BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF009K19

Length=741
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009622453.1|  PREDICTED: uncharacterized protein LOC104113849    324   8e-104   Nicotiana tomentosiformis
ref|XP_009766329.1|  PREDICTED: uncharacterized protein LOC104217722    322   4e-103   Nicotiana sylvestris
ref|XP_004242721.1|  PREDICTED: uncharacterized protein LOC101255210    319   6e-102   Solanum lycopersicum
ref|XP_006359513.1|  PREDICTED: uncharacterized protein LOC102584997    316   9e-101   Solanum tuberosum [potatoes]
ref|XP_007013639.1|  Major facilitator superfamily protein isoform 2    302   9e-97    
ref|XP_006381072.1|  hypothetical protein POPTR_0006s05990g             305   3e-96    Populus trichocarpa [western balsam poplar]
ref|XP_010244877.1|  PREDICTED: uncharacterized protein LOC104588582    304   6e-96    Nelumbo nucifera [Indian lotus]
ref|XP_011020248.1|  PREDICTED: uncharacterized protein LOC105122687    301   4e-95    Populus euphratica
gb|KDP30201.1|  hypothetical protein JCGZ_16983                         301   5e-95    Jatropha curcas
ref|XP_007013638.1|  Major facilitator superfamily protein isoform 1    301   5e-95    Theobroma cacao [chocolate]
ref|XP_006453197.1|  hypothetical protein CICLE_v100078531mg            297   2e-94    
ref|XP_007204209.1|  hypothetical protein PRUPE_ppa003398mg             297   2e-93    Prunus persica
gb|KCW82731.1|  hypothetical protein EUGRSUZ_C04108                     293   4e-93    Eucalyptus grandis [rose gum]
gb|KDO62001.1|  hypothetical protein CISIN_1g0082101mg                  296   6e-93    Citrus sinensis [apfelsine]
ref|XP_006474315.1|  PREDICTED: uncharacterized membrane protein ...    296   9e-93    Citrus sinensis [apfelsine]
emb|CBI25573.3|  unnamed protein product                                294   9e-93    Vitis vinifera
ref|XP_008242919.1|  PREDICTED: uncharacterized protein LOC103341215    295   1e-92    Prunus mume [ume]
ref|XP_011084061.1|  PREDICTED: uncharacterized protein LOC105166417    295   1e-92    Sesamum indicum [beniseed]
ref|XP_002268798.2|  PREDICTED: uncharacterized protein LOC100251745    294   5e-92    Vitis vinifera
ref|XP_006341383.1|  PREDICTED: uncharacterized protein LOC102606368    293   6e-92    Solanum tuberosum [potatoes]
ref|XP_004235913.1|  PREDICTED: uncharacterized protein LOC101263299    293   8e-92    Solanum lycopersicum
gb|KJB53964.1|  hypothetical protein B456_009G013800                    295   8e-92    Gossypium raimondii
ref|XP_010049904.1|  PREDICTED: uncharacterized protein LOC104438451    293   1e-91    Eucalyptus grandis [rose gum]
ref|XP_002531448.1|  conserved hypothetical protein                     293   1e-91    Ricinus communis
ref|XP_010927349.1|  PREDICTED: uncharacterized protein LOC105049...    287   3e-91    
ref|XP_010908361.1|  PREDICTED: probable transporter mch1 isoform X2    291   7e-91    Elaeis guineensis
ref|XP_008775757.1|  PREDICTED: uncharacterized protein LOC103696035    290   1e-90    Phoenix dactylifera
ref|XP_010102055.1|  hypothetical protein L484_016185                   290   1e-90    Morus notabilis
ref|XP_002270754.1|  PREDICTED: probable transporter mch1               290   1e-90    Vitis vinifera
ref|XP_010927348.1|  PREDICTED: uncharacterized protein LOC105049...    287   1e-89    Elaeis guineensis
ref|XP_008813131.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    285   6e-89    Phoenix dactylifera
ref|XP_004287243.1|  PREDICTED: protein NUCLEAR FUSION DEFECTIVE ...    285   8e-89    Fragaria vesca subsp. vesca
ref|XP_010047214.1|  PREDICTED: uncharacterized protein LOC104436175    285   1e-88    Eucalyptus grandis [rose gum]
ref|XP_009419093.1|  PREDICTED: probable transporter mch1               284   2e-88    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009798217.1|  PREDICTED: uncharacterized protein LOC104244484    283   3e-88    Nicotiana sylvestris
ref|XP_010908359.1|  PREDICTED: probable transporter mch1 isoform X1    281   4e-87    Elaeis guineensis
ref|XP_007155098.1|  hypothetical protein PHAVU_003G173000g             281   4e-87    Phaseolus vulgaris [French bean]
ref|XP_011082070.1|  PREDICTED: uncharacterized protein LOC105164931    281   4e-87    Sesamum indicum [beniseed]
ref|XP_003533860.1|  PREDICTED: uncharacterized membrane protein ...    280   6e-87    Glycine max [soybeans]
gb|KHN48124.1|  hypothetical protein glysoja_036680                     280   7e-87    Glycine soja [wild soybean]
emb|CDO98192.1|  unnamed protein product                                278   1e-86    Coffea canephora [robusta coffee]
ref|XP_009611327.1|  PREDICTED: uncharacterized membrane protein ...    279   1e-86    Nicotiana tomentosiformis
ref|XP_006600718.1|  PREDICTED: uncharacterized membrane protein ...    279   2e-86    Glycine max [soybeans]
gb|KHN23190.1|  hypothetical protein glysoja_044550                     278   3e-86    Glycine soja [wild soybean]
ref|XP_009363916.1|  PREDICTED: uncharacterized protein LOC103953847    278   4e-86    Pyrus x bretschneideri [bai li]
ref|XP_003546584.1|  PREDICTED: uncharacterized membrane protein ...    278   4e-86    Glycine max [soybeans]
ref|XP_008384897.1|  PREDICTED: uncharacterized protein LOC103447477    278   5e-86    Malus domestica [apple tree]
ref|XP_006427480.1|  hypothetical protein CICLE_v10025286mg             274   7e-86    
gb|KDP37029.1|  hypothetical protein JCGZ_06085                         277   1e-85    Jatropha curcas
gb|KHG20418.1|  putative transporter MCH1                               273   2e-85    Gossypium arboreum [tree cotton]
gb|KJB70656.1|  hypothetical protein B456_011G085700                    274   3e-85    Gossypium raimondii
ref|XP_007217245.1|  hypothetical protein PRUPE_ppa003638mg             275   4e-85    Prunus persica
gb|KDO52312.1|  hypothetical protein CISIN_1g014047mg                   271   4e-85    Citrus sinensis [apfelsine]
ref|XP_008228741.1|  PREDICTED: uncharacterized membrane protein ...    275   5e-85    Prunus mume [ume]
ref|XP_003541492.1|  PREDICTED: uncharacterized membrane protein ...    274   2e-84    
ref|XP_006427482.1|  hypothetical protein CICLE_v10025286mg             273   3e-84    Citrus clementina [clementine]
gb|KJB70655.1|  hypothetical protein B456_011G085700                    273   4e-84    Gossypium raimondii
ref|XP_004486637.1|  PREDICTED: uncharacterized membrane protein ...    273   5e-84    Cicer arietinum [garbanzo]
ref|XP_002298207.2|  hypothetical protein POPTR_0001s21170g             269   6e-84    
ref|XP_003609485.1|  hypothetical protein MTR_4g116210                  273   6e-84    Medicago truncatula
ref|XP_010063536.1|  PREDICTED: uncharacterized membrane protein ...    272   1e-83    Eucalyptus grandis [rose gum]
ref|XP_011012238.1|  PREDICTED: uncharacterized protein LOC105116...    269   2e-83    Populus euphratica
ref|XP_007138470.1|  hypothetical protein PHAVU_009G211900g             271   3e-83    Phaseolus vulgaris [French bean]
emb|CAN69082.1|  hypothetical protein VITISV_014065                     269   3e-83    Vitis vinifera
ref|XP_006465227.1|  PREDICTED: uncharacterized membrane protein ...    269   1e-82    Citrus sinensis [apfelsine]
ref|XP_004488508.1|  PREDICTED: uncharacterized protein LOC101489674    268   3e-82    Cicer arietinum [garbanzo]
ref|XP_011012237.1|  PREDICTED: uncharacterized protein LOC105116...    268   3e-82    Populus euphratica
ref|XP_006852818.1|  hypothetical protein AMTR_s00033p00175020          268   4e-82    Amborella trichopoda
gb|AAN62343.1|AF506028_10  nodulin-like protein                         267   6e-82    Citrus trifoliata [hardy orange]
ref|XP_004303264.1|  PREDICTED: protein NUCLEAR FUSION DEFECTIVE 4      266   2e-81    Fragaria vesca subsp. vesca
gb|KEH37893.1|  nodulin-like/MFS transporter                            265   7e-81    Medicago truncatula
ref|XP_010687781.1|  PREDICTED: uncharacterized protein LOC104901852    265   1e-80    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008351294.1|  PREDICTED: uncharacterized membrane protein ...    261   1e-80    
gb|EYU21686.1|  hypothetical protein MIMGU_mgv1a003901mg                261   7e-80    Erythranthe guttata [common monkey flower]
ref|XP_009401386.1|  PREDICTED: uncharacterized protein LOC103985421    260   4e-79    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010537919.1|  PREDICTED: uncharacterized protein LOC104812458    257   6e-78    Tarenaya hassleriana [spider flower]
ref|XP_009338491.1|  PREDICTED: uncharacterized protein LOC103930831    256   7e-78    Pyrus x bretschneideri [bai li]
ref|XP_004165074.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    254   8e-77    
ref|XP_004152187.1|  PREDICTED: uncharacterized protein LOC101211550    254   8e-77    Cucumis sativus [cucumbers]
ref|XP_010480493.1|  PREDICTED: uncharacterized protein LOC104759241    243   8e-77    Camelina sativa [gold-of-pleasure]
ref|XP_007023328.1|  Major facilitator superfamily protein              252   4e-76    
gb|EPS71124.1|  hypothetical protein M569_03631                         252   4e-76    Genlisea aurea
ref|XP_010691075.1|  PREDICTED: uncharacterized protein LOC104904508    251   9e-76    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011044882.1|  PREDICTED: probable transporter mch1               249   6e-75    Populus euphratica
ref|XP_006385272.1|  nodulin family protein                             249   8e-75    Populus trichocarpa [western balsam poplar]
ref|XP_008454196.1|  PREDICTED: LOW QUALITY PROTEIN: probable tra...    248   1e-74    
ref|XP_009409982.1|  PREDICTED: uncharacterized protein LOC103992...    248   1e-74    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010240084.1|  PREDICTED: uncharacterized protein LOC100826...    245   3e-74    
gb|EMS46208.1|  hypothetical protein TRIUR3_22471                       241   2e-73    Triticum urartu
dbj|BAK00222.1|  predicted protein                                      244   3e-73    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KCW70764.1|  hypothetical protein EUGRSUZ_F03926                     244   4e-73    Eucalyptus grandis [rose gum]
ref|XP_003580087.1|  PREDICTED: uncharacterized protein LOC100826...    244   5e-73    Brachypodium distachyon [annual false brome]
ref|XP_006653575.1|  PREDICTED: uncharacterized protein LOC102700706    243   7e-73    
ref|XP_002446751.1|  hypothetical protein SORBIDRAFT_06g021760          243   1e-72    Sorghum bicolor [broomcorn]
ref|NP_001053236.1|  Os04g0502800                                       243   1e-72    
emb|CAH67585.1|  OSIGBa0112M24.2                                        243   2e-72    Oryza sativa [red rice]
gb|EEE61279.1|  hypothetical protein OsJ_15362                          243   2e-72    Oryza sativa Japonica Group [Japonica rice]
gb|EEC77582.1|  hypothetical protein OsI_16534                          243   3e-72    Oryza sativa Indica Group [Indian rice]
gb|EMT26269.1|  hypothetical protein F775_26749                         241   3e-72    
emb|CAE02931.3|  OSJNBa0014K14.3                                        243   3e-72    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006307140.1|  hypothetical protein CARUB_v10008730mg             241   9e-72    Capsella rubella
ref|XP_010227968.1|  PREDICTED: LOW QUALITY PROTEIN: probable tra...    241   1e-71    
ref|XP_004976136.1|  PREDICTED: uncharacterized protein LOC101785714    241   1e-71    Setaria italica
ref|XP_006656700.1|  PREDICTED: uncharacterized protein LOC102716699    240   2e-71    Oryza brachyantha
ref|XP_004964691.1|  PREDICTED: uncharacterized protein LOC101759997    240   2e-71    Setaria italica
ref|NP_001056968.1|  Os06g0179200                                       239   2e-71    
gb|EAY99898.1|  hypothetical protein OsI_21894                          239   2e-71    Oryza sativa Indica Group [Indian rice]
ref|NP_001168515.1|  hypothetical protein                               235   6e-71    
ref|XP_009363919.1|  PREDICTED: uncharacterized protein LOC103953849    238   1e-70    Pyrus x bretschneideri [bai li]
ref|XP_008668342.1|  PREDICTED: hypothetical protein isoform X1         238   2e-70    Zea mays [maize]
ref|NP_178168.1|  Major facilitator superfamily protein                 236   4e-70    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002892879.1|  hypothetical protein ARALYDRAFT_312565             236   5e-70    Arabidopsis lyrata subsp. lyrata
ref|XP_002437947.1|  hypothetical protein SORBIDRAFT_10g005340          236   7e-70    Sorghum bicolor [broomcorn]
ref|XP_010532110.1|  PREDICTED: uncharacterized protein LOC104808196    234   2e-69    
ref|XP_008648081.1|  PREDICTED: hypothetical protein isoform X1         234   2e-69    
dbj|BAK00120.1|  predicted protein                                      234   4e-69    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010537918.1|  PREDICTED: uncharacterized protein LOC104812457    231   3e-68    Tarenaya hassleriana [spider flower]
ref|XP_008659217.1|  PREDICTED: uncharacterized protein LOC103637995    231   4e-68    Zea mays [maize]
ref|XP_006389807.1|  hypothetical protein EUTSA_v10018350mg             230   1e-67    Eutrema salsugineum [saltwater cress]
ref|XP_006369330.1|  hypothetical protein POPTR_0001s21170g             225   1e-67    
ref|XP_006302052.1|  hypothetical protein CARUB_v10020035mg             229   4e-67    
ref|XP_002887824.1|  hypothetical protein ARALYDRAFT_895939             228   1e-66    Arabidopsis lyrata subsp. lyrata
ref|XP_010472910.1|  PREDICTED: uncharacterized protein LOC104752465    227   1e-66    Camelina sativa [gold-of-pleasure]
ref|XP_010417694.1|  PREDICTED: uncharacterized protein LOC104703384    227   1e-66    Camelina sativa [gold-of-pleasure]
ref|XP_003564216.1|  PREDICTED: uncharacterized protein LOC100833364    226   2e-66    Brachypodium distachyon [annual false brome]
emb|CDX87321.1|  BnaA07g35520D                                          226   3e-66    
ref|XP_009106737.1|  PREDICTED: uncharacterized protein LOC103832476    226   3e-66    Brassica rapa
emb|CDY39967.1|  BnaC06g40450D                                          224   1e-65    Brassica napus [oilseed rape]
ref|XP_003597942.1|  Nodulin-like protein                               217   2e-65    
ref|XP_010691077.1|  PREDICTED: uncharacterized protein LOC104904509    224   9e-65    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009104470.1|  PREDICTED: uncharacterized protein LOC103830442    222   1e-64    Brassica rapa
emb|CDX67953.1|  BnaA07g19930D                                          222   1e-64    
emb|CDX79379.1|  BnaC06g19240D                                          221   2e-64    
gb|KFK42463.1|  hypothetical protein AALP_AA2G260200                    221   2e-64    Arabis alpina [alpine rockcress]
gb|EAZ06229.1|  hypothetical protein OsI_28471                          221   3e-64    Oryza sativa Indica Group [Indian rice]
ref|XP_010429940.1|  PREDICTED: uncharacterized protein LOC104714323    220   5e-64    Camelina sativa [gold-of-pleasure]
emb|CDX67954.1|  BnaA07g19940D                                          220   5e-64    
emb|CDX79374.1|  BnaC06g19290D                                          220   5e-64    
ref|XP_009104471.1|  PREDICTED: uncharacterized protein LOC103830443    220   5e-64    Brassica rapa
dbj|BAK02404.1|  predicted protein                                      220   7e-64    Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAC98515.1|  nodulin-like protein                                   218   6e-63    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010097162.1|  hypothetical protein L484_025707                   205   9e-63    
ref|XP_006659251.1|  PREDICTED: probable transporter mch1-like          212   5e-61    Oryza brachyantha
ref|XP_001757080.1|  predicted protein                                  204   6e-58    
ref|XP_002530466.1|  conserved hypothetical protein                     202   1e-57    
gb|EEE65202.1|  hypothetical protein OsJ_20331                          205   3e-57    Oryza sativa Japonica Group [Japonica rice]
ref|XP_001762698.1|  predicted protein                                  202   3e-57    
ref|XP_002960946.1|  hypothetical protein SELMODRAFT_266544             198   9e-56    
ref|XP_002967061.1|  hypothetical protein SELMODRAFT_87151              196   6e-55    
gb|EEC83207.1|  hypothetical protein OsI_28473                          190   5e-51    Oryza sativa Indica Group [Indian rice]
ref|XP_001758479.1|  predicted protein                                  182   9e-50    
ref|XP_009766430.1|  PREDICTED: uncharacterized protein LOC104217799    168   8e-45    Nicotiana sylvestris
ref|XP_007150777.1|  hypothetical protein PHAVU_005G179700g             163   9e-45    Phaseolus vulgaris [French bean]
ref|XP_008349349.1|  PREDICTED: uncharacterized protein LOC103412580    168   1e-44    Malus domestica [apple tree]
dbj|BAH20083.1|  AT4G34950                                              162   4e-44    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009349684.1|  PREDICTED: uncharacterized protein LOC103941215    167   4e-44    Pyrus x bretschneideri [bai li]
ref|XP_009622121.1|  PREDICTED: probable transporter mch1               166   4e-44    Nicotiana tomentosiformis
ref|XP_006367793.1|  PREDICTED: uncharacterized protein LOC102602269    166   4e-44    Solanum tuberosum [potatoes]
gb|KHN33680.1|  hypothetical protein glysoja_013686                     162   5e-44    Glycine soja [wild soybean]
ref|XP_008346339.1|  PREDICTED: uncharacterized protein LOC103409309    166   9e-44    Malus domestica [apple tree]
ref|XP_004248658.1|  PREDICTED: probable transporter mch1               165   1e-43    Solanum lycopersicum
gb|ABR18255.1|  unknown                                                 166   1e-43    Picea sitchensis
ref|XP_002462740.1|  hypothetical protein SORBIDRAFT_02g031140          164   3e-43    Sorghum bicolor [broomcorn]
ref|XP_010266799.1|  PREDICTED: probable transporter mch1               164   3e-43    Nelumbo nucifera [Indian lotus]
ref|XP_010526802.1|  PREDICTED: uncharacterized protein LOC104804268    164   3e-43    Tarenaya hassleriana [spider flower]
ref|XP_011092895.1|  PREDICTED: probable transporter mch1               164   4e-43    Sesamum indicum [beniseed]
gb|AGT17215.1|  Major facilitator superfamily domain, general sub...    164   4e-43    Saccharum hybrid cultivar R570
gb|KFK30131.1|  hypothetical protein AALP_AA7G221100                    164   5e-43    Arabis alpina [alpine rockcress]
ref|XP_006412170.1|  hypothetical protein EUTSA_v10024800mg             162   6e-43    
emb|CDO96930.1|  unnamed protein product                                155   6e-43    Coffea canephora [robusta coffee]
ref|XP_010436257.1|  PREDICTED: uncharacterized protein LOC104719977    160   6e-43    Camelina sativa [gold-of-pleasure]
ref|XP_011001982.1|  PREDICTED: probable transporter mch1               163   8e-43    Populus euphratica
ref|XP_006283706.1|  hypothetical protein CARUB_v10004777mg             161   9e-43    
ref|XP_002306177.1|  nodulin family protein                             163   9e-43    Populus trichocarpa [western balsam poplar]
ref|XP_010028707.1|  PREDICTED: uncharacterized protein LOC104418927    163   9e-43    Eucalyptus grandis [rose gum]
ref|XP_008235996.1|  PREDICTED: uncharacterized protein LOC103334808    162   1e-42    
ref|XP_004957481.1|  PREDICTED: uncharacterized protein LOC101778324    162   1e-42    Setaria italica
ref|XP_009340231.1|  PREDICTED: uncharacterized protein LOC103932378    162   1e-42    Pyrus x bretschneideri [bai li]
ref|NP_195221.1|  major facilitator family protein                      162   1e-42    Arabidopsis thaliana [mouse-ear cress]
ref|XP_003522712.1|  PREDICTED: uncharacterized protein LOC100813607    162   2e-42    Glycine max [soybeans]
ref|XP_008457674.1|  PREDICTED: uncharacterized protein LOC103497317    162   2e-42    Cucumis melo [Oriental melon]
ref|XP_006660896.1|  PREDICTED: uncharacterized protein LOC102701295    162   2e-42    Oryza brachyantha
gb|KDP29628.1|  hypothetical protein JCGZ_18790                         162   2e-42    Jatropha curcas
dbj|BAJ93070.1|  predicted protein                                      162   2e-42    Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDX69099.1|  BnaC01g03540D                                          162   2e-42    
gb|KEH30508.1|  nodulin-like/MFS transporter                            162   2e-42    Medicago truncatula
ref|XP_006412169.1|  hypothetical protein EUTSA_v10024800mg             162   2e-42    Eutrema salsugineum [saltwater cress]
gb|ACJ85602.1|  unknown                                                 162   2e-42    Medicago truncatula
gb|EMT16371.1|  hypothetical protein F775_20469                         159   3e-42    
gb|EEC84958.1|  hypothetical protein OsI_32184                          161   3e-42    Oryza sativa Indica Group [Indian rice]
ref|NP_001063787.1|  Os09g0536700                                       161   3e-42    
gb|EYU40425.1|  hypothetical protein MIMGU_mgv1a004038mg                161   4e-42    Erythranthe guttata [common monkey flower]
gb|EEE50938.1|  hypothetical protein OsJ_31482                          161   4e-42    Oryza sativa Japonica Group [Japonica rice]
ref|XP_004505781.1|  PREDICTED: uncharacterized membrane protein ...    160   5e-42    Cicer arietinum [garbanzo]
ref|XP_006851905.1|  hypothetical protein AMTR_s00041p00157100          160   6e-42    Amborella trichopoda
ref|XP_009136319.1|  PREDICTED: probable transporter mch1               160   6e-42    Brassica rapa
emb|CDY02250.1|  BnaA03g39170D                                          160   6e-42    
ref|XP_009107674.1|  PREDICTED: probable transporter mch1               160   7e-42    Brassica rapa
ref|XP_002867099.1|  nodulin family protein                             160   7e-42    
ref|XP_010447017.1|  PREDICTED: probable transporter mch1               160   8e-42    Camelina sativa [gold-of-pleasure]
ref|XP_003578521.1|  PREDICTED: uncharacterized protein LOC100831486    160   9e-42    Brachypodium distachyon [annual false brome]
ref|XP_007199775.1|  hypothetical protein PRUPE_ppa003698mg             160   9e-42    Prunus persica
ref|XP_010526898.1|  PREDICTED: uncharacterized protein LOC104804333    159   1e-41    Tarenaya hassleriana [spider flower]
gb|EAZ42068.1|  hypothetical protein OsJ_26629                          159   2e-41    Oryza sativa Japonica Group [Japonica rice]
ref|XP_011046453.1|  PREDICTED: uncharacterized protein LOC105141056    159   2e-41    Populus euphratica
ref|XP_010246855.1|  PREDICTED: probable transporter mch1               159   2e-41    Nelumbo nucifera [Indian lotus]
ref|XP_004147031.1|  PREDICTED: uncharacterized protein LOC101216743    159   2e-41    Cucumis sativus [cucumbers]
ref|XP_007137356.1|  hypothetical protein PHAVU_009G120400g             159   2e-41    Phaseolus vulgaris [French bean]
ref|XP_004158381.1|  PREDICTED: uncharacterized LOC101216743            159   3e-41    
ref|XP_009412967.1|  PREDICTED: probable transporter mch1               159   3e-41    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010437548.1|  PREDICTED: probable transporter mch1               159   3e-41    Camelina sativa [gold-of-pleasure]
ref|XP_006409413.1|  hypothetical protein EUTSA_v10022630mg             158   4e-41    Eutrema salsugineum [saltwater cress]
ref|XP_010935083.1|  PREDICTED: probable transporter mch1               157   6e-41    Elaeis guineensis
gb|KHN39887.1|  hypothetical protein glysoja_020627                     151   7e-41    Glycine soja [wild soybean]
ref|XP_006422631.1|  hypothetical protein CICLE_v10028125mg             157   7e-41    Citrus clementina [clementine]
ref|XP_006486761.1|  PREDICTED: uncharacterized membrane protein ...    157   7e-41    Citrus sinensis [apfelsine]
gb|KFK40073.1|  hypothetical protein AALP_AA3G326700                    157   7e-41    Arabis alpina [alpine rockcress]
ref|XP_009112395.1|  PREDICTED: probable transporter mch1               157   9e-41    Brassica rapa
gb|EMS65634.1|  hypothetical protein TRIUR3_01886                       157   1e-40    Triticum urartu
ref|XP_006359676.1|  PREDICTED: uncharacterized protein LOC102592169    157   1e-40    Solanum tuberosum [potatoes]
emb|CDY47472.1|  BnaA09g08810D                                          157   1e-40    Brassica napus [oilseed rape]
gb|EMS50901.1|  hypothetical protein TRIUR3_11662                       148   1e-40    Triticum urartu
ref|XP_004231025.1|  PREDICTED: uncharacterized protein LOC101261467    157   1e-40    Solanum lycopersicum
ref|XP_010090321.1|  hypothetical protein L484_024986                   156   2e-40    
emb|CDX76306.1|  BnaA08g10940D                                          156   2e-40    
ref|XP_010941299.1|  PREDICTED: uncharacterized protein LOC105059626    156   2e-40    Elaeis guineensis
ref|XP_002312970.1|  nodulin family protein                             156   3e-40    Populus trichocarpa [western balsam poplar]
ref|XP_009108692.1|  PREDICTED: probable transporter mch1               156   3e-40    Brassica rapa
gb|KJB32647.1|  hypothetical protein B456_005G253600                    155   3e-40    Gossypium raimondii
ref|XP_002277695.1|  PREDICTED: probable transporter mch1               155   4e-40    Vitis vinifera
ref|XP_008808634.1|  PREDICTED: probable transporter mch1               155   5e-40    Phoenix dactylifera
gb|AFG47257.1|  hypothetical protein 0_6091_01                          146   6e-40    Pinus taeda
gb|AEW07590.1|  hypothetical protein 0_6091_01                          145   6e-40    Pinus lambertiana
gb|AEW07589.1|  hypothetical protein 0_6091_01                          145   7e-40    Pinus radiata
emb|CDY26781.1|  BnaC09g09080D                                          154   7e-40    Brassica napus [oilseed rape]
gb|AFG47255.1|  hypothetical protein 0_6091_01                          145   9e-40    Pinus taeda
ref|XP_008447967.1|  PREDICTED: uncharacterized protein LOC103490296    154   9e-40    
gb|KHN05409.1|  Putative membrane protein YMR155W                       154   2e-39    Glycine soja [wild soybean]
ref|XP_010467394.1|  PREDICTED: uncharacterized protein LOC104747461    154   2e-39    Camelina sativa [gold-of-pleasure]
ref|XP_010516479.1|  PREDICTED: uncharacterized protein LOC104792123    153   2e-39    Camelina sativa [gold-of-pleasure]
ref|XP_006296698.1|  hypothetical protein CARUB_v10013397mg             153   2e-39    Capsella rubella
ref|NP_179257.1|  Major facilitator superfamily protein                 153   2e-39    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002886064.1|  nodulin family protein                             153   2e-39    Arabidopsis lyrata subsp. lyrata
gb|KHG25802.1|  Membrane protein                                        153   3e-39    Gossypium arboreum [tree cotton]
ref|XP_003540845.1|  PREDICTED: uncharacterized membrane protein ...    153   3e-39    Glycine max [soybeans]
ref|XP_010489237.1|  PREDICTED: uncharacterized protein LOC104766963    153   3e-39    Camelina sativa [gold-of-pleasure]
ref|XP_007041879.1|  Major facilitator superfamily protein              152   5e-39    Theobroma cacao [chocolate]
emb|CDP01885.1|  unnamed protein product                                152   5e-39    Coffea canephora [robusta coffee]
ref|XP_001758608.1|  predicted protein                                  152   7e-39    
ref|XP_007046677.1|  Major facilitator superfamily protein              151   1e-38    
ref|XP_003537801.1|  PREDICTED: uncharacterized membrane protein ...    151   2e-38    Glycine max [soybeans]
ref|XP_007131697.1|  hypothetical protein PHAVU_011G034300g             150   2e-38    Phaseolus vulgaris [French bean]
ref|XP_002967667.1|  hypothetical protein SELMODRAFT_88785              149   6e-38    
ref|XP_002964365.1|  hypothetical protein SELMODRAFT_166510             149   7e-38    
ref|XP_006846539.1|  hypothetical protein AMTR_s00018p00201390          149   9e-38    Amborella trichopoda
ref|XP_006383090.1|  hypothetical protein POPTR_0005s11450g             149   1e-37    
ref|XP_006425443.1|  hypothetical protein CICLE_v10027345mg             147   2e-37    Citrus clementina [clementine]
ref|XP_010028708.1|  PREDICTED: uncharacterized protein LOC104418928    147   3e-37    Eucalyptus grandis [rose gum]
ref|XP_011043179.1|  PREDICTED: uncharacterized membrane protein ...    147   3e-37    Populus euphratica
gb|KCW53165.1|  hypothetical protein EUGRSUZ_J02447                     147   4e-37    Eucalyptus grandis [rose gum]
ref|XP_010033499.1|  PREDICTED: uncharacterized protein LOC104422769    146   5e-37    Eucalyptus grandis [rose gum]
ref|XP_004512144.1|  PREDICTED: probable transporter MCH1-like          146   6e-37    Cicer arietinum [garbanzo]
ref|XP_004289856.1|  PREDICTED: protein NUCLEAR FUSION DEFECTIVE ...    146   7e-37    Fragaria vesca subsp. vesca
gb|KJB15777.1|  hypothetical protein B456_002G195700                    145   1e-36    Gossypium raimondii
ref|XP_001780273.1|  predicted protein                                  145   2e-36    
gb|KJB17640.1|  hypothetical protein B456_003G009000                    145   2e-36    Gossypium raimondii
gb|KHG02945.1|  Inner membrane yhjX                                     145   2e-36    Gossypium arboreum [tree cotton]
gb|KDP46769.1|  hypothetical protein JCGZ_06557                         144   4e-36    Jatropha curcas
ref|XP_002529652.1|  conserved hypothetical protein                     144   5e-36    Ricinus communis
gb|EAZ30529.1|  hypothetical protein OsJ_14578                          145   1e-35    Oryza sativa Japonica Group [Japonica rice]
ref|XP_011462264.1|  PREDICTED: protein NUCLEAR FUSION DEFECTIVE ...    142   3e-35    Fragaria vesca subsp. vesca
dbj|BAG89634.1|  unnamed protein product                                141   3e-35    Oryza sativa Japonica Group [Japonica rice]
emb|CAH66429.1|  OSIGBa0096P03.3                                        141   4e-35    Oryza sativa [red rice]
ref|XP_010917688.1|  PREDICTED: uncharacterized membrane protein ...    141   5e-35    Elaeis guineensis
gb|EPS72388.1|  hypothetical protein M569_02370                         140   9e-35    Genlisea aurea
ref|XP_008241911.1|  PREDICTED: uncharacterized protein LOC103340299    139   2e-34    Prunus mume [ume]
ref|XP_007203698.1|  hypothetical protein PRUPE_ppa022013mg             139   3e-34    Prunus persica
tpg|DAA54793.1|  TPA: hypothetical protein ZEAMMB73_389508              136   4e-34    
emb|CDX89732.1|  BnaC03g46460D                                          138   5e-34    
ref|XP_004975412.1|  PREDICTED: uncharacterized protein LOC101770...    137   5e-34    
gb|KEH27591.1|  MFS transporter                                         137   6e-34    
ref|XP_009400855.1|  PREDICTED: uncharacterized protein LOC103984984    138   6e-34    
ref|XP_003612193.1|  hypothetical protein MTR_5g022380                  137   1e-33    
ref|XP_004975411.1|  PREDICTED: uncharacterized protein LOC101770...    137   1e-33    
ref|XP_006653332.1|  PREDICTED: uncharacterized protein LOC102716407    138   1e-33    
ref|XP_010690391.1|  PREDICTED: probable transporter mch1               137   2e-33    
ref|XP_008801875.1|  PREDICTED: uncharacterized protein LOC103715...    136   2e-33    
gb|ACN35975.1|  unknown                                                 134   2e-33    
ref|NP_001149402.1|  nodulin-like protein                               136   2e-33    
tpg|DAA54792.1|  TPA: nodulin-like protein                              136   2e-33    
ref|XP_008798934.1|  PREDICTED: probable transporter mch1               134   7e-33    
ref|XP_002442621.1|  hypothetical protein SORBIDRAFT_08g023130          134   1e-32    
ref|XP_010459545.1|  PREDICTED: probable transporter MCH1 isoform X2    132   1e-32    
ref|XP_010498299.1|  PREDICTED: uncharacterized protein LOC104776010    134   1e-32    
ref|XP_010459543.1|  PREDICTED: uncharacterized protein LOC104740...    132   2e-32    
ref|XP_009783274.1|  PREDICTED: uncharacterized protein LOC104231909    133   2e-32    
ref|XP_002987406.1|  hypothetical protein SELMODRAFT_235284             133   2e-32    
ref|XP_010926825.1|  PREDICTED: probable transporter mch1               134   3e-32    
emb|CDY19262.1|  BnaC05g14630D                                          133   3e-32    
ref|XP_009403771.1|  PREDICTED: probable transporter mch1               133   3e-32    
ref|XP_002992049.1|  hypothetical protein SELMODRAFT_134679             133   4e-32    
ref|XP_002964118.1|  hypothetical protein SELMODRAFT_166743             133   4e-32    
emb|CDP16703.1|  unnamed protein product                                133   5e-32    
ref|XP_002964117.1|  hypothetical protein SELMODRAFT_62386              132   5e-32    
ref|XP_009601173.1|  PREDICTED: probable transporter mch1               132   7e-32    
ref|XP_010495184.1|  PREDICTED: uncharacterized protein LOC104772249    132   7e-32    
ref|XP_010524260.1|  PREDICTED: probable transporter mch1               132   8e-32    
ref|XP_002979925.1|  hypothetical protein SELMODRAFT_178001             132   8e-32    
emb|CDY26708.1|  BnaA06g13140D                                          132   8e-32    
gb|ACR38200.1|  unknown                                                 127   8e-32    
ref|XP_010420035.1|  PREDICTED: uncharacterized protein LOC104705...    132   1e-31    
ref|XP_002446304.1|  hypothetical protein SORBIDRAFT_06g013900          132   1e-31    
ref|XP_010453528.1|  PREDICTED: uncharacterized protein LOC104735432    132   1e-31    
ref|XP_006287365.1|  hypothetical protein CARUB_v10000565mg             131   1e-31    
ref|XP_009379410.1|  PREDICTED: uncharacterized protein LOC103967826    131   1e-31    
ref|XP_004963339.1|  PREDICTED: probable transporter mch1-like          131   1e-31    
gb|KHN01934.1|  Putative transporter MCH1                               130   1e-31    
ref|NP_001168963.1|  uncharacterized protein LOC100382788               130   2e-31    
gb|KFK25643.1|  hypothetical protein AALP_AA8G141300                    131   2e-31    
ref|XP_008662107.1|  PREDICTED: hypothetical protein isoform X1         130   2e-31    
ref|XP_001778186.1|  predicted protein                                  131   2e-31    
ref|XP_006416551.1|  hypothetical protein EUTSA_v10007356mg             130   2e-31    
ref|XP_006307112.1|  hypothetical protein CARUB_v10008700mg             130   2e-31    
emb|CDX70543.1|  BnaC03g06270D                                          130   3e-31    
ref|XP_010933941.1|  PREDICTED: probable transporter mch1 isoform X1    130   3e-31    
ref|XP_010540539.1|  PREDICTED: probable transporter MCH1 isoform X2    130   3e-31    
ref|XP_010540538.1|  PREDICTED: probable transporter MCH1 isoform X1    130   3e-31    
ref|XP_003523049.1|  PREDICTED: uncharacterized protein LOC100775...    130   3e-31    
ref|NP_173328.1|  nodulin-like and major facilitator domain-conta...    130   3e-31    
ref|XP_004975414.1|  PREDICTED: uncharacterized protein LOC101772491    130   4e-31    
tpg|DAA38148.1|  TPA: hypothetical protein ZEAMMB73_491057              130   4e-31    
ref|XP_010550225.1|  PREDICTED: uncharacterized protein LOC104821...    129   4e-31    
ref|XP_010913012.1|  PREDICTED: uncharacterized protein LOC105038807    130   4e-31    
ref|NP_001167921.1|  hypothetical protein                               130   5e-31    
gb|KHN19369.1|  Putative transporter MCH1                               128   6e-31    
ref|XP_010550224.1|  PREDICTED: probable transporter mch1 isoform X1    130   6e-31    
ref|XP_006390390.1|  hypothetical protein EUTSA_v10018391mg             129   7e-31    
emb|CDX78561.1|  BnaA03g04730D                                          129   8e-31    
ref|XP_006302127.1|  hypothetical protein CARUB_v10020132mg             129   8e-31    
ref|XP_003579618.1|  PREDICTED: probable transporter mch1               129   8e-31    
ref|XP_009131387.1|  PREDICTED: uncharacterized protein LOC103856061    129   8e-31    
gb|KHG00245.1|  putative transporter MCH1                               129   9e-31    
ref|XP_003579078.1|  PREDICTED: uncharacterized protein LOC100846557    129   9e-31    
ref|XP_009385482.1|  PREDICTED: probable transporter mch1               129   1e-30    
ref|XP_007209882.1|  hypothetical protein PRUPE_ppa003974mg             129   1e-30    
ref|XP_006838662.1|  hypothetical protein AMTR_s00002p00241480          129   1e-30    
ref|NP_196916.1|  major facilitator protein                             129   1e-30    
ref|XP_002871602.1|  nodulin family protein                             129   1e-30    
ref|NP_850497.1|  major facilitator protein                             128   1e-30    
ref|XP_008374915.1|  PREDICTED: uncharacterized protein LOC103438155    128   1e-30    
ref|XP_002887558.1|  nodulin family protein                             128   1e-30    
ref|XP_008790755.1|  PREDICTED: uncharacterized protein LOC103707...    128   1e-30    
ref|XP_010428471.1|  PREDICTED: uncharacterized protein LOC104713117    128   2e-30    
ref|XP_008790753.1|  PREDICTED: uncharacterized protein LOC103707...    128   2e-30    
ref|XP_004138620.1|  PREDICTED: uncharacterized protein LOC101211655    128   2e-30    
ref|XP_002890306.1|  nodulin family protein                             127   2e-30    
ref|XP_009149377.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    127   2e-30    
ref|NP_566157.1|  major facilitator protein                             128   2e-30    
ref|XP_002992050.1|  hypothetical protein SELMODRAFT_42415              128   2e-30    
gb|AAP04143.1|  unknown protein                                         127   2e-30    
ref|XP_008394084.1|  PREDICTED: uncharacterized protein LOC103456200    127   2e-30    
ref|NP_177616.1|  nodulin-like and major facilitator domain-conta...    127   2e-30    
ref|XP_002963237.1|  hypothetical protein SELMODRAFT_79408              128   3e-30    
ref|XP_002974541.1|  hypothetical protein SELMODRAFT_101779             128   3e-30    
gb|EMT05600.1|  hypothetical protein F775_14441                         128   3e-30    
ref|XP_008801667.1|  PREDICTED: uncharacterized protein LOC103715713    128   3e-30    
ref|XP_010416334.1|  PREDICTED: uncharacterized protein LOC104702206    127   3e-30    
gb|EYU34813.1|  hypothetical protein MIMGU_mgv1a003413mg                128   3e-30    
ref|XP_003528176.1|  PREDICTED: uncharacterized protein LOC100799596    127   3e-30    
ref|NP_001183397.1|  hypothetical protein                               127   3e-30    
ref|XP_008668551.1|  PREDICTED: hypothetical protein isoform X3         127   4e-30    
gb|KCW83147.1|  hypothetical protein EUGRSUZ_B00102                     126   4e-30    
ref|XP_008777475.1|  PREDICTED: probable transporter mch1               127   4e-30    
ref|XP_006352868.1|  PREDICTED: uncharacterized protein LOC102601846    126   4e-30    
ref|XP_010927760.1|  PREDICTED: uncharacterized protein LOC105049721    127   4e-30    
ref|XP_004233292.1|  PREDICTED: probable transporter mch1               127   4e-30    
ref|XP_004974007.1|  PREDICTED: uncharacterized protein LOC101764387    127   5e-30    
ref|XP_011098901.1|  PREDICTED: uncharacterized protein LOC105177434    127   5e-30    
ref|XP_008801876.1|  PREDICTED: uncharacterized protein LOC103715...    126   5e-30    
ref|XP_004297562.1|  PREDICTED: protein NUCLEAR FUSION DEFECTIVE ...    127   5e-30    
ref|XP_006399922.1|  hypothetical protein EUTSA_v10013083mg             126   5e-30    
ref|XP_004138144.1|  PREDICTED: uncharacterized protein LOC101216552    126   5e-30    
ref|XP_009141377.1|  PREDICTED: uncharacterized protein LOC103865331    126   6e-30    
ref|XP_010680020.1|  PREDICTED: probable transporter mch1               127   6e-30    
ref|XP_009402249.1|  PREDICTED: uncharacterized protein LOC103986091    127   6e-30    
ref|XP_008668550.1|  PREDICTED: hypothetical protein isoform X2         127   6e-30    
ref|XP_010249040.1|  PREDICTED: uncharacterized protein LOC104591744    127   7e-30    
ref|XP_009343443.1|  PREDICTED: uncharacterized protein LOC103935402    126   7e-30    
gb|KDO63912.1|  hypothetical protein CISIN_1g007654mg                   126   7e-30    
ref|XP_009802951.1|  PREDICTED: uncharacterized protein LOC104248396    127   7e-30    
ref|XP_002445809.1|  hypothetical protein SORBIDRAFT_07g026140          127   7e-30    
gb|EPS64558.1|  hypothetical protein M569_10221                         126   7e-30    
ref|XP_006848262.1|  hypothetical protein AMTR_s00013p00058430          127   7e-30    
ref|XP_009606507.1|  PREDICTED: uncharacterized protein LOC104100862    127   8e-30    
emb|CDP15002.1|  unnamed protein product                                127   8e-30    
ref|NP_001146179.1|  uncharacterized protein LOC100279749               127   8e-30    
ref|XP_010663424.1|  PREDICTED: uncharacterized protein LOC100250053    126   8e-30    
ref|XP_009104745.1|  PREDICTED: uncharacterized protein LOC103830685    126   8e-30    
ref|XP_006399921.1|  hypothetical protein EUTSA_v10013083mg             126   8e-30    
gb|AFW61584.1|  nodulin-like protein                                    127   9e-30    
ref|XP_009597103.1|  PREDICTED: probable transporter mch1 isoform X2    126   9e-30    
ref|XP_006351510.1|  PREDICTED: uncharacterized protein LOC102597647    126   1e-29    
ref|XP_010026435.1|  PREDICTED: uncharacterized protein LOC104416...    126   1e-29    
ref|XP_010471567.1|  PREDICTED: uncharacterized protein LOC104751346    125   1e-29    
ref|XP_006357196.1|  PREDICTED: uncharacterized protein LOC102603984    126   1e-29    
ref|XP_009413001.1|  PREDICTED: probable transporter mch1               126   1e-29    
ref|XP_004299628.1|  PREDICTED: protein NUCLEAR FUSION DEFECTIVE ...    125   1e-29    
ref|XP_009597102.1|  PREDICTED: probable transporter mch1 isoform X1    126   1e-29    
emb|CAH10068.1|  Unknown similar to A.thaliana Hypothetical prote...    125   1e-29    
gb|KJB11690.1|  hypothetical protein B456_001G272000                    125   1e-29    
emb|CAH10046.1|  Unknown similar to A.thaliana Hypothetical prote...    125   2e-29    
ref|XP_007161720.1|  hypothetical protein PHAVU_001G092800g             126   2e-29    
gb|ACJ22502.1|  unknown                                                 125   2e-29    
gb|KDO63907.1|  hypothetical protein CISIN_1g007654mg                   125   2e-29    
ref|XP_006447047.1|  hypothetical protein CICLE_v10014684mg             125   2e-29    
ref|XP_010509767.1|  PREDICTED: uncharacterized protein LOC104786129    125   2e-29    
ref|XP_002511499.1|  conserved hypothetical protein                     125   2e-29    
ref|NP_001152103.1|  nodulin-like protein                               125   2e-29    
emb|CDX68165.1|  BnaA07g22050D                                          125   2e-29    
emb|CAH10054.1|  Unknown similar to A.thaliana Hypothetical prote...    125   2e-29    
ref|XP_003617344.1|  Nodulin-related protein                            125   2e-29    
gb|EAY84053.1|  hypothetical protein OsI_39282                          125   2e-29    
emb|CAH10204.1|  Unknown similar to A.thaliana Hypothetical prote...    125   2e-29    
gb|KJB11688.1|  hypothetical protein B456_001G272000                    125   3e-29    
gb|KDO76012.1|  hypothetical protein CISIN_1g008482mg                   124   3e-29    
ref|XP_009404757.1|  PREDICTED: uncharacterized protein LOC103987995    125   3e-29    
ref|XP_011087197.1|  PREDICTED: uncharacterized protein LOC105168753    125   3e-29    
gb|AFW60461.1|  nodulin-like protein, mRNA                              124   3e-29    
ref|XP_004138145.1|  PREDICTED: uncharacterized protein LOC101216789    124   3e-29    
ref|XP_002270809.1|  PREDICTED: uncharacterized protein LOC100266857    125   3e-29    
ref|XP_008453165.1|  PREDICTED: uncharacterized protein LOC103493961    124   3e-29    
ref|XP_004155069.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    124   3e-29    
ref|XP_009784305.1|  PREDICTED: probable transporter mch1               125   3e-29    
ref|XP_002882160.1|  nodulin family protein                             125   4e-29    
gb|KGN63641.1|  hypothetical protein Csa_1G008470                       124   4e-29    
gb|AAV49984.1|  hypothetical protein                                    124   4e-29    
dbj|BAK00644.1|  predicted protein                                      123   4e-29    
ref|XP_009121693.1|  PREDICTED: uncharacterized protein LOC103846506    124   4e-29    
ref|NP_001067386.1|  Os12g0639100                                       124   4e-29    
dbj|BAF63500.1|  nodule protein Nlj70-like protein                      116   4e-29    
ref|XP_006439677.1|  hypothetical protein CICLE_v10019515mg             124   4e-29    
gb|KHN09928.1|  Putative transporter MCH1                               124   4e-29    
ref|XP_001768905.1|  predicted protein                                  125   4e-29    
gb|KHG08620.1|  putative transporter MCH1                               124   4e-29    
emb|CDX85856.1|  BnaC06g22780D                                          124   4e-29    
gb|EMT08736.1|  hypothetical protein F775_20527                         124   4e-29    
gb|KDO47305.1|  hypothetical protein CISIN_1g007766mg                   122   5e-29    
ref|XP_004299629.1|  PREDICTED: protein NUCLEAR FUSION DEFECTIVE ...    124   5e-29    
emb|CDY58410.1|  BnaC09g54560D                                          124   5e-29    
ref|XP_006604148.1|  PREDICTED: uncharacterized protein LOC100796...    124   5e-29    
ref|XP_010255962.1|  PREDICTED: uncharacterized protein LOC104596480    124   5e-29    
gb|EMS47359.1|  hypothetical protein TRIUR3_13857                       123   5e-29    
ref|XP_008362108.1|  PREDICTED: LOW QUALITY PROTEIN: probable tra...    123   6e-29    
ref|XP_008664391.1|  PREDICTED: uncharacterized protein LOC103643013    124   6e-29    
ref|XP_010272188.1|  PREDICTED: uncharacterized protein LOC104608039    124   6e-29    
gb|KJB76383.1|  hypothetical protein B456_012G086100                    123   6e-29    
gb|KDO76013.1|  hypothetical protein CISIN_1g008482mg                   124   6e-29    
ref|XP_006338702.1|  PREDICTED: probable transporter mch1-like          124   6e-29    
gb|KHN40970.1|  Putative transporter MCH1                               124   6e-29    
ref|XP_003553263.1|  PREDICTED: uncharacterized protein LOC100796...    124   7e-29    
gb|KDO47304.1|  hypothetical protein CISIN_1g007766mg                   123   7e-29    
ref|XP_008239662.1|  PREDICTED: probable transporter MCH1               123   7e-29    
ref|XP_003547642.1|  PREDICTED: uncharacterized protein LOC100818484    124   7e-29    
ref|XP_004231775.1|  PREDICTED: probable transporter mch1               124   7e-29    
ref|XP_009344920.1|  PREDICTED: probable transporter mch1               124   8e-29    
gb|KHG07666.1|  putative transporter MCH1                               124   8e-29    
ref|XP_006373206.1|  hypothetical protein POPTR_0017s09650g             122   9e-29    
ref|XP_009369375.1|  PREDICTED: probable transporter MCH1               123   9e-29    
ref|XP_003574828.1|  PREDICTED: probable transporter mch1               124   9e-29    
ref|XP_010317535.1|  PREDICTED: probable transporter mch1 isoform X2    122   1e-28    
ref|XP_006659624.1|  PREDICTED: uncharacterized protein LOC102701471    124   1e-28    
ref|XP_006294011.1|  hypothetical protein CARUB_v10022999mg             123   1e-28    
ref|XP_008339906.1|  PREDICTED: uncharacterized protein LOC103402901    123   1e-28    
dbj|BAJ95281.1|  predicted protein                                      123   1e-28    
ref|XP_010317536.1|  PREDICTED: probable transporter mch1 isoform X3    122   1e-28    
ref|XP_002509502.1|  conserved hypothetical protein                     123   1e-28    
ref|XP_004486805.1|  PREDICTED: uncharacterized protein LOC101503239    123   1e-28    
gb|KJB76382.1|  hypothetical protein B456_012G086100                    123   1e-28    
ref|XP_002446303.1|  hypothetical protein SORBIDRAFT_06g013890          123   1e-28    
gb|AES67885.2|  MFS transporter                                         122   1e-28    
ref|XP_010496426.1|  PREDICTED: uncharacterized protein LOC104773497    123   1e-28    
ref|XP_007037166.1|  Nodulin / Major Facilitator Superfamily protein    123   1e-28    
ref|XP_010933948.1|  PREDICTED: probable transporter mch1 isoform X2    122   2e-28    
ref|XP_008441327.1|  PREDICTED: uncharacterized protein LOC103485...    122   2e-28    
ref|XP_006664245.1|  PREDICTED: probable transporter MCH1-like          122   2e-28    
ref|XP_003522351.2|  PREDICTED: probable transporter mch1-like          122   2e-28    
gb|KHN01935.1|  Putative transporter MCH1                               122   2e-28    
ref|XP_009623438.1|  PREDICTED: probable transporter mch1               123   2e-28    
ref|XP_007138148.1|  hypothetical protein PHAVU_009G184200g             122   2e-28    
ref|XP_004234304.1|  PREDICTED: probable transporter mch1 isoform X1    123   2e-28    
ref|XP_007031903.1|  Major facilitator superfamily protein isoform 1    123   2e-28    
ref|XP_008392789.1|  PREDICTED: probable transporter mch1               123   2e-28    
gb|KDP46269.1|  hypothetical protein JCGZ_10109                         122   2e-28    
ref|XP_008453166.1|  PREDICTED: uncharacterized protein LOC103493962    122   2e-28    
gb|KDO47303.1|  hypothetical protein CISIN_1g007766mg                   122   2e-28    
ref|XP_006436853.1|  hypothetical protein CICLE_v10031034mg             122   2e-28    
ref|NP_850229.2|  major facilitator protein                             122   2e-28    
ref|XP_011007428.1|  PREDICTED: probable transporter mch1               121   2e-28    
ref|XP_010516580.1|  PREDICTED: uncharacterized protein LOC104792188    122   3e-28    
dbj|BAF00426.1|  nodulin-like protein                                   122   3e-28    



