BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF009L22

Length=777
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_010938608.1|  PREDICTED: serine--glyoxylate aminotransfera...    438   2e-150   Elaeis guineensis
ref|XP_011090165.1|  PREDICTED: serine--glyoxylate aminotransferase     438   3e-150   Sesamum indicum [beniseed]
gb|EYU35937.1|  hypothetical protein MIMGU_mgv1a026291mg                435   6e-150   Erythranthe guttata [common monkey flower]
ref|NP_001265946.1|  Hop-interacting protein THI032                     436   1e-149   Solanum lycopersicum
ref|XP_006659561.1|  PREDICTED: serine--glyoxylate aminotransfera...    436   2e-149   Oryza brachyantha
ref|XP_009619693.1|  PREDICTED: serine--glyoxylate aminotransferase     435   4e-149   Nicotiana tomentosiformis
gb|AAL47679.1|  aminotransferase 1                                      434   4e-149   Cucumis melo [Oriental melon]
ref|XP_004139054.1|  PREDICTED: serine--glyoxylate aminotransfera...    434   5e-149   Cucumis sativus [cucumbers]
gb|KJB54393.1|  hypothetical protein B456_009G074800                    431   6e-149   Gossypium raimondii
gb|KJB83533.1|  hypothetical protein B456_013G252200                    432   8e-149   Gossypium raimondii
ref|XP_006349776.1|  PREDICTED: serine--glyoxylate aminotransfera...    434   8e-149   Solanum tuberosum [potatoes]
ref|XP_009338530.1|  PREDICTED: serine--glyoxylate aminotransfera...    433   1e-148   
ref|XP_009775939.1|  PREDICTED: serine--glyoxylate aminotransferase     433   1e-148   Nicotiana sylvestris
ref|XP_007212264.1|  hypothetical protein PRUPE_ppa006653mg             433   2e-148   Prunus persica
ref|XP_008227244.1|  PREDICTED: serine--glyoxylate aminotransferase     433   2e-148   Prunus mume [ume]
ref|XP_004291746.1|  PREDICTED: serine--glyoxylate aminotransferase     432   5e-148   Fragaria vesca subsp. vesca
gb|AGT38285.1|  serine--glyoxylate aminotransferase                     432   5e-148   Gossypium hirsutum [American cotton]
ref|XP_009342610.1|  PREDICTED: serine--glyoxylate aminotransferase     432   6e-148   Pyrus x bretschneideri [bai li]
gb|KHG14448.1|  Serine--glyoxylate aminotransferase -like protein       431   7e-148   Gossypium arboreum [tree cotton]
gb|AAQ56192.1|  aminotransferase 1                                      431   7e-148   Cucumis melo [Oriental melon]
gb|KJB54389.1|  hypothetical protein B456_009G074800                    431   1e-147   Gossypium raimondii
ref|NP_001284450.1|  serine--glyoxylate aminotransferase                431   1e-147   Cucumis melo [Oriental melon]
ref|XP_007015204.1|  Alanine:glyoxylate aminotransferase isoform 1      430   2e-147   
ref|XP_008359496.1|  PREDICTED: serine--glyoxylate aminotransferase     430   3e-147   
ref|XP_008363560.1|  PREDICTED: serine--glyoxylate aminotransferase     430   3e-147   Malus domestica [apple tree]
ref|XP_006369574.1|  hypothetical protein POPTR_0001s26020g             424   3e-147   
ref|XP_002531124.1|  serine-pyruvate aminotransferase, putative         429   5e-147   Ricinus communis
ref|XP_010557501.1|  PREDICTED: serine--glyoxylate aminotransferase     429   5e-147   Tarenaya hassleriana [spider flower]
ref|XP_011080387.1|  PREDICTED: serine--glyoxylate aminotransfera...    429   6e-147   Sesamum indicum [beniseed]
ref|XP_010909203.1|  PREDICTED: serine--glyoxylate aminotransferase     429   6e-147   Elaeis guineensis
gb|AAB95218.1|  putative serine-glyoxylate aminotransferase             429   8e-147   Fritillaria agrestis
dbj|BAJ90006.1|  predicted protein                                      429   1e-146   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006369569.1|  hypothetical protein POPTR_0001s26020g             425   1e-146   
ref|XP_008812510.1|  PREDICTED: serine--glyoxylate aminotransferase     428   1e-146   Phoenix dactylifera
ref|XP_010045046.1|  PREDICTED: serine--glyoxylate aminotransferase     428   1e-146   Eucalyptus grandis [rose gum]
gb|AEX09250.1|  alanine glyoxylate aminotransferase                     426   2e-146   Peperomia schizandra
ref|XP_010277598.1|  PREDICTED: serine--glyoxylate aminotransferase     428   2e-146   Nelumbo nucifera [Indian lotus]
gb|EMS66805.1|  Serine--glyoxylate aminotransferase                     427   3e-146   Triticum urartu
ref|NP_001062170.1|  Os08g0502700                                       427   3e-146   
gb|KHG29969.1|  Serine--glyoxylate aminotransferase -like protein       427   4e-146   Gossypium arboreum [tree cotton]
gb|KDP35982.1|  hypothetical protein JCGZ_08377                         427   4e-146   Jatropha curcas
ref|XP_006843377.1|  hypothetical protein AMTR_s00053p00093890          427   5e-146   Amborella trichopoda
gb|AEX09255.1|  alanine glyoxylate aminotransferase                     425   6e-146   Peperomia bracteata
gb|KDO44953.1|  hypothetical protein CISIN_1g0157291mg                  426   7e-146   Citrus sinensis [apfelsine]
ref|XP_006470731.1|  PREDICTED: serine--glyoxylate aminotransfera...    426   7e-146   Citrus sinensis [apfelsine]
ref|XP_009415566.1|  PREDICTED: serine--glyoxylate aminotransferase     426   7e-146   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008449670.1|  PREDICTED: serine--glyoxylate aminotransfera...    426   8e-146   Cucumis melo [Oriental melon]
gb|ABQ81922.1|  aminotransferase 2                                      426   1e-145   Cucumis sativus [cucumbers]
gb|ABQ81924.1|  aminotransferase 2                                      426   1e-145   Cucumis sativus [cucumbers]
gb|AEX09273.1|  alanine glyoxylate aminotransferase                     424   1e-145   Peperomia cerrateae
gb|AEX09254.1|  alanine glyoxylate aminotransferase                     424   1e-145   Peperomia bracteata
gb|AAL62332.1|AF461048_1  aminotransferase 2                            426   2e-145   Cucumis melo [Oriental melon]
gb|AEX09247.1|  alanine glyoxylate aminotransferase                     423   2e-145   Peperomia cavispicata
gb|AEX09265.1|  alanine glyoxylate aminotransferase                     423   3e-145   Peperomia radiatinervosa
gb|AEX09258.1|  alanine glyoxylate aminotransferase                     423   3e-145   Peperomia bracteata
gb|AEX09303.1|  alanine glyoxylate aminotransferase                     423   3e-145   Peperomia ayacuchoana
gb|AEX09285.1|  alanine glyoxylate aminotransferase                     423   3e-145   Peperomia radiatinervosa
ref|XP_006446249.1|  hypothetical protein CICLE_v10015490mg             425   4e-145   Citrus clementina [clementine]
gb|AEX09257.1|  alanine glyoxylate aminotransferase                     423   4e-145   Peperomia bracteata
ref|XP_006584642.1|  PREDICTED: enzymatic resistance protein isof...    424   4e-145   Glycine max [soybeans]
gb|AEX09256.1|  alanine glyoxylate aminotransferase                     423   4e-145   Peperomia bracteata
gb|AEX09267.1|  alanine glyoxylate aminotransferase                     423   5e-145   Peperomia radiatinervosa
ref|XP_003600159.1|  Alanine glyoxylate aminotransferase                424   5e-145   Medicago truncatula
ref|XP_011043786.1|  PREDICTED: serine--glyoxylate aminotransferase     424   5e-145   Populus euphratica
gb|AEX09299.1|  alanine glyoxylate aminotransferase                     423   5e-145   Peperomia cerrateae
ref|XP_008666471.1|  PREDICTED: serine--glyoxylate aminotransfera...    419   5e-145   
ref|XP_002298306.1|  hypothetical protein POPTR_0001s26020g             424   5e-145   Populus trichocarpa [western balsam poplar]
gb|AEX09276.1|  alanine glyoxylate aminotransferase                     423   5e-145   Peperomia parvisagittata
gb|AEX09298.1|  alanine glyoxylate aminotransferase                     423   6e-145   Peperomia cerrateae
gb|EPS59280.1|  serine-glyoxylate aminotransferase                      424   6e-145   Genlisea aurea
ref|NP_001284445.1|  serine--glyoxylate aminotransferase-like           424   6e-145   Cucumis melo [Oriental melon]
ref|NP_001237048.1|  enzymatic resistance protein                       424   7e-145   
ref|XP_004499480.1|  PREDICTED: serine--glyoxylate aminotransfera...    423   1e-144   
gb|AEX09253.1|  alanine glyoxylate aminotransferase                     422   1e-144   Peperomia bracteata
gb|AEX09275.1|  alanine glyoxylate aminotransferase                     422   1e-144   Peperomia parvisagittata
gb|ABQ81925.1|  aminotransferase 2                                      423   2e-144   Cucumis melo [Oriental melon]
gb|AFK40703.1|  unknown                                                 423   2e-144   Medicago truncatula
gb|AEX09311.1|  alanine glyoxylate aminotransferase                     421   2e-144   Peperomia andina
gb|AEX09305.1|  alanine glyoxylate aminotransferase                     421   2e-144   Peperomia pseudoverruculosa
ref|XP_010673724.1|  PREDICTED: serine--glyoxylate aminotransferase     422   2e-144   Beta vulgaris subsp. vulgaris [field beet]
gb|AAQ56193.1|  aminotransferase 2                                      422   3e-144   Cucumis melo [Oriental melon]
ref|XP_004140203.1|  PREDICTED: serine--glyoxylate aminotransfera...    422   3e-144   Cucumis sativus [cucumbers]
emb|CBI24214.3|  unnamed protein product                                421   4e-144   Vitis vinifera
gb|AEX09248.1|  alanine glyoxylate aminotransferase                     420   5e-144   Peperomia questionis
gb|AEX09307.1|  alanine glyoxylate aminotransferase                     420   5e-144   Peperomia verruculosa
gb|AEX09270.1|  alanine glyoxylate aminotransferase                     420   6e-144   Peperomia verruculosa
gb|ACJ61246.1|  serine glyoxylate aminotransferase 2                    422   6e-144   Glycine max [soybeans]
gb|ACJ61247.1|  serine glyoxylate aminotransferase 3                    421   7e-144   Glycine max [soybeans]
gb|ABA00460.1|  serine-glyoxylate aminotransferase                      421   8e-144   Spirodela polyrhiza
ref|XP_002279236.1|  PREDICTED: serine--glyoxylate aminotransferase     421   1e-143   Vitis vinifera
ref|XP_003574732.2|  PREDICTED: serine--glyoxylate aminotransferase     423   1e-143   Brachypodium distachyon [annual false brome]
ref|XP_004973838.1|  PREDICTED: serine--glyoxylate aminotransfera...    421   1e-143   Setaria italica
gb|AEX09259.1|  alanine glyoxylate aminotransferase                     419   2e-143   Peperomia bracteata
gb|AEX09300.1|  alanine glyoxylate aminotransferase                     419   2e-143   Peperomia parvifolia
gb|KHN28521.1|  Serine--glyoxylate aminotransferase                     420   2e-143   Glycine soja [wild soybean]
gb|ACN39798.1|  unknown                                                 420   2e-143   Picea sitchensis
gb|ABK24112.1|  unknown                                                 420   2e-143   Picea sitchensis
emb|CDP08481.1|  unnamed protein product                                420   2e-143   Coffea canephora [robusta coffee]
ref|NP_001276276.1|  serine--glyoxylate aminotransferase-like           420   3e-143   Glycine max [soybeans]
gb|AEX09306.1|  alanine glyoxylate aminotransferase                     418   3e-143   Peperomia peruviana
gb|AEX09293.1|  alanine glyoxylate aminotransferase                     418   3e-143   Peperomia rupiseda
ref|XP_009410322.1|  PREDICTED: serine--glyoxylate aminotransfera...    419   4e-143   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004973837.1|  PREDICTED: serine--glyoxylate aminotransfera...    421   5e-143   
emb|CAN84001.1|  hypothetical protein VITISV_007680                     419   6e-143   Vitis vinifera
ref|XP_007146302.1|  hypothetical protein PHAVU_006G029100g             419   8e-143   Phaseolus vulgaris [French bean]
gb|AEX09304.1|  alanine glyoxylate aminotransferase                     417   9e-143   Peperomia chutanka
ref|XP_002313371.1|  aminotransferase 2 family protein                  418   2e-142   
gb|AGV54322.1|  serine glyoxylate aminotransferase 2                    418   2e-142   Phaseolus vulgaris [French bean]
ref|XP_006409690.1|  hypothetical protein EUTSA_v10022711mg             418   2e-142   
dbj|BAJ33858.1|  unnamed protein product                                419   2e-142   Eutrema halophilum
ref|XP_009112244.1|  PREDICTED: serine--glyoxylate aminotransferase     417   2e-142   Brassica rapa
ref|XP_002444789.1|  hypothetical protein SORBIDRAFT_07g028080          417   2e-142   Sorghum bicolor [broomcorn]
emb|CDX81443.1|  BnaC09g08540D                                          417   3e-142   
emb|CDY37208.1|  BnaA09g08290D                                          417   3e-142   Brassica napus [oilseed rape]
gb|AEX09249.1|  alanine glyoxylate aminotransferase                     416   3e-142   Peperomia aff. gracillima JN-2011
ref|NP_001148339.1|  LOC100281949                                       417   3e-142   Zea mays [maize]
gb|AEX09286.1|  alanine glyoxylate aminotransferase                     416   3e-142   Peperomia cyclaminoides
ref|XP_011032100.1|  PREDICTED: serine--glyoxylate aminotransfera...    417   4e-142   Populus euphratica
gb|AEX09263.1|  alanine glyoxylate aminotransferase                     414   9e-142   Peperomia putlaensis
gb|AEX09301.1|  alanine glyoxylate aminotransferase                     414   1e-141   Peperomia sp. JN-2011
gb|ABK96624.1|  unknown                                                 415   2e-141   Populus trichocarpa x Populus deltoides
ref|XP_009136209.1|  PREDICTED: serine--glyoxylate aminotransfera...    415   2e-141   Brassica rapa
gb|AEX09268.1|  alanine glyoxylate aminotransferase                     413   4e-141   Peperomia peruviana
gb|AEX09295.1|  alanine glyoxylate aminotransferase                     412   6e-141   Peperomia pugnicaudex
emb|CDX89604.1|  BnaC03g45180D                                          414   8e-141   
gb|AEX09308.1|  alanine glyoxylate aminotransferase                     411   2e-140   Peperomia polycephala
ref|XP_010518509.1|  PREDICTED: serine--glyoxylate aminotransfera...    412   2e-140   Camelina sativa [gold-of-pleasure]
gb|AEX09274.1|  alanine glyoxylate aminotransferase                     410   3e-140   Peperomia peruviana
ref|XP_010488837.1|  PREDICTED: serine--glyoxylate aminotransfera...    412   3e-140   Camelina sativa [gold-of-pleasure]
gb|ACN36238.1|  unknown                                                 408   8e-140   Zea mays [maize]
ref|NP_178969.1|  alanine--glyoxylate aminotransferase                  410   1e-139   Arabidopsis thaliana [mouse-ear cress]
gb|ABF70331.1|  aminotransferase 1                                      410   1e-139   Cucumis sativus [cucumbers]
ref|XP_002885871.1|  hypothetical protein ARALYDRAFT_480305             409   4e-139   
ref|XP_006297832.1|  hypothetical protein CARUB_v10013869mg             406   6e-138   Capsella rubella
gb|AFK37194.1|  unknown                                                 397   1e-136   Medicago truncatula
gb|AEX09277.1|  alanine glyoxylate aminotransferase                     399   8e-136   Peperomia cyclaminoides
gb|AEX09245.1|  alanine glyoxylate aminotransferase                     399   1e-135   Peperomia putlaensis
gb|AEX09272.1|  alanine glyoxylate aminotransferase                     397   2e-135   Peperomia cyclaminoides
ref|XP_010467178.1|  PREDICTED: serine--glyoxylate aminotransfera...    401   3e-135   Camelina sativa [gold-of-pleasure]
gb|AEX09280.1|  alanine glyoxylate aminotransferase                     395   8e-135   Peperomia peruviana
gb|AEX09266.1|  alanine glyoxylate aminotransferase                     396   9e-135   Peperomia peruviana
gb|AEX09284.1|  alanine glyoxylate aminotransferase                     395   2e-134   Peperomia peruviana
gb|AEX09261.1|  alanine glyoxylate aminotransferase                     395   2e-134   Peperomia aff. ovatopeltata JN-2011
gb|AEX09269.1|  alanine glyoxylate aminotransferase                     394   3e-134   Peperomia peruviana
gb|AEX09281.1|  alanine glyoxylate aminotransferase                     394   5e-134   Peperomia cyclaminoides
gb|AEX09283.1|  alanine glyoxylate aminotransferase                     394   7e-134   Peperomia peruviana
gb|AEX09271.1|  alanine glyoxylate aminotransferase                     393   7e-134   Peperomia peruviana
gb|KJB54391.1|  hypothetical protein B456_009G074800                    389   7e-134   Gossypium raimondii
gb|AEX09294.1|  alanine glyoxylate aminotransferase                     392   3e-133   Peperomia sp. JN-2011
gb|AEX09264.1|  alanine glyoxylate aminotransferase                     391   6e-133   Peperomia radiatinervosa
gb|AEX09262.1|  alanine glyoxylate aminotransferase                     388   2e-131   Peperomia aff. ovatopeltata JN-2011
gb|AEX09252.1|  alanine glyoxylate aminotransferase                     387   2e-131   Peperomia exclamationis
gb|AEX09302.1|  alanine glyoxylate aminotransferase                     386   7e-131   Peperomia sp. JN-2011
gb|AEX09289.1|  alanine glyoxylate aminotransferase                     377   1e-127   Peperomia gigantea
gb|AEX09242.1|  alanine glyoxylate aminotransferase                     377   3e-127   Peperomia aff. pinoi JN-2011
ref|XP_004491262.1|  PREDICTED: serine--glyoxylate aminotransfera...    377   2e-126   Cicer arietinum [garbanzo]
gb|AEX09291.1|  alanine glyoxylate aminotransferase                     373   5e-126   Peperomia jalcaensis
gb|AEX09246.1|  alanine glyoxylate aminotransferase                     373   8e-126   Peperomia elatior
gb|AEX09288.1|  alanine glyoxylate aminotransferase                     373   9e-126   Peperomia parvisagittata
ref|XP_003617296.1|  Alanine glyoxylate aminotransferase                375   1e-125   Medicago truncatula
gb|AEX09309.1|  alanine glyoxylate aminotransferase                     371   5e-125   Peperomia wernerrauhii
gb|AEX09251.1|  alanine glyoxylate aminotransferase                     370   1e-124   Peperomia schizandra
gb|AEX09282.1|  alanine glyoxylate aminotransferase                     369   2e-124   Peperomia cerrateae
gb|AEX09290.1|  alanine glyoxylate aminotransferase                     367   6e-124   Peperomia dolabella
gb|AEX09244.1|  alanine glyoxylate aminotransferase                     368   7e-124   Peperomia basiradicans
ref|XP_002990557.1|  hypothetical protein SELMODRAFT_448066             370   1e-123   Selaginella moellendorffii
gb|AEX09287.1|  alanine glyoxylate aminotransferase                     367   2e-123   Peperomia cerrateae
ref|XP_002983655.1|  hypothetical protein SELMODRAFT_228964             369   4e-123   
gb|AEX09292.1|  alanine glyoxylate aminotransferase                     366   4e-123   Peperomia klopfensteinii
gb|AEX09310.1|  alanine glyoxylate aminotransferase                     365   6e-123   Peperomia wernerrauhii
gb|AEX09243.1|  alanine glyoxylate aminotransferase                     350   2e-117   Peperomia sp. JN-2011
ref|XP_002969615.1|  hypothetical protein SELMODRAFT_267279             352   2e-116   Selaginella moellendorffii
ref|XP_010094254.1|  Serine--glyoxylate aminotransferase                350   2e-116   Morus notabilis
gb|AEX09260.1|  alanine glyoxylate aminotransferase                     348   3e-116   Peperomia aff. ovatopeltata JN-2011
ref|XP_002970880.1|  hypothetical protein SELMODRAFT_147375             350   5e-116   Selaginella moellendorffii
ref|XP_001755667.1|  predicted protein                                  349   1e-115   
ref|XP_001783551.1|  predicted protein                                  347   9e-115   
ref|XP_003600160.1|  Alanine glyoxylate aminotransferase                347   9e-115   
ref|XP_006369573.1|  hypothetical protein POPTR_0001s26020g             345   4e-114   
gb|KDO44954.1|  hypothetical protein CISIN_1g0157291mg                  342   3e-113   Citrus sinensis [apfelsine]
tpg|DAA47908.1|  TPA: hypothetical protein ZEAMMB73_592349              337   4e-113   
gb|ABR16109.1|  unknown                                                 340   2e-112   Picea sitchensis
tpg|DAA47863.1|  TPA: hypothetical protein ZEAMMB73_595389              335   2e-110   
ref|XP_003617694.1|  Alanine glyoxylate aminotransferase                323   4e-106   
ref|XP_003615391.1|  Alanine glyoxylate aminotransferase                313   5e-102   
ref|XP_001763095.1|  predicted protein                                  313   3e-101   
gb|EMT09291.1|  Serine--glyoxylate aminotransferase                     297   1e-96    
gb|AEA48973.1|  glyoxylate aminotransferase                             290   2e-95    Rosa roxburghii [chestnut rose]
tpg|DAA47890.1|  TPA: hypothetical protein ZEAMMB73_424946              270   1e-87    
gb|ABR26184.1|  serine-glyoxylate aminotransferase                      258   3e-83    Oryza sativa Indica Group [Indian rice]
ref|WP_040580464.1|  serine--glyoxylate aminotransferase                266   6e-83    
dbj|BAQ18801.1|  serine-glyoxylate aminotransferase                     265   6e-83    Methyloceanibacter caenitepidi
gb|ABS86859.1|  alanine glyoxylate aminotransferase                     256   1e-82    Phaseolus vulgaris [French bean]
ref|WP_036260471.1|  serine--glyoxylate aminotransferase                263   7e-82    Methylocapsa aurea
gb|ABS86860.1|  alanine glyoxylate aminotransferase                     254   1e-81    Phaseolus vulgaris [French bean]
dbj|BAQ46928.1|  serine--glyoxylate aminotransferase                    261   2e-81    Methylobacterium aquaticum
ref|XP_005709273.1|  serine--glyoxylate transaminase                    260   9e-81    Galdieria sulphuraria
ref|WP_024878012.1|  MULTISPECIES: serine--glyoxylate aminotransf...    259   1e-80    Methylocystaceae
ref|WP_018267457.1|  serine--glyoxylate aminotransferase                259   2e-80    Methylosinus sp. LW4
ref|WP_036293367.1|  serine--glyoxylate aminotransferase                259   3e-80    Methylosinus
ref|XP_011399157.1|  Serine-glyoxylate aminotransferase                 257   7e-80    Auxenochlorella protothecoides
ref|WP_026608295.1|  serine--glyoxylate aminotransferase                256   5e-79    Methylocapsa acidiphila
ref|WP_026610206.1|  serine--glyoxylate aminotransferase                255   6e-79    Methylocaldum szegediense
ref|WP_003613273.1|  serine--glyoxylate aminotransferase                254   1e-78    Methylosinus
ref|XP_002953765.1|  hypothetical protein VOLCADRAFT_75980              256   1e-78    Volvox carteri f. nagariensis
ref|WP_035525480.1|  serine--glyoxylate aminotransferase                254   3e-78    Paraburkholderia sacchari
ref|WP_012590731.1|  serine--glyoxylate aminotransferase                253   3e-78    Methylocella silvestris
gb|AGN53916.1|  glyoxylate aminotransferase                             244   6e-78    Silene latifolia
gb|AGN53915.1|  glyoxylate aminotransferase                             243   1e-77    Silene latifolia
gb|AGN53900.1|  glyoxylate aminotransferase                             243   2e-77    Silene latifolia
gb|AGN53917.1|  glyoxylate aminotransferase                             243   2e-77    Silene latifolia
gb|AGN53906.1|  glyoxylate aminotransferase                             242   2e-77    Silene latifolia
gb|AGN53895.1|  glyoxylate aminotransferase                             241   4e-77    Silene latifolia
ref|WP_012405153.1|  serine--glyoxylate aminotransferase                251   5e-77    Paraburkholderia phymatum
emb|CAD13310.1|  serine-glyoxylate aminotransferase                     249   6e-77    Methylorubrum extorquens DM4
gb|AFZ62596.1|  serine-glyoxylate aminotransferase                      250   7e-77    Hyphomicrobium nitrativorans NL23
ref|WP_041319044.1|  serine--glyoxylate aminotransferase                250   8e-77    Hyphomicrobium nitrativorans
gb|AGN53914.1|  glyoxylate aminotransferase                             241   8e-77    Silene latifolia
ref|WP_015933415.1|  serine--glyoxylate aminotransferase                250   9e-77    Methylobacterium nodulans
ref|WP_003597639.1|  serine--glyoxylate aminotransferase                249   1e-76    Methylobacteriaceae
gb|AGN53923.1|  glyoxylate aminotransferase                             241   1e-76    Silene latifolia
ref|WP_015950680.1|  serine--glyoxylate aminotransferase                249   1e-76    Methylorubrum extorquens
ref|WP_016921634.1|  serine--glyoxylate aminotransferase                249   1e-76    Methylocystis parvus
gb|AGN54050.1|  glyoxylate aminotransferase                             240   2e-76    Silene vulgaris [maiden's-tears]
gb|AGN53897.1|  glyoxylate aminotransferase                             240   2e-76    Silene latifolia
ref|WP_035937801.1|  serine--glyoxylate aminotransferase                249   2e-76    Caballeronia glathei
ref|WP_012253362.1|  serine--glyoxylate aminotransferase                248   3e-76    Methylobacteriaceae
gb|AGN53921.1|  glyoxylate aminotransferase                             239   3e-76    Silene latifolia
ref|WP_042306504.1|  serine--glyoxylate aminotransferase                249   3e-76    Paraburkholderia terrae
ref|WP_017485211.1|  serine--glyoxylate aminotransferase                248   3e-76    Methylobacterium sp. MB200
ref|WP_012453656.1|  serine--glyoxylate aminotransferase                248   5e-76    Methylorubrum populi
gb|AGN54049.1|  glyoxylate aminotransferase                             239   5e-76    Silene vulgaris [maiden's-tears]
ref|WP_012336184.1|  serine--glyoxylate aminotransferase                248   7e-76    Methylobacterium sp. 4-46
ref|WP_026190999.1|  serine--glyoxylate aminotransferase                248   7e-76    Methylobacterium sp. WSM2598
ref|WP_035994918.1|  serine--glyoxylate aminotransferase                248   7e-76    Paraburkholderia caribensis
ref|WP_007585769.1|  serine--glyoxylate aminotransferase                248   7e-76    Paraburkholderia hospita
ref|WP_028367172.1|  serine--glyoxylate aminotransferase                248   7e-76    Burkholderia sp. UYPR1.413
ref|WP_028097617.1|  serine--glyoxylate aminotransferase                247   8e-76    Dongia sp. URHE0060
ref|WP_028212654.1|  serine--glyoxylate aminotransferase                248   1e-75    Paraburkholderia mimosarum
ref|WP_007742731.1|  serine--glyoxylate aminotransferase                248   1e-75    Burkholderiaceae
ref|WP_036284904.1|  serine--glyoxylate aminotransferase                246   1e-75    Methylocystis sp. ATCC 49242
gb|KIZ03753.1|  serine--glyoxylate transaminase                         247   2e-75    Monoraphidium neglectum
ref|WP_008058631.1|  serine--glyoxylate aminotransferase                246   2e-75    Methyloversatilis universalis
ref|WP_020085137.1|  serine--glyoxylate aminotransferase                245   4e-75    Hyphomicrobium zavarzinii
ref|WP_038511699.1|  serine--glyoxylate aminotransferase                245   5e-75    Granulibacter bethesdensis
ref|WP_011630756.1|  serine--glyoxylate aminotransferase                245   5e-75    Granulibacter bethesdensis
ref|WP_012320605.1|  MULTISPECIES: serine--glyoxylate aminotransf...    245   7e-75    Methylobacterium
ref|WP_036230592.1|  MULTISPECIES: serine--glyoxylate aminotransf...    245   8e-75    Methylibium
ref|WP_041930245.1|  serine--glyoxylate aminotransferase                244   8e-75    
gb|ABM96214.1|  serine-glyoxylate aminotransferase                      245   1e-74    Methylibium petroleiphilum PM1
gb|AHJ67030.1|  hypothetical protein GbCGDNIH2_0048                     245   1e-74    Granulibacter bethesdensis
gb|AHJ64409.1|  Serine-pyruvate aminotransferase                        245   1e-74    Granulibacter bethesdensis CGDNIH4
ref|WP_027172630.1|  serine--glyoxylate aminotransferase                244   1e-74    Methylobacterium
sp|O08374.2|SGAA_HYPME  RecName: Full=Serine--glyoxylate aminotra...    244   2e-74    Hyphomicrobium methylovorum
ref|WP_038515723.1|  serine--glyoxylate aminotransferase                243   2e-74    Granulibacter bethesdensis
ref|WP_028223486.1|  serine--glyoxylate aminotransferase                244   3e-74    Paraburkholderia oxyphila
ref|WP_010687105.1|  Aminotransferase class V                           243   3e-74    Methylobacterium mesophilicum
ref|WP_037471319.1|  serine--glyoxylate aminotransferase                243   4e-74    Sinorhizobium fredii
gb|AHJ61786.1|  Serine-pyruvate aminotransferase                        244   5e-74    Granulibacter bethesdensis
ref|WP_037401694.1|  serine--glyoxylate aminotransferase                243   5e-74    Sinorhizobium fredii
ref|WP_026175686.1|  serine--glyoxylate aminotransferase                243   6e-74    Methylobacterium sp. 88A
ref|WP_031597721.1|  serine--glyoxylate aminotransferase                242   7e-74    Ferrovum
ref|WP_015599474.1|  serine--glyoxylate aminotransferase                242   8e-74    Hyphomicrobium denitrificans
ref|WP_036271184.1|  serine--glyoxylate aminotransferase                242   9e-74    Methyloversatilis universalis
ref|WP_034858116.1|  serine--glyoxylate aminotransferase                241   1e-73    Ensifer sojae
ref|WP_028755163.1|  serine--glyoxylate aminotransferase                241   1e-73    Rhizobium leucaenae
ref|WP_013217108.1|  serine--glyoxylate aminotransferase                241   1e-73    Hyphomicrobium denitrificans
ref|WP_022947294.1|  serine--glyoxylate aminotransferase                241   1e-73    Methylohalobius crimeensis
ref|WP_023434100.1|  Serine--glyoxylate aminotransferase                241   2e-73    Lutibaculum baratangense
ref|XP_005648727.1|  serine glyoxylate aminotransferase                 242   2e-73    Coccomyxa subellipsoidea C-169
ref|WP_037437034.1|  serine--glyoxylate aminotransferase                236   2e-73    
ref|WP_043363897.1|  serine--glyoxylate aminotransferase                241   2e-73    Methyloversatilis discipulorum
ref|WP_037429341.1|  serine--glyoxylate aminotransferase                236   2e-73    Sinorhizobium fredii
ref|WP_037460312.1|  serine--glyoxylate aminotransferase                236   2e-73    Sinorhizobium fredii
ref|WP_037447404.1|  serine--glyoxylate aminotransferase                237   2e-73    Sinorhizobium fredii
ref|WP_040962653.1|  serine--glyoxylate aminotransferase                241   2e-73    Sinorhizobium fredii
ref|WP_037399704.1|  serine--glyoxylate aminotransferase                236   3e-73    Sinorhizobium fredii
ref|WP_029644281.1|  serine--glyoxylate aminotransferase                240   4e-73    Methyloversatilis discipulorum
ref|WP_007559580.1|  serine--glyoxylate aminotransferase                240   7e-73    Methylobacterium
ref|WP_018238561.1|  serine--glyoxylate aminotransferase                239   7e-73    
ref|WP_020092657.1|  serine--glyoxylate aminotransferase                239   1e-72    
ref|WP_014989411.1|  serine--glyoxylate aminotransferase                239   1e-72    
ref|WP_037131645.1|  serine--glyoxylate aminotransferase                239   1e-72    
ref|WP_018001111.1|  serine--glyoxylate aminotransferase                239   1e-72    
ref|WP_029964417.1|  serine--glyoxylate aminotransferase                239   1e-72    
gb|AEW08188.1|  hypothetical protein 2_2585_01                          229   2e-72    
ref|WP_026223456.1|  serine--glyoxylate aminotransferase                238   2e-72    
ref|WP_026622911.1|  serine--glyoxylate aminotransferase                238   2e-72    
ref|WP_026597137.1|  serine--glyoxylate aminotransferase                238   3e-72    
ref|WP_043355705.1|  serine--glyoxylate aminotransferase                238   3e-72    
ref|WP_043385155.1|  MULTISPECIES: serine--glyoxylate aminotransf...    238   4e-72    
ref|WP_024925735.1|  MULTISPECIES: serine--glyoxylate aminotransf...    238   4e-72    
ref|WP_026622392.1|  serine--glyoxylate aminotransferase                237   5e-72    
ref|WP_027147316.1|  MULTISPECIES: serine--glyoxylate aminotransf...    237   5e-72    
ref|WP_013949995.1|  MULTISPECIES: serine--glyoxylate aminotransf...    238   5e-72    
ref|WP_012709136.1|  serine--glyoxylate aminotransferase                237   7e-72    
ref|WP_014762541.1|  serine--glyoxylate aminotransferase                237   7e-72    
ref|WP_017840623.1|  serine--glyoxylate aminotransferase                236   8e-72    
ref|WP_026362994.1|  serine--glyoxylate aminotransferase                237   8e-72    
ref|WP_018410273.1|  serine--glyoxylate aminotransferase                237   8e-72    
ref|WP_003535479.1|  serine--glyoxylate aminotransferase                236   9e-72    
ref|WP_019858769.1|  serine--glyoxylate aminotransferase                236   9e-72    
ref|WP_015314900.1|  serine--glyoxylate aminotransferase                236   1e-71    
gb|AIQ91949.1|  Aminotransferase class V                                238   1e-71    
ref|WP_010960683.1|  serine--glyoxylate aminotransferase                236   1e-71    
ref|WP_015888023.1|  serine--glyoxylate aminotransferase                236   2e-71    
ref|WP_042673896.1|  serine--glyoxylate aminotransferase                236   2e-71    
ref|WP_020592928.1|  hypothetical protein                               236   2e-71    
ref|WP_026616975.1|  serine--glyoxylate aminotransferase                236   2e-71    
ref|WP_036253086.1|  serine--glyoxylate aminotransferase                236   2e-71    
ref|WP_037384071.1|  serine--glyoxylate aminotransferase                236   2e-71    
ref|WP_018405893.1|  serine--glyoxylate aminotransferase                236   2e-71    
ref|WP_014329402.1|  serine--glyoxylate aminotransferase                236   2e-71    
ref|WP_014890662.1|  serine--glyoxylate aminotransferase                235   3e-71    
ref|WP_040961132.1|  serine--glyoxylate aminotransferase                235   3e-71    
ref|WP_029648781.1|  serine--glyoxylate aminotransferase                235   3e-71    
gb|AFG57258.1|  hypothetical protein 2_2585_01                          226   3e-71    
ref|WP_032930697.1|  serine--glyoxylate aminotransferase                235   3e-71    
ref|WP_027163728.1|  serine--glyoxylate aminotransferase                235   3e-71    
gb|AEW08187.1|  hypothetical protein 2_2585_01                          226   5e-71    
ref|WP_037416404.1|  serine--glyoxylate aminotransferase                234   5e-71    
ref|WP_042643125.1|  serine--glyoxylate aminotransferase                234   6e-71    
ref|WP_010395294.1|  serine--glyoxylate aminotransferase                234   7e-71    
ref|WP_020188076.1|  hypothetical protein                               234   8e-71    
ref|XP_005539023.1|  serine-glyoxylate aminotransferase                 234   9e-71    
ref|WP_018238011.1|  serine--glyoxylate aminotransferase                234   1e-70    
ref|WP_036741500.1|  serine--glyoxylate aminotransferase                234   1e-70    
ref|WP_037380858.1|  serine--glyoxylate aminotransferase                234   1e-70    
gb|AGL09530.1|  alanine-glyoxylate aminotransferase                     230   2e-70    
ref|WP_010910076.1|  serine--glyoxylate aminotransferase                233   2e-70    
gb|AGL09525.1|  alanine-glyoxylate aminotransferase                     229   2e-70    
ref|WP_014955398.1|  serine--glyoxylate aminotransferase                233   2e-70    
gb|AGL09526.1|  alanine-glyoxylate aminotransferase                     229   3e-70    
ref|WP_023779196.1|  serine--glyoxylate aminotransferase                233   3e-70    
gb|AID30749.1|  serine--glyoxylate aminotransferase                     228   3e-70    
ref|XP_001702106.1|  serine glyoxylate aminotransferase                 234   3e-70    
ref|XP_001702107.1|  serine glyoxylate aminotransferase                 234   3e-70    
ref|WP_034483968.1|  serine--glyoxylate aminotransferase                233   3e-70    
ref|WP_013894918.1|  serine--glyoxylate aminotransferase                233   3e-70    
gb|ABG64679.1|  serine-glyoxylate aminotransferase apoenzyme            233   3e-70    
ref|WP_013819317.1|  serine--glyoxylate aminotransferase                232   3e-70    
ref|WP_041545642.1|  serine--glyoxylate aminotransferase                233   4e-70    
ref|WP_005371842.1|  MULTISPECIES: serine--glyoxylate aminotransf...    232   4e-70    
ref|WP_034505845.1|  serine--glyoxylate aminotransferase                232   4e-70    
ref|WP_030092530.1|  serine--glyoxylate aminotransferase                232   5e-70    
ref|WP_037126267.1|  serine--glyoxylate aminotransferase                232   6e-70    
ref|WP_039621788.1|  serine--glyoxylate aminotransferase                232   6e-70    
gb|AGL09523.1|  alanine-glyoxylate aminotransferase                     228   7e-70    
ref|WP_011750154.1|  serine--glyoxylate aminotransferase                232   8e-70    
ref|WP_041003840.1|  serine--glyoxylate aminotransferase                231   9e-70    
ref|WP_027288003.1|  serine--glyoxylate aminotransferase                231   9e-70    
ref|WP_028719065.1|  serine--glyoxylate aminotransferase                231   1e-69    
ref|WP_040969922.1|  serine--glyoxylate aminotransferase                231   1e-69    
ref|WP_031434945.1|  serine--glyoxylate aminotransferase                231   1e-69    
ref|WP_027999163.1|  serine--glyoxylate aminotransferase                231   1e-69    
ref|WP_023685219.1|  serine--glyoxylate aminotransferase                231   2e-69    
ref|WP_023698325.1|  serine--glyoxylate aminotransferase                231   2e-69    
ref|WP_014762956.1|  serine--glyoxylate aminotransferase                231   2e-69    
ref|WP_004668649.1|  serine--glyoxylate aminotransferase                231   2e-69    
ref|WP_037197032.1|  serine--glyoxylate aminotransferase                231   2e-69    
ref|WP_024505109.1|  serine--glyoxylate aminotransferase                231   2e-69    
ref|WP_010968118.1|  serine--glyoxylate aminotransferase                231   2e-69    
gb|AGL09524.1|  alanine-glyoxylate aminotransferase                     227   3e-69    
ref|WP_028716825.1|  serine--glyoxylate aminotransferase                230   3e-69    
ref|WP_028712351.1|  serine--glyoxylate aminotransferase                230   3e-69    
ref|WP_037133426.1|  serine--glyoxylate aminotransferase                230   3e-69    
ref|WP_023782620.1|  serine--glyoxylate aminotransferase                230   3e-69    
ref|WP_023690974.1|  MULTISPECIES: serine--glyoxylate aminotransf...    230   3e-69    
ref|WP_024844788.1|  serine--glyoxylate aminotransferase                230   4e-69    
ref|WP_023706127.1|  MULTISPECIES: serine--glyoxylate aminotransf...    230   4e-69    
dbj|BAD94403.1|  alanine-glyoxylate aminotransferase                    221   4e-69    
ref|WP_023829410.1|  serine--glyoxylate aminotransferase                230   4e-69    
ref|WP_023769804.1|  MULTISPECIES: serine--glyoxylate aminotransf...    229   4e-69    
ref|WP_037094842.1|  serine--glyoxylate aminotransferase                229   5e-69    
ref|WP_023822176.1|  serine--glyoxylate aminotransferase                229   5e-69    
ref|WP_023763335.1|  serine--glyoxylate aminotransferase                229   5e-69    
ref|WP_023700366.1|  serine--glyoxylate aminotransferase                229   5e-69    
ref|WP_023731220.1|  MULTISPECIES: serine--glyoxylate aminotransf...    229   5e-69    
ref|WP_023670792.1|  serine--glyoxylate aminotransferase                229   5e-69    
ref|WP_023746858.1|  MULTISPECIES: serine--glyoxylate aminotransf...    229   5e-69    
ref|WP_027051273.1|  serine--glyoxylate aminotransferase                229   6e-69    
ref|WP_023712721.1|  MULTISPECIES: serine--glyoxylate aminotransf...    229   6e-69    
ref|WP_040981991.1|  serine--glyoxylate aminotransferase                229   6e-69    
ref|WP_006203221.1|  serine--glyoxylate aminotransferase                229   6e-69    
ref|WP_023753463.1|  MULTISPECIES: serine--glyoxylate aminotransf...    229   6e-69    
ref|WP_013529882.1|  serine--glyoxylate aminotransferase                229   7e-69    
ref|WP_027044922.1|  serine--glyoxylate aminotransferase                229   7e-69    
ref|WP_041011880.1|  serine--glyoxylate aminotransferase                229   7e-69    
ref|WP_041007618.1|  serine--glyoxylate aminotransferase                229   8e-69    
ref|WP_039537917.1|  serine--glyoxylate aminotransferase                229   9e-69    
ref|WP_036753911.1|  serine--glyoxylate aminotransferase                229   9e-69    
ref|WP_026227793.1|  serine--glyoxylate aminotransferase                229   9e-69    
ref|WP_037276810.1|  serine--glyoxylate aminotransferase                229   1e-68    
ref|WP_027168976.1|  serine--glyoxylate aminotransferase                229   1e-68    
ref|WP_027029542.1|  serine--glyoxylate aminotransferase                229   1e-68    
ref|XP_005851882.1|  hypothetical protein CHLNCDRAFT_33614              230   1e-68    
ref|WP_020058450.1|  hypothetical protein                               228   1e-68    
gb|ERL97602.1|  serine-pyruvate aminotransferase/archaeal asparta...    229   1e-68    
ref|WP_039166767.1|  serine--glyoxylate aminotransferase                228   2e-68    
ref|WP_023818017.1|  serine--glyoxylate aminotransferase                228   2e-68    
gb|AGL09528.1|  alanine-glyoxylate aminotransferase                     224   2e-68    
ref|WP_028035328.1|  serine--glyoxylate aminotransferase                228   2e-68    
ref|WP_023714322.1|  serine--glyoxylate aminotransferase                228   2e-68    
ref|WP_023805485.1|  serine--glyoxylate aminotransferase                228   2e-68    
ref|WP_006005059.1|  serine--glyoxylate aminotransferase                228   2e-68    
ref|WP_023739129.1|  MULTISPECIES: serine--glyoxylate aminotransf...    228   2e-68    
ref|WP_023741624.1|  serine--glyoxylate aminotransferase                228   2e-68    
ref|WP_014149643.1|  serine--glyoxylate aminotransferase                228   2e-68    
ref|WP_037293454.1|  serine--glyoxylate aminotransferase                228   3e-68    
ref|WP_008558487.1|  serine--glyoxylate aminotransferase                228   3e-68    
ref|WP_023690293.1|  serine--glyoxylate aminotransferase                227   4e-68    
ref|WP_024298006.1|  serine--glyoxylate aminotransferase                227   4e-68    
gb|EBA13502.1|  Serine--glyoxylate transaminase                         227   4e-68    
ref|WP_039194170.1|  serine--glyoxylate aminotransferase                227   5e-68    
ref|WP_039152395.1|  MULTISPECIES: serine--glyoxylate aminotransf...    227   6e-68    
ref|WP_038006422.1|  MULTISPECIES: serine--glyoxylate aminotransf...    227   6e-68    
ref|WP_023002149.1|  MULTISPECIES: serine--glyoxylate aminotransf...    227   6e-68    
ref|WP_019294507.1|  MULTISPECIES: septum site-determining protein      227   6e-68    
ref|WP_039187206.1|  serine--glyoxylate aminotransferase                227   6e-68    
ref|WP_023833857.1|  serine--glyoxylate aminotransferase                226   8e-68    
ref|WP_023827347.1|  serine--glyoxylate aminotransferase                226   8e-68    
ref|WP_027260136.1|  serine--glyoxylate aminotransferase                226   9e-68    
ref|WP_039195772.1|  serine--glyoxylate aminotransferase                226   1e-67    
ref|WP_037249159.1|  serine--glyoxylate aminotransferase                226   1e-67    
ref|WP_027146511.1|  serine--glyoxylate aminotransferase                226   1e-67    
ref|WP_008757940.1|  serine--glyoxylate aminotransferase                226   1e-67    
ref|WP_027061369.1|  serine--glyoxylate aminotransferase                226   2e-67    
ref|WP_015317366.1|  serine--glyoxylate aminotransferase                226   2e-67    
ref|WP_036274731.1|  serine--glyoxylate aminotransferase                225   2e-67    
ref|WP_019867322.1|  serine--glyoxylate aminotransferase                225   2e-67    
emb|CAM59875.2|  alanine:glyoxylate aminotransferase                    216   2e-67    
ref|WP_020482091.1|  serine--glyoxylate aminotransferase                225   3e-67    
ref|WP_026850920.1|  serine--glyoxylate aminotransferase                225   3e-67    
ref|WP_033156535.1|  serine--glyoxylate aminotransferase                225   3e-67    
ref|WP_043145413.1|  serine--glyoxylate aminotransferase                225   3e-67    
gb|EEE42985.1|  aminotransferase, class V superfamily                   224   3e-67    
ref|WP_007817284.1|  serine--glyoxylate aminotransferase                225   4e-67    
ref|WP_010441851.1|  serine--glyoxylate aminotransferase                224   4e-67    
ref|WP_008279759.1|  serine--glyoxylate aminotransferase                224   4e-67    
ref|WP_024092553.1|  serine--glyoxylate aminotransferase                224   5e-67    
ref|WP_026604426.1|  serine--glyoxylate aminotransferase                224   5e-67    
ref|WP_040450969.1|  serine--glyoxylate aminotransferase                224   5e-67    
ref|WP_009178240.1|  serine--glyoxylate aminotransferase                224   7e-67    
ref|WP_003594239.1|  serine--glyoxylate aminotransferase                224   9e-67    
ref|WP_040651093.1|  serine--glyoxylate aminotransferase                223   1e-66    
ref|WP_006935547.1|  serine--glyoxylate aminotransferase                223   1e-66    
ref|WP_027233841.1|  serine--glyoxylate aminotransferase                223   1e-66    
ref|WP_009464599.1|  serine--glyoxylate aminotransferase                223   1e-66    
emb|CAM59874.1|  alanine:glyoxylate aminotransferase                    214   2e-66    
ref|WP_029357831.1|  serine--glyoxylate aminotransferase                223   2e-66    
ref|WP_015498822.1|  serine--glyoxylate aminotransferase                223   2e-66    
ref|WP_012329920.1|  MULTISPECIES: serine--glyoxylate aminotransf...    223   2e-66    
ref|WP_021102121.1|  Serine--glyoxylate aminotransferase                223   2e-66    
ref|WP_009812827.1|  serine--glyoxylate aminotransferase                222   3e-66    
ref|WP_020180326.1|  serine--glyoxylate aminotransferase                222   4e-66    
gb|KJF70525.1|  serine--glyoxylate aminotransferase                     222   4e-66    
ref|WP_020919828.1|  serine--glyoxylate aminotransferase                222   4e-66    
ref|WP_015895604.1|  serine--glyoxylate aminotransferase                222   4e-66    
ref|WP_015494023.1|  serine--glyoxylate aminotransferase                221   5e-66    
gb|EAQ23658.1|  probable serine-glyoxylate aminotransferase             224   6e-66    
ref|WP_037279938.1|  serine--glyoxylate aminotransferase                221   7e-66    
ref|WP_018329867.1|  serine--glyoxylate aminotransferase                221   7e-66    
ref|WP_006311601.1|  serine--glyoxylate aminotransferase                221   7e-66    
ref|WP_011455723.1|  serine--glyoxylate aminotransferase                221   8e-66    
ref|WP_008209359.1|  serine--glyoxylate aminotransferase                221   8e-66    
emb|CAM59878.2|  alanine:glyoxylate aminotransferase                    212   8e-66    
ref|WP_011280657.1|  serine--glyoxylate aminotransferase                221   9e-66    
gb|AGL09531.1|  alanine-glyoxylate aminotransferase                     217   1e-65    
emb|CAM59876.2|  alanine:glyoxylate aminotransferase                    211   1e-65    
ref|WP_039135088.1|  serine--glyoxylate aminotransferase                221   2e-65    
ref|WP_011513322.1|  MULTISPECIES: serine--glyoxylate aminotransf...    220   2e-65    
ref|WP_031437003.1|  serine--glyoxylate aminotransferase                220   2e-65    
ref|WP_006890572.1|  serine--glyoxylate aminotransferase                220   2e-65    
ref|WP_012177563.1|  serine--glyoxylate aminotransferase                220   3e-65    
ref|WP_010686651.1|  serine--glyoxylate transaminase                    220   3e-65    
ref|WP_008888199.1|  serine--glyoxylate aminotransferase                219   3e-65    
ref|WP_043847105.1|  serine--glyoxylate aminotransferase                219   4e-65    
emb|CAM59877.2|  alanine:glyoxylate aminotransferase                    210   4e-65    
ref|WP_024927669.1|  MULTISPECIES: serine--glyoxylate aminotransf...    219   5e-65    
ref|WP_011569032.1|  serine--glyoxylate aminotransferase                219   5e-65    
emb|CAM59872.1|  alanine:glyoxylate aminotransferase                    210   6e-65    
ref|WP_009827863.1|  serine--glyoxylate aminotransferase                219   7e-65    
ref|WP_020094516.1|  MULTISPECIES: serine--glyoxylate aminotransf...    218   9e-65    
gb|KIX16576.1|  serine--glyoxylate aminotransferase                     218   1e-64    
ref|WP_028957602.1|  serine--glyoxylate aminotransferase                218   1e-64    
ref|WP_042251598.1|  serine--glyoxylate aminotransferase                218   1e-64    
ref|WP_013961473.1|  serine--glyoxylate aminotransferase                218   2e-64    
ref|WP_011540013.1|  serine--glyoxylate aminotransferase                218   2e-64    
ref|WP_007427777.1|  serine--glyoxylate aminotransferase                218   2e-64    
ref|WP_020950386.1|  serine-glyoxylate transaminase                     218   2e-64    
ref|WP_036191573.1|  serine--glyoxylate aminotransferase                218   2e-64    
ref|WP_037308357.1|  serine--glyoxylate aminotransferase                218   2e-64    
emb|CAM84338.1|  alanine:glyoxylate aminotransferase                    208   2e-64    
ref|WP_037283573.1|  serine--glyoxylate aminotransferase                218   2e-64    
ref|WP_037929134.1|  serine--glyoxylate aminotransferase                217   3e-64    
emb|CAM59873.1|  alanine:glyoxylate aminotransferase                    208   3e-64    
ref|WP_027156802.1|  serine--glyoxylate aminotransferase                216   4e-64    
ref|WP_023496630.1|  serine--glyoxylate aminotransferase SgaA           216   8e-64    
ref|WP_011241925.1|  serine--glyoxylate aminotransferase                216   1e-63    
ref|WP_037263007.1|  serine--glyoxylate aminotransferase                216   1e-63    



