLVDKELKNDYDPIELEEMIQVALLCTQNLPGQRPKMSEVVRMLEGDGLAE  579

Query  204  KWEASQRAETPR----HGNTVPQRYYDLIEESSLVVEAMELSGPR  82
            KWEASQRAE+ R    +  +  +RY DL ++SSL+ +AMELSGPR
Sbjct  580  KWEASQRAESNRCRTNNDFSSSERYSDLTDDSSLLAQAMELSGPR  624



>gb|KFK39862.1| hypothetical protein AALP_AA3G298400 [Arabis alpina]
Length=631

 Score =   348 bits (892),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 170/227 (75%), Positives = 196/227 (86%), Gaps = 6/227 (3%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RKRIALG  RGL+YLHEQCDPKIIHRDVKAANILLD+Y EAVVGDFGLAKLLDH ESHV+
Sbjct  405  RKRIALGAGRGLLYLHEQCDPKIIHRDVKAANILLDDYCEAVVGDFGLAKLLDHEESHVT  464

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELITG +A+EFGK  NQ+  +L+ VK
Sbjct  465  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGLRALEFGKAANQRGAILEWVK  524

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            +L QE+KL  +VDKDL +N+DRIE+EEMVQVALLCTQ+ P HRPKMSEV+RMLEGDGL E
Sbjct  525  KLQQEKKLEQIVDKDLKSNYDRIEIEEMVQVALLCTQYLPIHRPKMSEVVRMLEGDGLVE  584

Query  204  KWEA-SQRAETPRHGN-----TVPQRYYDLIEESSLVVEAMELSGPR  82
            +WEA SQR ET R  +     +  +RY DL ++SS++V+AMELSGPR
Sbjct  585  RWEASSQRTETNRSYSKPNEFSTSERYSDLTDDSSVLVQAMELSGPR  631



>emb|CDY61461.1| BnaC01g43240D [Brassica napus]
Length=635

 Score =   348 bits (892),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 172/231 (74%), Positives = 196/231 (85%), Gaps = 10/231 (4%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RK+IA+G ARGLVYLHEQCDPKIIHRDVKAANILLDE FEAVVGDFGLAKLLDHR+SHV+
Sbjct  405  RKKIAVGTARGLVYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRDSHVT  464

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKA++FG+ ++QK VMLD VK
Sbjct  465  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRSSHQKGVMLDWVK  524

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            +LHQE KL  ++DKDL   +D +ELEE+VQVALLCTQFNP +RPKMSEV++MLEGDGLA+
Sbjct  525  KLHQEGKLKQLIDKDLNDKYDTVELEEIVQVALLCTQFNPSNRPKMSEVMKMLEGDGLAD  584

Query  204  KWEASQRAETPRHGNTVPQ---------RYY-DLIEESSLVVEAMELSGPR  82
            +WEASQ          +P          RYY D I+ESSLVVEA+ELSGPR
Sbjct  585  RWEASQSGGAKSLPPPLPSGMVSSSPRVRYYSDYIQESSLVVEAIELSGPR  635



>ref|XP_009391272.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=646

 Score =   348 bits (892),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 168/227 (74%), Positives = 199/227 (88%), Gaps = 8/227 (4%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RKRIA+G ARGL+YLHEQCDPKIIHRDVKAANILLD+Y EAVVGDFGLAKLLDHR+SHV+
Sbjct  422  RKRIAVGAARGLLYLHEQCDPKIIHRDVKAANILLDDYCEAVVGDFGLAKLLDHRDSHVT  481

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELITG+ A+EFGK  NQK  MLD VK
Sbjct  482  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGRTALEFGKSVNQKGTMLDWVK  541

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            ++HQE+KL L++DK+L  N+DRIELEEMV+VALLCTQF+P HRPKMSEV+RMLEGDGL E
Sbjct  542  KIHQEKKLELLMDKNLKHNYDRIELEEMVKVALLCTQFHPRHRPKMSEVVRMLEGDGLVE  601

Query  204  KWEASQRAETPRHGNTVPQR------YYDLIEESSLVVEAMELSGPR  82
            +WEASQR ++   G  +P+       Y +L ++SS++++A+ELSGPR
Sbjct  602  RWEASQRVDS--QGFKMPELAFSDRCYSNLTDDSSILIQAVELSGPR  646



>ref|XP_009391273.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=642

 Score =   348 bits (892),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 168/227 (74%), Positives = 199/227 (88%), Gaps = 8/227 (4%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RKRIA+G ARGL+YLHEQCDPKIIHRDVKAANILLD+Y EAVVGDFGLAKLLDHR+SHV+
Sbjct  418  RKRIAVGAARGLLYLHEQCDPKIIHRDVKAANILLDDYCEAVVGDFGLAKLLDHRDSHVT  477