>ref|XP_009622453.1| PREDICTED: uncharacterized protein LOC104113849 [Nicotiana tomentosiformis]
Length=559

 Score =   324 bits (830),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 163/198 (82%), Positives = 185/198 (93%), Gaps = 0/198 (0%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            VLNNLAQ+GIAQG++DT ILLSLFSFCNFVGRLGGG+VSE+FVRLKA+PRT+WMT TQVV
Sbjct  362  VLNNLAQIGIAQGLHDTKILLSLFSFCNFVGRLGGGVVSEYFVRLKAVPRTVWMTCTQVV  421

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            MIITY LFASALNGTLY ATALLG+CYGVQF+ ++PT SELFGLKHFG+I +FM +GNPL
Sbjct  422  MIITYLLFASALNGTLYAATALLGVCYGVQFTTMVPTASELFGLKHFGMIFNFMSLGNPL  481

Query  381  GAYLFSGLLAGYLYDIEAAKQHSDTCIGPNCFRVTFlvlaglcsagallsVVLTVRLKPV  202
            GAYLFSGLLAG+LYD EAAKQHS TC+GPNCFRVTFL+LAG+C  G +LS+VLT+R+KPV
Sbjct  482  GAYLFSGLLAGFLYDNEAAKQHSATCLGPNCFRVTFLILAGVCGIGTMLSIVLTMRIKPV  541

Query  201  YQMLYAGGSFRLPQSSNH  148
            YQMLYAGGSFRLPQSSNH
Sbjct  542  YQMLYAGGSFRLPQSSNH  559



>ref|XP_009766329.1| PREDICTED: uncharacterized protein LOC104217722 [Nicotiana sylvestris]
Length=557

 Score =   322 bits (825),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 162/198 (82%), Positives = 185/198 (93%), Gaps = 0/198 (0%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            VLNNLAQ+GIAQG++DT ILLSLFSFCNFVGRLGGG+VSE+FVRLKA+PRT+WMT TQVV
Sbjct  360  VLNNLAQIGIAQGLHDTKILLSLFSFCNFVGRLGGGVVSEYFVRLKAVPRTVWMTCTQVV  419

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            MIITY LFASALNGTLY ATALLG+CYGVQF+ ++PT SELFGLKHFG+I +FM +GNPL
Sbjct  420  MIITYLLFASALNGTLYAATALLGVCYGVQFTTMVPTASELFGLKHFGMIFNFMSLGNPL  479

Query  381  GAYLFSGLLAGYLYDIEAAKQHSDTCIGPNCFRVTFlvlaglcsagallsVVLTVRLKPV  202
            GAYLFSGLLAG+LYD EAAKQHS TC+GPNCFRVTFL+LAG+C  G +LS+VLT+R+KPV
Sbjct  480  GAYLFSGLLAGFLYDNEAAKQHSATCLGPNCFRVTFLILAGVCGIGTMLSIVLTMRIKPV  539

Query  201  YQMLYAGGSFRLPQSSNH  148
            YQMLYAGGSFRLPQ+SNH
Sbjct  540  YQMLYAGGSFRLPQNSNH  557



>ref|XP_004242721.1| PREDICTED: uncharacterized protein LOC101255210 [Solanum lycopersicum]
Length=559

 Score =   319 bits (817),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 160/198 (81%), Positives = 184/198 (93%), Gaps = 0/198 (0%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            VLNNLAQ+GIAQG++DT ILLSLFSFCNFVGRLGGG++SE+FVRLKA+PRT+WMT TQVV
Sbjct  362  VLNNLAQIGIAQGLHDTKILLSLFSFCNFVGRLGGGVISEYFVRLKAVPRTVWMTCTQVV  421

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            MIITY LFASALNGTLY ATALLG+CYGVQF+ ++PT SELFGLKHFG+I +FM +GNPL
Sbjct  422  MIITYLLFASALNGTLYAATALLGVCYGVQFTTMVPTASELFGLKHFGIIFNFMSLGNPL  481

Query  381  GAYLFSGLLAGYLYDIEAAKQHSDTCIGPNCFRVTFlvlaglcsagallsVVLTVRLKPV  202
            GAYLFSGLLAGYLYD EAAKQHS TC GP+CFRVTFL+LAG+C  G +LS+VLT+R++PV
Sbjct  482  GAYLFSGLLAGYLYDNEAAKQHSATCFGPDCFRVTFLILAGVCGLGTVLSIVLTMRIRPV  541

Query  201  YQMLYAGGSFRLPQSSNH  148
            YQMLYAGGSFRLPQSS+H
Sbjct  542  YQMLYAGGSFRLPQSSSH  559



>ref|XP_006359513.1| PREDICTED: uncharacterized protein LOC102584997 [Solanum tuberosum]
Length=559

 Score =   316 bits (809),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 158/198 (80%), Positives = 184/198 (93%), Gaps = 0/198 (0%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            VLNNLAQ+GIAQG++DT ILLSLFSFCNFVGRLGGG++SE+FVRLKA+PRT+WMT TQVV
Sbjct  362  VLNNLAQIGIAQGLHDTKILLSLFSFCNFVGRLGGGVISEYFVRLKAVPRTVWMTCTQVV  421

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            MIITY LFASALNGTLY A ALLG+CYGVQF+ ++PT SELFGLKHFG+I +FM +GNPL
Sbjct  422  MIITYLLFASALNGTLYAAIALLGVCYGVQFTTMVPTASELFGLKHFGIIFNFMSLGNPL  481

Query  381  GAYLFSGLLAGYLYDIEAAKQHSDTCIGPNCFRVTFlvlaglcsagallsVVLTVRLKPV  202
            GAYLFSGLLAGYLYD EAA+QHS TC+GP+CFRVTFL+LAG+C  G +LS+VLT+R++PV
Sbjct  482  GAYLFSGLLAGYLYDNEAAQQHSATCLGPDCFRVTFLILAGVCGLGTVLSIVLTMRIRPV  541

Query  201  YQMLYAGGSFRLPQSSNH  148
            YQMLYAGGSFRLPQSS+H
Sbjct  542  YQMLYAGGSFRLPQSSSH  559



>ref|XP_007013639.1| Major facilitator superfamily protein isoform 2 [Theobroma cacao]
 gb|EOY31258.1| Major facilitator superfamily protein isoform 2 [Theobroma cacao]
Length=442

 Score =   302 bits (773),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 153/205 (75%), Positives = 178/205 (87%), Gaps = 7/205 (3%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            VLNNLAQ+GIAQGV +TTILLSLFSFCNFVGRLGGG VSEHFVR K +PRTIWMT TQ+V
Sbjct  238  VLNNLAQIGIAQGVQNTTILLSLFSFCNFVGRLGGGTVSEHFVRSKTVPRTIWMTCTQIV  297

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            M++TY LFASA++GTLY ATALLGICYGVQFSI+IPT SELFGLKHFG+  +FM +GNPL
Sbjct  298  MVVTYLLFASAIDGTLYAATALLGICYGVQFSIMIPTVSELFGLKHFGIFYNFMSLGNPL  357

Query  381  GAYLFSGLLAGYLYDIEAAKQH-------SDTCIGPNCFRVTFlvlaglcsagallsVVL  223
            GA+LFSGLLAGY+YD EAAKQ+       S +C+GPNCFR+TFLVLAG+   G++ S++L
Sbjct  358  GAFLFSGLLAGYIYDTEAAKQYGLNLVNSSVSCVGPNCFRLTFLVLAGVSGVGSIASIIL  417

Query  222  TVRLKPVYQMLYAGGSFRLPQSSNH  148
            T R+ PVYQMLY GGSFRLPQ+SNH
Sbjct  418  TKRIWPVYQMLYGGGSFRLPQTSNH  442



>ref|XP_006381072.1| hypothetical protein POPTR_0006s05990g [Populus trichocarpa]
 gb|ERP58869.1| hypothetical protein POPTR_0006s05990g [Populus trichocarpa]
Length=580

 Score =   305 bits (780),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 159/206 (77%), Positives = 182/206 (88%), Gaps = 8/206 (4%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            VLNNLAQ+GIAQGV+DTTILLSLFSFCNFVGRLGGGIVSEHFVR K +PRTIWMT TQV+
Sbjct  368  VLNNLAQIGIAQGVHDTTILLSLFSFCNFVGRLGGGIVSEHFVRSKTIPRTIWMTCTQVM  427

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            MIITY LFASA++G LY ATALLGICYGVQFSI+IPT SELFGLKHFGL  +FM +GNPL
Sbjct  428  MIITYLLFASAIDGILYAATALLGICYGVQFSIMIPTVSELFGLKHFGLFYNFMSLGNPL  487

Query  381  GAYLFSGLLAGYLYDIEAAKQH--------SDTCIGPNCFRVTFlvlaglcsagallsVV  226
            GA+LFSGLLAGY+YD EAAKQ         S +C+GPNCFR+TFLVLAG C  G++LS++
Sbjct  488  GAFLFSGLLAGYVYDNEAAKQQVPNLLSNSSISCLGPNCFRLTFLVLAGACGLGSILSII  547

Query  225  LTVRLKPVYQMLYAGGSFRLPQSSNH  148
            LT+R++PVY+MLYAGGSFRLPQ+SNH
Sbjct  548  LTMRIRPVYEMLYAGGSFRLPQTSNH  573



>ref|XP_010244877.1| PREDICTED: uncharacterized protein LOC104588582 [Nelumbo nucifera]
Length=573

 Score =   304 bits (778),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 157/205 (77%), Positives = 181/205 (88%), Gaps = 7/205 (3%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            VLNNLAQ+G A GVNDTTILLSLFSFCNFVGRLGGG VSEHFVR K +PRT+WMT TQVV
Sbjct  369  VLNNLAQIGTALGVNDTTILLSLFSFCNFVGRLGGGAVSEHFVRSKMIPRTVWMTCTQVV  428

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            MI+TY LFASALNGTLY ATALLGICYGVQFSI++PT SELFGLKHFG+I +FM +GNPL
Sbjct  429  MIVTYLLFASALNGTLYAATALLGICYGVQFSIMVPTASELFGLKHFGIIYNFMLLGNPL  488

Query  381  GAYLFSGLLAGYLYDIEAAKQH-------SDTCIGPNCFRVTFlvlaglcsagallsVVL  223
            GA+LFS LLAGY+YD E AKQH       S +C+GPNCFR+TFLVLAG+C  G++LS++L
Sbjct  489  GAFLFSALLAGYVYDKEVAKQHGLNLLGSSASCLGPNCFRLTFLVLAGVCGLGSILSIIL  548

Query  222  TVRLKPVYQMLYAGGSFRLPQSSNH  148
            T+R+KPVYQMLY+GGSFR+PQ+SNH
Sbjct  549  TMRIKPVYQMLYSGGSFRIPQNSNH  573



>ref|XP_011020248.1| PREDICTED: uncharacterized protein LOC105122687 [Populus euphratica]
Length=573

 Score =   301 bits (772),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 158/206 (77%), Positives = 180/206 (87%), Gaps = 8/206 (4%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            VLNNLAQ+GIAQGV+DTTILLSLFSFCNFVGRLGGGIVSEHFVR K +PRTIWMT TQV 
Sbjct  368  VLNNLAQIGIAQGVHDTTILLSLFSFCNFVGRLGGGIVSEHFVRSKTIPRTIWMTCTQVT  427

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            MIITY LFASA++G LY ATALLGICYGVQFSI+IPT SELFGLKHFGL  +FM +GNPL
Sbjct  428  MIITYLLFASAIDGILYTATALLGICYGVQFSIMIPTVSELFGLKHFGLFYNFMSLGNPL  487

Query  381  GAYLFSGLLAGYLYDIEAAKQH--------SDTCIGPNCFRVTFlvlaglcsagallsVV  226
            GA+LFSGLLAGY+YD EAAKQ         S +C GPNCFR+TFLVLAG C  G++LS++
Sbjct  488  GAFLFSGLLAGYVYDNEAAKQQVPNLLSNSSISCSGPNCFRLTFLVLAGACGLGSILSII  547

Query  225  LTVRLKPVYQMLYAGGSFRLPQSSNH  148
            LT+R++PVY+MLYAGGSFR+PQ+SNH
Sbjct  548  LTMRIRPVYEMLYAGGSFRIPQTSNH  573



>gb|KDP30201.1| hypothetical protein JCGZ_16983 [Jatropha curcas]
Length=574

 Score =   301 bits (772),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 156/206 (76%), Positives = 182/206 (88%), Gaps = 8/206 (4%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            VLNNLAQ+GIAQGV++TTILL+LFSFCNFVGRLGGG VSEHFVR K +PRTIWMT TQV+
Sbjct  369  VLNNLAQIGIAQGVHNTTILLTLFSFCNFVGRLGGGTVSEHFVRSKTIPRTIWMTCTQVI  428