>ref|XP_010938608.1| PREDICTED: serine--glyoxylate aminotransferase-like [Elaeis guineensis]
Length=401

 Score =   438 bits (1127),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 219/236 (93%), Positives = 229/236 (97%), Gaps = 0/236 (0%)
 Frame = -1

Query  777  YQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA  598
            Y HPALLLVDGVSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GI+CASPKALEASKTA
Sbjct  166  YNHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIICASPKALEASKTA  225

Query  597  KSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTAT  418
            KSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH RLG AT
Sbjct  226  KSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHNRLGKAT  285

Query  417  RLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKV  238
            RLAV+AWGLKNCTQKEEWFSDTVTAVVVP YIDS+E+V+RAWKRYNLSLGLGLNKVAGKV
Sbjct  286  RLAVEAWGLKNCTQKEEWFSDTVTAVVVPPYIDSAEVVRRAWKRYNLSLGLGLNKVAGKV  345

Query  237  FRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  70
            FRIGHLGNLNELQLLGCL+GVEMVLKDIGYPVKLGSGV AA+AYLQNTTPMIPSRI
Sbjct  346  FRIGHLGNLNELQLLGCLSGVEMVLKDIGYPVKLGSGVGAAAAYLQNTTPMIPSRI  401



>ref|XP_011090165.1| PREDICTED: serine--glyoxylate aminotransferase [Sesamum indicum]
Length=401

 Score =   438 bits (1126),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 216/236 (92%), Positives = 232/236 (98%), Gaps = 0/236 (0%)
 Frame = -1

Query  777  YQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA  598
            YQHPAL LVDGVSSICA+DFRMDEWG+DVALTGSQKALSLPTG+GIVCASPKALEA+KTA
Sbjct  166  YQHPALFLVDGVSSICALDFRMDEWGIDVALTGSQKALSLPTGLGIVCASPKALEATKTA  225

Query  597  KSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTAT  418
            KSVRVFFDW DYLKFYK+GTYWPYTPSIQLLYGLRA LDL+FEEGLDN+IARHTRLG AT
Sbjct  226  KSVRVFFDWNDYLKFYKLGTYWPYTPSIQLLYGLRAALDLIFEEGLDNIIARHTRLGKAT  285

Query  417  RLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKV  238
            RLAV+AWGLKNCTQKEEW+SDTVTAVV+PSYIDS+EIV++AWKRYNLSLGLGLNKVAGKV
Sbjct  286  RLAVEAWGLKNCTQKEEWYSDTVTAVVIPSYIDSTEIVRQAWKRYNLSLGLGLNKVAGKV  345

Query  237  FRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  70
            FRIGHLGNLNELQLLGCLAGVEMVLKD+GYPVKLGSGVAAASAYLQN+TP+IPSRI
Sbjct  346  FRIGHLGNLNELQLLGCLAGVEMVLKDVGYPVKLGSGVAAASAYLQNSTPLIPSRI  401



>gb|EYU35937.1| hypothetical protein MIMGU_mgv1a026291mg, partial [Erythranthe 
guttata]
Length=359

 Score =   435 bits (1119),  Expect = 6e-150, Method: Compositional matrix adjust.
 Identities = 217/236 (92%), Positives = 228/236 (97%), Gaps = 0/236 (0%)
 Frame = -1

Query  777  YQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA  598
            YQHPAL LVDGVSSICA+DFRMDEWG+DVALTGSQKALSLPTG+GIVCASPKALEASKTA
Sbjct  124  YQHPALFLVDGVSSICALDFRMDEWGIDVALTGSQKALSLPTGMGIVCASPKALEASKTA  183

Query  597  KSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTAT  418
             SVRVFFDW DYLKFYK+G+YWPYTPSIQLLYGLRA LDLLFEEGLDNVIARHTRL  AT
Sbjct  184  TSVRVFFDWNDYLKFYKLGSYWPYTPSIQLLYGLRAALDLLFEEGLDNVIARHTRLAKAT  243

Query  417  RLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKV  238
            RLAV AWGLKNCTQKEEWFSDTVTAV+VPSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKV
Sbjct  244  RLAVDAWGLKNCTQKEEWFSDTVTAVIVPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKV  303

Query  237  FRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  70
            FRIGHLGNLNELQLLGCLAGVEMVLKD+GYPV LGSGVAAASA+LQNTTP+IPSRI
Sbjct  304  FRIGHLGNLNELQLLGCLAGVEMVLKDVGYPVTLGSGVAAASAFLQNTTPLIPSRI  359



>ref|NP_001265946.1| Hop-interacting protein THI032 [Solanum lycopersicum]
 ref|XP_010314658.1| PREDICTED: hop-interacting protein THI032 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010314659.1| PREDICTED: hop-interacting protein THI032 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010314661.1| PREDICTED: hop-interacting protein THI032 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010314662.1| PREDICTED: hop-interacting protein THI032 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010314663.1| PREDICTED: hop-interacting protein THI032 isoform X1 [Solanum 
lycopersicum]
 gb|AEW69795.1| Hop-interacting protein THI032 [Solanum lycopersicum]
Length=401

 Score =   436 bits (1121),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 220/236 (93%), Positives = 229/236 (97%), Gaps = 0/236 (0%)
 Frame = -1

Query  777  YQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA  598
            YQHPAL LVDGVSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTA
Sbjct  166  YQHPALFLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEASKTA  225

Query  597  KSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTAT  418
            KSVRVFFDW DYLKFYK+GTYWPYTPSIQLLYGLRA LDLLFEEGLDNVIARH RLG AT
Sbjct  226  KSVRVFFDWSDYLKFYKLGTYWPYTPSIQLLYGLRAALDLLFEEGLDNVIARHARLGKAT  285

Query  417  RLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKV  238
            RLAV+AWGLKNCTQKEEWFSDTVTAVVVP +I+SSEIVKRAWKRYNLSLGLGLNKVAGKV
Sbjct  286  RLAVEAWGLKNCTQKEEWFSDTVTAVVVPPHIESSEIVKRAWKRYNLSLGLGLNKVAGKV  345

Query  237  FRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  70
            FRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVK GSGVAAASA+LQN+TP+IPSRI
Sbjct  346  FRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKFGSGVAAASAFLQNSTPLIPSRI  401



>ref|XP_006659561.1| PREDICTED: serine--glyoxylate aminotransferase-like isoform X1 
[Oryza brachyantha]
 ref|XP_006659562.1| PREDICTED: serine--glyoxylate aminotransferase-like isoform X2 
[Oryza brachyantha]
 ref|XP_006659563.1| PREDICTED: serine--glyoxylate aminotransferase-like isoform X3 
[Oryza brachyantha]
Length=402

 Score =   436 bits (1120),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 219/236 (93%), Positives = 231/236 (98%), Gaps = 0/236 (0%)
 Frame = -1

Query  777  YQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA  598
            ++HPALLLVDGVSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTA
Sbjct  167  HRHPALLLVDGVSSICAVDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEASKTA  226

Query  597  KSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTAT  418
            KSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVI RHTRLGTAT
Sbjct  227  KSVRVFFDWADYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIKRHTRLGTAT  286

Query  417  RLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKV  238
            RLAV+AWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVK AWKRYNLSLGLGLNKVAGKV
Sbjct  287  RLAVEAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKHAWKRYNLSLGLGLNKVAGKV  346

Query  237  FRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  70
            FRIGHLG+LNELQLLGCL+GVEMVLKD+GYPVKLGSGVAAA+AYL N+TP+IPSRI
Sbjct  347  FRIGHLGHLNELQLLGCLSGVEMVLKDVGYPVKLGSGVAAAAAYLSNSTPLIPSRI  402



>ref|XP_009619693.1| PREDICTED: serine--glyoxylate aminotransferase [Nicotiana tomentosiformis]
Length=401

 Score =   435 bits (1118),  Expect = 4e-149, Method: Compositional matrix adjust.
 Identities = 219/236 (93%), Positives = 228/236 (97%), Gaps = 0/236 (0%)
 Frame = -1

Query  777  YQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA  598
            YQHPALLLVDGVSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEA+KTA
Sbjct  166  YQHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEAAKTA  225

Query  597  KSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTAT  418
            KSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDLLFEEGL+NVIARH RLG AT
Sbjct  226  KSVRVFFDWSDYLKFYKMGTYWPYTPSIQLLYGLRAALDLLFEEGLENVIARHARLGKAT  285

Query  417  RLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKV  238
            RLAV+AWGLKNCTQKEEWFSDTVTAVVVP YIDS EIVKRAWKRYNLSLGLGLNKVAGKV
Sbjct  286  RLAVEAWGLKNCTQKEEWFSDTVTAVVVPPYIDSVEIVKRAWKRYNLSLGLGLNKVAGKV  345

Query  237  FRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  70
            FRIGHLGNLNELQLLGCLAGVEMVLKD+GYPVK GSGVAAAS +LQN+TP+IPSRI
Sbjct  346  FRIGHLGNLNELQLLGCLAGVEMVLKDVGYPVKFGSGVAAASTFLQNSTPLIPSRI  401



>gb|AAL47679.1| aminotransferase 1 [Cucumis melo]
Length=401

 Score =   434 bits (1117),  Expect = 4e-149, Method: Compositional matrix adjust.
 Identities = 217/236 (92%), Positives = 231/236 (98%), Gaps = 0/236 (0%)
 Frame = -1

Query  777  YQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA  598
            Y+HPALLLVDGVSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GI+CASPKALEASKT+
Sbjct  166  YKHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGLGIICASPKALEASKTS  225

Query  597  KSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTAT  418
            KSV+VFFDWKDYLKFY +GTYWPYTPSIQLLYGLRA LDLLFEEGLDNVIARH+RLG AT
Sbjct  226  KSVKVFFDWKDYLKFYNLGTYWPYTPSIQLLYGLRAALDLLFEEGLDNVIARHSRLGKAT  285

Query  417  RLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKV  238
            RLAV+AWGLKNCTQKEEWFSDTVTAV+VPSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKV
Sbjct  286  RLAVEAWGLKNCTQKEEWFSDTVTAVLVPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKV  345

Query  237  FRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  70
            FRIGHLGNLNELQLLGCLAGVEMVLKD+GYPVKLGSGVAAASAYLQN  P+IPSRI
Sbjct  346  FRIGHLGNLNELQLLGCLAGVEMVLKDVGYPVKLGSGVAAASAYLQNNIPLIPSRI  401



>ref|XP_004139054.1| PREDICTED: serine--glyoxylate aminotransferase-like [Cucumis 
sativus]
 ref|XP_004166102.1| PREDICTED: serine--glyoxylate aminotransferase-like [Cucumis 
sativus]
 gb|KGN66521.1| Aminotransferase 1 [Cucumis sativus]
Length=401

 Score =   434 bits (1117),  Expect = 5e-149, Method: Compositional matrix adjust.
 Identities = 216/236 (92%), Positives = 231/236 (98%), Gaps = 0/236 (0%)
 Frame = -1

Query  777  YQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA  598
            Y+HPALLLVDGVSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GI+CASPKALEASKT+
Sbjct  166  YKHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGLGIICASPKALEASKTS  225

Query  597  KSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTAT  418
            KSV+VFFDWKDYLKFY +GTYWPYTPSIQLLYGLRA LDLLFEEGLDNVIARH+RLG AT
Sbjct  226  KSVKVFFDWKDYLKFYNLGTYWPYTPSIQLLYGLRAALDLLFEEGLDNVIARHSRLGKAT  285

Query  417  RLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKV  238
            RLAV+AWGLKNCTQKEEWFSDTVTAV+VPSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKV
Sbjct  286  RLAVEAWGLKNCTQKEEWFSDTVTAVLVPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKV  345

Query  237  FRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  70
            FRIGHLGNLNELQLLGCLAGVEM+LKD+GYPVKLGSGVAAASAYLQN  P+IPSRI
Sbjct  346  FRIGHLGNLNELQLLGCLAGVEMILKDVGYPVKLGSGVAAASAYLQNNIPLIPSRI  401



>gb|KJB54393.1| hypothetical protein B456_009G074800 [Gossypium raimondii]
Length=306

 Score =   431 bits (1107),  Expect = 6e-149, Method: Compositional matrix adjust.
 Identities = 214/236 (91%), Positives = 229/236 (97%), Gaps = 0/236 (0%)
 Frame = -1

Query  777  YQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA  598
            Y+HPALLLVDGVSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASK+A
Sbjct  71   YRHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEASKSA  130

Query  597  KSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTAT  418
            KSVRVFFDW DYLKFYK+GT+WPYTPSIQLLYGLRA LDL+FEEGLDNVIARHTR+G AT
Sbjct  131  KSVRVFFDWNDYLKFYKLGTFWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHTRMGKAT  190

Query  417  RLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKV  238
            RLAV+AWGLKNCTQKEEW+SDTVTAV+VP YIDS+EIVKRAWKRYN+SLGLGLNKVAGKV
Sbjct  191  RLAVEAWGLKNCTQKEEWYSDTVTAVLVPPYIDSAEIVKRAWKRYNMSLGLGLNKVAGKV  250

Query  237  FRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  70
            FRIGHLGNLNELQLLGCLAGVEM+LKD+GYPVKLGSGVAAA AYLQN  PMIPSRI
Sbjct  251  FRIGHLGNLNELQLLGCLAGVEMILKDVGYPVKLGSGVAAACAYLQNNIPMIPSRI  306



>gb|KJB83533.1| hypothetical protein B456_013G252200 [Gossypium raimondii]
Length=342

 Score =   432 bits (1110),  Expect = 8e-149, Method: Compositional matrix adjust.
 Identities = 216/236 (92%), Positives = 227/236 (96%), Gaps = 0/236 (0%)
 Frame = -1

Query  777  YQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA  598
            Y HPALLLVDGVSSICA+DFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEA+KTA
Sbjct  107  YGHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEATKTA  166

Query  597  KSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTAT  418
            KSVRVFFDW DYLKFYK+GT+WPYTPSIQLLYGLRA LDL+FEEGLDN+I RH+RLG AT
Sbjct  167  KSVRVFFDWNDYLKFYKLGTFWPYTPSIQLLYGLRAALDLIFEEGLDNIIERHSRLGKAT  226

Query  417  RLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKV  238
            RLAV+AWGLKNCTQKEEWFSDTVTAV+VP YIDSSEIVKR WKRYNLSLGLGLNKVAGKV
Sbjct  227  RLAVEAWGLKNCTQKEEWFSDTVTAVLVPPYIDSSEIVKRGWKRYNLSLGLGLNKVAGKV  286

Query  237  FRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  70
            FRIGHLGNLNELQLLGCLAGVEM+LKD+GYPVKLGSGVAAASAYLQN  PMIPSRI
Sbjct  287  FRIGHLGNLNELQLLGCLAGVEMILKDVGYPVKLGSGVAAASAYLQNNIPMIPSRI  342



>ref|XP_006349776.1| PREDICTED: serine--glyoxylate aminotransferase-like [Solanum 
tuberosum]
Length=401

 Score =   434 bits (1116),  Expect = 8e-149, Method: Compositional matrix adjust.
 Identities = 219/236 (93%), Positives = 229/236 (97%), Gaps = 0/236 (0%)
 Frame = -1

Query  777  YQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA  598
            YQHPAL LVDGVSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTA
Sbjct  166  YQHPALFLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEASKTA  225

Query  597  KSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTAT  418
            KSVRVFFDW DYLKFYK+GTYWPYTPSIQLLYGLRA LDLLFEEGLDNVIARH RLG AT
Sbjct  226  KSVRVFFDWSDYLKFYKLGTYWPYTPSIQLLYGLRAALDLLFEEGLDNVIARHARLGKAT  285

Query  417  RLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKV  238
            RLAV+AWGLKNCTQKEEWFSDTVTAVVVP +I+SSEIVKRAWKRYNLSLGLGLNKVAGKV
Sbjct  286  RLAVEAWGLKNCTQKEEWFSDTVTAVVVPPHIESSEIVKRAWKRYNLSLGLGLNKVAGKV  345

Query  237  FRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  70
            FRIGHLG+LNELQLLGCLAGVEMVLKDIGYPVK GSGVAAASA+LQN+TP+IPSRI
Sbjct  346  FRIGHLGSLNELQLLGCLAGVEMVLKDIGYPVKFGSGVAAASAFLQNSTPLIPSRI  401



>ref|XP_009338530.1| PREDICTED: serine--glyoxylate aminotransferase-like [Pyrus x 
bretschneideri]
Length=401

 Score =   433 bits (1114),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 217/236 (92%), Positives = 228/236 (97%), Gaps = 0/236 (0%)
 Frame = -1

Query  777  YQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA  598
            Y+HPAL LVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA
Sbjct  166  YRHPALFLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA  225

Query  597  KSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTAT  418
            KSVRVFFDW DYLKFYK+GTYWPYTPSIQLLYGLR  LDLLFEEGLDNVIARH+RLG AT
Sbjct  226  KSVRVFFDWNDYLKFYKLGTYWPYTPSIQLLYGLRTALDLLFEEGLDNVIARHSRLGKAT  285

Query  417  RLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKV  238
            RLAV+AWGLKNCTQ+EEW SDTVTAV+VP +IDS+EIVKRAWKRYNLSLGLGLNKVAGKV
Sbjct  286  RLAVEAWGLKNCTQREEWVSDTVTAVLVPPHIDSTEIVKRAWKRYNLSLGLGLNKVAGKV  345

Query  237  FRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  70
            FRIGHLGNLNELQLLGCLAGVEMVL+D+GYPVKLGSGVAAASAYLQN TP+IPSRI
Sbjct  346  FRIGHLGNLNELQLLGCLAGVEMVLRDVGYPVKLGSGVAAASAYLQNNTPLIPSRI  401



>ref|XP_009775939.1| PREDICTED: serine--glyoxylate aminotransferase [Nicotiana sylvestris]
Length=401

 Score =   433 bits (1114),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 218/236 (92%), Positives = 227/236 (96%), Gaps = 0/236 (0%)
 Frame = -1

Query  777  YQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA  598
            YQHPAL LVDGVSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEA+KTA
Sbjct  166  YQHPALFLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEAAKTA  225

Query  597  KSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTAT  418
            KSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDLLFEEGL+NVIARH RLG AT
Sbjct  226  KSVRVFFDWSDYLKFYKMGTYWPYTPSIQLLYGLRAALDLLFEEGLENVIARHARLGKAT  285

Query  417  RLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKV  238
            RLAV+AWGLKNCTQKEEWFSDTVTAVVVP YIDS EIVKRAWKRYNLSLGLGLNKVAGKV
Sbjct  286  RLAVEAWGLKNCTQKEEWFSDTVTAVVVPPYIDSVEIVKRAWKRYNLSLGLGLNKVAGKV  345

Query  237  FRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  70
            FRIGHLGNLNELQLLGCLAGVEMVLKD+GYPVK GSGVAAAS +LQN+TP+IPSRI
Sbjct  346  FRIGHLGNLNELQLLGCLAGVEMVLKDVGYPVKFGSGVAAASTFLQNSTPLIPSRI  401



>ref|XP_007212264.1| hypothetical protein PRUPE_ppa006653mg [Prunus persica]
 gb|EMJ13463.1| hypothetical protein PRUPE_ppa006653mg [Prunus persica]
Length=401

 Score =   433 bits (1113),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 214/236 (91%), Positives = 227/236 (96%), Gaps = 0/236 (0%)
 Frame = -1

Query  777  YQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA  598
            Y+HPAL LVDGVSSICA+DFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA
Sbjct  166  YRHPALFLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA  225

Query  597  KSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTAT  418
            KSVRVFFDW DYLKFYK+GTYWPYTPSIQLLYGLR  LDL+FEEGLDNVIARH+RLG AT
Sbjct  226  KSVRVFFDWNDYLKFYKLGTYWPYTPSIQLLYGLRTALDLIFEEGLDNVIARHSRLGKAT  285

Query  417  RLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKV  238
            RLAV+AWGLKNCTQ EEWFSDTVTAV+VP YIDS+EIV+RAWKRYNLSLGLGLNK+AGKV
Sbjct  286  RLAVEAWGLKNCTQSEEWFSDTVTAVLVPPYIDSTEIVRRAWKRYNLSLGLGLNKIAGKV  345

Query  237  FRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  70
            FRIGHLGNLNELQLLGCLAGVEMVL+D+GYPVKLGSGVAAASAY QN TP+IPSRI
Sbjct  346  FRIGHLGNLNELQLLGCLAGVEMVLRDVGYPVKLGSGVAAASAYFQNNTPLIPSRI  401



>ref|XP_008227244.1| PREDICTED: serine--glyoxylate aminotransferase [Prunus mume]
Length=401

 Score =   433 bits (1113),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 214/236 (91%), Positives = 227/236 (96%), Gaps = 0/236 (0%)
 Frame = -1

Query  777  YQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA  598
            Y+HPAL LVDGVSSICA+DFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA
Sbjct  166  YRHPALFLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA  225

Query  597  KSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTAT  418
            KSVRVFFDW DYLKFYK+GTYWPYTPSIQLLYGLR  LDL+FEEGLDNVIARH+RLG AT
Sbjct  226  KSVRVFFDWNDYLKFYKLGTYWPYTPSIQLLYGLRTALDLIFEEGLDNVIARHSRLGKAT  285

Query  417  RLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKV  238
            RLAV+AWGLKNCTQ EEWFSDTVTAV+VP YIDS+EIV+RAWKRYNLSLGLGLNK+AGKV
Sbjct  286  RLAVEAWGLKNCTQSEEWFSDTVTAVLVPPYIDSTEIVRRAWKRYNLSLGLGLNKIAGKV  345

Query  237  FRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  70
            FRIGHLGNLNELQLLGCLAGVEMVL+D+GYPVKLGSGVAAASAY QN TP+IPSRI
Sbjct  346  FRIGHLGNLNELQLLGCLAGVEMVLRDVGYPVKLGSGVAAASAYFQNNTPLIPSRI  401



>ref|XP_004291746.1| PREDICTED: serine--glyoxylate aminotransferase [Fragaria vesca 
subsp. vesca]
Length=401

 Score =   432 bits (1111),  Expect = 5e-148, Method: Compositional matrix adjust.
 Identities = 215/236 (91%), Positives = 229/236 (97%), Gaps = 0/236 (0%)
 Frame = -1

Query  777  YQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA  598
            Y+HPAL LVDGVSSICA+DFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA
Sbjct  166  YRHPALFLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA  225

Query  597  KSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTAT  418
            KSVRVFFDW DYLKFYK+GTYWPYTPS+QLLYGLRA LDLLFEEGLDNVIARH+RLG AT
Sbjct  226  KSVRVFFDWNDYLKFYKLGTYWPYTPSVQLLYGLRAALDLLFEEGLDNVIARHSRLGKAT  285

Query  417  RLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKV  238
            RLAV+AWGLKNCTQKEEW SDTVTAV+VP YIDS+EIV+RAWKRYNLSLGLGLNK+AGKV
Sbjct  286  RLAVEAWGLKNCTQKEEWVSDTVTAVLVPPYIDSTEIVRRAWKRYNLSLGLGLNKIAGKV  345

Query  237  FRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  70
            FRIGHLGNLNELQLLGCLAGVEMVL+D+GYPVKLGSGVAAASAYLQN TP+IPSR+
Sbjct  346  FRIGHLGNLNELQLLGCLAGVEMVLRDLGYPVKLGSGVAAASAYLQNNTPLIPSRV  401



>gb|AGT38285.1| serine--glyoxylate aminotransferase [Gossypium hirsutum]
 gb|KJB83532.1| hypothetical protein B456_013G252200 [Gossypium raimondii]
Length=401

 Score =   432 bits (1110),  Expect = 5e-148, Method: Compositional matrix adjust.
 Identities = 216/236 (92%), Positives = 227/236 (96%), Gaps = 0/236 (0%)
 Frame = -1

Query  777  YQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA  598
            Y HPALLLVDGVSSICA+DFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEA+KTA
Sbjct  166  YGHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEATKTA  225

Query  597  KSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTAT  418
            KSVRVFFDW DYLKFYK+GT+WPYTPSIQLLYGLRA LDL+FEEGLDN+I RH+RLG AT
Sbjct  226  KSVRVFFDWNDYLKFYKLGTFWPYTPSIQLLYGLRAALDLIFEEGLDNIIERHSRLGKAT  285

Query  417  RLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKV  238
            RLAV+AWGLKNCTQKEEWFSDTVTAV+VP YIDSSEIVKR WKRYNLSLGLGLNKVAGKV
Sbjct  286  RLAVEAWGLKNCTQKEEWFSDTVTAVLVPPYIDSSEIVKRGWKRYNLSLGLGLNKVAGKV  345

Query  237  FRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  70
            FRIGHLGNLNELQLLGCLAGVEM+LKD+GYPVKLGSGVAAASAYLQN  PMIPSRI
Sbjct  346  FRIGHLGNLNELQLLGCLAGVEMILKDVGYPVKLGSGVAAASAYLQNNIPMIPSRI  401



>ref|XP_009342610.1| PREDICTED: serine--glyoxylate aminotransferase [Pyrus x bretschneideri]
 ref|XP_009342611.1| PREDICTED: serine--glyoxylate aminotransferase [Pyrus x bretschneideri]
Length=401

 Score =   432 bits (1110),  Expect = 6e-148, Method: Compositional matrix adjust.
 Identities = 215/236 (91%), Positives = 225/236 (95%), Gaps = 0/236 (0%)
 Frame = -1

Query  777  YQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA  598
            Y HPAL LVDGVSSICA+DFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA
Sbjct  166  YMHPALFLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA  225

Query  597  KSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTAT  418
            KSVRVFFDW DYLKFYK+GTYWPYTPSIQLLYGLR  LDL+FEEGLDNVIARH+RLG AT
Sbjct  226  KSVRVFFDWNDYLKFYKLGTYWPYTPSIQLLYGLRTALDLVFEEGLDNVIARHSRLGKAT  285

Query  417  RLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKV  238
            RLAV+AWGLKNCTQ EEW SDTVTAV+VP YIDS+EIVKRAWKRYNLSLGLGLNK+AGKV
Sbjct  286  RLAVEAWGLKNCTQSEEWVSDTVTAVLVPPYIDSTEIVKRAWKRYNLSLGLGLNKIAGKV  345

Query  237  FRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  70
            FRIGHLGNLNELQLLGCLAGVEMVLKD+GYPVKLGSGVAAASAY QN TP+IPSRI
Sbjct  346  FRIGHLGNLNELQLLGCLAGVEMVLKDVGYPVKLGSGVAAASAYFQNNTPLIPSRI  401



>gb|KHG14448.1| Serine--glyoxylate aminotransferase -like protein [Gossypium 
arboreum]
Length=401

 Score =   431 bits (1109),  Expect = 7e-148, Method: Compositional matrix adjust.
 Identities = 217/236 (92%), Positives = 227/236 (96%), Gaps = 0/236 (0%)
 Frame = -1

Query  777  YQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA  598
            Y HPALLLVDGVSSICA+DFRMDEWGVDVALTGSQKALSLPTGIGIVCAS KALEA+KTA
Sbjct  166  YGHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGIGIVCASQKALEATKTA  225

Query  597  KSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTAT  418
            KSVRVFFDW DYLKFYK+GT+WPYTPSIQLLYGLRA LDL+FEEGLDNVI RH+RLG AT
Sbjct  226  KSVRVFFDWNDYLKFYKLGTFWPYTPSIQLLYGLRAALDLIFEEGLDNVIERHSRLGKAT  285

Query  417  RLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKV  238
            RLAV+AWGLKNCTQKEEWFSDTVTAV+VP YIDSSEIVKRAWKRYNLSLGLGLNKVAGKV
Sbjct  286  RLAVEAWGLKNCTQKEEWFSDTVTAVLVPPYIDSSEIVKRAWKRYNLSLGLGLNKVAGKV  345

Query  237  FRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  70
            FRIGHLGNLNELQLLGCLAGVEM+LKD+GYPVKLGSGVAAASAYLQN  PMIPSRI
Sbjct  346  FRIGHLGNLNELQLLGCLAGVEMILKDVGYPVKLGSGVAAASAYLQNNIPMIPSRI  401



>gb|AAQ56192.1| aminotransferase 1 [Cucumis melo]
Length=401

 Score =   431 bits (1109),  Expect = 7e-148, Method: Compositional matrix adjust.
 Identities = 215/236 (91%), Positives = 230/236 (97%), Gaps = 0/236 (0%)
 Frame = -1

Query  777  YQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA  598
            Y+HPALLLVDGVSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GI+CASPKALEASKT+
Sbjct  166  YKHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGLGIICASPKALEASKTS  225

Query  597  KSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTAT  418
            KSV+VFFDWKDYLKFY +GTYWPYTPSIQLLYGLRA LDLLFEEGLDNVIARH+RLG AT
Sbjct  226  KSVKVFFDWKDYLKFYNLGTYWPYTPSIQLLYGLRAALDLLFEEGLDNVIARHSRLGKAT  285

Query  417  RLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKV  238
            RLAV+AWGLKNCTQKEEWFSDTVTAV+VPSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKV
Sbjct  286  RLAVEAWGLKNCTQKEEWFSDTVTAVLVPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKV  345

Query  237  FRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  70
            F IGHLGNLNELQLLGCLAGVEM+LKD+GYPVKLGSGVAAASAYLQN  P+IPSRI
Sbjct  346  FSIGHLGNLNELQLLGCLAGVEMILKDVGYPVKLGSGVAAASAYLQNNIPLIPSRI  401



>gb|KJB54389.1| hypothetical protein B456_009G074800 [Gossypium raimondii]
 gb|KJB54390.1| hypothetical protein B456_009G074800 [Gossypium raimondii]
 gb|KJB54392.1| hypothetical protein B456_009G074800 [Gossypium raimondii]
 gb|KJB54394.1| hypothetical protein B456_009G074800 [Gossypium raimondii]
Length=401

 Score =   431 bits (1108),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 214/236 (91%), Positives = 229/236 (97%), Gaps = 0/236 (0%)
 Frame = -1

Query  777  YQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA  598
            Y+HPALLLVDGVSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASK+A
Sbjct  166  YRHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEASKSA  225

Query  597  KSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTAT  418
            KSVRVFFDW DYLKFYK+GT+WPYTPSIQLLYGLRA LDL+FEEGLDNVIARHTR+G AT
Sbjct  226  KSVRVFFDWNDYLKFYKLGTFWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHTRMGKAT  285

Query  417  RLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKV  238
            RLAV+AWGLKNCTQKEEW+SDTVTAV+VP YIDS+EIVKRAWKRYN+SLGLGLNKVAGKV
Sbjct  286  RLAVEAWGLKNCTQKEEWYSDTVTAVLVPPYIDSAEIVKRAWKRYNMSLGLGLNKVAGKV  345

Query  237  FRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  70
            FRIGHLGNLNELQLLGCLAGVEM+LKD+GYPVKLGSGVAAA AYLQN  PMIPSRI
Sbjct  346  FRIGHLGNLNELQLLGCLAGVEMILKDVGYPVKLGSGVAAACAYLQNNIPMIPSRI  401



>ref|NP_001284450.1| serine--glyoxylate aminotransferase [Cucumis melo]
 gb|AAQ56194.1| aminotransferase 1 [Cucumis melo]
Length=401

 Score =   431 bits (1108),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 215/236 (91%), Positives = 230/236 (97%), Gaps = 0/236 (0%)
 Frame = -1

Query  777  YQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA  598
            Y+HPALLLVDGVSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GI+CASPKAL ASKT+
Sbjct  166  YKHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGLGIICASPKALVASKTS  225

Query  597  KSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTAT  418
            KSV+VFFDWKDYLKFY +GTYWPYTPSIQLLYGLRA LDLLFEEGLDNVIARH+RLG AT
Sbjct  226  KSVKVFFDWKDYLKFYNLGTYWPYTPSIQLLYGLRAALDLLFEEGLDNVIARHSRLGKAT  285

Query  417  RLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKV  238
            RLAV+AWGLKNCTQKEEWFSDTVTAV+VPSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKV
Sbjct  286  RLAVEAWGLKNCTQKEEWFSDTVTAVLVPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKV  345

Query  237  FRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  70
            FRIGHLGNLNELQLLGCLAGVEM+LKD+GYPVKLGSGVAAASAYLQN  P+IPSRI
Sbjct  346  FRIGHLGNLNELQLLGCLAGVEMILKDVGYPVKLGSGVAAASAYLQNNIPLIPSRI  401



>ref|XP_007015204.1| Alanine:glyoxylate aminotransferase isoform 1 [Theobroma cacao]
 ref|XP_007015205.1| Alanine:glyoxylate aminotransferase isoform 1 [Theobroma cacao]
 ref|XP_007015206.1| Alanine:glyoxylate aminotransferase isoform 1 [Theobroma cacao]
 gb|EOY32823.1| Alanine:glyoxylate aminotransferase isoform 1 [Theobroma cacao]
 gb|EOY32824.1| Alanine:glyoxylate aminotransferase isoform 1 [Theobroma cacao]
 gb|EOY32825.1| Alanine:glyoxylate aminotransferase isoform 1 [Theobroma cacao]
Length=401

 Score =   430 bits (1106),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 213/236 (90%), Positives = 229/236 (97%), Gaps = 0/236 (0%)
 Frame = -1

Query  777  YQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA  598
            Y+HPALLLVDGVSSICA+DFRMDEWGVDVALTGSQKALSLPTGIG+VCASPKALEASK+A
Sbjct  166  YRHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGIGLVCASPKALEASKSA  225

Query  597  KSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTAT  418
            KSVRVFFDW DYLKFYK+GT+WPYTPS+QLLYGLRA LDL+FEEGLDNVI RH+RLG AT
Sbjct  226  KSVRVFFDWNDYLKFYKLGTFWPYTPSVQLLYGLRAALDLIFEEGLDNVITRHSRLGKAT  285

Query  417  RLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKV  238
            RLAV+AWGLKNCTQKEEW+SDTVTAV+VP YIDS+EIV+RAWKRYNLSLGLGLNKVAGKV
Sbjct  286  RLAVEAWGLKNCTQKEEWYSDTVTAVLVPPYIDSTEIVRRAWKRYNLSLGLGLNKVAGKV  345

Query  237  FRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  70
            FRIGHLGNLNELQLLGCLAGVEM+LKD+GYPVKLGSGVAAA AYLQNT PMIPSRI
Sbjct  346  FRIGHLGNLNELQLLGCLAGVEMILKDVGYPVKLGSGVAAACAYLQNTIPMIPSRI  401



>ref|XP_008359496.1| PREDICTED: serine--glyoxylate aminotransferase [Malus domestica]
 ref|XP_008359497.1| PREDICTED: serine--glyoxylate aminotransferase [Malus domestica]
Length=401

 Score =   430 bits (1106),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 216/236 (92%), Positives = 227/236 (96%), Gaps = 0/236 (0%)
 Frame = -1

Query  777  YQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA  598
            Y+HPAL LVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA
Sbjct  166  YRHPALFLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA  225

Query  597  KSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTAT  418
            KSVRVFFDW DYLKFYK+GTYWPYTPSIQLLYGLR  LDLLFEEGLDNVIARH+RLG AT
Sbjct  226  KSVRVFFDWNDYLKFYKLGTYWPYTPSIQLLYGLRTALDLLFEEGLDNVIARHSRLGKAT  285

Query  417  RLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKV  238
            RLAV+AWGLKNCTQ+EEW SDTVTAV+VP +IDS+EIVKRAWKRYNLSLGLGLNKVAGKV
Sbjct  286  RLAVEAWGLKNCTQREEWVSDTVTAVLVPPHIDSTEIVKRAWKRYNLSLGLGLNKVAGKV  345

Query  237  FRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  70
            FRIGHLGNLNELQLLGCLAGVEMVL+D+GY VKLGSGVAAASAYLQN TP+IPSRI
Sbjct  346  FRIGHLGNLNELQLLGCLAGVEMVLRDVGYXVKLGSGVAAASAYLQNNTPLIPSRI  401



>ref|XP_008363560.1| PREDICTED: serine--glyoxylate aminotransferase [Malus domestica]
Length=401

 Score =   430 bits (1106),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 215/236 (91%), Positives = 225/236 (95%), Gaps = 0/236 (0%)
 Frame = -1

Query  777  YQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA  598
            Y HPAL LVDGVSSICA+DFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASK+A
Sbjct  166  YMHPALFLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKSA  225

Query  597  KSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTAT  418
            KSVRVFFDW DYLKFYK+GTYWPYTPSIQLLYGLR  LDLLFEEGLDNVIARH+RLG AT
Sbjct  226  KSVRVFFDWNDYLKFYKLGTYWPYTPSIQLLYGLRTALDLLFEEGLDNVIARHSRLGKAT  285

Query  417  RLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKV  238
            RLAV+AWGLKNCTQ EEW SDTVTAV+VP YIDS+EIVKRAWKRYNLSLGLGLNK+AGKV
Sbjct  286  RLAVEAWGLKNCTQSEEWVSDTVTAVLVPPYIDSTEIVKRAWKRYNLSLGLGLNKIAGKV  345

Query  237  FRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  70
            FRIGHLGNLNELQLLGCLAGVEMVLKD+GYPVKLGSGVAAASAY QN TP+IPSRI
Sbjct  346  FRIGHLGNLNELQLLGCLAGVEMVLKDVGYPVKLGSGVAAASAYFQNNTPLIPSRI  401



>ref|XP_006369574.1| hypothetical protein POPTR_0001s26020g [Populus trichocarpa]
 gb|ERP66143.1| hypothetical protein POPTR_0001s26020g [Populus trichocarpa]
Length=244

 Score =   424 bits (1090),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 212/236 (90%), Positives = 225/236 (95%), Gaps = 0/236 (0%)
 Frame = -1

Query  777  YQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA  598
            Y+HPAL LVDGVSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTA
Sbjct  9    YRHPALFLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTA  68

Query  597  KSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTAT  418
            KS RVFFDWKDYLKFYK+GT+WPYTPSIQLLYGLR  LDLLF EGLDNVIARH RLG AT
Sbjct  69   KSFRVFFDWKDYLKFYKLGTFWPYTPSIQLLYGLREALDLLFAEGLDNVIARHARLGKAT  128

Query  417  RLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKV  238
            RLAV+AWGLKNCTQKEEWFSDTVTAV+VP YIDS+EIV+R WKRYNLSLGLGLNKVAGKV
Sbjct  129  RLAVEAWGLKNCTQKEEWFSDTVTAVLVPPYIDSAEIVRRGWKRYNLSLGLGLNKVAGKV  188

Query  237  FRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  70
            FRIGHLGNLNELQLLGCLAGVEM+LKD+GYPVKLGSGVAAA AYLQN+TP+I SRI
Sbjct  189  FRIGHLGNLNELQLLGCLAGVEMILKDVGYPVKLGSGVAAACAYLQNSTPLIASRI  244



>ref|XP_002531124.1| serine-pyruvate aminotransferase, putative [Ricinus communis]
 gb|EEF31258.1| serine-pyruvate aminotransferase, putative [Ricinus communis]
Length=401

 Score =   429 bits (1104),  Expect = 5e-147, Method: Compositional matrix adjust.
 Identities = 215/236 (91%), Positives = 226/236 (96%), Gaps = 0/236 (0%)
 Frame = -1

Query  777  YQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA  598
            Y+HPAL LVDGVSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTA
Sbjct  166  YRHPALFLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTA  225

Query  597  KSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTAT  418
            KSVRVFFDWKDYLKFYKMGT+WPYTPSIQLLYGLRA LDL+FEEGLDNVI RH RLG AT
Sbjct  226  KSVRVFFDWKDYLKFYKMGTFWPYTPSIQLLYGLRAALDLIFEEGLDNVIERHARLGKAT  285

Query  417  RLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKV  238
            RLAV+AWGL NCTQKEEWFSDTVTAV+VP YIDS+EIVKRAWKRYNLSLGLGLNKVAGKV
Sbjct  286  RLAVEAWGLNNCTQKEEWFSDTVTAVLVPPYIDSTEIVKRAWKRYNLSLGLGLNKVAGKV  345

Query  237  FRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  70
            FRIGHLGNLNELQLLGCLAGVEM+LKD+GYPVKLGSGVAAA AYLQN  P+IPSRI
Sbjct  346  FRIGHLGNLNELQLLGCLAGVEMILKDVGYPVKLGSGVAAACAYLQNNIPLIPSRI  401



>ref|XP_010557501.1| PREDICTED: serine--glyoxylate aminotransferase [Tarenaya hassleriana]
 ref|XP_010557502.1| PREDICTED: serine--glyoxylate aminotransferase [Tarenaya hassleriana]
Length=401

 Score =   429 bits (1104),  Expect = 5e-147, Method: Compositional matrix adjust.
 Identities = 214/236 (91%), Positives = 227/236 (96%), Gaps = 0/236 (0%)
 Frame = -1

Query  777  YQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA  598
            Y HPALLLVDGVSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTA
Sbjct  166  YNHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTA  225

Query  597  KSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTAT  418
            KSVRVFFDW DYLKFYK+GT+WPYTPSIQLLYGLRA LDL+FEEGLDNVIARH RLG AT
Sbjct  226  KSVRVFFDWSDYLKFYKLGTFWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHARLGKAT  285

Query  417  RLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKV  238
            RLAVQAWGLKNCTQKEEW+SDTVTAVVVP +IDS+EIV+RAWKRYNLSLGLGLNKVAGKV
Sbjct  286  RLAVQAWGLKNCTQKEEWYSDTVTAVVVPPHIDSTEIVRRAWKRYNLSLGLGLNKVAGKV  345

Query  237  FRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  70
            FRIGHLGNLNELQLLGCLAGVEM+L+D+GYPVKLGSGVAAA AYLQN  P+IPSRI
Sbjct  346  FRIGHLGNLNELQLLGCLAGVEMILRDVGYPVKLGSGVAAACAYLQNNVPLIPSRI  401



>ref|XP_011080387.1| PREDICTED: serine--glyoxylate aminotransferase-like [Sesamum 
indicum]
Length=401

 Score =   429 bits (1104),  Expect = 6e-147, Method: Compositional matrix adjust.
 Identities = 216/236 (92%), Positives = 227/236 (96%), Gaps = 0/236 (0%)
 Frame = -1

Query  777  YQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA  598
            YQHPAL LVDGVSSICA+DFRMDEWG+DVALTGSQKALSLPTG+GIVCAS KAL A+KTA
Sbjct  166  YQHPALFLVDGVSSICALDFRMDEWGIDVALTGSQKALSLPTGMGIVCASAKALRATKTA  225

Query  597  KSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTAT  418
            KSVRVFFDW DYLKFYK+GTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH RLG AT
Sbjct  226  KSVRVFFDWNDYLKFYKLGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHARLGQAT  285

Query  417  RLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKV  238
            RLAVQAWGLKNCTQKEEW+SDTVTAVVVPS IDSSEIV+RAWKRYNLSLGLGLNKVAGKV
Sbjct  286  RLAVQAWGLKNCTQKEEWYSDTVTAVVVPSNIDSSEIVRRAWKRYNLSLGLGLNKVAGKV  345

Query  237  FRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  70
            FRIGHLG+LNELQLLGCLAGVEMVLKD+GYPVKLGSGVAAASAYLQN+TP IPSRI
Sbjct  346  FRIGHLGHLNELQLLGCLAGVEMVLKDVGYPVKLGSGVAAASAYLQNSTPYIPSRI  401



>ref|XP_010909203.1| PREDICTED: serine--glyoxylate aminotransferase [Elaeis guineensis]
 ref|XP_010909204.1| PREDICTED: serine--glyoxylate aminotransferase [Elaeis guineensis]
Length=402

 Score =   429 bits (1104),  Expect = 6e-147, Method: Compositional matrix adjust.
 Identities = 212/236 (90%), Positives = 230/236 (97%), Gaps = 0/236 (0%)
 Frame = -1

Query  777  YQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA  598
            Y+HPALLLVDGVSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASK A
Sbjct  167  YRHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKMA  226

Query  597  KSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTAT  418
            KS+RVFFDW DYLKFYK+GTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH+RLG AT
Sbjct  227  KSLRVFFDWNDYLKFYKLGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHSRLGKAT  286

Query  417  RLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKV  238
            RLAV+AWGLKNCTQK+EWFSDTVTAVVVP YIDS+++V+R WKRYNLSLGLGLNKVAGKV
Sbjct  287  RLAVEAWGLKNCTQKDEWFSDTVTAVVVPPYIDSADVVRRGWKRYNLSLGLGLNKVAGKV  346

Query  237  FRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  70
            FRIGHLGN+NELQLLGCL+GVEM+LKD+GYPVKLGSGVAAA+AYLQNTTPMIPSRI
Sbjct  347  FRIGHLGNVNELQLLGCLSGVEMILKDVGYPVKLGSGVAAAAAYLQNTTPMIPSRI  402



>gb|AAB95218.1| putative serine-glyoxylate aminotransferase [Fritillaria agrestis]
Length=401

 Score =   429 bits (1102),  Expect = 8e-147, Method: Compositional matrix adjust.
 Identities = 211/236 (89%), Positives = 227/236 (96%), Gaps = 0/236 (0%)
 Frame = -1

Query  777  YQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA  598
            Y HPALLLVDGVSSICA+DFRMDEWG+DVALTGSQKALS+PTG+G +CASPKALEASKTA
Sbjct  166  YNHPALLLVDGVSSICALDFRMDEWGIDVALTGSQKALSMPTGMGFICASPKALEASKTA  225