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELITG+ A+EFGK  NQK  MLD VK
Sbjct  478  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGRTALEFGKSVNQKGTMLDWVK  537

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            ++HQE+KL L++DK+L  N+DRIELEEMV+VALLCTQF+P HRPKMSEV+RMLEGDGL E
Sbjct  538  KIHQEKKLELLMDKNLKHNYDRIELEEMVKVALLCTQFHPRHRPKMSEVVRMLEGDGLVE  597

Query  204  KWEASQRAETPRHGNTVPQR------YYDLIEESSLVVEAMELSGPR  82
            +WEASQR ++   G  +P+       Y +L ++SS++++A+ELSGPR
Sbjct  598  RWEASQRVDS--QGFKMPELAFSDRCYSNLTDDSSILIQAVELSGPR  642



>ref|XP_010927978.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X1 [Elaeis 
guineensis]
Length=635

 Score =   347 bits (891),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 170/226 (75%), Positives = 195/226 (86%), Gaps = 7/226 (3%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RKRIALG ARGL+YLHEQCDPKIIHRDVKAANILLD+  EA+VGDFGLAKLLDHR+SHV+
Sbjct  412  RKRIALGAARGLLYLHEQCDPKIIHRDVKAANILLDDCCEAIVGDFGLAKLLDHRDSHVT  471

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ A+EFGK  NQK  MLD VK
Sbjct  472  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQTALEFGKAANQKGAMLDWVK  531

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            ++HQ++KL ++VDKDL   +DRIELEEMVQVALLCTQ+ P HRPKMSEV+RMLEGDGLAE
Sbjct  532  KIHQDKKLDMLVDKDLRDKYDRIELEEMVQVALLCTQYLPGHRPKMSEVVRMLEGDGLAE  591

Query  204  KWEASQRAETPRHGNTVPQR-----YYDLIEESSLVVEAMELSGPR  82
            +WEASQR +   H   +P+      + DL ++SSL+ +AMELSGPR
Sbjct  592  RWEASQRVDA--HMFKLPEFSSERCFSDLTDDSSLLAQAMELSGPR  635



>ref|XP_010044332.1| PREDICTED: protein NSP-INTERACTING KINASE 2 [Eucalyptus grandis]
 gb|KCW86416.1| hypothetical protein EUGRSUZ_B03087 [Eucalyptus grandis]
Length=623

 Score =   347 bits (890),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 167/225 (74%), Positives = 197/225 (88%), Gaps = 4/225 (2%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RKRIALG ARGL+YLHEQCDPKIIHRDVKAANILLD+Y EAVVGDFGLAKLLDHRESHV+
Sbjct  399  RKRIALGAARGLLYLHEQCDPKIIHRDVKAANILLDDYCEAVVGDFGLAKLLDHRESHVT  458

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT GHIAPEYL +GQSSEKTDVFGFGILLLELITG +A+EFGK  NQ+  MLD V+
Sbjct  459  TAVRGTAGHIAPEYLLSGQSSEKTDVFGFGILLLELITGLRALEFGKAANQRGAMLDWVR  518

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            ++H E+K+ ++VDKDL  N+DRIELEE++QV+LLCTQ+ P +RPKMSEV+RMLEGDGL E
Sbjct  519  KVHLEKKIEMLVDKDLKDNYDRIELEEIIQVSLLCTQYLPTNRPKMSEVVRMLEGDGLVE  578

Query  204  KWEASQRAETPR----HGNTVPQRYYDLIEESSLVVEAMELSGPR  82
            KWEASQRAE+ R    +  +  +RY DL ++SSL+++AMELSGPR
Sbjct  579  KWEASQRAESTRCRAANEFSSSERYSDLTDDSSLLIQAMELSGPR  623



>ref|XP_010236002.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X2 [Brachypodium 
distachyon]
Length=627

 Score =   347 bits (890),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 169/226 (75%), Positives = 197/226 (87%), Gaps = 7/226 (3%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RK IALG ARGL+YLHEQCDPKIIHRDVKAAN+LLD++ EA+VGDFGLAKLLDHR+SHV+
Sbjct  404  RKGIALGAARGLLYLHEQCDPKIIHRDVKAANVLLDDFCEAIVGDFGLAKLLDHRDSHVT  463

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ A+EFGK +NQK  MLD VK
Sbjct  464  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQTALEFGKSSNQKGAMLDWVK  523