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            MIITY LFASA++GTLY ATALLGICYGVQFSI+IPT SELFGLKHFG+  +FM +GNPL
Sbjct  429  MIITYLLFASAIDGTLYAATALLGICYGVQFSIMIPTVSELFGLKHFGIFYNFMSLGNPL  488

Query  381  GAYLFSGLLAGYLYDIEAAKQH--------SDTCIGPNCFRVTFlvlaglcsagallsVV  226
            GA+LFSGLLAGY+YD EAAKQH        S +CIGPNCF++TFLVLAG+C  G++LS++
Sbjct  489  GAFLFSGLLAGYIYDTEAAKQHALDALLSSSMSCIGPNCFKLTFLVLAGVCGVGSILSLI  548

Query  225  LTVRLKPVYQMLYAGGSFRLPQSSNH  148
            LT+R+ PVYQMLY+GGSFRLPQ+S H
Sbjct  549  LTMRIWPVYQMLYSGGSFRLPQTSTH  574



>ref|XP_007013638.1| Major facilitator superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY31257.1| Major facilitator superfamily protein isoform 1 [Theobroma cacao]
Length=573

 Score =   301 bits (772),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 153/205 (75%), Positives = 178/205 (87%), Gaps = 7/205 (3%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            VLNNLAQ+GIAQGV +TTILLSLFSFCNFVGRLGGG VSEHFVR K +PRTIWMT TQ+V
Sbjct  369  VLNNLAQIGIAQGVQNTTILLSLFSFCNFVGRLGGGTVSEHFVRSKTVPRTIWMTCTQIV  428

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            M++TY LFASA++GTLY ATALLGICYGVQFSI+IPT SELFGLKHFG+  +FM +GNPL
Sbjct  429  MVVTYLLFASAIDGTLYAATALLGICYGVQFSIMIPTVSELFGLKHFGIFYNFMSLGNPL  488

Query  381  GAYLFSGLLAGYLYDIEAAKQH-------SDTCIGPNCFRVTFlvlaglcsagallsVVL  223
            GA+LFSGLLAGY+YD EAAKQ+       S +C+GPNCFR+TFLVLAG+   G++ S++L
Sbjct  489  GAFLFSGLLAGYIYDTEAAKQYGLNLVNSSVSCVGPNCFRLTFLVLAGVSGVGSIASIIL  548

Query  222  TVRLKPVYQMLYAGGSFRLPQSSNH  148
            T R+ PVYQMLY GGSFRLPQ+SNH
Sbjct  549  TKRIWPVYQMLYGGGSFRLPQTSNH  573



>ref|XP_006453197.1| hypothetical protein CICLE_v100078531mg, partial [Citrus clementina]
 gb|ESR66437.1| hypothetical protein CICLE_v100078531mg, partial [Citrus clementina]
Length=466

 Score =   297 bits (760),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 152/206 (74%), Positives = 179/206 (87%), Gaps = 9/206 (4%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            VLNNLAQ+GIAQGV+DTTILLSLFSFCNFVGRLGGG+VSEHFVR K +PRTIWMT TQV+
Sbjct  262  VLNNLAQIGIAQGVHDTTILLSLFSFCNFVGRLGGGVVSEHFVR-KTIPRTIWMTCTQVI  320

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            MIITY LFAS+++GTLY ATALLGICYGVQFSI+IPT SELFGL+HFGLI +F+ +GNPL
Sbjct  321  MIITYLLFASSIDGTLYAATALLGICYGVQFSIMIPTVSELFGLEHFGLISNFLALGNPL  380

Query  381  GAYLFSGLLAGYLYDIEAAKQHS--------DTCIGPNCFRVTFlvlaglcsagallsVV  226
             A+LFSGLLAGY+YD EAAKQ           +C+GPNCFR+TF VLAG+C  G++ S++
Sbjct  381  AAFLFSGLLAGYIYDNEAAKQQGFNLLTSNVISCLGPNCFRITFFVLAGVCCVGSIFSII  440

Query  225  LTVRLKPVYQMLYAGGSFRLPQSSNH  148
            L +R++PVYQMLYAGGSFRLPQ+SN 
Sbjct  441  LNIRIRPVYQMLYAGGSFRLPQTSNK  466



>ref|XP_007204209.1| hypothetical protein PRUPE_ppa003398mg [Prunus persica]
 gb|EMJ05408.1| hypothetical protein PRUPE_ppa003398mg [Prunus persica]
Length=578

 Score =   297 bits (761),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 152/206 (74%), Positives = 178/206 (86%), Gaps = 8/206 (4%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            VLNNLAQ+GIAQG  DTTILLSLFSF NFVGRLGGG+VSEHFVR K +PRT+WMT TQ++
Sbjct  373  VLNNLAQIGIAQGFRDTTILLSLFSFGNFVGRLGGGVVSEHFVRSKTIPRTVWMTCTQII  432

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            MI TY LFASA++GTLY ATALLGICYGVQFSI+IPT SELFGL+HFG+  +FM +GNPL
Sbjct  433  MIGTYLLFASAISGTLYAATALLGICYGVQFSIMIPTVSELFGLRHFGIFYNFMSLGNPL  492

Query  381  GAYLFSGLLAGYLYDIEAAKQHSD--------TCIGPNCFRVTFlvlaglcsagallsVV  226
            GA+LFSGLLAGY+YD EAAKQH          +C+GPNCFR+TFLVLA +C  G +LS+V
Sbjct  493  GAFLFSGLLAGYVYDNEAAKQHGSNNIYGTNVSCLGPNCFRLTFLVLAAVCGVGTILSIV  552

Query  225  LTVRLKPVYQMLYAGGSFRLPQSSNH  148
            L++R+KPVYQMLYAGGSFR+PQS+NH
Sbjct  553  LSIRIKPVYQMLYAGGSFRVPQSTNH  578



>gb|KCW82731.1| hypothetical protein EUGRSUZ_C04108 [Eucalyptus grandis]
Length=470

 Score =   293 bits (751),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 147/205 (72%), Positives = 179/205 (87%), Gaps = 7/205 (3%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            VLNN+AQ+GIA GV+DTTIL+SLFSF NFVGRLGGG+VSEHFVR K +PRTIWMT TQV+
Sbjct  266  VLNNMAQIGIAVGVHDTTILMSLFSFGNFVGRLGGGVVSEHFVRSKIIPRTIWMTLTQVI  325

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            MIITY LFASA++GTLY AT+LLG CYGVQFSI++PT SELFGLKHFGL+ +F+ +GNP+
Sbjct  326  MIITYLLFASAIDGTLYAATSLLGFCYGVQFSIMVPTVSELFGLKHFGLLYNFISLGNPI  385

Query  381  GAYLFSGLLAGYLYDIEAAKQH-------SDTCIGPNCFRVTFlvlaglcsagallsVVL  223
            GA+LFSGLLAGY+YD EAAKQH       + TC+GP+CFR+TFL+LA +C  G ++S++L
Sbjct  386  GAFLFSGLLAGYIYDNEAAKQHGFDVLASTMTCLGPDCFRLTFLILAAVCGFGVIMSLIL  445

Query  222  TVRLKPVYQMLYAGGSFRLPQSSNH  148
            T+R+KPVY+ LYAGGSFRLPQSS H
Sbjct  446  TIRIKPVYEALYAGGSFRLPQSSTH  470



>gb|KDO62001.1| hypothetical protein CISIN_1g0082101mg [Citrus sinensis]
Length=574

 Score =   296 bits (758),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 153/206 (74%), Positives = 180/206 (87%), Gaps = 9/206 (4%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            VLNNLAQ+GIAQGV+DTTILLSLFSFCNFVGRLGGG+VSEHFVR K +PRTIWMT TQV+
Sbjct  370  VLNNLAQIGIAQGVHDTTILLSLFSFCNFVGRLGGGVVSEHFVR-KTIPRTIWMTCTQVI  428

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            MIITY LFAS+++GTLY ATALLGICYGVQFSI+IPT SELFGL+HFGLI +F+ +GNPL
Sbjct  429  MIITYLLFASSIDGTLYAATALLGICYGVQFSIMIPTVSELFGLEHFGLISNFLALGNPL  488

Query  381  GAYLFSGLLAGYLYDIEAAKQHS--------DTCIGPNCFRVTFlvlaglcsagallsVV  226
             A+LFSGLLAGY+YD EAAKQ           +C+GPNCFR+TF VLAG+C  G++LS++
Sbjct  489  AAFLFSGLLAGYIYDNEAAKQQGFNLLTSNVVSCLGPNCFRITFFVLAGVCCVGSILSII  548

Query  225  LTVRLKPVYQMLYAGGSFRLPQSSNH  148
            L +R++PVYQMLYAGGSFRLPQ+SN 
Sbjct  549  LNIRIRPVYQMLYAGGSFRLPQTSNK  574



>ref|XP_006474315.1| PREDICTED: uncharacterized membrane protein YMR155W-like [Citrus 
sinensis]
Length=574

 Score =   296 bits (757),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 152/206 (74%), Positives = 179/206 (87%), Gaps = 9/206 (4%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            VLNNLAQ+GIAQGV+DTTILLSLFSFCNFVGRLGGG+VSEHFVR K +PRTIWMT TQV+
Sbjct  370  VLNNLAQIGIAQGVHDTTILLSLFSFCNFVGRLGGGVVSEHFVR-KTIPRTIWMTCTQVI  428

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            MIITY LFAS+++GTLY ATALLGICYGVQFSI+IPT SELFGL+HFGLI +F+ +GNPL
Sbjct  429  MIITYLLFASSIDGTLYAATALLGICYGVQFSIMIPTVSELFGLEHFGLISNFLALGNPL  488

Query  381  GAYLFSGLLAGYLYDIEAAKQHS--------DTCIGPNCFRVTFlvlaglcsagallsVV  226
             A+LFSGLLAGY+YD EAAKQ           +C+GPNCFR+TF VLAG+C  G++ S++
Sbjct  489  AAFLFSGLLAGYIYDNEAAKQQGFNLLTSNVISCLGPNCFRITFFVLAGVCCVGSIFSII  548

Query  225  LTVRLKPVYQMLYAGGSFRLPQSSNH  148
            L +R++PVYQMLYAGGSFRLPQ+SN 
Sbjct  549  LNIRIRPVYQMLYAGGSFRLPQTSNK  574



>emb|CBI25573.3| unnamed protein product [Vitis vinifera]
Length=512

 Score =   294 bits (752),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 150/205 (73%), Positives = 182/205 (89%), Gaps = 7/205 (3%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            VLNNLAQ+GIAQGV++TT+LL LFSFCNF+GRLGGG VSEHF+R K +PRTIWMT TQV+
Sbjct  308  VLNNLAQIGIAQGVHNTTMLLCLFSFCNFLGRLGGGAVSEHFLRSKTIPRTIWMTCTQVI  367

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            M+ITY LFASAL+GTLY ATALLGICYGVQFSI++PT SELFGLKHFG+  +FM +GNPL
Sbjct  368  MVITYLLFASALDGTLYAATALLGICYGVQFSIMVPTVSELFGLKHFGIFYNFMSLGNPL  427

Query  381  GAYLFSGLLAGYLYDIEAAKQH-------SDTCIGPNCFRVTFlvlaglcsagallsVVL  223
            GA+LFSGLLAG++YD EAAKQ        S +C+GPNCFR+TFLVLAG+C  G++LS++L
Sbjct  428  GAFLFSGLLAGFVYDNEAAKQQGMNLLNSSVSCLGPNCFRLTFLVLAGVCGVGSILSIIL  487

Query  222  TVRLKPVYQMLYAGGSFRLPQSSNH  148
            T+R++PVYQMLY+GGSFRLPQ+S+H
Sbjct  488  TMRIRPVYQMLYSGGSFRLPQNSDH  512



>ref|XP_008242919.1| PREDICTED: uncharacterized protein LOC103341215 [Prunus mume]
 ref|XP_008242920.1| PREDICTED: uncharacterized protein LOC103341215 [Prunus mume]
Length=577

 Score =   295 bits (756),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 150/205 (73%), Positives = 178/205 (87%), Gaps = 7/205 (3%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            VLNNLAQ+GIAQG  DTTILLSLFSF NFVGRLGGG+VSEHFVR K +PRT+WMT +Q++
Sbjct  373  VLNNLAQIGIAQGFRDTTILLSLFSFGNFVGRLGGGVVSEHFVRSKTIPRTVWMTCSQII  432

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            MI TY LFASA++GTLY ATALLGICYGVQFSI+IPT SELFGL+HFG+  +FM +GNPL
Sbjct  433  MIGTYLLFASAISGTLYAATALLGICYGVQFSIMIPTVSELFGLRHFGIFYNFMSLGNPL  492

Query  381  GAYLFSGLLAGYLYDIEAAKQHSD-------TCIGPNCFRVTFlvlaglcsagallsVVL  223
            GA+LFSGLLAGY+YD EAAKQH         +C+GPNCFR+TFLVLA +C  G +LS+VL
Sbjct  493  GAFLFSGLLAGYVYDNEAAKQHGSNIYGTNVSCLGPNCFRLTFLVLAAVCGVGTILSIVL  552

Query  222  TVRLKPVYQMLYAGGSFRLPQSSNH  148
            ++R+KPVYQMLYAGGSFR+P+S+NH
Sbjct  553  SIRIKPVYQMLYAGGSFRIPRSTNH  577



>ref|XP_011084061.1| PREDICTED: uncharacterized protein LOC105166417 [Sesamum indicum]
Length=588

 Score =   295 bits (756),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 149/198 (75%), Positives = 176/198 (89%), Gaps = 0/198 (0%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            VLNNLAQ+GIAQ ++DT +LLSLFSFCNFVGRLGGG++SE+ VR KA+PRTIWMT TQV+
Sbjct  391  VLNNLAQIGIAQYMHDTKVLLSLFSFCNFVGRLGGGVISEYLVRSKAIPRTIWMTITQVI  450

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            M+ TY LFASA+NGTL+  T+LLGICYGVQFSI++PT SELFGLK+FGL  +FM +GNPL
Sbjct  451  MVFTYLLFASAINGTLFAGTSLLGICYGVQFSIMVPTASELFGLKNFGLFFNFMSLGNPL  510

Query  381  GAYLFSGLLAGYLYDIEAAKQHSDTCIGPNCFRVTFlvlaglcsagallsVVLTVRLKPV  202
            GAYLFSGLLAG++YD EAAKQHS TC+GP CFR+TFLVLAG C  G +LS+VLT+R+ PV
Sbjct  511  GAYLFSGLLAGFVYDNEAAKQHSATCLGPTCFRLTFLVLAGACIIGTMLSIVLTMRILPV  570

Query  201  YQMLYAGGSFRLPQSSNH  148
            Y+MLYAGGSFRLPQSSN 
Sbjct  571  YKMLYAGGSFRLPQSSNR  588



>ref|XP_002268798.2| PREDICTED: uncharacterized protein LOC100251745 [Vitis vinifera]
Length=573

 Score =   294 bits (752),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 150/205 (73%), Positives = 182/205 (89%), Gaps = 7/205 (3%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            VLNNLAQ+GIAQGV++TT+LL LFSFCNF+GRLGGG VSEHF+R K +PRTIWMT TQV+
Sbjct  369  VLNNLAQIGIAQGVHNTTMLLCLFSFCNFLGRLGGGAVSEHFLRSKTIPRTIWMTCTQVI  428

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            M+ITY LFASAL+GTLY ATALLGICYGVQFSI++PT SELFGLKHFG+  +FM +GNPL
Sbjct  429  MVITYLLFASALDGTLYAATALLGICYGVQFSIMVPTVSELFGLKHFGIFYNFMSLGNPL  488

Query  381  GAYLFSGLLAGYLYDIEAAKQH-------SDTCIGPNCFRVTFlvlaglcsagallsVVL  223
            GA+LFSGLLAG++YD EAAKQ        S +C+GPNCFR+TFLVLAG+C  G++LS++L
Sbjct  489  GAFLFSGLLAGFVYDNEAAKQQGMNLLNSSVSCLGPNCFRLTFLVLAGVCGVGSILSIIL  548

Query  222  TVRLKPVYQMLYAGGSFRLPQSSNH  148
            T+R++PVYQMLY+GGSFRLPQ+S+H
Sbjct  549  TMRIRPVYQMLYSGGSFRLPQNSDH  573



>ref|XP_006341383.1| PREDICTED: uncharacterized protein LOC102606368 [Solanum tuberosum]
Length=563

 Score =   293 bits (751),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 145/198 (73%), Positives = 173/198 (87%), Gaps = 0/198 (0%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            VLNNLAQ+G+A GVNDTTILLSLFSFCNF+GRLG G+VSEHFVR K +PRT WM  TQ++
Sbjct  366  VLNNLAQIGVALGVNDTTILLSLFSFCNFLGRLGAGVVSEHFVRSKTIPRTFWMMITQIL  425

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            MIIT+ L+ASAL+GTLY ATALLGIC+GVQF ++IPT+SELFGLKHFG+I +FM +GNPL
Sbjct  426  MIITFLLYASALSGTLYAATALLGICFGVQFGVMIPTSSELFGLKHFGIIFNFMQLGNPL  485

Query  381  GAYLFSGLLAGYLYDIEAAKQHSDTCIGPNCFRVTFlvlaglcsagallsVVLTVRLKPV  202
            GA LFSGLLAGY+YD EA KQ    C+GPNCFR+TFLVLAG  + GA LS++LT+R++PV
Sbjct  486  GALLFSGLLAGYVYDTEAGKQQGSHCLGPNCFRLTFLVLAGASAFGAFLSMILTIRIRPV  545

Query  201  YQMLYAGGSFRLPQSSNH  148
            YQMLYA GSFRL Q+S+H
Sbjct  546  YQMLYAAGSFRLAQASDH  563



>ref|XP_004235913.1| PREDICTED: uncharacterized protein LOC101263299 [Solanum lycopersicum]
Length=563

 Score =   293 bits (750),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 145/198 (73%), Positives = 174/198 (88%), Gaps = 0/198 (0%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            VLNNLAQ+G+A GVNDTTILLSLFSFCNF+GRLG G+VSEHFVR K +PRT WM  TQ++
Sbjct  366  VLNNLAQIGVALGVNDTTILLSLFSFCNFLGRLGAGVVSEHFVRSKTIPRTFWMMITQIL  425

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            MIIT+ L+ASAL+GTLY ATALLGIC+GVQF ++IPT+SELFGLKHFG+I +FM +GNPL
Sbjct  426  MIITFLLYASALSGTLYAATALLGICFGVQFGVMIPTSSELFGLKHFGIIFNFMQLGNPL  485

Query  381  GAYLFSGLLAGYLYDIEAAKQHSDTCIGPNCFRVTFlvlaglcsagallsVVLTVRLKPV  202
            GA LFSGLLAGY+YD EA KQ    C+GPNCFR+TFLVLAG+ + GA LS++LT+R++PV
Sbjct  486  GALLFSGLLAGYVYDTEAGKQQGSHCLGPNCFRLTFLVLAGVSAFGAFLSMILTIRIRPV  545

Query  201  YQMLYAGGSFRLPQSSNH  148
            YQMLYA GSFRL Q+S+H
Sbjct  546  YQMLYAAGSFRLAQASDH  563



>gb|KJB53964.1| hypothetical protein B456_009G013800 [Gossypium raimondii]
Length=637

 Score =   295 bits (755),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 150/205 (73%), Positives = 179/205 (87%), Gaps = 7/205 (3%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            VLNNLAQ+GIAQG++ TTILLSLFSFCNF+GRLGGG+VSEHFVR K +PRT+WMT TQ++
Sbjct  433  VLNNLAQIGIAQGIHSTTILLSLFSFCNFIGRLGGGVVSEHFVRSKTVPRTLWMTCTQII  492

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            M+ITY LFASA++GTLY ATALLGICYGVQFSI+IPT SELFGLKHFG+  +FM +GNPL
Sbjct  493  MVITYLLFASAISGTLYAATALLGICYGVQFSIMIPTVSELFGLKHFGIFYNFMSLGNPL  552

Query  381  GAYLFSGLLAGYLYDIEAAKQH-------SDTCIGPNCFRVTFlvlaglcsagallsVVL  223
            GA+LFSGLLAGY+YD EAAKQH       S +CIGPNCFR+TFL+LAG+C  G++ S++L
Sbjct  553  GAFLFSGLLAGYIYDNEAAKQHGLGLITSSISCIGPNCFRLTFLILAGICGVGSVASIIL  612

Query  222  TVRLKPVYQMLYAGGSFRLPQSSNH  148
            T R+ PVYQMLY GGSFRLPQ+S +
Sbjct  613  TKRIWPVYQMLYGGGSFRLPQTSTY  637



>ref|XP_010049904.1| PREDICTED: uncharacterized protein LOC104438451 [Eucalyptus grandis]
 gb|KCW82730.1| hypothetical protein EUGRSUZ_C04108 [Eucalyptus grandis]
Length=570

 Score =   293 bits (749),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 147/205 (72%), Positives = 179/205 (87%), Gaps = 7/205 (3%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            VLNN+AQ+GIA GV+DTTIL+SLFSF NFVGRLGGG+VSEHFVR K +PRTIWMT TQV+
Sbjct  366  VLNNMAQIGIAVGVHDTTILMSLFSFGNFVGRLGGGVVSEHFVRSKIIPRTIWMTLTQVI  425

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            MIITY LFASA++GTLY AT+LLG CYGVQFSI++PT SELFGLKHFGL+ +F+ +GNP+
Sbjct  426  MIITYLLFASAIDGTLYAATSLLGFCYGVQFSIMVPTVSELFGLKHFGLLYNFISLGNPI  485

Query  381  GAYLFSGLLAGYLYDIEAAKQH-------SDTCIGPNCFRVTFlvlaglcsagallsVVL  223
            GA+LFSGLLAGY+YD EAAKQH       + TC+GP+CFR+TFL+LA +C  G ++S++L
Sbjct  486  GAFLFSGLLAGYIYDNEAAKQHGFDVLASTMTCLGPDCFRLTFLILAAVCGFGVIMSLIL  545

Query  222  TVRLKPVYQMLYAGGSFRLPQSSNH  148
            T+R+KPVY+ LYAGGSFRLPQSS H
Sbjct  546  TIRIKPVYEALYAGGSFRLPQSSTH  570



>ref|XP_002531448.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF30935.1| conserved hypothetical protein [Ricinus communis]
Length=570

 Score =   293 bits (749),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 154/206 (75%), Positives = 177/206 (86%), Gaps = 8/206 (4%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            VLNNLAQ+GIA GV+DTT LLSLFSFCNFVGRLGGG VSEHFVR + +PRTIWMT TQ+V
Sbjct  365  VLNNLAQIGIALGVHDTTTLLSLFSFCNFVGRLGGGTVSEHFVRSRTIPRTIWMTCTQIV  424

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            MIITY LFASA++G LY ATALLGICYGVQFSI+IPT SELFGLKHFG+  +F+ IGNPL
Sbjct  425  MIITYLLFASAIDGILYAATALLGICYGVQFSIMIPTVSELFGLKHFGIFYNFISIGNPL  484

Query  381  GAYLFSGLLAGYLYDIEAAKQH--------SDTCIGPNCFRVTFlvlaglcsagallsVV  226
            GA+LFSGLLAGY+YD EAAKQ         S  CIGPNCFR+TFLVLAG+C  G++LS++
Sbjct  485  GAFLFSGLLAGYIYDTEAAKQQGMNLLLGSSIACIGPNCFRLTFLVLAGVCGVGSILSLI  544

Query  225  LTVRLKPVYQMLYAGGSFRLPQSSNH  148
            LT+R+ PVY+MLYAGGSFRLPQ+S H
Sbjct  545  LTMRIWPVYEMLYAGGSFRLPQTSAH  570



>ref|XP_010927349.1| PREDICTED: uncharacterized protein LOC105049416 isoform X2 [Elaeis 
guineensis]
Length=414

 Score =   287 bits (734),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 152/205 (74%), Positives = 174/205 (85%), Gaps = 7/205 (3%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            VLNNLAQ+GIA GV+DTTILLSLFSFCNFVGRLGGG VSE+FVR K  PR IWMT TQV+
Sbjct  210  VLNNLAQIGIAAGVDDTTILLSLFSFCNFVGRLGGGAVSEYFVRSKMFPRPIWMTCTQVI  269

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            MI+ Y LFAS LNGTLY + ALLGICYGVQFS+++PT SELFGLKHFGLI +FM +GNPL
Sbjct  270  MIVAYLLFASGLNGTLYASNALLGICYGVQFSVMVPTASELFGLKHFGLIYNFMLLGNPL  329

Query  381  GAYLFSGLLAGYLYDIEAAKQH-------SDTCIGPNCFRVTFlvlaglcsagallsVVL  223
            GA LFS  LAGY+YDIEAAKQ+       +++C+GPNCFR+TFLVLAG+C  G LLS+VL
Sbjct  330  GALLFSAGLAGYVYDIEAAKQNPGFLDASTNSCLGPNCFRLTFLVLAGVCCLGTLLSIVL  389

Query  222  TVRLKPVYQMLYAGGSFRLPQSSNH  148
            TVR+KPVYQMLYA GSFR P+SS H
Sbjct  390  TVRIKPVYQMLYASGSFRQPRSSQH  414



>ref|XP_010908361.1| PREDICTED: probable transporter mch1 isoform X2 [Elaeis guineensis]
Length=571

 Score =   291 bits (744),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 153/205 (75%), Positives = 177/205 (86%), Gaps = 7/205 (3%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            VLNNLAQ+GIA GV+DTTILL LFSFCNFVGRL GG VSE+FVR K  PR+IWMT TQV+
Sbjct  367  VLNNLAQIGIAAGVDDTTILLCLFSFCNFVGRLAGGAVSEYFVRSKMFPRSIWMTCTQVI  426

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            MIITY LFAS LNGTLY +TALLG CYGVQFS+++PT SELFGLKHFGL+ +FM +GNPL
Sbjct  427  MIITYLLFASGLNGTLYASTALLGFCYGVQFSVMVPTASELFGLKHFGLVYNFMLLGNPL  486

Query  381  GAYLFSGLLAGYLYDIEAAKQH-------SDTCIGPNCFRVTFlvlaglcsagallsVVL  223
            GA LFS  LAGYLYD+EAAKQ+       +++C+GPNCFR+TFLVLAG+CS G LLS++L
Sbjct  487  GALLFSAGLAGYLYDVEAAKQNRGFHDALTNSCLGPNCFRITFLVLAGVCSLGTLLSIIL  546

Query  222  TVRLKPVYQMLYAGGSFRLPQSSNH  148
            TVR+KPVYQMLYAGGSFR P+SSNH
Sbjct  547  TVRIKPVYQMLYAGGSFRQPRSSNH  571



>ref|XP_008775757.1| PREDICTED: uncharacterized protein LOC103696035 [Phoenix dactylifera]
Length=571

 Score =   290 bits (742),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 154/205 (75%), Positives = 174/205 (85%), Gaps = 7/205 (3%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            VLNNLAQ+GIA GV+DTTILL LFSFCNF GRL GG VSE+FVR K  PR IWMT TQV+
Sbjct  367  VLNNLAQIGIAAGVDDTTILLCLFSFCNFAGRLAGGAVSEYFVRSKMFPRPIWMTCTQVI  426

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            MIITY LFAS LNGTLY +TALLGICYGVQFS+++PT SELFGLKHFGLI +FM +GNPL
Sbjct  427  MIITYLLFASGLNGTLYASTALLGICYGVQFSVMVPTASELFGLKHFGLIYNFMLLGNPL  486

Query  381  GAYLFSGLLAGYLYDIEAAKQH-------SDTCIGPNCFRVTFlvlaglcsagallsVVL  223
            GA LFS  LAGYLYD+EAAKQ+       S++C+GPNCFR+TFL LAG+CS G LLS++L
Sbjct  487  GALLFSAGLAGYLYDVEAAKQNSGFHDALSNSCLGPNCFRITFLALAGVCSLGTLLSIIL  546

Query  222  TVRLKPVYQMLYAGGSFRLPQSSNH  148
            TVRLKPVYQMLYAGGSFR P+S NH
Sbjct  547  TVRLKPVYQMLYAGGSFRQPRSLNH  571



>ref|XP_010102055.1| hypothetical protein L484_016185 [Morus notabilis]
 gb|EXB91565.1| hypothetical protein L484_016185 [Morus notabilis]
Length=573

 Score =   290 bits (742),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 149/205 (73%), Positives = 173/205 (84%), Gaps = 7/205 (3%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            VLNNLAQ+GIAQG++DTTILLSLFSFCNF+GRLGGG+VSE+ +  K +PRT+WMTFTQ++
Sbjct  369  VLNNLAQIGIAQGLHDTTILLSLFSFCNFLGRLGGGVVSEYCLMWKTIPRTVWMTFTQII  428

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            MII Y LFASA+NGTLY A ALLG+C+G Q SI+IPT SELFGLKHFGL  + M IGNPL
Sbjct  429  MIIAYLLFASAINGTLYAAVALLGVCFGTQVSIMIPTVSELFGLKHFGLFYNIMSIGNPL  488

Query  381  GAYLFSGLLAGYLYDIEAAKQH-------SDTCIGPNCFRVTFlvlaglcsagallsVVL  223
            GA LFS LLAGY+YD EAAKQ        S TC+GPNCFR+TF VLA +C  G LLS+VL
Sbjct  489  GALLFSSLLAGYVYDNEAAKQQGLYPSDSSSTCLGPNCFRLTFFVLAAVCGVGTLLSIVL  548

Query  222  TVRLKPVYQMLYAGGSFRLPQSSNH  148
            T+R+KPVYQMLYAGGSFRLPQS+NH
Sbjct  549  TIRIKPVYQMLYAGGSFRLPQSTNH  573



>ref|XP_002270754.1| PREDICTED: probable transporter mch1 [Vitis vinifera]
 emb|CBI36437.3| unnamed protein product [Vitis vinifera]
Length=564

 Score =   290 bits (741),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 148/198 (75%), Positives = 175/198 (88%), Gaps = 0/198 (0%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            VLNNLAQ+G+A GV DTTILLSLFSFCNF+GRL GG+VSE+FVR + LPRTIWMTF+QVV
Sbjct  366  VLNNLAQIGVAFGVTDTTILLSLFSFCNFLGRLFGGVVSEYFVRTRTLPRTIWMTFSQVV  425

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            M++T+ L+ASAL+GTLY +TALLGICYGVQFSI++P  SELFGLKHFG+I +FM +GNP+
Sbjct  426  MVVTFLLYASALSGTLYASTALLGICYGVQFSIMVPCASELFGLKHFGVIYNFMLLGNPI  485

Query  381  GAYLFSGLLAGYLYDIEAAKQHSDTCIGPNCFRVTFlvlaglcsagallsVVLTVRLKPV  202
            GA LFSGLLAGY+YD EAAKQ S TC+G  CFR+TFLVLAG C  G +LS++LT+R+KPV
Sbjct  486  GALLFSGLLAGYVYDFEAAKQQSSTCLGGTCFRLTFLVLAGACGLGTILSIILTIRIKPV  545

Query  201  YQMLYAGGSFRLPQSSNH  148
            YQMLYAGGSFRLP SSN 
Sbjct  546  YQMLYAGGSFRLPSSSNQ  563



>ref|XP_010927348.1| PREDICTED: uncharacterized protein LOC105049416 isoform X1 [Elaeis 
guineensis]
Length=565

 Score =   287 bits (735),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 152/205 (74%), Positives = 174/205 (85%), Gaps = 7/205 (3%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            VLNNLAQ+GIA GV+DTTILLSLFSFCNFVGRLGGG VSE+FVR K  PR IWMT TQV+
Sbjct  361  VLNNLAQIGIAAGVDDTTILLSLFSFCNFVGRLGGGAVSEYFVRSKMFPRPIWMTCTQVI  420

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            MI+ Y LFAS LNGTLY + ALLGICYGVQFS+++PT SELFGLKHFGLI +FM +GNPL
Sbjct  421  MIVAYLLFASGLNGTLYASNALLGICYGVQFSVMVPTASELFGLKHFGLIYNFMLLGNPL  480

Query  381  GAYLFSGLLAGYLYDIEAAKQH-------SDTCIGPNCFRVTFlvlaglcsagallsVVL  223
            GA LFS  LAGY+YDIEAAKQ+       +++C+GPNCFR+TFLVLAG+C  G LLS+VL
Sbjct  481  GALLFSAGLAGYVYDIEAAKQNPGFLDASTNSCLGPNCFRLTFLVLAGVCCLGTLLSIVL  540