Query  597  KSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTAT  418
            +S RVFFDW DYLKFYK+GTYWPYTPSIQ+LYGLRA LDL+FEEGLDNVIARH+RLG AT
Sbjct  226  QSARVFFDWNDYLKFYKIGTYWPYTPSIQMLYGLRAALDLIFEEGLDNVIARHSRLGKAT  285

Query  417  RLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKV  238
            RLAV+AWGLKNCTQKEEW SDTVTAVVVP YIDSSEIV+RAWKRYNLSLGLGLNKVAGKV
Sbjct  286  RLAVEAWGLKNCTQKEEWHSDTVTAVVVPPYIDSSEIVRRAWKRYNLSLGLGLNKVAGKV  345

Query  237  FRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  70
            FRIGHLGNLNELQLLGCL+GVEMVLKD+GYPVKLGSGVAAA+ YLQN+TPMIPSRI
Sbjct  346  FRIGHLGNLNELQLLGCLSGVEMVLKDVGYPVKLGSGVAAAATYLQNSTPMIPSRI  401



>dbj|BAJ90006.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ90413.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ95504.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ95684.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=401

 Score =   429 bits (1102),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 220/236 (93%), Positives = 229/236 (97%), Gaps = 0/236 (0%)
 Frame = -1

Query  777  YQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA  598
            Y+HPALLLVDGVSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEA+KTA
Sbjct  166  YRHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEAAKTA  225

Query  597  KSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTAT  418
            KSVRVFFDWKDYLKFYKMGTYWPYTPSIQLLYGLRAGLDLLFEEGLDNVI RHTRLGTAT
Sbjct  226  KSVRVFFDWKDYLKFYKMGTYWPYTPSIQLLYGLRAGLDLLFEEGLDNVIKRHTRLGTAT  285

Query  417  RLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKV  238
            RLAV AWGLKNCT+KEE FSDTVTAVVVP YIDSSEIVK AWKRYNLSLGLGLNKVAGKV
Sbjct  286  RLAVAAWGLKNCTEKEENFSDTVTAVVVPPYIDSSEIVKHAWKRYNLSLGLGLNKVAGKV  345

Query  237  FRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  70
            FRIGHLG+LNELQLLGCL GVEMVLKDIGYPVKLGSGVAAA+AYL N+TP+IPSRI
Sbjct  346  FRIGHLGHLNELQLLGCLGGVEMVLKDIGYPVKLGSGVAAAAAYLSNSTPLIPSRI  401



>ref|XP_006369569.1| hypothetical protein POPTR_0001s26020g [Populus trichocarpa]
 gb|ERP66138.1| hypothetical protein POPTR_0001s26020g [Populus trichocarpa]
Length=311

 Score =   425 bits (1093),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 212/236 (90%), Positives = 225/236 (95%), Gaps = 0/236 (0%)
 Frame = -1

Query  777  YQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA  598
            Y+HPAL LVDGVSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTA
Sbjct  76   YRHPALFLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTA  135

Query  597  KSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTAT  418
            KS RVFFDWKDYLKFYK+GT+WPYTPSIQLLYGLR  LDLLF EGLDNVIARH RLG AT
Sbjct  136  KSFRVFFDWKDYLKFYKLGTFWPYTPSIQLLYGLREALDLLFAEGLDNVIARHARLGKAT  195

Query  417  RLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKV  238
            RLAV+AWGLKNCTQKEEWFSDTVTAV+VP YIDS+EIV+R WKRYNLSLGLGLNKVAGKV
Sbjct  196  RLAVEAWGLKNCTQKEEWFSDTVTAVLVPPYIDSAEIVRRGWKRYNLSLGLGLNKVAGKV  255

Query  237  FRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  70
            FRIGHLGNLNELQLLGCLAGVEM+LKD+GYPVKLGSGVAAA AYLQN+TP+I SRI
Sbjct  256  FRIGHLGNLNELQLLGCLAGVEMILKDVGYPVKLGSGVAAACAYLQNSTPLIASRI  311



>ref|XP_008812510.1| PREDICTED: serine--glyoxylate aminotransferase [Phoenix dactylifera]
 ref|XP_008812512.1| PREDICTED: serine--glyoxylate aminotransferase [Phoenix dactylifera]
 ref|XP_008812513.1| PREDICTED: serine--glyoxylate aminotransferase [Phoenix dactylifera]
 ref|XP_008812514.1| PREDICTED: serine--glyoxylate aminotransferase [Phoenix dactylifera]
Length=401

 Score =   428 bits (1101),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 214/236 (91%), Positives = 228/236 (97%), Gaps = 0/236 (0%)
 Frame = -1

Query  777  YQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA  598
            Y+HPALLLVDGVSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GI+CASPKALEASK A
Sbjct  166  YRHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIICASPKALEASKMA  225

Query  597  KSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTAT  418
            KSVRVFFDW DYLKFYK+GTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH RLG AT
Sbjct  226  KSVRVFFDWNDYLKFYKLGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHGRLGKAT  285

Query  417  RLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKV  238
            RLAV+AWGLKNCTQKEEWFSDTVTAVVVP YIDS+E+V+RAWKRYNLSLGLGLNKVAGKV
Sbjct  286  RLAVEAWGLKNCTQKEEWFSDTVTAVVVPPYIDSAEVVRRAWKRYNLSLGLGLNKVAGKV  345

Query  237  FRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  70
            FRIGHLGNLNELQLLGCL+GVEM+LKD+G PVKLGSGVAAA+AYLQNT PMIPSRI
Sbjct  346  FRIGHLGNLNELQLLGCLSGVEMILKDLGCPVKLGSGVAAAAAYLQNTIPMIPSRI  401



>ref|XP_010045046.1| PREDICTED: serine--glyoxylate aminotransferase [Eucalyptus grandis]
 ref|XP_010045047.1| PREDICTED: serine--glyoxylate aminotransferase [Eucalyptus grandis]
 gb|KCW87200.1| hypothetical protein EUGRSUZ_B03720 [Eucalyptus grandis]
Length=401

 Score =   428 bits (1101),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 214/236 (91%), Positives = 226/236 (96%), Gaps = 0/236 (0%)
 Frame = -1

Query  777  YQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA  598
            Y+HPAL LVDGVSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTA
Sbjct  166  YRHPALFLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTA  225

Query  597  KSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTAT  418
            KS +VFFDWKDYLKFY+MGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH RL T T
Sbjct  226  KSYKVFFDWKDYLKFYQMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHNRLATGT  285

Query  417  RLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKV  238
            RLAV+AWGLKNCTQKEEWFSDTVTAVVVP YI+SSEIV+RAWKRYNLSLGLGLNKVAGKV
Sbjct  286  RLAVEAWGLKNCTQKEEWFSDTVTAVVVPPYIESSEIVRRAWKRYNLSLGLGLNKVAGKV  345

Query  237  FRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  70
            FRIGHLGNLNELQLLGCLAGVEMVLKD+GYP+KLGSGV AASAY QNTTP+I SRI
Sbjct  346  FRIGHLGNLNELQLLGCLAGVEMVLKDVGYPIKLGSGVGAASAYFQNTTPLIASRI  401



>gb|AEX09250.1| alanine glyoxylate aminotransferase [Peperomia schizandra]
Length=362

 Score =   426 bits (1096),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 211/232 (91%), Positives = 226/232 (97%), Gaps = 0/232 (0%)
 Frame = -1

Query  777  YQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA  598
            Y HPALLLVDGVSSICA+DFRMDEWG DVALTGSQKALSLPTG+GIVCASPKALEASKTA
Sbjct  131  YNHPALLLVDGVSSICALDFRMDEWGXDVALTGSQKALSLPTGMGIVCASPKALEASKTA  190

Query  597  KSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTAT  418
            KSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH+RLG AT
Sbjct  191  KSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHSRLGKAT  250

Query  417  RLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKV  238
            RLAV+AWGLKNCTQKEEWFSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKV
Sbjct  251  RLAVEAWGLKNCTQKEEWFSDTVTAVLIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKV  310

Query  237  FRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  82
            FRIGHLGN+NELQLLGCL+GVEMVLKD+GYPVK GSGVAAA+AYLQNTTP+I
Sbjct  311  FRIGHLGNVNELQLLGCLSGVEMVLKDVGYPVKFGSGVAAAAAYLQNTTPLI  362



>ref|XP_010277598.1| PREDICTED: serine--glyoxylate aminotransferase [Nelumbo nucifera]
 ref|XP_010277599.1| PREDICTED: serine--glyoxylate aminotransferase [Nelumbo nucifera]
Length=401

 Score =   428 bits (1100),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 213/236 (90%), Positives = 227/236 (96%), Gaps = 0/236 (0%)
 Frame = -1

Query  777  YQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA  598
            Y+HPAL LVDGVSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASK+A
Sbjct  166  YRHPALFLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKSA  225

Query  597  KSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTAT  418
            KSVRVFFDW DYLKFYK+GT+WPYTPSIQLLYGLRA LDL+FEEGL+NVI RH+RLG AT
Sbjct  226  KSVRVFFDWNDYLKFYKLGTFWPYTPSIQLLYGLRAALDLIFEEGLENVIERHSRLGKAT  285

Query  417  RLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKV  238
            RLAV+AWGLKNCTQKEEWFSDTVTAVVVP YIDSSEIV+RAWKRYNLSLGLGLNKVAGKV
Sbjct  286  RLAVEAWGLKNCTQKEEWFSDTVTAVVVPPYIDSSEIVRRAWKRYNLSLGLGLNKVAGKV  345

Query  237  FRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  70
            FRIGHLGNLNELQLLGCLAGVEM+LKD+GYPVKLGSGVAAA AYLQN  P+IPSRI
Sbjct  346  FRIGHLGNLNELQLLGCLAGVEMILKDVGYPVKLGSGVAAACAYLQNNIPLIPSRI  401



>gb|EMS66805.1| Serine--glyoxylate aminotransferase [Triticum urartu]
Length=401

 Score =   427 bits (1099),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 220/236 (93%), Positives = 228/236 (97%), Gaps = 0/236 (0%)
 Frame = -1

Query  777  YQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA  598
            Y+HPALLLVDGVSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEA+KTA
Sbjct  166  YRHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEAAKTA  225

Query  597  KSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTAT  418
            KSVRVFFDWKDYLKFYKMGTYWPYTPSIQLLYGLRAGLDLLFEEGLDNVI RHTRLGTAT
Sbjct  226  KSVRVFFDWKDYLKFYKMGTYWPYTPSIQLLYGLRAGLDLLFEEGLDNVIKRHTRLGTAT  285

Query  417  RLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKV  238
            RLAV AWGLKNCT KEE FSDTVTAVVVP YIDSSEIVK AWKRYNLSLGLGLNKVAGKV
Sbjct  286  RLAVAAWGLKNCTAKEENFSDTVTAVVVPPYIDSSEIVKHAWKRYNLSLGLGLNKVAGKV  345

Query  237  FRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  70
            FRIGHLG+LNELQLLGCL GVEMVLKDIGYPVKLGSGVAAA+AYL N+TP+IPSRI
Sbjct  346  FRIGHLGHLNELQLLGCLGGVEMVLKDIGYPVKLGSGVAAAAAYLSNSTPLIPSRI  401



>ref|NP_001062170.1| Os08g0502700 [Oryza sativa Japonica Group]
 dbj|BAD08917.1| putative aminotransferase [Oryza sativa Japonica Group]
 dbj|BAD09269.1| putative aminotransferase [Oryza sativa Japonica Group]
 dbj|BAF24084.1| Os08g0502700 [Oryza sativa Japonica Group]
 gb|EAZ07527.1| hypothetical protein OsI_29783 [Oryza sativa Indica Group]
 gb|EAZ43252.1| hypothetical protein OsJ_27850 [Oryza sativa Japonica Group]
 dbj|BAG89198.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG89373.1| unnamed protein product [Oryza sativa Japonica Group]
Length=402

 Score =   427 bits (1099),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 214/236 (91%), Positives = 228/236 (97%), Gaps = 0/236 (0%)
 Frame = -1

Query  777  YQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA  598
            ++HPALLLVDGVSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTA
Sbjct  167  HRHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEASKTA  226

Query  597  KSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTAT  418
            KSVRVFFDWKDYLKFYKMGTYWPYTPSIQLLYGLR  LDL+FEEGL+NVI RH RLGTAT
Sbjct  227  KSVRVFFDWKDYLKFYKMGTYWPYTPSIQLLYGLRTALDLIFEEGLENVIKRHNRLGTAT  286

Query  417  RLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKV  238
            RLAV+AWGLKNCTQKEEWFSDTVTAVVVP YIDS+EIVK AWKRYNLSLGLGLNKVAGKV
Sbjct  287  RLAVEAWGLKNCTQKEEWFSDTVTAVVVPPYIDSAEIVKHAWKRYNLSLGLGLNKVAGKV  346

Query  237  FRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  70
            FRIGHLG+LNELQL+G L+GVEMVLKDIGYPVKLGSGVAAA+AYL N+TP+IPSRI
Sbjct  347  FRIGHLGHLNELQLMGALSGVEMVLKDIGYPVKLGSGVAAAAAYLSNSTPLIPSRI  402



>gb|KHG29969.1| Serine--glyoxylate aminotransferase -like protein [Gossypium 
arboreum]
Length=401

 Score =   427 bits (1098),  Expect = 4e-146, Method: Compositional matrix adjust.
 Identities = 212/236 (90%), Positives = 228/236 (97%), Gaps = 0/236 (0%)
 Frame = -1

Query  777  YQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA  598
            Y+HPALLLVDGVSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASK+A
Sbjct  166  YRHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEASKSA  225

Query  597  KSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTAT  418
            KSVRVFFDW DYLKFYK+GT+WPYTPSIQLLYGLRA LDL+FEEGLD+VIARH R+G AT
Sbjct  226  KSVRVFFDWNDYLKFYKLGTFWPYTPSIQLLYGLRAALDLIFEEGLDSVIARHNRMGKAT  285

Query  417  RLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKV  238
            RLAV+AWGLKNCTQKEEW+SDTVTAV+VP YIDS+EIVKRAWKRYN+SLGLGLNKVAGKV
Sbjct  286  RLAVEAWGLKNCTQKEEWYSDTVTAVLVPPYIDSAEIVKRAWKRYNMSLGLGLNKVAGKV  345

Query  237  FRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  70
            FRIGHLGNLNELQLLGCLAGVEM+LKD+GYPVKLGSGVAAA AYLQN  PMIPSRI
Sbjct  346  FRIGHLGNLNELQLLGCLAGVEMILKDVGYPVKLGSGVAAACAYLQNNIPMIPSRI  401



>gb|KDP35982.1| hypothetical protein JCGZ_08377 [Jatropha curcas]
Length=401

 Score =   427 bits (1098),  Expect = 4e-146, Method: Compositional matrix adjust.
 Identities = 213/236 (90%), Positives = 227/236 (96%), Gaps = 0/236 (0%)
 Frame = -1

Query  777  YQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA  598
            Y+HPAL LVDGVSSICA+DFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA
Sbjct  166  YRHPALFLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA  225

Query  597  KSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTAT  418
            +SVRVFFDW DYLKFYK+GTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH RLG AT
Sbjct  226  RSVRVFFDWNDYLKFYKLGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHARLGKAT  285

Query  417  RLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKV  238
            RLAV+AWGLKNCTQKEEWFSDTVTAV+VP  IDS+EIV+R WKRYNLSLGLGLNKVAGKV
Sbjct  286  RLAVEAWGLKNCTQKEEWFSDTVTAVLVPPSIDSAEIVRRGWKRYNLSLGLGLNKVAGKV  345

Query  237  FRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  70
            FRIGHLGNLNELQLLGCLAGVEM+L+D+GYPVKLGSGVAAASA+LQN TP+IPSRI
Sbjct  346  FRIGHLGNLNELQLLGCLAGVEMLLRDVGYPVKLGSGVAAASAFLQNNTPLIPSRI  401



>ref|XP_006843377.1| hypothetical protein AMTR_s00053p00093890 [Amborella trichopoda]
 gb|ERN05052.1| hypothetical protein AMTR_s00053p00093890 [Amborella trichopoda]
Length=401

 Score =   427 bits (1097),  Expect = 5e-146, Method: Compositional matrix adjust.
 Identities = 212/235 (90%), Positives = 228/235 (97%), Gaps = 0/235 (0%)
 Frame = -1

Query  774  QHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAK  595
            +HPALLLVDGVSSICA+DFRMDEWG+DVALTGSQKALSLPTGIG+VCASPKALEASK+AK
Sbjct  167  RHPALLLVDGVSSICALDFRMDEWGIDVALTGSQKALSLPTGIGLVCASPKALEASKSAK  226

Query  594  SVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATR  415
            SVRVFFDW DYL+FYKMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH+RLG ATR
Sbjct  227  SVRVFFDWNDYLRFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHSRLGKATR  286

Query  414  LAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVF  235
            LAV+AWGLKNCTQKEEWFSDTVTAVV+P+ IDSSEIV+RAW RYNLSLGLGLNKVAGKVF
Sbjct  287  LAVEAWGLKNCTQKEEWFSDTVTAVVIPANIDSSEIVRRAWNRYNLSLGLGLNKVAGKVF  346

Query  234  RIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  70
            RIGHLGNLNELQLLGCL+GVEM+LKD+GYPVKLGSGVAAASAYLQN+ PMI SRI
Sbjct  347  RIGHLGNLNELQLLGCLSGVEMILKDVGYPVKLGSGVAAASAYLQNSIPMIASRI  401



>gb|AEX09255.1| alanine glyoxylate aminotransferase [Peperomia bracteata]
Length=362

 Score =   425 bits (1093),  Expect = 6e-146, Method: Compositional matrix adjust.
 Identities = 212/232 (91%), Positives = 225/232 (97%), Gaps = 0/232 (0%)
 Frame = -1

Query  777  YQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA  598
            Y HPALLLVDGVSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTA
Sbjct  131  YNHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTA  190

Query  597  KSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTAT  418
            KSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH RLG AT
Sbjct  191  KSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHARLGKAT  250

Query  417  RLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKV  238
            RLAV+AWGLKNCTQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKV
Sbjct  251  RLAVEAWGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKV  310

Query  237  FRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  82
            FRIGHLGN+NELQLLGCL+GVEMVLKD+GYPVK GSGVAAA+AYLQNTTP+I
Sbjct  311  FRIGHLGNVNELQLLGCLSGVEMVLKDVGYPVKFGSGVAAAAAYLQNTTPLI  362



>gb|KDO44953.1| hypothetical protein CISIN_1g0157291mg [Citrus sinensis]
Length=401

 Score =   426 bits (1096),  Expect = 7e-146, Method: Compositional matrix adjust.
 Identities = 211/236 (89%), Positives = 228/236 (97%), Gaps = 0/236 (0%)
 Frame = -1

Query  777  YQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA  598
            Y+HPAL LVDGVSSICAIDFRMDEWG+DVALTGSQKALSLPTG+GIVCASPKALEASKTA
Sbjct  166  YRHPALFLVDGVSSICAIDFRMDEWGIDVALTGSQKALSLPTGMGIVCASPKALEASKTA  225

Query  597  KSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTAT  418
            KSVRVFFDWKDY+KFY +GT+WPYTPSIQLLYGLRA LDL+FEEGL+NVI RH RLG AT
Sbjct  226  KSVRVFFDWKDYIKFYNLGTFWPYTPSIQLLYGLRAALDLIFEEGLENVIERHRRLGKAT  285

Query  417  RLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKV  238
            RLAV+AWGLKNCTQKEEWFSDTVTAV+VPS+I+SSEIV+RAW+RYNLSLGLGLNKVAGKV
Sbjct  286  RLAVEAWGLKNCTQKEEWFSDTVTAVIVPSHINSSEIVRRAWQRYNLSLGLGLNKVAGKV  345

Query  237  FRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  70
            FRIGHLG+LNELQLLGCLAGVEM+LKD+GYPVKLGSGVAAASAYLQN  PMIPSRI
Sbjct  346  FRIGHLGHLNELQLLGCLAGVEMILKDVGYPVKLGSGVAAASAYLQNNIPMIPSRI  401



>ref|XP_006470731.1| PREDICTED: serine--glyoxylate aminotransferase-like [Citrus sinensis]
Length=401

 Score =   426 bits (1096),  Expect = 7e-146, Method: Compositional matrix adjust.
 Identities = 211/236 (89%), Positives = 228/236 (97%), Gaps = 0/236 (0%)
 Frame = -1

Query  777  YQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA  598
            Y+HPAL LVDGVSSICAIDFRMDEWG+DVALTGSQKALSLPTG+GIVCASPKALEASKTA
Sbjct  166  YRHPALFLVDGVSSICAIDFRMDEWGIDVALTGSQKALSLPTGMGIVCASPKALEASKTA  225

Query  597  KSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTAT  418
            KSVRVFFDWKDY+KFY +GT+WPYTPSIQLLYGLRA LDL+FEEGL+NVI RH RLG AT
Sbjct  226  KSVRVFFDWKDYIKFYNLGTFWPYTPSIQLLYGLRAALDLIFEEGLENVIERHRRLGKAT  285

Query  417  RLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKV  238
            RLAV+AWGLKNCTQKEEWFSDTVTAV+VPS+I+SSEIV+RAW+RYNLSLGLGLNKVAGKV
Sbjct  286  RLAVEAWGLKNCTQKEEWFSDTVTAVIVPSHINSSEIVRRAWQRYNLSLGLGLNKVAGKV  345

Query  237  FRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  70
            FRIGHLG+LNELQLLGCLAGVEM+LKD+GYPVKLGSGVAAASAYLQN  PMIPSRI
Sbjct  346  FRIGHLGHLNELQLLGCLAGVEMILKDVGYPVKLGSGVAAASAYLQNNIPMIPSRI  401



>ref|XP_009415566.1| PREDICTED: serine--glyoxylate aminotransferase [Musa acuminata 
subsp. malaccensis]
Length=401

 Score =   426 bits (1096),  Expect = 7e-146, Method: Compositional matrix adjust.
 Identities = 210/236 (89%), Positives = 230/236 (97%), Gaps = 0/236 (0%)
 Frame = -1

Query  777  YQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA  598
            Y+HPALLLVDGVSSICA+DFRMDEWGVDVALTGSQKALS+PTG+GIVCASPKA+EA+KTA
Sbjct  166  YRHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSMPTGMGIVCASPKAMEAAKTA  225

Query  597  KSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTAT  418
            KSVRVFFDW DYLKFYK+GTYWPYTPSIQLLYGLR  LDLLFEEGLDNVIARH+RLG AT
Sbjct  226  KSVRVFFDWNDYLKFYKLGTYWPYTPSIQLLYGLRTALDLLFEEGLDNVIARHSRLGKAT  285

Query  417  RLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKV  238
            RLAV+AWGLKNCTQ+EEWFSDTVTAVVVPSYI+S+++VKRAW RYNLSLGLGLNKVAGKV
Sbjct  286  RLAVEAWGLKNCTQREEWFSDTVTAVVVPSYINSADVVKRAWTRYNLSLGLGLNKVAGKV  345

Query  237  FRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  70
            FRIGHLGNLNELQLLGCL+GVEMVL+D+GYPVKLGSGVAAA+AYL+N+TPMI SRI
Sbjct  346  FRIGHLGNLNELQLLGCLSGVEMVLRDVGYPVKLGSGVAAAAAYLRNSTPMITSRI  401



>ref|XP_008449670.1| PREDICTED: serine--glyoxylate aminotransferase-like [Cucumis 
melo]
 gb|AAQ56195.1| aminotransferase 2 [Cucumis melo]
Length=401

 Score =   426 bits (1096),  Expect = 8e-146, Method: Compositional matrix adjust.
 Identities = 212/236 (90%), Positives = 227/236 (96%), Gaps = 0/236 (0%)
 Frame = -1

Query  777  YQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA  598
            Y+HPAL LVDGVSSICA+DFRMD+WGVDVALTGSQKALSLPTGIGIVCASP+ALEASKTA
Sbjct  166  YRHPALFLVDGVSSICALDFRMDDWGVDVALTGSQKALSLPTGIGIVCASPRALEASKTA  225

Query  597  KSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTAT  418
            KS+RVFFDWKDYLKFY +GTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG AT
Sbjct  226  KSLRVFFDWKDYLKFYNLGTYWPYTPSIQLLYGLRAALDLVFEEGLENVIARHKRLGQAT  285

Query  417  RLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKV  238
            RLAV+AWGLKNCTQKEEW SDTVTAVVVP YIDS+EIV+RAWKRYNLSLGLGLNKVAGKV
Sbjct  286  RLAVEAWGLKNCTQKEEWHSDTVTAVVVPPYIDSAEIVRRAWKRYNLSLGLGLNKVAGKV  345

Query  237  FRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  70
            FRIGHLGNLNELQLLGCLAGVEM+LKD+GYPVKLGSGVAAAS+YLQN  P+IPSRI
Sbjct  346  FRIGHLGNLNELQLLGCLAGVEMILKDVGYPVKLGSGVAAASSYLQNNIPLIPSRI  401



>gb|ABQ81922.1| aminotransferase 2 [Cucumis sativus]
Length=401

 Score =   426 bits (1095),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 212/236 (90%), Positives = 227/236 (96%), Gaps = 0/236 (0%)
 Frame = -1

Query  777  YQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA  598
            Y+HPAL LVDGVSSICA+DFRMD+WGVDVALTGSQKALSLPTGIGIVCASP+ALEASKTA
Sbjct  166  YRHPALFLVDGVSSICALDFRMDDWGVDVALTGSQKALSLPTGIGIVCASPRALEASKTA  225

Query  597  KSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTAT  418
            KS+RVFFDWKDYLKFY +GTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG AT
Sbjct  226  KSLRVFFDWKDYLKFYNLGTYWPYTPSIQLLYGLRAALDLVFEEGLENVIARHKRLGQAT  285

Query  417  RLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKV  238
            RLAV+AWGLKNCTQKEEW SDTVTAVVVP YIDS+EIV+RAWKRYNLSLGLGLNKVAGKV
Sbjct  286  RLAVEAWGLKNCTQKEEWHSDTVTAVVVPPYIDSAEIVRRAWKRYNLSLGLGLNKVAGKV  345

Query  237  FRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  70
            FRIGHLGNLNELQLLGCLAGVEM+LKD+GYPVKLGSGVAAAS+YLQN  P+IPSRI
Sbjct  346  FRIGHLGNLNELQLLGCLAGVEMILKDVGYPVKLGSGVAAASSYLQNNIPLIPSRI  401



>gb|ABQ81924.1| aminotransferase 2 [Cucumis sativus]
Length=401

 Score =   426 bits (1095),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 212/236 (90%), Positives = 227/236 (96%), Gaps = 0/236 (0%)
 Frame = -1

Query  777  YQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA  598
            Y+HPAL LVDGVSSICA+DFRMD+WGVDVALTGSQKALSLPTGIGIVCASP+ALEASKTA
Sbjct  166  YRHPALFLVDGVSSICALDFRMDDWGVDVALTGSQKALSLPTGIGIVCASPRALEASKTA  225

Query  597  KSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTAT  418
            KS+RVFFDWKDYLKFY +GTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG AT
Sbjct  226  KSLRVFFDWKDYLKFYNLGTYWPYTPSIQLLYGLRAALDLVFEEGLENVIARHKRLGQAT  285

Query  417  RLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKV  238
            RLAV+AWGLKNCTQKEEW SDTVTAVVVP YIDS+EIV+RAWKRYNLSLGLGLNKVAGKV
Sbjct  286  RLAVEAWGLKNCTQKEEWHSDTVTAVVVPPYIDSAEIVRRAWKRYNLSLGLGLNKVAGKV  345

Query  237  FRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  70
            FRIGHLGNLNELQLLGCLAGVEM+LKD+GYPVKLGSGVAAAS+YLQN  P+IPSRI
Sbjct  346  FRIGHLGNLNELQLLGCLAGVEMILKDVGYPVKLGSGVAAASSYLQNNIPLIPSRI  401



>gb|AEX09273.1| alanine glyoxylate aminotransferase [Peperomia cerrateae]
Length=362

 Score =   424 bits (1091),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 212/232 (91%), Positives = 224/232 (97%), Gaps = 0/232 (0%)
 Frame = -1

Query  777  YQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA  598
            Y HPALLLVDGVSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTA
Sbjct  131  YNHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTA  190

Query  597  KSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTAT  418
            KSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH RLG AT
Sbjct  191  KSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHARLGKAT  250

Query  417  RLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKV  238
            RLAV+AWGLKNCTQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKV
Sbjct  251  RLAVEAWGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKV  310

Query  237  FRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  82
            FRIGHLGN+NELQLLGCL+GVEMVLKD+GYPVK GSGVAAA AYLQNTTP+I
Sbjct  311  FRIGHLGNVNELQLLGCLSGVEMVLKDVGYPVKFGSGVAAAEAYLQNTTPLI  362



>gb|AEX09254.1| alanine glyoxylate aminotransferase [Peperomia bracteata]
Length=362

 Score =   424 bits (1090),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 211/232 (91%), Positives = 225/232 (97%), Gaps = 0/232 (0%)
 Frame = -1

Query  777  YQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA  598
            Y HPALLLVDGVSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTA
Sbjct  131  YNHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTA  190

Query  597  KSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTAT  418
            KSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG AT
Sbjct  191  KSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKAT  250

Query  417  RLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKV  238
            RLAV+AWGLKNCTQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKV
Sbjct  251  RLAVEAWGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKV  310

Query  237  FRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  82
            FRIGHLGN+NELQLLGCL+GVEMVLKD+GYPVK GSGVAAA+AYLQNTTP+I
Sbjct  311  FRIGHLGNVNELQLLGCLSGVEMVLKDVGYPVKFGSGVAAAAAYLQNTTPLI  362



>gb|AAL62332.1|AF461048_1 aminotransferase 2 [Cucumis melo]
Length=401

 Score =   426 bits (1094),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 211/236 (89%), Positives = 226/236 (96%), Gaps = 0/236 (0%)
 Frame = -1

Query  777  YQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA  598
            Y+HPAL LVDGVSSICA+DFRMD+WGVDVALTGSQKALSLPTGIGIVCASP+ALEASKTA
Sbjct  166  YRHPALFLVDGVSSICALDFRMDDWGVDVALTGSQKALSLPTGIGIVCASPRALEASKTA  225

Query  597  KSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTAT  418
            KS+RVFFDWKDYLKFY +GTYWPYTPSIQLLYGLR  LDL+FEEGL+NVIARH RLG AT
Sbjct  226  KSLRVFFDWKDYLKFYNLGTYWPYTPSIQLLYGLRPALDLVFEEGLENVIARHKRLGQAT  285

Query  417  RLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKV  238
            RLAV+AWGLKNCTQKEEW SDTVTAVVVP YIDS+EIV+RAWKRYNLSLGLGLNKVAGKV
Sbjct  286  RLAVEAWGLKNCTQKEEWHSDTVTAVVVPPYIDSAEIVRRAWKRYNLSLGLGLNKVAGKV  345

Query  237  FRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  70
            FRIGHLGNLNELQLLGCLAGVEM+LKD+GYPVKLGSGVAAAS+YLQN  P+IPSRI
Sbjct  346  FRIGHLGNLNELQLLGCLAGVEMILKDVGYPVKLGSGVAAASSYLQNNIPLIPSRI  401



>gb|AEX09247.1| alanine glyoxylate aminotransferase [Peperomia cavispicata]
Length=342

 Score =   423 bits (1088),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 211/232 (91%), Positives = 225/232 (97%), Gaps = 0/232 (0%)
 Frame = -1

Query  777  YQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA  598
            Y HPALLLVDGVSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTA
Sbjct  111  YNHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTA  170

Query  597  KSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTAT  418
            KSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG AT
Sbjct  171  KSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKAT  230

Query  417  RLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKV  238
            RLAV+AWGLKNCTQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKV
Sbjct  231  RLAVEAWGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKV  290

Query  237  FRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  82
            FRIGHLGN+NELQLLGCL+GVEMVLKD+GYPVK GSGVAAA+AYLQNTTP+I
Sbjct  291  FRIGHLGNVNELQLLGCLSGVEMVLKDVGYPVKFGSGVAAAAAYLQNTTPLI  342



>gb|AEX09265.1| alanine glyoxylate aminotransferase [Peperomia radiatinervosa]
Length=353

 Score =   423 bits (1087),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 211/232 (91%), Positives = 225/232 (97%), Gaps = 0/232 (0%)
 Frame = -1

Query  777  YQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA  598
            Y HPALLLVDGVSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTA
Sbjct  122  YNHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTA  181

Query  597  KSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTAT  418
            KSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG AT
Sbjct  182  KSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKAT  241

Query  417  RLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKV  238
            RLAV+AWGLKNCTQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKV
Sbjct  242  RLAVEAWGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKV  301

Query  237  FRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  82
            FRIGHLGN+NELQLLGCL+GVEMVLKD+GYPVK GSGVAAA+AYLQNTTP+I
Sbjct  302  FRIGHLGNVNELQLLGCLSGVEMVLKDVGYPVKFGSGVAAAAAYLQNTTPLI  353



>gb|AEX09258.1| alanine glyoxylate aminotransferase [Peperomia bracteata]
Length=362

 Score =   423 bits (1088),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 211/232 (91%), Positives = 225/232 (97%), Gaps = 0/232 (0%)
 Frame = -1

Query  777  YQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA  598
            Y HPALLLVDGVSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTA
Sbjct  131  YNHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTA  190

Query  597  KSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTAT  418
            KSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG AT
Sbjct  191  KSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKAT  250

Query  417  RLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKV  238
            RLAV+AWGLKNCTQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKV
Sbjct  251  RLAVEAWGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKV  310

Query  237  FRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  82
            FRIGHLGN+NELQLLGCL+GVEMVLKD+GYPVK GSGVAAA+AYLQNTTP+I
Sbjct  311  FRIGHLGNVNELQLLGCLSGVEMVLKDVGYPVKFGSGVAAAAAYLQNTTPLI  362



>gb|AEX09303.1| alanine glyoxylate aminotransferase [Peperomia ayacuchoana]
Length=351

 Score =   423 bits (1087),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 211/232 (91%), Positives = 224/232 (97%), Gaps = 0/232 (0%)
 Frame = -1

Query  777  YQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA  598
            Y HPALLLVDGVSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTA
Sbjct  120  YNHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTA  179

Query  597  KSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTAT  418
            KSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG AT
Sbjct  180  KSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKAT  239

Query  417  RLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKV  238
            RLAV+AWGLKNCTQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKV
Sbjct  240  RLAVEAWGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKV  299

Query  237  FRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  82
            FRIGHLGN+NELQLLGCL+GVEMVLKD+GYPVK GSGVAAA AYLQNTTP+I
Sbjct  300  FRIGHLGNVNELQLLGCLSGVEMVLKDVGYPVKFGSGVAAAEAYLQNTTPLI  351



>gb|AEX09285.1| alanine glyoxylate aminotransferase [Peperomia radiatinervosa]
Length=350

 Score =   423 bits (1087),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 211/232 (91%), Positives = 225/232 (97%), Gaps = 0/232 (0%)
 Frame = -1

Query  777  YQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA  598
            Y HPALLLVDGVSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTA
Sbjct  119  YNHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTA  178

Query  597  KSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTAT  418
            KSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG AT
Sbjct  179  KSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKAT  238

Query  417  RLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKV  238
            RLAV+AWGLKNCTQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKV
Sbjct  239  RLAVEAWGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKV  298

Query  237  FRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  82
            FRIGHLGN+NELQLLGCL+GVEMVLKD+GYPVK GSGVAAA+AYLQNTTP+I
Sbjct  299  FRIGHLGNVNELQLLGCLSGVEMVLKDVGYPVKFGSGVAAAAAYLQNTTPLI  350



>ref|XP_006446249.1| hypothetical protein CICLE_v10015490mg [Citrus clementina]
 ref|XP_006446250.1| hypothetical protein CICLE_v10015490mg [Citrus clementina]
 gb|ESR59489.1| hypothetical protein CICLE_v10015490mg [Citrus clementina]
 gb|ESR59490.1| hypothetical protein CICLE_v10015490mg [Citrus clementina]
Length=401

 Score =   425 bits (1092),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 210/236 (89%), Positives = 227/236 (96%), Gaps = 0/236 (0%)
 Frame = -1

Query  777  YQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA  598
            Y+HPAL LVDGVSSICAIDFRMDEWG+DVALTGSQKALSLPTG+GIVCASPKALEASKTA
Sbjct  166  YRHPALFLVDGVSSICAIDFRMDEWGIDVALTGSQKALSLPTGMGIVCASPKALEASKTA  225

Query  597  KSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTAT  418
            KSVRVFFDWKDY+KFY +GT+WPYTPSIQLLYGLRA LDL+FEEGL+NVI RH RLG AT
Sbjct  226  KSVRVFFDWKDYIKFYNLGTFWPYTPSIQLLYGLRAALDLIFEEGLENVIERHRRLGKAT  285

Query  417  RLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKV  238
            RLAV+AWGLKNCTQKEEWFSDTVTAV+VP +I+SSEIV+RAW+RYNLSLGLGLNKVAGKV
Sbjct  286  RLAVEAWGLKNCTQKEEWFSDTVTAVIVPPHINSSEIVRRAWQRYNLSLGLGLNKVAGKV  345

Query  237  FRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  70
            FRIGHLG+LNELQLLGCLAGVEM+LKD+GYPVKLGSGVAAASAYLQN  PMIPSRI
Sbjct  346  FRIGHLGHLNELQLLGCLAGVEMILKDVGYPVKLGSGVAAASAYLQNNIPMIPSRI  401



>gb|AEX09257.1| alanine glyoxylate aminotransferase [Peperomia bracteata]
 gb|AEX09278.1| alanine glyoxylate aminotransferase [Peperomia cyclaminoides]
 gb|AEX09279.1| alanine glyoxylate aminotransferase [Peperomia cyclaminoides]
Length=362

 Score =   423 bits (1088),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 211/232 (91%), Positives = 225/232 (97%), Gaps = 0/232 (0%)
 Frame = -1

Query  777  YQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA  598
            Y HPALLLVDGVSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTA
Sbjct  131  YNHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTA  190

Query  597  KSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTAT  418
            KSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG AT
Sbjct  191  KSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKAT  250

Query  417  RLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKV  238
            RLAV+AWGLKNCTQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKV
Sbjct  251  RLAVEAWGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKV  310

Query  237  FRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  82
            FRIGHLGN+NELQLLGCL+GVEMVLKD+GYPVK GSGVAAA+AYLQNTTP+I
Sbjct  311  FRIGHLGNVNELQLLGCLSGVEMVLKDVGYPVKFGSGVAAAAAYLQNTTPLI  362



>ref|XP_006584642.1| PREDICTED: enzymatic resistance protein isoform X1 [Glycine max]
 gb|ACE63506.1| alanine:glyoxylate aminotransferase [Vigna radiata]
 gb|ACU23313.1| unknown [Glycine max]
 gb|KHM99689.1| Serine--glyoxylate aminotransferase [Glycine soja]
Length=401

 Score =   424 bits (1091),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 210/236 (89%), Positives = 229/236 (97%), Gaps = 0/236 (0%)
 Frame = -1

Query  777  YQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA  598
            YQHPALL+VDGVSSICA+DFRMDEWGVDVA+TGSQKALSLPTGIGIV A PKA+EASK A
Sbjct  166  YQHPALLIVDGVSSICALDFRMDEWGVDVAITGSQKALSLPTGIGIVVAGPKAIEASKHA  225

Query  597  KSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTAT  418
            KS+RVFFDWKDYLKFY++GTYWPYTPSI LLYGLRA LDL+FEEGL+NVIARH+RLG AT
Sbjct  226  KSLRVFFDWKDYLKFYQLGTYWPYTPSIHLLYGLRAALDLIFEEGLENVIARHSRLGKAT  285

Query  417  RLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKV  238
            RLAV+AWGLKNCTQKEEW+SDTVTAV+VP+YIDS+EIV+RAWKRYNLSLGLGLNKVAGKV
Sbjct  286  RLAVEAWGLKNCTQKEEWYSDTVTAVLVPAYIDSTEIVRRAWKRYNLSLGLGLNKVAGKV  345

Query  237  FRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  70
            FRIGHLG+LNELQLLGCLAGVEM+LKD+GYPVKLGSGVAAASAYLQNT PMIPSRI
Sbjct  346  FRIGHLGHLNELQLLGCLAGVEMILKDVGYPVKLGSGVAAASAYLQNTIPMIPSRI  401



>gb|AEX09256.1| alanine glyoxylate aminotransferase [Peperomia bracteata]
Length=362

 Score =   423 bits (1087),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 211/232 (91%), Positives = 225/232 (97%), Gaps = 0/232 (0%)
 Frame = -1

Query  777  YQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA  598
            Y HPALLLVDGVSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTA
Sbjct  131  YNHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTA  190

Query  597  KSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTAT  418
            KSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG AT
Sbjct  191  KSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKAT  250

Query  417  RLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKV  238
            RLAV+AWGLKNCTQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKV
Sbjct  251  RLAVEAWGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKV  310

Query  237  FRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  82
            FRIGHLGN+NELQLLGCL+GVEMVLKD+GYPVK GSGVAAA+AYLQNTTP+I
Sbjct  311  FRIGHLGNVNELQLLGCLSGVEMVLKDVGYPVKFGSGVAAAAAYLQNTTPLI  362



>gb|AEX09267.1| alanine glyoxylate aminotransferase [Peperomia radiatinervosa]
Length=362

 Score =   423 bits (1087),  Expect = 5e-145, Method: Compositional matrix adjust.
 Identities = 211/232 (91%), Positives = 224/232 (97%), Gaps = 0/232 (0%)
 Frame = -1

Query  777  YQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA  598
            Y HPALLLVDGVSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTA
Sbjct  131  YNHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTA  190

Query  597  KSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTAT  418
            KSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG AT
Sbjct  191  KSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGRAT  250

Query  417  RLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKV  238
            RLAV+AWGLKNCTQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKV
Sbjct  251  RLAVEAWGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKV  310

Query  237  FRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  82
            FRIGHLGN+NELQLLGCL+GVEMVLKD+GYPVK GSGVAAA AYLQNTTP+I
Sbjct  311  FRIGHLGNVNELQLLGCLSGVEMVLKDVGYPVKFGSGVAAAEAYLQNTTPLI  362



>ref|XP_003600159.1| Alanine glyoxylate aminotransferase [Medicago truncatula]
 gb|AES70410.1| serine-glyoxylate aminotransferase-like protein [Medicago truncatula]
Length=401

 Score =   424 bits (1091),  Expect = 5e-145, Method: Compositional matrix adjust.
 Identities = 211/236 (89%), Positives = 226/236 (96%), Gaps = 0/236 (0%)
 Frame = -1

Query  777  YQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA  598
            YQHPALLLVDGVSSICA+DFRMDEWGVDVA+TGSQKALSLPTGIG V ASPKA+EASK+A
Sbjct  166  YQHPALLLVDGVSSICALDFRMDEWGVDVAITGSQKALSLPTGIGFVVASPKAIEASKSA  225

Query  597  KSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTAT  418
            KS+RVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+N+IARH RLGTAT
Sbjct  226  KSLRVFFDWSDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENIIARHNRLGTAT  285

Query  417  RLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKV  238
            RLAV+AWGLKNCTQ+EEWFSDTVTAVVVP YID +EIV+RAWKRYNLSLGLGLNKVAGKV
Sbjct  286  RLAVEAWGLKNCTQEEEWFSDTVTAVVVPPYIDGAEIVRRAWKRYNLSLGLGLNKVAGKV  345

Query  237  FRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  70
            FRIGHLGNLNELQLLG LAGVEM+LKD+GYPVKLGSGVAAASAYLQN  P+IPSRI
Sbjct  346  FRIGHLGNLNELQLLGALAGVEMILKDVGYPVKLGSGVAAASAYLQNNIPLIPSRI  401



>ref|XP_011043786.1| PREDICTED: serine--glyoxylate aminotransferase [Populus euphratica]
 ref|XP_011043787.1| PREDICTED: serine--glyoxylate aminotransferase [Populus euphratica]
 ref|XP_011043788.1| PREDICTED: serine--glyoxylate aminotransferase [Populus euphratica]
Length=401

 Score =   424 bits (1091),  Expect = 5e-145, Method: Compositional matrix adjust.
 Identities = 213/236 (90%), Positives = 225/236 (95%), Gaps = 0/236 (0%)
 Frame = -1

Query  777  YQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA  598
            Y+HPALLLVDGVSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTA
Sbjct  166  YRHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTA  225

Query  597  KSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTAT  418
            KS RVFFDWKDYLKFYK+GT+WPYTPSIQLLYGLR  LDLLF EGLDNVIARH RLG AT
Sbjct  226  KSFRVFFDWKDYLKFYKLGTFWPYTPSIQLLYGLREALDLLFLEGLDNVIARHARLGKAT  285

Query  417  RLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKV  238
            RLAV+AWGLKNCTQKEEWFSDTVTAV+VP YIDS+EIV+R WKRYNLSLGLGLNKVAGKV
Sbjct  286  RLAVEAWGLKNCTQKEEWFSDTVTAVLVPPYIDSAEIVRRGWKRYNLSLGLGLNKVAGKV  345

Query  237  FRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  70
            FRIGHLGNLNELQLLGCLAGVEM+LKD+GYPVKLGSGVAAA AYLQN TP+I SRI
Sbjct  346  FRIGHLGNLNELQLLGCLAGVEMILKDVGYPVKLGSGVAAACAYLQNNTPLIASRI  401



>gb|AEX09299.1| alanine glyoxylate aminotransferase [Peperomia cerrateae]
Length=362

 Score =   423 bits (1087),  Expect = 5e-145, Method: Compositional matrix adjust.
 Identities = 211/232 (91%), Positives = 224/232 (97%), Gaps = 0/232 (0%)
 Frame = -1

Query  777  YQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA  598
            + HPALLLVDGVSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTA
Sbjct  131  HNHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTA  190

Query  597  KSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTAT  418
            KSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH RLG AT
Sbjct  191  KSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHARLGKAT  250

Query  417  RLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKV  238
            RLAV+AWGLKNCTQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKV
Sbjct  251  RLAVEAWGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKV  310

Query  237  FRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  82
            FRIGHLGN+NELQLLGCL+GVEMVLKD+GYPVK GSGVAAA AYLQNTTP+I
Sbjct  311  FRIGHLGNVNELQLLGCLSGVEMVLKDVGYPVKFGSGVAAAEAYLQNTTPLI  362



>ref|XP_008666471.1| PREDICTED: serine--glyoxylate aminotransferase-like [Zea mays]
 tpg|DAA47907.1| TPA: hypothetical protein ZEAMMB73_592349 [Zea mays]
Length=262

 Score =   419 bits (1077),  Expect = 5e-145, Method: Compositional matrix adjust.
 Identities = 206/236 (87%), Positives = 224/236 (95%), Gaps = 0/236 (0%)
 Frame = -1

Query  777  YQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA  598
            + HPALLLVDGVSSICA+DFRMDEWGVDVALTGSQKALS+PTG+GIVCASP+ALEASKTA
Sbjct  27   HAHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSMPTGMGIVCASPRALEASKTA  86

Query  597  KSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTAT  418
            +SVRVFFDWKDYL+FY MGTYWPYTPSIQLLYGLR  LDL+FEEGLDNV+ RH RLGTAT
Sbjct  87   RSVRVFFDWKDYLRFYDMGTYWPYTPSIQLLYGLRTALDLIFEEGLDNVVRRHNRLGTAT  146

Query  417  RLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKV  238
            RLAV+AWGL NC QKEEWFSDTVTAVVVP  IDS+E+V+ AWKRYNLSLGLGLNKVAGKV
Sbjct  147  RLAVEAWGLSNCCQKEEWFSDTVTAVVVPPNIDSAEVVRHAWKRYNLSLGLGLNKVAGKV  206

Query  237  FRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  70
            FRIGHLGNLNELQLLGCL+GVEMVLKD+GYPVKLGSGVAAA+AYL N+TP+IPSRI
Sbjct  207  FRIGHLGNLNELQLLGCLSGVEMVLKDVGYPVKLGSGVAAAAAYLSNSTPLIPSRI  262



>ref|XP_002298306.1| hypothetical protein POPTR_0001s26020g [Populus trichocarpa]
 ref|XP_006369570.1| aminotransferase 2 family protein [Populus trichocarpa]
 ref|XP_006369571.1| hypothetical protein POPTR_0001s26020g [Populus trichocarpa]
 gb|EEE83111.1| hypothetical protein POPTR_0001s26020g [Populus trichocarpa]
 gb|ERP66139.1| aminotransferase 2 family protein [Populus trichocarpa]
 gb|ERP66140.1| hypothetical protein POPTR_0001s26020g [Populus trichocarpa]
Length=401