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            ++HQE+KL ++VDK L  ++D IELEEMVQVALLCTQ+ P HRPKMSEV+RMLEGDGLAE
Sbjct  524  KMHQEKKLDVLVDKGLRNSYDHIELEEMVQVALLCTQYLPGHRPKMSEVVRMLEGDGLAE  583

Query  204  KWEASQRAETPRHGNTVPQR-----YYDLIEESSLVVEAMELSGPR  82
            +WEASQR ++  H   VP+      Y DL ++SSL+V+A+ELSGPR
Sbjct  584  RWEASQRTDS--HKFKVPEFTFGRCYSDLTDDSSLLVQAVELSGPR  627



>ref|XP_003572984.2| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X1 [Brachypodium 
distachyon]
Length=628

 Score =   347 bits (890),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 169/226 (75%), Positives = 197/226 (87%), Gaps = 7/226 (3%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RK IALG ARGL+YLHEQCDPKIIHRDVKAAN+LLD++ EA+VGDFGLAKLLDHR+SHV+
Sbjct  405  RKGIALGAARGLLYLHEQCDPKIIHRDVKAANVLLDDFCEAIVGDFGLAKLLDHRDSHVT  464

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ A+EFGK +NQK  MLD VK
Sbjct  465  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQTALEFGKSSNQKGAMLDWVK  524

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            ++HQE+KL ++VDK L  ++D IELEEMVQVALLCTQ+ P HRPKMSEV+RMLEGDGLAE
Sbjct  525  KMHQEKKLDVLVDKGLRNSYDHIELEEMVQVALLCTQYLPGHRPKMSEVVRMLEGDGLAE  584

Query  204  KWEASQRAETPRHGNTVPQR-----YYDLIEESSLVVEAMELSGPR  82
            +WEASQR ++  H   VP+      Y DL ++SSL+V+A+ELSGPR
Sbjct  585  RWEASQRTDS--HKFKVPEFTFGRCYSDLTDDSSLLVQAVELSGPR  628



>ref|XP_009396215.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009396224.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Musa acuminata 
subsp. malaccensis]
Length=621

 Score =   346 bits (888),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 173/225 (77%), Positives = 197/225 (88%), Gaps = 8/225 (4%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RKRIALG ARGL+YLHEQCDPKIIHRDVKAANILLD+Y EAVVGDFGLAKLLDHR++HV+
Sbjct  401  RKRIALGAARGLLYLHEQCDPKIIHRDVKAANILLDDYCEAVVGDFGLAKLLDHRDTHVT  460

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSS+KTDVFGFGILLLELITG +A+E+GK   QK  MLD V+
Sbjct  461  TAVRGTVGHIAPEYLSTGQSSDKTDVFGFGILLLELITGLRALEYGKAAKQKGAMLDWVR  520

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            ++HQE+KL ++VDKDL  N+DRIELEEMVQVALLCTQ+ P HRPKMSEV+RMLEGDGLAE
Sbjct  521  KMHQEKKLDVLVDKDL-KNYDRIELEEMVQVALLCTQYVPGHRPKMSEVVRMLEGDGLAE  579

Query  204  KWEASQRAETPRHGNTVP----QRYYDLIEESSLVVEAMELSGPR  82
            +WEASQR E   H   VP    +RY DL ++ SL+VEAMELSGPR
Sbjct  580  RWEASQRTEV--HKFRVPEFSSERYSDLTDD-SLLVEAMELSGPR  621



>ref|XP_006338306.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Solanum tuberosum]
Length=626

 Score =   346 bits (888),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 167/225 (74%), Positives = 196/225 (87%), Gaps = 4/225 (2%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RKRIA+G ARGL+YLHEQCDPKIIHRDVKAANILLD++ EAVVGDFGLAKLLDH++SHV+
Sbjct  402  RKRIAIGAARGLLYLHEQCDPKIIHRDVKAANILLDDFCEAVVGDFGLAKLLDHQDSHVT  461

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELITG +A+EFGK  NQK VMLD V+
Sbjct  462  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGMRAIEFGKAANQKGVMLDWVR  521

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            ++HQE+KL ++VDKDL  N+DRIELEEMVQVALL TQ+ P HRPKMSE++RMLEGDGLAE
Sbjct  522  KIHQEKKLDVLVDKDLRINYDRIELEEMVQVALLSTQYLPGHRPKMSEIVRMLEGDGLAE  581

Query  204  KWEASQRAETPRHGNT----VPQRYYDLIEESSLVVEAMELSGPR  82
            +WEASQ+ +      T      +R+ DL ++S L+V+AMELSGPR
Sbjct  582  RWEASQKFDGSNKYKTKELSSSERFSDLTDDSLLLVQAMELSGPR  626