Query  222  TVRLKPVYQMLYAGGSFRLPQSSNH  148
            TVR+KPVYQMLYA GSFR P+SS H
Sbjct  541  TVRIKPVYQMLYASGSFRQPRSSQH  565



>ref|XP_008813131.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103723845 
[Phoenix dactylifera]
Length=565

 Score =   285 bits (730),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 151/205 (74%), Positives = 173/205 (84%), Gaps = 7/205 (3%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            VLNNLAQ+GIA GV+DTTILLSLFSFCNFVGRLGGG VSE+FVR K LPR IWMT  QVV
Sbjct  361  VLNNLAQIGIAAGVDDTTILLSLFSFCNFVGRLGGGAVSEYFVRSKMLPRPIWMTCAQVV  420

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            MII Y LFA   NGTLY +TALLGICYGVQFS+++PT SELFGLKHFGLI +FM +GNPL
Sbjct  421  MIIAYLLFAYGFNGTLYASTALLGICYGVQFSVMVPTASELFGLKHFGLIYNFMLLGNPL  480

Query  381  GAYLFSGLLAGYLYDIEAAKQH-------SDTCIGPNCFRVTFlvlaglcsagallsVVL  223
            GA LFS  LAGY+YDIEAAKQ+       +++C+GPNCFR+TFLVLAG+C  G L+S++L
Sbjct  481  GALLFSAGLAGYVYDIEAAKQNPGFLDASTNSCLGPNCFRLTFLVLAGVCILGTLVSIIL  540

Query  222  TVRLKPVYQMLYAGGSFRLPQSSNH  148
            TVR+KPVYQMLYA GSFR P+SS H
Sbjct  541  TVRIKPVYQMLYASGSFRQPRSSQH  565



>ref|XP_004287243.1| PREDICTED: protein NUCLEAR FUSION DEFECTIVE 4-like [Fragaria 
vesca subsp. vesca]
Length=565

 Score =   285 bits (730),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 149/206 (72%), Positives = 178/206 (86%), Gaps = 8/206 (4%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            VLNNLAQ+GIAQG +DTTILLSLFSF NFVGRLGGG+VSEHFV+ K +PRT WMT TQ++
Sbjct  360  VLNNLAQIGIAQGTHDTTILLSLFSFGNFVGRLGGGVVSEHFVKTKTIPRTFWMTCTQIL  419

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            MI  Y LFASA++GTLY ATALLGICYGVQFSI+IPT SELFGL+HFGL  +FM +GNPL
Sbjct  420  MIFIYLLFASAISGTLYAATALLGICYGVQFSIMIPTVSELFGLRHFGLFYNFMSLGNPL  479

Query  381  GAYLFSGLLAGYLYDIEAAKQH--------SDTCIGPNCFRVTFlvlaglcsagallsVV  226
            GA+LFSGLLAGY+YD EAAKQH        + +C+GP+CFR+TFLVLAG+C  G +LSVV
Sbjct  480  GAFLFSGLLAGYIYDNEAAKQHGLNYLHGTNVSCLGPDCFRLTFLVLAGVCGVGTILSVV  539

Query  225  LTVRLKPVYQMLYAGGSFRLPQSSNH  148
            L+ R+KPVY+MLYAGGSFRLPQ++++
Sbjct  540  LSTRIKPVYEMLYAGGSFRLPQNTSN  565



>ref|XP_010047214.1| PREDICTED: uncharacterized protein LOC104436175 [Eucalyptus grandis]
 gb|KCW79047.1| hypothetical protein EUGRSUZ_C00477 [Eucalyptus grandis]
Length=580

 Score =   285 bits (730),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 147/210 (70%), Positives = 176/210 (84%), Gaps = 12/210 (6%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            VLNNLAQ+GIAQGV+DTTILLSLFSF NF GRLGGG+VSEHFVR K +PRT+WMT+TQV 
Sbjct  371  VLNNLAQIGIAQGVHDTTILLSLFSFGNFAGRLGGGVVSEHFVRTKTMPRTVWMTWTQVA  430

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            MI  Y LFASA++GTLY A ALLG CYGVQFSI++PT SELFGLK+FG+  +FM +GNP+
Sbjct  431  MIAIYLLFASAIDGTLYAAIALLGFCYGVQFSIMVPTVSELFGLKYFGIFYNFMLMGNPI  490

Query  381  GAYLFSGLLAGYLYDIEAAKQH------------SDTCIGPNCFRVTFlvlaglcsagal  238
            GA+LFSGLLAGY+YD EAAKQH            S +C+GPNCFR+TFLVLAG+C  G +
Sbjct  491  GAFLFSGLLAGYIYDNEAAKQHGLTLHGLMLLKSSVSCLGPNCFRLTFLVLAGVCGFGVI  550

Query  237  lsVVLTVRLKPVYQMLYAGGSFRLPQSSNH  148
            +S++LT+R+KPVY+MLY+GGSFRLP SS H
Sbjct  551  MSIILTIRIKPVYEMLYSGGSFRLPNSSRH  580



>ref|XP_009419093.1| PREDICTED: probable transporter mch1 [Musa acuminata subsp. malaccensis]
Length=564

 Score =   284 bits (727),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 147/200 (74%), Positives = 176/200 (88%), Gaps = 2/200 (1%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            VLNNLAQ+G+A G++DTTILL LFSFCNFVGR+GGG VSE+FVR + LPR IWM  TQVV
Sbjct  365  VLNNLAQIGVALGLDDTTILLCLFSFCNFVGRIGGGSVSEYFVRSRMLPRPIWMACTQVV  424

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            MI+ Y L+ASALNGTLY +TALLGICYGVQFS+++PT SELFGLKHFG+  +FM +GNPL
Sbjct  425  MIVAYLLYASALNGTLYASTALLGICYGVQFSVMVPTVSELFGLKHFGIFYNFMLLGNPL  484

Query  381  GAYLFSGLLAGYLYDIEAAKQH--SDTCIGPNCFRVTFlvlaglcsagallsVVLTVRLK  208
            GA+ FSGLLAGY+YD EAA QH  S TC+GP+CFR+TFLVLAG+CS G LLS++L+VR++
Sbjct  485  GAFFFSGLLAGYVYDKEAANQHPVSSTCLGPSCFRLTFLVLAGMCSLGTLLSIILSVRIR  544

Query  207  PVYQMLYAGGSFRLPQSSNH  148
            PVYQMLYAGGSFR+P+SS H
Sbjct  545  PVYQMLYAGGSFRMPRSSLH  564



>ref|XP_009798217.1| PREDICTED: uncharacterized protein LOC104244484 [Nicotiana sylvestris]
Length=563

 Score =   283 bits (725),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 141/198 (71%), Positives = 171/198 (86%), Gaps = 0/198 (0%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            VLNNLAQ+G+A GVNDTTILLSLFSFCNF+GRLG G+VSEHFVR K +PRT WM  TQ++
Sbjct  366  VLNNLAQIGVALGVNDTTILLSLFSFCNFLGRLGAGVVSEHFVRSKTIPRTFWMMVTQII  425

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            MI+ + L+ASAL+GTLY ATALLGIC+GVQF ++IPT SELFGLKHFG+I +FM +GNP+
Sbjct  426  MIVIFLLYASALSGTLYAATALLGICFGVQFGVMIPTASELFGLKHFGIIFNFMQLGNPI  485

Query  381  GAYLFSGLLAGYLYDIEAAKQHSDTCIGPNCFRVTFlvlaglcsagallsVVLTVRLKPV  202
            GA LFSGLLAGY+YD EA KQ    C+G NCFR+TFLVLAG+C+ GA LS++LT+R++PV
Sbjct  486  GALLFSGLLAGYVYDAEAGKQQGPHCLGANCFRLTFLVLAGVCAFGAFLSMILTIRIRPV  545

Query  201  YQMLYAGGSFRLPQSSNH  148
            YQMLYA GSFR+ Q S+H
Sbjct  546  YQMLYAAGSFRVAQDSDH  563



>ref|XP_010908359.1| PREDICTED: probable transporter mch1 isoform X1 [Elaeis guineensis]
Length=584

 Score =   281 bits (720),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 153/218 (70%), Positives = 177/218 (81%), Gaps = 20/218 (9%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRL-------------KA  601
            VLNNLAQ+GIA GV+DTTILL LFSFCNFVGRL GG VSE+FVR              K 
Sbjct  367  VLNNLAQIGIAAGVDDTTILLCLFSFCNFVGRLAGGAVSEYFVRWNHFPFHFMAHLRSKM  426

Query  600  LPRTIWMTFTQVVMIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHF  421
             PR+IWMT TQV+MIITY LFAS LNGTLY +TALLG CYGVQFS+++PT SELFGLKHF
Sbjct  427  FPRSIWMTCTQVIMIITYLLFASGLNGTLYASTALLGFCYGVQFSVMVPTASELFGLKHF  486

Query  420  GLILSFMGIGNPLGAYLFSGLLAGYLYDIEAAKQH-------SDTCIGPNCFRVTFlvla  262
            GL+ +FM +GNPLGA LFS  LAGYLYD+EAAKQ+       +++C+GPNCFR+TFLVLA
Sbjct  487  GLVYNFMLLGNPLGALLFSAGLAGYLYDVEAAKQNRGFHDALTNSCLGPNCFRITFLVLA  546

Query  261  glcsagallsVVLTVRLKPVYQMLYAGGSFRLPQSSNH  148
            G+CS G LLS++LTVR+KPVYQMLYAGGSFR P+SSNH
Sbjct  547  GVCSLGTLLSIILTVRIKPVYQMLYAGGSFRQPRSSNH  584



>ref|XP_007155098.1| hypothetical protein PHAVU_003G173000g [Phaseolus vulgaris]
 gb|ESW27092.1| hypothetical protein PHAVU_003G173000g [Phaseolus vulgaris]
Length=571

 Score =   281 bits (719),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 143/205 (70%), Positives = 172/205 (84%), Gaps = 7/205 (3%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            VLNNLAQ+GIAQG+ DTTILLSLFSF NFVGRLGGG+VSEHFVR K +PRTIWMT TQ++
Sbjct  367  VLNNLAQIGIAQGIEDTTILLSLFSFFNFVGRLGGGVVSEHFVRTKTIPRTIWMTCTQMI  426

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            M+  Y +FA A+NGTLY A A+LGICYGVQFSI+IPT SELFGLKHFGL+ +FMG+GNPL
Sbjct  427  MMFLYLVFAYAINGTLYPAIAVLGICYGVQFSIVIPTVSELFGLKHFGLLSNFMGLGNPL  486

Query  381  GAYLFSGLLAGYLYDIEAAKQHSD-------TCIGPNCFRVTFlvlaglcsagallsVVL  223
            GA LFS LLAG++YD EAAKQH +        C+GP+CF++TF  LAG+C  G L S++L
Sbjct  487  GALLFSALLAGHIYDNEAAKQHGEGLIASSVACMGPSCFQLTFFTLAGVCVVGTLSSIIL  546

Query  222  TVRLKPVYQMLYAGGSFRLPQSSNH  148
            T+R+KPVYQMLY+GGSF+LPQ+  H
Sbjct  547  TIRIKPVYQMLYSGGSFKLPQTPGH  571



>ref|XP_011082070.1| PREDICTED: uncharacterized protein LOC105164931 [Sesamum indicum]
Length=559

 Score =   281 bits (718),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 140/198 (71%), Positives = 171/198 (86%), Gaps = 0/198 (0%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            VLNNLAQ+G++ GV+D T LLSLFSFCNF+GRLG G VSEHFVR K +PRT WM  TQ++
Sbjct  362  VLNNLAQIGVSLGVDDATTLLSLFSFCNFLGRLGSGAVSEHFVRSKTIPRTFWMGITQII  421

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            M++T+ L+ASAL+GTLY ATALLGICYGVQF I+IPT SELFGLKHFG+I +F+ +GNP 
Sbjct  422  MVLTFLLYASALSGTLYAATALLGICYGVQFGIMIPTASELFGLKHFGIIFNFISLGNPA  481

Query  381  GAYLFSGLLAGYLYDIEAAKQHSDTCIGPNCFRVTFlvlaglcsagallsVVLTVRLKPV  202
            GA LFSG LAG +YD EAAKQ + +C+GP+CFR+TFL+LAG+C  G LLS++LT+R++PV
Sbjct  482  GALLFSGWLAGQIYDAEAAKQLTSSCMGPSCFRLTFLLLAGICGLGTLLSIILTIRIRPV  541

Query  201  YQMLYAGGSFRLPQSSNH  148
            YQMLYAGGSFRLPQSS H
Sbjct  542  YQMLYAGGSFRLPQSSGH  559



>ref|XP_003533860.1| PREDICTED: uncharacterized membrane protein YMR155W-like [Glycine 
max]
Length=569

 Score =   280 bits (717),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 143/207 (69%), Positives = 174/207 (84%), Gaps = 9/207 (4%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            VLNNLAQ+GIAQG  DTT LLS+FSFCNFVGRLGGG+VSEHFVR K +PRT+WMT TQ +
Sbjct  363  VLNNLAQIGIAQGEEDTTTLLSIFSFCNFVGRLGGGVVSEHFVRTKTIPRTVWMTCTQTL  422

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            M++ Y LFA A+NGTLY A A LG+CYGVQ S+++PT SELFGLKHFG++ SFM +GNP+
Sbjct  423  MLVVYLLFAYAINGTLYPAIAFLGVCYGVQVSVMLPTVSELFGLKHFGVLSSFMSLGNPI  482

Query  381  GAYLFSGLLAGYLYDIEAAKQH--------SDTCIGPNCFRVTFlvlaglcsagallsVV  226
            GA+LFS LLAG +YD EAAKQH          +CIGPNCF++TF +L+G+C+AG +LS++
Sbjct  483  GAFLFSALLAGNIYDNEAAKQHGIGLLLDSGVSCIGPNCFKLTFFILSGVCAAGIVLSII  542

Query  225  LTVRLKPVYQMLYAGGSFRLPQ-SSNH  148
            LT+R+KPVYQMLYAGGSFRLPQ SSNH
Sbjct  543  LTLRIKPVYQMLYAGGSFRLPQTSSNH  569



>gb|KHN48124.1| hypothetical protein glysoja_036680 [Glycine soja]
Length=569

 Score =   280 bits (717),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 143/207 (69%), Positives = 174/207 (84%), Gaps = 9/207 (4%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            VLNNLAQ+GIAQG  DTT LLS+FSFCNFVGRLGGG+VSEHFVR K +PRT+WMT TQ +
Sbjct  363  VLNNLAQIGIAQGEEDTTTLLSIFSFCNFVGRLGGGVVSEHFVRTKTIPRTVWMTCTQTL  422

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            M++ Y LFA A+NGTLY A A LG+CYGVQ S+++PT SELFGLKHFG++ SFM +GNP+
Sbjct  423  MLVVYLLFAYAINGTLYPAIAFLGVCYGVQVSVMLPTVSELFGLKHFGVLSSFMSLGNPI  482

Query  381  GAYLFSGLLAGYLYDIEAAKQH--------SDTCIGPNCFRVTFlvlaglcsagallsVV  226
            GA+LFS LLAG +YD EAAKQH          +CIGPNCF++TF +L+G+C+AG +LS++
Sbjct  483  GAFLFSALLAGNIYDNEAAKQHGIGLLLDSGVSCIGPNCFKLTFFILSGVCAAGIVLSII  542

Query  225  LTVRLKPVYQMLYAGGSFRLPQ-SSNH  148
            LT+R+KPVYQMLYAGGSFRLPQ SSNH
Sbjct  543  LTLRIKPVYQMLYAGGSFRLPQTSSNH  569



>emb|CDO98192.1| unnamed protein product [Coffea canephora]
Length=513

 Score =   278 bits (711),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 142/199 (71%), Positives = 174/199 (87%), Gaps = 1/199 (1%)
 Frame = -1

Query  741  VLNNLAQVGIAQ-GVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQV  565
            VLNNLAQ+G++  G+ND T+LLSLFSFCNF+GRLGGG VSE+FVR KA+PRT WMT  Q+
Sbjct  315  VLNNLAQIGVSLLGLNDATVLLSLFSFCNFLGRLGGGAVSEYFVRSKAIPRTAWMTVAQI  374

Query  564  VMIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNP  385
            +M+IT+ L+ASALNGTL+ ATALLGIC+G QF+I+IPT SELFGL+HFG+I +FM +GNP
Sbjct  375  LMVITFLLYASALNGTLHAATALLGICFGFQFAIMIPTASELFGLRHFGVIFNFMQLGNP  434

Query  384  LGAYLFSGLLAGYLYDIEAAKQHSDTCIGPNCFRVTFlvlaglcsagallsVVLTVRLKP  205
            +GA LFSGLLAG +YD EAAKQ   +C GP+C+R+TFLVLAG C  GALLS++LT+R++P
Sbjct  435  IGALLFSGLLAGQVYDSEAAKQGGSSCAGPDCYRLTFLVLAGACGLGALLSIILTIRIRP  494

Query  204  VYQMLYAGGSFRLPQSSNH  148
            VYQMLYAGGSFRLPQSS H
Sbjct  495  VYQMLYAGGSFRLPQSSGH  513



>ref|XP_009611327.1| PREDICTED: uncharacterized membrane protein YMR155W-like [Nicotiana 
tomentosiformis]
Length=562

 Score =   279 bits (714),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 140/198 (71%), Positives = 171/198 (86%), Gaps = 0/198 (0%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            VLNNLAQ+G+A GVNDTTILLSLFSF NF+GRLG G+VSEHFVR K +PRT WM  TQ++
Sbjct  365  VLNNLAQIGVALGVNDTTILLSLFSFSNFLGRLGAGVVSEHFVRSKTIPRTFWMMVTQII  424

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            MI+T+ L+ASAL+GTLY ATALLGIC+GVQF ++IPT SELFGLKHFG+I +FM +GNP+
Sbjct  425  MIVTFLLYASALSGTLYAATALLGICFGVQFGVMIPTASELFGLKHFGIIFNFMQLGNPI  484

Query  381  GAYLFSGLLAGYLYDIEAAKQHSDTCIGPNCFRVTFlvlaglcsagallsVVLTVRLKPV  202
            GA LFSGLLAGY+YD EA KQ    C+G +CFR+TFLVLAG+C+ GA LS++LT+R++PV
Sbjct  485  GALLFSGLLAGYVYDTEAGKQQGPHCLGASCFRLTFLVLAGVCAFGAFLSMILTIRIRPV  544

Query  201  YQMLYAGGSFRLPQSSNH  148
            YQMLYA GSFR+ Q S+H
Sbjct  545  YQMLYAAGSFRVAQDSDH  562



>ref|XP_006600718.1| PREDICTED: uncharacterized membrane protein YMR155W-like [Glycine 
max]
 gb|KHN15017.1| Putative membrane protein [Glycine soja]
Length=571

 Score =   279 bits (713),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 144/205 (70%), Positives = 172/205 (84%), Gaps = 7/205 (3%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            VLNNLAQ+GIAQG+ DTTILLSLFSF NFVGRLGGG+VSE+FVR K +PRTIWMT TQ++
Sbjct  367  VLNNLAQIGIAQGMEDTTILLSLFSFFNFVGRLGGGVVSEYFVRTKTIPRTIWMTCTQII  426

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            MI  Y +FA A+ GTLY A A+LGICYGVQFSI+IPT SELFGLK FGL+ +FM +GNPL
Sbjct  427  MIFLYLVFAYAIKGTLYPAIAVLGICYGVQFSIVIPTVSELFGLKDFGLLSNFMALGNPL  486

Query  381  GAYLFSGLLAGYLYDIEAAKQH-------SDTCIGPNCFRVTFlvlaglcsagallsVVL  223
            GA+LFS LLAG++YD EAAKQH       S  C+GPNCF++TF  LAG+C AG + S++L
Sbjct  487  GAFLFSALLAGHIYDNEAAKQHGVGLIASSVACMGPNCFKLTFFTLAGVCIAGTISSIIL  546

Query  222  TVRLKPVYQMLYAGGSFRLPQSSNH  148
            T+R+KPVYQMLYAGGSF+LPQ+S H
Sbjct  547  TIRIKPVYQMLYAGGSFKLPQTSGH  571



>gb|KHN23190.1| hypothetical protein glysoja_044550 [Glycine soja]
Length=568

 Score =   278 bits (712),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 142/206 (69%), Positives = 171/206 (83%), Gaps = 8/206 (4%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            VLNNLAQ+GIAQG  DTT LLS+FSFCNFVGRL GG+VSEHFVR K +PRT+WMT TQ V
Sbjct  362  VLNNLAQIGIAQGEEDTTTLLSIFSFCNFVGRLSGGVVSEHFVRTKTIPRTVWMTCTQTV  421

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            M+I Y LFA A+NGTLY A A LG+CYGVQ S+++PT SELFGLKHFG++ SFM +GNP+
Sbjct  422  MLIAYLLFAYAINGTLYPAIAFLGVCYGVQVSVMLPTVSELFGLKHFGVLSSFMSLGNPI  481

Query  381  GAYLFSGLLAGYLYDIEAAKQH--------SDTCIGPNCFRVTFlvlaglcsagallsVV  226
            GA+LFS LLAG +YD EAAKQH          +CIGPNCF++TF +LAG+C AG + SV+
Sbjct  482  GAFLFSALLAGNIYDNEAAKQHGIDLLLDSGVSCIGPNCFKLTFFILAGVCIAGIVFSVI  541

Query  225  LTVRLKPVYQMLYAGGSFRLPQSSNH  148
            LT+R+KPVYQMLYAGGSFRLPQ+S++
Sbjct  542  LTLRIKPVYQMLYAGGSFRLPQTSSN  567



>ref|XP_009363916.1| PREDICTED: uncharacterized protein LOC103953847 [Pyrus x bretschneideri]
Length=573

 Score =   278 bits (712),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 143/205 (70%), Positives = 174/205 (85%), Gaps = 7/205 (3%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            VLNNLAQ+GIAQG +DTT+LLSLFSF NFVGRLGGG+VSEHFVR K +PRT+WMT TQ++
Sbjct  369  VLNNLAQIGIAQGFHDTTVLLSLFSFGNFVGRLGGGVVSEHFVRSKTIPRTVWMTCTQII  428

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            MI TY LFASA++ T Y ATALLGICYGVQFS++IPT SELFGL+ FG+  +FM +GNPL
Sbjct  429  MIATYLLFASAISATFYPATALLGICYGVQFSVMIPTVSELFGLRDFGIFYNFMSLGNPL  488

Query  381  GAYLFSGLLAGYLYDIEAAKQH-------SDTCIGPNCFRVTFlvlaglcsagallsVVL  223
            GA LFSGLLAGY+YD EAAKQH       + +C+GPNCFR+TFLVLA +C  G +LS+VL
Sbjct  489  GALLFSGLLAGYIYDNEAAKQHGVHLYGTNVSCVGPNCFRLTFLVLAAVCGVGTILSIVL  548

Query  222  TVRLKPVYQMLYAGGSFRLPQSSNH  148
            ++R+KPVYQMLY+GGSFR+  ++NH
Sbjct  549  SLRIKPVYQMLYSGGSFRVLPNTNH  573



>ref|XP_003546584.1| PREDICTED: uncharacterized membrane protein YMR155W-like [Glycine 
max]
Length=570

 Score =   278 bits (712),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 142/206 (69%), Positives = 171/206 (83%), Gaps = 8/206 (4%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            VLNNLAQ+GIAQG  DTT LLS+FSFCNFVGRL GG+VSEHFVR K +PRT+WMT TQ V
Sbjct  364  VLNNLAQIGIAQGEEDTTTLLSIFSFCNFVGRLSGGVVSEHFVRTKTIPRTVWMTCTQTV  423

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            M+I Y LFA A+NGTLY A A LG+CYGVQ S+++PT SELFGLKHFG++ SFM +GNP+
Sbjct  424  MLIVYLLFAYAINGTLYPAIAFLGVCYGVQVSVMLPTVSELFGLKHFGVLSSFMSLGNPI  483

Query  381  GAYLFSGLLAGYLYDIEAAKQH--------SDTCIGPNCFRVTFlvlaglcsagallsVV  226
            GA+LFS LLAG +YD EAAKQH          +CIGPNCF++TF +LAG+C AG + SV+
Sbjct  484  GAFLFSALLAGNIYDNEAAKQHGIGLLLDSGVSCIGPNCFKLTFFILAGVCIAGIVFSVI  543

Query  225  LTVRLKPVYQMLYAGGSFRLPQSSNH  148
            LT+R+KPVYQMLYAGGSFRLPQ+S++
Sbjct  544  LTLRIKPVYQMLYAGGSFRLPQTSSN  569



>ref|XP_008384897.1| PREDICTED: uncharacterized protein LOC103447477 [Malus domestica]
Length=573

 Score =   278 bits (711),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 143/205 (70%), Positives = 174/205 (85%), Gaps = 7/205 (3%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            VLNNLAQ+GIAQG +DTT+LLSLFSF NFVGRLGGG+VSEHFVR K +PRT+WMT TQ++
Sbjct  369  VLNNLAQIGIAQGFHDTTVLLSLFSFGNFVGRLGGGVVSEHFVRSKTIPRTVWMTCTQII  428

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            MI TY LFASA++ T Y ATALLGICYGVQFS++IPT SELFGL+ FG+  +FM +GNPL
Sbjct  429  MIATYLLFASAISATFYPATALLGICYGVQFSVMIPTVSELFGLRDFGIFYNFMSLGNPL  488

Query  381  GAYLFSGLLAGYLYDIEAAKQH-------SDTCIGPNCFRVTFlvlaglcsagallsVVL  223
            GA LFSGLLAGY+YD EAAKQH       + +C+GPNCFR+TFLVLA +C  G +LS+VL
Sbjct  489  GALLFSGLLAGYVYDNEAAKQHGIHLYGTNISCVGPNCFRLTFLVLAAVCGVGTILSIVL  548

Query  222  TVRLKPVYQMLYAGGSFRLPQSSNH  148
            ++R+KPVYQMLY+GGSFR+  ++NH
Sbjct  549  SLRIKPVYQMLYSGGSFRVLPNTNH  573



>ref|XP_006427480.1| hypothetical protein CICLE_v10025286mg [Citrus clementina]
 ref|XP_006427481.1| hypothetical protein CICLE_v10025286mg [Citrus clementina]
 gb|ESR40720.1| hypothetical protein CICLE_v10025286mg [Citrus clementina]
 gb|ESR40721.1| hypothetical protein CICLE_v10025286mg [Citrus clementina]
Length=431

 Score =   274 bits (700),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 137/198 (69%), Positives = 170/198 (86%), Gaps = 0/198 (0%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            VLNNLAQ+G+A GVNDTT LL LFS CNF GRLG G++SEH+VR KA+PRT+W+T T ++
Sbjct  234  VLNNLAQIGVALGVNDTTELLCLFSLCNFAGRLGSGVLSEHYVRSKAIPRTVWITCTHIM  293

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            MI+T+ L+ASAL+GTLY AT LLG+CYGV +S+++PT SELFGLKHFGLI +F+ +GNP+
Sbjct  294  MILTFLLYASALSGTLYAATVLLGVCYGVIYSLMVPTASELFGLKHFGLIYNFILLGNPI  353

Query  381  GAYLFSGLLAGYLYDIEAAKQHSDTCIGPNCFRVTFlvlaglcsagallsVVLTVRLKPV  202
            GA LFSGLLAG LYD EA KQ S TCIG  CFR+TFLVLAG+C  G +LS++LT+R++PV
Sbjct  354  GALLFSGLLAGKLYDAEATKQGSSTCIGAECFRLTFLVLAGVCGLGTILSIILTIRIRPV  413

Query  201  YQMLYAGGSFRLPQSSNH  148
            YQMLYAGGSFR+PQ S+H
Sbjct  414  YQMLYAGGSFRVPQPSDH  431



>gb|KDP37029.1| hypothetical protein JCGZ_06085 [Jatropha curcas]
Length=565

 Score =   277 bits (708),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 137/198 (69%), Positives = 173/198 (87%), Gaps = 0/198 (0%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            +LNNLAQ+G+A G++DTTILL++FSFCNFVGRLG G +SEHFVR K +PRTIWMT   ++
Sbjct  368  ILNNLAQIGVAFGLDDTTILLAVFSFCNFVGRLGSGAISEHFVRSKTIPRTIWMTLAHMI  427

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            M++T+ LFA AL+G LYVATAL+GICYG+ +S+++ T SELFGLKHFG+I +FM +GNP+
Sbjct  428  MVVTFVLFALALDGILYVATALIGICYGILYSVIVSTASELFGLKHFGIIYAFMLLGNPI  487

Query  381  GAYLFSGLLAGYLYDIEAAKQHSDTCIGPNCFRVTFlvlaglcsagallsVVLTVRLKPV  202
            GA LFSGLLAGY+YD EAAKQ S TC+G +CF++TFLVLAG+C  GAL S++LT+R++PV
Sbjct  488  GALLFSGLLAGYVYDAEAAKQGSSTCVGSDCFKLTFLVLAGICGLGALFSIILTIRIRPV  547

Query  201  YQMLYAGGSFRLPQSSNH  148
            YQMLYAGGSFRLPQSS H
Sbjct  548  YQMLYAGGSFRLPQSSGH  565



>gb|KHG20418.1| putative transporter MCH1 [Gossypium arboreum]
Length=467

 Score =   273 bits (699),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 136/198 (69%), Positives = 171/198 (86%), Gaps = 0/198 (0%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            VLNNLAQ+G+A GV +TTILLSLFSFCNFVGRLG G +SEHFVR + +PRT+WM  T +V
Sbjct  270  VLNNLAQIGLAFGVENTTILLSLFSFCNFVGRLGSGALSEHFVRTRTIPRTLWMACTLIV  329

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            M+I + L+A A +GTLYV+TALLGICYG Q+++++PT SELFGL+HFG+I SFM +GNP+
Sbjct  330  MVIAFVLYALAFSGTLYVSTALLGICYGFQYNLMVPTASELFGLEHFGIIYSFMLLGNPV  389

Query  381  GAYLFSGLLAGYLYDIEAAKQHSDTCIGPNCFRVTFlvlaglcsagallsVVLTVRLKPV  202
            GA LFSGLLAGY+YD EAAKQ S TC+GP CFR+TF VLAG+C  G+ LS++LT+R++PV
Sbjct  390  GALLFSGLLAGYVYDAEAAKQGSSTCLGPECFRLTFFVLAGICGLGSFLSLILTIRIRPV  449

Query  201  YQMLYAGGSFRLPQSSNH  148
            YQMLYA GSFRLP++S+H
Sbjct  450  YQMLYASGSFRLPRASDH  467



>gb|KJB70656.1| hypothetical protein B456_011G085700 [Gossypium raimondii]
Length=478

 Score =   274 bits (700),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 136/198 (69%), Positives = 171/198 (86%), Gaps = 0/198 (0%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            VLNNLAQ+G+A GV +TTILLSLFSFCNFVGRLG G +SEHFVR + +PRT+WM  T +V
Sbjct  281  VLNNLAQIGLAFGVENTTILLSLFSFCNFVGRLGSGALSEHFVRTRTIPRTLWMACTLIV  340

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            M+I + L+A A +GTLYV+TALLGICYG Q+++++PT SELFGL+HFG+I SFM +GNP+
Sbjct  341  MVIAFVLYALAFSGTLYVSTALLGICYGFQYNLMVPTASELFGLEHFGIIYSFMLLGNPV  400

Query  381  GAYLFSGLLAGYLYDIEAAKQHSDTCIGPNCFRVTFlvlaglcsagallsVVLTVRLKPV  202
            GA LFSGLLAGY+YD EAAKQ S TC+GP CFR+TF VLAG+C  G+ LS++LT+R++PV
Sbjct  401  GALLFSGLLAGYVYDAEAAKQGSSTCLGPECFRLTFFVLAGICGLGSFLSLILTIRIRPV  460

Query  201  YQMLYAGGSFRLPQSSNH  148
            YQMLYA GSFRLP++S+H
Sbjct  461  YQMLYASGSFRLPRASDH  478



>ref|XP_007217245.1| hypothetical protein PRUPE_ppa003638mg [Prunus persica]
 gb|EMJ18444.1| hypothetical protein PRUPE_ppa003638mg [Prunus persica]
Length=560

 Score =   275 bits (704),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 139/198 (70%), Positives = 168/198 (85%), Gaps = 0/198 (0%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            VLNNL+Q+GIA G +DTTILLSLFSFCNFVGRLG G VSEHF+R K +PRT WM    V+
Sbjct  363  VLNNLSQIGIALGASDTTILLSLFSFCNFVGRLGSGAVSEHFLRTKTIPRTFWMACAHVL  422