 Score =   424 bits (1090),  Expect = 5e-145, Method: Compositional matrix adjust.
 Identities = 212/236 (90%), Positives = 225/236 (95%), Gaps = 0/236 (0%)
 Frame = -1

Query  777  YQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA  598
            Y+HPAL LVDGVSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTA
Sbjct  166  YRHPALFLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTA  225

Query  597  KSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTAT  418
            KS RVFFDWKDYLKFYK+GT+WPYTPSIQLLYGLR  LDLLF EGLDNVIARH RLG AT
Sbjct  226  KSFRVFFDWKDYLKFYKLGTFWPYTPSIQLLYGLREALDLLFAEGLDNVIARHARLGKAT  285

Query  417  RLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKV  238
            RLAV+AWGLKNCTQKEEWFSDTVTAV+VP YIDS+EIV+R WKRYNLSLGLGLNKVAGKV
Sbjct  286  RLAVEAWGLKNCTQKEEWFSDTVTAVLVPPYIDSAEIVRRGWKRYNLSLGLGLNKVAGKV  345

Query  237  FRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  70
            FRIGHLGNLNELQLLGCLAGVEM+LKD+GYPVKLGSGVAAA AYLQN+TP+I SRI
Sbjct  346  FRIGHLGNLNELQLLGCLAGVEMILKDVGYPVKLGSGVAAACAYLQNSTPLIASRI  401



>gb|AEX09276.1| alanine glyoxylate aminotransferase [Peperomia parvisagittata]
Length=362

 Score =   423 bits (1087),  Expect = 5e-145, Method: Compositional matrix adjust.
 Identities = 211/232 (91%), Positives = 225/232 (97%), Gaps = 0/232 (0%)
 Frame = -1

Query  777  YQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA  598
            Y HPALLLVDGVSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTA
Sbjct  131  YNHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTA  190

Query  597  KSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTAT  418
            KSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG AT
Sbjct  191  KSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKAT  250

Query  417  RLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKV  238
            RLAV+AWGLKNCTQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKV
Sbjct  251  RLAVEAWGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKV  310

Query  237  FRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  82
            FRIGHLGN+NELQLLGCL+GVEMVLKD+GYPVK GSGVAAA+AYLQNTTP+I
Sbjct  311  FRIGHLGNVNELQLLGCLSGVEMVLKDVGYPVKFGSGVAAAAAYLQNTTPLI  362



>gb|AEX09298.1| alanine glyoxylate aminotransferase [Peperomia cerrateae]
Length=362

 Score =   423 bits (1087),  Expect = 6e-145, Method: Compositional matrix adjust.
 Identities = 211/232 (91%), Positives = 224/232 (97%), Gaps = 0/232 (0%)
 Frame = -1

Query  777  YQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA  598
            + HPALLLVDGVSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTA
Sbjct  131  HNHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTA  190

Query  597  KSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTAT  418
            KSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH RLG AT
Sbjct  191  KSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHARLGKAT  250

Query  417  RLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKV  238
            RLAV+AWGLKNCTQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKV
Sbjct  251  RLAVEAWGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKV  310

Query  237  FRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  82
            FRIGHLGN+NELQLLGCL+GVEMVLKD+GYPVK GSGVAAA AYLQNTTP+I
Sbjct  311  FRIGHLGNVNELQLLGCLSGVEMVLKDVGYPVKFGSGVAAAEAYLQNTTPLI  362



>gb|EPS59280.1| serine-glyoxylate aminotransferase [Genlisea aurea]
Length=401

 Score =   424 bits (1090),  Expect = 6e-145, Method: Compositional matrix adjust.
 Identities = 209/236 (89%), Positives = 227/236 (96%), Gaps = 0/236 (0%)
 Frame = -1

Query  777  YQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA  598
            YQHPAL LVDGVSSICA+DFRMDEWG+DVALTGSQKALSLPTG+GI+CASPKALEA+K+A
Sbjct  166  YQHPALFLVDGVSSICALDFRMDEWGIDVALTGSQKALSLPTGLGILCASPKALEATKSA  225

Query  597  KSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTAT  418
            KSVRVFFDW DYLKFYK+GTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH RLG AT
Sbjct  226  KSVRVFFDWNDYLKFYKLGTYWPYTPSIQLLYGLRAALDLVFEEGLDNVIARHARLGKAT  285

Query  417  RLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKV  238
            RLAV+AWGLKNCTQ EEW SDTVTA++VPSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKV
Sbjct  286  RLAVEAWGLKNCTQSEEWVSDTVTAIMVPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKV  345

Query  237  FRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  70
            FRIGHLGNLNELQLLGCLAGVE+VL+D+GYPVKLGSGVAAASAY QN+TP+I SRI
Sbjct  346  FRIGHLGNLNELQLLGCLAGVELVLRDVGYPVKLGSGVAAASAYFQNSTPLISSRI  401



>ref|NP_001284445.1| serine--glyoxylate aminotransferase-like [Cucumis melo]
 gb|ABQ81923.1| aminotransferase 2 [Cucumis melo]
Length=401

 Score =   424 bits (1090),  Expect = 6e-145, Method: Compositional matrix adjust.
 Identities = 211/236 (89%), Positives = 226/236 (96%), Gaps = 0/236 (0%)
 Frame = -1

Query  777  YQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA  598
            Y+HPAL LVDGV SICA+DFRMD+WGVDVALTGSQKALSLPTGIGIVCASP+ALEASKTA
Sbjct  166  YRHPALFLVDGVPSICALDFRMDDWGVDVALTGSQKALSLPTGIGIVCASPRALEASKTA  225

Query  597  KSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTAT  418
            KS+RVFFDWKDYLKFY +GTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG AT
Sbjct  226  KSLRVFFDWKDYLKFYNLGTYWPYTPSIQLLYGLRAALDLVFEEGLENVIARHKRLGQAT  285

Query  417  RLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKV  238
            RLAV+AWGLKNCTQKEEW SDTVTAVVVP YIDS+EIV+RAWKRYNLSLGLGLNKVAGKV
Sbjct  286  RLAVEAWGLKNCTQKEEWHSDTVTAVVVPPYIDSAEIVRRAWKRYNLSLGLGLNKVAGKV  345

Query  237  FRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  70
            FRIGHLGNLNELQLLGCLAGVEM+LKD+GYPVKLGSGVAAAS+YLQN  P+IPSRI
Sbjct  346  FRIGHLGNLNELQLLGCLAGVEMILKDVGYPVKLGSGVAAASSYLQNNIPLIPSRI  401



>ref|NP_001237048.1| enzymatic resistance protein [Glycine max]
 gb|AAZ94162.1| enzymatic resistance protein [Glycine max]
Length=401

 Score =   424 bits (1090),  Expect = 7e-145, Method: Compositional matrix adjust.
 Identities = 208/236 (88%), Positives = 229/236 (97%), Gaps = 0/236 (0%)
 Frame = -1

Query  777  YQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA  598
            YQHPALL+VDGVSSICA+DFRMDEWGVDVA+TGSQKALSLPTGIGIV A P+A+EASK A
Sbjct  166  YQHPALLIVDGVSSICALDFRMDEWGVDVAITGSQKALSLPTGIGIVVAGPRAIEASKHA  225

Query  597  KSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTAT  418
            KS+RVFFDWKDYLKFY++GTYWPYTPSI LLYGLRA L+L+FEEGL+NVIARH+RLG AT
Sbjct  226  KSLRVFFDWKDYLKFYQLGTYWPYTPSIHLLYGLRAALNLIFEEGLENVIARHSRLGKAT  285

Query  417  RLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKV  238
            RLAV+AWGLKNCTQKEEW+SDTVTAV+VP+YIDS+EIV+RAWKRYNLSLGLGLNKVAGKV
Sbjct  286  RLAVEAWGLKNCTQKEEWYSDTVTAVLVPAYIDSTEIVRRAWKRYNLSLGLGLNKVAGKV  345

Query  237  FRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  70
            FRIGHLGNLNELQLLGCLAGVEM+LKD+GYPVKLGSGVAAASAYLQ+T PMIPSRI
Sbjct  346  FRIGHLGNLNELQLLGCLAGVEMILKDVGYPVKLGSGVAAASAYLQDTIPMIPSRI  401



>ref|XP_004499480.1| PREDICTED: serine--glyoxylate aminotransferase-like [Cicer arietinum]
Length=401

 Score =   423 bits (1088),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 210/236 (89%), Positives = 226/236 (96%), Gaps = 0/236 (0%)
 Frame = -1

Query  777  YQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA  598
            YQHPALLLVDGVSSICA+DFRMDEWGVDVA+TGSQKA SLPTGIGIV ASPKA+EASK+A
Sbjct  166  YQHPALLLVDGVSSICALDFRMDEWGVDVAITGSQKAXSLPTGIGIVVASPKAIEASKSA  225

Query  597  KSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTAT  418
            KS+RVFFDW DYLKFYK+GTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH+RLG AT
Sbjct  226  KSLRVFFDWSDYLKFYKLGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHSRLGKAT  285

Query  417  RLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKV  238
            RLAV+AWGLKNCTQ EEW+SDTVTAVVVP YIDS+EIV+RAWKRYNLSLGLGLNKVAGKV
Sbjct  286  RLAVEAWGLKNCTQSEEWYSDTVTAVVVPPYIDSAEIVRRAWKRYNLSLGLGLNKVAGKV  345

Query  237  FRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  70
            FRIGHLGNLNELQLLGCLAGVEM+LKD+GYP+K GSGVAAASAYLQN  P+IPSRI
Sbjct  346  FRIGHLGNLNELQLLGCLAGVEMILKDVGYPIKYGSGVAAASAYLQNNIPLIPSRI  401



>gb|AEX09253.1| alanine glyoxylate aminotransferase [Peperomia bracteata]
Length=362

 Score =   422 bits (1085),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 210/232 (91%), Positives = 225/232 (97%), Gaps = 0/232 (0%)
 Frame = -1

Query  777  YQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA  598
            Y HPALLLVDGVSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GI+CASPKALEASKTA
Sbjct  131  YNHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGMGILCASPKALEASKTA  190

Query  597  KSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTAT  418
            KSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG AT
Sbjct  191  KSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKAT  250

Query  417  RLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKV  238
            RLAV+AWGLKNCTQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKV
Sbjct  251  RLAVEAWGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKV  310

Query  237  FRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  82
            FRIGHLGN+NELQLLGCL+GVEMVLKD+GYPVK GSGVAAA+AYLQNTTP+I
Sbjct  311  FRIGHLGNVNELQLLGCLSGVEMVLKDVGYPVKFGSGVAAAAAYLQNTTPLI  362



>gb|AEX09275.1| alanine glyoxylate aminotransferase [Peperomia parvisagittata]
Length=362

 Score =   422 bits (1084),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 210/232 (91%), Positives = 225/232 (97%), Gaps = 0/232 (0%)
 Frame = -1

Query  777  YQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA  598
            Y HPALLLVDGVSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTA
Sbjct  131  YNHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTA  190

Query  597  KSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTAT  418
            KSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG AT
Sbjct  191  KSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKAT  250

Query  417  RLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKV  238
            RLAV+AWGLKNCTQ+EE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKV
Sbjct  251  RLAVEAWGLKNCTQEEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKV  310

Query  237  FRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  82
            FRIGHLGN+NELQLLGCL+GVEMVLKD+GYPVK GSGVAAA+AYLQNTTP+I
Sbjct  311  FRIGHLGNVNELQLLGCLSGVEMVLKDVGYPVKFGSGVAAAAAYLQNTTPLI  362



>gb|ABQ81925.1| aminotransferase 2 [Cucumis melo]
Length=401

 Score =   423 bits (1087),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 210/236 (89%), Positives = 226/236 (96%), Gaps = 0/236 (0%)
 Frame = -1

Query  777  YQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA  598
            Y+HPAL LVDGVSSICA+DFRMD+WGVDVALTGSQK LSLPTGIGIVCASP+ALEASKTA
Sbjct  166  YRHPALFLVDGVSSICALDFRMDDWGVDVALTGSQKVLSLPTGIGIVCASPRALEASKTA  225

Query  597  KSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTAT  418
            KS+RVFFDWKDYLKFY +GTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG AT
Sbjct  226  KSLRVFFDWKDYLKFYNLGTYWPYTPSIQLLYGLRAALDLVFEEGLENVIARHKRLGQAT  285

Query  417  RLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKV  238
            RLAV+AWGLKNCTQKEEW SDTVTAVVVP Y+DS+EIV+RAWKRYNLSLGLGLNKVAGKV
Sbjct  286  RLAVEAWGLKNCTQKEEWHSDTVTAVVVPPYMDSAEIVRRAWKRYNLSLGLGLNKVAGKV  345

Query  237  FRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  70
            FRIGHLGNLNELQLLGCLAGVEM+LKD+GYPVKLGSGVAAAS+YLQN  P+IPSRI
Sbjct  346  FRIGHLGNLNELQLLGCLAGVEMILKDVGYPVKLGSGVAAASSYLQNNIPLIPSRI  401



>gb|AFK40703.1| unknown [Medicago truncatula]
Length=401

 Score =   423 bits (1087),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 210/236 (89%), Positives = 226/236 (96%), Gaps = 0/236 (0%)
 Frame = -1

Query  777  YQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA  598
            YQHPALLLVDGVSSICA+DFRMDEWGVDVA+TGSQKALSLPTGIG V ASPKA+EASK+A
Sbjct  166  YQHPALLLVDGVSSICALDFRMDEWGVDVAITGSQKALSLPTGIGFVVASPKAIEASKSA  225

Query  597  KSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTAT  418
            KS+RVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+N+IARH RLGTAT
Sbjct  226  KSLRVFFDWSDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENIIARHNRLGTAT  285

Query  417  RLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKV  238
            RLAV+AWGLKNCTQ+EEWFSDTVTAVVVP YID +EIV+RAWKR+NLSLGLGLNKVAGKV
Sbjct  286  RLAVEAWGLKNCTQEEEWFSDTVTAVVVPPYIDGAEIVRRAWKRFNLSLGLGLNKVAGKV  345

Query  237  FRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  70
            FRIGHLGNLNELQLLG LAGVEM+LKD+GYPVKLGSGVAAASAYLQN  P+IPSRI
Sbjct  346  FRIGHLGNLNELQLLGALAGVEMILKDVGYPVKLGSGVAAASAYLQNNIPLIPSRI  401



>gb|AEX09311.1| alanine glyoxylate aminotransferase [Peperomia andina]
Length=362

 Score =   421 bits (1083),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 210/232 (91%), Positives = 225/232 (97%), Gaps = 0/232 (0%)
 Frame = -1

Query  777  YQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA  598
            Y HPALLLVDGVSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTA
Sbjct  131  YNHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTA  190

Query  597  KSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTAT  418
            KSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG AT
Sbjct  191  KSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRATLDLIFEEGLENVIARHARLGKAT  250

Query  417  RLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKV  238
            RLAV+AWGLKNCTQKEE FSDTVTAV++PSYI+S+EIV+RAWKRYNLSLGLGLNKVAGKV
Sbjct  251  RLAVEAWGLKNCTQKEECFSDTVTAVMIPSYINSAEIVRRAWKRYNLSLGLGLNKVAGKV  310

Query  237  FRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  82
            FRIGHLGN+NELQLLGCL+GVEMVLKD+GYPVK GSGVAAA+AYLQNTTP+I
Sbjct  311  FRIGHLGNVNELQLLGCLSGVEMVLKDVGYPVKFGSGVAAAAAYLQNTTPLI  362



>gb|AEX09305.1| alanine glyoxylate aminotransferase [Peperomia pseudoverruculosa]
Length=362

 Score =   421 bits (1083),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 210/232 (91%), Positives = 223/232 (96%), Gaps = 0/232 (0%)
 Frame = -1

Query  777  YQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA  598
            Y HPALLLVDGVSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTA
Sbjct  131  YNHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTA  190

Query  597  KSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTAT  418
            KSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG AT
Sbjct  191  KSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKAT  250

Query  417  RLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKV  238
            RLAV+AWGLKNCTQKEE FSDTVTAV++PSYIDS+EIV+R WKRYNLSLGLGLNKVAGKV
Sbjct  251  RLAVEAWGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRGWKRYNLSLGLGLNKVAGKV  310

Query  237  FRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  82
            FRIGHLGN+NELQLLGCL+GVEMVLKD+GYPVK GSGVAAA AYLQNTTP+I
Sbjct  311  FRIGHLGNVNELQLLGCLSGVEMVLKDVGYPVKFGSGVAAAEAYLQNTTPLI  362



>ref|XP_010673724.1| PREDICTED: serine--glyoxylate aminotransferase [Beta vulgaris 
subsp. vulgaris]
Length=401

 Score =   422 bits (1086),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 210/236 (89%), Positives = 227/236 (96%), Gaps = 0/236 (0%)
 Frame = -1

Query  777  YQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA  598
            Y HPALLLVDGVSSICA+DFR DEWGVDVALTGSQKALSLPTG+GI+ ASPKALEA+KTA
Sbjct  166  YNHPALLLVDGVSSICALDFRQDEWGVDVALTGSQKALSLPTGMGIISASPKALEATKTA  225

Query  597  KSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTAT  418
            KSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH+RLG AT
Sbjct  226  KSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHSRLGKAT  285

Query  417  RLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKV  238
            RLAV+AWGLKNCTQKEEWFSDTVTAVVVP +IDS+E+VKRAW+RYN+SLGLGLNKVAGKV
Sbjct  286  RLAVEAWGLKNCTQKEEWFSDTVTAVVVPPHIDSNEVVKRAWRRYNMSLGLGLNKVAGKV  345

Query  237  FRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  70
            FRIGHLGN+NELQLLG LAGVEM+LKD+GYPVKLGSGVAAA+AYLQN+TPMI SRI
Sbjct  346  FRIGHLGNINELQLLGALAGVEMILKDVGYPVKLGSGVAAAAAYLQNSTPMITSRI  401



>gb|AAQ56193.1| aminotransferase 2 [Cucumis melo]
Length=401

 Score =   422 bits (1086),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 210/236 (89%), Positives = 226/236 (96%), Gaps = 0/236 (0%)
 Frame = -1

Query  777  YQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA  598
            Y+HPAL LVDGVSSICA+DFRMD+WGV VALTGSQKALSLPTG+GIVCASP+ALEASKTA
Sbjct  166  YRHPALFLVDGVSSICALDFRMDDWGVGVALTGSQKALSLPTGVGIVCASPRALEASKTA  225

Query  597  KSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTAT  418
            KS+RVFFDWKDYLKFY +GTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG AT
Sbjct  226  KSLRVFFDWKDYLKFYNLGTYWPYTPSIQLLYGLRAALDLVFEEGLENVIARHKRLGQAT  285

Query  417  RLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKV  238
            RLAV+AWGLKNCTQKEEW SDTVTAVVVP YIDS+EIV+RAWKRYNLSLGLGLNKVAGKV
Sbjct  286  RLAVEAWGLKNCTQKEEWHSDTVTAVVVPPYIDSAEIVRRAWKRYNLSLGLGLNKVAGKV  345

Query  237  FRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  70
            FRIGHLGNLNELQLLGCLAGVEM+LKD+GYPVKLGSGVAAAS+YLQN  P+IPSRI
Sbjct  346  FRIGHLGNLNELQLLGCLAGVEMILKDVGYPVKLGSGVAAASSYLQNNIPLIPSRI  401



>ref|XP_004140203.1| PREDICTED: serine--glyoxylate aminotransferase-like [Cucumis 
sativus]
 ref|XP_004156042.1| PREDICTED: serine--glyoxylate aminotransferase-like [Cucumis 
sativus]
 gb|KGN48108.1| Aminotransferase 2 [Cucumis sativus]
Length=401

 Score =   422 bits (1086),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 210/236 (89%), Positives = 226/236 (96%), Gaps = 0/236 (0%)
 Frame = -1

Query  777  YQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA  598
            Y+HPAL LVDGVSSICA+DFRMD+WGVDVALTGSQKALSLPTGIGIVCASP+ALEASKTA
Sbjct  166  YRHPALFLVDGVSSICALDFRMDDWGVDVALTGSQKALSLPTGIGIVCASPRALEASKTA  225

Query  597  KSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTAT  418
            KS+RVFFDWKDYLKFY +GTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG AT
Sbjct  226  KSLRVFFDWKDYLKFYNLGTYWPYTPSIQLLYGLRAALDLVFEEGLENVIARHKRLGQAT  285

Query  417  RLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKV  238
            RLAV+AWGLKNCTQKEEW SDTVTAV+VP YIDSSEIV+RAWKRYNLSLGLGLNKVAGKV
Sbjct  286  RLAVEAWGLKNCTQKEEWHSDTVTAVLVPPYIDSSEIVRRAWKRYNLSLGLGLNKVAGKV  345

Query  237  FRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  70
            FRIGHLG+LNELQLLGCLAGVEM+LKD+GYPVKLGSGVAAAS+Y QN  P+IPSRI
Sbjct  346  FRIGHLGHLNELQLLGCLAGVEMILKDVGYPVKLGSGVAAASSYFQNNIPLIPSRI  401



>emb|CBI24214.3| unnamed protein product [Vitis vinifera]
Length=374

 Score =   421 bits (1082),  Expect = 4e-144, Method: Compositional matrix adjust.
 Identities = 206/236 (87%), Positives = 226/236 (96%), Gaps = 0/236 (0%)
 Frame = -1

Query  777  YQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA  598
            Y+HPAL LVDGVSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCA PKALEASK+A
Sbjct  139  YRHPALFLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCAGPKALEASKSA  198

Query  597  KSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTAT  418
            +SVR FFDW DYLKFYK+GT+WPYTPSIQLLYG+RA LD++FEEGLDNVI RH+RLG AT
Sbjct  199  QSVRFFFDWNDYLKFYKLGTFWPYTPSIQLLYGMRAALDIIFEEGLDNVIERHSRLGKAT  258

Query  417  RLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKV  238
            RLAV+AWGLKNCTQ+EEWFSDTVTAVVVP YIDS+EIVKRAWKRYNLSLGLGLNKVAGKV
Sbjct  259  RLAVEAWGLKNCTQREEWFSDTVTAVVVPPYIDSTEIVKRAWKRYNLSLGLGLNKVAGKV  318

Query  237  FRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  70
            FRIGHLG+LN++QLLGCLAGVEMVLKD+GYPVK+GSGV AASAYLQNT P+IPSRI
Sbjct  319  FRIGHLGHLNDVQLLGCLAGVEMVLKDVGYPVKMGSGVGAASAYLQNTIPLIPSRI  374



>gb|AEX09248.1| alanine glyoxylate aminotransferase [Peperomia questionis]
Length=360

 Score =   420 bits (1080),  Expect = 5e-144, Method: Compositional matrix adjust.
 Identities = 210/230 (91%), Positives = 223/230 (97%), Gaps = 0/230 (0%)
 Frame = -1

Query  777  YQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA  598
            Y HPALLLVDGVSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTA
Sbjct  131  YNHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTA  190

Query  597  KSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTAT  418
            KSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG AT
Sbjct  191  KSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKAT  250

Query  417  RLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKV  238
            RLAV+AWGLKNCTQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKV
Sbjct  251  RLAVEAWGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKV  310

Query  237  FRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTP  88
            FRIGHLGN+NELQLLGCL+GVEMVLKD+GYPVK GSGVAAA+AYLQNTTP
Sbjct  311  FRIGHLGNVNELQLLGCLSGVEMVLKDVGYPVKFGSGVAAAAAYLQNTTP  360



>gb|AEX09307.1| alanine glyoxylate aminotransferase [Peperomia verruculosa]
Length=351

 Score =   420 bits (1079),  Expect = 5e-144, Method: Compositional matrix adjust.
 Identities = 210/232 (91%), Positives = 224/232 (97%), Gaps = 0/232 (0%)
 Frame = -1

Query  777  YQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA  598
            Y HPALLLVDGVSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTA
Sbjct  120  YNHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTA  179

Query  597  KSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTAT  418
            KSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG AT
Sbjct  180  KSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKAT  239

Query  417  RLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKV  238
            RLAV+AWGLKNCTQKEE FSDTVTAV++PS IDS+EIV+RAWKRYNLSLGLGLNKVAGKV
Sbjct  240  RLAVEAWGLKNCTQKEECFSDTVTAVMIPSNIDSAEIVRRAWKRYNLSLGLGLNKVAGKV  299

Query  237  FRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  82
            FRIGHLGN+NELQLLGCL+GVEMVLKD+GYPVK GSGVAAA+AYLQNTTP+I
Sbjct  300  FRIGHLGNVNELQLLGCLSGVEMVLKDVGYPVKFGSGVAAAAAYLQNTTPLI  351



>gb|AEX09270.1| alanine glyoxylate aminotransferase [Peperomia verruculosa]
 gb|AEX09296.1| alanine glyoxylate aminotransferase [Peperomia verruculosa]
 gb|AEX09297.1| alanine glyoxylate aminotransferase [Peperomia verruculosa]
Length=362

 Score =   420 bits (1080),  Expect = 6e-144, Method: Compositional matrix adjust.
 Identities = 210/232 (91%), Positives = 224/232 (97%), Gaps = 0/232 (0%)
 Frame = -1

Query  777  YQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA  598
            Y HPALLLVDGVSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTA
Sbjct  131  YNHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTA  190

Query  597  KSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTAT  418
            KSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG AT
Sbjct  191  KSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKAT  250

Query  417  RLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKV  238
            RLAV+AWGLKNCTQKEE FSDTVTAV++PS IDS+EIV+RAWKRYNLSLGLGLNKVAGKV
Sbjct  251  RLAVEAWGLKNCTQKEECFSDTVTAVMIPSNIDSAEIVRRAWKRYNLSLGLGLNKVAGKV  310

Query  237  FRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  82
            FRIGHLGN+NELQLLGCL+GVEMVLKD+GYPVK GSGVAAA+AYLQNTTP+I
Sbjct  311  FRIGHLGNVNELQLLGCLSGVEMVLKDVGYPVKFGSGVAAAAAYLQNTTPLI  362



>gb|ACJ61246.1| serine glyoxylate aminotransferase 2 [Glycine max]
Length=401

 Score =   422 bits (1084),  Expect = 6e-144, Method: Compositional matrix adjust.
 Identities = 208/236 (88%), Positives = 229/236 (97%), Gaps = 0/236 (0%)
 Frame = -1

Query  777  YQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA  598
            Y+HPALL+VDGVSSICA+DFRMDEWGVDVA+TGSQKALSLPTGIGIV A P+A+EASK A
Sbjct  166  YRHPALLIVDGVSSICALDFRMDEWGVDVAITGSQKALSLPTGIGIVVAGPRAIEASKHA  225

Query  597  KSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTAT  418
            KS+RVFFDWKDYLKFY++GTYWPYTPSI LLYGLRA LDL+FEEGL+NVIARH+RLG AT
Sbjct  226  KSLRVFFDWKDYLKFYQLGTYWPYTPSIHLLYGLRAALDLIFEEGLENVIARHSRLGKAT  285

Query  417  RLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKV  238
            RLAV+AWGLKNCTQKEEW+SDTVTAV+VP+YIDS+EIV+RAWKRYNLSLGLGLNKVAGKV
Sbjct  286  RLAVEAWGLKNCTQKEEWYSDTVTAVLVPAYIDSTEIVRRAWKRYNLSLGLGLNKVAGKV  345

Query  237  FRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  70
            FRIGHLG+LNELQLLGCLAGVEM+LKD+GYPVKLGSGVAAASAYLQNT PMIPSRI
Sbjct  346  FRIGHLGHLNELQLLGCLAGVEMILKDVGYPVKLGSGVAAASAYLQNTIPMIPSRI  401



>gb|ACJ61247.1| serine glyoxylate aminotransferase 3 [Glycine max]
Length=401

 Score =   421 bits (1083),  Expect = 7e-144, Method: Compositional matrix adjust.
 Identities = 209/236 (89%), Positives = 228/236 (97%), Gaps = 0/236 (0%)
 Frame = -1

Query  777  YQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA  598
            YQHPALL+VDGVSSICA+DFRMDEWGVDVA+TGSQKALSLPTGIGIV A PKA+EASK A
Sbjct  166  YQHPALLIVDGVSSICALDFRMDEWGVDVAITGSQKALSLPTGIGIVVAGPKAIEASKHA  225

Query  597  KSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTAT  418
            KS+RVFFDWKDYLKFY++GTYWPYTPSI LLYGLRA LDL+FEEGL+NVIARH+RLG AT
Sbjct  226  KSLRVFFDWKDYLKFYQLGTYWPYTPSIHLLYGLRAALDLIFEEGLENVIARHSRLGKAT  285

Query  417  RLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKV  238
            RLAV+AWGLKNCTQKEEW+SDTVTAV+VP+YIDS+EIV+RAWKR NLSLGLGLNKVAGKV
Sbjct  286  RLAVEAWGLKNCTQKEEWYSDTVTAVLVPAYIDSTEIVRRAWKRNNLSLGLGLNKVAGKV  345

Query  237  FRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  70
            FRIGHLG+LNELQLLGCLAGVEM+LKD+GYPVKLGSGVAAASAYLQNT PMIPSRI
Sbjct  346  FRIGHLGHLNELQLLGCLAGVEMILKDVGYPVKLGSGVAAASAYLQNTIPMIPSRI  401



>gb|ABA00460.1| serine-glyoxylate aminotransferase [Spirodela polyrhiza]
Length=401

 Score =   421 bits (1083),  Expect = 8e-144, Method: Compositional matrix adjust.
 Identities = 214/236 (91%), Positives = 229/236 (97%), Gaps = 0/236 (0%)
 Frame = -1

Query  777  YQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA  598
            Y+HPALLLVDGVSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTA
Sbjct  166  YRHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTA  225

Query  597  KSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTAT  418
            KSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVI RH+RLGTAT
Sbjct  226  KSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIRRHSRLGTAT  285

Query  417  RLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKV  238
            RLAV+AWGLKNCTQKEEWFSDTVTAVVVP YIDSSEIV+RAWKR+NLSLGLGLNKVAGKV
Sbjct  286  RLAVEAWGLKNCTQKEEWFSDTVTAVVVPGYIDSSEIVRRAWKRFNLSLGLGLNKVAGKV  345

Query  237  FRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  70
            FRIGHLGN+NELQLLGCL+GVEMVL+D+GYP KLGSGVAAA+AYL N TP+IPSRI
Sbjct  346  FRIGHLGNVNELQLLGCLSGVEMVLRDVGYPAKLGSGVAAAAAYLLNNTPLIPSRI  401



>ref|XP_002279236.1| PREDICTED: serine--glyoxylate aminotransferase [Vitis vinifera]
 ref|XP_010651495.1| PREDICTED: serine--glyoxylate aminotransferase [Vitis vinifera]
Length=401

 Score =   421 bits (1082),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 206/236 (87%), Positives = 226/236 (96%), Gaps = 0/236 (0%)
 Frame = -1

Query  777  YQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA  598
            Y+HPAL LVDGVSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCA PKALEASK+A
Sbjct  166  YRHPALFLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCAGPKALEASKSA  225

Query  597  KSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTAT  418
            +SVR FFDW DYLKFYK+GT+WPYTPSIQLLYG+RA LD++FEEGLDNVI RH+RLG AT
Sbjct  226  QSVRFFFDWNDYLKFYKLGTFWPYTPSIQLLYGMRAALDIIFEEGLDNVIERHSRLGKAT  285

Query  417  RLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKV  238
            RLAV+AWGLKNCTQ+EEWFSDTVTAVVVP YIDS+EIVKRAWKRYNLSLGLGLNKVAGKV
Sbjct  286  RLAVEAWGLKNCTQREEWFSDTVTAVVVPPYIDSTEIVKRAWKRYNLSLGLGLNKVAGKV  345

Query  237  FRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  70
            FRIGHLG+LN++QLLGCLAGVEMVLKD+GYPVK+GSGV AASAYLQNT P+IPSRI
Sbjct  346  FRIGHLGHLNDVQLLGCLAGVEMVLKDVGYPVKMGSGVGAASAYLQNTIPLIPSRI  401



>ref|XP_003574732.2| PREDICTED: serine--glyoxylate aminotransferase [Brachypodium 
distachyon]
Length=461

 Score =   423 bits (1087),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 218/236 (92%), Positives = 230/236 (97%), Gaps = 0/236 (0%)
 Frame = -1

Query  777  YQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA  598
            Y+HPALLLVDGVSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASP+ALEASKTA
Sbjct  226  YRHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPRALEASKTA  285

Query  597  KSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTAT  418
            KSVRVFFDWKDYLKFYKMGTYWPYTPSIQLLYGLRAGLDL+FEEGLDNVI RHTRLGTAT
Sbjct  286  KSVRVFFDWKDYLKFYKMGTYWPYTPSIQLLYGLRAGLDLIFEEGLDNVIKRHTRLGTAT  345

Query  417  RLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKV  238
            R+AV+AWGLKNCTQKEE FSDTVTAVVVP YIDS+EIVK AWKRYNLSLGLGLNKVAGKV
Sbjct  346  RMAVEAWGLKNCTQKEENFSDTVTAVVVPPYIDSAEIVKHAWKRYNLSLGLGLNKVAGKV  405

Query  237  FRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  70
            FRIGHLGNLNELQLLGCL+GVEMVLKD+GYPVKLGSGVAAA+AYL N TP+IPSRI
Sbjct  406  FRIGHLGNLNELQLLGCLSGVEMVLKDVGYPVKLGSGVAAAAAYLSNATPLIPSRI  461



>ref|XP_004973838.1| PREDICTED: serine--glyoxylate aminotransferase-like isoform X2 
[Setaria italica]
 ref|XP_004973839.1| PREDICTED: serine--glyoxylate aminotransferase-like isoform X3 
[Setaria italica]
Length=402

 Score =   421 bits (1081),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 212/236 (90%), Positives = 225/236 (95%), Gaps = 0/236 (0%)
 Frame = -1

Query  777  YQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA  598
            Y+HPAL+LVDGVSSICA+DFRMDEWGVDVALTGSQKALS+PTG+GIVCASPKALEASKTA
Sbjct  167  YRHPALILVDGVSSICALDFRMDEWGVDVALTGSQKALSMPTGLGIVCASPKALEASKTA  226

Query  597  KSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTAT  418
            KSVRVFFDW DYLK YK+G+YWPYTPSIQLLYGLRA LDLLF EGLDNV  RH RLGTAT
Sbjct  227  KSVRVFFDWNDYLKSYKIGSYWPYTPSIQLLYGLRAALDLLFLEGLDNVFKRHKRLGTAT  286

Query  417  RLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKV  238
            RLAV+AWGLKNCTQKEEWFSDTVTAVVVP YIDS EIVK AWKRYNLSLGLGLNKVAGKV
Sbjct  287  RLAVEAWGLKNCTQKEEWFSDTVTAVVVPPYIDSGEIVKHAWKRYNLSLGLGLNKVAGKV  346

Query  237  FRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  70
            FRIGHLGNLNELQLLGCL+GVEMVLKD+GYPVKLGSGVAAA+AYL N+TP+IPSRI
Sbjct  347  FRIGHLGNLNELQLLGCLSGVEMVLKDVGYPVKLGSGVAAAAAYLSNSTPLIPSRI  402



>gb|AEX09259.1| alanine glyoxylate aminotransferase [Peperomia bracteata]
Length=351

 Score =   419 bits (1076),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 210/232 (91%), Positives = 224/232 (97%), Gaps = 0/232 (0%)
 Frame = -1

Query  777  YQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA  598
            Y HPALLLVDGVSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTA
Sbjct  120  YNHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTA  179

Query  597  KSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTAT  418
            KSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG AT
Sbjct  180  KSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKAT  239

Query  417  RLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKV  238
            RLAV+A GLKNCTQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKV
Sbjct  240  RLAVEARGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKV  299

Query  237  FRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  82
            FRIGHLGN+NELQLLGCL+GVEMVLKD+GYPVK GSGVAAA+AYLQNTTP+I
Sbjct  300  FRIGHLGNVNELQLLGCLSGVEMVLKDVGYPVKFGSGVAAAAAYLQNTTPLI  351



>gb|AEX09300.1| alanine glyoxylate aminotransferase [Peperomia parvifolia]
Length=362

 Score =   419 bits (1077),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 209/232 (90%), Positives = 224/232 (97%), Gaps = 0/232 (0%)
 Frame = -1

Query  777  YQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA  598
            Y HPALLLVDGVSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTA
Sbjct  131  YNHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTA  190

Query  597  KSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTAT  418
            KSVRVFFDW D LKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG AT
Sbjct  191  KSVRVFFDWNDNLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKAT  250

Query  417  RLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKV  238
            RLAV+AWGLKNCTQKEE FSDTVTAV++PSYIDS+EIV+RAW+RYNLSLGLGLNKVAGKV
Sbjct  251  RLAVEAWGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRAWERYNLSLGLGLNKVAGKV  310

Query  237  FRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  82
            FRIGHLGN+NELQLLGCL+GVEMVLKD+GYPVK GSGVAAA+AYLQNTTP+I
Sbjct  311  FRIGHLGNVNELQLLGCLSGVEMVLKDVGYPVKFGSGVAAAAAYLQNTTPLI  362



>gb|KHN28521.1| Serine--glyoxylate aminotransferase [Glycine soja]
Length=401

 Score =   420 bits (1080),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 207/236 (88%), Positives = 229/236 (97%), Gaps = 0/236 (0%)
 Frame = -1

Query  777  YQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA  598
            Y+HPALL+VDGVSSICA+DFRMDEWGVDVA+TGSQKALSLPTGIGIV A P+A+EASK A
Sbjct  166  YRHPALLIVDGVSSICALDFRMDEWGVDVAITGSQKALSLPTGIGIVVAGPRAIEASKHA  225

Query  597  KSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTAT  418
            KS+RVFFDWKD+LKFY++GTYWPYTPSI LLYGLRA LDL+FEEGL+NVIARH+RLG AT
Sbjct  226  KSLRVFFDWKDHLKFYQLGTYWPYTPSIHLLYGLRAALDLIFEEGLENVIARHSRLGKAT  285

Query  417  RLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKV  238
            RLAV+AWGLKNCTQKEEW+SDTVTAV+VP+YIDS+EIV+RAWKRYNLSLGLGLNKVAGKV
Sbjct  286  RLAVEAWGLKNCTQKEEWYSDTVTAVLVPAYIDSTEIVRRAWKRYNLSLGLGLNKVAGKV  345

Query  237  FRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  70
            FRIGHLGNLNELQLLGCLAGVEM+LKD+GYPVKLGSGVAAASAYLQ+T PMIPSRI
Sbjct  346  FRIGHLGNLNELQLLGCLAGVEMILKDVGYPVKLGSGVAAASAYLQDTIPMIPSRI  401



>gb|ACN39798.1| unknown [Picea sitchensis]
Length=401

 Score =   420 bits (1080),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 210/234 (90%), Positives = 225/234 (96%), Gaps = 0/234 (0%)
 Frame = -1

Query  771  HPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKS  592
            HPAL LVDGVSS+CAIDFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEA+KTAKS
Sbjct  168  HPALFLVDGVSSVCAIDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEATKTAKS  227

Query  591  VRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRL  412
            +RVFFDW DYLKFYK+GTYWPYTPSIQLLYGLR  LDL+F EGLDNVIARHTRLG ATRL
Sbjct  228  LRVFFDWNDYLKFYKLGTYWPYTPSIQLLYGLRTALDLIFLEGLDNVIARHTRLGRATRL  287

Query  411  AVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFR  232
            AV+AWGLKNCTQ+EEW+SDTVTAVV+P YIDS+EIVKRAWKRYNLSLGLGLNKVAGKVFR
Sbjct  288  AVEAWGLKNCTQREEWYSDTVTAVVIPPYIDSTEIVKRAWKRYNLSLGLGLNKVAGKVFR  347

Query  231  IGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  70
            IGHLGNLNELQLLGCL+GVEMVLKDIGYPVKLGSGVAAA+AYLQ TTP+I SR+
Sbjct  348  IGHLGNLNELQLLGCLSGVEMVLKDIGYPVKLGSGVAAAAAYLQMTTPLIASRV  401



>gb|ABK24112.1| unknown [Picea sitchensis]
Length=401

 Score =   420 bits (1080),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 210/234 (90%), Positives = 225/234 (96%), Gaps = 0/234 (0%)
 Frame = -1

Query  771  HPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKS  592
            HPAL LVDGVSS+CAIDFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEA+KTAKS
Sbjct  168  HPALFLVDGVSSVCAIDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEATKTAKS  227

Query  591  VRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRL  412
            +RVFFDW DYLKFYK+GTYWPYTPSIQLLYGLR  LDL+F EGLDNVIARHTRLG ATRL
Sbjct  228  LRVFFDWNDYLKFYKLGTYWPYTPSIQLLYGLRTALDLIFLEGLDNVIARHTRLGRATRL  287

Query  411  AVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFR  232
            AV+AWGLKNCTQ+EEW+SDTVTAVV+P YIDS+EIVKRAWKRYNLSLGLGLNKVAGKVFR
Sbjct  288  AVEAWGLKNCTQREEWYSDTVTAVVIPPYIDSTEIVKRAWKRYNLSLGLGLNKVAGKVFR  347

Query  231  IGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  70
            IGHLGNLNELQLLGCL+GVEMVLKDIGYPVKLGSGVAAA+AYLQ TTP+I SR+
Sbjct  348  IGHLGNLNELQLLGCLSGVEMVLKDIGYPVKLGSGVAAAAAYLQMTTPLIASRV  401



>emb|CDP08481.1| unnamed protein product [Coffea canephora]
Length=401

 Score =   420 bits (1080),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 211/236 (89%), Positives = 223/236 (94%), Gaps = 0/236 (0%)
 Frame = -1

Query  777  YQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA  598
            Y HPAL +VDGVSSICA+DFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA
Sbjct  166  YNHPALFVVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA  225

Query  597  KSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTAT  418
            KSVRVFFDWKDYLK YK+GTYWPYTPSI LLYGLRA LDL+FEEGL+NV ARH RL  AT
Sbjct  226  KSVRVFFDWKDYLKVYKLGTYWPYTPSIHLLYGLRAALDLIFEEGLENVFARHARLAKAT  285

Query  417  RLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKV  238
            RLA++AWGLKNCTQKEEW+SDTVTAV+VP  IDSSEIV+RAWKRYNLSLGLGLNKVAGKV
Sbjct  286  RLAMEAWGLKNCTQKEEWYSDTVTAVLVPPNIDSSEIVRRAWKRYNLSLGLGLNKVAGKV  345

Query  237  FRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  70
            FRIGHLGNLNELQLLGCLAGVEMVLKD+GYPVKLGSGV AA AYLQNTTP+IPSRI
Sbjct  346  FRIGHLGNLNELQLLGCLAGVEMVLKDVGYPVKLGSGVGAACAYLQNTTPLIPSRI  401



>ref|NP_001276276.1| serine--glyoxylate aminotransferase-like [Glycine max]
 gb|ACU18294.1| unknown [Glycine max]
Length=401

 Score =   420 bits (1079),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 207/236 (88%), Positives = 228/236 (97%), Gaps = 0/236 (0%)
 Frame = -1

Query  777  YQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA  598
            Y+HPALL+VDGVSSICA+DFRMDEWGVDVA+TGSQKALSLPTGIGIV A P+A+EASK A
Sbjct  166  YRHPALLIVDGVSSICALDFRMDEWGVDVAITGSQKALSLPTGIGIVVAGPRAIEASKHA  225

Query  597  KSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTAT  418
            KS+RVFFDWKDYLKFY++GTYWPYTPSI LLYGLRA LDL+FEEGL+NVIARH+RLG AT
Sbjct  226  KSLRVFFDWKDYLKFYQLGTYWPYTPSIHLLYGLRAALDLIFEEGLENVIARHSRLGKAT  285

Query  417  RLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKV  238
            RLAV+AWGLKNCTQKEEW+SDTVTAV+VP+YIDS+EIV+RAWKRYNLSLGLGLNKVAGKV
Sbjct  286  RLAVEAWGLKNCTQKEEWYSDTVTAVLVPAYIDSTEIVRRAWKRYNLSLGLGLNKVAGKV  345

Query  237  FRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  70
            FRIGHLGNLNELQLLGCL GVEM+LKD+GYPVKLGSGVAAASAYLQ+T PMIPSRI
Sbjct  346  FRIGHLGNLNELQLLGCLTGVEMILKDVGYPVKLGSGVAAASAYLQDTIPMIPSRI  401



>gb|AEX09306.1| alanine glyoxylate aminotransferase [Peperomia peruviana]
Length=362

 Score =   418 bits (1075),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 209/232 (90%), Positives = 222/232 (96%), Gaps = 0/232 (0%)
 Frame = -1

Query  777  YQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA  598
            Y HPALLLVDGVSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTA
Sbjct  131  YNHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTA  190

Query  597  KSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTAT  418
            KSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVI RH RLG AT
Sbjct  191  KSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIERHARLGKAT  250

Query  417  RLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKV  238
            RLAV+AWGLKNCTQKEE FS+TVTAV++P YIDS+EIV+RAWKRYNLSLGLGLNKVAGKV
Sbjct  251  RLAVEAWGLKNCTQKEECFSNTVTAVMIPPYIDSAEIVRRAWKRYNLSLGLGLNKVAGKV  310

Query  237  FRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  82
            FRIGHLGN+NELQLLGCL+GVEMVLKD+GYPVK GSGVAAA AYLQNTTP+I
Sbjct  311  FRIGHLGNVNELQLLGCLSGVEMVLKDVGYPVKFGSGVAAAEAYLQNTTPLI  362



>gb|AEX09293.1| alanine glyoxylate aminotransferase [Peperomia rupiseda]
Length=358

 Score =   418 bits (1074),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 208/228 (91%), Positives = 221/228 (97%), Gaps = 0/228 (0%)
 Frame = -1

Query  777  YQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA  598
            Y HPALLLVDGVSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTA
Sbjct  131  YNHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTA  190

Query  597  KSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTAT  418
            KSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG AT
Sbjct  191  KSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKAT  250

Query  417  RLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKV  238
            RLAV+AWGLKNCTQKEEWFSDTVTAV++P YIDS+EIV+RAWKRYNLSLGLGLNKVAGKV
Sbjct  251  RLAVEAWGLKNCTQKEEWFSDTVTAVMIPPYIDSAEIVRRAWKRYNLSLGLGLNKVAGKV  310

Query  237  FRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNT  94
            FRIGHLGN+NELQLLGCL+GVEMVLKD+GYPVK GSGVAAA+AYLQNT
Sbjct  311  FRIGHLGNVNELQLLGCLSGVEMVLKDVGYPVKFGSGVAAAAAYLQNT  358



>ref|XP_009410322.1| PREDICTED: serine--glyoxylate aminotransferase-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009410323.1| PREDICTED: serine--glyoxylate aminotransferase-like [Musa acuminata 
subsp. malaccensis]
Length=401

 Score =   419 bits (1078),  Expect = 4e-143, Method: Compositional matrix adjust.
 Identities = 209/236 (89%), Positives = 226/236 (96%), Gaps = 0/236 (0%)
 Frame = -1

Query  777  YQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA  598
            + HPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALS+PTG+GIVCASPKALEA+K+A
Sbjct  166  HNHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSMPTGMGIVCASPKALEAAKSA  225

Query  597  KSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTAT  418
            KSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYG RA LDLLFEEGLDNVIARH+RLG AT
Sbjct  226  KSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGFRAALDLLFEEGLDNVIARHSRLGKAT  285

Query  417  RLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKV  238
            RLAV+AWGLKNCTQKEEWFSDTVTAV+VP +I+SS++VKRAW RYNLSLGLGLNKVAGKV
Sbjct  286  RLAVEAWGLKNCTQKEEWFSDTVTAVMVPPHINSSDVVKRAWTRYNLSLGLGLNKVAGKV  345

Query  237  FRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  70
            FRIGHLGNLN+LQLLGCL+GVEMVL+D+GY VKLGSGVAAA+AYLQNT PMI SRI
Sbjct  346  FRIGHLGNLNDLQLLGCLSGVEMVLRDVGYQVKLGSGVAAAAAYLQNTIPMISSRI  401



>ref|XP_004973837.1| PREDICTED: serine--glyoxylate aminotransferase-like isoform X1 
[Setaria italica]
Length=437

 Score =   421 bits (1081),  Expect = 5e-143, Method: Compositional matrix adjust.
 Identities = 212/236 (90%), Positives = 225/236 (95%), Gaps = 0/236 (0%)
 Frame = -1

Query  777  YQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA  598
            Y+HPAL+LVDGVSSICA+DFRMDEWGVDVALTGSQKALS+PTG+GIVCASPKALEASKTA
Sbjct  202  YRHPALILVDGVSSICALDFRMDEWGVDVALTGSQKALSMPTGLGIVCASPKALEASKTA  261