>ref|XP_010492459.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Camelina sativa]
Length=640

 Score =   347 bits (889),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 170/231 (74%), Positives = 201/231 (87%), Gaps = 10/231 (4%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RKRIA+G ARGLVYLHEQCDPKIIHRDVKAANILLD+Y EAVVGDFGLAKLLDH+++HV+
Sbjct  410  RKRIAIGAARGLVYLHEQCDPKIIHRDVKAANILLDDYCEAVVGDFGLAKLLDHQDTHVT  469

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLEL+TGQ+A EFGK  NQK VMLD VK
Sbjct  470  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELVTGQRAFEFGKAANQKGVMLDWVK  529

Query  384  RLHQERKLSLMVDKDL--GTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGL  211
            ++HQE+KL L+VDK+L    ++D IEL+EMV+VALLCTQ+ P HRPKMSEV+RMLEGDGL
Sbjct  530  KIHQEKKLELLVDKELLKKKSYDEIELDEMVRVALLCTQYLPGHRPKMSEVVRMLEGDGL  589

Query  210  AEKWEASQRAE--TPRHGNTVPQ------RYYDLIEESSLVVEAMELSGPR  82
            AE+WEASQR++  T +  N + +      RY DL ++S+L+V+AMELSGPR
Sbjct  590  AERWEASQRSDTSTSKCSNRINELMSSSDRYSDLTDDSTLLVQAMELSGPR  640



>gb|EYU44266.1| hypothetical protein MIMGU_mgv1a002951mg [Erythranthe guttata]
Length=622

 Score =   346 bits (887),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 168/224 (75%), Positives = 196/224 (88%), Gaps = 3/224 (1%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RKRIALG ARGL+YLHEQCDPKIIHRDVKAANILLDEY EAVVGDFGLAKLLDH++SHV+
Sbjct  399  RKRIALGAARGLLYLHEQCDPKIIHRDVKAANILLDEYCEAVVGDFGLAKLLDHQDSHVT  458

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELITG +A++FGK  NQK  +LD VK
Sbjct  459  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGLRALQFGKSANQKGAVLDWVK  518

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            +LHQE+KL  +VDKDL +N+D IELEE+VQVALLCTQ+ P  RPKMSE++RMLEGDGLAE
Sbjct  519  KLHQEKKLEEVVDKDLRSNYDIIELEEIVQVALLCTQYLPGLRPKMSEIVRMLEGDGLAE  578

Query  204  KWEASQRAETPRHGN---TVPQRYYDLIEESSLVVEAMELSGPR  82
            +WEASQR E+ +      +  +RY DL ++SSL+ +A+ELSGPR
Sbjct  579  RWEASQRLESNKFKTQELSSSERYSDLTDDSSLIAQAIELSGPR  622



>emb|CDY48073.1| BnaA06g33550D [Brassica napus]
Length=640

 Score =   346 bits (888),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 169/227 (74%), Positives = 196/227 (86%), Gaps = 6/227 (3%)
 Frame = -1

Query  744  RKRIALGIARGLVYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLDHRESHVS  565
            RKRIALG ARGL+YLHEQCDPKIIHRDVKAANILLD+Y+EAVVGDFGLAKLLDH ESHV+
Sbjct  414  RKRIALGAARGLLYLHEQCDPKIIHRDVKAANILLDDYYEAVVGDFGLAKLLDHEESHVT  473

Query  564  TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGKGTNQKVVMLDLVK  385
            TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELITG +A+EFGK  NQ+  +LD VK
Sbjct  474  TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGLRALEFGKAANQRGAILDWVK  533

Query  384  RLHQERKLSLMVDKDLGTNFDRIELEEMVQVALLCTQFNPCHRPKMSEVLRMLEGDGLAE  205
            +L QE+ L  ++DKDL  N+DRIE+EE+V+VALLCTQ+ P HRPKMSEV+RMLEGDGL E
Sbjct  534  KLQQEKNLEQIIDKDLERNYDRIEVEEIVKVALLCTQYLPIHRPKMSEVVRMLEGDGLVE  593

Query  204  KWEA-SQRAETPRHGN-----TVPQRYYDLIEESSLVVEAMELSGPR  82
            KWEA SQR ET R  +     +  +RY DL ++SS++V+AMELSGPR
Sbjct  594  KWEASSQRTETNRSYSKPNEFSSSERYSDLTDDSSVLVQAMELSGPR  640



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1360982043420