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            MI+++ L+A AL+GTLYVATAL GICYG Q+SI++PT+SELFGLKHFG+  SFMG+GNP+
Sbjct  423  MIVSFVLYALALSGTLYVATALFGICYGTQYSIMVPTSSELFGLKHFGVNYSFMGLGNPI  482

Query  381  GAYLFSGLLAGYLYDIEAAKQHSDTCIGPNCFRVTFlvlaglcsagallsVVLTVRLKPV  202
            GA LFS LLAG +YD EAAKQ   TCIG +CFR+TF+VLA  C  G +LS++LT+R++PV
Sbjct  483  GAILFSVLLAGNVYDAEAAKQGGSTCIGSSCFRLTFIVLASACGLGTILSIILTIRVRPV  542

Query  201  YQMLYAGGSFRLPQSSNH  148
            YQMLYAGGSFRLPQSS+H
Sbjct  543  YQMLYAGGSFRLPQSSSH  560



>gb|KDO52312.1| hypothetical protein CISIN_1g014047mg [Citrus sinensis]
Length=431

 Score =   271 bits (694),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 136/198 (69%), Positives = 170/198 (86%), Gaps = 0/198 (0%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            VLNNLAQ+G+A GVNDTT LL LFS CNF GRLG G++SEH+VR KA+PRT+W+T T ++
Sbjct  234  VLNNLAQIGVALGVNDTTELLCLFSLCNFAGRLGSGVLSEHYVRSKAIPRTVWITCTHIM  293

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            MI+T+ L+ASAL+GTLY AT LLG+CYGV +S+++PT SELFGLKHFGLI +F+ +GNP+
Sbjct  294  MILTFLLYASALSGTLYAATVLLGVCYGVIYSLMVPTASELFGLKHFGLIYNFILLGNPI  353

Query  381  GAYLFSGLLAGYLYDIEAAKQHSDTCIGPNCFRVTFlvlaglcsagallsVVLTVRLKPV  202
            GA LFSGLLAG LYD EA KQ S TCIG  CFR+TFLVLAG+C  G +LS++LT+R++PV
Sbjct  354  GALLFSGLLAGKLYDAEATKQGSSTCIGAECFRLTFLVLAGVCGLGTILSIILTIRIRPV  413

Query  201  YQMLYAGGSFRLPQSSNH  148
            YQMLYAGGSFR+PQ+S+ 
Sbjct  414  YQMLYAGGSFRVPQASDR  431



>ref|XP_008228741.1| PREDICTED: uncharacterized membrane protein YMR155W [Prunus mume]
Length=560

 Score =   275 bits (704),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 139/198 (70%), Positives = 169/198 (85%), Gaps = 0/198 (0%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            VLNNL+Q+GIA G +DTTILLSLFSFCNFVGRLG G VSEHF+R K +PRT WM    ++
Sbjct  363  VLNNLSQIGIALGASDTTILLSLFSFCNFVGRLGSGAVSEHFLRTKTIPRTFWMACAHIL  422

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            MI+++ L+A AL+GTLYVATAL GICYG Q+SI++PT+SELFGLKHFG+  SFMG+GNP+
Sbjct  423  MIVSFVLYALALSGTLYVATALFGICYGTQYSIMVPTSSELFGLKHFGVNYSFMGLGNPI  482

Query  381  GAYLFSGLLAGYLYDIEAAKQHSDTCIGPNCFRVTFlvlaglcsagallsVVLTVRLKPV  202
            GA LFS LLAG +YD EAAKQ   TCIG +CFR+TF+VLAG C  G +LS++LT+R++PV
Sbjct  483  GAILFSVLLAGNVYDAEAAKQGGSTCIGSSCFRLTFIVLAGACGLGTILSIILTIRVRPV  542

Query  201  YQMLYAGGSFRLPQSSNH  148
            YQMLYAGGSFRLPQS+NH
Sbjct  543  YQMLYAGGSFRLPQSANH  560



>ref|XP_003541492.1| PREDICTED: uncharacterized membrane protein YMR155W-like [Glycine 
max]
 gb|KHN47125.1| Putative membrane protein [Glycine soja]
Length=571

 Score =   274 bits (700),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 143/205 (70%), Positives = 171/205 (83%), Gaps = 7/205 (3%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            VLNNLAQ+GIAQG+ DTT LLSLFSF NFVGRLGGG+VSE+FVR   +PRTIWMT TQ++
Sbjct  367  VLNNLAQIGIAQGMEDTTNLLSLFSFFNFVGRLGGGVVSEYFVRTNTIPRTIWMTCTQII  426

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            MI +Y +FA A+ GTLY A A+LGICYGVQFSI+IPT SELFGLK FGL+ +FM +GNPL
Sbjct  427  MIFSYLVFAYAIKGTLYPAIAILGICYGVQFSIVIPTVSELFGLKDFGLLSNFMALGNPL  486

Query  381  GAYLFSGLLAGYLYDIEAAKQH-------SDTCIGPNCFRVTFlvlaglcsagallsVVL  223
            GA+LFS LLAG++YD EAAKQH       S  C+GPNCF++TFL LAG+C AG + S++L
Sbjct  487  GAFLFSALLAGHIYDNEAAKQHGVGLIASSVACMGPNCFKLTFLTLAGVCVAGTISSIIL  546

Query  222  TVRLKPVYQMLYAGGSFRLPQSSNH  148
            TVR+KPVYQMLYAGGSF+LPQ+S  
Sbjct  547  TVRIKPVYQMLYAGGSFKLPQTSGQ  571



>ref|XP_006427482.1| hypothetical protein CICLE_v10025286mg [Citrus clementina]
 gb|ESR40722.1| hypothetical protein CICLE_v10025286mg [Citrus clementina]
Length=564

 Score =   273 bits (699),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 137/198 (69%), Positives = 170/198 (86%), Gaps = 0/198 (0%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            VLNNLAQ+G+A GVNDTT LL LFS CNF GRLG G++SEH+VR KA+PRT+W+T T ++
Sbjct  367  VLNNLAQIGVALGVNDTTELLCLFSLCNFAGRLGSGVLSEHYVRSKAIPRTVWITCTHIM  426

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            MI+T+ L+ASAL+GTLY AT LLG+CYGV +S+++PT SELFGLKHFGLI +F+ +GNP+
Sbjct  427  MILTFLLYASALSGTLYAATVLLGVCYGVIYSLMVPTASELFGLKHFGLIYNFILLGNPI  486

Query  381  GAYLFSGLLAGYLYDIEAAKQHSDTCIGPNCFRVTFlvlaglcsagallsVVLTVRLKPV  202
            GA LFSGLLAG LYD EA KQ S TCIG  CFR+TFLVLAG+C  G +LS++LT+R++PV
Sbjct  487  GALLFSGLLAGKLYDAEATKQGSSTCIGAECFRLTFLVLAGVCGLGTILSIILTIRIRPV  546

Query  201  YQMLYAGGSFRLPQSSNH  148
            YQMLYAGGSFR+PQ S+H
Sbjct  547  YQMLYAGGSFRVPQPSDH  564



>gb|KJB70655.1| hypothetical protein B456_011G085700 [Gossypium raimondii]
Length=565

 Score =   273 bits (698),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 136/198 (69%), Positives = 171/198 (86%), Gaps = 0/198 (0%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            VLNNLAQ+G+A GV +TTILLSLFSFCNFVGRLG G +SEHFVR + +PRT+WM  T +V
Sbjct  368  VLNNLAQIGLAFGVENTTILLSLFSFCNFVGRLGSGALSEHFVRTRTIPRTLWMACTLIV  427

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            M+I + L+A A +GTLYV+TALLGICYG Q+++++PT SELFGL+HFG+I SFM +GNP+
Sbjct  428  MVIAFVLYALAFSGTLYVSTALLGICYGFQYNLMVPTASELFGLEHFGIIYSFMLLGNPV  487

Query  381  GAYLFSGLLAGYLYDIEAAKQHSDTCIGPNCFRVTFlvlaglcsagallsVVLTVRLKPV  202
            GA LFSGLLAGY+YD EAAKQ S TC+GP CFR+TF VLAG+C  G+ LS++LT+R++PV
Sbjct  488  GALLFSGLLAGYVYDAEAAKQGSSTCLGPECFRLTFFVLAGICGLGSFLSLILTIRIRPV  547

Query  201  YQMLYAGGSFRLPQSSNH  148
            YQMLYA GSFRLP++S+H
Sbjct  548  YQMLYASGSFRLPRASDH  565



>ref|XP_004486637.1| PREDICTED: uncharacterized membrane protein YMR155W-like [Cicer 
arietinum]
Length=562

 Score =   273 bits (697),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 140/198 (71%), Positives = 167/198 (84%), Gaps = 0/198 (0%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            VLNNLAQ+G+A GV D TILL++FSFCNF+GRLG G VSEHFVRL  LPRT WMT TQV+
Sbjct  365  VLNNLAQIGVALGVEDATILLAVFSFCNFMGRLGAGAVSEHFVRLITLPRTFWMTCTQVI  424

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            MII + L+ASAL+GTLY ATALLG+CYGVQ+SI++PT SELFGLKHFG+I SFM +GNP+
Sbjct  425  MIIAFLLYASALDGTLYAATALLGMCYGVQYSIMVPTVSELFGLKHFGVISSFMMLGNPI  484

Query  381  GAYLFSGLLAGYLYDIEAAKQHSDTCIGPNCFRVTFlvlaglcsagallsVVLTVRLKPV  202
            GA LFS   AG +YD EAAKQ + TC G +CFR+TFLVLAG+C  G +LS++LTVR++PV
Sbjct  485  GALLFSVFFAGNVYDTEAAKQGNSTCYGADCFRITFLVLAGVCGLGTILSIILTVRIRPV  544

Query  201  YQMLYAGGSFRLPQSSNH  148
            YQMLYAGGSFRL  +SN 
Sbjct  545  YQMLYAGGSFRLSHTSNQ  562



>ref|XP_002298207.2| hypothetical protein POPTR_0001s21170g [Populus trichocarpa]
 gb|EEE83012.2| hypothetical protein POPTR_0001s21170g [Populus trichocarpa]
Length=431

 Score =   269 bits (687),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 138/198 (70%), Positives = 173/198 (87%), Gaps = 0/198 (0%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            VLNNLAQ+G+A G+ DTT+LL+LFSFCNFVGR+G G +SEHFVRLK +PRT+WMTF  +V
Sbjct  234  VLNNLAQIGVAFGLEDTTLLLTLFSFCNFVGRIGSGAISEHFVRLKMIPRTLWMTFALMV  293

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            M++T+ LFA ALNG LY A  LLGI YGV ++I++PT SELFGLKHFGLI SFMG+GNP+
Sbjct  294  MLMTFILFAFALNGILYAAIPLLGISYGVLYAIMVPTVSELFGLKHFGLIYSFMGLGNPI  353

Query  381  GAYLFSGLLAGYLYDIEAAKQHSDTCIGPNCFRVTFlvlaglcsagallsVVLTVRLKPV  202
            GA LFSG+LAGY+YD EAAKQ S +C+GP+CF+VTFLVLAG+C  G +LS++LTVR++PV
Sbjct  354  GALLFSGMLAGYVYDAEAAKQSSSSCVGPDCFKVTFLVLAGVCGLGTILSIILTVRIRPV  413

Query  201  YQMLYAGGSFRLPQSSNH  148
            Y++LY+GGSFRLPQ+S H
Sbjct  414  YELLYSGGSFRLPQTSGH  431



>ref|XP_003609485.1| hypothetical protein MTR_4g116210 [Medicago truncatula]
 gb|AES91682.1| nodulin-like/MFS transporter [Medicago truncatula]
Length=575

 Score =   273 bits (698),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 144/203 (71%), Positives = 167/203 (82%), Gaps = 7/203 (3%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            V+NNLAQVG AQGV D TILLS+FSF NFVGRLGGG+VSEHFVR K +PRT+WMT TQ+V
Sbjct  371  VINNLAQVGAAQGVEDITILLSVFSFFNFVGRLGGGVVSEHFVRKKTIPRTVWMTCTQIV  430

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            MII Y LFA A+ GTLY A  +LGICYGVQFSILIPT SELFGL+HFGL  +FM +GNPL
Sbjct  431  MIILYLLFAFAIKGTLYPAVGVLGICYGVQFSILIPTVSELFGLEHFGLFFNFMSLGNPL  490

Query  381  GAYLFSGLLAGYLYDIEAAKQH-------SDTCIGPNCFRVTFlvlaglcsagallsVVL  223
            GA LFS LLAG +YD E AKQ        S +C+GP+CF+VTFLVLA +C+AG + S++L
Sbjct  491  GALLFSALLAGRIYDSELAKQQGFGLIVSSVSCVGPDCFKVTFLVLAAVCAAGTISSIIL  550

Query  222  TVRLKPVYQMLYAGGSFRLPQSS  154
            T+R+KPVYQMLYAGGSFRLPQ S
Sbjct  551  TIRIKPVYQMLYAGGSFRLPQMS  573



>ref|XP_010063536.1| PREDICTED: uncharacterized membrane protein YMR155W [Eucalyptus 
grandis]
 gb|KCW70765.1| hypothetical protein EUGRSUZ_F03926 [Eucalyptus grandis]
Length=562

 Score =   272 bits (695),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 143/198 (72%), Positives = 169/198 (85%), Gaps = 0/198 (0%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            VLNNLAQ+G A GV+DTT+LL +FSF NF+GRLG G+VSE+FVR KALPRTIWMTF Q++
Sbjct  365  VLNNLAQIGAALGVDDTTVLLCVFSFFNFLGRLGSGVVSEYFVRSKALPRTIWMTFAQII  424

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            MI T+ L+ASALNGTLY ATALLG+CYGVQFSI+IPT SELFGLKHFG+I +FM +GNP+
Sbjct  425  MIATFLLYASALNGTLYAATALLGMCYGVQFSIMIPTASELFGLKHFGIIFNFMQLGNPI  484

Query  381  GAYLFSGLLAGYLYDIEAAKQHSDTCIGPNCFRVTFlvlaglcsagallsVVLTVRLKPV  202
            GA+LFSGLLAG +YD EAA Q   TC+GP CFR+TFLVLAGLC  G LLS+VL VR++PV
Sbjct  485  GAFLFSGLLAGDVYDAEAALQGGSTCLGPTCFRLTFLVLAGLCGLGTLLSIVLYVRIRPV  544

Query  201  YQMLYAGGSFRLPQSSNH  148
            YQ LY+ GSFR P SS+ 
Sbjct  545  YQSLYSEGSFRNPPSSDQ  562



>ref|XP_011012238.1| PREDICTED: uncharacterized protein LOC105116533 isoform X2 [Populus 
euphratica]
Length=482

 Score =   269 bits (687),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 139/198 (70%), Positives = 172/198 (87%), Gaps = 0/198 (0%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            VLNNLAQ+G+A G+ DTT+LL+LFSFCNFVGRLG G +SEHFVR K +PRT+WMTF  +V
Sbjct  285  VLNNLAQIGVAFGLEDTTLLLTLFSFCNFVGRLGSGAISEHFVRWKMIPRTLWMTFALMV  344

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            M++T+ LFA ALNG LY A  LLGICYGV +SI++PT SELFGLKHFGLI SFMG+GNP+
Sbjct  345  MLMTFILFAFALNGILYAAIPLLGICYGVLYSIMVPTVSELFGLKHFGLIYSFMGLGNPI  404

Query  381  GAYLFSGLLAGYLYDIEAAKQHSDTCIGPNCFRVTFlvlaglcsagallsVVLTVRLKPV  202
            GA LFSG+LAGY+YD EAAKQ S +C+G +CF+VTFLVLAG+C  G +LS++LTVR++PV
Sbjct  405  GALLFSGMLAGYVYDAEAAKQSSSSCVGSDCFKVTFLVLAGVCGLGTILSIILTVRIRPV  464

Query  201  YQMLYAGGSFRLPQSSNH  148
            Y++LY+GGSFRLPQ+S H
Sbjct  465  YELLYSGGSFRLPQTSGH  482



>ref|XP_007138470.1| hypothetical protein PHAVU_009G211900g [Phaseolus vulgaris]
 gb|ESW10464.1| hypothetical protein PHAVU_009G211900g [Phaseolus vulgaris]
Length=569

 Score =   271 bits (692),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 137/204 (67%), Positives = 173/204 (85%), Gaps = 7/204 (3%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            VLNNLAQ+GIA+G  DTT L+S+FSFCNF+GRLGGG+VSEHFVR K LPRT+WMT TQ++
Sbjct  364  VLNNLAQIGIARGEEDTTTLVSIFSFCNFLGRLGGGVVSEHFVRTKTLPRTVWMTCTQII  423

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            M+I YFLFA A++GTLY A A LG+CYGVQ S++IPT SE+FGLKHFG++ S M +GNP+
Sbjct  424  MLIVYFLFAYAVDGTLYPAVAFLGVCYGVQISVMIPTVSEVFGLKHFGVLSSVMALGNPI  483

Query  381  GAYLFSGLLAGYLYDIEAAKQH-------SDTCIGPNCFRVTFlvlaglcsagallsVVL  223
            GA LFS LLAG +YD EAAKQH         +C+GPNCF++TFL+LAG+C+ G +LSV++
Sbjct  484  GAVLFSVLLAGNIYDNEAAKQHGIGLLDSGVSCLGPNCFKLTFLILAGVCAVGIILSVIV  543

Query  222  TVRLKPVYQMLYAGGSFRLPQSSN  151
            T+R+KPVY+MLYAGGSFRLPQ+S+
Sbjct  544  TLRIKPVYRMLYAGGSFRLPQTSS  567



>emb|CAN69082.1| hypothetical protein VITISV_014065 [Vitis vinifera]
Length=504

 Score =   269 bits (687),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 142/198 (72%), Positives = 168/198 (85%), Gaps = 7/198 (4%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            VLNNLAQ+G+A GV DTTILLSLFSFCNF+GRL GG+        K LPRTIWMTF+QVV
Sbjct  313  VLNNLAQIGVAFGVTDTTILLSLFSFCNFLGRLFGGVD-------KTLPRTIWMTFSQVV  365

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            M++T+ L+ASAL+GTLY +TALLGICYGVQFSI++P  SELFGLKHFG+I +FM +GNP+
Sbjct  366  MVVTFLLYASALSGTLYASTALLGICYGVQFSIMVPCASELFGLKHFGVIYNFMLLGNPI  425

Query  381  GAYLFSGLLAGYLYDIEAAKQHSDTCIGPNCFRVTFlvlaglcsagallsVVLTVRLKPV  202
            GA LFSGLLAGY+YD EAAKQ S TC+G  CFR+TFLVLAG C  G +LS++LT+R+KPV
Sbjct  426  GALLFSGLLAGYVYDFEAAKQQSSTCLGGTCFRLTFLVLAGACGLGTILSIILTIRIKPV  485

Query  201  YQMLYAGGSFRLPQSSNH  148
            YQMLYAGGSFRLP SS+ 
Sbjct  486  YQMLYAGGSFRLPSSSSQ  503



>ref|XP_006465227.1| PREDICTED: uncharacterized membrane protein YMR155W-like [Citrus 
sinensis]
Length=564

 Score =   269 bits (688),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 135/198 (68%), Positives = 170/198 (86%), Gaps = 0/198 (0%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            VLNNLAQ+G+A GVNDTT LL LFS CNF GRLG G++SEH+VR KA+PRT+W+T T ++
Sbjct  367  VLNNLAQIGVALGVNDTTELLCLFSLCNFAGRLGSGVLSEHYVRSKAIPRTVWITCTHIM  426

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            MI+T+ L+ASAL+GTLY AT LLG+C GV +S+++PT SELFGLKHFGLI +F+ +GNP+
Sbjct  427  MILTFLLYASALSGTLYAATVLLGVCCGVIYSLMVPTASELFGLKHFGLIYNFILLGNPI  486

Query  381  GAYLFSGLLAGYLYDIEAAKQHSDTCIGPNCFRVTFlvlaglcsagallsVVLTVRLKPV  202
            GA+LFSGLLAG LYD EA KQ S TCIG  CFR+TFLVLAG+C  G +LS++LT+R++PV
Sbjct  487  GAFLFSGLLAGKLYDAEATKQGSSTCIGAECFRLTFLVLAGVCGLGTILSIILTIRIRPV  546

Query  201  YQMLYAGGSFRLPQSSNH  148
            YQMLYAGGSFR+PQ+S+ 
Sbjct  547  YQMLYAGGSFRVPQASDR  564



>ref|XP_004488508.1| PREDICTED: uncharacterized protein LOC101489674 [Cicer arietinum]
Length=572

 Score =   268 bits (686),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 138/205 (67%), Positives = 170/205 (83%), Gaps = 7/205 (3%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            VLNNLAQ+GIAQG  DTT LLS+FSFCNFVGRLGGG+VSE+FVR + +PRT W+T TQ +
Sbjct  367  VLNNLAQIGIAQGEEDTTTLLSIFSFCNFVGRLGGGVVSEYFVRTRLIPRTFWLTCTQTI  426

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            M++ Y +FA A+NGTLY A A LG+CYGVQ SI+IPT SELFGLKHFG++ SFM IGNPL
Sbjct  427  MLMVYLIFAFAVNGTLYPAVAFLGVCYGVQVSIMIPTVSELFGLKHFGVLSSFMSIGNPL  486

Query  381  GAYLFSGLLAGYLYDIEAAKQH-------SDTCIGPNCFRVTFlvlaglcsagallsVVL  223
            GA LFS LLAG +YD EAAKQH         +C+G +CF++TF +L+G+C+AG +LSV+L
Sbjct  487  GATLFSALLAGSIYDTEAAKQHGIDLFANGASCVGASCFKLTFFILSGVCAAGIILSVIL  546

Query  222  TVRLKPVYQMLYAGGSFRLPQSSNH  148
            T+R+KPVYQMLYAGGSFRLPQ+S+ 
Sbjct  547  TLRIKPVYQMLYAGGSFRLPQTSSS  571



>ref|XP_011012237.1| PREDICTED: uncharacterized protein LOC105116533 isoform X1 [Populus 
euphratica]
 ref|XP_011015382.1| PREDICTED: uncharacterized protein LOC105118996 [Populus euphratica]
Length=565

 Score =   268 bits (685),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 139/198 (70%), Positives = 172/198 (87%), Gaps = 0/198 (0%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            VLNNLAQ+G+A G+ DTT+LL+LFSFCNFVGRLG G +SEHFVR K +PRT+WMTF  +V
Sbjct  368  VLNNLAQIGVAFGLEDTTLLLTLFSFCNFVGRLGSGAISEHFVRWKMIPRTLWMTFALMV  427

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            M++T+ LFA ALNG LY A  LLGICYGV +SI++PT SELFGLKHFGLI SFMG+GNP+
Sbjct  428  MLMTFILFAFALNGILYAAIPLLGICYGVLYSIMVPTVSELFGLKHFGLIYSFMGLGNPI  487

Query  381  GAYLFSGLLAGYLYDIEAAKQHSDTCIGPNCFRVTFlvlaglcsagallsVVLTVRLKPV  202
            GA LFSG+LAGY+YD EAAKQ S +C+G +CF+VTFLVLAG+C  G +LS++LTVR++PV
Sbjct  488  GALLFSGMLAGYVYDAEAAKQSSSSCVGSDCFKVTFLVLAGVCGLGTILSIILTVRIRPV  547

Query  201  YQMLYAGGSFRLPQSSNH  148
            Y++LY+GGSFRLPQ+S H
Sbjct  548  YELLYSGGSFRLPQTSGH  565



>ref|XP_006852818.1| hypothetical protein AMTR_s00033p00175020 [Amborella trichopoda]
 gb|ERN14285.1| hypothetical protein AMTR_s00033p00175020 [Amborella trichopoda]
Length=585

 Score =   268 bits (685),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 142/206 (69%), Positives = 174/206 (84%), Gaps = 8/206 (4%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            VLNNLAQ+GIA GV DTTILLSLFSFCNF+GRLGGG+VSEHFV+ K  PR +WMT TQ++
Sbjct  380  VLNNLAQIGIAAGVEDTTILLSLFSFCNFIGRLGGGMVSEHFVKSKMTPRPLWMTLTQII  439

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            M  +Y ++ASAL GTLY ATALLGICYGVQFSI++PT+SELFGLKHFG+I +FM +GNPL
Sbjct  440  MAFSYLMYASALPGTLYAATALLGICYGVQFSIMVPTSSELFGLKHFGVIYAFMCLGNPL  499

Query  381  GAYLFSGLLAGYLYDIEAAKQ--------HSDTCIGPNCFRVTFlvlaglcsagallsVV  226
            GA +FSG LAGY+YD EAAKQ         S +C+GPNCFR+TF VL+G+C  G+ LSV+
Sbjct  500  GALIFSGGLAGYVYDKEAAKQIGGFLLGSSSSSCLGPNCFRLTFFVLSGVCFLGSFLSVI  559

Query  225  LTVRLKPVYQMLYAGGSFRLPQSSNH  148
            LT+RL+PVYQMLY+GGSFR+P++S+ 
Sbjct  560  LTLRLRPVYQMLYSGGSFRIPRNSDR  585



>gb|AAN62343.1|AF506028_10 nodulin-like protein [Citrus trifoliata]
Length=564

 Score =   267 bits (683),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 135/198 (68%), Positives = 169/198 (85%), Gaps = 0/198 (0%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            VLNNLAQ+G+A GVNDTT LL LFS CNF GRLG G++SEH+VR KA+PRT+W+T T ++
Sbjct  367  VLNNLAQIGVALGVNDTTELLCLFSLCNFAGRLGSGVLSEHYVRSKAIPRTVWITCTHIM  426

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            MI+T+ L+ASAL+GTLY AT LLG+C GV +S+++PT SELFGLKHFGLI +F+ +GNP+
Sbjct  427  MILTFLLYASALSGTLYAATILLGVCCGVIYSLMVPTASELFGLKHFGLIYNFILLGNPI  486

Query  381  GAYLFSGLLAGYLYDIEAAKQHSDTCIGPNCFRVTFlvlaglcsagallsVVLTVRLKPV  202
            GA LFSGLLAG LYD EA KQ S TCIG  CFR+TFLVLAG+C  G +LS++LT+R++PV
Sbjct  487  GALLFSGLLAGKLYDAEATKQGSSTCIGAECFRLTFLVLAGVCGLGTILSIILTIRIRPV  546

Query  201  YQMLYAGGSFRLPQSSNH  148
            YQMLYAGGSFR+PQ+S+ 
Sbjct  547  YQMLYAGGSFRVPQASDR  564



>ref|XP_004303264.1| PREDICTED: protein NUCLEAR FUSION DEFECTIVE 4 [Fragaria vesca 
subsp. vesca]
Length=560

 Score =   266 bits (679),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 137/198 (69%), Positives = 167/198 (84%), Gaps = 0/198 (0%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            VLNNL+Q+G+A G +DTTILLSLFSFCNF GRLG G+VSEHFV+   LPRT WMT   ++
Sbjct  363  VLNNLSQIGVALGSDDTTILLSLFSFCNFGGRLGSGVVSEHFVKKNTLPRTFWMTCAHIL  422

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            MI+++ L+AS L+GTLYVAT LLGICYGVQ+S+++PT SELFGLKHFG+   FM IGNP+
Sbjct  423  MILSFILYASDLSGTLYVATTLLGICYGVQYSMMVPTVSELFGLKHFGINYGFMLIGNPI  482

Query  381  GAYLFSGLLAGYLYDIEAAKQHSDTCIGPNCFRVTFlvlaglcsagallsVVLTVRLKPV  202
            GA LFS LLAG LYD EAAKQ + TC+G +CFR+TFLVLAG+C  G +LS++LTVR++PV
Sbjct  483  GAVLFSVLLAGNLYDAEAAKQGTSTCVGADCFRITFLVLAGVCGLGTVLSIILTVRVRPV  542

Query  201  YQMLYAGGSFRLPQSSNH  148
            YQMLYAGGSFRLP S+ H
Sbjct  543  YQMLYAGGSFRLPSSAIH  560



>gb|KEH37893.1| nodulin-like/MFS transporter [Medicago truncatula]
Length=570

 Score =   265 bits (676),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 137/205 (67%), Positives = 169/205 (82%), Gaps = 7/205 (3%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            VLNNLAQ+GIAQG  DTT LLS+FSFCNFVGRLGGG+VSEHFVR K +PRT W+T TQ V
Sbjct  365  VLNNLAQIGIAQGEEDTTTLLSIFSFCNFVGRLGGGVVSEHFVRTKLIPRTFWLTCTQTV  424

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            M++ Y LFA A+NGTLY A A LG+CYGVQ SI+IPTTSELFGLK+FG+  + M +GNPL
Sbjct  425  MLLVYLLFAFAVNGTLYPAVAFLGVCYGVQVSIMIPTTSELFGLKNFGVFSNIMSLGNPL  484

Query  381  GAYLFSGLLAGYLYDIEAAKQH-------SDTCIGPNCFRVTFlvlaglcsagallsVVL  223
            GA LFS LLAG +YD EAAKQH         +C+G +CF++TF +L+G+C+AG +LS++L
Sbjct  485  GATLFSALLAGSIYDKEAAKQHGINLLASGVSCVGASCFKLTFFILSGVCAAGIILSIIL  544

Query  222  TVRLKPVYQMLYAGGSFRLPQSSNH  148
            T+R+KPVYQMLYAGGSFRLPQ+++ 
Sbjct  545  TLRIKPVYQMLYAGGSFRLPQTTSS  569



>ref|XP_010687781.1| PREDICTED: uncharacterized protein LOC104901852 [Beta vulgaris 
subsp. vulgaris]
Length=576

 Score =   265 bits (676),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 140/206 (68%), Positives = 166/206 (81%), Gaps = 8/206 (4%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            VLNNLAQ+GIA G+ D +ILL LFSF NFVGRLGGG VSE+FVR + LPRTIW+T TQV+
Sbjct  366  VLNNLAQIGIAFGMPDASILLCLFSFFNFVGRLGGGSVSEYFVRTRTLPRTIWLTCTQVI  425

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            MII Y LFA  ++GTLY AT +LG+C+GVQFSI+IPT SELFGL++FG+I +FM IGNPL
Sbjct  426  MIIVYLLFAWGVDGTLYAATGMLGLCFGVQFSIMIPTASELFGLQNFGIIYNFMSIGNPL  485

Query  381  GAYLFSGLLAGYLYDIEAAKQH--------SDTCIGPNCFRVTFlvlaglcsagallsVV  226
            GA LFSGLLAGY YD E +KQH        S TC GPNCFR+TF+VLA +C  G++LS+V
Sbjct  486  GALLFSGLLAGYTYDSEVSKQHGINIPYANSHTCYGPNCFRITFVVLACVCGIGSILSIV  545

Query  225  LTVRLKPVYQMLYAGGSFRLPQSSNH  148
            LT R+KPVYQMLYAGGS R P S+N 
Sbjct  546  LTTRIKPVYQMLYAGGSLRQPSSTNE  571



>ref|XP_008351294.1| PREDICTED: uncharacterized membrane protein YMR155W-like [Malus 
domestica]
Length=452

 Score =   261 bits (667),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 133/195 (68%), Positives = 162/195 (83%), Gaps = 0/195 (0%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            VLNNL+Q+GIA G +DTTILLSLFSFCNFVGRLG G VSEHF+R K +PRT+WM    VV
Sbjct  257  VLNNLSQIGIALGASDTTILLSLFSFCNFVGRLGSGAVSEHFLRTKTVPRTVWMACAHVV  316

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            M+I++ L+A A++GTLYVATAL GICYG Q+S+++PT SELFGLK+F +I SFMG+GNP+
Sbjct  317  MLISFVLYALAISGTLYVATALFGICYGAQYSLMVPTASELFGLKNFAVIYSFMGLGNPI  376

Query  381  GAYLFSGLLAGYLYDIEAAKQHSDTCIGPNCFRVTFlvlaglcsagallsVVLTVRLKPV  202
            GA LFS LLAG +YD EAAKQ   TC+G  CF +TF+VLA  C  G +LSV+LT+R++PV
Sbjct  377  GAVLFSVLLAGDVYDAEAAKQGGSTCVGSACFGLTFIVLAIACGLGFILSVILTIRVRPV  436

Query  201  YQMLYAGGSFRLPQS  157
            YQMLYAGGSFRLP S
Sbjct  437  YQMLYAGGSFRLPSS  451



>gb|EYU21686.1| hypothetical protein MIMGU_mgv1a003901mg [Erythranthe guttata]
Length=556