Query  597  KSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTAT  418
            KSVRVFFDW DYLK YK+G+YWPYTPSIQLLYGLRA LDLLF EGLDNV  RH RLGTAT
Sbjct  262  KSVRVFFDWNDYLKSYKIGSYWPYTPSIQLLYGLRAALDLLFLEGLDNVFKRHKRLGTAT  321

Query  417  RLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKV  238
            RLAV+AWGLKNCTQKEEWFSDTVTAVVVP YIDS EIVK AWKRYNLSLGLGLNKVAGKV
Sbjct  322  RLAVEAWGLKNCTQKEEWFSDTVTAVVVPPYIDSGEIVKHAWKRYNLSLGLGLNKVAGKV  381

Query  237  FRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  70
            FRIGHLGNLNELQLLGCL+GVEMVLKD+GYPVKLGSGVAAA+AYL N+TP+IPSRI
Sbjct  382  FRIGHLGNLNELQLLGCLSGVEMVLKDVGYPVKLGSGVAAAAAYLSNSTPLIPSRI  437



>emb|CAN84001.1| hypothetical protein VITISV_007680 [Vitis vinifera]
Length=401

 Score =   419 bits (1077),  Expect = 6e-143, Method: Compositional matrix adjust.
 Identities = 206/236 (87%), Positives = 224/236 (95%), Gaps = 0/236 (0%)
 Frame = -1

Query  777  YQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA  598
            Y HPAL LVDGVSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCA PKALEASK A
Sbjct  166  YXHPALFLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCAGPKALEASKXA  225

Query  597  KSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTAT  418
            +SVR FFDW DYLKFYK+GT+WPYTPSIQLLYG+RA LD++FEEGLDNVI RH+RLG AT
Sbjct  226  QSVRFFFDWNDYLKFYKLGTFWPYTPSIQLLYGMRAALDIIFEEGLDNVIERHSRLGKAT  285

Query  417  RLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKV  238
            RLAV+AWGLKNCTQ+EEWFSDTVTAVVVP YIDS+EIVKRAWKRYNLSLGLGLNKVAGKV
Sbjct  286  RLAVEAWGLKNCTQREEWFSDTVTAVVVPPYIDSTEIVKRAWKRYNLSLGLGLNKVAGKV  345

Query  237  FRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  70
            FRIGHLG+LN++QLLGCLAGVEMVLKD+GYPVK+GSGV AASAYLQNT P+IPSRI
Sbjct  346  FRIGHLGHLNDVQLLGCLAGVEMVLKDVGYPVKMGSGVGAASAYLQNTIPLIPSRI  401



>ref|XP_007146302.1| hypothetical protein PHAVU_006G029100g [Phaseolus vulgaris]
 ref|XP_007146303.1| hypothetical protein PHAVU_006G029100g [Phaseolus vulgaris]
 gb|ESW18296.1| hypothetical protein PHAVU_006G029100g [Phaseolus vulgaris]
 gb|ESW18297.1| hypothetical protein PHAVU_006G029100g [Phaseolus vulgaris]
Length=401

 Score =   419 bits (1076),  Expect = 8e-143, Method: Compositional matrix adjust.
 Identities = 207/236 (88%), Positives = 227/236 (96%), Gaps = 0/236 (0%)
 Frame = -1

Query  777  YQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA  598
            Y+HPALL+VDGVSSICA+DFRMDEWGVDVA+TGSQKALSLPTGIGIV A P+A+EASKTA
Sbjct  166  YKHPALLIVDGVSSICALDFRMDEWGVDVAITGSQKALSLPTGIGIVVAGPRAIEASKTA  225

Query  597  KSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTAT  418
            KS+RVFFDWKDYLKFY++GTYWPYTPSI LLYGLRA LDL+FEEGL+NVIARH RLGTAT
Sbjct  226  KSLRVFFDWKDYLKFYQLGTYWPYTPSIHLLYGLRAALDLVFEEGLENVIARHNRLGTAT  285

Query  417  RLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKV  238
            RLAV+AWGLKNCTQKEEW SDTVTAV+VPSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKV
Sbjct  286  RLAVEAWGLKNCTQKEEWHSDTVTAVIVPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKV  345

Query  237  FRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  70
            FRIGHLG LNELQLLGCLAGVEM+L+D+GYPVKLGSGVAAASAY +NT P+IPSRI
Sbjct  346  FRIGHLGYLNELQLLGCLAGVEMILQDVGYPVKLGSGVAAASAYFKNTIPLIPSRI  401



>gb|AEX09304.1| alanine glyoxylate aminotransferase [Peperomia chutanka]
Length=358

 Score =   417 bits (1072),  Expect = 9e-143, Method: Compositional matrix adjust.
 Identities = 209/228 (92%), Positives = 220/228 (96%), Gaps = 0/228 (0%)
 Frame = -1

Query  777  YQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA  598
            Y HPALLLVDGVSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTA
Sbjct  131  YNHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTA  190

Query  597  KSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTAT  418
            KSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH RLG AT
Sbjct  191  KSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHARLGKAT  250

Query  417  RLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKV  238
            RLAV+AWGLKNCTQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKV
Sbjct  251  RLAVEAWGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKV  310

Query  237  FRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNT  94
            FRIGHLGN+NELQLLGCL+GVEMVLKD+GYPVK GSGVAAA AYLQNT
Sbjct  311  FRIGHLGNVNELQLLGCLSGVEMVLKDVGYPVKFGSGVAAAEAYLQNT  358



>ref|XP_002313371.1| aminotransferase 2 family protein [Populus trichocarpa]
 gb|EEE87326.1| aminotransferase 2 family protein [Populus trichocarpa]
Length=401

 Score =   418 bits (1074),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 209/236 (89%), Positives = 222/236 (94%), Gaps = 0/236 (0%)
 Frame = -1

Query  777  YQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA  598
            Y HPAL LVDGVSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKA+EASKTA
Sbjct  166  YSHPALFLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKAIEASKTA  225

Query  597  KSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTAT  418
            KSVRVFFDWKDYLKFY +GT+WPYTPSIQLLYGLRA LDLLF EGL+NV  RH RLG AT
Sbjct  226  KSVRVFFDWKDYLKFYNLGTFWPYTPSIQLLYGLRAALDLLFAEGLENVFERHARLGKAT  285

Query  417  RLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKV  238
            RLAV+AWGLKNCTQKEEWFSDTVTAVVVP YIDS+EIV+R WKRYNLSLGLGLNKVAGKV
Sbjct  286  RLAVEAWGLKNCTQKEEWFSDTVTAVVVPPYIDSAEIVRRGWKRYNLSLGLGLNKVAGKV  345

Query  237  FRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  70
            FRIGHLGNLNELQLLGCLAGVEM+LKD+GYPVKLGSGVAAA AYLQN TP+I SR+
Sbjct  346  FRIGHLGNLNELQLLGCLAGVEMILKDVGYPVKLGSGVAAACAYLQNNTPLIASRV  401



>gb|AGV54322.1| serine glyoxylate aminotransferase 2 [Phaseolus vulgaris]
Length=401

 Score =   418 bits (1074),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 207/236 (88%), Positives = 227/236 (96%), Gaps = 0/236 (0%)
 Frame = -1

Query  777  YQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA  598
            Y+HPALL+VDGVSSICA+DFRMDEWGVDVA+TGSQKALSLPTGIGIV A P+A+EASKTA
Sbjct  166  YKHPALLIVDGVSSICALDFRMDEWGVDVAITGSQKALSLPTGIGIVVAGPRAIEASKTA  225

Query  597  KSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTAT  418
            KS+RVFFDWKDYLKFY++GTYWPYTPSI LLYGLRA LDL+FEEGL+NVIARH RLGTAT
Sbjct  226  KSLRVFFDWKDYLKFYQLGTYWPYTPSIHLLYGLRAALDLVFEEGLENVIARHNRLGTAT  285

Query  417  RLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKV  238
            RLAV+AWGLKNCT+KEEW SDTVTAVVVPSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKV
Sbjct  286  RLAVEAWGLKNCTEKEEWHSDTVTAVVVPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKV  345

Query  237  FRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  70
            FRIGHLG LNELQLLGCLAGVEM+L+D+GYPVKLGSGVAAASAY +NT P+IPSRI
Sbjct  346  FRIGHLGYLNELQLLGCLAGVEMILQDVGYPVKLGSGVAAASAYFKNTIPLIPSRI  401



>ref|XP_006409690.1| hypothetical protein EUTSA_v10022711mg [Eutrema salsugineum]
 gb|ESQ51143.1| hypothetical protein EUTSA_v10022711mg [Eutrema salsugineum]
Length=401

 Score =   418 bits (1074),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 209/236 (89%), Positives = 225/236 (95%), Gaps = 0/236 (0%)
 Frame = -1

Query  777  YQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA  598
            Y+HPALLLVDGVSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEA+KT+
Sbjct  166  YKHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEATKTS  225

Query  597  KSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTAT  418
            KS++VFFDW DYLKFYK+GTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH RLG AT
Sbjct  226  KSLKVFFDWNDYLKFYKLGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHARLGKAT  285

Query  417  RLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKV  238
            RLAV+AWGLKNCTQKEEW S+TVTAVVVP  IDS+EIVKRAWKRYNLSLGLGLNKVAGKV
Sbjct  286  RLAVEAWGLKNCTQKEEWISNTVTAVVVPPNIDSTEIVKRAWKRYNLSLGLGLNKVAGKV  345

Query  237  FRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  70
            FRIGHLGNLNELQLLGCLAGVEM+LKD+GYPV LGSGVAAAS YLQ+  P+IPSRI
Sbjct  346  FRIGHLGNLNELQLLGCLAGVEMILKDVGYPVVLGSGVAAASTYLQHHIPLIPSRI  401



>dbj|BAJ33858.1| unnamed protein product [Thellungiella halophila]
Length=438

 Score =   419 bits (1077),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 209/236 (89%), Positives = 225/236 (95%), Gaps = 0/236 (0%)
 Frame = -1

Query  777  YQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA  598
            Y+HPALLLVDGVSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEA+KT+
Sbjct  203  YKHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEATKTS  262

Query  597  KSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTAT  418
            KS++VFFDW DYLKFYK+GTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH RLG AT
Sbjct  263  KSLKVFFDWNDYLKFYKLGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHARLGKAT  322

Query  417  RLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKV  238
            RLAV+AWGLKNCTQKEEW S+TVTAVVVP  IDS+EIVKRAWKRYNLSLGLGLNKVAGKV
Sbjct  323  RLAVEAWGLKNCTQKEEWISNTVTAVVVPPNIDSTEIVKRAWKRYNLSLGLGLNKVAGKV  382

Query  237  FRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  70
            FRIGHLGNLNELQLLGCLAGVEM+LKD+GYPV LGSGVAAAS YLQ+  P+IPSRI
Sbjct  383  FRIGHLGNLNELQLLGCLAGVEMILKDVGYPVVLGSGVAAASTYLQHHIPLIPSRI  438



>ref|XP_009112244.1| PREDICTED: serine--glyoxylate aminotransferase [Brassica rapa]
Length=401

 Score =   417 bits (1073),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 208/236 (88%), Positives = 225/236 (95%), Gaps = 0/236 (0%)
 Frame = -1

Query  777  YQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA  598
            Y+HPALLLVDGVSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEA+KT+
Sbjct  166  YKHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEATKTS  225

Query  597  KSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTAT  418
            KS++VFFDW DYLKFYK+GTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH RLG AT
Sbjct  226  KSLKVFFDWNDYLKFYKLGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHARLGKAT  285

Query  417  RLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKV  238
            RLAV+AWGLKNCTQKEEW S+TVTAVVVP  IDS+EIVKRAWKRYNLSLGLGLNKVAGKV
Sbjct  286  RLAVEAWGLKNCTQKEEWISNTVTAVVVPPNIDSTEIVKRAWKRYNLSLGLGLNKVAGKV  345

Query  237  FRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  70
            FRIGHLGNLNELQLLGCLAGVEM+LKD+GYP+ LGSGVAAAS YLQ+  P+IPSRI
Sbjct  346  FRIGHLGNLNELQLLGCLAGVEMILKDVGYPIVLGSGVAAASTYLQHHIPLIPSRI  401



>ref|XP_002444789.1| hypothetical protein SORBIDRAFT_07g028080 [Sorghum bicolor]
 gb|EES14284.1| hypothetical protein SORBIDRAFT_07g028080 [Sorghum bicolor]
Length=402

 Score =   417 bits (1073),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 208/236 (88%), Positives = 223/236 (94%), Gaps = 0/236 (0%)
 Frame = -1

Query  777  YQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA  598
            Y HPALLLVDGVSSICA+DFRMDEWGVDVALTGSQKALS+PTG+GIVCAS KALEASK A
Sbjct  167  YAHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSMPTGMGIVCASSKALEASKAA  226

Query  597  KSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTAT  418
            +SVRVFFDWKDYL+FY+MGTYWPYTPSIQLLYGLR  LDL+FEEGLDNV+ RH RLGTAT
Sbjct  227  RSVRVFFDWKDYLRFYEMGTYWPYTPSIQLLYGLRTALDLIFEEGLDNVVKRHNRLGTAT  286

Query  417  RLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKV  238
            R AV+AWGLKNC QKEE FSDTVTAVVVP YIDS+EIVK AWKRYNLSLGLGLNKVAGKV
Sbjct  287  RFAVEAWGLKNCCQKEECFSDTVTAVVVPPYIDSAEIVKHAWKRYNLSLGLGLNKVAGKV  346

Query  237  FRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  70
            FRIGHLGNLNELQLLGCL+GVEMVLKD+GYPVKLGSGVAAA+AYL N+TP+IPSRI
Sbjct  347  FRIGHLGNLNELQLLGCLSGVEMVLKDVGYPVKLGSGVAAAAAYLSNSTPLIPSRI  402



>emb|CDX81443.1| BnaC09g08540D [Brassica napus]
Length=401

 Score =   417 bits (1073),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 208/236 (88%), Positives = 225/236 (95%), Gaps = 0/236 (0%)
 Frame = -1

Query  777  YQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA  598
            Y+HPALLLVDGVSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEA+KT+
Sbjct  166  YKHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEATKTS  225

Query  597  KSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTAT  418
            KS++VFFDW DYLKFYK+GTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH RLG AT
Sbjct  226  KSLKVFFDWNDYLKFYKLGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHARLGKAT  285

Query  417  RLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKV  238
            RLAV+AWGLKNCTQKEEW S+TVTAVVVP  IDS+EIVKRAWKRYNLSLGLGLNKVAGKV
Sbjct  286  RLAVEAWGLKNCTQKEEWISNTVTAVVVPPNIDSTEIVKRAWKRYNLSLGLGLNKVAGKV  345

Query  237  FRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  70
            FRIGHLGNLNELQLLGCLAGVEM+LKD+GYP+ LGSGVAAAS YLQ+  P+IPSRI
Sbjct  346  FRIGHLGNLNELQLLGCLAGVEMILKDVGYPIVLGSGVAAASTYLQHHIPLIPSRI  401



>emb|CDY37208.1| BnaA09g08290D [Brassica napus]
Length=401

 Score =   417 bits (1073),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 208/236 (88%), Positives = 225/236 (95%), Gaps = 0/236 (0%)
 Frame = -1

Query  777  YQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA  598
            Y+HPALLLVDGVSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEA+KT+
Sbjct  166  YKHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEATKTS  225

Query  597  KSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTAT  418
            KS++VFFDW DYLKFYK+GTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH RLG AT
Sbjct  226  KSLKVFFDWNDYLKFYKLGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHARLGKAT  285

Query  417  RLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKV  238
            RLAV+AWGLKNCTQKEEW S+TVTAVVVP  IDS+EIVKRAWKRYNLSLGLGLNKVAGKV
Sbjct  286  RLAVEAWGLKNCTQKEEWISNTVTAVVVPPNIDSTEIVKRAWKRYNLSLGLGLNKVAGKV  345

Query  237  FRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  70
            FRIGHLGNLNELQLLGCLAGVEM+LKD+GYP+ LGSGVAAAS YLQ+  P+IPSRI
Sbjct  346  FRIGHLGNLNELQLLGCLAGVEMILKDVGYPIVLGSGVAAASTYLQHHIPLIPSRI  401



>gb|AEX09249.1| alanine glyoxylate aminotransferase [Peperomia aff. gracillima 
JN-2011]
Length=358

 Score =   416 bits (1068),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 208/228 (91%), Positives = 221/228 (97%), Gaps = 0/228 (0%)
 Frame = -1

Query  777  YQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA  598
            Y HPALLLVDGVSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTA
Sbjct  131  YNHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTA  190

Query  597  KSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTAT  418
            KSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG AT
Sbjct  191  KSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKAT  250

Query  417  RLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKV  238
            RLAV+AWGLKNCTQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKV
Sbjct  251  RLAVEAWGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKV  310

Query  237  FRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNT  94
            FRIGHLGN+NELQLLGCL+GVEMVLKD+GYPVK GSGVAAA+AYLQNT
Sbjct  311  FRIGHLGNVNELQLLGCLSGVEMVLKDVGYPVKFGSGVAAAAAYLQNT  358



>ref|NP_001148339.1| LOC100281949 [Zea mays]
 ref|XP_008675752.1| PREDICTED: LOC100281949 isoform X1 [Zea mays]
 ref|XP_008675758.1| PREDICTED: LOC100281949 isoform X1 [Zea mays]
 gb|ACG30854.1| serine--glyoxylate aminotransferase [Zea mays]
 gb|ACN28633.1| unknown [Zea mays]
 tpg|DAA47859.1| TPA: Serine--glyoxylate aminotransferase isoform 1 [Zea mays]
 tpg|DAA47860.1| TPA: Serine--glyoxylate aminotransferase isoform 2 [Zea mays]
 tpg|DAA47861.1| TPA: Serine--glyoxylate aminotransferase isoform 3 [Zea mays]
 tpg|DAA47862.1| TPA: Serine--glyoxylate aminotransferase isoform 4 [Zea mays]
Length=403

 Score =   417 bits (1072),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 205/236 (87%), Positives = 223/236 (94%), Gaps = 0/236 (0%)
 Frame = -1

Query  777  YQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA  598
            + HPALLLVDGVSSICA+DFRMDEWGVDVALTGSQKALS+PTG+GIVCASP+ALEASKTA
Sbjct  168  HAHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSMPTGMGIVCASPRALEASKTA  227

Query  597  KSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTAT  418
            +SVRVFFDWKDYL+FY MGTYWPYTPSIQLLYGLR  LDL+FEEGLDNV+ RH RLGTAT
Sbjct  228  RSVRVFFDWKDYLRFYDMGTYWPYTPSIQLLYGLRTALDLIFEEGLDNVVRRHNRLGTAT  287

Query  417  RLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKV  238
            RLAV+AWGL NC QKEEWFSDTVTA VVP  IDS+E+V+ AWKRYNLSLGLGLNKVAGKV
Sbjct  288  RLAVEAWGLSNCCQKEEWFSDTVTAAVVPPNIDSAEVVRHAWKRYNLSLGLGLNKVAGKV  347

Query  237  FRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  70
            FRIGHLGNLNELQLLGCL+GVEMVLKD+GYPVKLGSGVAAA+AYL N+TP+IPSRI
Sbjct  348  FRIGHLGNLNELQLLGCLSGVEMVLKDVGYPVKLGSGVAAAAAYLSNSTPLIPSRI  403



>gb|AEX09286.1| alanine glyoxylate aminotransferase [Peperomia cyclaminoides]
Length=358

 Score =   416 bits (1068),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 208/228 (91%), Positives = 221/228 (97%), Gaps = 0/228 (0%)
 Frame = -1

Query  777  YQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA  598
            Y HPALLLVDGVSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTA
Sbjct  131  YNHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTA  190

Query  597  KSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTAT  418
            KSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG AT
Sbjct  191  KSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGEAT  250

Query  417  RLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKV  238
            RLAV+AWGLKNCTQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKV
Sbjct  251  RLAVEAWGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKV  310

Query  237  FRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNT  94
            FRIGHLGN+NELQLLGCL+GVEMVLKD+GYPVK GSGVAAA+AYLQNT
Sbjct  311  FRIGHLGNVNELQLLGCLSGVEMVLKDVGYPVKFGSGVAAAAAYLQNT  358



>ref|XP_011032100.1| PREDICTED: serine--glyoxylate aminotransferase-like [Populus 
euphratica]
Length=401

 Score =   417 bits (1071),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 208/236 (88%), Positives = 223/236 (94%), Gaps = 0/236 (0%)
 Frame = -1

Query  777  YQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA  598
            Y HPAL+LVDGVSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKA+EASKTA
Sbjct  166  YSHPALVLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKAIEASKTA  225

Query  597  KSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTAT  418
            KSVRVFFDWKDYLKFY +GT+WPYTPSIQLLYGLRA LDLLF EGL+NV  RH RLG AT
Sbjct  226  KSVRVFFDWKDYLKFYNLGTFWPYTPSIQLLYGLRAALDLLFAEGLENVFERHARLGKAT  285

Query  417  RLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKV  238
            RLAV+AWGLKNCTQKEEWFSDTVTAV+VP YIDS+EIV+R WKRYNLSLGLGLNKVAGKV
Sbjct  286  RLAVEAWGLKNCTQKEEWFSDTVTAVLVPPYIDSAEIVRRGWKRYNLSLGLGLNKVAGKV  345

Query  237  FRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  70
            FRIGHLGNLNELQLLGCLAGVEM+LKD+GYPVKLGSGVAAA AYLQN TP+I SR+
Sbjct  346  FRIGHLGNLNELQLLGCLAGVEMILKDVGYPVKLGSGVAAACAYLQNNTPLIASRV  401



>gb|AEX09263.1| alanine glyoxylate aminotransferase [Peperomia putlaensis]
Length=358

 Score =   414 bits (1065),  Expect = 9e-142, Method: Compositional matrix adjust.
 Identities = 207/228 (91%), Positives = 221/228 (97%), Gaps = 0/228 (0%)
 Frame = -1

Query  777  YQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA  598
            Y HPALLLVDGVSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GI+CASPKALEASKTA
Sbjct  131  YNHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGMGILCASPKALEASKTA  190

Query  597  KSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTAT  418
            KSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG AT
Sbjct  191  KSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKAT  250

Query  417  RLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKV  238
            RLAV+AWGLKNCTQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKV
Sbjct  251  RLAVEAWGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKV  310

Query  237  FRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNT  94
            FRIGHLGN+NELQLLGCL+GVEMVLKD+GYPVK GSGVAAA+AYLQNT
Sbjct  311  FRIGHLGNVNELQLLGCLSGVEMVLKDVGYPVKFGSGVAAAAAYLQNT  358



>gb|AEX09301.1| alanine glyoxylate aminotransferase [Peperomia sp. JN-2011]
Length=358

 Score =   414 bits (1064),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 207/227 (91%), Positives = 220/227 (97%), Gaps = 0/227 (0%)
 Frame = -1

Query  774  QHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAK  595
             HPALLLVDGVSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAK
Sbjct  132  NHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAK  191

Query  594  SVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATR  415
            SVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVI RH RLG ATR
Sbjct  192  SVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIDRHARLGKATR  251

Query  414  LAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVF  235
            LAV+AWGLKNCTQKEEWFS+TVTAV++P YIDS+EIV+RAWKRYNLSLGLGLNKVAGKVF
Sbjct  252  LAVEAWGLKNCTQKEEWFSNTVTAVMIPPYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVF  311

Query  234  RIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNT  94
            RIGHLGN+NELQLLGCL+GVEMVLKD+GYPVKLGSGVAAA+AYLQNT
Sbjct  312  RIGHLGNVNELQLLGCLSGVEMVLKDVGYPVKLGSGVAAAAAYLQNT  358



>gb|ABK96624.1| unknown [Populus trichocarpa x Populus deltoides]
Length=401

 Score =   415 bits (1067),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 208/236 (88%), Positives = 221/236 (94%), Gaps = 0/236 (0%)
 Frame = -1

Query  777  YQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA  598
            Y HPAL LVDGVSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKA+EASKTA
Sbjct  166  YSHPALFLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKAIEASKTA  225

Query  597  KSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTAT  418
            KSVRVFFDWKDYLKFY +GT+WPYTPSIQLLYGLRA LDLLF EGL+NV  RH R G AT
Sbjct  226  KSVRVFFDWKDYLKFYNLGTFWPYTPSIQLLYGLRAALDLLFAEGLENVFERHARPGKAT  285

Query  417  RLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKV  238
            RLAV+AWGLKNCTQKEEWFSDTVTAVVVP YIDS+EIV+R WKRYNLSLGLGLNKVAGKV
Sbjct  286  RLAVEAWGLKNCTQKEEWFSDTVTAVVVPPYIDSAEIVRRGWKRYNLSLGLGLNKVAGKV  345

Query  237  FRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  70
            FRIGHLGNLNELQLLGCLAGVEM+LKD+GYPVKLGSGVAAA AYLQN TP+I SR+
Sbjct  346  FRIGHLGNLNELQLLGCLAGVEMILKDVGYPVKLGSGVAAACAYLQNNTPLIASRV  401



>ref|XP_009136209.1| PREDICTED: serine--glyoxylate aminotransferase-like [Brassica 
rapa]
 ref|XP_009136210.1| PREDICTED: serine--glyoxylate aminotransferase-like [Brassica 
rapa]
 emb|CDX93112.1| BnaA03g38340D [Brassica napus]
Length=401

 Score =   415 bits (1067),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 207/236 (88%), Positives = 225/236 (95%), Gaps = 0/236 (0%)
 Frame = -1

Query  777  YQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA  598
            Y+HPALLLVDGVSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEA+KT+
Sbjct  166  YKHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEATKTS  225

Query  597  KSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTAT  418
            KS++VFFDW DYLKFYK+GTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH RLG AT
Sbjct  226  KSLKVFFDWNDYLKFYKLGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHARLGKAT  285

Query  417  RLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKV  238
            RLAV+AWGLKNCTQKEEW S+TVTAV+VP  IDS+EIVKRAWKRYNLSLGLGLNKVAGKV
Sbjct  286  RLAVEAWGLKNCTQKEEWISNTVTAVMVPPNIDSTEIVKRAWKRYNLSLGLGLNKVAGKV  345

Query  237  FRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  70
            FRIGHLG+LNELQLLGCLAGVEM+LKD+GYPV LGSGVAAAS YLQ+  P+IPSRI
Sbjct  346  FRIGHLGHLNELQLLGCLAGVEMILKDVGYPVVLGSGVAAASTYLQHQIPLIPSRI  401



>gb|AEX09268.1| alanine glyoxylate aminotransferase [Peperomia peruviana]
Length=359

 Score =   413 bits (1061),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 207/229 (90%), Positives = 219/229 (96%), Gaps = 0/229 (0%)
 Frame = -1

Query  777  YQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA  598
            Y HPALLLVDGVSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTA
Sbjct  131  YNHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTA  190

Query  597  KSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTAT  418
            KSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVI RH RLG AT
Sbjct  191  KSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIDRHARLGKAT  250

Query  417  RLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKV  238
            RLAV+AWGLKNCTQKEE FS+TVTAV++P YIDS+EIV+RAWKRYNLSLGLGLNKVAGKV
Sbjct  251  RLAVEAWGLKNCTQKEECFSNTVTAVMIPPYIDSAEIVRRAWKRYNLSLGLGLNKVAGKV  310

Query  237  FRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTT  91
            FRIGHLGN+NELQLLGCL+GVEMVLKD+GYPVK GSGVAAA AYLQNTT
Sbjct  311  FRIGHLGNVNELQLLGCLSGVEMVLKDVGYPVKFGSGVAAAEAYLQNTT  359



>gb|AEX09295.1| alanine glyoxylate aminotransferase [Peperomia pugnicaudex]
Length=356

 Score =   412 bits (1059),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 207/226 (92%), Positives = 218/226 (96%), Gaps = 0/226 (0%)
 Frame = -1

Query  777  YQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA  598
            Y HPALLLVDGVSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTA
Sbjct  131  YNHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTA  190

Query  597  KSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTAT  418
            KSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH RLG AT
Sbjct  191  KSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHARLGKAT  250

Query  417  RLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKV  238
            RLAV+AWGLKNCTQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKV
Sbjct  251  RLAVEAWGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKV  310

Query  237  FRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQ  100
            FRIGHLGN+NELQLLGCL+GVEMVLKD+GYPVK GSGVAAA AYLQ
Sbjct  311  FRIGHLGNVNELQLLGCLSGVEMVLKDVGYPVKFGSGVAAAEAYLQ  356



>emb|CDX89604.1| BnaC03g45180D [Brassica napus]
Length=401

 Score =   414 bits (1063),  Expect = 8e-141, Method: Compositional matrix adjust.
 Identities = 206/236 (87%), Positives = 225/236 (95%), Gaps = 0/236 (0%)
 Frame = -1

Query  777  YQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA  598
            Y+HPALLLVDGVSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEA+KT+
Sbjct  166  YKHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEATKTS  225

Query  597  KSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTAT  418
            KS++VFFDW DYLKFYK+GTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG AT
Sbjct  226  KSLKVFFDWNDYLKFYKLGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKAT  285

Query  417  RLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKV  238
            RLAV+AWGLKNCTQKEEW S+TVTAV+VP  IDS+EIVKRAWKRYNLSLGLGLNKVAGKV
Sbjct  286  RLAVEAWGLKNCTQKEEWISNTVTAVMVPPNIDSTEIVKRAWKRYNLSLGLGLNKVAGKV  345

Query  237  FRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  70
            FRIGHLG+LNELQLLGCLAGVEM+LKD+GYPV LGSGVAAAS YLQ+  P+IPSRI
Sbjct  346  FRIGHLGHLNELQLLGCLAGVEMILKDVGYPVVLGSGVAAASTYLQHQIPLIPSRI  401



>gb|AEX09308.1| alanine glyoxylate aminotransferase [Peperomia polycephala]
Length=356

 Score =   411 bits (1056),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 205/226 (91%), Positives = 218/226 (96%), Gaps = 0/226 (0%)
 Frame = -1

Query  777  YQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA  598
            Y HPALLLVDGVSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTA
Sbjct  131  YNHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTA  190

Query  597  KSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTAT  418
            KSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVI RH RLG AT
Sbjct  191  KSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIDRHARLGKAT  250

Query  417  RLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKV  238
            RLAV+AWGLKNCTQKEEWFS+TVTAV++P YIDS+EIV+RAWKRYNLSLGLGLNKVAGKV
Sbjct  251  RLAVEAWGLKNCTQKEEWFSNTVTAVMIPPYIDSAEIVRRAWKRYNLSLGLGLNKVAGKV  310

Query  237  FRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQ  100
            FRIGHLGN+NELQLLGCL+GVEMVLKD+GYPVK GSGVAAA+AYLQ
Sbjct  311  FRIGHLGNVNELQLLGCLSGVEMVLKDVGYPVKFGSGVAAAAAYLQ  356



>ref|XP_010518509.1| PREDICTED: serine--glyoxylate aminotransferase isoform X1 [Camelina 
sativa]
 ref|XP_010518516.1| PREDICTED: serine--glyoxylate aminotransferase isoform X1 [Camelina 
sativa]
 ref|XP_010518525.1| PREDICTED: serine--glyoxylate aminotransferase isoform X2 [Camelina 
sativa]
Length=401

 Score =   412 bits (1060),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 202/236 (86%), Positives = 225/236 (95%), Gaps = 0/236 (0%)
 Frame = -1

Query  777  YQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA  598
            Y+HPALLLVDGVSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEA+KT+
Sbjct  166  YKHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEATKTS  225

Query  597  KSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTAT  418
            KS++VFFDW DYLKFYK+GTYWPYTPSIQLLYGLRA LDL+FEEGL+N+IARH RLG AT
Sbjct  226  KSLKVFFDWNDYLKFYKLGTYWPYTPSIQLLYGLRAALDLIFEEGLENIIARHARLGKAT  285

Query  417  RLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKV  238
            RLAV+AWGLKNCTQKEEW S+TVTAV+VP +ID SEIV+RAW+RYNLSLGLGLNK+AGKV
Sbjct  286  RLAVEAWGLKNCTQKEEWISNTVTAVMVPPHIDGSEIVRRAWQRYNLSLGLGLNKIAGKV  345

Query  237  FRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  70
            FRIGHLGN+NELQLLGCLAGVEM+LKD+GYPV +GSGVAAAS YLQN  P+IPSRI
Sbjct  346  FRIGHLGNVNELQLLGCLAGVEMILKDVGYPVVMGSGVAAASTYLQNHIPLIPSRI  401



>gb|AEX09274.1| alanine glyoxylate aminotransferase [Peperomia peruviana]
Length=358

 Score =   410 bits (1055),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 206/228 (90%), Positives = 218/228 (96%), Gaps = 0/228 (0%)
 Frame = -1

Query  777  YQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA  598
            Y HPALLLVDGVSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTA
Sbjct  131  YNHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTA  190

Query  597  KSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTAT  418
            KSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVI RH RLG AT
Sbjct  191  KSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIDRHARLGKAT  250

Query  417  RLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKV  238
            RLAV+AWGLKNCTQKEE FS+TVTAV++P YIDS+EIV+RAWKRYNLSLGLGLNKVAGKV
Sbjct  251  RLAVEAWGLKNCTQKEECFSNTVTAVMIPPYIDSAEIVRRAWKRYNLSLGLGLNKVAGKV  310

Query  237  FRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNT  94
            FRIGHLGN+NELQLLGCL+GVEMVLKD+GYPVK GSGVAAA AYLQNT
Sbjct  311  FRIGHLGNVNELQLLGCLSGVEMVLKDVGYPVKFGSGVAAAEAYLQNT  358



>ref|XP_010488837.1| PREDICTED: serine--glyoxylate aminotransferase-like [Camelina 
sativa]
Length=401

 Score =   412 bits (1059),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 201/236 (85%), Positives = 225/236 (95%), Gaps = 0/236 (0%)
 Frame = -1

Query  777  YQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA  598
            Y+HPALLLVDGVSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEA+KT+
Sbjct  166  YKHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEATKTS  225

Query  597  KSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTAT  418
            KS++VFFDW DYLKFYK+GTYWPYTPSIQLLYGLRA LDL+FEEGL+N+IARH RLG AT
Sbjct  226  KSLKVFFDWNDYLKFYKLGTYWPYTPSIQLLYGLRAALDLIFEEGLENIIARHARLGKAT  285

Query  417  RLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKV  238
            RLAV+AWGLKNCTQKEEW S+TVTAV+VP +ID SEIV+RAW+RYNLSLGLGLNK+AGKV
Sbjct  286  RLAVEAWGLKNCTQKEEWISNTVTAVMVPPHIDGSEIVRRAWQRYNLSLGLGLNKIAGKV  345

Query  237  FRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  70
            FRIGHLGN+NELQLLGCLAGVEM+LKD+GYP+ +GSGVAAAS YLQN  P+IPSRI
Sbjct  346  FRIGHLGNVNELQLLGCLAGVEMILKDVGYPIVMGSGVAAASTYLQNHIPLIPSRI  401



>gb|ACN36238.1| unknown [Zea mays]
Length=328

 Score =   408 bits (1049),  Expect = 8e-140, Method: Compositional matrix adjust.
 Identities = 202/232 (87%), Positives = 220/232 (95%), Gaps = 0/232 (0%)
 Frame = -1

Query  765  ALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVR  586
            +LLLVDGVSSICA+DFRMDEWGVDVALTGSQKALS+PTG+GIVCASP+ALEASKTA+SVR
Sbjct  97   SLLLVDGVSSICALDFRMDEWGVDVALTGSQKALSMPTGMGIVCASPRALEASKTARSVR  156

Query  585  VFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAV  406
            VFFDWKDYL+FY MGTYWPYTPSIQLLYGLR  LDL+FEEGLDNV+ RH RLGTATRLAV
Sbjct  157  VFFDWKDYLRFYDMGTYWPYTPSIQLLYGLRTALDLIFEEGLDNVVRRHNRLGTATRLAV  216

Query  405  QAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIG  226
            +AWGL NC QKEEWFSDTVTA VVP  IDS+E+V+ AWKRYNLSLGLGLNKVAGKVFRIG
Sbjct  217  EAWGLSNCCQKEEWFSDTVTAAVVPPNIDSAEVVRHAWKRYNLSLGLGLNKVAGKVFRIG  276

Query  225  HLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  70
            HLGNLNELQLLGCL+GVEMVLKD+GYPVKLGSGVAAA+AYL N+TP+IPSRI
Sbjct  277  HLGNLNELQLLGCLSGVEMVLKDVGYPVKLGSGVAAAAAYLSNSTPLIPSRI  328



>ref|NP_178969.1| alanine--glyoxylate aminotransferase [Arabidopsis thaliana]
 ref|NP_849951.1| alanine--glyoxylate aminotransferase [Arabidopsis thaliana]
 sp|Q56YA5.2|SGAT_ARATH RecName: Full=Serine--glyoxylate aminotransferase; AltName: Full=Alanine--glyoxylate 
aminotransferase; Short=AGT; AltName: 
Full=Asparagine aminotransferase; AltName: Full=Serine--pyruvate 
aminotransferase [Arabidopsis thaliana]
 gb|AAC26854.1| alanine:glyoxylate aminotransferase [Arabidopsis thaliana]
 gb|AAD28669.1| alanine-glyoxylate aminotransferase [Arabidopsis thaliana]
 dbj|BAB20811.1| serine glyoxylate aminotransferase [Arabidopsis thaliana]
 gb|AAM20136.1| putative alanine-glyoxylate aminotransferase [Arabidopsis thaliana]
 gb|AAM45058.1| putative alanine-glyoxylate aminotransferase [Arabidopsis thaliana]
 gb|AEC06227.1| alanine--glyoxylate aminotransferase [Arabidopsis thaliana]
 gb|AEC06228.1| alanine--glyoxylate aminotransferase [Arabidopsis thaliana]
Length=401

 Score =   410 bits (1055),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 202/236 (86%), Positives = 225/236 (95%), Gaps = 0/236 (0%)
 Frame = -1

Query  777  YQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA  598
            Y+HPALLLVDGVSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEA+KT+
Sbjct  166  YKHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEATKTS  225

Query  597  KSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTAT  418
            KS++VFFDW DYLKFYK+GTYWPYTPSIQLLYGLRA LDL+FEEGL+N+IARH RLG AT
Sbjct  226  KSLKVFFDWNDYLKFYKLGTYWPYTPSIQLLYGLRAALDLIFEEGLENIIARHARLGKAT  285

Query  417  RLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKV  238
            RLAV+AWGLKNCTQKEEW S+TVTAV+VP +ID SEIV+RAW+RYNLSLGLGLNKVAGKV
Sbjct  286  RLAVEAWGLKNCTQKEEWISNTVTAVMVPPHIDGSEIVRRAWQRYNLSLGLGLNKVAGKV  345

Query  237  FRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  70
            FRIGHLGN+NELQLLGCLAGVEM+LKD+GYPV +GSGVAAAS YLQ+  P+IPSRI
Sbjct  346  FRIGHLGNVNELQLLGCLAGVEMILKDVGYPVVMGSGVAAASTYLQHHIPLIPSRI  401



>gb|ABF70331.1| aminotransferase 1 [Cucumis sativus]
Length=386

 Score =   410 bits (1053),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 206/227 (91%), Positives = 220/227 (97%), Gaps = 0/227 (0%)
 Frame = -1

Query  777  YQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA  598
            Y+HPALLLVDGVSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GI+CASPKALEASKT+
Sbjct  159  YKHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGLGIICASPKALEASKTS  218

Query  597  KSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTAT  418
            KSV+VFFDWKDYLKFY +GTYWPYTPSIQLLYGLRA LDLLFEEGLDNVIARH+RLG AT
Sbjct  219  KSVKVFFDWKDYLKFYNLGTYWPYTPSIQLLYGLRAALDLLFEEGLDNVIARHSRLGKAT  278

Query  417  RLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKV  238
            R AV+AWGLKNCTQKEEWFSDTVTAV+VPSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKV
Sbjct  279  RPAVEAWGLKNCTQKEEWFSDTVTAVLVPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKV  338

Query  237  FRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQN  97
            FRIGHLGNLNELQLLGCLAGVEM+LKD+GYPVKLGSGVAAAS  L N
Sbjct  339  FRIGHLGNLNELQLLGCLAGVEMILKDVGYPVKLGSGVAAASESLVN  385



>ref|XP_002885871.1| hypothetical protein ARALYDRAFT_480305 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH62130.1| hypothetical protein ARALYDRAFT_480305 [Arabidopsis lyrata subsp. 
lyrata]
Length=401

 Score =   409 bits (1052),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 202/236 (86%), Positives = 225/236 (95%), Gaps = 0/236 (0%)
 Frame = -1

Query  777  YQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA  598
            Y+HPALLLVDGVSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEA+KT+
Sbjct  166  YKHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEATKTS  225

Query  597  KSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTAT  418
            KS++VFFDW DYLKFYK+GTYWPYTPSIQLLYGLRA LDL+FEEGL+N+IAR+ RLG AT
Sbjct  226  KSLKVFFDWNDYLKFYKLGTYWPYTPSIQLLYGLRAALDLIFEEGLENIIARNARLGKAT  285

Query  417  RLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKV  238
            RLAV+AWGLKNCTQKEEW S+TVTAV+VP +ID SEIV+RAWKRYNLSLGLGLNKVAGKV
Sbjct  286  RLAVEAWGLKNCTQKEEWISNTVTAVMVPPHIDGSEIVRRAWKRYNLSLGLGLNKVAGKV  345

Query  237  FRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  70
            FRIGHLGN+NELQLLGCLAGVEM+LKD+GYPV +GSGVAAAS YLQ+  P+IPSRI
Sbjct  346  FRIGHLGNVNELQLLGCLAGVEMILKDVGYPVVMGSGVAAASTYLQHHIPLIPSRI  401



>ref|XP_006297832.1| hypothetical protein CARUB_v10013869mg [Capsella rubella]
 gb|EOA30730.1| hypothetical protein CARUB_v10013869mg [Capsella rubella]
Length=401

 Score =   406 bits (1044),  Expect = 6e-138, Method: Compositional matrix adjust.
 Identities = 200/236 (85%), Positives = 223/236 (94%), Gaps = 0/236 (0%)
 Frame = -1

Query  777  YQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA  598
            Y+HPALLLVDGVSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEA+KT+
Sbjct  166  YKHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEATKTS  225

Query  597  KSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTAT  418
            KS++VFFDW DYLKFYK+GTYWPYTPSIQLLYGLRA LDL+FEEGL+N+IARH RLG AT
Sbjct  226  KSLKVFFDWNDYLKFYKLGTYWPYTPSIQLLYGLRAALDLIFEEGLENIIARHARLGKAT  285

Query  417  RLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKV  238
            RLAV+AWGLKNCTQKEEW S+TVTAV+VP  ID SE+V+RAW+RYNLSLGLGLNKVAGKV
Sbjct  286  RLAVEAWGLKNCTQKEEWISNTVTAVMVPPNIDGSEVVRRAWQRYNLSLGLGLNKVAGKV  345

Query  237  FRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  70
            FRIGHLGN+NELQLLGCLAGVEM+LKD+GYP+ +GSGVAAAS YLQN  P+I SRI
Sbjct  346  FRIGHLGNVNELQLLGCLAGVEMILKDVGYPIVMGSGVAAASTYLQNHIPLILSRI  401



>gb|AFK37194.1| unknown [Medicago truncatula]
Length=238

 Score =   397 bits (1019),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 200/234 (85%), Positives = 218/234 (93%), Gaps = 1/234 (0%)
 Frame = -1

Query  771  HPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKS  592
             P+ LL++    ICA+DFRMDEWGVDVA+TGSQKALSLPTGIG V ASPKA+EASK+AKS
Sbjct  6    QPSSLLME-CHPICALDFRMDEWGVDVAITGSQKALSLPTGIGFVVASPKAIEASKSAKS  64

Query  591  VRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRL  412
            +RVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+N+IARH RLGTATRL
Sbjct  65   LRVFFDWSDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENIIARHNRLGTATRL  124

Query  411  AVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFR  232
            AV+AWGLKNCTQ+EEWFSDTVTAVVVP YID +EIV+RAWKRYNLSLGLGLNKVAGKVFR
Sbjct  125  AVEAWGLKNCTQEEEWFSDTVTAVVVPPYIDGAEIVRRAWKRYNLSLGLGLNKVAGKVFR  184

Query  231  IGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  70
            IGHLGNLNELQLLG LAGVEM+LKD+GYPVKLGSGVAAASAYLQN  P+IPSRI
Sbjct  185  IGHLGNLNELQLLGALAGVEMILKDVGYPVKLGSGVAAASAYLQNNIPLIPSRI  238



>gb|AEX09277.1| alanine glyoxylate aminotransferase [Peperomia cyclaminoides]
Length=351

 Score =   399 bits (1025),  Expect = 8e-136, Method: Compositional matrix adjust.
 Identities = 201/221 (91%), Positives = 213/221 (96%), Gaps = 0/221 (0%)
 Frame = -1

Query  777  YQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA  598
            Y HPALLLVDGVSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTA
Sbjct  131  YNHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTA  190

Query  597  KSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTAT  418
            KSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG AT
Sbjct  191  KSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKAT  250

Query  417  RLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKV  238
            RLAV+AWGLKNCTQKEE FSDTVTAV++PS IDS+EIV+RAWKRYNLSLGLGLNKVAGKV
Sbjct  251  RLAVEAWGLKNCTQKEECFSDTVTAVMIPSNIDSAEIVRRAWKRYNLSLGLGLNKVAGKV  310

Query  237  FRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAA  115
            FRIGHLGN+NELQLLGCL+GVEMVLKD+GYPVK GSGVAAA
Sbjct  311  FRIGHLGNVNELQLLGCLSGVEMVLKDVGYPVKFGSGVAAA  351



>gb|AEX09245.1| alanine glyoxylate aminotransferase [Peperomia putlaensis]
Length=349

 Score =   399 bits (1024),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 200/219 (91%), Positives = 212/219 (97%), Gaps = 0/219 (0%)
 Frame = -1

Query  777  YQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA  598
            Y HPALLLVDGVSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTA
Sbjct  131  YNHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTA  190

Query  597  KSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTAT  418
            KSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG AT
Sbjct  191  KSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKAT  250

Query  417  RLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKV  238
            RLAV+AWGLKNCTQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKV
Sbjct  251  RLAVEAWGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKV  310

Query  237  FRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVA  121
            FRIGHLGN+NELQLLGCL+GVEMVLKD+GYPVK GSGVA
Sbjct  311  FRIGHLGNVNELQLLGCLSGVEMVLKDVGYPVKFGSGVA  349



>gb|AEX09272.1| alanine glyoxylate aminotransferase [Peperomia cyclaminoides]
Length=338

 Score =   397 bits (1021),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 200/220 (91%), Positives = 212/220 (96%), Gaps = 0/220 (0%)
 Frame = -1

Query  777  YQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA  598
            Y HPALLLVDGVSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTA
Sbjct  119  YNHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTA  178

Query  597  KSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTAT  418
            KSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG AT
Sbjct  179  KSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKAT  238

Query  417  RLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKV  238
            RLAV+AWGLKNCTQKEE FSDTVTAV++PS IDS+EIV+RAWKRYNLSLGLGLNKVAGKV
Sbjct  239  RLAVEAWGLKNCTQKEECFSDTVTAVMIPSNIDSAEIVRRAWKRYNLSLGLGLNKVAGKV  298

Query  237  FRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAA  118
            FRIGHLGN+NELQLLGCL+GVEMVLKD+GYPVK GSGVAA
Sbjct  299  FRIGHLGNVNELQLLGCLSGVEMVLKDVGYPVKFGSGVAA  338



>ref|XP_010467178.1| PREDICTED: serine--glyoxylate aminotransferase-like [Camelina 
sativa]
Length=454

 Score =   401 bits (1031),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 196/230 (85%), Positives = 219/230 (95%), Gaps = 0/230 (0%)
 Frame = -1

Query  777  YQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA  598
            Y+HPALLLVDGVSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEA+KT+
Sbjct  166  YKHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEATKTS  225

Query  597  KSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTAT  418
            KS++VFFDW DYLKFYK+GTYWPYTPSIQLLYGLRA LDL+FEEGL+N+IARH RLG AT
Sbjct  226  KSLKVFFDWNDYLKFYKLGTYWPYTPSIQLLYGLRAALDLIFEEGLENIIARHARLGKAT  285

Query  417  RLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKV  238
            RLAV+AWGLKNCTQKEEW S+TVTAV+VP +ID SEIV+RAW+RYNLSLGLGLNK+AGKV
Sbjct  286  RLAVEAWGLKNCTQKEEWISNTVTAVMVPPHIDGSEIVRRAWQRYNLSLGLGLNKIAGKV  345