 Score =   261 bits (668),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 139/199 (70%), Positives = 169/199 (85%), Gaps = 2/199 (1%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVR-LKALPRTIWMTFTQV  565
            VLNNLAQ+G++ GV+DTTILLSLFSFCNF+GRLG G VSEH VR  K +PRT  M+ TQ+
Sbjct  356  VLNNLAQIGVSLGVDDTTILLSLFSFCNFLGRLGAGAVSEHLVRSTKTIPRTFLMSVTQL  415

Query  564  VMIITYFLFASALNG-TLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGN  388
            +MI+ + L+ASAL+  TLY AT LLG+CYGVQF+++IPT SELFGL+HFG+I +FM +GN
Sbjct  416  IMILIFLLYASALSSVTLYAATGLLGVCYGVQFAVMIPTASELFGLRHFGIIFNFMQLGN  475

Query  387  PLGAYLFSGLLAGYLYDIEAAKQHSDTCIGPNCFRVTFlvlaglcsagallsVVLTVRLK  208
            P+GA LFS LLAG +YD EAAKQ    C+GPNCFR TFLVLAG+C  G+LLSVVLT+R++
Sbjct  476  PVGALLFSALLAGQVYDSEAAKQTGPNCMGPNCFRATFLVLAGVCGLGSLLSVVLTIRIR  535

Query  207  PVYQMLYAGGSFRLPQSSN  151
            PVYQMLYAGGSFRLPQSS+
Sbjct  536  PVYQMLYAGGSFRLPQSSS  554



>ref|XP_009401386.1| PREDICTED: uncharacterized protein LOC103985421 [Musa acuminata 
subsp. malaccensis]
Length=558

 Score =   260 bits (664),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 138/205 (67%), Positives = 169/205 (82%), Gaps = 7/205 (3%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            VLNNLAQ+G A G++D TILL LFSF NF+GRLGGG VSE+FVR + LPR IWMT TQ++
Sbjct  354  VLNNLAQIGAAAGIDDPTILLCLFSFGNFLGRLGGGAVSEYFVRTRMLPRPIWMTCTQMI  413

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            MII Y L+A  L+ TL  +TA+LGICYGVQ SI++PT SELFGLKHFG   +FM +GNPL
Sbjct  414  MIIAYLLYALGLSSTLNASTAMLGICYGVQTSIMVPTVSELFGLKHFGTFFNFMLLGNPL  473

Query  381  GAYLFSGLLAGYLYDIEAAKQ------HSDT-CIGPNCFRVTFlvlaglcsagallsVVL  223
            GA+LFSGLLAGYLYD EAA+Q      HS+T C GP+CFR+TF +LAG+CS G LL+++L
Sbjct  474  GAFLFSGLLAGYLYDKEAAEQQLGFLHHSNTSCFGPSCFRLTFFILAGVCSLGTLLTIIL  533

Query  222  TVRLKPVYQMLYAGGSFRLPQSSNH  148
            TVR++PVYQMLYAGGSFR PQ+++H
Sbjct  534  TVRIRPVYQMLYAGGSFRQPQTTHH  558



>ref|XP_010537919.1| PREDICTED: uncharacterized protein LOC104812458 [Tarenaya hassleriana]
 ref|XP_010537920.1| PREDICTED: uncharacterized protein LOC104812458 [Tarenaya hassleriana]
 ref|XP_010537921.1| PREDICTED: uncharacterized protein LOC104812458 [Tarenaya hassleriana]
Length=589

 Score =   257 bits (657),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 129/193 (67%), Positives = 162/193 (84%), Gaps = 0/193 (0%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            VLNNLAQ+GIA GV+DTTILL LFSF NF GRLG G +SEHFVR +A+PRT+WMT  Q+ 
Sbjct  397  VLNNLAQIGIALGVDDTTILLCLFSFFNFAGRLGSGAISEHFVRSRAMPRTVWMTVAQIA  456

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            M+I + L+A +L G+LY ATALLG CYG Q+S+++PT SELFGLKHFGLI +F+ +GNP+
Sbjct  457  MVIAFLLYAVSLTGSLYPATALLGTCYGFQYSLMVPTASELFGLKHFGLIYNFVLLGNPI  516

Query  381  GAYLFSGLLAGYLYDIEAAKQHSDTCIGPNCFRVTFlvlaglcsagallsVVLTVRLKPV  202
            GA+LFS LLAG+LYD EA++Q + TC GP CFRVTFL+LAG+ + GA+L V+LTVR++PV
Sbjct  517  GAFLFSSLLAGHLYDAEASRQGNSTCYGPECFRVTFLMLAGVSAMGAMLGVILTVRIRPV  576

Query  201  YQMLYAGGSFRLP  163
            Y+ LYA GSFRLP
Sbjct  577  YRSLYASGSFRLP  589



>ref|XP_009338491.1| PREDICTED: uncharacterized protein LOC103930831 [Pyrus x bretschneideri]
Length=558

 Score =   256 bits (655),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 132/195 (68%), Positives = 160/195 (82%), Gaps = 0/195 (0%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            VLNNL+Q+GIA G +DTTILLSLFSFCNFVGRLG G VSE+F+R K +PRT+WM    VV
Sbjct  363  VLNNLSQIGIALGASDTTILLSLFSFCNFVGRLGSGAVSEYFLRTKTVPRTVWMACAHVV  422

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            M+I+Y LFA  ++GTLYVATAL GICYG Q+S+++PT SELFGLK+F +I SFMG+GNP+
Sbjct  423  MLISYVLFALGISGTLYVATALFGICYGAQYSLMVPTASELFGLKNFAVIYSFMGLGNPI  482

Query  381  GAYLFSGLLAGYLYDIEAAKQHSDTCIGPNCFRVTFlvlaglcsagallsVVLTVRLKPV  202
            GA LFS  LAG +YD EAAKQ   TC+G  CF +TF+VLA  C  G +LSV+LT+R++PV
Sbjct  483  GAVLFSVFLAGDVYDAEAAKQGGTTCVGSACFGLTFIVLASACGLGFILSVILTIRVRPV  542

Query  201  YQMLYAGGSFRLPQS  157
            YQMLYAGGSFRLP S
Sbjct  543  YQMLYAGGSFRLPSS  557



>ref|XP_004165074.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101223430 
[Cucumis sativus]
Length=565

 Score =   254 bits (649),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 126/198 (64%), Positives = 162/198 (82%), Gaps = 0/198 (0%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            VLNNL+Q+GI+ G+ND T+LL+LFSFCNFVGRLG G++SEHFVR + +PR++WM F  V+
Sbjct  368  VLNNLSQIGISLGINDATLLLALFSFCNFVGRLGSGVISEHFVRSRMIPRSLWMMFALVL  427

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            M I + L+ASAL  TLY+AT L GI YGV +S+++P  SE+FGLK+FG+I +FM +GNP+
Sbjct  428  MSIAFLLYASALTITLYIATGLTGISYGVLYSMMVPLASEIFGLKNFGVIFNFMQLGNPI  487

Query  381  GAYLFSGLLAGYLYDIEAAKQHSDTCIGPNCFRVTFlvlaglcsagallsVVLTVRLKPV  202
            GA LFS LL   LYDIEAAKQ S TCIG  CFR TF +L+G+   G+++S++LT+RL+PV
Sbjct  488  GAVLFSVLLTSTLYDIEAAKQGSITCIGQQCFRTTFFILSGVAGLGSIVSLILTIRLRPV  547

Query  201  YQMLYAGGSFRLPQSSNH  148
            YQMLYAGGSFRLPQSS H
Sbjct  548  YQMLYAGGSFRLPQSSGH  565



>ref|XP_004152187.1| PREDICTED: uncharacterized protein LOC101211550 [Cucumis sativus]
 gb|KGN52923.1| hypothetical protein Csa_4G006300 [Cucumis sativus]
Length=565

 Score =   254 bits (649),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 126/198 (64%), Positives = 162/198 (82%), Gaps = 0/198 (0%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            VLNNL+Q+GI+ G+ND T+LL+LFSFCNFVGRLG G++SEHFVR + +PR++WM F  V+
Sbjct  368  VLNNLSQIGISLGINDATLLLALFSFCNFVGRLGSGVISEHFVRSRMIPRSLWMMFALVL  427

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            M I + L+ASAL  TLY+AT L GI YGV +S+++P  SE+FGLK+FG+I +FM +GNP+
Sbjct  428  MSIAFLLYASALTITLYIATGLTGISYGVLYSMMVPLASEIFGLKNFGVIFNFMQLGNPI  487

Query  381  GAYLFSGLLAGYLYDIEAAKQHSDTCIGPNCFRVTFlvlaglcsagallsVVLTVRLKPV  202
            GA LFS LL   LYDIEAAKQ S TCIG  CFR TF +L+G+   G+++S++LT+RL+PV
Sbjct  488  GAVLFSVLLTSTLYDIEAAKQGSITCIGQQCFRTTFFILSGVAGLGSIVSLILTIRLRPV  547

Query  201  YQMLYAGGSFRLPQSSNH  148
            YQMLYAGGSFRLPQSS H
Sbjct  548  YQMLYAGGSFRLPQSSGH  565



>ref|XP_010480493.1| PREDICTED: uncharacterized protein LOC104759241 [Camelina sativa]
Length=221

 Score =   243 bits (621),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 122/195 (63%), Positives = 155/195 (79%), Gaps = 0/195 (0%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            VLNNLAQVGIA G+ +TT+LL LFSF NFVGRL  G +SEHFV+ +A+PRT+WMT  Q +
Sbjct  27   VLNNLAQVGIAVGIENTTVLLCLFSFFNFVGRLSSGAISEHFVKSRAMPRTVWMTLAQFL  86

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            M++ + L+A +   TLY ATALLG CYG Q+S+++PT SELFGL+HFG+I SFM +GNP+
Sbjct  87   MVLAFILYALSSTATLYPATALLGTCYGFQYSLMVPTASELFGLEHFGIIYSFMILGNPI  146

Query  381  GAYLFSGLLAGYLYDIEAAKQHSDTCIGPNCFRVTFlvlaglcsagallsVVLTVRLKPV  202
            GA LFSGLLAG LYD EA +Q S TC GP+CF++TF++LA +C   A+L V+LTVR++PV
Sbjct  147  GAVLFSGLLAGRLYDAEAIRQGSSTCYGPDCFKLTFMILACVCGVAAILGVILTVRIRPV  206

Query  201  YQMLYAGGSFRLPQS  157
            YQ LY   SFRLPQ 
Sbjct  207  YQSLYGSRSFRLPQE  221



>ref|XP_007023328.1| Major facilitator superfamily protein [Theobroma cacao]
 gb|EOY25950.1| Major facilitator superfamily protein [Theobroma cacao]
Length=564

 Score =   252 bits (644),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 135/198 (68%), Positives = 171/198 (86%), Gaps = 0/198 (0%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            VLNNLAQ+G+A GV++TTILLSLFSFCNFVGRLG G +SEHFVR +A+PRT+WMT T ++
Sbjct  367  VLNNLAQIGVAFGVDNTTILLSLFSFCNFVGRLGSGALSEHFVRTRAIPRTLWMTCTLII  426

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            M++ + L+A ALNGTLYV+TALLG+C G Q+++++PT SELFGLKHFG+I +FM +GNP+
Sbjct  427  MVLAFVLYALALNGTLYVSTALLGVCCGFQYNLMVPTASELFGLKHFGVIYNFMLLGNPV  486

Query  381  GAYLFSGLLAGYLYDIEAAKQHSDTCIGPNCFRVTFlvlaglcsagallsVVLTVRLKPV  202
            GA L SGLLAGY+YD EAAKQ S TC+GP CFR+TF VLAG+C  G  LS+ LT+RL+PV
Sbjct  487  GALLLSGLLAGYVYDAEAAKQGSSTCLGPECFRLTFFVLAGICGLGTFLSIFLTIRLRPV  546

Query  201  YQMLYAGGSFRLPQSSNH  148
            Y+MLY+ GSFRLPQ+S+H
Sbjct  547  YKMLYSSGSFRLPQASDH  564



>gb|EPS71124.1| hypothetical protein M569_03631, partial [Genlisea aurea]
Length=565

 Score =   252 bits (644),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 130/196 (66%), Positives = 161/196 (82%), Gaps = 3/196 (2%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            VLNNLAQ+G++ GV++ TILLSLFSFCNF+GRLG G +SEHFVR K +PRT WM  TQ +
Sbjct  370  VLNNLAQIGVSLGVDNATILLSLFSFCNFLGRLGSGALSEHFVRCKMIPRTFWMAATQAL  429

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            M++T+ L+AS+LNGTL+ AT LLGICYGVQF I+IPT SELFGLKHFG+I +F+ +GNP+
Sbjct  430  MVLTFLLYASSLNGTLHAATGLLGICYGVQFGIMIPTASELFGLKHFGIIFNFIQLGNPV  489

Query  381  GAYLFSGLLAGYLYDIEAAKQHSDT---CIGPNCFRVTFlvlaglcsagallsVVLTVRL  211
            GA LFS LLAG +YD EAAKQ       C+GP+CFR+TFLVLA +C  G +++ VLT R+
Sbjct  490  GATLFSVLLAGQVYDSEAAKQQQQQQLGCVGPSCFRLTFLVLAAVCGVGTVMAAVLTARI  549

Query  210  KPVYQMLYAGGSFRLP  163
            +PVYQ LYAGGSFRLP
Sbjct  550  RPVYQSLYAGGSFRLP  565



>ref|XP_010691075.1| PREDICTED: uncharacterized protein LOC104904508 [Beta vulgaris 
subsp. vulgaris]
Length=563

 Score =   251 bits (641),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 132/198 (67%), Positives = 163/198 (82%), Gaps = 0/198 (0%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            VLNNLAQ+G AQ   DTT+LLSLFS CNFVGRLGGG VSE+FVRL  +PRTIWMT TQ++
Sbjct  366  VLNNLAQIGYAQAERDTTVLLSLFSICNFVGRLGGGAVSEYFVRLTTIPRTIWMTVTQLI  425

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            M+I +  +A A++GTL+VATALLG CYGVQ +I+IPT SELFGLK+FG+I +F+  GNP+
Sbjct  426  MVIAFLFYAFAVSGTLHVATALLGTCYGVQTAIMIPTASELFGLKNFGVIYNFIQFGNPI  485

Query  381  GAYLFSGLLAGYLYDIEAAKQHSDTCIGPNCFRVTFlvlaglcsagallsVVLTVRLKPV  202
            GA LFSG+LAGY+YD EA KQ   TCIG +CF++TF VLAGLC  G+LL ++LT+R+ PV
Sbjct  486  GALLFSGMLAGYIYDAEAIKQGVSTCIGASCFKLTFFVLAGLCGLGSLLGILLTIRIIPV  545

Query  201  YQMLYAGGSFRLPQSSNH  148
            Y+MLYAGGSFR    S+H
Sbjct  546  YKMLYAGGSFRSLPRSDH  563



>ref|XP_011044882.1| PREDICTED: probable transporter mch1 [Populus euphratica]
Length=564

 Score =   249 bits (636),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 124/198 (63%), Positives = 161/198 (81%), Gaps = 0/198 (0%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            +LNNLAQ+G A G+ DTTILL+LFSFCNFVGR+G G VSEHFVR + +PRT+ MT   ++
Sbjct  367  ILNNLAQIGAAFGLEDTTILLALFSFCNFVGRIGSGAVSEHFVRSRTIPRTLLMTCAHII  426

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            M +T+  FA AL+G LY A ALLGI YG+ +++++PT SELFGL+HFGLI +FM +GNP+
Sbjct  427  MAVTFIPFAFALDGILYTAIALLGISYGILYAVMVPTASELFGLRHFGLIYNFMLLGNPV  486

Query  381  GAYLFSGLLAGYLYDIEAAKQHSDTCIGPNCFRVTFlvlaglcsagallsVVLTVRLKPV  202
            GA LFSG+LAGY+YD E A+Q S TC+GP+CF+VTFL LAG C  G ++S++LTVR+ PV
Sbjct  487  GALLFSGILAGYVYDAETARQGSSTCLGPDCFKVTFLALAGFCGLGTVMSIILTVRIWPV  546

Query  201  YQMLYAGGSFRLPQSSNH  148
            YQMLY+GGS+ LPQ+  H
Sbjct  547  YQMLYSGGSYHLPQNLGH  564



>ref|XP_006385272.1| nodulin family protein [Populus trichocarpa]
 gb|ERP63069.1| nodulin family protein [Populus trichocarpa]
Length=564

 Score =   249 bits (635),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 123/198 (62%), Positives = 162/198 (82%), Gaps = 0/198 (0%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            +LNNLAQ+G A G+ DTTILL+LF FCNFVGR+G G VSEHFVR +A+PRT+ MT   ++
Sbjct  367  ILNNLAQIGAAFGLEDTTILLALFGFCNFVGRIGSGAVSEHFVRSRAIPRTLLMTCAHII  426

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            M IT+  FA AL+G LY ATALLGI YG+ +++++PT SELFGL+HFGLI + + +GNP+
Sbjct  427  MAITFIPFALALDGILYTATALLGISYGILYAVMVPTASELFGLRHFGLIYNVLLLGNPV  486

Query  381  GAYLFSGLLAGYLYDIEAAKQHSDTCIGPNCFRVTFlvlaglcsagallsVVLTVRLKPV  202
            GA LFSG+LAGY+YD E A+Q S TC+GP+CF++TFL LAG C  G ++S++LTVR++PV
Sbjct  487  GALLFSGILAGYVYDAETARQGSSTCLGPDCFKITFLALAGFCGLGTVVSIILTVRIRPV  546

Query  201  YQMLYAGGSFRLPQSSNH  148
            YQMLY+GGS+ LPQ+  H
Sbjct  547  YQMLYSGGSYHLPQNLGH  564



>ref|XP_008454196.1| PREDICTED: LOW QUALITY PROTEIN: probable transporter mch1 [Cucumis 
melo]
Length=565

 Score =   248 bits (634),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 124/198 (63%), Positives = 160/198 (81%), Gaps = 0/198 (0%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            VLNNL+Q+GI+ G+NDTT+LL+LFSFCNFVGRLG G++SEHFVR + +PR++WM F  V+
Sbjct  368  VLNNLSQIGISLGINDTTLLLALFSFCNFVGRLGSGVISEHFVRSRMIPRSLWMMFALVL  427

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            M I + L+AS L  TLY+AT L GI YGV +S+++P  SE+FGLK+FG+I +FM +GNP+
Sbjct  428  MSIAFLLYASGLTITLYIATGLTGISYGVLYSMMVPLASEIFGLKNFGVIFNFMQLGNPI  487

Query  381  GAYLFSGLLAGYLYDIEAAKQHSDTCIGPNCFRVTFlvlaglcsagallsVVLTVRLKPV  202
            GA LFS LL   LYD EAA Q S TCIG  CFR TF +L+G+   G+++S++LT+RL+PV
Sbjct  488  GAVLFSVLLTSTLYDKEAAMQGSITCIGQQCFRTTFFILSGVAGLGSIVSLILTIRLRPV  547

Query  201  YQMLYAGGSFRLPQSSNH  148
            YQMLYAGGSFRLPQSS H
Sbjct  548  YQMLYAGGSFRLPQSSGH  565



>ref|XP_009409982.1| PREDICTED: uncharacterized protein LOC103992116 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=570

 Score =   248 bits (634),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 139/205 (68%), Positives = 167/205 (81%), Gaps = 7/205 (3%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            VLNNLAQ+GIA GV+D TILL LFSF NF+GRLGGG VSE+FVR + LPR IWMT TQ++
Sbjct  366  VLNNLAQIGIAVGVDDPTILLCLFSFGNFLGRLGGGAVSEYFVRTRMLPRPIWMTCTQII  425

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            MI+ Y L+A  L+ TL  +TA+LGICYGVQ S+++PT SELFGLKHFG + +FM +GNPL
Sbjct  426  MILAYLLYALGLSSTLNASTAMLGICYGVQTSVMVPTVSELFGLKHFGTLFNFMLLGNPL  485

Query  381  GAYLFSGLLAGYLYDIEAAKQH-------SDTCIGPNCFRVTFlvlaglcsagallsVVL  223
            GA+LFSGLLAG LYD EAAKQH       S +C+GP+CFRVTFL LAG+CS G LLS++L
Sbjct  486  GAFLFSGLLAGSLYDKEAAKQHPPFLDHSSTSCLGPSCFRVTFLTLAGVCSLGTLLSMIL  545

Query  222  TVRLKPVYQMLYAGGSFRLPQSSNH  148
            T R++PVYQMLYAGGSFR P +S H
Sbjct  546  TRRIRPVYQMLYAGGSFRQPPTSIH  570



>ref|XP_010240084.1| PREDICTED: uncharacterized protein LOC100826615 isoform X2 [Brachypodium 
distachyon]
Length=474

 Score =   245 bits (625),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 128/204 (63%), Positives = 154/204 (75%), Gaps = 5/204 (2%)
 Frame = -1

Query  738  LNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVVM  559
            LNNLAQ+GIA G NDTTILL LF FCNFVGR+ GG VSE+FVR + LPR  WM  TQV+M
Sbjct  271  LNNLAQIGIAAGANDTTILLCLFGFCNFVGRILGGSVSEYFVRSRMLPRPFWMMCTQVIM  330

Query  558  IITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPLG  379
            ++T+ LFA+ L+  +YV+T LLGICYGVQF+++IPT SELFGLK FGL+ +FM + NPLG
Sbjct  331  VVTFLLFATGLHSLIYVSTTLLGICYGVQFAVMIPTVSELFGLKDFGLMYNFMLLVNPLG  390

Query  378  AYLFSGLLAGYLYDIEAAKQH-----SDTCIGPNCFRVTFlvlaglcsagallsVVLTVR  214
            A+ FS LLAGY+YD EAAKQH     +  C GP+CFRVTF V A +C  G L+SV    R
Sbjct  391  AFFFSALLAGYIYDKEAAKQHPGVLEASNCFGPDCFRVTFYVCAMVCCCGILVSVFFIAR  450

Query  213  LKPVYQMLYAGGSFRLPQSSNH*H  142
            +KPVYQMLYA GSFR P+     H
Sbjct  451  IKPVYQMLYASGSFRHPRHHQLLH  474



>gb|EMS46208.1| hypothetical protein TRIUR3_22471 [Triticum urartu]
Length=429

 Score =   241 bits (616),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 134/204 (66%), Positives = 156/204 (76%), Gaps = 7/204 (3%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            VLNNLAQVGIA G  DTTI LSLFSFCNF GRLGGG VSE+ VR   +PRT  +  TQVV
Sbjct  227  VLNNLAQVGIAAGAVDTTISLSLFSFCNFFGRLGGGAVSEYLVRSWTIPRTALIICTQVV  286

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            MI TY LFA  L+ TL+VA ALLGICYG+QFS +I  +SELFGLKHFG I +F+ +GNPL
Sbjct  287  MIFTYLLFALGLHSTLHVAVALLGICYGIQFSAMISASSELFGLKHFGKIYNFISLGNPL  346

Query  381  GAYLFSGLLAGYLYDIEAAKQHSDT------CIGPNCFRVTFlvlaglcsagallsVVLT  220
            GA LF+  LAGY YD+E  KQH+ T      C GPNCFR+TF +L+G+   G LLS+VLT
Sbjct  347  GALLFNS-LAGYFYDLEVEKQHATTTDFDVACHGPNCFRLTFFILSGMACLGTLLSIVLT  405

Query  219  VRLKPVYQMLYAGGSFRLPQSSNH  148
            VR++PVYQMLYAGGSF  P+SS H
Sbjct  406  VRIRPVYQMLYAGGSFSQPRSSAH  429



>dbj|BAK00222.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=563

 Score =   244 bits (624),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 135/204 (66%), Positives = 157/204 (77%), Gaps = 7/204 (3%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            VLNNLAQVGIA G  DTTI LSLFSFCNF GRLGGG VSE+ VR   +PRT  +  TQVV
Sbjct  361  VLNNLAQVGIAAGAVDTTISLSLFSFCNFFGRLGGGAVSEYLVRSWTIPRTALIICTQVV  420

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            MI TY LFA  L+ TLYVA ALLGICYG+QFS++I  +SELFGLKHFG I +F+ +GNPL
Sbjct  421  MIFTYLLFALGLHSTLYVAVALLGICYGIQFSVMISASSELFGLKHFGKIYNFISLGNPL  480

Query  381  GAYLFSGLLAGYLYDIEAAKQHSDT------CIGPNCFRVTFlvlaglcsagallsVVLT  220
            GA LF+  LAGY YD+E  KQH+ T      C GPNCFR+TF +L+G+   G LLS+VLT
Sbjct  481  GALLFNS-LAGYFYDLEVEKQHATTTDFDVACHGPNCFRLTFFILSGMACLGTLLSIVLT  539

Query  219  VRLKPVYQMLYAGGSFRLPQSSNH  148
            VR++PVYQMLYAGGSF  P+SS H
Sbjct  540  VRIRPVYQMLYAGGSFSQPRSSAH  563



>gb|KCW70764.1| hypothetical protein EUGRSUZ_F03926 [Eucalyptus grandis]
Length=542

 Score =   244 bits (622),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 115/156 (74%), Positives = 136/156 (87%), Gaps = 0/156 (0%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            VLNNLAQ+G A GV+DTT+LL +FSF NF+GRLG G+VSE+FVR KALPRTIWMTF Q++
Sbjct  365  VLNNLAQIGAALGVDDTTVLLCVFSFFNFLGRLGSGVVSEYFVRSKALPRTIWMTFAQII  424

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            MI T+ L+ASALNGTLY ATALLG+CYGVQFSI+IPT SELFGLKHFG+I +FM +GNP+
Sbjct  425  MIATFLLYASALNGTLYAATALLGMCYGVQFSIMIPTASELFGLKHFGIIFNFMQLGNPI  484

Query  381  GAYLFSGLLAGYLYDIEAAKQHSDTCIGPNCFRVTF  274
            GA+LFSGLLAG +YD EAA Q   TC+GP CFR+TF
Sbjct  485  GAFLFSGLLAGDVYDAEAALQGGSTCLGPTCFRLTF  520



>ref|XP_003580087.1| PREDICTED: uncharacterized protein LOC100826615 isoform X1 [Brachypodium 
distachyon]
Length=581

 Score =   244 bits (623),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 128/204 (63%), Positives = 154/204 (75%), Gaps = 5/204 (2%)
 Frame = -1

Query  738  LNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVVM  559
            LNNLAQ+GIA G NDTTILL LF FCNFVGR+ GG VSE+FVR + LPR  WM  TQV+M
Sbjct  378  LNNLAQIGIAAGANDTTILLCLFGFCNFVGRILGGSVSEYFVRSRMLPRPFWMMCTQVIM  437

Query  558  IITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPLG  379
            ++T+ LFA+ L+  +YV+T LLGICYGVQF+++IPT SELFGLK FGL+ +FM + NPLG
Sbjct  438  VVTFLLFATGLHSLIYVSTTLLGICYGVQFAVMIPTVSELFGLKDFGLMYNFMLLVNPLG  497

Query  378  AYLFSGLLAGYLYDIEAAKQH-----SDTCIGPNCFRVTFlvlaglcsagallsVVLTVR  214
            A+ FS LLAGY+YD EAAKQH     +  C GP+CFRVTF V A +C  G L+SV    R
Sbjct  498  AFFFSALLAGYIYDKEAAKQHPGVLEASNCFGPDCFRVTFYVCAMVCCCGILVSVFFIAR  557

Query  213  LKPVYQMLYAGGSFRLPQSSNH*H  142
            +KPVYQMLYA GSFR P+     H
Sbjct  558  IKPVYQMLYASGSFRHPRHHQLLH  581



>ref|XP_006653575.1| PREDICTED: uncharacterized protein LOC102700706 [Oryza brachyantha]
Length=559

 Score =   243 bits (621),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 125/205 (61%), Positives = 157/205 (77%), Gaps = 5/205 (2%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            VLNNLAQVG+A G +DTTILL LF FCNFVGR+ GG +SE+FVR + LPR  WM  TQ++
Sbjct  355  VLNNLAQVGMAVGADDTTILLCLFGFCNFVGRILGGSISEYFVRSRMLPRPFWMMCTQII  414

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            M+IT+ LFA+ L+  +YV+T LLG+CYGVQF+++IPT SELFGLK FGL+ +FM + NPL
Sbjct  415  MVITFLLFATGLHSLIYVSTTLLGLCYGVQFAVMIPTVSELFGLKDFGLMYNFMLLVNPL  474

Query  381  GAYLFSGLLAGYLYDIEAAKQH-----SDTCIGPNCFRVTFlvlaglcsagallsVVLTV  217
            GA+ FS LLAGY+YD EAA+QH       TC+GP+CFR+TF + A +C  G L+SV    
Sbjct  475  GAFFFSALLAGYIYDKEAARQHPGVLEPSTCLGPDCFRLTFYICAFVCCCGTLVSVFFIA  534

Query  216  RLKPVYQMLYAGGSFRLPQSSNH*H  142
            R+KPVYQMLYA GSFR P+S    H
Sbjct  535  RIKPVYQMLYASGSFRHPRSQQQLH  559



>ref|XP_002446751.1| hypothetical protein SORBIDRAFT_06g021760 [Sorghum bicolor]
 gb|EES11079.1| hypothetical protein SORBIDRAFT_06g021760 [Sorghum bicolor]
Length=583

 Score =   243 bits (621),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 127/205 (62%), Positives = 156/205 (76%), Gaps = 5/205 (2%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            VLNNLAQ+G++ G NDTTILL LF FCNFVGR+ GG VSEHFVR + LPR  WM  TQ++
Sbjct  379  VLNNLAQIGMSVGANDTTILLCLFGFCNFVGRILGGSVSEHFVRSRMLPRPFWMMCTQII  438

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            M++T+ LFA+ L+  +YV+T LLGICYGVQF+++IPT SELFGLK FGL+ +FM + NPL
Sbjct  439  MVVTFLLFATGLHSLIYVSTTLLGICYGVQFAVMIPTVSELFGLKDFGLMYNFMLLVNPL  498

Query  381  GAYLFSGLLAGYLYDIEAAKQH-----SDTCIGPNCFRVTFlvlaglcsagallsVVLTV  217
            GA+ FS LLAGY+YD EAA+QH        C GP+CFR+TF V A +C  G LLSV+   
Sbjct  499  GAFFFSALLAGYIYDKEAARQHPGVLEPSDCYGPDCFRLTFYVCAIVCCCGTLLSVLFIS  558

Query  216  RLKPVYQMLYAGGSFRLPQSSNH*H  142
            R+KPVYQMLYA GSFR P+S    H
Sbjct  559  RIKPVYQMLYASGSFRHPRSQQQLH  583



>ref|NP_001053236.1| Os04g0502800 [Oryza sativa Japonica Group]
 dbj|BAF15150.1| Os04g0502800, partial [Oryza sativa Japonica Group]
Length=565

 Score =   243 bits (620),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 127/202 (63%), Positives = 155/202 (77%), Gaps = 5/202 (2%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            VLNNLAQVG+A G +DTTILL LF FCNFVGR+ GG VSE+FVR + LPR  WM  TQ++
Sbjct  362  VLNNLAQVGMAVGADDTTILLCLFGFCNFVGRILGGSVSEYFVRSRMLPRPFWMMCTQII  421

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            M+IT+ LFA+ L+  +YV+T  LGICYGVQF+++IPT SELFGLK FGL+ +FM + NPL
Sbjct  422  MVITFLLFATGLHSLIYVSTTFLGICYGVQFAVMIPTVSELFGLKDFGLMYNFMLLVNPL  481

Query  381  GAYLFSGLLAGYLYDIEAAKQ-----HSDTCIGPNCFRVTFlvlaglcsagallsVVLTV  217
            GA+ FS LLAGY+YD EAAKQ        TC+GP+CFR+TF V A +C  G L+SVV   
Sbjct  482  GAFFFSALLAGYIYDKEAAKQQPGVLEPSTCLGPDCFRLTFYVCAIVCCCGTLVSVVFIA  541

Query  216  RLKPVYQMLYAGGSFRLPQSSN  151
            R+KPVYQMLYA GSFR P+S  
Sbjct  542  RIKPVYQMLYASGSFRHPRSQQ  563



>emb|CAH67585.1| OSIGBa0112M24.2 [Oryza sativa Indica Group]
Length=582

 Score =   243 bits (620),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 127/202 (63%), Positives = 155/202 (77%), Gaps = 5/202 (2%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            VLNNLAQVG+A G +DTTILL LF FCNFVGR+ GG VSE+FVR + LPR  WM  TQ++
Sbjct  379  VLNNLAQVGMAVGADDTTILLCLFGFCNFVGRILGGSVSEYFVRSRMLPRPFWMMCTQII  438

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            M+IT+ LFA+ L+  +YV+T  LGICYGVQF+++IPT SELFGLK FGL+ +FM + NPL
Sbjct  439  MVITFLLFATGLHSLIYVSTTFLGICYGVQFAVMIPTVSELFGLKDFGLMYNFMLLVNPL  498

Query  381  GAYLFSGLLAGYLYDIEAAKQ-----HSDTCIGPNCFRVTFlvlaglcsagallsVVLTV  217
            GA+ FS LLAGY+YD EAAKQ        TC+GP+CFR+TF V A +C  G L+SVV   
Sbjct  499  GAFFFSALLAGYIYDKEAAKQQPGVLEPSTCLGPDCFRLTFYVCAIVCCCGTLVSVVFIA  558

Query  216  RLKPVYQMLYAGGSFRLPQSSN  151
            R+KPVYQMLYA GSFR P+S  
Sbjct  559  RIKPVYQMLYASGSFRHPRSQQ  580



>gb|EEE61279.1| hypothetical protein OsJ_15362 [Oryza sativa Japonica Group]
Length=601

 Score =   243 bits (620),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 127/202 (63%), Positives = 155/202 (77%), Gaps = 5/202 (2%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            VLNNLAQVG+A G +DTTILL LF FCNFVGR+ GG VSE+FVR + LPR  WM  TQ++
Sbjct  398  VLNNLAQVGMAVGADDTTILLCLFGFCNFVGRILGGSVSEYFVRSRMLPRPFWMMCTQII  457

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            M+IT+ LFA+ L+  +YV+T  LGICYGVQF+++IPT SELFGLK FGL+ +FM + NPL
Sbjct  458  MVITFLLFATGLHSLIYVSTTFLGICYGVQFAVMIPTVSELFGLKDFGLMYNFMLLVNPL  517

Query  381  GAYLFSGLLAGYLYDIEAAKQ-----HSDTCIGPNCFRVTFlvlaglcsagallsVVLTV  217
            GA+ FS LLAGY+YD EAAKQ        TC+GP+CFR+TF V A +C  G L+SVV   
Sbjct  518  GAFFFSALLAGYIYDKEAAKQQPGVLEPSTCLGPDCFRLTFYVCAIVCCCGTLVSVVFIA  577

Query  216  RLKPVYQMLYAGGSFRLPQSSN  151
            R+KPVYQMLYA GSFR P+S  
Sbjct  578  RIKPVYQMLYASGSFRHPRSQQ  599



>gb|EEC77582.1| hypothetical protein OsI_16534 [Oryza sativa Indica Group]
Length=601

 Score =   243 bits (620),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 127/202 (63%), Positives = 155/202 (77%), Gaps = 5/202 (2%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            VLNNLAQVG+A G +DTTILL LF FCNFVGR+ GG VSE+FVR + LPR  WM  TQ++
Sbjct  398  VLNNLAQVGMAVGADDTTILLCLFGFCNFVGRILGGSVSEYFVRSRMLPRPFWMMCTQII  457

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            M+IT+ LFA+ L+  +YV+T  LGICYGVQF+++IPT SELFGLK FGL+ +FM + NPL
Sbjct  458  MVITFLLFATGLHSLIYVSTTFLGICYGVQFAVMIPTVSELFGLKDFGLMYNFMLLVNPL  517

Query  381  GAYLFSGLLAGYLYDIEAAKQ-----HSDTCIGPNCFRVTFlvlaglcsagallsVVLTV  217
            GA+ FS LLAGY+YD EAAKQ        TC+GP+CFR+TF V A +C  G L+SVV   
Sbjct  518  GAFFFSALLAGYIYDKEAAKQQPGVLEPSTCLGPDCFRLTFYVCAIVCCCGTLVSVVFIA  577

Query  216  RLKPVYQMLYAGGSFRLPQSSN  151
            R+KPVYQMLYA GSFR P+S  
Sbjct  578  RIKPVYQMLYASGSFRHPRSQQ  599



>gb|EMT26269.1| hypothetical protein F775_26749 [Aegilops tauschii]
Length=544

 Score =   241 bits (616),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 134/204 (66%), Positives = 156/204 (76%), Gaps = 7/204 (3%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            VLNNLAQVGIA G  DTTI LSLFSFCNF GRLGGG VSE+ VR   +PRT  +  TQVV
Sbjct  342  VLNNLAQVGIAAGAVDTTISLSLFSFCNFFGRLGGGAVSEYLVRSWTIPRTALIICTQVV  401

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            MI TY LFA  L+ TL+VA ALLGICYG+QFS +I  +SELFGLKHFG I +F+ +GNPL
Sbjct  402  MIFTYLLFALGLHSTLHVAVALLGICYGIQFSAMISASSELFGLKHFGKIYNFISLGNPL  461

Query  381  GAYLFSGLLAGYLYDIEAAKQHSDT------CIGPNCFRVTFlvlaglcsagallsVVLT  220
            GA LF+  LAGY YD+E  KQH+ T      C GPNCFR+TF +L+G+   G LLS+VLT
Sbjct  462  GALLFNS-LAGYFYDLEVEKQHATTTDFDVACHGPNCFRLTFFILSGMACLGTLLSIVLT  520

Query  219  VRLKPVYQMLYAGGSFRLPQSSNH  148
            VR++PVYQMLYAGGSF  P+SS H
Sbjct  521  VRIRPVYQMLYAGGSFSQPRSSAH  544



>emb|CAE02931.3| OSJNBa0014K14.3 [Oryza sativa Japonica Group]
Length=624

 Score =   243 bits (620),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 127/202 (63%), Positives = 155/202 (77%), Gaps = 5/202 (2%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            VLNNLAQVG+A G +DTTILL LF FCNFVGR+ GG VSE+FVR + LPR  WM  TQ++
Sbjct  421  VLNNLAQVGMAVGADDTTILLCLFGFCNFVGRILGGSVSEYFVRSRMLPRPFWMMCTQII  480

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            M+IT+ LFA+ L+  +YV+T  LGICYGVQF+++IPT SELFGLK FGL+ +FM + NPL
Sbjct  481  MVITFLLFATGLHSLIYVSTTFLGICYGVQFAVMIPTVSELFGLKDFGLMYNFMLLVNPL  540

Query  381  GAYLFSGLLAGYLYDIEAAKQH-----SDTCIGPNCFRVTFlvlaglcsagallsVVLTV  217
            GA+ FS LLAGY+YD EAAKQ        TC+GP+CFR+TF V A +C  G L+SVV   
Sbjct  541  GAFFFSALLAGYIYDKEAAKQQPGVLEPSTCLGPDCFRLTFYVCAIVCCCGTLVSVVFIA  600

Query  216  RLKPVYQMLYAGGSFRLPQSSN  151
            R+KPVYQMLYA GSFR P+S  
Sbjct  601  RIKPVYQMLYASGSFRHPRSQQ  622



>ref|XP_006307140.1| hypothetical protein CARUB_v10008730mg [Capsella rubella]
 gb|EOA40038.1| hypothetical protein CARUB_v10008730mg [Capsella rubella]
Length=562

 Score =   241 bits (614),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 121/195 (62%), Positives = 153/195 (78%), Gaps = 0/195 (0%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            VLNNLAQVGI  G+N+TT+LL LFSF NFVGRL  G +SEHFV+ +A+PRTIWMT  Q +
Sbjct  368  VLNNLAQVGIVVGINNTTVLLCLFSFFNFVGRLSSGAISEHFVKSRAMPRTIWMTLAQFL  427

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            M++ + L+A +   TLY ATALLG CYG Q+++++PT SELFGL+HFG+I SFM +GNP+
Sbjct  428  MVLAFILYALSSTATLYPATALLGTCYGFQYALMVPTASELFGLEHFGIIYSFMILGNPI  487

Query  381  GAYLFSGLLAGYLYDIEAAKQHSDTCIGPNCFRVTFlvlaglcsagallsVVLTVRLKPV  202
            GA LFSGLL G LYD EA +Q S TC GP+CFR+TF++LA +C   A+L V+LTVR+ PV
Sbjct  488  GAVLFSGLLVGRLYDAEAIRQGSSTCYGPDCFRLTFMILACVCGVAAILGVILTVRISPV  547

Query  201  YQMLYAGGSFRLPQS  157
            Y+ LY   SFRLPQ 
Sbjct  548  YRSLYGSRSFRLPQE  562



>ref|XP_010227968.1| PREDICTED: LOW QUALITY PROTEIN: probable transporter mch1 [Brachypodium 
distachyon]
Length=568

 Score =   241 bits (614),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 132/204 (65%), Positives = 156/204 (76%), Gaps = 7/204 (3%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            VLNNLAQVGIA G  DTTI LSLFSFCNF GRLGGG  SE+ VR   +PRT  +  TQVV
Sbjct  366  VLNNLAQVGIAAGALDTTISLSLFSFCNFFGRLGGGAASEYLVRSWTVPRTALIVLTQVV  425

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            MI TY LFA  L  TL+V+ ALLGICYG+QFS+++  +SELFGLKHFG I +F+ +GNPL
Sbjct  426  MIFTYLLFALGLPATLHVSVALLGICYGIQFSVMVSASSELFGLKHFGKIYNFIALGNPL  485

Query  381  GAYLFSGLLAGYLYDIEAAKQHSDT------CIGPNCFRVTFlvlaglcsagallsVVLT  220
            GA LF+  LAGY+YD+E  KQH+ T      C GPNCFR+TF VL+G+   G LLS+VLT
Sbjct  486  GALLFNS-LAGYVYDLEVEKQHAGTTDFDIACHGPNCFRLTFCVLSGMACLGTLLSIVLT  544

Query  219  VRLKPVYQMLYAGGSFRLPQSSNH  148
            VR++PVYQMLYAGGSF  P+SS H
Sbjct  545  VRIRPVYQMLYAGGSFSQPRSSGH  568



>ref|XP_004976136.1| PREDICTED: uncharacterized protein LOC101785714 [Setaria italica]
Length=581

 Score =   241 bits (614),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 125/205 (61%), Positives = 154/205 (75%), Gaps = 5/205 (2%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            VLNNLAQ+G++ G NDTTILL LF FCNF+GR+ GG VSE+FVR + LPR  WM  TQ++
Sbjct  377  VLNNLAQIGMSVGANDTTILLCLFGFCNFIGRILGGSVSEYFVRSRMLPRPFWMMCTQII  436

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            M+IT+ LFA+ L+  +YV+  LLGICYGVQF+++IPT SELFGLK FGL+ +FM + NPL
Sbjct  437  MVITFLLFATGLHSLIYVSVTLLGICYGVQFAVMIPTVSELFGLKDFGLMYNFMLLVNPL  496

Query  381  GAYLFSGLLAGYLYDIEAAKQH-----SDTCIGPNCFRVTFlvlaglcsagallsVVLTV  217
            GA+ FS LLAGY+YD EAA+QH        C GP+CFRVTF V   +C  G LLSV+   
Sbjct  497  GAFFFSALLAGYIYDKEAARQHPGVLEPSNCYGPDCFRVTFHVCGIVCCCGTLLSVLFIA  556

Query  216  RLKPVYQMLYAGGSFRLPQSSNH*H  142
            R+KPVYQMLYA GSFR P+S    H
Sbjct  557  RIKPVYQMLYASGSFRHPRSQQQLH  581



>ref|XP_006656700.1| PREDICTED: uncharacterized protein LOC102716699 [Oryza brachyantha]
Length=567

 Score =   240 bits (612),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 135/204 (66%), Positives = 159/204 (78%), Gaps = 7/204 (3%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            VLNNLAQVGIA GV DTTI LSLFSF NF GRLGGG VSE+ VR + LPRT  +T TQV+
Sbjct  365  VLNNLAQVGIAAGVVDTTISLSLFSFGNFFGRLGGGAVSEYLVRSRTLPRTTLITCTQVM  424

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            MII Y LFA   + TL+V+ ALLGICYG QFS+++ T+SELFGLKHFG I +F+ +GNPL
Sbjct  425  MIIIYLLFALGHHATLHVSVALLGICYGAQFSVMVSTSSELFGLKHFGKIFNFISLGNPL  484

Query  381  GAYLFSGLLAGYLYDIEAAKQHSDT------CIGPNCFRVTFlvlaglcsagallsVVLT  220
            GA LF+  LAGY+YD E  +QH+ T      C GPNCFR+TF VLAG+ S G LLS+VLT
Sbjct  485  GALLFNS-LAGYVYDKEVERQHATTMDTDIACHGPNCFRLTFCVLAGVASLGTLLSIVLT  543

Query  219  VRLKPVYQMLYAGGSFRLPQSSNH  148
            VR++PVYQMLYAGGSF  P+SS H
Sbjct  544  VRIRPVYQMLYAGGSFSQPRSSAH  567



>ref|XP_004964691.1| PREDICTED: uncharacterized protein LOC101759997 [Setaria italica]
Length=559

 Score =   240 bits (612),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 132/204 (65%), Positives = 158/204 (77%), Gaps = 7/204 (3%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            VLNNLAQ+GIA G  DTTI LS+FSFCNF GRLGGG VSE+FVR + LPR++ +  TQVV
Sbjct  357  VLNNLAQIGIAAGAVDTTISLSVFSFCNFFGRLGGGAVSEYFVRARTLPRSVLIICTQVV  416

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            MIITY LFA     TLYV+ ALLGICYGVQFS++I  +SELFGLKHFG I +F+ + NP+
Sbjct  417  MIITYLLFALGQRTTLYVSVALLGICYGVQFSVIISISSELFGLKHFGKIYNFIALANPV  476

Query  381  GAYLFSGLLAGYLYDIEAAKQHS---DT---CIGPNCFRVTFlvlaglcsagallsVVLT  220
            GA+LF+  LAGY+YD+E  KQ +   DT   C GPNCFR+TF VL+G    G LLS VLT
Sbjct  477  GAFLFN-TLAGYVYDLEVEKQKAGMVDTDIACHGPNCFRLTFYVLSGAACLGTLLSTVLT  535

Query  219  VRLKPVYQMLYAGGSFRLPQSSNH  148
            VR++PVYQMLYAGGSF  P++S H
Sbjct  536  VRVRPVYQMLYAGGSFSQPRTSAH  559



>ref|NP_001056968.1| Os06g0179200 [Oryza sativa Japonica Group]
 dbj|BAC22240.1| nodulin-like protein [Oryza sativa Japonica Group]
 dbj|BAF18882.1| Os06g0179200 [Oryza sativa Japonica Group]
 dbj|BAG94931.1| unnamed protein product [Oryza sativa Japonica Group]
Length=567

 Score =   239 bits (611),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 134/204 (66%), Positives = 159/204 (78%), Gaps = 7/204 (3%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            VLNNLAQVGIA GV DTTI L+LFSF NF GRLGGG VSE+ VR + LPRT  +T TQV+
Sbjct  365  VLNNLAQVGIAAGVADTTISLALFSFGNFFGRLGGGAVSEYLVRSRTLPRTTLITCTQVM  424

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            MII Y LFA   + TL+V+ ALLGICYG QFS+++ T+SELFGLKHFG I +F+ +GNPL
Sbjct  425  MIIIYLLFALGHHATLHVSVALLGICYGAQFSVMVSTSSELFGLKHFGKIFNFISLGNPL  484

Query  381  GAYLFSGLLAGYLYDIEAAKQHSDT------CIGPNCFRVTFlvlaglcsagallsVVLT  220
            GA LF+  LAGY+YD E  +QH+ T      C GPNCFR+TF VLAG+ S G LLS+VLT
Sbjct  485  GALLFNS-LAGYVYDQEVERQHATTMDTDIACHGPNCFRLTFCVLAGVASLGTLLSIVLT  543

Query  219  VRLKPVYQMLYAGGSFRLPQSSNH  148
            VR++PVYQMLYAGGSF  P+SS H
Sbjct  544  VRIRPVYQMLYAGGSFSQPRSSAH  567



>gb|EAY99898.1| hypothetical protein OsI_21894 [Oryza sativa Indica Group]
Length=567

 Score =   239 bits (611),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 134/204 (66%), Positives = 159/204 (78%), Gaps = 7/204 (3%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            VLNNLAQVGIA GV DTTI L+LFSF NF GRLGGG VSE+ VR + LPRT  +T TQV+
Sbjct  365  VLNNLAQVGIAAGVADTTISLALFSFGNFFGRLGGGAVSEYLVRSRTLPRTTLITCTQVM  424

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            MII Y LFA   + TL+V+ ALLGICYG QFS+++ T+SELFGLKHFG I +F+ +GNPL
Sbjct  425  MIIIYLLFALGHHATLHVSVALLGICYGAQFSVMVSTSSELFGLKHFGKIFNFISLGNPL  484

Query  381  GAYLFSGLLAGYLYDIEAAKQHSDT------CIGPNCFRVTFlvlaglcsagallsVVLT  220
            GA LF+  LAGY+YD E  +QH+ T      C GPNCFR+TF VLAG+ S G LLS+VLT
Sbjct  485  GALLFNS-LAGYVYDQEVERQHATTMDTDIACHGPNCFRLTFCVLAGVASLGTLLSIVLT  543

Query  219  VRLKPVYQMLYAGGSFRLPQSSNH  148
            VR++PVYQMLYAGGSF  P+SS H
Sbjct  544  VRIRPVYQMLYAGGSFSQPRSSAH  567



>ref|NP_001168515.1| hypothetical protein [Zea mays]
 gb|ACN28490.1| unknown [Zea mays]
 gb|AFW77134.1| hypothetical protein ZEAMMB73_773444 [Zea mays]
Length=427

 Score =   235 bits (599),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 126/204 (62%), Positives = 156/204 (76%), Gaps = 7/204 (3%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            VLNNLAQ+GIA G  DTTI LS+FSFCNF GRLGGG+VSE+ VR + LPR++ +  TQ V
Sbjct  225  VLNNLAQIGIAAGAVDTTISLSVFSFCNFFGRLGGGVVSEYLVRSRTLPRSVLIIGTQAV  284

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            MIITY LFA     TLYV+ ALLGIC+G+  S++I T+SELFGLKHFG I +F+ + NP+
Sbjct  285  MIITYLLFALGRLATLYVSVALLGICFGISLSVIISTSSELFGLKHFGKIFNFIALANPV  344

Query  381  GAYLFSGLLAGYLYDIEAAKQHSDT------CIGPNCFRVTFlvlaglcsagallsVVLT  220
            GA+LF+  LAGY+YD+E  KQH+ T      C GPNCFR+TF VL+G+   G LLS VLT
Sbjct  345  GAFLFN-TLAGYVYDLEVEKQHATTSGSDVACHGPNCFRLTFCVLSGVACLGTLLSTVLT  403

Query  219  VRLKPVYQMLYAGGSFRLPQSSNH  148
            VR++PVYQMLYAGGSF  P++  H
Sbjct  404  VRVRPVYQMLYAGGSFSQPRNPAH  427



>ref|XP_009363919.1| PREDICTED: uncharacterized protein LOC103953849 [Pyrus x bretschneideri]
Length=580

 Score =   238 bits (607),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 129/205 (63%), Positives = 156/205 (76%), Gaps = 7/205 (3%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            VLNNLAQ+GIAQG +DTT LLSLF   NFVGRLGGG VSE FVR K +PRT+WMT TQ++
Sbjct  367  VLNNLAQIGIAQGFDDTTFLLSLFGVGNFVGRLGGGFVSELFVRSKTIPRTVWMTCTQII  426

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            M  TY LFASA+N T Y AT +LG CYGVQFS++I T SELFGLK  G   +FM +GNPL
Sbjct  427  MFATYLLFASAINATFYPATGILGACYGVQFSVMISTVSELFGLKDIGTFYNFMALGNPL  486

Query  381  GAYLFSGLLAGYLYDIEAAKQH-------SDTCIGPNCFRVTFlvlaglcsagallsVVL  223
            GA LFSGLLAGY+YD EAAKQ        + +C+GPNCFR+TFLVLA +C  G++LS+VL
Sbjct  487  GALLFSGLLAGYVYDNEAAKQQGIHLYGTNVSCVGPNCFRLTFLVLAAVCFVGSILSIVL  546

Query  222  TVRLKPVYQMLYAGGSFRLPQSSNH  148
            ++R+KP YQ L+AG S  +   +N 
Sbjct  547  SLRIKPFYQNLFAGASVGVLPDTNQ  571



>ref|XP_008668342.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 tpg|DAA37072.1| TPA: hypothetical protein ZEAMMB73_819248 [Zea mays]
Length=582

 Score =   238 bits (606),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 123/205 (60%), Positives = 153/205 (75%), Gaps = 5/205 (2%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            VLNNLAQ+G++ G NDTTILL LF FCNF GR+ GG VSE+FVR + LPR  WM  TQ++
Sbjct  378  VLNNLAQIGMSVGANDTTILLCLFGFCNFAGRILGGSVSEYFVRSRMLPRPFWMMCTQII  437

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            M++T+ LFA+ L+  +YV+T LLGICYGVQF+++IPT SELFGL+ FGL+ +FM + NPL
Sbjct  438  MVVTFLLFATGLHSLIYVSTTLLGICYGVQFAVMIPTVSELFGLRDFGLMYNFMLLVNPL  497

Query  381  GAYLFSGLLAGYLYDIEAAKQH-----SDTCIGPNCFRVTFlvlaglcsagallsVVLTV  217
            GA+ FS LLAGY+YD EAA+QH        C GP+CFR+TF V A +C  G LL V    
Sbjct  498  GAFFFSALLAGYIYDKEAARQHPGVLEPSDCYGPDCFRLTFYVCAVVCCCGTLLGVFFIS  557

Query  216  RLKPVYQMLYAGGSFRLPQSSNH*H  142
            R+KPVYQMLYA GSFR P+S    H
Sbjct  558  RIKPVYQMLYASGSFRHPRSQQQLH  582



>ref|NP_178168.1| Major facilitator superfamily protein [Arabidopsis thaliana]
 gb|AAF27120.1|AC018849_8 nodulin-like protein; 38383-40406 [Arabidopsis thaliana]
 gb|AAK59618.1| putative nodulin protein [Arabidopsis thaliana]
 gb|AAL07191.1| putative nodulin protein [Arabidopsis thaliana]
 gb|AEE36416.1| Major facilitator superfamily protein [Arabidopsis thaliana]
Length=561

 Score =   236 bits (603),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 129/199 (65%), Positives = 158/199 (79%), Gaps = 2/199 (1%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            V NNLAQ+G A G+ DTTILL LFSF NF+GRL  G +SEHFVR + LPRT+WM   Q+V
Sbjct  364  VSNNLAQIGFAFGIKDTTILLCLFSFFNFIGRLASGAISEHFVRSRTLPRTLWMGAAQLV  423

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            M+ T+ LFA A++ T+YVATAL+GIC G QF + I T SELFGL+HFG+  +F+ +GNPL
Sbjct  424  MVFTFLLFAMAIDHTIYVATALIGICMGFQF-LSIATISELFGLRHFGINFNFILLGNPL  482

Query  381  GAYLFSGLLAGYLYDIEAAKQHSDTCIGPNCFRVTFlvlaglcsagallsVVLTVRLKPV  202
            GA +FS +LAGY+YD EA KQ   TCIGP+CFRVTFLVLAG+C  G LLS++LTVR++PV
Sbjct  483  GATIFSAILAGYIYDKEADKQGKMTCIGPDCFRVTFLVLAGVCGLGTLLSIILTVRIRPV  542

Query  201  YQMLYAGGSFRL-PQSSNH  148
            YQ LYA GSFRL PQS+ H
Sbjct  543  YQALYASGSFRLQPQSTGH  561



>ref|XP_002892879.1| hypothetical protein ARALYDRAFT_312565 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69138.1| hypothetical protein ARALYDRAFT_312565 [Arabidopsis lyrata subsp. 
lyrata]
Length=557

 Score =   236 bits (602),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 116/195 (59%), Positives = 153/195 (78%), Gaps = 0/195 (0%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            VLNNLAQVGIA G+++TT+LL LFSF NFVGRL  G +SEHFV+ +A+PRT+WMT  Q +
Sbjct  363  VLNNLAQVGIAVGIDNTTVLLCLFSFFNFVGRLSSGAISEHFVKSRAMPRTVWMTLAQFL  422

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            M++ + L+A +   TLY ATALLG CYG Q+++++PT SELFGL+HFG+I SFM +GNP+
Sbjct  423  MVLAFILYALSSTATLYPATALLGTCYGFQYALMVPTASELFGLEHFGIIYSFMILGNPI  482

Query  381  GAYLFSGLLAGYLYDIEAAKQHSDTCIGPNCFRVTFlvlaglcsagallsVVLTVRLKPV  202
            GA L SGLLAG LYD EA KQ S TC GP CF++TF++L+ +C   A+L V+L++R++PV
Sbjct  483  GAVLLSGLLAGRLYDAEAIKQGSSTCYGPECFKLTFVILSSVCGVAAILGVILSIRIRPV  542

Query  201  YQMLYAGGSFRLPQS  157
            YQ LY    +RLPQ 
Sbjct  543  YQSLYGSRFYRLPQE  557



>ref|XP_002437947.1| hypothetical protein SORBIDRAFT_10g005340 [Sorghum bicolor]
 gb|EER89314.1| hypothetical protein SORBIDRAFT_10g005340 [Sorghum bicolor]
Length=562

 Score =   236 bits (601),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 130/204 (64%), Positives = 157/204 (77%), Gaps = 7/204 (3%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            V+NNLAQ+GIA G  DTTI LS+FSFCNF GRLGGG VSE+ VR + LPR++ +  TQVV
Sbjct  360  VVNNLAQIGIAAGAVDTTISLSVFSFCNFFGRLGGGAVSEYLVRSRTLPRSVLIICTQVV  419

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            MIITY LFA     TLYV+ ALLGICYG   S++I T+SELFGLKH+G I +F+ + NP+
Sbjct  420  MIITYLLFALGQLATLYVSVALLGICYGALLSVIISTSSELFGLKHWGKIFNFIILANPV  479

Query  381  GAYLFSGLLAGYLYDIEAAKQHSDT------CIGPNCFRVTFlvlaglcsagallsVVLT  220
            GAYLF+  LAGY+YD+E AKQH+ T      C GPNCFR+TF VL+G    G LLSVVLT
Sbjct  480  GAYLFN-TLAGYVYDLEVAKQHATTSGSDIACHGPNCFRLTFCVLSGAACLGTLLSVVLT  538

Query  219  VRLKPVYQMLYAGGSFRLPQSSNH  148
            VR++PVYQMLYAGGSF  P++S H
Sbjct  539  VRVRPVYQMLYAGGSFSQPRNSGH  562



>ref|XP_010532110.1| PREDICTED: uncharacterized protein LOC104808196 [Tarenaya hassleriana]
Length=541

 Score =   234 bits (597),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 125/197 (63%), Positives = 158/197 (80%), Gaps = 1/197 (1%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            V NNLAQ+G A GV DTTILL LFSFCNF+GRL  G +SEHFVR + LPRT WM  +Q++
Sbjct  344  VSNNLAQIGFAFGVKDTTILLCLFSFCNFIGRLTSGAISEHFVRSRTLPRTFWMGASQLL  403

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            M +T+ LFA+AL  T+Y+ATAL+ I  G QF + I T SELFGLKHFG+  +F+ +GNP+
Sbjct  404  MALTFLLFATALEHTIYIATALIAIGMGFQF-VSISTVSELFGLKHFGINFNFILLGNPI  462

Query  381  GAYLFSGLLAGYLYDIEAAKQHSDTCIGPNCFRVTFlvlaglcsagallsVVLTVRLKPV  202
            GA +FS +LAG++YDIEA KQ + TCIGP+CFR+TFLVLAG+C  G LLS+VLTVR++PV
Sbjct  463  GATIFSAVLAGHVYDIEAEKQATQTCIGPDCFRLTFLVLAGVCGLGTLLSIVLTVRIRPV  522

Query  201  YQMLYAGGSFRLPQSSN  151
            YQ LY+ GSFRLP +S+
Sbjct  523  YQALYSSGSFRLPHTSS  539



>ref|XP_008648081.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|AFW77135.1| hypothetical protein ZEAMMB73_773444 [Zea mays]
Length=561

 Score =   234 bits (598),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 126/204 (62%), Positives = 156/204 (76%), Gaps = 7/204 (3%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            VLNNLAQ+GIA G  DTTI LS+FSFCNF GRLGGG+VSE+ VR + LPR++ +  TQ V
Sbjct  359  VLNNLAQIGIAAGAVDTTISLSVFSFCNFFGRLGGGVVSEYLVRSRTLPRSVLIIGTQAV  418

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            MIITY LFA     TLYV+ ALLGIC+G+  S++I T+SELFGLKHFG I +F+ + NP+
Sbjct  419  MIITYLLFALGRLATLYVSVALLGICFGISLSVIISTSSELFGLKHFGKIFNFIALANPV  478

Query  381  GAYLFSGLLAGYLYDIEAAKQHSDT------CIGPNCFRVTFlvlaglcsagallsVVLT  220
            GA+LF+  LAGY+YD+E  KQH+ T      C GPNCFR+TF VL+G+   G LLS VLT
Sbjct  479  GAFLFN-TLAGYVYDLEVEKQHATTSGSDVACHGPNCFRLTFCVLSGVACLGTLLSTVLT  537

Query  219  VRLKPVYQMLYAGGSFRLPQSSNH  148
            VR++PVYQMLYAGGSF  P++  H
Sbjct  538  VRVRPVYQMLYAGGSFSQPRNPAH  561



>dbj|BAK00120.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=577

 Score =   234 bits (596),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 118/201 (59%), Positives = 151/201 (75%), Gaps = 5/201 (2%)
 Frame = -1

Query  738  LNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVVM  559
            LNNLAQ+G + G NDTT+LL LF FCNFVGR+ GG +SE+FVR + LPR  WM  TQ++M
Sbjct  375  LNNLAQIGTSVGANDTTVLLCLFGFCNFVGRILGGSISEYFVRTRMLPRPFWMMCTQIIM  434

Query  558  IITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPLG  379
            +IT+ LFA+ L+  +YV+T LLGICYGVQF+++IPT SELFGLK FGL+ +FM + NP+G
Sbjct  435  VITFLLFATGLHSLIYVSTTLLGICYGVQFAVMIPTVSELFGLKDFGLMYNFMLMVNPIG  494

Query  378  AYLFSGLLAGYLYDIEAAKQHSD-----TCIGPNCFRVTFlvlaglcsagallsVVLTVR  214
            A+ FS LLAGY+YD EAA+Q+        C GP+CFR+TF V A +C  G L+ +V   R
Sbjct  495  AFFFSALLAGYVYDKEAARQNPGVLDPANCFGPDCFRLTFYVCAMVCCCGTLICLVFIAR  554

Query  213  LKPVYQMLYAGGSFRLPQSSN  151
            +KPVYQMLYA GSFR P+   
Sbjct  555  IKPVYQMLYASGSFRHPRQQQ  575



>ref|XP_010537918.1| PREDICTED: uncharacterized protein LOC104812457 [Tarenaya hassleriana]
Length=564

 Score =   231 bits (590),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 126/200 (63%), Positives = 155/200 (78%), Gaps = 1/200 (1%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            V NNLAQ+G A G  DTTI+L LFSFCNF+GRL  G +SEHFVR + LPRT+WM   Q  
Sbjct  366  VSNNLAQIGFAFGAKDTTIILCLFSFCNFIGRLTSGSISEHFVRSRTLPRTLWMGVAQFF  425

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            M IT+ +FA +L  TLY+ATALLGI  G QF + I T SELFGLKHFG+  +F+ +GNP+
Sbjct  426  MAITFLIFAISLKHTLYIATALLGIGTGFQF-LSISTVSELFGLKHFGINFNFILLGNPI  484

Query  381  GAYLFSGLLAGYLYDIEAAKQHSDTCIGPNCFRVTFlvlaglcsagallsVVLTVRLKPV  202
            GA +FS +LAG++YD+EA KQ S TCIGP+CFR+TFLVLAG C  G LLS++LTVR++PV
Sbjct  485  GATIFSAVLAGHVYDMEAEKQGSQTCIGPDCFRLTFLVLAGACGLGTLLSIILTVRIRPV  544

Query  201  YQMLYAGGSFRLPQSSNH*H  142
            YQ LYA GSFRLP +S+  H
Sbjct  545  YQALYASGSFRLPHTSSSDH  564



>ref|XP_008659217.1| PREDICTED: uncharacterized protein LOC103637995 [Zea mays]
 gb|AFW85588.1| hypothetical protein ZEAMMB73_636421 [Zea mays]
Length=565

 Score =   231 bits (589),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 130/207 (63%), Positives = 156/207 (75%), Gaps = 10/207 (5%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            VLNNLAQ+GIA G  DTTI LS+FSFCNF GRLGGG VSE+ VR + LPR++ +  TQVV
Sbjct  360  VLNNLAQIGIAAGAVDTTISLSVFSFCNFFGRLGGGAVSEYLVRSRTLPRSVLVICTQVV  419