Query  237  FRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTP  88
            FRIGHLGN+NELQLLGCLAGVEM+LKD+GYP+ +GSGVAAAS YLQN  P
Sbjct  346  FRIGHLGNVNELQLLGCLAGVEMILKDVGYPIVMGSGVAAASTYLQNHIP  395



>gb|AEX09280.1| alanine glyoxylate aminotransferase [Peperomia peruviana]
Length=330

 Score =   395 bits (1016),  Expect = 8e-135, Method: Compositional matrix adjust.
 Identities = 199/221 (90%), Positives = 211/221 (95%), Gaps = 0/221 (0%)
 Frame = -1

Query  777  YQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA  598
            Y HPALLLVDGVSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTA
Sbjct  110  YNHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTA  169

Query  597  KSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTAT  418
            KSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVI RH RLG AT
Sbjct  170  KSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIXRHARLGKAT  229

Query  417  RLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKV  238
            RLAV+AWGLKNCTQKEE FS+TVTAV++P YIDS+EIV+RAWKRYNLSLGLGLNKV GKV
Sbjct  230  RLAVEAWGLKNCTQKEECFSNTVTAVMIPPYIDSAEIVRRAWKRYNLSLGLGLNKVXGKV  289

Query  237  FRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAA  115
            FRIGHLGN+NELQLLGCL+GVEMVLKD+GYPVK GSGVAAA
Sbjct  290  FRIGHLGNVNELQLLGCLSGVEMVLKDVGYPVKFGSGVAAA  330



>gb|AEX09266.1| alanine glyoxylate aminotransferase [Peperomia peruviana]
Length=350

 Score =   396 bits (1018),  Expect = 9e-135, Method: Compositional matrix adjust.
 Identities = 199/220 (90%), Positives = 211/220 (96%), Gaps = 0/220 (0%)
 Frame = -1

Query  777  YQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA  598
            Y HPALLLVDGVSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTA
Sbjct  131  YNHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTA  190

Query  597  KSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTAT  418
            KSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVI RH RLG AT
Sbjct  191  KSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIXRHARLGKAT  250

Query  417  RLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKV  238
            RLAV+AWGLKNCTQKEE FS+TVTAV++P YIDS+EIV+RAWKRYNLSLGLGLNKVAGKV
Sbjct  251  RLAVEAWGLKNCTQKEECFSNTVTAVMIPPYIDSAEIVRRAWKRYNLSLGLGLNKVAGKV  310

Query  237  FRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAA  118
            FRIGHLGN+NELQLLGCL+GVEMVLKD+GYPVK GSGVAA
Sbjct  311  FRIGHLGNVNELQLLGCLSGVEMVLKDVGYPVKFGSGVAA  350



>gb|AEX09284.1| alanine glyoxylate aminotransferase [Peperomia peruviana]
Length=338

 Score =   395 bits (1015),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 199/220 (90%), Positives = 211/220 (96%), Gaps = 0/220 (0%)
 Frame = -1

Query  777  YQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA  598
            Y HPALLLVDGVSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTA
Sbjct  119  YNHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTA  178

Query  597  KSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTAT  418
            KSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVI RH RLG AT
Sbjct  179  KSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIDRHARLGKAT  238

Query  417  RLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKV  238
            RLAV+AWGLKNCTQKEE FS+TVTAV++P YIDS+EIV+RAWKRYNLSLGLGLNKVAGKV
Sbjct  239  RLAVEAWGLKNCTQKEECFSNTVTAVMIPPYIDSAEIVRRAWKRYNLSLGLGLNKVAGKV  298

Query  237  FRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAA  118
            FRIGHLGN+NELQLLGCL+GVEMVLKD+GYPVK GSGVAA
Sbjct  299  FRIGHLGNVNELQLLGCLSGVEMVLKDVGYPVKFGSGVAA  338



>gb|AEX09261.1| alanine glyoxylate aminotransferase [Peperomia aff. ovatopeltata 
JN-2011]
Length=327

 Score =   395 bits (1014),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 198/217 (91%), Positives = 210/217 (97%), Gaps = 0/217 (0%)
 Frame = -1

Query  777  YQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA  598
            Y HPALLLVDGVSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTA
Sbjct  111  YNHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTA  170

Query  597  KSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTAT  418
            KSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG AT
Sbjct  171  KSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKAT  230

Query  417  RLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKV  238
            RLAV+AWGLKNCTQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKV
Sbjct  231  RLAVEAWGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKV  290

Query  237  FRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSG  127
            FRIGHLGN+NELQLLGCL+GVEMVLKD+GYPVK GSG
Sbjct  291  FRIGHLGNVNELQLLGCLSGVEMVLKDVGYPVKFGSG  327



>gb|AEX09269.1| alanine glyoxylate aminotransferase [Peperomia peruviana]
Length=328

 Score =   394 bits (1012),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 198/219 (90%), Positives = 210/219 (96%), Gaps = 0/219 (0%)
 Frame = -1

Query  777  YQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA  598
            Y HPALLLVDGVSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTA
Sbjct  110  YNHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTA  169

Query  597  KSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTAT  418
            KSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVI RH RLG AT
Sbjct  170  KSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIERHARLGKAT  229

Query  417  RLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKV  238
            RLAV+AWGLKNCTQKEE FS+TVTAV++P YIDS+EIV+RAWKRYNLSLGLGLNKVAGKV
Sbjct  230  RLAVEAWGLKNCTQKEECFSNTVTAVMIPPYIDSAEIVRRAWKRYNLSLGLGLNKVAGKV  289

Query  237  FRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVA  121
            FRIGHLGN+NELQLLGCL+GVEMVLKD+GYPVK GSGVA
Sbjct  290  FRIGHLGNVNELQLLGCLSGVEMVLKDVGYPVKFGSGVA  328



>gb|AEX09281.1| alanine glyoxylate aminotransferase [Peperomia cyclaminoides]
Length=330

 Score =   394 bits (1011),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 199/220 (90%), Positives = 211/220 (96%), Gaps = 0/220 (0%)
 Frame = -1

Query  777  YQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA  598
            Y HPALLLVDGVSSICA+DFRMDEWGVDVALTGSQKA SLPTG+GIVCASPKALEASKTA
Sbjct  111  YNHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKAPSLPTGMGIVCASPKALEASKTA  170

Query  597  KSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTAT  418
            KSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG AT
Sbjct  171  KSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKAT  230

Query  417  RLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKV  238
            RLAV+AWGLKNCTQKEE FSDTVTAV++PS IDS+EIV+RAWKRYNLSLGLGLNKVAGKV
Sbjct  231  RLAVEAWGLKNCTQKEECFSDTVTAVMIPSNIDSAEIVRRAWKRYNLSLGLGLNKVAGKV  290

Query  237  FRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAA  118
            FRIGHLGN+NELQLLGCL+GVEMVLKD+GYPVK GSGVAA
Sbjct  291  FRIGHLGNVNELQLLGCLSGVEMVLKDVGYPVKFGSGVAA  330



>gb|AEX09283.1| alanine glyoxylate aminotransferase [Peperomia peruviana]
Length=349

 Score =   394 bits (1012),  Expect = 7e-134, Method: Compositional matrix adjust.
 Identities = 198/219 (90%), Positives = 210/219 (96%), Gaps = 0/219 (0%)
 Frame = -1

Query  777  YQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA  598
            Y HPALLLVDGVSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTA
Sbjct  131  YNHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTA  190

Query  597  KSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTAT  418
            KSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVI RH RLG AT
Sbjct  191  KSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIDRHARLGKAT  250

Query  417  RLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKV  238
            RLAV+AWGLKNCTQKEE FS+TVTAV++P YIDS+EIV+RAWKRYNLSLGLGLNKVAGKV
Sbjct  251  RLAVEAWGLKNCTQKEECFSNTVTAVMIPPYIDSAEIVRRAWKRYNLSLGLGLNKVAGKV  310

Query  237  FRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVA  121
            FRIGHLGN+NELQLLGCL+GVEMVLKD+GYPVK GSGVA
Sbjct  311  FRIGHLGNVNELQLLGCLSGVEMVLKDVGYPVKFGSGVA  349



>gb|AEX09271.1| alanine glyoxylate aminotransferase [Peperomia peruviana]
Length=332

 Score =   393 bits (1010),  Expect = 7e-134, Method: Compositional matrix adjust.
 Identities = 198/219 (90%), Positives = 210/219 (96%), Gaps = 0/219 (0%)
 Frame = -1

Query  777  YQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA  598
            Y HPALLLVDGVSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTA
Sbjct  114  YNHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTA  173

Query  597  KSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTAT  418
            KSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVI RH RLG AT
Sbjct  174  KSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIDRHARLGKAT  233

Query  417  RLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKV  238
            RLAV+AWGLKNCTQKEE FS+TVTAV++P YIDS+EIV+RAWKRYNLSLGLGLNKVAGKV
Sbjct  234  RLAVEAWGLKNCTQKEECFSNTVTAVMIPPYIDSAEIVRRAWKRYNLSLGLGLNKVAGKV  293

Query  237  FRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVA  121
            FRIGHLGN+NELQLLGCL+GVEMVLKD+GYPVK GSGVA
Sbjct  294  FRIGHLGNVNELQLLGCLSGVEMVLKDVGYPVKFGSGVA  332



>gb|KJB54391.1| hypothetical protein B456_009G074800 [Gossypium raimondii]
Length=215

 Score =   389 bits (999),  Expect = 7e-134, Method: Compositional matrix adjust.
 Identities = 195/215 (91%), Positives = 208/215 (97%), Gaps = 0/215 (0%)
 Frame = -1

Query  714  MDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTY  535
            MDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASK+AKSVRVFFDW DYLKFYK+GT+
Sbjct  1    MDEWGVDVALTGSQKALSLPTGLGIVCASPKALEASKSAKSVRVFFDWNDYLKFYKLGTF  60

Query  534  WPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSD  355
            WPYTPSIQLLYGLRA LDL+FEEGLDNVIARHTR+G ATRLAV+AWGLKNCTQKEEW+SD
Sbjct  61   WPYTPSIQLLYGLRAALDLIFEEGLDNVIARHTRMGKATRLAVEAWGLKNCTQKEEWYSD  120

Query  354  TVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGV  175
            TVTAV+VP YIDS+EIVKRAWKRYN+SLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGV
Sbjct  121  TVTAVLVPPYIDSAEIVKRAWKRYNMSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGV  180

Query  174  EMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  70
            EM+LKD+GYPVKLGSGVAAA AYLQN  PMIPSRI
Sbjct  181  EMILKDVGYPVKLGSGVAAACAYLQNNIPMIPSRI  215



>gb|AEX09294.1| alanine glyoxylate aminotransferase [Peperomia sp. JN-2011]
Length=345

 Score =   392 bits (1007),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 196/215 (91%), Positives = 208/215 (97%), Gaps = 0/215 (0%)
 Frame = -1

Query  777  YQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA  598
            Y HPALLLVDGVSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEA+KTA
Sbjct  131  YNHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEATKTA  190

Query  597  KSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTAT  418
            KSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH RLG AT
Sbjct  191  KSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHARLGKAT  250

Query  417  RLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKV  238
            RLAV+AWGLKNCTQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKV
Sbjct  251  RLAVEAWGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKV  310

Query  237  FRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLG  133
            FRIGHLGN+NELQLLGCL+GVEMVLKD+GYPVK G
Sbjct  311  FRIGHLGNVNELQLLGCLSGVEMVLKDVGYPVKFG  345



>gb|AEX09264.1| alanine glyoxylate aminotransferase [Peperomia radiatinervosa]
Length=334

 Score =   391 bits (1005),  Expect = 6e-133, Method: Compositional matrix adjust.
 Identities = 196/215 (91%), Positives = 208/215 (97%), Gaps = 0/215 (0%)
 Frame = -1

Query  777  YQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA  598
            Y HPALLLVDGVSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTA
Sbjct  120  YNHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTA  179

Query  597  KSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTAT  418
            KSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG AT
Sbjct  180  KSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKAT  239

Query  417  RLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKV  238
            RLAV+AWGLKNCTQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKV
Sbjct  240  RLAVEAWGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKV  299

Query  237  FRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLG  133
            FRIGHLGN+NELQLLGCL+GVEMVLKD+GYPVK G
Sbjct  300  FRIGHLGNVNELQLLGCLSGVEMVLKDVGYPVKFG  334



>gb|AEX09262.1| alanine glyoxylate aminotransferase [Peperomia aff. ovatopeltata 
JN-2011]
Length=342

 Score =   388 bits (996),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 194/212 (92%), Positives = 206/212 (97%), Gaps = 0/212 (0%)
 Frame = -1

Query  777  YQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA  598
            Y HPALLLVDGVSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTA
Sbjct  131  YNHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTA  190

Query  597  KSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTAT  418
            KSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG AT
Sbjct  191  KSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKAT  250

Query  417  RLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKV  238
            RLAV+AWGLKNCTQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKV
Sbjct  251  RLAVEAWGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKV  310

Query  237  FRIGHLGNLNELQLLGCLAGVEMVLKDIGYPV  142
            FRIGHLGN+NELQLLGCL+GVEMVLKD+GYPV
Sbjct  311  FRIGHLGNVNELQLLGCLSGVEMVLKDVGYPV  342



>gb|AEX09252.1| alanine glyoxylate aminotransferase [Peperomia exclamationis]
Length=342

 Score =   387 bits (995),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 194/212 (92%), Positives = 206/212 (97%), Gaps = 0/212 (0%)
 Frame = -1

Query  777  YQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA  598
            Y HPALLLVDGVSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTA
Sbjct  131  YNHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTA  190

Query  597  KSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTAT  418
            KSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG AT
Sbjct  191  KSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKAT  250

Query  417  RLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKV  238
            RLAV+AWGLKNCTQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKV
Sbjct  251  RLAVEAWGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKV  310

Query  237  FRIGHLGNLNELQLLGCLAGVEMVLKDIGYPV  142
            FRIGHLGN+NELQLLGCL+GVEMVLKD+GYPV
Sbjct  311  FRIGHLGNVNELQLLGCLSGVEMVLKDVGYPV  342



>gb|AEX09302.1| alanine glyoxylate aminotransferase [Peperomia sp. JN-2011]
Length=343

 Score =   386 bits (992),  Expect = 7e-131, Method: Compositional matrix adjust.
 Identities = 193/212 (91%), Positives = 205/212 (97%), Gaps = 0/212 (0%)
 Frame = -1

Query  774  QHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAK  595
             HPALLLVDGVSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAK
Sbjct  132  NHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAK  191

Query  594  SVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATR  415
            SVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVI RH RLG ATR
Sbjct  192  SVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIDRHARLGKATR  251

Query  414  LAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVF  235
            LAV+AWGLKNCTQKEEWFS+TVTAV++P YIDS+EIV+RAWKRYNLSLGLGLNKVAGKVF
Sbjct  252  LAVEAWGLKNCTQKEEWFSNTVTAVMIPPYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVF  311

Query  234  RIGHLGNLNELQLLGCLAGVEMVLKDIGYPVK  139
            RIGHLGN+NELQLLGCL+GVEMVLKD+GYPVK
Sbjct  312  RIGHLGNVNELQLLGCLSGVEMVLKDVGYPVK  343



>gb|AEX09289.1| alanine glyoxylate aminotransferase [Peperomia gigantea]
Length=312

 Score =   377 bits (967),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 189/206 (92%), Positives = 200/206 (97%), Gaps = 0/206 (0%)
 Frame = -1

Query  777  YQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA  598
            Y HPALLLVDGVSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTA
Sbjct  107  YNHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTA  166

Query  597  KSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTAT  418
            KSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG AT
Sbjct  167  KSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKAT  226

Query  417  RLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKV  238
            RLAV+AWGLKNCTQKEEWFSDTVTAV++P YIDS+EIV+RAWKRYNLSLGLGLNKVAGKV
Sbjct  227  RLAVEAWGLKNCTQKEEWFSDTVTAVMIPPYIDSAEIVRRAWKRYNLSLGLGLNKVAGKV  286

Query  237  FRIGHLGNLNELQLLGCLAGVEMVLK  160
            FRIGHLGN+NELQLLGCL+GVEMVLK
Sbjct  287  FRIGHLGNVNELQLLGCLSGVEMVLK  312



>gb|AEX09242.1| alanine glyoxylate aminotransferase [Peperomia aff. pinoi JN-2011]
Length=335

 Score =   377 bits (967),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 189/205 (92%), Positives = 199/205 (97%), Gaps = 0/205 (0%)
 Frame = -1

Query  777  YQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA  598
            Y HPALLLVDGVSSICA+DFRMDEWG+DVALTGSQKALSLPTG+GIVCASPKALEASKTA
Sbjct  131  YNHPALLLVDGVSSICALDFRMDEWGIDVALTGSQKALSLPTGMGIVCASPKALEASKTA  190

Query  597  KSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTAT  418
            KSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH RLG AT
Sbjct  191  KSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHARLGKAT  250

Query  417  RLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKV  238
            RLAV+AWGLKNCTQKEEW SDTVTAVV+PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKV
Sbjct  251  RLAVEAWGLKNCTQKEEWSSDTVTAVVIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKV  310

Query  237  FRIGHLGNLNELQLLGCLAGVEMVL  163
            FRIGHLGN+NELQLLGCL+GVEMVL
Sbjct  311  FRIGHLGNVNELQLLGCLSGVEMVL  335



>ref|XP_004491262.1| PREDICTED: serine--glyoxylate aminotransferase-like [Cicer arietinum]
Length=401

 Score =   377 bits (967),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 187/236 (79%), Positives = 213/236 (90%), Gaps = 0/236 (0%)
 Frame = -1

Query  777  YQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA  598
            Y+HPAL++VD VSSI A+DFRMDEWG+DVA+T SQKALSLPTG+GIVCASPKA+EASK A
Sbjct  166  YKHPALVIVDAVSSIGALDFRMDEWGIDVAVTSSQKALSLPTGMGIVCASPKAIEASKHA  225

Query  597  KSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTAT  418
             S+R +FDW  YLK Y +GTYWPYTPSIQLLYGLRA LDL+FEEGL+NVI+RH RL  AT
Sbjct  226  TSLRSYFDWNGYLKCYNLGTYWPYTPSIQLLYGLRATLDLIFEEGLENVISRHKRLAKAT  285

Query  417  RLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKV  238
            RLAV+AWGLKNC Q +E +SD+VTAVVVP+ IDS EIV RAWK+YNLSLG+GLNKVAGKV
Sbjct  286  RLAVEAWGLKNCCQNKESYSDSVTAVVVPTNIDSGEIVNRAWKKYNLSLGVGLNKVAGKV  345

Query  237  FRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  70
            FRIGHLGN+NELQLLGCLAGVEMVL+D+GYP+K GSGVAAASAYL NT P+IPSRI
Sbjct  346  FRIGHLGNINELQLLGCLAGVEMVLRDVGYPIKFGSGVAAASAYLHNTIPLIPSRI  401



>gb|AEX09291.1| alanine glyoxylate aminotransferase [Peperomia jalcaensis]
Length=323

 Score =   373 bits (958),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 188/205 (92%), Positives = 199/205 (97%), Gaps = 0/205 (0%)
 Frame = -1

Query  777  YQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA  598
            Y HPALLLVDGVSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTA
Sbjct  119  YNHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTA  178

Query  597  KSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTAT  418
            KSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG AT
Sbjct  179  KSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKAT  238

Query  417  RLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKV  238
            RLAV+AWGLKNCTQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKV
Sbjct  239  RLAVEAWGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKV  298

Query  237  FRIGHLGNLNELQLLGCLAGVEMVL  163
            FRIGHLGN+NELQLLGCL+GVEMVL
Sbjct  299  FRIGHLGNVNELQLLGCLSGVEMVL  323



>gb|AEX09246.1| alanine glyoxylate aminotransferase [Peperomia elatior]
Length=335

 Score =   373 bits (957),  Expect = 8e-126, Method: Compositional matrix adjust.
 Identities = 188/205 (92%), Positives = 199/205 (97%), Gaps = 0/205 (0%)
 Frame = -1

Query  777  YQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA  598
            Y HPALLLVDGVSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTA
Sbjct  131  YNHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTA  190

Query  597  KSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTAT  418
            KSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG AT
Sbjct  191  KSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKAT  250

Query  417  RLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKV  238
            RLAV+AWGLKNCTQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKV
Sbjct  251  RLAVEAWGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKV  310

Query  237  FRIGHLGNLNELQLLGCLAGVEMVL  163
            FRIGHLGN+NELQLLGCL+GVEMVL
Sbjct  311  FRIGHLGNVNELQLLGCLSGVEMVL  335



>gb|AEX09288.1| alanine glyoxylate aminotransferase [Peperomia parvisagittata]
Length=335

 Score =   373 bits (957),  Expect = 9e-126, Method: Compositional matrix adjust.
 Identities = 188/205 (92%), Positives = 199/205 (97%), Gaps = 0/205 (0%)
 Frame = -1

Query  777  YQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA  598
            Y HPALLLVDGVSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTA
Sbjct  131  YNHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTA  190

Query  597  KSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTAT  418
            KSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG AT
Sbjct  191  KSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKAT  250

Query  417  RLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKV  238
            RLAV+AWGLKNCTQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKV
Sbjct  251  RLAVEAWGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKV  310

Query  237  FRIGHLGNLNELQLLGCLAGVEMVL  163
            FRIGHLGN+NELQLLGCL+GVEMVL
Sbjct  311  FRIGHLGNVNELQLLGCLSGVEMVL  335



>ref|XP_003617296.1| Alanine glyoxylate aminotransferase [Medicago truncatula]
 gb|AET00255.1| serine-glyoxylate aminotransferase-like protein [Medicago truncatula]
Length=401

 Score =   375 bits (963),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 189/236 (80%), Positives = 208/236 (88%), Gaps = 0/236 (0%)
 Frame = -1

Query  777  YQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA  598
            YQHPAL++VD VSSI A+DFRMDEWGVDV +T SQKALSLPTG+GIVCA PKA+EA+K+A
Sbjct  166  YQHPALIIVDAVSSIGALDFRMDEWGVDVVVTSSQKALSLPTGMGIVCAGPKAIEATKSA  225

Query  597  KSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTAT  418
             SVR FFDW  YLK Y +GTYWPYTPSIQLLYGLRA LDL+FEEG +NVI RH RL  AT
Sbjct  226  TSVRSFFDWNGYLKCYNLGTYWPYTPSIQLLYGLRAALDLVFEEGFENVILRHKRLAKAT  285

Query  417  RLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKV  238
            RLAV+AWGLKNC QKEEW+S +VTA+VVP  IDS EIV RAWKRYNLSLG GLNKVAGKV
Sbjct  286  RLAVEAWGLKNCCQKEEWYSASVTAIVVPPNIDSGEIVSRAWKRYNLSLGGGLNKVAGKV  345

Query  237  FRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  70
            FRIGH+G+LNELQLLGCLAGVEM LKD+GYPVKLGSGVAAASAYL N  P+IPSRI
Sbjct  346  FRIGHVGHLNELQLLGCLAGVEMTLKDVGYPVKLGSGVAAASAYLLNNVPLIPSRI  401



>gb|AEX09309.1| alanine glyoxylate aminotransferase [Peperomia wernerrauhii]
Length=335

 Score =   371 bits (952),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 187/205 (91%), Positives = 198/205 (97%), Gaps = 0/205 (0%)
 Frame = -1

Query  777  YQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA  598
            Y HPALLLVDGVSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTA
Sbjct  131  YNHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTA  190

Query  597  KSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTAT  418
            KSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG AT
Sbjct  191  KSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKAT  250

Query  417  RLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKV  238
            RLAV+AWGLKNCTQKEE FSD VTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKV
Sbjct  251  RLAVEAWGLKNCTQKEECFSDAVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKV  310

Query  237  FRIGHLGNLNELQLLGCLAGVEMVL  163
            FRIGHLGN+NELQLLGCL+GVEMVL
Sbjct  311  FRIGHLGNVNELQLLGCLSGVEMVL  335



>gb|AEX09251.1| alanine glyoxylate aminotransferase [Peperomia schizandra]
Length=331

 Score =   370 bits (949),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 185/201 (92%), Positives = 196/201 (98%), Gaps = 0/201 (0%)
 Frame = -1

Query  777  YQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA  598
            Y HPALLLVDGVSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTA
Sbjct  131  YNHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTA  190

Query  597  KSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTAT  418
            KSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG AT
Sbjct  191  KSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKAT  250

Query  417  RLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKV  238
            RLAV+AWGLKNCTQKEEWFSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKV
Sbjct  251  RLAVEAWGLKNCTQKEEWFSDTVTAVLIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKV  310

Query  237  FRIGHLGNLNELQLLGCLAGV  175
            FRIGHLGN+NELQLLGCL+GV
Sbjct  311  FRIGHLGNVNELQLLGCLSGV  331



>gb|AEX09282.1| alanine glyoxylate aminotransferase [Peperomia cerrateae]
Length=332

 Score =   369 bits (947),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 186/202 (92%), Positives = 196/202 (97%), Gaps = 0/202 (0%)
 Frame = -1

Query  777  YQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA  598
            Y HPALLLVDGVSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTA
Sbjct  131  YNHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTA  190

Query  597  KSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTAT  418
            KSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH RLG AT
Sbjct  191  KSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHARLGKAT  250

Query  417  RLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKV  238
            RLAV+AWGLKNCTQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKV
Sbjct  251  RLAVEAWGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKV  310

Query  237  FRIGHLGNLNELQLLGCLAGVE  172
            FRIGHLGN+NELQLLGCL+GVE
Sbjct  311  FRIGHLGNVNELQLLGCLSGVE  332



>gb|AEX09290.1| alanine glyoxylate aminotransferase [Peperomia dolabella]
Length=311

 Score =   367 bits (943),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 185/202 (92%), Positives = 196/202 (97%), Gaps = 0/202 (0%)
 Frame = -1

Query  777  YQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA  598
            Y HPALLLVDGVSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTA
Sbjct  110  YNHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTA  169

Query  597  KSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTAT  418
            KSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG AT
Sbjct  170  KSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKAT  229

Query  417  RLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKV  238
            RLAV+AWGLKNCTQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKV
Sbjct  230  RLAVEAWGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKV  289

Query  237  FRIGHLGNLNELQLLGCLAGVE  172
            FRIGHLGN+NELQLLGCL+GVE
Sbjct  290  FRIGHLGNVNELQLLGCLSGVE  311



>gb|AEX09244.1| alanine glyoxylate aminotransferase [Peperomia basiradicans]
Length=332

 Score =   368 bits (945),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 185/202 (92%), Positives = 196/202 (97%), Gaps = 0/202 (0%)
 Frame = -1

Query  777  YQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA  598
            Y HPALLLVDGVSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GI+CASPKALEASKTA
Sbjct  131  YNHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGMGILCASPKALEASKTA  190

Query  597  KSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTAT  418
            KSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH RLG AT
Sbjct  191  KSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHARLGKAT  250

Query  417  RLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKV  238
            RLAV+AWGLKNCTQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKV
Sbjct  251  RLAVEAWGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKV  310

Query  237  FRIGHLGNLNELQLLGCLAGVE  172
            FRIGHLGN+NELQLLGCL+GVE
Sbjct  311  FRIGHLGNVNELQLLGCLSGVE  332



>ref|XP_002990557.1| hypothetical protein SELMODRAFT_448066 [Selaginella moellendorffii]
 gb|EFJ08434.1| hypothetical protein SELMODRAFT_448066 [Selaginella moellendorffii]
Length=401

 Score =   370 bits (950),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 187/236 (79%), Positives = 211/236 (89%), Gaps = 0/236 (0%)
 Frame = -1

Query  777  YQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA  598
            ++HPALLLVDGVSSI AI+F+MDEWGVDVALTGSQKAL LPTG+GIVCA PKALEA+KTA
Sbjct  166  HKHPALLLVDGVSSIGAIEFKMDEWGVDVALTGSQKALGLPTGLGIVCAGPKALEAAKTA  225

Query  597  KSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTAT  418
             S RVFFDW DYLKFYK+G+YWPYTPS Q+LY LRA LDL+FEEGLDNVI RH RLG AT
Sbjct  226  TSPRVFFDWADYLKFYKLGSYWPYTPSSQMLYALRASLDLIFEEGLDNVIKRHARLGEAT  285

Query  417  RLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKV  238
            RLAV AWGLK CT++ EW SDTVTAVVVP YI+S ++VK AWK+YNLSLG+GLNKVAGKV
Sbjct  286  RLAVAAWGLKLCTKRPEWNSDTVTAVVVPPYINSLDVVKMAWKKYNLSLGVGLNKVAGKV  345

Query  237  FRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  70
            FRIGHLG +NELQLLG L+GVEM+LKDIGYPV LGSGVAAA+A+LQ  TP+I SR+
Sbjct  346  FRIGHLGFVNELQLLGALSGVEMILKDIGYPVVLGSGVAAAAAHLQKKTPLISSRL  401



>gb|AEX09287.1| alanine glyoxylate aminotransferase [Peperomia cerrateae]
Length=331

 Score =   367 bits (941),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 185/201 (92%), Positives = 195/201 (97%), Gaps = 0/201 (0%)
 Frame = -1

Query  777  YQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA  598
            Y HPALLLVDGVSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTA
Sbjct  131  YNHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTA  190

Query  597  KSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTAT  418
            KSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH RLG AT
Sbjct  191  KSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHARLGKAT  250

Query  417  RLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKV  238
            RLAV+AWGLKNCTQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKV
Sbjct  251  RLAVEAWGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKV  310

Query  237  FRIGHLGNLNELQLLGCLAGV  175
            FRIGHLGN+NELQLLGCL+GV
Sbjct  311  FRIGHLGNVNELQLLGCLSGV  331



>ref|XP_002983655.1| hypothetical protein SELMODRAFT_228964 [Selaginella moellendorffii]
 gb|EFJ15151.1| hypothetical protein SELMODRAFT_228964 [Selaginella moellendorffii]
Length=401

 Score =   369 bits (946),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 186/236 (79%), Positives = 211/236 (89%), Gaps = 0/236 (0%)
 Frame = -1

Query  777  YQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA  598
            ++HPALLLVDGVSSI AI+F+MDEWGVDVALTGSQKAL LPTG+GIVCA PKALEA+KTA
Sbjct  166  HKHPALLLVDGVSSIGAIEFKMDEWGVDVALTGSQKALGLPTGLGIVCAGPKALEAAKTA  225

Query  597  KSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTAT  418
             S RVFFDW DYLKFYK+G+YWPYTPS Q+LY LRA LDL+FEEGLDNVI RH RLG AT
Sbjct  226  TSPRVFFDWADYLKFYKVGSYWPYTPSSQMLYALRASLDLIFEEGLDNVIKRHARLGEAT  285

Query  417  RLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKV  238
            RLAV AWGLK CT++ EW SDTVTAVVVP Y++S ++VK AWK+YNLSLG+GLNKVAGKV
Sbjct  286  RLAVAAWGLKLCTKRPEWNSDTVTAVVVPPYLNSLDVVKMAWKKYNLSLGVGLNKVAGKV  345

Query  237  FRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  70
            FRIGHLG +NELQLLG L+GVEM+LKDIGYPV LGSGVAAA+A+LQ  TP+I SR+
Sbjct  346  FRIGHLGFVNELQLLGALSGVEMILKDIGYPVVLGSGVAAAAAHLQKKTPLISSRL  401



>gb|AEX09292.1| alanine glyoxylate aminotransferase [Peperomia klopfensteinii]
Length=330

 Score =   366 bits (939),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 183/200 (92%), Positives = 194/200 (97%), Gaps = 0/200 (0%)
 Frame = -1

Query  777  YQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA  598
            Y HPALLLVDGVSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTA
Sbjct  131  YNHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTA  190

Query  597  KSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTAT  418
            KSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG AT
Sbjct  191  KSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKAT  250

Query  417  RLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKV  238
            RLAV+AWGLKNCTQKEEWFSDTVTAV++P YIDS+EIV+RAWKRYNLSLGLGLNKVAGKV
Sbjct  251  RLAVEAWGLKNCTQKEEWFSDTVTAVMIPPYIDSAEIVRRAWKRYNLSLGLGLNKVAGKV  310

Query  237  FRIGHLGNLNELQLLGCLAG  178
            FRIGHLGN+NELQLLGCL+G
Sbjct  311  FRIGHLGNVNELQLLGCLSG  330



>gb|AEX09310.1| alanine glyoxylate aminotransferase [Peperomia wernerrauhii]
Length=331

 Score =   365 bits (938),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 184/201 (92%), Positives = 195/201 (97%), Gaps = 0/201 (0%)
 Frame = -1

Query  777  YQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA  598
            Y HPALLLVDGVSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTA
Sbjct  131  YNHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTA  190

Query  597  KSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTAT  418
            KSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG AT
Sbjct  191  KSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKAT  250

Query  417  RLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKV  238
            RLAV+AWGLKNCTQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKV
Sbjct  251  RLAVEAWGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKV  310

Query  237  FRIGHLGNLNELQLLGCLAGV  175
            FRIGHLGN+NELQLLGCL+GV
Sbjct  311  FRIGHLGNVNELQLLGCLSGV  331



>gb|AEX09243.1| alanine glyoxylate aminotransferase [Peperomia sp. JN-2011]
Length=301

 Score =   350 bits (899),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 177/194 (91%), Positives = 188/194 (97%), Gaps = 0/194 (0%)
 Frame = -1

Query  777  YQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA  598
            Y HPALLLVDGVSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GI+CASPKALEASKTA
Sbjct  108  YNHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGMGILCASPKALEASKTA  167

Query  597  KSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTAT  418
            KSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG AT
Sbjct  168  KSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKAT  227

Query  417  RLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKV  238
            RLAV+AWGLKNCTQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKV
Sbjct  228  RLAVEAWGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKV  287

Query  237  FRIGHLGNLNELQL  196
            FRIGHLGN+NELQL
Sbjct  288  FRIGHLGNVNELQL  301



>ref|XP_002969615.1| hypothetical protein SELMODRAFT_267279 [Selaginella moellendorffii]
 gb|EFJ29703.1| hypothetical protein SELMODRAFT_267279 [Selaginella moellendorffii]
Length=401

 Score =   352 bits (902),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 179/235 (76%), Positives = 209/235 (89%), Gaps = 0/235 (0%)
 Frame = -1

Query  774  QHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAK  595
            QHPALLLVDGVSSI A+ FRMDEW VDVALTGSQK+L LPTG+GI+CASPKALEASK+A+
Sbjct  167  QHPALLLVDGVSSIGALAFRMDEWKVDVALTGSQKSLGLPTGLGILCASPKALEASKSAR  226

Query  594  SVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATR  415
            S R FFDW  YLK Y++G+YWPYTPSIQLLYGLRA LDLLFEEGL+NVI RH RL  ATR
Sbjct  227  SPRGFFDWSAYLKSYELGSYWPYTPSIQLLYGLRAALDLLFEEGLENVIKRHHRLAHATR  286

Query  414  LAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVF  235
            LAV+AWGL+ C +  E +SDTVTAVVVPSY++S+++V+ AW++YNLS+G+GLNKVAGKVF
Sbjct  287  LAVKAWGLELCVKDPELYSDTVTAVVVPSYLNSTDVVRVAWRKYNLSIGIGLNKVAGKVF  346

Query  234  RIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  70
            RIGHLG LNELQL+  LAGVEM LKD+G+PVKLGSGVAAA AYLQ +TP+IPSR+
Sbjct  347  RIGHLGFLNELQLISALAGVEMALKDVGFPVKLGSGVAAAQAYLQESTPLIPSRL  401



>ref|XP_010094254.1| Serine--glyoxylate aminotransferase [Morus notabilis]
 gb|EXB55505.1| Serine--glyoxylate aminotransferase [Morus notabilis]
Length=358

 Score =   350 bits (898),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 177/192 (92%), Positives = 187/192 (97%), Gaps = 0/192 (0%)
 Frame = -1

Query  777  YQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA  598
            Y HPALLLVDGVSSICA+DFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASK+A
Sbjct  166  YGHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKSA  225

Query  597  KSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTAT  418
            KSVRVFFDW DYLKFYK+GTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH+RLG AT
Sbjct  226  KSVRVFFDWNDYLKFYKLGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHSRLGKAT  285

Query  417  RLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKV  238
            RLAV+AWGLKNCTQKEEW+SDTVTAV+VP YIDS+EIVKRAWKRYNLSLGLGLNKVAGKV
Sbjct  286  RLAVEAWGLKNCTQKEEWYSDTVTAVLVPPYIDSTEIVKRAWKRYNLSLGLGLNKVAGKV  345

Query  237  FRIGHLGNLNEL  202
            FRIGHLGNLNE+
Sbjct  346  FRIGHLGNLNEV  357



>gb|AEX09260.1| alanine glyoxylate aminotransferase [Peperomia aff. ovatopeltata 
JN-2011]
Length=326

 Score =   348 bits (893),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 177/196 (90%), Positives = 187/196 (95%), Gaps = 0/196 (0%)
 Frame = -1

Query  777  YQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA  598
            Y HPALLLVDGVSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTA
Sbjct  131  YNHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTA  190

Query  597  KSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTAT  418
            KSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG AT
Sbjct  191  KSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKAT  250

Query  417  RLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKV  238
            RL V+AWGLKNCT KEE FSDTVTAV++PSYIDS+EIV+RAWKR NLSLGLGLNKVAGKV
Sbjct  251  RLXVEAWGLKNCTPKEECFSDTVTAVMIPSYIDSAEIVRRAWKRSNLSLGLGLNKVAGKV  310

Query  237  FRIGHLGNLNELQLLG  190
            FRIGHLGN+NELQLLG
Sbjct  311  FRIGHLGNVNELQLLG  326



>ref|XP_002970880.1| hypothetical protein SELMODRAFT_147375 [Selaginella moellendorffii]
 gb|EFJ28206.1| hypothetical protein SELMODRAFT_147375 [Selaginella moellendorffii]
Length=401

 Score =   350 bits (899),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 178/235 (76%), Positives = 209/235 (89%), Gaps = 0/235 (0%)
 Frame = -1

Query  774  QHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAK  595
            QHPALLLVDGVSSI A+ FRMDEW VDVALTGSQK+L LPTG+GI+CASPKALEASK+A+
Sbjct  167  QHPALLLVDGVSSIGALAFRMDEWKVDVALTGSQKSLGLPTGLGILCASPKALEASKSAR  226

Query  594  SVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATR  415
            S R FFDW  YLK Y++G+YWPYTPSIQLLYGLRA LDLLFEEGL+NVI RH RL  ATR
Sbjct  227  SPRGFFDWSAYLKSYELGSYWPYTPSIQLLYGLRAALDLLFEEGLENVIKRHHRLAHATR  286

Query  414  LAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVF  235
            LAV+AWGL+ C +  E +SDTVTAVVVPSY++S+++V+ AW++YNLS+G+GLNKVAGKVF
Sbjct  287  LAVKAWGLELCIKDPELYSDTVTAVVVPSYLNSTDVVRVAWRKYNLSIGIGLNKVAGKVF  346

Query  234  RIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  70
            RIGHLG LNELQL+  LAGVEM LKD+G+PVKLGSGV+AA AYLQ +TP+IPSR+
Sbjct  347  RIGHLGFLNELQLISALAGVEMALKDVGFPVKLGSGVSAAQAYLQESTPLIPSRL  401



>ref|XP_001755667.1| predicted protein [Physcomitrella patens]
 gb|EDQ79340.1| predicted protein [Physcomitrella patens]
Length=402

 Score =   349 bits (896),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 182/236 (77%), Positives = 207/236 (88%), Gaps = 1/236 (0%)
 Frame = -1

Query  774  QHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAK  595
            +HPALLLVDGVSSI AIDFRMD+W VDVALTGSQKALSLPTG+GIVCASPKAL A+K +K
Sbjct  167  RHPALLLVDGVSSIGAIDFRMDDWKVDVALTGSQKALSLPTGLGIVCASPKALAAAKQSK  226

Query  594  SVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLF-EEGLDNVIARHTRLGTAT  418
            S RVFFDW DYLKFY+ GTYWPYTPS Q+LYGLRA LD++  EEGLDNVIARH RLG AT
Sbjct  227  STRVFFDWGDYLKFYEAGTYWPYTPSSQMLYGLRASLDMILNEEGLDNVIARHCRLGEAT  286

Query  417  RLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKV  238
            R AV+AWGL  CTQ  +W SDTVTAVVVPS+I+S++IVK A+K+YNLSLG+GLNKVAGKV
Sbjct  287  RQAVKAWGLTLCTQDPKWKSDTVTAVVVPSWINSNDIVKIAYKKYNLSLGIGLNKVAGKV  346

Query  237  FRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  70
            FRIGHLGN+NELQ+LG LAGVE+ L ++GYPV LGSGVAAA A+L   TP+I SRI
Sbjct  347  FRIGHLGNVNELQMLGALAGVELCLMEVGYPVTLGSGVAAAQAHLAKKTPLISSRI  402



>ref|XP_001783551.1| predicted protein [Physcomitrella patens]
 gb|EDQ51640.1| predicted protein [Physcomitrella patens]
Length=402

 Score =   347 bits (891),  Expect = 9e-115, Method: Compositional matrix adjust.
 Identities = 182/236 (77%), Positives = 206/236 (87%), Gaps = 1/236 (0%)
 Frame = -1

Query  774  QHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAK  595
             HPALLLVDGVSSI AIDFRMD+W VDVALTGSQKALSLPTG+GIVCASPKALEA+K +K
Sbjct  167  NHPALLLVDGVSSIGAIDFRMDDWRVDVALTGSQKALSLPTGLGIVCASPKALEAAKRSK  226

Query  594  SVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLF-EEGLDNVIARHTRLGTAT  418
            S RVFFDW DYLKFY+ GTYWPYTPS Q+LYGLRA LD++  EEGLDNVIARH RL  AT
Sbjct  227  STRVFFDWGDYLKFYEAGTYWPYTPSSQMLYGLRASLDMILNEEGLDNVIARHCRLAEAT  286

Query  417  RLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKV  238
            R AV+AWGL  CT+  +W SDTVTAVVVPS+I+S++IVK A+K+YNLSLG+GLNKVAGKV
Sbjct  287  RQAVRAWGLTLCTKDPKWKSDTVTAVVVPSWINSNDIVKIAYKKYNLSLGVGLNKVAGKV  346

Query  237  FRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  70
            FRIGHLGN+NELQLLG LAGVE+ L ++GYPV LGSGVAAA A+L   TP+I SRI
Sbjct  347  FRIGHLGNVNELQLLGALAGVELCLMEVGYPVTLGSGVAAAQAHLAKKTPLIVSRI  402



>ref|XP_003600160.1| Alanine glyoxylate aminotransferase [Medicago truncatula]
 gb|AES70411.1| serine-glyoxylate aminotransferase-like protein [Medicago truncatula]
Length=408

 Score =   347 bits (891),  Expect = 9e-115, Method: Compositional matrix adjust.
 Identities = 173/195 (89%), Positives = 187/195 (96%), Gaps = 0/195 (0%)
 Frame = -1

Query  777  YQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA  598
            YQHPALLLVDGVSSICA+DFRMDEWGVDVA+TGSQKALSLPTGIG V ASPKA+EASK+A
Sbjct  166  YQHPALLLVDGVSSICALDFRMDEWGVDVAITGSQKALSLPTGIGFVVASPKAIEASKSA  225

Query  597  KSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTAT  418
            KS+RVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+N+IARH RLGTAT
Sbjct  226  KSLRVFFDWSDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENIIARHNRLGTAT  285

Query  417  RLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKV  238
            RLAV+AWGLKNCTQ+EEWFSDTVTAVVVP YID +EIV+RAWKRYNLSLGLGLNKVAGKV
Sbjct  286  RLAVEAWGLKNCTQEEEWFSDTVTAVVVPPYIDGAEIVRRAWKRYNLSLGLGLNKVAGKV  345

Query  237  FRIGHLGNLNELQLL  193
            FRIGHLGNLNE+ L+
Sbjct  346  FRIGHLGNLNEVTLI  360



>ref|XP_006369573.1| hypothetical protein POPTR_0001s26020g [Populus trichocarpa]
 gb|ERP66142.1| hypothetical protein POPTR_0001s26020g [Populus trichocarpa]
Length=381

 Score =   345 bits (884),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 173/195 (89%), Positives = 184/195 (94%), Gaps = 0/195 (0%)
 Frame = -1

Query  777  YQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA  598
            Y+HPAL LVDGVSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTA
Sbjct  166  YRHPALFLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTA  225

Query  597  KSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTAT  418
            KS RVFFDWKDYLKFYK+GT+WPYTPSIQLLYGLR  LDLLF EGLDNVIARH RLG AT
Sbjct  226  KSFRVFFDWKDYLKFYKLGTFWPYTPSIQLLYGLREALDLLFAEGLDNVIARHARLGKAT  285

Query  417  RLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKV  238
            RLAV+AWGLKNCTQKEEWFSDTVTAV+VP YIDS+EIV+R WKRYNLSLGLGLNKVAGKV
Sbjct  286  RLAVEAWGLKNCTQKEEWFSDTVTAVLVPPYIDSAEIVRRGWKRYNLSLGLGLNKVAGKV  345

Query  237  FRIGHLGNLNELQLL  193
            FRIGHLGNLNE+  +
Sbjct  346  FRIGHLGNLNEVTFI  360



>gb|KDO44954.1| hypothetical protein CISIN_1g0157291mg [Citrus sinensis]
Length=367

 Score =   342 bits (877),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 170/194 (88%), Positives = 186/194 (96%), Gaps = 0/194 (0%)
 Frame = -1

Query  777  YQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA  598
            Y+HPAL LVDGVSSICAIDFRMDEWG+DVALTGSQKALSLPTG+GIVCASPKALEASKTA
Sbjct  166  YRHPALFLVDGVSSICAIDFRMDEWGIDVALTGSQKALSLPTGMGIVCASPKALEASKTA  225

Query  597  KSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTAT  418
            KSVRVFFDWKDY+KFY +GT+WPYTPSIQLLYGLRA LDL+FEEGL+NVI RH RLG AT
Sbjct  226  KSVRVFFDWKDYIKFYNLGTFWPYTPSIQLLYGLRAALDLIFEEGLENVIERHRRLGKAT  285

Query  417  RLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKV  238
            RLAV+AWGLKNCTQKEEWFSDTVTAV+VPS+I+SSEIV+RAW+RYNLSLGLGLNKVAGKV
Sbjct  286  RLAVEAWGLKNCTQKEEWFSDTVTAVIVPSHINSSEIVRRAWQRYNLSLGLGLNKVAGKV  345

Query  237  FRIGHLGNLNELQL  196
            FRIGHLG+LNE+  
Sbjct  346  FRIGHLGHLNEVMF  359



>tpg|DAA47908.1| TPA: hypothetical protein ZEAMMB73_592349 [Zea mays]
Length=234

 Score =   337 bits (864),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 167/192 (87%), Positives = 181/192 (94%), Gaps = 0/192 (0%)
 Frame = -1

Query  777  YQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA  598
            + HPALLLVDGVSSICA+DFRMDEWGVDVALTGSQKALS+PTG+GIVCASP+ALEASKTA
Sbjct  27   HAHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSMPTGMGIVCASPRALEASKTA  86

Query  597  KSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTAT  418
            +SVRVFFDWKDYL+FY MGTYWPYTPSIQLLYGLR  LDL+FEEGLDNV+ RH RLGTAT
Sbjct  87   RSVRVFFDWKDYLRFYDMGTYWPYTPSIQLLYGLRTALDLIFEEGLDNVVRRHNRLGTAT  146

Query  417  RLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKV  238
            RLAV+AWGL NC QKEEWFSDTVTAVVVP  IDS+E+V+ AWKRYNLSLGLGLNKVAGKV
Sbjct  147  RLAVEAWGLSNCCQKEEWFSDTVTAVVVPPNIDSAEVVRHAWKRYNLSLGLGLNKVAGKV  206

Query  237  FRIGHLGNLNEL  202
            FRIGHLGNLNE+
Sbjct  207  FRIGHLGNLNEV  218



>gb|ABR16109.1| unknown [Picea sitchensis]
Length=359

 Score =   340 bits (871),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 170/189 (90%), Positives = 182/189 (96%), Gaps = 0/189 (0%)
 Frame = -1

Query  771  HPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKS  592
            HPAL LVDGVSS+CAIDFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEA+KTAKS
Sbjct  168  HPALFLVDGVSSVCAIDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEATKTAKS  227

Query  591  VRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRL  412
            +RVFFDW DYLKFYK+GTYWPYTPSIQLLYGLR  LDL+F EGLDNVIARH+RLG ATRL
Sbjct  228  LRVFFDWNDYLKFYKLGTYWPYTPSIQLLYGLRTALDLIFLEGLDNVIARHSRLGRATRL  287

Query  411  AVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFR  232
            AV+AWGLKNCTQ+EEW+SDTVTAVV+P YIDS+EIVKRAWKRYNLSLGLGLNKVAGKVFR
Sbjct  288  AVEAWGLKNCTQREEWYSDTVTAVVIPPYIDSTEIVKRAWKRYNLSLGLGLNKVAGKVFR  347

Query  231  IGHLGNLNE  205
            IGHLGNLNE
Sbjct  348  IGHLGNLNE  356



>tpg|DAA47863.1| TPA: hypothetical protein ZEAMMB73_595389 [Zea mays]
Length=368

 Score =   335 bits (859),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 166/192 (86%), Positives = 180/192 (94%), Gaps = 0/192 (0%)
 Frame = -1

Query  777  YQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA  598
            + HPALLLVDGVSSICA+DFRMDEWGVDVALTGSQKALS+PTG+GIVCASP+ALEASKTA
Sbjct  168  HAHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSMPTGMGIVCASPRALEASKTA  227

Query  597  KSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTAT  418
            +SVRVFFDWKDYL+FY MGTYWPYTPSIQLLYGLR  LDL+FEEGLDNV+ RH RLGTAT
Sbjct  228  RSVRVFFDWKDYLRFYDMGTYWPYTPSIQLLYGLRTALDLIFEEGLDNVVRRHNRLGTAT  287

Query  417  RLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKV  238
            RLAV+AWGL NC QKEEWFSDTVTA VVP  IDS+E+V+ AWKRYNLSLGLGLNKVAGKV
Sbjct  288  RLAVEAWGLSNCCQKEEWFSDTVTAAVVPPNIDSAEVVRHAWKRYNLSLGLGLNKVAGKV  347

Query  237  FRIGHLGNLNEL  202
            FRIGHLGNLNE+
Sbjct  348  FRIGHLGNLNEV  359



>ref|XP_003617694.1| Alanine glyoxylate aminotransferase [Medicago truncatula]
 gb|AET00653.1| serine-glyoxylate aminotransferase-like protein [Medicago truncatula]
Length=350

 Score =   323 bits (828),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 171/237 (72%), Positives = 193/237 (81%), Gaps = 15/237 (6%)
 Frame = -1

Query  777  YQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA  598
            YQHPAL++ D V SI A+DFRMDEWGVDV +T SQKALSLPTG+GIVCA PKA+E     
Sbjct  128  YQHPALIIGDAVFSIGALDFRMDEWGVDVVVTSSQKALSLPTGMGIVCAGPKAIE-----  182

Query  597  KSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTAT  418
                       YLK Y +GTYWPYTPSI LLYGLRA LDL+FEEG +NVI RH RL  AT
Sbjct  183  ---------NGYLKCYNLGTYWPYTPSIPLLYGLRAALDLIFEEGFENVILRHKRLTKAT  233

Query  417  RLAVQAWGLKNCTQKEE-WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGK  241
            RLAV+AWGLKNC Q+EE W+S +VTA++VP  ID+ EIV RAWKRYNLSLG GLNKVAGK
Sbjct  234  RLAVEAWGLKNCCQQEEEWYSASVTAIIVPPNIDNGEIVSRAWKRYNLSLGGGLNKVAGK  293

Query  240  VFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  70
            VFRIGH+GNLNELQLLGCLAGVEM+LK++GY +KLGSGVAAASAYL N  P+IPSRI
Sbjct  294  VFRIGHVGNLNELQLLGCLAGVEMILKEVGYLLKLGSGVAAASAYLLNNVPLIPSRI  350



>ref|XP_003615391.1| Alanine glyoxylate aminotransferase [Medicago truncatula]
 gb|AES98349.1| serine-glyoxylate aminotransferase-like protein [Medicago truncatula]
Length=343

 Score =   313 bits (801),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 168/236 (71%), Positives = 189/236 (80%), Gaps = 19/236 (8%)
 Frame = -1

Query  777  YQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA  598
            YQHP+L++VD VSSI A+DFRMDEWGVDV +T SQKALSL TG+GIVCA PKA+EASK+A
Sbjct  127  YQHPSLIIVDAVSSIGALDFRMDEWGVDVVVTSSQKALSLSTGMGIVCAGPKAIEASKSA  186

Query  597  KSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTAT  418
             S+R FFDW  YLK Y +GTYWPYTPSIQLLYGLRA LDL+FEEG +NVI RH       
Sbjct  187  TSLRSFFDWNGYLKCYNLGTYWPYTPSIQLLYGLRAALDLVFEEGFENVILRH-------  239

Query  417  RLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKV  238
            +L V            EW+S +VTA+V P  IDS EIV RAWKR NLSLG GLNKVAGKV
Sbjct  240  KLVV------------EWYSASVTAIVGPPNIDSGEIVSRAWKRCNLSLGGGLNKVAGKV  287

Query  237  FRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  70
            FRIGH+G+LNELQLLGCLAGVEM LKD+GYPV+LGSGVAAASAYL N  P+IPSRI
Sbjct  288  FRIGHVGHLNELQLLGCLAGVEMTLKDVGYPVQLGSGVAAASAYLLNNVPIIPSRI  343



>ref|XP_001763095.1| predicted protein [Physcomitrella patens]
 gb|EDQ71972.1| predicted protein [Physcomitrella patens]
Length=402

 Score =   313 bits (801),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 165/236 (70%), Positives = 196/236 (83%), Gaps = 1/236 (0%)
 Frame = -1

Query  774  QHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAK  595
            +HPALLLVDGVSS+ A+DFRMD+WGVDVALTGSQKALSLPTG+GI+CAS KA+E SK AK
Sbjct  167  RHPALLLVDGVSSVGAMDFRMDDWGVDVALTGSQKALSLPTGLGILCASLKAIETSKQAK  226

Query  594  SVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLF-EEGLDNVIARHTRLGTAT  418
              R +FDW +YLK YK GTY PYTPS+QLLYGLRA LD++  +EGL+NVIARH RL  AT
Sbjct  227  YPRGYFDWAEYLKSYKAGTYSPYTPSVQLLYGLRASLDIILKQEGLENVIARHLRLAEAT  286

Query  417  RLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKV  238
            R AV+AWGL  C +K +W S  VT VVVPS +DS++++K AWK+YNLSLGLGL +V GKV
Sbjct  287  RRAVRAWGLTVCARKPQWDSAVVTGVVVPSSLDSNDVIKIAWKKYNLSLGLGLGEVNGKV  346

Query  237  FRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  70
            FRIGHLG +NELQLLG LAGVE+VL ++GYPV  GSGVAAA A+L   TP+I SR+
Sbjct  347  FRIGHLGYVNELQLLGALAGVELVLLEVGYPVIFGSGVAAAQAFLSKQTPIIASRL  402



>gb|EMT09291.1| Serine--glyoxylate aminotransferase [Aegilops tauschii]
Length=290

 Score =   297 bits (760),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 167/184 (91%), Positives = 172/184 (93%), Gaps = 0/184 (0%)
 Frame = -1

Query  621  ALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIAR  442
               A+KTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQLLYGLRAGLDLLFEEGLDNVI R
Sbjct  107  GFSAAKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQLLYGLRAGLDLLFEEGLDNVIKR  166

Query  441  HTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLG  262
            HTRLGTATRLAV AWGLKNCT KEE FSDTVTAVVVP YIDSSEIVK AWKRYNLSLGLG
Sbjct  167  HTRLGTATRLAVAAWGLKNCTAKEENFSDTVTAVVVPPYIDSSEIVKHAWKRYNLSLGLG  226

Query  261  LNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  82
            LNKVAGKVFRIGHLG+LNELQLLGCL G EMVLKDIGYPVKLGSGVAAA+AYL N+TP+I
Sbjct  227  LNKVAGKVFRIGHLGHLNELQLLGCLGGGEMVLKDIGYPVKLGSGVAAAAAYLSNSTPLI  286

Query  81   PSRI  70
            PSRI
Sbjct  287  PSRI  290



>gb|AEA48973.1| glyoxylate aminotransferase [Rosa roxburghii]
Length=168

 Score =   290 bits (741),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 147/167 (88%), Positives = 160/167 (96%), Gaps = 0/167 (0%)
 Frame = -1

Query  570  KDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGL  391
            ++YLKFYK+GTYWPYTPSIQLLYGLRA LDLLFEEGLDNVIARH+RLG ATR AV+AWGL
Sbjct  2    ENYLKFYKLGTYWPYTPSIQLLYGLRAALDLLFEEGLDNVIARHSRLGKATRHAVEAWGL  61

Query  390  KNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNL  211
            KNCTQKEEW SDTVTAV+VP YIDS+EIV+RAWKRYNLSLGLGLNK+AGKVFRIGHLGNL
Sbjct  62   KNCTQKEEWVSDTVTAVLVPPYIDSTEIVRRAWKRYNLSLGLGLNKIAGKVFRIGHLGNL  121

Query  210  NELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  70
            NELQLLGCLAGVEMVL+D+GYPVKLGSGVAAASAYLQN  P+IPSR+
Sbjct  122  NELQLLGCLAGVEMVLRDVGYPVKLGSGVAAASAYLQNNIPLIPSRV  168



>tpg|DAA47890.1| TPA: hypothetical protein ZEAMMB73_424946 [Zea mays]
Length=159

 Score =   270 bits (689),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 137/159 (86%), Positives = 148/159 (93%), Gaps = 0/159 (0%)
 Frame = -1

Query  546  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  367
            MGTYWPYTPSIQLLYGLR  LDL+FEEGLDNV+ RH RLGTATRLAV+AWGL NC QKEE
Sbjct  1    MGTYWPYTPSIQLLYGLRTALDLIFEEGLDNVVRRHNRLGTATRLAVEAWGLSNCCQKEE  60

Query  366  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  187
            WFSD VTAVVVP  IDS+E+V+ AWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC
Sbjct  61   WFSDIVTAVVVPPNIDSAEVVRHAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  120

Query  186  LAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  70
            L+GVEMVLKD+GYPVKLGSGVAAA+AYL N+TP+IPSRI
Sbjct  121  LSGVEMVLKDVGYPVKLGSGVAAAAAYLSNSTPLIPSRI  159



>gb|ABR26184.1| serine-glyoxylate aminotransferase [Oryza sativa Indica Group]
Length=152

 Score =   258 bits (658),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 134/152 (88%), Positives = 144/152 (95%), Gaps = 0/152 (0%)
 Frame = -1

Query  525  TPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVT  346
            TPSIQLLYGLR  LDL+FEEGL+NVI RH RLGTATRLAV+AWGLKNCTQKEEWFSDTVT
Sbjct  1    TPSIQLLYGLRTALDLIFEEGLENVIKRHNRLGTATRLAVEAWGLKNCTQKEEWFSDTVT  60

Query  345  AVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMV  166
            AVVVP YIDS+EIVK AWKRYNLSLGLGLNKVAGKVFRIGHLG+LNELQL+G L+GVEMV
Sbjct  61   AVVVPPYIDSAEIVKHAWKRYNLSLGLGLNKVAGKVFRIGHLGHLNELQLMGALSGVEMV  120

Query  165  LKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  70
            LKDIGYPVKLGSGVAAA+AYL N+TP+IPSRI
Sbjct  121  LKDIGYPVKLGSGVAAAAAYLSNSTPLIPSRI  152



>ref|WP_040580464.1| serine--glyoxylate aminotransferase [Methyloferula stellata]
Length=404

 Score =   266 bits (679),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 137/231 (59%), Positives = 172/231 (74%), Gaps = 1/231 (0%)
 Frame = -1

Query  774  QHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAK  595
            +HPALL VDGVSSI  IDFRMDEWGVD+A+ GSQK   LP G+ IV AS KALEA  TAK
Sbjct  170  KHPALLYVDGVSSIGCIDFRMDEWGVDLAVAGSQKGFMLPAGLAIVGASQKALEARHTAK  229

Query  594  SVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATR  415
              RVFF+++D +K    G Y+PYTPS+ LLYGLR  + ++FEEG +NV  RH  L +  R
Sbjct  230  CARVFFNFEDMIKSNATG-YFPYTPSLPLLYGLRESMKMMFEEGQENVFQRHHYLASGVR  288

Query  414  LAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVF  235
             AV AWGLKNC  + +WFSDTVTA+VVP   + ++++  A++RYNL+LG GL KVAGKVF
Sbjct  289  AAVSAWGLKNCATEPKWFSDTVTAIVVPEGFNGADVIATAYRRYNLALGAGLAKVAGKVF  348

Query  234  RIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  82
            RIGHLG+LNEL +LG LAG EM + DIG  ++ GSGVAAA  Y +++  +I
Sbjct  349  RIGHLGDLNELMVLGALAGAEMSMLDIGIKIEPGSGVAAAQNYFRSSNSVI  399



>dbj|BAQ18801.1| serine-glyoxylate aminotransferase [Methyloceanibacter caenitepidi]
Length=372

 Score =   265 bits (676),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 132/234 (56%), Positives = 174/234 (74%), Gaps = 1/234 (0%)
 Frame = -1

Query  771  HPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKS  592
            HPALL VDGVSSI +IDFR DEWGVD+A+TGSQK + LP G+GIVCASPKAL    TA  
Sbjct  137  HPALLYVDGVSSIGSIDFRFDEWGVDLAITGSQKGMMLPAGLGIVCASPKALARMDTATC  196

Query  591  VRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRL  412
             R +F+  D+ K    G Y+PYTP++ LLYGLR  L ++FEEGLDN+ ARH  L + TR 
Sbjct  197  TRAYFNLADHFK-ANAGGYFPYTPALPLLYGLRESLAMMFEEGLDNIFARHRYLASGTRA  255

Query  411  AVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFR  232
            AV AWGL  C ++ +W SDTV+A++VP+  + ++++ RA++RYNL+LG GL++VAGK+FR
Sbjct  256  AVDAWGLSLCAKEPKWQSDTVSAIMVPAGFNGADVIDRAYRRYNLALGAGLSEVAGKLFR  315

Query  231  IGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  70
            IGHLG+LNEL LLG ++G EM ++D+G  V+ GSGVAAA  Y +N       R+
Sbjct  316  IGHLGDLNELMLLGAISGAEMSMRDVGIQVEPGSGVAAAQEYFRNAHGAADQRL  369



>gb|ABS86859.1| alanine glyoxylate aminotransferase [Phaseolus vulgaris]
Length=149

 Score =   256 bits (654),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 131/149 (88%), Positives = 143/149 (96%), Gaps = 0/149 (0%)
 Frame = -1

Query  714  MDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTY  535
            MDEWGVDVA+TGSQKALSLPTGIGIV A P+A+EASKTAKS+RVFFDWKDYLKFY++GTY
Sbjct  1    MDEWGVDVAITGSQKALSLPTGIGIVVAGPRAIEASKTAKSLRVFFDWKDYLKFYQLGTY  60

Query  534  WPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSD  355
            WPYTPSI LLYGLRA LDL+FEEGL+NVIARH RLGTATRLAV+AWGLKNCT+KEEW SD
Sbjct  61   WPYTPSIHLLYGLRAALDLVFEEGLENVIARHNRLGTATRLAVEAWGLKNCTEKEEWHSD  120

Query  354  TVTAVVVPSYIDSSEIVKRAWKRYNLSLG  268
            TVTAVVVPSYIDS+EIV+RAWKRYNLSLG
Sbjct  121  TVTAVVVPSYIDSAEIVRRAWKRYNLSLG  149



>ref|WP_036260471.1| serine--glyoxylate aminotransferase [Methylocapsa aurea]
Length=412

 Score =   263 bits (672),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 134/225 (60%), Positives = 171/225 (76%), Gaps = 1/225 (0%)
 Frame = -1

Query  774  QHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAK  595
             HPALL VDGVSSI ++DFR DEW VD+A+ GSQK L LP G+GIVCASP+ALEASKTA 
Sbjct  162  NHPALLFVDGVSSIGSLDFRTDEWRVDLAIAGSQKGLMLPAGLGIVCASPRALEASKTAG  221

Query  594  SVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATR  415
              RVFFD+ D +K    G Y+PYTP++ +LYGLR  L +LFEE L++V  RH  L    R
Sbjct  222  LKRVFFDFNDMIKANATG-YFPYTPALPMLYGLRESLKILFEEKLEHVFERHHVLAGGVR  280

Query  414  LAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVF  235
             AV+AWGLK C  + +W+SDTVTA+VVP  I+ ++++  A++RYNLSLG GL++VAGKVF
Sbjct  281  AAVKAWGLKPCATEPKWYSDTVTAIVVPPGINGADVIDAAYRRYNLSLGAGLSQVAGKVF  340

Query  234  RIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQ  100
            RIGHLG+LN+L +LG + G EM + D+G  VKLGSGV AA A+ +
Sbjct  341  RIGHLGDLNDLMVLGAIGGAEMAMADVGIDVKLGSGVGAAQAHFR  385



>gb|ABS86860.1| alanine glyoxylate aminotransferase [Phaseolus vulgaris]
Length=149

 Score =   254 bits (648),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 130/149 (87%), Positives = 142/149 (95%), Gaps = 0/149 (0%)
 Frame = -1

Query  714  MDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTY  535
            MDEWGVDVA+TGSQKALSLPTGIGIV A P+A+EASKTAKS+RVFFDWKDYLKFY++GTY
Sbjct  1    MDEWGVDVAITGSQKALSLPTGIGIVVAGPRAIEASKTAKSLRVFFDWKDYLKFYQLGTY  60

Query  534  WPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSD  355
            WPYTPSI LLYGLRA LDL+FEEGL+NVIARH RLGTAT LAV+AWGLKNCTQKEEW SD
Sbjct  61   WPYTPSIHLLYGLRAALDLVFEEGLENVIARHNRLGTATGLAVEAWGLKNCTQKEEWHSD  120

Query  354  TVTAVVVPSYIDSSEIVKRAWKRYNLSLG  268
            TVTAV+VPSYIDS+EIV+RAWKRYNLSLG
Sbjct  121  TVTAVIVPSYIDSAEIVRRAWKRYNLSLG  149



>dbj|BAQ46928.1| serine--glyoxylate aminotransferase [Methylobacterium aquaticum]
Length=396

 Score =   261 bits (668),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 134/226 (59%), Positives = 175/226 (77%), Gaps = 1/226 (0%)
 Frame = -1

Query  771  HPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKS  592
            HPA+L VDGVS+I +IDFR +EW VD A+TGSQK L LP G+GIVCAS +ALEASKTA+ 
Sbjct  168  HPAMLFVDGVSAIGSIDFRAEEWRVDCAITGSQKGLMLPAGLGIVCASKRALEASKTAEC  227

Query  591  VRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRL  412
             RVFFD+ D  K    G Y+PYTP++ +LYGLR  L  + +EGL+NV ARH RL  +TR 
Sbjct  228  RRVFFDFGDQAKANATG-YFPYTPALPMLYGLREALRCVEDEGLENVFARHRRLADSTRA  286

Query  411  AVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFR  232
            AV+AWGL  C ++E+W+SDTV+AV+VP  ++ +E++  A+KRYNL+LG GL++VAGK+FR
Sbjct  287  AVEAWGLTLCAKEEKWYSDTVSAVMVPDGVNGAEVIDIAYKRYNLALGAGLSQVAGKLFR  346

Query  231  IGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNT  94
            IGH+G+LNEL LLG LAGVEM + D G  ++ GSGVAAA   L+ +
Sbjct  347  IGHIGDLNELMLLGALAGVEMAMLDAGIRIEPGSGVAAAQKSLRGS  392



>ref|XP_005709273.1| serine--glyoxylate transaminase [Galdieria sulphuraria]
 gb|EME32753.1| serine--glyoxylate transaminase [Galdieria sulphuraria]
Length=400

 Score =   260 bits (664),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 135/232 (58%), Positives = 172/232 (74%), Gaps = 1/232 (0%)
 Frame = -1

Query  777  YQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA  598
            Y HPALL+VDGVSSI +I F+MDEW VD+A+TGSQK L LP G+G+VCAS KALE SK  
Sbjct  163  YHHPALLMVDGVSSIASIPFKMDEWKVDLAITGSQKGLMLPAGLGMVCASEKALERSKKN  222

Query  597  KSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTAT  418
               RVFF ++D +    +G Y+PYTPSI LLYGL+  L +L EEGL++V  RH RL    
Sbjct  223  NLHRVFFSFEDMIVNNDVG-YFPYTPSIPLLYGLKESLAMLMEEGLESVYVRHRRLAHGV  281

Query  417  RLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKV  238
            R AV+AWGLK C +  + +SDTVTAVVVP   D+ ++++ A+++YNLSLG GL KV G+V
Sbjct  282  RRAVEAWGLKTCCKNPKEYSDTVTAVVVPEGFDAQQVIRIAYEKYNLSLGAGLMKVRGRV  341

Query  237  FRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  82
            FRIGHLG+LNEL +L  LAG EM + ++G P+KLGSGVAAAS Y   T+  +
Sbjct  342  FRIGHLGDLNELMVLATLAGTEMAMLEVGIPIKLGSGVAAASEYYMKTSKQV  393



>ref|WP_024878012.1| MULTISPECIES: serine--glyoxylate aminotransferase [Methylocystaceae]
Length=397

 Score =   259 bits (662),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 133/222 (60%), Positives = 171/222 (77%), Gaps = 1/222 (0%)
 Frame = -1

Query  774  QHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAK  595
            +HPA+L VDGVSS+ ++DF+ DEWGVDVA++GSQK   LP G+ I+  S KAL+A +TAK
Sbjct  167  KHPAMLFVDGVSSVGSLDFKQDEWGVDVAVSGSQKGFMLPAGLAIMSVSQKALKAGETAK  226

Query  594  SVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATR  415
              R +FD++D++K    G Y+PYTP++ LLYGLR  L++LFEEGLD V ARH  L    R
Sbjct  227  LHRAYFDFQDHVKANATG-YFPYTPALPLLYGLRESLNVLFEEGLDQVYARHHHLAEGVR  285

Query  414  LAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVF  235
             AV AWGLK C ++ +W SDTVTA+VVP   D++++++ A+KRYNL+LG GLNKVAGKVF
Sbjct  286  AAVAAWGLKPCAKEAKWNSDTVTAIVVPEGFDAAKVIEIAYKRYNLALGAGLNKVAGKVF  345

Query  234  RIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASA  109
            RIGHLG+LNEL LLG +AG EM + D+G PV  GSGVAAA A
Sbjct  346  RIGHLGDLNELMLLGAIAGAEMAMLDVGIPVTAGSGVAAAQA  387



>ref|WP_018267457.1| serine--glyoxylate aminotransferase [Methylosinus sp. LW4]
Length=397

 Score =   259 bits (661),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 133/222 (60%), Positives = 171/222 (77%), Gaps = 1/222 (0%)
 Frame = -1

Query  774  QHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAK  595
            +HPALL VDGVSS+ ++DF+ DEWGVDVA++GSQK   LP G+ ++  S KAL+A +TAK
Sbjct  167  KHPALLFVDGVSSVGSLDFKQDEWGVDVAVSGSQKGFMLPAGLALLSVSQKALKAGETAK  226

Query  594  SVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATR  415
              R +FD++D++K    G Y+PYTP++ LLYGLR  L++LFEEGLD V ARH  L    R
Sbjct  227  LHRAYFDFQDHVKANATG-YFPYTPALPLLYGLRESLNVLFEEGLDQVYARHHHLAEGVR  285

Query  414  LAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVF  235
             AV AWGLK C ++ +W SDTVTA+VVP   D++++++ A+KRYNL+LG GLNKVAGKVF
Sbjct  286  AAVAAWGLKPCAKEAKWNSDTVTAIVVPEGFDAAKVIEIAYKRYNLALGAGLNKVAGKVF  345

Query  234  RIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASA  109
            RIGHLG+LNEL LLG +AG EM + D+G PV  GSGVAAA A
Sbjct  346  RIGHLGDLNELMLLGAIAGAEMAMLDVGIPVTAGSGVAAAQA  387



>ref|WP_036293367.1| serine--glyoxylate aminotransferase [Methylosinus sp. PW1]
Length=397

 Score =   259 bits (661),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 133/222 (60%), Positives = 171/222 (77%), Gaps = 1/222 (0%)
 Frame = -1

Query  774  QHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAK  595
            +HPALL VDGVSS+ ++DF+ DEWGVDVA++GSQK   LP G+ ++  S KAL+A +TAK
Sbjct  167  KHPALLFVDGVSSVGSLDFKQDEWGVDVAVSGSQKGFMLPAGLALLSVSQKALKAGETAK  226

Query  594  SVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATR  415
              R +FD++D++K    G Y+PYTP++ LLYGLR  L++LFEEGLD V ARH  L    R
Sbjct  227  LHRAYFDFQDHVKANATG-YFPYTPALPLLYGLRESLNVLFEEGLDQVYARHHHLAEGVR  285

Query  414  LAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVF  235
             AV AWGLK C ++ +W SDTVTA+VVP   D++++++ A+KRYNL+LG GLNKVAGKVF
Sbjct  286  AAVAAWGLKPCAKEAKWNSDTVTAIVVPEGFDAAKVIEIAYKRYNLALGAGLNKVAGKVF  345

Query  234  RIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASA  109
            RIGHLG+LNEL LLG +AG EM + D+G PV  GSGVAAA A
Sbjct  346  RIGHLGDLNELMLLGAIAGAEMAMLDVGIPVTAGSGVAAAQA  387



>ref|XP_011399157.1| Serine-glyoxylate aminotransferase [Auxenochlorella protothecoides]
 gb|KFM26261.1| Serine-glyoxylate aminotransferase [Auxenochlorella protothecoides]
Length=377

 Score =   257 bits (656),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 142/233 (61%), Positives = 172/233 (74%), Gaps = 1/233 (0%)
 Frame = -1

Query  771  HPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKS  592
            HPALL+VDGVSS+ A+ F+ D+W VDVA+TGSQKALSLPTG+GIV AS KAL+A  +AK 
Sbjct  141  HPALLMVDGVSSVGALPFKFDDWRVDVAVTGSQKALSLPTGLGIVAASDKALDARSSAKL  200

Query  591  VRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRL  412
             RV+F + D LK  K G   PYTP + LL+GL+A L LL  EGLDNV ARH RL   TR 
Sbjct  201  KRVYFSFDDMLKTNKNGGV-PYTPILPLLHGLKASLGLLNAEGLDNVFARHHRLAEGTRA  259

Query  411  AVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFR  232
            AV AWGLK   ++  W SDT+T V VP  +DS +IV  A+ +YNLSLGLGL +V GKVFR
Sbjct  260  AVAAWGLKLLCREPRWQSDTLTVVEVPEGLDSQKIVDTAFAKYNLSLGLGLAEVQGKVFR  319

Query  231  IGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSR  73
            IGHLGN++EL L G L GVEM L+D+G P++LGSGV AA    Q  TP+IP+R
Sbjct  320  IGHLGNMDELMLAGALGGVEMTLRDVGLPIELGSGVGAALKVWQEGTPVIPTR  372



>ref|WP_026608295.1| serine--glyoxylate aminotransferase [Methylocapsa acidiphila]
Length=412

 Score =   256 bits (654),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 128/227 (56%), Positives = 173/227 (76%), Gaps = 1/227 (0%)
 Frame = -1

Query  774  QHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAK  595
             HPALL VDGVSSI ++DFR DEW VD+A+ GSQK L LP G+GIVCASP+AL A+KTA 
Sbjct  162  NHPALLYVDGVSSIGSLDFRADEWRVDLAIAGSQKGLMLPAGLGIVCASPRALAATKTAG  221

Query  594  SVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATR  415
              RV+FD+ D +K    G Y+PYTP++ +LYGLR  + +LFEE L++V  RH  L    R
Sbjct  222  LKRVYFDFADMIKANATG-YFPYTPALPMLYGLRESMRILFEEKLEHVFERHHVLAGGVR  280

Query  414  LAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVF  235
             AV+AWGL  C ++ +W SDTVTA+VVP+ I+ ++++  A++RYNLSLG GL++VAGKVF
Sbjct  281  AAVKAWGLHPCAKEAKWDSDTVTAIVVPAGINGADVIDTAYRRYNLSLGAGLSQVAGKVF  340

Query  234  RIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNT  94
            RIGHLG+LN+L +LG +AG EM ++D+G  ++LGSGV AA  + ++T
Sbjct  341  RIGHLGDLNDLMVLGAIAGAEMAMRDVGIDIQLGSGVGAAQEHFRST  387



>ref|WP_026610206.1| serine--glyoxylate aminotransferase [Methylocaldum szegediense]
Length=394

 Score =   255 bits (651),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 133/234 (57%), Positives = 167/234 (71%), Gaps = 1/234 (0%)
 Frame = -1

Query  774  QHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAK  595
             HPA+  VDGVSSI +IDFRMDEWG+D+ L GSQK   LP G+ ++C S KALEA  TAK
Sbjct  162  NHPAMFFVDGVSSIASIDFRMDEWGIDIGLAGSQKGFMLPAGLALLCFSQKALEARHTAK  221

Query  594  SVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATR  415
            S R F D +D++     G Y+PYTPSI LLYGLR  +DLL EEGL NV ARH RL    R
Sbjct  222  SRRCFLDIQDHITNNASG-YFPYTPSIPLLYGLRKAIDLLLEEGLQNVFARHQRLAEGVR  280

Query  414  LAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVF  235
             AV+AWGL+ C +  +W+S+TV+A+VVP   D+ +++  A+ RYNLSLG GL++VAGKVF
Sbjct  281  RAVKAWGLELCARDPKWYSNTVSAIVVPQGYDARDVMHYAYHRYNLSLGAGLSEVAGKVF  340

Query  234  RIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSR  73
            RIGHLG+LNEL L   +AG EM ++D+G  V  GSGVAAA  Y + T P +  R
Sbjct  341  RIGHLGDLNELMLCSAIAGAEMAMRDVGIQVTPGSGVAAACEYWRETAPAVKPR  394



>ref|WP_003613273.1| serine--glyoxylate aminotransferase [Methylosinus trichosporium]
Length=397

 Score =   254 bits (650),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 130/222 (59%), Positives = 171/222 (77%), Gaps = 1/222 (0%)
 Frame = -1

Query  774  QHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAK  595
            +HPA+L VDGVSS+ ++DF+ DEWGVDVA++GSQK   LP G+ ++  S KAL+A +TAK
Sbjct  167  KHPAMLFVDGVSSVGSLDFKQDEWGVDVAVSGSQKGFMLPAGLALLSVSQKALKAGETAK  226

Query  594  SVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATR  415
              R +FD++D++K    G Y+PYTP++ LLYGLR  L++LFEEGLD V ARH  L    R
Sbjct  227  LHRAYFDFQDHVKANATG-YFPYTPALPLLYGLRESLNVLFEEGLDQVYARHHHLAEGVR  285

Query  414  LAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVF  235
             AV AWGLK C ++ +W SDTVTA++VP   D++++++ A+KRYNL+LG GL+KVAGKVF
Sbjct  286  AAVAAWGLKPCAKESKWNSDTVTAILVPEGFDAAKVIEIAYKRYNLALGAGLSKVAGKVF  345

Query  234  RIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASA  109
            RIGHLG+LNEL LLG +AG EM + D+G PV  GSGVAAA A
Sbjct  346  RIGHLGDLNELMLLGAIAGAEMAMLDVGIPVTPGSGVAAAQA  387



>ref|XP_002953765.1| hypothetical protein VOLCADRAFT_75980 [Volvox carteri f. nagariensis]
 gb|EFJ45089.1| hypothetical protein VOLCADRAFT_75980 [Volvox carteri f. nagariensis]
Length=449

 Score =   256 bits (653),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 135/234 (58%), Positives = 172/234 (74%), Gaps = 1/234 (0%)
 Frame = -1

Query  774  QHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAK  595
             HPALLLVDGVSSI A++FRMD+W VDVA+TGSQKALSLPTG+  V ASPKALEA K+AK
Sbjct  212  NHPALLLVDGVSSIGALEFRMDDWRVDVAVTGSQKALSLPTGLAFVAASPKALEAMKSAK  271

Query  594  SVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATR  415
              RV++D+ D L+    G   PYTPS+ +LYG+R  + +L EEG++NV ARH RLG   R
Sbjct  272  LKRVYYDFADMLRTNPSGNV-PYTPSLAMLYGMRESIKMLREEGMENVFARHHRLGEGAR  330

Query  414  LAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVF  235
             AV+ WGLK   +   W SD++T V VP  IDS++IVK A+ +Y+LSLG+GL ++ GKVF
Sbjct  331  RAVEGWGLKLLCKNPRWRSDSLTVVEVPEGIDSNKIVKVAYAKYDLSLGIGLAQINGKVF  390

Query  234  RIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSR  73
            RIGHLGN+NEL L+  LAG EM + D G P++ GSGV  A  Y Q T+ +I +R
Sbjct  391  RIGHLGNMNELMLVSALAGAEMAMIDAGVPIRPGSGVGKAIEYWQQTSSVIKTR  444



>ref|WP_035525480.1| serine--glyoxylate aminotransferase [Burkholderia sacchari]
 gb|KHD21372.1| serine--glyoxylate aminotransferase [Burkholderia sacchari]
Length=418

 Score =   254 bits (649),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 133/231 (58%), Positives = 171/231 (74%), Gaps = 2/231 (1%)
 Frame = -1

Query  774  QHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAK  595
             HPALL VDGVSSI  IDFRMD+W VD+A+TGSQK L LP G+GI+C SPKAL+A +TAK
Sbjct  170  HHPALLFVDGVSSIGCIDFRMDDWRVDLAVTGSQKGLMLPAGLGILCVSPKALKAIETAK  229

Query  594  SVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATR  415
            S R +FD  D +K    G Y+PYTP++ LLYGLR  LDL+F+EGLDNV ARH  L    R
Sbjct  230  SKRCYFDLGDMIKANATG-YFPYTPALSLLYGLRTALDLIFQEGLDNVFARHHHLAQGVR  288

Query  414  LAV-QAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKV  238
             AV + WGL+ C +  +W+SDTV+A+VVP   +++ ++ RA++RYNL+LG GL+KVAGKV
Sbjct  289  AAVTEGWGLELCAKGPKWYSDTVSAIVVPQGFNAANVIDRAFRRYNLALGAGLSKVAGKV  348

Query  237  FRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPM  85
            FRIGHLG+LNEL L   +AG EM + D+G  V+ GSG  AA+ Y +   P+
Sbjct  349  FRIGHLGDLNELMLTSAIAGAEMAMLDVGIDVRPGSGTGAATQYWRTHDPL  399



>ref|WP_012590731.1| serine--glyoxylate aminotransferase [Methylocella silvestris]
 gb|ACK50661.1| aminotransferase class V [Methylocella silvestris BL2]
Length=396

 Score =   253 bits (647),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 127/229 (55%), Positives = 169/229 (74%), Gaps = 1/229 (0%)
 Frame = -1

Query  771  HPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKS  592
            HPALL VD VSS+ ++DFR DEWGVD+A++GSQK L LP G+G++  S KAL ASKTA S
Sbjct  163  HPALLFVDAVSSLGSLDFRQDEWGVDLAVSGSQKGLMLPAGLGVLGVSQKALAASKTATS  222

Query  591  VRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRL  412
             R +FD+ D +K    G Y+PYTP + LLYGLR  L ++ +EGL+N+  RH+ L    R 
Sbjct  223  KRCYFDFDDMIKANATG-YFPYTPPLPLLYGLRESLKMIEDEGLENIFVRHSHLAGGVRA  281

Query  411  AVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFR  232
            AV+AWGL  C ++ +W+SDTVTA+VVP   ++ +++  A+ RYNLSLG GL++VAGKVFR
Sbjct  282  AVKAWGLTPCAKEPKWYSDTVTAIVVPPQFNAVQVISTAYSRYNLSLGAGLSQVAGKVFR  341

Query  231  IGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPM  85
            IGHLG+LNEL +LG LAG EM + D+G PV LGSGV AA ++ +   P+
Sbjct  342  IGHLGDLNELMVLGALAGAEMAMADVGIPVTLGSGVGAAQSFYRAAAPV  390



>gb|AGN53916.1| glyoxylate aminotransferase, partial [Silene latifolia]
Length=141

 Score =   244 bits (622),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 126/141 (89%), Positives = 134/141 (95%), Gaps = 0/141 (0%)
 Frame = -1

Query  702  GVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYT  523
            GVDVALTGSQKALSLPTG+GI+CASPKALEA+KTAKSVRVFFDW DYLKFYKMGTYWPYT
Sbjct  1    GVDVALTGSQKALSLPTGMGIICASPKALEATKTAKSVRVFFDWNDYLKFYKMGTYWPYT  60

Query  522  PSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTA  343
            PSIQLLYGLRA LDL+FEEGLDNVIARH RL  ATRLAV+AWGLKNC QKEEWFSDTVTA
Sbjct  61   PSIQLLYGLRAALDLIFEEGLDNVIARHGRLAKATRLAVEAWGLKNCAQKEEWFSDTVTA  120

Query  342  VVVPSYIDSSEIVKRAWKRYN  280
            V+VP YI+SS+IVKRAWKRYN
Sbjct  121  VIVPPYIESSDIVKRAWKRYN  141



>gb|AGN53915.1| glyoxylate aminotransferase, partial [Silene latifolia]
Length=141

 Score =   243 bits (620),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 126/141 (89%), Positives = 133/141 (94%), Gaps = 0/141 (0%)
 Frame = -1

Query  702  GVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYT  523
            GVDVALTGSQKALSLPTG+GI+CAS KALEA+KTAKSVRVFFDW DYLKFYKMGTYWPYT
Sbjct  1    GVDVALTGSQKALSLPTGMGIICASAKALEATKTAKSVRVFFDWNDYLKFYKMGTYWPYT  60

Query  522  PSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTA  343
            PSIQLLYGLRA LDL+FEEGLDNVIARH RL  ATRLAV+AWGLKNC QKEEWFSDTVTA
Sbjct  61   PSIQLLYGLRAALDLIFEEGLDNVIARHGRLAKATRLAVEAWGLKNCAQKEEWFSDTVTA  120

Query  342  VVVPSYIDSSEIVKRAWKRYN  280
            VV+P YIDS+EIVKRAWKRYN
Sbjct  121  VVIPPYIDSAEIVKRAWKRYN  141



>gb|AGN53900.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53924.1| glyoxylate aminotransferase, partial [Silene latifolia]
Length=141

 Score =   243 bits (619),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 126/141 (89%), Positives = 134/141 (95%), Gaps = 0/141 (0%)
 Frame = -1

Query  702  GVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYT  523
            GVDVALTGSQKALSLPTG+GIVCASPKALEA+KTAKSVRVFFDW DYLKFYKMGTYWPYT
Sbjct  1    GVDVALTGSQKALSLPTGMGIVCASPKALEATKTAKSVRVFFDWNDYLKFYKMGTYWPYT  60

Query  522  PSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTA  343
            PSIQLLYGLRA LDL+FEEGLDNVIARH RL  ATRLAV+AWGLKNC QKEEWFSDTVTA
Sbjct  61   PSIQLLYGLRAALDLIFEEGLDNVIARHGRLAKATRLAVEAWGLKNCAQKEEWFSDTVTA  120

Query  342  VVVPSYIDSSEIVKRAWKRYN  280
            V+VP YI+SS+IVK+AWKRYN
Sbjct  121  VIVPPYIESSDIVKKAWKRYN  141



>gb|AGN53917.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53918.1| glyoxylate aminotransferase, partial [Silene latifolia]
Length=141

 Score =   243 bits (619),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 125/141 (89%), Positives = 134/141 (95%), Gaps = 0/141 (0%)
 Frame = -1

Query  702  GVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYT  523
            GVDVALTGSQKALSLPTG+GI+CASPKALEA+KTAKSVRVFFDW DYLKFYKMGTYWPYT
Sbjct  1    GVDVALTGSQKALSLPTGMGIICASPKALEATKTAKSVRVFFDWNDYLKFYKMGTYWPYT  60

Query  522  PSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTA  343
            PSIQLLYGLRA LDL+FEEGLDNVI+RH RL  ATRLAV+AWGLKNC QKEEWFSDTVTA
Sbjct  61   PSIQLLYGLRAALDLIFEEGLDNVISRHGRLAKATRLAVEAWGLKNCAQKEEWFSDTVTA  120

Query  342  VVVPSYIDSSEIVKRAWKRYN  280
            V+VP YI+SS+IVKRAWKRYN
Sbjct  121  VIVPPYIESSDIVKRAWKRYN  141



>gb|AGN53906.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53920.1| glyoxylate aminotransferase, partial [Silene latifolia]
Length=141

 Score =   242 bits (618),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 125/141 (89%), Positives = 134/141 (95%), Gaps = 0/141 (0%)
 Frame = -1

Query  702  GVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYT  523
            GVDVALTGSQKALSLPTG+GI+CASPKALEA+KTAKSVRVFFDW DYLKFYKMGTYWPYT
Sbjct  1    GVDVALTGSQKALSLPTGMGIICASPKALEATKTAKSVRVFFDWNDYLKFYKMGTYWPYT  60

Query  522  PSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTA  343
            PSIQLLYGLRA LDL+FEEGLDNVIARH RL  ATRLAV+AWGLKNC QKEEWFSDTVTA
Sbjct  61   PSIQLLYGLRAALDLIFEEGLDNVIARHGRLAKATRLAVEAWGLKNCAQKEEWFSDTVTA  120

Query  342  VVVPSYIDSSEIVKRAWKRYN  280
            V+VP YI+SS+IVK+AWKRYN
Sbjct  121  VIVPPYIESSDIVKKAWKRYN  141



>gb|AGN53895.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53896.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53901.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53902.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53905.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53913.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53925.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53926.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53927.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53928.1| glyoxylate aminotransferase, partial [Silene latifolia]
Length=141

 Score =   241 bits (616),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 125/141 (89%), Positives = 133/141 (94%), Gaps = 0/141 (0%)
 Frame = -1

Query  702  GVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYT  523
            GVDVALTGSQKALSLPTG+GI+CAS KALEA+KTAKSVRVFFDW DYLKFYKMGTYWPYT
Sbjct  1    GVDVALTGSQKALSLPTGMGIICASAKALEATKTAKSVRVFFDWNDYLKFYKMGTYWPYT  60

Query  522  PSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTA  343
            PSIQLLYGLRA LDL+FEEGLDNVIARH RL  ATRLAV+AWGLKNC QKEEWFSDTVTA
Sbjct  61   PSIQLLYGLRAALDLIFEEGLDNVIARHGRLAKATRLAVEAWGLKNCAQKEEWFSDTVTA  120

Query  342  VVVPSYIDSSEIVKRAWKRYN  280
            VV+P YIDS+EIVK+AWKRYN
Sbjct  121  VVIPPYIDSAEIVKKAWKRYN  141



>ref|WP_012405153.1| serine--glyoxylate aminotransferase [Burkholderia phymatum]
 gb|ACC74993.1| Serine--glyoxylate transaminase [Burkholderia phymatum STM815]
Length=421

 Score =   251 bits (641),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 135/230 (59%), Positives = 170/230 (74%), Gaps = 2/230 (1%)
 Frame = -1

Query  774  QHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAK  595
            +HPALL VDGVSSI  IDFRMDEWGVD+A+TGSQK L LP G+GI+C S KAL+A   AK
Sbjct  170  RHPALLFVDGVSSIGCIDFRMDEWGVDLAVTGSQKGLMLPAGLGILCVSQKALKAISHAK  229

Query  594  SVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATR  415
            S R +FD  D ++    G Y+PYTP++ LLYGLRA LDLLFEEGL+NV ARH  L    R
Sbjct  230  SRRCYFDLADMVRTNATG-YFPYTPALSLLYGLRAALDLLFEEGLENVFARHHYLAAGVR  288

Query  414  LAV-QAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKV  238
             AV + WGL+ C +   W SDTV+A+VVP  +++++++  A++RYNL+LG GL+KVAGKV
Sbjct  289  AAVTEGWGLELCAKAPRWHSDTVSAIVVPEGVNAAQVIDTAYRRYNLALGAGLSKVAGKV  348

Query  237  FRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTP  88
            FRIGHLG+LNEL L+  +AG EM + D G  V+ GSGV AA  Y +  TP
Sbjct  349  FRIGHLGDLNELMLMSAIAGAEMAMLDAGIDVRPGSGVGAAGQYWRTHTP  398



>emb|CAD13310.1| serine-glyoxylate aminotransferase [Methylobacterium extorquens 
DM4]
Length=379

 Score =   249 bits (637),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 134/231 (58%), Positives = 167/231 (72%), Gaps = 6/231 (3%)
 Frame = -1

Query  771  HPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEAS-----  607
            HPALL VDGVSSI ++ F+ DEW VD A+ GSQK L LP G+G++C S KAL+A+     
Sbjct  145  HPALLFVDGVSSIGSLPFKADEWKVDCAIAGSQKGLMLPAGLGVICVSQKALKAAEGQSG  204

Query  606  KTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLG  427
            +  +  RV+FDW+D  K    G Y+PYTP + LLYGLR  L  LFEEGL+NV  RH  LG
Sbjct  205  RNDRLARVYFDWEDQKKQNPTG-YFPYTPPLPLLYGLREALACLFEEGLENVYHRHAVLG  263

Query  426  TATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVA  247
             ATR AV AWGLK C +  EW SDTVTA++ P  +D+++I+K A+ RYNL+LG GL++VA
Sbjct  264  EATRQAVAAWGLKTCAKSPEWNSDTVTAILAPEGVDAAKIIKHAYVRYNLALGAGLSQVA  323

Query  246  GKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNT  94
            GKVFRIGH+G+LNEL LLG +AG EM L D G  V  GSGVAAAS+YL+  
Sbjct  324  GKVFRIGHVGDLNELSLLGAIAGAEMSLIDNGVKVTPGSGVAAASSYLREN  374



>gb|AFZ62596.1| serine-glyoxylate aminotransferase [Hyphomicrobium nitrativorans 
NL23]
 gb|AHB49532.1| serine--glyoxylate aminotransferase [Hyphomicrobium nitrativorans 
NL23]
Length=400

 Score =   250 bits (638),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 133/235 (57%), Positives = 169/235 (72%), Gaps = 4/235 (2%)
 Frame = -1

Query  774  QHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKT--  601
            +HPA+L VD VS + ++D RM EWGVD  ++GSQK   LPTG+GI+  S KAL+A+K+  
Sbjct  164  KHPAMLFVDSVSGVGSLDMRMGEWGVDCCVSGSQKGFMLPTGLGILAVSQKALDANKSLN  223

Query  600  AKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTA  421
             +  R FF W+D +K    G ++PYTP+ QL+ GLR  LDLLF EG+DNV ARHTRL + 
Sbjct  224  GRMNRCFFSWEDMIKTNDQG-FFPYTPATQLIRGLRTSLDLLFAEGIDNVFARHTRLASG  282

Query  420  TRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGK  241
             R AV AWGLK C ++ +W SDTV+A++VP  IDS+ +VK A+ RYN SLG+GLNKVAGK
Sbjct  283  VRAAVDAWGLKLCAKEPKWHSDTVSAILVPEGIDSANVVKTAYYRYNTSLGVGLNKVAGK  342

Query  240  VFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPS  76
            VFRIGHLG L+E  + G L  VEM LKD G PVKLGSG  AA+ Y  N  P+ P+
Sbjct  343  VFRIGHLGALDEYMIGGVLFSVEMALKDCGVPVKLGSGTGAAAEYFVN-NPVKPA  396



>ref|WP_041319044.1| serine--glyoxylate aminotransferase [Hyphomicrobium nitrativorans]
Length=397

 Score =   250 bits (638),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 133/235 (57%), Positives = 169/235 (72%), Gaps = 4/235 (2%)
 Frame = -1

Query  774  QHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKT--  601
            +HPA+L VD VS + ++D RM EWGVD  ++GSQK   LPTG+GI+  S KAL+A+K+  
Sbjct  161  KHPAMLFVDSVSGVGSLDMRMGEWGVDCCVSGSQKGFMLPTGLGILAVSQKALDANKSLN  220

Query  600  AKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTA  421
             +  R FF W+D +K    G ++PYTP+ QL+ GLR  LDLLF EG+DNV ARHTRL + 
Sbjct  221  GRMNRCFFSWEDMIKTNDQG-FFPYTPATQLIRGLRTSLDLLFAEGIDNVFARHTRLASG  279

Query  420  TRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGK  241
             R AV AWGLK C ++ +W SDTV+A++VP  IDS+ +VK A+ RYN SLG+GLNKVAGK
Sbjct  280  VRAAVDAWGLKLCAKEPKWHSDTVSAILVPEGIDSANVVKTAYYRYNTSLGVGLNKVAGK  339

Query  240  VFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPS  76
            VFRIGHLG L+E  + G L  VEM LKD G PVKLGSG  AA+ Y  N  P+ P+
Sbjct  340  VFRIGHLGALDEYMIGGVLFSVEMALKDCGVPVKLGSGTGAAAEYFVN-NPVKPA  393



>gb|AGN53914.1| glyoxylate aminotransferase, partial [Silene latifolia]
Length=141

 Score =   241 bits (615),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 125/141 (89%), Positives = 133/141 (94%), Gaps = 0/141 (0%)
 Frame = -1

Query  702  GVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYT  523
            GVDVALTGSQKALSLPTG+GI+CAS KALEA+KTAKSVRVFFDW DYLKFYKMGTYWPYT
Sbjct  1    GVDVALTGSQKALSLPTGMGIICASAKALEATKTAKSVRVFFDWNDYLKFYKMGTYWPYT  60

Query  522  PSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTA  343
            PSIQLLYGLRA LDL+FEEGLDNVIARH RL  ATRLAV+AWGLKNC QKEEWFSDTVTA
Sbjct  61   PSIQLLYGLRAALDLIFEEGLDNVIARHGRLAKATRLAVEAWGLKNCAQKEEWFSDTVTA  120

Query  342  VVVPSYIDSSEIVKRAWKRYN  280
            VV+P YIDSS+IVK+AWKRYN
Sbjct  121  VVIPPYIDSSDIVKKAWKRYN  141



>ref|WP_015933415.1| serine--glyoxylate aminotransferase [Methylobacterium nodulans]
 gb|ACL61852.1| aminotransferase class V [Methylobacterium nodulans ORS 2060]
Length=417

 Score =   250 bits (639),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 130/227 (57%), Positives = 167/227 (74%), Gaps = 1/227 (0%)
 Frame = -1

Query  774  QHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAK  595
             HPA+L VDGVSSI +IDFR  EWGVD A+TGSQK L LP G+GIVC SPKAL A KTA+
Sbjct  167  NHPAMLYVDGVSSIGSIDFRASEWGVDCAITGSQKGLMLPAGLGIVCVSPKALAAYKTAE  226

Query  594  SVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATR  415
              RV+FD+ D  K    G Y+PYTP++ LLYGLR  +  LFEEGL+ V  RH  L    R
Sbjct  227  CRRVYFDFGDMSKANATG-YFPYTPALPLLYGLRESMACLFEEGLERVFERHRVLADGCR  285

Query  414  LAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVF  235
             AV+AWGL  C ++ +W+SDTV+A++VP  I+ ++++  A++RYNL+LG GL+KVAGK+F
Sbjct  286  AAVKAWGLTLCAKEPKWYSDTVSAIMVPEGINGADVIDIAFRRYNLALGAGLSKVAGKLF  345

Query  234  RIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNT  94
            RIGHLG+LN+L LLG LAG EM + D G  ++ GSGVAAA  + + T
Sbjct  346  RIGHLGDLNDLMLLGALAGAEMSMLDAGIKIEPGSGVAAAQQHFRET  392



>ref|WP_003597639.1| serine--glyoxylate aminotransferase [Methylobacterium extorquens]
 sp|P55819.2|SGAA_METEA RecName: Full=Serine--glyoxylate aminotransferase; Short=SGAT 
[Methylobacterium extorquens AM1]
 gb|ACS39570.1| serine-glyoxylate aminotransferase (SGAT) [Methylobacterium extorquens 
AM1]
 emb|CAX24121.1| serine-glyoxylate aminotransferase (SGAT) [Methylobacterium extorquens 
DM4]
 gb|EHP94104.1| Serine--glyoxylate transaminase [Methylobacterium extorquens 
DSM 13060]
Length=402

 Score =   249 bits (637),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 134/231 (58%), Positives = 167/231 (72%), Gaps = 6/231 (3%)
 Frame = -1

Query  771  HPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEAS-----  607
            HPALL VDGVSSI ++ F+ DEW VD A+ GSQK L LP G+G++C S KAL+A+     
Sbjct  168  HPALLFVDGVSSIGSLPFKADEWKVDCAIAGSQKGLMLPAGLGVICVSQKALKAAEGQSG  227

Query  606  KTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLG  427
            +  +  RV+FDW+D  K    G Y+PYTP + LLYGLR  L  LFEEGL+NV  RH  LG
Sbjct  228  RNDRLARVYFDWEDQKKQNPTG-YFPYTPPLPLLYGLREALACLFEEGLENVYHRHAVLG  286

Query  426  TATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVA  247
             ATR AV AWGLK C +  EW SDTVTA++ P  +D+++I+K A+ RYNL+LG GL++VA
Sbjct  287  EATRQAVAAWGLKTCAKSPEWNSDTVTAILAPEGVDAAKIIKHAYVRYNLALGAGLSQVA  346

Query  246  GKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNT  94
            GKVFRIGH+G+LNEL LLG +AG EM L D G  V  GSGVAAAS+YL+  
Sbjct  347  GKVFRIGHVGDLNELSLLGAIAGAEMSLIDNGVKVTPGSGVAAASSYLREN  397



>gb|AGN53923.1| glyoxylate aminotransferase, partial [Silene latifolia]
Length=141

 Score =   241 bits (614),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 125/141 (89%), Positives = 133/141 (94%), Gaps = 0/141 (0%)
 Frame = -1

Query  702  GVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYT  523
            GVDVALTGSQKALSLPTG+GIVCAS KALEA+KTAKSVRVFFDW DYLKFYKMGTYWPYT
Sbjct  1    GVDVALTGSQKALSLPTGMGIVCASAKALEATKTAKSVRVFFDWNDYLKFYKMGTYWPYT  60

Query  522  PSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTA  343
            PSIQLLYGLRA LDL+FEEGLDNVIARH RL  ATRLAV+AWGLKNC QKEEWFSDTVTA
Sbjct  61   PSIQLLYGLRAALDLIFEEGLDNVIARHGRLAKATRLAVEAWGLKNCAQKEEWFSDTVTA  120

Query  342  VVVPSYIDSSEIVKRAWKRYN  280
            VV+P YIDS+EIVK+AWK+YN
Sbjct  121  VVIPPYIDSAEIVKKAWKKYN  141



>ref|WP_015950680.1| serine--glyoxylate aminotransferase [Methylobacterium extorquens]
 gb|ACK82978.1| aminotransferase class V [Methylobacterium extorquens CM4]
Length=402

 Score =   249 bits (636),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 134/231 (58%), Positives = 167/231 (72%), Gaps = 6/231 (3%)
 Frame = -1

Query  771  HPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEAS-----  607
            HPALL VDGVSSI ++ F+ DEW VD A+ GSQK L LP G+G++C S KAL+A+     
Sbjct  168  HPALLFVDGVSSIGSLPFKADEWKVDCAIAGSQKGLMLPAGLGVICVSQKALKAAEGQSG  227

Query  606  KTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLG  427
            +  +  RV+FDW+D  K    G Y+PYTP + LLYGLR  L  LFEEGL+NV  RH  LG
Sbjct  228  RNDRLARVYFDWEDQKKQNPTG-YFPYTPPLPLLYGLREALACLFEEGLENVYHRHAVLG  286

Query  426  TATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVA  247
             ATR AV AWGLK C +  EW SDTVTA++ P  +D+++I+K A+ RYNL+LG GL++VA
Sbjct  287  EATRQAVAAWGLKTCAKSPEWNSDTVTAILAPEGVDAAKIIKHAYVRYNLALGAGLSQVA  346

Query  246  GKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNT  94
            GKVFRIGH+G+LNEL LLG +AG EM L D G  V  GSGVAAAS+YL+  
Sbjct  347  GKVFRIGHVGDLNELSLLGAIAGAEMSLIDNGVKVTPGSGVAAASSYLREN  397



>ref|WP_016921634.1| serine--glyoxylate aminotransferase [Methylocystis parvus]
Length=397

 Score =   249 bits (636),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 127/225 (56%), Positives = 168/225 (75%), Gaps = 1/225 (0%)
 Frame = -1

Query  774  QHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAK  595
            +HPALL VDGVSS+ +++F+MDEWGVDV ++GSQK   LP G+ ++ ASPKA++A KT K
Sbjct  167  KHPALLFVDGVSSVASLEFKMDEWGVDVIVSGSQKGFMLPAGLLLMAASPKAIDAGKTNK  226

Query  594  SVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATR  415
              R +F+++D +     G Y+PYTPS+ LLYGL+  L +LFEEGLD V  RH  L   TR
Sbjct  227  GRRAYFEFQDMIAQNANG-YFPYTPSVPLLYGLKESLSILFEEGLDQVYKRHHHLAEGTR  285

Query  414  LAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVF  235
             AV AWGLK C ++ +W SDTVTA+VVP   D+ ++++ A+KRYNL+LG GL++VAGKVF
Sbjct  286  AAVAAWGLKTCAKEPKWNSDTVTAIVVPEGYDAVKVIETAYKRYNLALGAGLSEVAGKVF  345

Query  234  RIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQ  100
            RIGHLG+LNEL LLG +AG EM + D G  ++ GSGVAAA A  +
Sbjct  346  RIGHLGDLNELMLLGAIAGAEMAMLDNGIKIEAGSGVAAAQAVFR  390



>gb|AGN54050.1| glyoxylate aminotransferase, partial [Silene vulgaris]
Length=141

 Score =   240 bits (613),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 126/141 (89%), Positives = 132/141 (94%), Gaps = 0/141 (0%)
 Frame = -1

Query  702  GVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYT  523
            GVDVALTGSQKALSLPTG+GIVCAS KALEA+KTAKSVRVFFDW DYLKFYKMGTYWPYT
Sbjct  1    GVDVALTGSQKALSLPTGMGIVCASAKALEATKTAKSVRVFFDWNDYLKFYKMGTYWPYT  60

Query  522  PSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTA  343
            PSIQLLYGLRA LDL+FEEGLDNVIARH RL  ATRLAV+AWGLKNC QKEEWFSDTVTA
Sbjct  61   PSIQLLYGLRAALDLIFEEGLDNVIARHGRLAKATRLAVEAWGLKNCAQKEEWFSDTVTA  120

Query  342  VVVPSYIDSSEIVKRAWKRYN  280
            VV+P YI+SSEIVK AWKRYN
Sbjct  121  VVIPPYINSSEIVKMAWKRYN  141



>gb|AGN53897.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53898.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53899.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53903.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53904.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53907.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53908.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53909.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53910.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53911.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53912.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53919.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53929.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53930.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53931.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53932.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53933.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53934.1| glyoxylate aminotransferase, partial [Silene latifolia]
Length=141

 Score =   240 bits (613),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 124/141 (88%), Positives = 133/141 (94%), Gaps = 0/141 (0%)
 Frame = -1

Query  702  GVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYT  523
            GVDVALTGSQKALSLPTG+GI+CAS KALEA+KTAKSVRVFFDW DYLKFYKMGTYWPYT
Sbjct  1    GVDVALTGSQKALSLPTGMGIICASAKALEATKTAKSVRVFFDWNDYLKFYKMGTYWPYT  60

Query  522  PSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTA  343
            PSIQLLYGLRA LDL+FEEGLDNVIARH RL  ATRLAV+AWGLKNC QKEEWFSDTVTA
Sbjct  61   PSIQLLYGLRAALDLIFEEGLDNVIARHGRLAKATRLAVEAWGLKNCAQKEEWFSDTVTA  120

Query  342  VVVPSYIDSSEIVKRAWKRYN  280
            VV+P YIDS+EIVK+AWK+YN
Sbjct  121  VVIPPYIDSAEIVKKAWKKYN  141



>ref|WP_035937801.1| serine--glyoxylate aminotransferase [Burkholderia glathei]
 gb|KDR42451.1| serine--glyoxylate aminotransferase [Burkholderia glathei]
 emb|CDY78627.1| Serine--glyoxylate aminotransferase [Burkholderia glathei]
Length=419

 Score =   249 bits (637),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 133/224 (59%), Positives = 167/224 (75%), Gaps = 2/224 (1%)
 Frame = -1

Query  774  QHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAK  595
            +HPALL VDGVSSI  IDFRMD+W VD+A+TGSQK L LP G+GI+C S KAL+AS+TA 
Sbjct  170  RHPALLFVDGVSSIGCIDFRMDDWRVDLAVTGSQKGLMLPAGLGILCVSQKALKASETAT  229

Query  594  SVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATR  415
            S R +FD  D +K    G Y+PYTP++ LLYGLR  LDLLFEEGLDNV ARH  L    R
Sbjct  230  SRRCYFDLADMIKANATG-YFPYTPALPLLYGLRTALDLLFEEGLDNVFARHHYLAQGVR  288

Query  414  LAV-QAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKV  238
             A+ + W L  C +  +W SDTV+A+VVP   +++ ++ RA++RYNL+LG GL+KVAGKV
Sbjct  289  AAITEGWDLGVCAKAPKWHSDTVSAIVVPEKFNAAHVIDRAYRRYNLALGAGLSKVAGKV  348

Query  237  FRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAY  106
            FRIGHLG+LNEL L+G +AG EM + DIG  V+ GSG  AA+ Y
Sbjct  349  FRIGHLGDLNELMLMGAIAGAEMAMLDIGIDVRPGSGTGAAAQY  392



>ref|WP_012253362.1| serine--glyoxylate aminotransferase [Methylobacterium extorquens]
 gb|ABY30194.1| Serine--glyoxylate transaminase [Methylobacterium extorquens 
PA1]
Length=402

 Score =   248 bits (634),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 133/231 (58%), Positives = 167/231 (72%), Gaps = 6/231 (3%)
 Frame = -1

Query  771  HPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEAS-----  607
            HPALL VDGVSSI ++ F+ DEW VD A+ GSQK L LP G+G++C S +AL+A+     
Sbjct  168  HPALLFVDGVSSIGSLPFKADEWKVDCAIAGSQKGLMLPAGLGVICVSQRALKAAEGQSG  227

Query  606  KTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLG  427
            +  +  RV+FDW+D  K    G Y+PYTP + LLYGLR  L  LFEEGL+NV  RH  LG
Sbjct  228  RNDRLARVYFDWEDQKKQNPTG-YFPYTPPLPLLYGLREALACLFEEGLENVYHRHAVLG  286

Query  426  TATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVA  247
             ATR AV AWGLK C +  EW SDTVTA++ P  +D+++I+K A+ RYNL+LG GL++VA
Sbjct  287  EATRQAVAAWGLKTCAKSPEWNSDTVTAILAPEGVDAAKIIKHAYVRYNLALGAGLSQVA  346

Query  246  GKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNT  94
            GKVFRIGH+G+LNEL LLG +AG EM L D G  V  GSGVAAAS+YL+  
Sbjct  347  GKVFRIGHVGDLNELSLLGAIAGAEMSLIDNGVKVTPGSGVAAASSYLREN  397



>gb|AGN53921.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53922.1| glyoxylate aminotransferase, partial [Silene latifolia]
Length=141

 Score =   239 bits (611),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 123/141 (87%), Positives = 133/141 (94%), Gaps = 0/141 (0%)
 Frame = -1

Query  702  GVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYT  523
            GVDVALTGSQKALSLPTG+GI+CAS KALEA+KTAKSVRVFFDW DY+KFYKMGTYWPYT
Sbjct  1    GVDVALTGSQKALSLPTGMGIICASAKALEATKTAKSVRVFFDWNDYMKFYKMGTYWPYT  60

Query  522  PSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTA  343
            PSIQLLYGLRA LDL+FEEGLDNVIARH RL  ATRLAV+AWGLKNC QKEEWFSDTVTA
Sbjct  61   PSIQLLYGLRAALDLIFEEGLDNVIARHGRLAKATRLAVEAWGLKNCAQKEEWFSDTVTA  120

Query  342  VVVPSYIDSSEIVKRAWKRYN  280
            VV+P YIDS+EIVK+AWK+YN
Sbjct  121  VVIPPYIDSAEIVKKAWKKYN  141



>ref|WP_042306504.1| serine--glyoxylate aminotransferase [Burkholderia terrae]
Length=422

 Score =   249 bits (636),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 134/229 (59%), Positives = 169/229 (74%), Gaps = 2/229 (1%)
 Frame = -1

Query  771  HPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKS  592
            HPALL VDGVSSI  IDFRMDEWGVD+A+TGSQK L LP G+GI+C S KAL+    AKS
Sbjct  171  HPALLFVDGVSSIGCIDFRMDEWGVDLAVTGSQKGLMLPAGLGILCVSQKALKTIGHAKS  230

Query  591  VRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRL  412
             R +FD  D ++    G Y+PYTP++ LLYGLRA LDLLFEEGLDNV ARH  L +  R 
Sbjct  231  RRCYFDLADMVRTNATG-YFPYTPALSLLYGLRAALDLLFEEGLDNVFARHHYLASGVRA  289

Query  411  AV-QAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVF  235
            A+ + WGL+ C +  +W SDTV+A+VVP   ++++++  A++RYNL+LG GL+KVAGKVF
Sbjct  290  AITEGWGLEVCAKAPKWHSDTVSAIVVPEGFNAAQVIDTAYRRYNLALGAGLSKVAGKVF  349

Query  234  RIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTP  88
            RIGHLG+LNEL L+  +AG EM + D G  V+ GSGV AA  Y +  TP
Sbjct  350  RIGHLGDLNELMLVSAIAGAEMAMLDAGIDVRPGSGVGAAGQYWRTHTP  398



>ref|WP_017485211.1| serine--glyoxylate aminotransferase [Methylobacterium sp. MB200]
Length=402

 Score =   248 bits (634),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 133/231 (58%), Positives = 167/231 (72%), Gaps = 6/231 (3%)
 Frame = -1

Query  771  HPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEAS-----  607
            HPA+L VDGVSSI ++ F  DEW VD A+ GSQK L LP G+G++C S KAL+A+     
Sbjct  168  HPAMLFVDGVSSIGSLPFYADEWKVDCAIAGSQKGLMLPAGLGVICVSQKALKAAEGQSG  227

Query  606  KTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLG  427
            +  +  RV+FDW+D+ K    G Y+PYTP + LLYGLR  L  LFEEGL+NV  RH  LG
Sbjct  228  RNDRLARVYFDWEDHKKQNPAG-YFPYTPPLPLLYGLREALACLFEEGLENVYHRHAVLG  286

Query  426  TATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVA  247
             ATR AV AWGLK C +  EW SDTVTA++ P  +D+++I+K A+ RYNL+LG GL++VA
Sbjct  287  EATRQAVAAWGLKTCAKSPEWNSDTVTAILAPEGVDAAKIIKHAYVRYNLALGAGLSQVA  346

Query  246  GKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNT  94
            GKVFRIGH+G+LNEL LLG +AG EM L D G  V  GSGVAAAS+YL+  
Sbjct  347  GKVFRIGHVGDLNELSLLGAIAGAEMSLLDNGVKVTPGSGVAAASSYLREN  397



>ref|WP_012453656.1| serine--glyoxylate aminotransferase [Methylobacterium populi]
 gb|ACB79910.1| aminotransferase class V [Methylobacterium populi BJ001]
Length=402

 Score =   248 bits (633),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 133/231 (58%), Positives = 167/231 (72%), Gaps = 6/231 (3%)
 Frame = -1

Query  771  HPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEAS-----  607
            HPA+L VDGVSSI ++ F  DEW VD A+ GSQK L LP G+G++C S KAL+A+     
Sbjct  168  HPAMLFVDGVSSIGSLPFYADEWKVDCAIAGSQKGLMLPAGLGVICVSQKALKAAEGQSG  227

Query  606  KTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLG  427
            +  +  RV+FDW+D+ K    G Y+PYTP + LLYGLR  L  LFEEGL+NV  RH  LG
Sbjct  228  RNDRLARVYFDWEDHKKQNPAG-YFPYTPPLPLLYGLREALACLFEEGLENVYHRHAVLG  286

Query  426  TATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVA  247
             ATR AV AWGLK C +  EW SDTVTA++ P  +D+++I+K A+ RYNL+LG GL++VA
Sbjct  287  EATRQAVAAWGLKTCAKSPEWNSDTVTAILAPEGVDAAKIIKHAYVRYNLALGAGLSQVA  346

Query  246  GKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNT  94
            GKVFRIGH+G+LNEL LLG +AG EM L D G  V  GSGVAAAS+YL+  
Sbjct  347  GKVFRIGHVGDLNELSLLGAIAGAEMSLLDNGVNVTPGSGVAAASSYLREN  397



>gb|AGN54049.1| glyoxylate aminotransferase, partial [Silene vulgaris]
Length=141

 Score =   239 bits (610),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 125/141 (89%), Positives = 132/141 (94%), Gaps = 0/141 (0%)
 Frame = -1

Query  702  GVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYT  523
            GVDVALTGSQKALSLPTG+GIVCAS KALEA+KTAKSVRVFFDW DYLKFYKMGTYWPYT
Sbjct  1    GVDVALTGSQKALSLPTGMGIVCASAKALEATKTAKSVRVFFDWNDYLKFYKMGTYWPYT  60

Query  522  PSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTA  343
            PSIQLLYGLRA LDL+FEEGLDNVIARH RL  ATRLAV+AWGLKNC QKEEWFSDTVTA
Sbjct  61   PSIQLLYGLRAALDLIFEEGLDNVIARHGRLAKATRLAVEAWGLKNCAQKEEWFSDTVTA  120

Query  342  VVVPSYIDSSEIVKRAWKRYN  280
            VV+P YI+S+EIVK AWKRYN
Sbjct  121  VVIPPYINSAEIVKMAWKRYN  141



>ref|WP_012336184.1| serine--glyoxylate aminotransferase [Methylobacterium sp. 4-46]
 gb|ACA20808.1| Serine--glyoxylate transaminase [Methylobacterium sp. 4-46]
Length=417

 Score =   248 bits (633),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 128/227 (56%), Positives = 166/227 (73%), Gaps = 1/227 (0%)
 Frame = -1

Query  774  QHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAK  595
             HPA+L VDGVSSI +IDFR  EWGVD A+TGSQK L LP G+GIVC SPKAL A KTA+
Sbjct  167  NHPAMLYVDGVSSIGSIDFRATEWGVDCAITGSQKGLMLPAGLGIVCVSPKALAAYKTAE  226

Query  594  SVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATR  415
              RV+FD+ D  K    G Y+PYTP++ LLYGLR  +  LFEEGL+ V  RH  L    R
Sbjct  227  CRRVYFDFGDMSKANATG-YFPYTPALPLLYGLREAMACLFEEGLERVFERHRVLADGCR  285

Query  414  LAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVF  235
             AV+AWGL  C ++ +W+SDTV+A++VP  ++ ++++  A++RYNL+LG GL+KVAGK+F
Sbjct  286  AAVKAWGLTLCAKEPKWYSDTVSAIMVPDGVNGADVIDVAFRRYNLALGAGLSKVAGKLF  345

Query  234  RIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNT  94
            RIGHLG+LN+L LLG LAG EM + D G  ++ GSGV AA  + + T
Sbjct  346  RIGHLGDLNDLMLLGALAGAEMAMLDAGIRIEPGSGVGAAQKHFRET  392



>ref|WP_026190999.1| serine--glyoxylate aminotransferase [Methylobacterium sp. WSM2598]
Length=417

 Score =   248 bits (633),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 128/227 (56%), Positives = 166/227 (73%), Gaps = 1/227 (0%)
 Frame = -1

Query  774  QHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAK  595
             HPA+L VDGVSSI +IDFR  EWGVD A+TGSQK L LP G+GIVC SPKAL A KTA+
Sbjct  167  NHPAMLYVDGVSSIGSIDFRATEWGVDCAITGSQKGLMLPAGLGIVCVSPKALAAYKTAE  226

Query  594  SVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATR  415
              RV+FD+ D  K    G Y+PYTP++ LLYGLR  +  LFEEGL+ V  RH  L    R
Sbjct  227  CRRVYFDFGDMSKANATG-YFPYTPALPLLYGLREAMACLFEEGLERVFERHRVLADGCR  285

Query  414  LAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVF  235
             AV+AWGL  C ++ +W+SDTV+A++VP  ++ ++++  A++RYNL+LG GL+KVAGK+F
Sbjct  286  AAVKAWGLTLCAKEPKWYSDTVSAIMVPEGVNGADVIDVAFRRYNLALGAGLSKVAGKLF  345

Query  234  RIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNT  94
            RIGHLG+LN+L LLG LAG EM + D G  ++ GSGV AA  + + T
Sbjct  346  RIGHLGDLNDLMLLGALAGAEMAMLDAGIRIEPGSGVGAAQKHFRET  392



>ref|WP_035994918.1| serine--glyoxylate aminotransferase [Burkholderia caribensis]
 gb|ETY83415.1| Serine--glyoxylate aminotransferase [Burkholderia caribensis 
MBA4]
Length=422

 Score =   248 bits (633),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 133/229 (58%), Positives = 169/229 (74%), Gaps = 2/229 (1%)
 Frame = -1

Query  771  HPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKS  592
            HPALL VDGVSSI  IDFRMDEWGVD+A+TGSQK L LP G+GI+C S KAL+    AKS
Sbjct  171  HPALLFVDGVSSIGCIDFRMDEWGVDLAVTGSQKGLMLPAGLGILCVSQKALKTIGHAKS  230

Query  591  VRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRL  412
             R +FD  D ++    G Y+PYTP++ LLYGLRA LDLLF+EGLDNV ARH  L +  R 
Sbjct  231  RRCYFDLADMVRTNATG-YFPYTPALSLLYGLRAALDLLFQEGLDNVFARHHYLASGVRA  289

Query  411  AV-QAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVF  235
            A+ + WGL+ C +  +W SDTV+A+VVP   ++++++  A++RYNL+LG GL+KVAGKVF
Sbjct  290  AITEGWGLEVCAKAPKWHSDTVSAIVVPEGFNAAQVIDTAYRRYNLALGAGLSKVAGKVF  349

Query  234  RIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTP  88
            RIGHLG+LNEL L+  +AG EM + D G  V+ GSGV AA  Y +  TP
Sbjct  350  RIGHLGDLNELMLVSAIAGAEMAMLDAGIDVRPGSGVGAAGQYWRTHTP  398



>ref|WP_007585769.1| serine--glyoxylate aminotransferase [Burkholderia terrae]
 gb|EIM98368.1| serine--glyoxylate transaminase [Burkholderia terrae BS001]
Length=422

 Score =   248 bits (633),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 133/229 (58%), Positives = 169/229 (74%), Gaps = 2/229 (1%)
 Frame = -1

Query  771  HPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKS  592
            HPALL VDGVSSI  IDFRMDEWGVD+A+TGSQK L LP G+GI+C S KAL+    AKS
Sbjct  171  HPALLFVDGVSSIGCIDFRMDEWGVDLAVTGSQKGLMLPAGLGILCVSQKALKTIGHAKS  230

Query  591  VRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRL  412
             R +FD  D ++    G Y+PYTP++ LLYGLRA LDLLF+EGLDNV ARH  L +  R 
Sbjct  231  RRCYFDLADMVRTNATG-YFPYTPALSLLYGLRAALDLLFQEGLDNVFARHHYLASGVRA  289

Query  411  AV-QAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVF  235
            A+ + WGL+ C +  +W SDTV+A+VVP   ++++++  A++RYNL+LG GL+KVAGKVF
Sbjct  290  AITEGWGLEVCAKAPKWHSDTVSAIVVPEGFNAAQVIDTAYRRYNLALGAGLSKVAGKVF  349

Query  234  RIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTP  88
            RIGHLG+LNEL L+  +AG EM + D G  V+ GSGV AA  Y +  TP
Sbjct  350  RIGHLGDLNELMLVSAIAGAEMAMLDAGIDVRPGSGVGAAGQYWRTHTP  398



>ref|WP_028367172.1| serine--glyoxylate aminotransferase [Burkholderia sp. UYPR1.413]
Length=421

 Score =   248 bits (633),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 135/230 (59%), Positives = 167/230 (73%), Gaps = 2/230 (1%)
 Frame = -1

Query  774  QHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAK  595
             HPALL VDGVSSI  IDFRMDEWGVD+A+TGSQK L LP G+GI+C S KAL+A   AK
Sbjct  170  DHPALLFVDGVSSIGCIDFRMDEWGVDLAVTGSQKGLMLPAGLGILCVSQKALKAISHAK  229

Query  594  SVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATR  415
            S R +FD  D ++    G Y+PYTP++ LLYGLRA LDLLFEEGL+NV ARH  L +  R
Sbjct  230  SRRCYFDLADMVRTNATG-YFPYTPALSLLYGLRAALDLLFEEGLENVFARHHYLASGVR  288

Query  414  LAV-QAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKV  238
             AV + WGL  C +   W SDTV+A+VVP  ++ ++++  A++RYNL+LG GL+KVAGKV
Sbjct  289  AAVTEGWGLSLCAKAPRWHSDTVSAIVVPEGVNGAQVIDTAYRRYNLALGAGLSKVAGKV  348

Query  237  FRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTP  88
            FRIGHLG+LNEL L+  +AG EM + D G  V  GSGV AA  Y +  TP
Sbjct  349  FRIGHLGDLNELMLMSAIAGAEMAMLDAGIDVCPGSGVGAAGQYWRTHTP  398



>ref|WP_028097617.1| serine--glyoxylate aminotransferase [Dongia sp. URHE0060]
Length=397

 Score =   247 bits (631),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 123/226 (54%), Positives = 164/226 (73%), Gaps = 1/226 (0%)
 Frame = -1

Query  774  QHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAK  595
            +HPALL VDGVSSI +IDFRMDEWGVD+A+ GSQK   LP G+ I+C SPKAL+ +K +K
Sbjct  162  RHPALLFVDGVSSIASIDFRMDEWGVDIAVCGSQKGFMLPGGLAILCVSPKALDTAKNSK  221

Query  594  SVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATR  415
              R +FD+ D +K  K G ++PYTP +QL+ GLR  +D+L  EGL+NV ARH RLG   R
Sbjct  222  LHRCYFDFADMIKTNKDG-FFPYTPPMQLIRGLRTSVDMLLSEGLENVFARHHRLGEGVR  280

Query  414  LAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVF  235
             AV AW +K   +++ W SDTV+A+ +    DS+ +V+ A++RY LSLG+GL ++ GKVF
Sbjct  281  RAVAAWNMKLVAKEKRWQSDTVSAIQITDGFDSNSLVRHAYRRYGLSLGVGLARLNGKVF  340

Query  234  RIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQN  97
            RIGHLG+LNEL +L  L GVE+ ++D+G P+K GSGV AA  Y   
Sbjct  341  RIGHLGDLNELMVLSALGGVELAMRDVGVPIKAGSGVGAAVDYFHQ  386



>ref|WP_028212654.1| serine--glyoxylate aminotransferase [Burkholderia mimosarum]
Length=419

 Score =   248 bits (632),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 133/224 (59%), Positives = 167/224 (75%), Gaps = 2/224 (1%)
 Frame = -1

Query  774  QHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAK  595
             HPALL VDGVSSI  IDFRMD+W VD+A+TGSQK L LP G+GI+CASPKAL+A + A+
Sbjct  170  HHPALLFVDGVSSIGCIDFRMDDWRVDLAVTGSQKGLMLPAGLGILCASPKALKAMEHAQ  229

Query  594  SVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATR  415
            S R +FD  D +K    G Y+PYTP++ LLYGLRA LDLLFEEGLDNV ARH  L    R
Sbjct  230  SRRCYFDLGDMIKANATG-YFPYTPALSLLYGLRASLDLLFEEGLDNVFARHHYLAAGVR  288

Query  414  LAV-QAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKV  238
             AV + WGL+ C +  +W SDTVTA+VVP   +++ ++  A++RYNL+LG GL+KVAGKV
Sbjct  289  AAVTEGWGLELCAKAPKWHSDTVTAIVVPQGFNAAHVIDTAFRRYNLALGAGLSKVAGKV  348

Query  237  FRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAY  106
            FRIGHLG+LNEL L   ++G EM + D+G  V+ GSG  AA+ Y
Sbjct  349  FRIGHLGDLNELMLTSAISGAEMAMLDVGIDVRPGSGTGAATQY  392



>ref|WP_007742731.1| serine--glyoxylate aminotransferase [Burkholderia sp. BT03]
 gb|EUC15360.1| Serine--glyoxylate transaminase [Burkholderia sp. BT03]
Length=422

 Score =   248 bits (632),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 133/229 (58%), Positives = 169/229 (74%), Gaps = 2/229 (1%)
 Frame = -1

Query  771  HPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKS  592
            HPALL VDGVSSI  IDFRMDEWGVD+A+TGSQK L LP G+GI+C S KAL+    AKS
Sbjct  171  HPALLFVDGVSSIGCIDFRMDEWGVDLAVTGSQKGLMLPAGLGILCVSQKALKTIGHAKS  230

Query  591  VRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRL  412
             R +FD  D ++    G Y+PYTP++ LLYGLRA LDLLF+EGLDNV ARH  L +  R 
Sbjct  231  RRCYFDLADMVRTNATG-YFPYTPALSLLYGLRAALDLLFQEGLDNVFARHHYLASGVRA  289

Query  411  AV-QAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVF  235
            A+ + WGL+ C +  +W SDTV+A+VVP   ++++++  A++RYNL+LG GL+KVAGKVF
Sbjct  290  AITEGWGLEVCAKAPKWHSDTVSAIVVPEGFNAAQVIDTAYRRYNLALGAGLSKVAGKVF  349

Query  234  RIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTP  88
            RIGHLG+LNEL L+  +AG EM + D G  V+ GSGV AA  Y +  TP
Sbjct  350  RIGHLGDLNELMLVSAIAGAEMAMLDAGIDVRPGSGVGAAGQYWRTHTP  398



>ref|WP_036284904.1| serine--glyoxylate aminotransferase [Methylocystis sp. ATCC 49242]
Length=397

 Score =   246 bits (629),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 125/225 (56%), Positives = 167/225 (74%), Gaps = 1/225 (0%)
 Frame = -1

Query  774  QHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAK  595
            +HPA+L VDGVSS+ +++F+MDEWGVDV ++GSQK   LP G+ ++ ASPKA+E  KT K
Sbjct  167  KHPAMLFVDGVSSVASLEFKMDEWGVDVIVSGSQKGFMLPAGLLLMAASPKAIEKGKTNK  226

Query  594  SVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATR  415
              R +F+++D +     G Y+PYTPS+ LLYGL+  L +LFEEGLD V  RH  L    R
Sbjct  227  GRRAYFEFQDMIAQNANG-YFPYTPSVPLLYGLKEALSILFEEGLDQVYKRHHHLAEGCR  285

Query  414  LAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVF  235
             AV AWGLK C ++ +W SDTVTA+VVP   D++++++ A+KRYNL+LG GL++VAGKVF
Sbjct  286  AAVAAWGLKTCAKEPKWNSDTVTAIVVPEGFDAAKVIETAYKRYNLALGAGLSEVAGKVF  345

Query  234  RIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQ  100
            RIGHLG+LNEL LLG +AG EM + D G  ++ GSGVAAA A  +
Sbjct  346  RIGHLGDLNELMLLGAIAGAEMAMLDNGIKIQPGSGVAAAQAVFR  390



>gb|KIZ03753.1| serine--glyoxylate transaminase [Monoraphidium neglectum]
Length=425

 Score =   247 bits (631),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 130/234 (56%), Positives = 169/234 (72%), Gaps = 1/234 (0%)
 Frame = -1

Query  774  QHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAK  595
            +HPALL+VDGVSSI A++F+ D+W VDVA+TGSQKALSLPTG+ ++C S KAL+A KTAK
Sbjct  191  KHPALLMVDGVSSIGALEFKFDDWRVDVAVTGSQKALSLPTGLALLCVSDKALDARKTAK  250

Query  594  SVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATR  415
              R+++ W D L     G   PYTPS+ LL+GL+  L LL EEG DNV+ARH RL   TR
Sbjct  251  LPRIYYSWDDQLNTNPSGNV-PYTPSLMLLHGLKESLALLREEGFDNVVARHHRLAEGTR  309

Query  414  LAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVF  235
             AV+ WGLK   +   W SD++T + VP+ IDS+ IVK A+ +YNLS+G+GL+KV GKVF
Sbjct  310  KAVEGWGLKLLCKHPRWQSDSLTVIEVPAGIDSNLIVKNAYSKYNLSIGIGLSKVNGKVF  369

Query  234  RIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSR  73
            RIGHLGN++EL +   L+G EM + D G  +  GSGV  A  Y Q T+ +IP+R
Sbjct  370  RIGHLGNMDELMMCSALSGAEMAMLDAGMKITPGSGVGRAIEYWQKTSKVIPTR  423



>ref|WP_008058631.1| serine--glyoxylate aminotransferase [Methyloversatilis universalis]
 gb|EGK73403.1| Serine-glyoxylate aminotransferase [Methyloversatilis universalis 
FAM5]
Length=396

 Score =   246 bits (628),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 129/230 (56%), Positives = 165/230 (72%), Gaps = 2/230 (1%)
 Frame = -1

Query  774  QHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAK  595
             HPALL+VD VSS+ +IDFRMDEWGVD A++GSQK   LP G+GI+  SPKAL+A +TA 
Sbjct  165  NHPALLMVDTVSSLVSIDFRMDEWGVDCAVSGSQKGFMLPAGMGILGVSPKALKAMETAT  224

Query  594  SVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATR  415
            S R +FD  D LK    G Y+PYTPSI +LYG+R  L+ +FEEGL+N+ ARH  L +  R
Sbjct  225  SRRCYFDLGDMLKNNATG-YFPYTPSIPMLYGMRESLNTIFEEGLENIFARHNYLASGVR  283

Query  414  LAVQ-AWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKV  238
             AVQ  W L  C +  EW+SDTV+A++VP   D+++++  A+ +YNLSLG GL+KVAGKV
Sbjct  284  AAVQEGWKLNLCAKAPEWYSDTVSAILVPEGFDATKVISNAYAKYNLSLGAGLSKVAGKV  343

Query  237  FRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTP  88
            FRIGHLG+LN L L+  +AG EM + D G  V  GSGVAAAS Y +   P
Sbjct  344  FRIGHLGDLNALSLMSAIAGAEMSMLDNGINVTPGSGVAAASTYWRTHAP  393



>ref|WP_020085137.1| serine--glyoxylate aminotransferase [Hyphomicrobium zavarzinii]
Length=400

 Score =   245 bits (626),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 125/229 (55%), Positives = 166/229 (72%), Gaps = 3/229 (1%)
 Frame = -1

Query  774  QHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKT--  601
            +HPALL VDGVSS+ ++D RM EWGVD  ++GSQK   LPTG+GI+  S KAL+A+K+  
Sbjct  163  KHPALLFVDGVSSVGSLDMRMGEWGVDACVSGSQKGFMLPTGLGILAVSQKALDANKSLN  222

Query  600  AKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTA  421
             +  R FF W+D +K   +G ++PYTP+ QL+ GLRA L+L+F EG+DN++ARHTRL + 
Sbjct  223  GRMNRCFFSWEDMIKTNDLG-FFPYTPATQLIRGLRASLNLIFAEGIDNIVARHTRLASG  281

Query  420  TRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGK  241
             R AV AWGLK C ++ +W SDTV+A+VVP  ID++ ++K A+ RYN SLG GLNK+ G+
Sbjct  282  VRAAVDAWGLKLCAKEPKWHSDTVSAIVVPEGIDANNVLKTAYYRYNTSLGTGLNKLNGR  341

Query  240  VFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNT  94
            VFRIGHLG L+E  +   L  VEM LKD G P+K GSG  AA+ Y   T
Sbjct  342  VFRIGHLGALDEGMIGSALFNVEMTLKDCGVPIKFGSGTGAAAEYFSKT  390



>ref|WP_038511699.1| serine--glyoxylate aminotransferase [Granulibacter bethesdensis]
Length=394

 Score =   245 bits (625),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 130/232 (56%), Positives = 169/232 (73%), Gaps = 6/232 (3%)
 Frame = -1

Query  774  QHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAK  595
            +HPALL VDGVSSI +IDFRMD+W VD  +TGSQK L LP G+GI   S KALEA K A+
Sbjct  162  KHPALLFVDGVSSIGSIDFRMDDWKVDAIITGSQKGLMLPAGLGIAVVSQKALEAQKAAR  221

Query  594  S----VRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLF-EEGLDNVIARHTRL  430
            +     RV+FD++D  K  + G Y+PYTP++ LLYGLR  L ++  EEGLDNVIARH  L
Sbjct  222  ANNPLRRVYFDFEDQSKANETG-YFPYTPALPLLYGLREALQIILDEEGLDNVIARHHYL  280

Query  429  GTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKV  250
                R AV+AWGL  C + ++W+SDTV+A++VP   + ++++ RA+KRYNL+LG GL++V
Sbjct  281  AQGVREAVKAWGLTLCAKDQKWYSDTVSAILVPEGFNGADVISRAFKRYNLALGAGLSQV  340

Query  249  AGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNT  94
            AGK+FRIGHLG+LNEL  LG + G EM ++DIG  VK GSG AAA  Y +  
Sbjct  341  AGKLFRIGHLGDLNELMCLGAITGAEMAMRDIGIDVKPGSGAAAAEEYYRTN  392



>ref|WP_011630756.1| serine--glyoxylate aminotransferase [Granulibacter bethesdensis]
 gb|ABI60946.1| serine--glyoxylate aminotransferase [Granulibacter bethesdensis 
CGDNIH1]
Length=394

 Score =   245 bits (625),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 130/232 (56%), Positives = 169/232 (73%), Gaps = 6/232 (3%)
 Frame = -1

Query  774  QHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAK  595
            +HPALL VDGVSSI +IDFRMD+W VD  +TGSQK L LP G+GI   S KALEA K A+
Sbjct  162  KHPALLFVDGVSSIGSIDFRMDDWKVDAIITGSQKGLMLPAGLGIAVVSQKALEAQKAAR  221

Query  594  S----VRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLF-EEGLDNVIARHTRL  430
            +     RV+FD++D  K  + G Y+PYTP++ LLYGLR  L ++  EEGLDNVIARH  L
Sbjct  222  ANNPLRRVYFDFEDQSKANETG-YFPYTPALPLLYGLREALQIILDEEGLDNVIARHHYL  280

Query  429  GTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKV  250
                R AV+AWGL  C + ++W+SDTV+A++VP   + ++++ RA+KRYNL+LG GL++V
Sbjct  281  AQGVREAVKAWGLTLCAKDQKWYSDTVSAILVPEGFNGADVISRAFKRYNLALGAGLSQV  340

Query  249  AGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNT  94
            AGK+FRIGHLG+LNEL  LG + G EM ++DIG  VK GSG AAA  Y +  
Sbjct  341  AGKLFRIGHLGDLNELMCLGAITGAEMAMRDIGIDVKPGSGAAAAEEYYRTN  392



>ref|WP_012320605.1| MULTISPECIES: serine--glyoxylate aminotransferase [Methylobacterium]
 gb|ACB25646.1| aminotransferase class V [Methylobacterium radiotolerans JCM 
2831]
 gb|KIU30995.1| serine--glyoxylate aminotransferase [Methylobacterium radiotolerans]
 dbj|GAN47418.1| class V aminotransferase [Methylobacterium sp. ME121]
Length=402

 Score =   245 bits (625),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 132/231 (57%), Positives = 169/231 (73%), Gaps = 6/231 (3%)
 Frame = -1

Query  771  HPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASK--TA  598
            HPALL VDG+SSI ++ F+MDEWGVD A+ GSQK   LP G+G++C SPKAL+ ++  T 
Sbjct  168  HPALLFVDGISSIGSLPFKMDEWGVDCAIAGSQKGFMLPAGLGLICISPKALKIAEGGTG  227

Query  597  KSVRV---FFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLG  427
            ++ R+   +F WKD L     G Y+PYTP + LLYGLR  L ++ EEGL+NV  RH  L 
Sbjct  228  RNDRLGHAYFAWKDQLAANATG-YFPYTPVLPLLYGLREALAIVKEEGLENVYHRHHVLA  286

Query  426  TATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVA  247
             ATR AV AWGLK C ++ +W SDTVTA+VVP   D+++++  A++RYNLSLG GL+KVA
Sbjct  287  EATRQAVAAWGLKPCAKEPKWNSDTVTAIVVPEGADAAKVITHAYERYNLSLGAGLSKVA  346

Query  246  GKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNT  94
            GKVFRIGHLG+LNEL LLG +AG EM + D G  V  GSGVAAAS+YL+  
Sbjct  347  GKVFRIGHLGDLNELSLLGAIAGAEMAMLDCGIKVTPGSGVAAASSYLREN  397



>ref|WP_036230592.1| MULTISPECIES: serine--glyoxylate aminotransferase [Methylibium]
 gb|EWS54025.1| Soluble hydrogenase 42 kDa subunit [Methylibium sp. T29]
 gb|EWS61014.1| Soluble hydrogenase 42 kDa subunit [Methylibium sp. T29-B]
Length=415

 Score =   245 bits (626),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 129/235 (55%), Positives = 173/235 (74%), Gaps = 3/235 (1%)
 Frame = -1

Query  774  QHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAK  595
            +HPALLLVD VSS+ +IDFRMDEWGVD+ ++GSQK L LP G+GIVCAS KAL+A +++ 
Sbjct  162  RHPALLLVDAVSSLGSIDFRMDEWGVDICVSGSQKGLMLPAGLGIVCASEKALKARESST  221

Query  594  SVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATR  415
            + R FFD+ D +K    G Y+PYTP++ +LYGLR  L ++ EEGL+N+  RHT L +  R
Sbjct  222  APRCFFDFGDMIKANATG-YFPYTPALPMLYGLRESLTMIKEEGLENIFWRHTYLASGVR  280

Query  414  LAV-QAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKV  238
             AV   W L  C +  +W+SDTV+A+VVP  I+ + ++  A++RYNLSLG GL+KVAGKV
Sbjct  281  AAVLDGWKLGLCAKDPKWYSDTVSAIVVPEGINGAHVIDVAFRRYNLSLGAGLSKVAGKV  340

Query  237  FRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSR  73
            FRIGHLG+LNEL +LG LAG EM + D+G  ++ GSGVAAA  Y + T   +P +
Sbjct  341  FRIGHLGDLNELMVLGALAGAEMSMLDVGIKIEPGSGVAAAQKYFR-THDNVPKK  394



>ref|WP_041930245.1| serine--glyoxylate aminotransferase, partial [Methylibium petroleiphilum]
Length=395

 Score =   244 bits (624),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 127/227 (56%), Positives = 169/227 (74%), Gaps = 2/227 (1%)
 Frame = -1

Query  774  QHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAK  595
            +HPALLLVD VSS+ +IDFRMDEWGVD+ ++GSQK L LP G+GIVCAS KAL+A +++ 
Sbjct  162  RHPALLLVDAVSSLGSIDFRMDEWGVDICVSGSQKGLMLPAGLGIVCASEKALKARESST  221

Query  594  SVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATR  415
            + R FFD+ D +K    G Y+PYTP++ +LYGLR  L ++ EEGL+N+  RHT L +  R
Sbjct  222  APRCFFDFGDMIKANATG-YFPYTPALPMLYGLRESLTMIKEEGLENIFWRHTYLASGVR  280

Query  414  LAV-QAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKV  238
             AV   W L  C +  +W+SDTV+A+VVP  I+ + ++  A++RYNLSLG GL+KVAGKV
Sbjct  281  AAVLDGWKLGLCAKDPKWYSDTVSAIVVPEGINGAHVIDVAFRRYNLSLGAGLSKVAGKV  340

Query  237  FRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQN  97
            FRIGHLG+LNEL +LG LAG EM + D+G  ++ GSGVAAA  Y + 
Sbjct  341  FRIGHLGDLNELMVLGALAGAEMSMLDVGIRIEPGSGVAAAQKYFRT  387



>gb|ABM96214.1| serine-glyoxylate aminotransferase [Methylibium petroleiphilum 
PM1]
Length=415

 Score =   245 bits (625),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 129/235 (55%), Positives = 173/235 (74%), Gaps = 3/235 (1%)
 Frame = -1

Query  774  QHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAK  595
            +HPALLLVD VSS+ +IDFRMDEWGVD+ ++GSQK L LP G+GIVCAS KAL+A +++ 
Sbjct  162  RHPALLLVDAVSSLGSIDFRMDEWGVDICVSGSQKGLMLPAGLGIVCASEKALKARESST  221

Query  594  SVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATR  415
            + R FFD+ D +K    G Y+PYTP++ +LYGLR  L ++ EEGL+N+  RHT L +  R
Sbjct  222  APRCFFDFGDMIKANATG-YFPYTPALPMLYGLRESLTMIKEEGLENIFWRHTYLASGVR  280

Query  414  LAV-QAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKV  238
             AV   W L  C +  +W+SDTV+A+VVP  I+ + ++  A++RYNLSLG GL+KVAGKV
Sbjct  281  AAVLDGWKLGLCAKDPKWYSDTVSAIVVPEGINGAHVIDVAFRRYNLSLGAGLSKVAGKV  340

Query  237  FRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSR  73
            FRIGHLG+LNEL +LG LAG EM + D+G  ++ GSGVAAA  Y + T   +P +
Sbjct  341  FRIGHLGDLNELMVLGALAGAEMSMLDVGIRIEPGSGVAAAQKYFR-THDNVPKK  394



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1507754616730