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            MIITY LFA     TLYV+ ALLG+CYGV  S++I T+SELFGLKHFG I +F+ + NP+
Sbjct  420  MIITYLLFALGRLATLYVSVALLGLCYGVLLSVVISTSSELFGLKHFGKIYNFITLANPV  479

Query  381  GAYLFSGLLAGYLYDIEAAKQH-------SD--TCIGPNCFRVTFlvlaglcsagallsV  229
            GAYLF+  LAGY+YD+E  +QH       SD   C GP+CFR+TF VLAG    G LLS 
Sbjct  480  GAYLFN-TLAGYVYDLEVERQHAAAAAAGSDVVACHGPSCFRLTFCVLAGAACLGTLLST  538

Query  228  VLTVRLKPVYQMLYAGGSFRLPQSSNH  148
            VLTVR++PVYQMLYAGGSF  P++S H
Sbjct  539  VLTVRVRPVYQMLYAGGSFSQPRNSAH  565



>ref|XP_006389807.1| hypothetical protein EUTSA_v10018350mg [Eutrema salsugineum]
 gb|ESQ27093.1| hypothetical protein EUTSA_v10018350mg [Eutrema salsugineum]
Length=563

 Score =   230 bits (586),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 126/199 (63%), Positives = 157/199 (79%), Gaps = 2/199 (1%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            V NNLAQ+G A G+ DTTILL LFSF NF+GRL  G +SEHFVR + LPRT+WM   Q+V
Sbjct  366  VSNNLAQIGFAFGIKDTTILLCLFSFFNFIGRLASGAISEHFVRSRTLPRTLWMGAAQLV  425

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            M+ T+ LFA A++ T+YVATAL+GI  G QF + I T SELFGL+HFG+  +F+ +GNP+
Sbjct  426  MVFTFLLFAMAIDHTIYVATALIGIGMGFQF-LSIATISELFGLRHFGINFNFILLGNPI  484

Query  381  GAYLFSGLLAGYLYDIEAAKQHSDTCIGPNCFRVTFlvlaglcsagallsVVLTVRLKPV  202
            GA +FS  LAGY+YD+EA KQ + TCIGP+CFRVTFLVLAG+C  G LL+V+LT+R++PV
Sbjct  485  GATIFSAFLAGYIYDMEADKQGNPTCIGPDCFRVTFLVLAGVCGLGTLLTVILTMRIRPV  544

Query  201  YQMLYAGGSFRL-PQSSNH  148
            YQ LYA GSFRL PQS  H
Sbjct  545  YQALYASGSFRLQPQSGGH  563



>ref|XP_006369330.1| hypothetical protein POPTR_0001s21170g [Populus trichocarpa]
 gb|ERP65899.1| hypothetical protein POPTR_0001s21170g [Populus trichocarpa]
Length=392

 Score =   225 bits (574),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 107/153 (70%), Positives = 132/153 (86%), Gaps = 0/153 (0%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            VLNNLAQ+G+A G+ DTT+LL+LFSFCNFVGR+G G +SEHFVRLK +PRT+WMTF  +V
Sbjct  234  VLNNLAQIGVAFGLEDTTLLLTLFSFCNFVGRIGSGAISEHFVRLKMIPRTLWMTFALMV  293

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            M++T+ LFA ALNG LY A  LLGI YGV ++I++PT SELFGLKHFGLI SFMG+GNP+
Sbjct  294  MLMTFILFAFALNGILYAAIPLLGISYGVLYAIMVPTVSELFGLKHFGLIYSFMGLGNPI  353

Query  381  GAYLFSGLLAGYLYDIEAAKQHSDTCIGPNCFR  283
            GA LFSG+LAGY+YD EAAKQ S +C+GP+CF+
Sbjct  354  GALLFSGMLAGYVYDAEAAKQSSSSCVGPDCFK  386



>ref|XP_006302052.1| hypothetical protein CARUB_v10020035mg, partial [Capsella rubella]
 gb|EOA34950.1| hypothetical protein CARUB_v10020035mg, partial [Capsella rubella]
Length=588

 Score =   229 bits (584),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 126/199 (63%), Positives = 157/199 (79%), Gaps = 2/199 (1%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            V NNLAQ+G A GV DTTILL LFSF NF+GRL  G +SEHFV+ + LPRT+WM   Q+V
Sbjct  391  VSNNLAQIGFAFGVKDTTILLCLFSFFNFIGRLASGAISEHFVKSRTLPRTLWMGAAQLV  450

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            M+ T+ LFA+A N T+Y+ATAL+G+  G QF + I T SELFGL+HFG+  +F+ +GNPL
Sbjct  451  MVFTFLLFATATNYTIYIATALIGVGMGFQF-LSIATISELFGLRHFGINFNFILLGNPL  509

Query  381  GAYLFSGLLAGYLYDIEAAKQHSDTCIGPNCFRVTFlvlaglcsagallsVVLTVRLKPV  202
            GA +FS  LAGY+YD EA KQ + TCIGP+C+RVTFLVLAG+C  G LLS++LTVR++PV
Sbjct  510  GATIFSAFLAGYIYDKEAEKQGNMTCIGPDCYRVTFLVLAGVCGLGTLLSIILTVRIRPV  569

Query  201  YQMLYAGGSFRL-PQSSNH  148
            YQ LYA GSFRL PQS+ H
Sbjct  570  YQALYASGSFRLQPQSTGH  588



>ref|XP_002887824.1| hypothetical protein ARALYDRAFT_895939 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH64083.1| hypothetical protein ARALYDRAFT_895939 [Arabidopsis lyrata subsp. 
lyrata]
Length=563

 Score =   228 bits (580),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 130/201 (65%), Positives = 157/201 (78%), Gaps = 4/201 (2%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            V NNLAQ+G A G+ DTTILL LFSF NF+GRL  G +SEHFVR + LPRTIWM   Q+V
Sbjct  364  VSNNLAQIGFAFGIKDTTILLCLFSFFNFIGRLASGAISEHFVRSRTLPRTIWMGAAQLV  423

Query  561  MIITYFLFASALNGTL--YVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGN  388
            M+ T+ LFA A++ T+  YVATAL+GI  G QF + I T SELFGL+HFG+  +F+ +GN
Sbjct  424  MVFTFLLFAMAIDHTMSIYVATALIGIGMGFQF-LSISTISELFGLRHFGINFNFILLGN  482

Query  387  PLGAYLFSGLLAGYLYDIEAAKQHSDTCIGPNCFRVTFlvlaglcsagallsVVLTVRLK  208
            PLGA +FS  LAGY+YD EA KQ + TCIGP+CFRVTFLVLAG+C  G LLSV+LTVR++
Sbjct  483  PLGATIFSAFLAGYIYDKEADKQGNMTCIGPDCFRVTFLVLAGVCGLGTLLSVILTVRIR  542

Query  207  PVYQMLYAGGSFRL-PQSSNH  148
            PVYQ LYA GSFRL PQS+ H
Sbjct  543  PVYQALYASGSFRLQPQSAGH  563



>ref|XP_010472910.1| PREDICTED: uncharacterized protein LOC104752465 [Camelina sativa]
Length=561

 Score =   227 bits (579),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 124/199 (62%), Positives = 158/199 (79%), Gaps = 2/199 (1%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            V NNLAQ+G+A G+ DTTILL LFSF NF+GRL  G +SEHFV+ + LPRT+WM   Q+V
Sbjct  364  VSNNLAQIGLAFGIKDTTILLCLFSFFNFIGRLASGAISEHFVKSRTLPRTLWMGAAQLV  423

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            M+ T+ LFA+A + T+YVATAL+G+  G QF + I T SELFGL+HFG+  +F+ +GNPL
Sbjct  424  MVFTFLLFATASDLTIYVATALIGVAMGFQF-LSIATISELFGLRHFGINFNFILLGNPL  482

Query  381  GAYLFSGLLAGYLYDIEAAKQHSDTCIGPNCFRVTFlvlaglcsagallsVVLTVRLKPV  202
            GA +FS  LAG++YD EA KQ + TC+GP+CFRVTFLVLAG+C  G LLS++LTVR++PV
Sbjct  483  GATIFSAFLAGHIYDKEAEKQGNMTCLGPDCFRVTFLVLAGVCGLGTLLSIILTVRIRPV  542

Query  201  YQMLYAGGSFRL-PQSSNH  148
            YQ LYA GSFRL PQS+ H
Sbjct  543  YQALYASGSFRLQPQSTGH  561



>ref|XP_010417694.1| PREDICTED: uncharacterized protein LOC104703384 [Camelina sativa]
Length=561

 Score =   227 bits (579),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 125/199 (63%), Positives = 158/199 (79%), Gaps = 2/199 (1%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            V NNLAQ+G+A G+ DTTILL LFSF NF+GRL  G +SEHFV+ + LPRT+WM   Q+V
Sbjct  364  VSNNLAQIGLAFGIKDTTILLCLFSFFNFIGRLASGAISEHFVKSRTLPRTLWMGAAQLV  423

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            M+ T+ LFA+A + T+YVATAL+G+  G QF + I T SELFGL+HFG+  +F+ +GNPL
Sbjct  424  MVFTFLLFATASDLTIYVATALIGVAMGFQF-LSIATISELFGLRHFGINFNFILLGNPL  482

Query  381  GAYLFSGLLAGYLYDIEAAKQHSDTCIGPNCFRVTFlvlaglcsagallsVVLTVRLKPV  202
            GA +FS  LAG++YD EA KQ + TC+GP+CFRVTFLVLAG+C  G LLSV+LTVR++PV
Sbjct  483  GATIFSAFLAGHIYDKEAEKQGNMTCLGPDCFRVTFLVLAGVCGLGTLLSVILTVRIRPV  542

Query  201  YQMLYAGGSFRL-PQSSNH  148
            YQ LYA GSFRL PQS+ H
Sbjct  543  YQALYASGSFRLQPQSTGH  561



>ref|XP_003564216.1| PREDICTED: uncharacterized protein LOC100833364 [Brachypodium 
distachyon]
Length=566

 Score =   226 bits (577),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 129/208 (62%), Positives = 155/208 (75%), Gaps = 11/208 (5%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            VLNNLAQVGIA G  DTTI LSLFSF NF GRLGGG  S++ VR   LPRT+ +T TQVV
Sbjct  360  VLNNLAQVGIAAGAVDTTISLSLFSFGNFFGRLGGGAASDYIVRSWTLPRTVLLTCTQVV  419

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            MIITY +FA  L+ TLY++ A+LG+CYGV FS+++ T+SELFGLK FG I +F+ + NPL
Sbjct  420  MIITYLIFALGLHATLYISVAVLGVCYGVHFSVMVSTSSELFGLKQFGKIYNFIMLANPL  479

Query  381  GAYLFSGLLAGYLYDIEAAKQHS----------DTCIGPNCFRVTFlvlaglcsagalls  232
            GA LFS  LAGY+YD+EAAKQHS            C GP+CFR+ F VL+G+   G LLS
Sbjct  480  GALLFSS-LAGYIYDLEAAKQHSAGAAVGSDHVTVCHGPSCFRLMFCVLSGMACLGTLLS  538

Query  231  VVLTVRLKPVYQMLYAGGSFRLPQSSNH  148
            VVLTVR++PVYQMLYAGGS    +SS H
Sbjct  539  VVLTVRIRPVYQMLYAGGSSNQLRSSAH  566



>emb|CDX87321.1| BnaA07g35520D [Brassica napus]
Length=559

 Score =   226 bits (576),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 129/199 (65%), Positives = 157/199 (79%), Gaps = 2/199 (1%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            V NNLAQ+G A G+  TTILL LFSF NF GRL  G +SEHFVR KALPRT+WM   Q+V
Sbjct  362  VSNNLAQIGFAFGIKGTTILLCLFSFFNFCGRLASGAISEHFVRSKALPRTLWMGAAQLV  421

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            M+ T+ LF+ A+NGT+YVATAL+GI  G Q+ + I T SELFGLK+FG+  +F+ +GNP 
Sbjct  422  MMFTFILFSMAINGTIYVATALVGIGMGFQY-LSISTISELFGLKNFGINFNFILLGNPT  480

Query  381  GAYLFSGLLAGYLYDIEAAKQHSDTCIGPNCFRVTFlvlaglcsagallsVVLTVRLKPV  202
            GA +FS L+AG++YD EA KQ S TCIGP+C+RVTFLVLAGLC  G LLSV+LTVR++PV
Sbjct  481  GAAIFSALMAGHIYDREATKQGSSTCIGPDCYRVTFLVLAGLCGLGTLLSVILTVRIRPV  540

Query  201  YQMLYAGGSFRL-PQSSNH  148
            YQ LYA GSFRL PQS+ H
Sbjct  541  YQALYASGSFRLQPQSNGH  559



>ref|XP_009106737.1| PREDICTED: uncharacterized protein LOC103832476 [Brassica rapa]
Length=559

 Score =   226 bits (576),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 129/199 (65%), Positives = 157/199 (79%), Gaps = 2/199 (1%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            V NNLAQ+G A G+  TTILL LFSF NF GRL  G +SEHFVR KALPRT+WM   Q+V
Sbjct  362  VSNNLAQIGFAFGIKGTTILLCLFSFFNFCGRLASGAISEHFVRSKALPRTLWMGAAQLV  421

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            M+ T+ LF+ A+NGT+YVATAL+GI  G Q+ + I T SELFGLK+FG+  +F+ +GNP 
Sbjct  422  MMFTFILFSMAINGTIYVATALVGIGMGFQY-LSISTISELFGLKNFGINFNFILLGNPT  480

Query  381  GAYLFSGLLAGYLYDIEAAKQHSDTCIGPNCFRVTFlvlaglcsagallsVVLTVRLKPV  202
            GA +FS L+AG++YD EA KQ S TCIGP+C+RVTFLVLAGLC  G LLSV+LTVR++PV
Sbjct  481  GAAIFSALMAGHIYDREATKQGSSTCIGPDCYRVTFLVLAGLCGLGTLLSVILTVRIRPV  540

Query  201  YQMLYAGGSFRL-PQSSNH  148
            YQ LYA GSFRL PQS+ H
Sbjct  541  YQALYASGSFRLQPQSNGH  559



>emb|CDY39967.1| BnaC06g40450D [Brassica napus]
Length=559

 Score =   224 bits (572),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 128/199 (64%), Positives = 157/199 (79%), Gaps = 2/199 (1%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            V NNLAQ+G A G+  TTILL LFSF NF GRL  G +SEHFVR KALPRT+WM   Q+V
Sbjct  362  VSNNLAQIGFAFGIKGTTILLCLFSFFNFCGRLASGAISEHFVRSKALPRTLWMGAAQLV  421

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            M+ T+ LF+ A++GT+YVATAL+GI  G Q+ + I T SELFGLK+FG+  +F+ +GNP 
Sbjct  422  MMFTFLLFSMAIDGTIYVATALVGIGMGFQY-LSISTISELFGLKNFGINFNFILLGNPT  480

Query  381  GAYLFSGLLAGYLYDIEAAKQHSDTCIGPNCFRVTFlvlaglcsagallsVVLTVRLKPV  202
            GA +FS L+AG++YD EA KQ S TCIGP+C+RVTFLVLAGLC  G LLSV+LTVR++PV
Sbjct  481  GAAIFSALMAGHIYDREATKQGSSTCIGPDCYRVTFLVLAGLCGLGTLLSVILTVRIRPV  540

Query  201  YQMLYAGGSFRL-PQSSNH  148
            YQ LYA GSFRL PQS+ H
Sbjct  541  YQALYASGSFRLQPQSNGH  559



>ref|XP_003597942.1| Nodulin-like protein [Medicago truncatula]
 gb|AES68193.1| nodulin-like/MFS transporter [Medicago truncatula]
Length=312

 Score =   217 bits (553),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 124/198 (63%), Positives = 145/198 (73%), Gaps = 30/198 (15%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            VLNNLAQ+G A GV DTTILLS+FSFCNF+GRLG G VSEHFV       +IW       
Sbjct  138  VLNNLAQIGAALGVEDTTILLSIFSFCNFIGRLGAGAVSEHFVS------SIWH------  185

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
                            Y ATALLG+CYGVQ+SI++PT SELFGLKHFG+I SFM +GNP+
Sbjct  186  ----------------YAATALLGMCYGVQYSIMVPTVSELFGLKHFGVISSFMMLGNPI  229

Query  381  GAYLFSGLLAGYLYDIEAAKQHSDTCIGPNCFRVTFlvlaglcsagallsVVLTVRLKPV  202
            GA LFS  +AG LYD EAAKQ + TC G NCFR+TFLVLAG+C  G +LS++LTVR++PV
Sbjct  230  GALLFS--VAGNLYDTEAAKQGNSTCYGANCFRITFLVLAGVCGIGTILSIILTVRIRPV  287

Query  201  YQMLYAGGSFRLPQSSNH  148
            YQMLYAGGSFRL Q+SN 
Sbjct  288  YQMLYAGGSFRLSQTSNQ  305



>ref|XP_010691077.1| PREDICTED: uncharacterized protein LOC104904509 [Beta vulgaris 
subsp. vulgaris]
Length=645

 Score =   224 bits (570),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 119/196 (61%), Positives = 152/196 (78%), Gaps = 0/196 (0%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            VLNNLAQ+G AQG  DT++LL+LF+F NFVGRLGGG+ SEH VR K +PRTI M+  Q V
Sbjct  448  VLNNLAQIGFAQGEYDTSVLLALFAFFNFVGRLGGGVFSEHLVRSKNIPRTILMSMAQAV  507

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            M++T+ L+ S+L  TLY AT LLGICYGV  +++ P  SELFGLKH G+I +F+ +GNPL
Sbjct  508  MVVTFLLYRSSLGATLYAATVLLGICYGVHSAVMTPVASELFGLKHVGVIYNFIQLGNPL  567

Query  381  GAYLFSGLLAGYLYDIEAAKQHSDTCIGPNCFRVTFlvlaglcsagallsVVLTVRLKPV  202
            GA LFS LLAG +YD EAAKQ   TC+G +CF +T+LVLAG+C  G +L ++LT+R++PV
Sbjct  568  GAALFSVLLAGNIYDAEAAKQGVSTCMGASCFGLTYLVLAGVCGLGVILGLILTIRIRPV  627

Query  201  YQMLYAGGSFRLPQSS  154
            YQ LY  GSF + QSS
Sbjct  628  YQRLYGSGSFYILQSS  643



>ref|XP_009104470.1| PREDICTED: uncharacterized protein LOC103830442 [Brassica rapa]
Length=557

 Score =   222 bits (565),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 123/199 (62%), Positives = 154/199 (77%), Gaps = 2/199 (1%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            V NNLAQ+G A G+ DTTILL LFSF NF+GRL  G +SEHFV+ + LPRT+WM   Q+V
Sbjct  360  VSNNLAQIGYAFGIKDTTILLCLFSFFNFIGRLASGAISEHFVKSRTLPRTLWMGAAQLV  419

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            M+ T+ LF  A++ T+YVATAL+GI  G QF + I T SELFGL+HFG+  + + +GNP+
Sbjct  420  MVFTFLLFYMAIDHTIYVATALIGIGMGFQF-LSIATISELFGLRHFGINYNVILLGNPI  478

Query  381  GAYLFSGLLAGYLYDIEAAKQHSDTCIGPNCFRVTFlvlaglcsagallsVVLTVRLKPV  202
            GA +FS LLAGY+YD EA KQ + TC+GP+CFR TFLVLAG+C  G LL+V+LTVR++PV
Sbjct  479  GATIFSALLAGYIYDKEAEKQGNPTCVGPDCFRETFLVLAGVCGLGTLLTVILTVRIRPV  538

Query  201  YQMLYAGGSFRL-PQSSNH  148
            YQ LYA GSFRL PQS  H
Sbjct  539  YQALYASGSFRLQPQSGGH  557



>emb|CDX67953.1| BnaA07g19930D [Brassica napus]
Length=557

 Score =   222 bits (565),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 123/199 (62%), Positives = 154/199 (77%), Gaps = 2/199 (1%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            V NNLAQ+G A G+ DTTILL LFSF NF+GRL  G +SEHFV+ + LPRT+WM   Q+V
Sbjct  360  VSNNLAQIGYAFGIKDTTILLCLFSFFNFIGRLASGAISEHFVKSRTLPRTLWMGAAQLV  419

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            M+ T+ LF  A++ T+YVATAL+GI  G QF + I T SELFGL+HFG+  + + +GNP+
Sbjct  420  MVFTFLLFYMAIDHTIYVATALIGIGMGFQF-LSIATISELFGLRHFGINYNVILLGNPI  478

Query  381  GAYLFSGLLAGYLYDIEAAKQHSDTCIGPNCFRVTFlvlaglcsagallsVVLTVRLKPV  202
            GA +FS LLAGY+YD EA KQ + TC+GP+CFR TFLVLAG+C  G LL+V+LTVR++PV
Sbjct  479  GATIFSALLAGYIYDKEAEKQGNPTCVGPDCFRETFLVLAGVCGLGTLLTVILTVRIRPV  538

Query  201  YQMLYAGGSFRL-PQSSNH  148
            YQ LYA GSFRL PQS  H
Sbjct  539  YQALYASGSFRLQPQSGGH  557



>emb|CDX79379.1| BnaC06g19240D [Brassica napus]
Length=560

 Score =   221 bits (564),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 123/199 (62%), Positives = 154/199 (77%), Gaps = 2/199 (1%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            V NNLAQ+G A G+ DTTILL LFSF NF+GRL  G +SEHFV+ + LPRT+WM   Q+V
Sbjct  363  VSNNLAQIGYAFGIKDTTILLCLFSFFNFIGRLASGAISEHFVKSRTLPRTLWMGAAQLV  422

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            M+ T+ LF  A++ T+YVATAL+GI  G QF + I T SELFGL+HFG+  + + +GNP+
Sbjct  423  MVFTFLLFYMAIDHTIYVATALIGIGMGFQF-LSIATISELFGLRHFGINYNVILLGNPI  481

Query  381  GAYLFSGLLAGYLYDIEAAKQHSDTCIGPNCFRVTFlvlaglcsagallsVVLTVRLKPV  202
            GA +FS LLAGY+YD EA KQ + TC+GP+CFR TFLVLAG+C  G LL+V+LTVR++PV
Sbjct  482  GATIFSALLAGYIYDKEAEKQGNPTCVGPDCFRETFLVLAGVCGLGTLLTVILTVRIRPV  541

Query  201  YQMLYAGGSFRL-PQSSNH  148
            YQ LYA GSFRL PQS  H
Sbjct  542  YQALYASGSFRLQPQSGGH  560



>gb|KFK42463.1| hypothetical protein AALP_AA2G260200 [Arabis alpina]
Length=562

 Score =   221 bits (563),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 120/199 (60%), Positives = 155/199 (78%), Gaps = 2/199 (1%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            V NNLAQ+G A G+ DTTILL +FSF NF+GRL  G +SEHFV+ + LPRTIWM   Q++
Sbjct  365  VSNNLAQIGFAFGIKDTTILLCIFSFFNFIGRLTSGAISEHFVKSRTLPRTIWMAAAQLL  424

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            M+ T+ LFA A++ T+Y+ATAL+ I  G QF + + T SELFGL+HFG+  +F+ +GNP+
Sbjct  425  MVFTFLLFALAIDHTIYIATALIAIGMGFQF-LSVSTISELFGLRHFGINFNFILLGNPI  483

Query  381  GAYLFSGLLAGYLYDIEAAKQHSDTCIGPNCFRVTFlvlaglcsagallsVVLTVRLKPV  202
            GA +FS LLA Y+YD EA KQ + TC+GP CFRVTFLVLAG+C  G LL+V+LT+R++PV
Sbjct  484  GATIFSSLLAAYIYDKEADKQGNMTCVGPECFRVTFLVLAGVCGFGTLLTVILTMRIRPV  543

Query  201  YQMLYAGGSFRL-PQSSNH  148
            YQ LYA GSFRL PQS+ H
Sbjct  544  YQALYASGSFRLQPQSTGH  562



>gb|EAZ06229.1| hypothetical protein OsI_28471 [Oryza sativa Indica Group]
Length=569

 Score =   221 bits (563),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 121/202 (60%), Positives = 148/202 (73%), Gaps = 4/202 (2%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKAL-PRTIWMTFTQV  565
            VLNNLAQ+G+A G+ DTT+LLSLF+  NF GRLGGG +SE FVR   L PR IWM  TQ 
Sbjct  367  VLNNLAQIGVAAGIGDTTVLLSLFALGNFFGRLGGGAISEKFVRSTLLVPRPIWMALTQT  426

Query  564  VMIITYFLFASALNGTL-YVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGN  388
            V+++ Y   A  L   + Y  TA +G+CYGVQFS++IPTTSELFGLK+FGL  + M + N
Sbjct  427  VLVVAYLCLAYTLGPAVAYACTAAVGLCYGVQFSVMIPTTSELFGLKNFGLFYNLMSLAN  486

Query  387  PLGAYLFSGLLAGYLYDIEAAK-QHS-DTCIGPNCFRVTFlvlaglcsagallsVVLTVR  214
            PLGA LFSG LAG LYD EAA+ QHS   C+GP CFR  F+VLAG CS G  +S+VL  R
Sbjct  487  PLGAALFSGELAGRLYDEEAARQQHSGGACLGPGCFRAAFMVLAGACSMGTAVSLVLAAR  546

Query  213  LKPVYQMLYAGGSFRLPQSSNH  148
            ++PVY+ LY+GGSFRLP +S  
Sbjct  547  IRPVYRALYSGGSFRLPNASQQ  568



>ref|XP_010429940.1| PREDICTED: uncharacterized protein LOC104714323 [Camelina sativa]
Length=562

 Score =   220 bits (561),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 124/200 (62%), Positives = 157/200 (79%), Gaps = 3/200 (2%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            V NNLAQ+G+A G+ DTTILL LFSF NF+GRL  G +SEHFV+ + LPRT+WM   Q+V
Sbjct  364  VSNNLAQIGLAFGIKDTTILLCLFSFFNFIGRLTSGAISEHFVKSRTLPRTLWMGAAQLV  423

Query  561  MIITYFLFASALNG-TLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNP  385
            M+ T+ LFA+  +G T+YVATAL+G+  G QF + I T SELF L+HFG+  +F+ +GNP
Sbjct  424  MVFTFLLFAATASGLTIYVATALIGVAMGFQF-LSIATISELFVLRHFGINFNFILLGNP  482

Query  384  LGAYLFSGLLAGYLYDIEAAKQHSDTCIGPNCFRVTFlvlaglcsagallsVVLTVRLKP  205
            LGA +FS  LAG++YD EA +Q + TCIGP+CFRVTFLVLAG+C  G LLSV+LTVR++P
Sbjct  483  LGATIFSAFLAGHIYDKEAERQGNMTCIGPDCFRVTFLVLAGVCGLGTLLSVILTVRIRP  542

Query  204  VYQMLYAGGSFRL-PQSSNH  148
            VYQ LYA GSFRL PQS+ H
Sbjct  543  VYQALYASGSFRLQPQSTGH  562



>emb|CDX67954.1| BnaA07g19940D [Brassica napus]
Length=560

 Score =   220 bits (561),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 122/199 (61%), Positives = 154/199 (77%), Gaps = 2/199 (1%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            V NNLAQ+G A G+ DTTIL+ +FSF NF GRL  G +SEHFV+ + LPRT+WM  +Q+V
Sbjct  363  VSNNLAQIGFAYGIKDTTILVCIFSFFNFTGRLASGALSEHFVKSRMLPRTLWMGASQLV  422

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            M+ T+ LFA A++ T+YVATAL GI  G Q  + I T SELFGL+HFG+  + + + NP+
Sbjct  423  MVFTFLLFAMAIDHTIYVATALAGIGMGFQL-LSIATISELFGLRHFGINFNVILLANPI  481

Query  381  GAYLFSGLLAGYLYDIEAAKQHSDTCIGPNCFRVTFlvlaglcsagallsVVLTVRLKPV  202
            GA LFS LLAGY+YD EA KQ + TCIGP+CFRVTFLVLAG+C  G LL+V+LTVR++PV
Sbjct  482  GASLFSALLAGYIYDKEADKQGNPTCIGPDCFRVTFLVLAGVCGLGTLLTVILTVRIRPV  541

Query  201  YQMLYAGGSFRL-PQSSNH  148
            YQ LYA GSF+L PQS+ H
Sbjct  542  YQALYASGSFKLQPQSAGH  560



>emb|CDX79374.1| BnaC06g19290D [Brassica napus]
Length=561

 Score =   220 bits (561),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 122/199 (61%), Positives = 154/199 (77%), Gaps = 2/199 (1%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            V NNLAQ+G A G+ DTTIL+ +FSF NF GRL  G +SEHFV+ + LPRT+WM  +Q+V
Sbjct  364  VSNNLAQIGFAYGIKDTTILVCIFSFFNFTGRLASGALSEHFVKSRMLPRTLWMGASQLV  423

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            M+ T+ LFA A++ T+YVATAL GI  G Q  + I T SELFGL+HFG+  + + + NP+
Sbjct  424  MVFTFLLFAMAIDHTIYVATALAGIGMGFQL-LSIATISELFGLRHFGVNFNVILLANPI  482

Query  381  GAYLFSGLLAGYLYDIEAAKQHSDTCIGPNCFRVTFlvlaglcsagallsVVLTVRLKPV  202
            GA LFS LLAGY+YD EA KQ + TCIGP+CFRVTFLVLAG+C  G LL+V+LTVR++PV
Sbjct  483  GASLFSALLAGYIYDKEAEKQGNPTCIGPDCFRVTFLVLAGVCGLGTLLTVILTVRIRPV  542

Query  201  YQMLYAGGSFRL-PQSSNH  148
            YQ LYA GSF+L PQS+ H
Sbjct  543  YQALYASGSFKLQPQSAGH  561



>ref|XP_009104471.1| PREDICTED: uncharacterized protein LOC103830443 [Brassica rapa]
Length=560

 Score =   220 bits (561),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 121/199 (61%), Positives = 154/199 (77%), Gaps = 2/199 (1%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            V NNLAQ+G A G+ DTT+L+ +FSF NF GRL  G +SEHFV+ + LPRT+WM  +Q+V
Sbjct  363  VSNNLAQIGFAYGIKDTTVLVCIFSFFNFTGRLASGALSEHFVKSRMLPRTLWMGASQLV  422

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            M+ T+ LFA A++ T+YVATAL GI  G Q  + I T SELFGL+HFG+  + + + NP+
Sbjct  423  MVFTFLLFAMAIDHTIYVATALAGIGMGFQL-LSIATISELFGLRHFGINFNVILLANPI  481

Query  381  GAYLFSGLLAGYLYDIEAAKQHSDTCIGPNCFRVTFlvlaglcsagallsVVLTVRLKPV  202
            GA LFS LLAGY+YD EA KQ + TCIGP+CFRVTFLVLAG+C  G LL+V+LTVR++PV
Sbjct  482  GASLFSALLAGYIYDKEAEKQGNPTCIGPDCFRVTFLVLAGVCGLGTLLTVILTVRIRPV  541

Query  201  YQMLYAGGSFRL-PQSSNH  148
            YQ LYA GSF+L PQS+ H
Sbjct  542  YQALYASGSFKLQPQSAGH  560



>dbj|BAK02404.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=562

 Score =   220 bits (560),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 124/208 (60%), Positives = 152/208 (73%), Gaps = 11/208 (5%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            VLNNLAQVG A GV  TTI +SLFS  NF GRLGGG VS++FVR + LPRT+ +T TQVV
Sbjct  356  VLNNLAQVGTAAGVVGTTISVSLFSLGNFFGRLGGGAVSDYFVRSRTLPRTVLITCTQVV  415

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            MII Y +FA  L  TLY++ A+LGICYGV FS+++ T+SELFGLK FG I +F+ + NPL
Sbjct  416  MIINYLVFALGLKATLYISVAILGICYGVHFSVMVSTSSELFGLKQFGKIYNFILLANPL  475

Query  381  GAYLFSGLLAGYLYDIEAAKQHS----------DTCIGPNCFRVTFlvlaglcsagalls  232
            GA +FS  LAGY+YD EAAKQHS            C GP+CFR+TF VL+G+   G  LS
Sbjct  476  GALVFSS-LAGYVYDHEAAKQHSVAAVAGSDHVTVCYGPSCFRLTFFVLSGMACLGTFLS  534

Query  231  VVLTVRLKPVYQMLYAGGSFRLPQSSNH  148
            V+LTVR++PVYQMLY GG    P+SS +
Sbjct  535  VILTVRIRPVYQMLYGGGPSNQPRSSAY  562



>dbj|BAC98515.1| nodulin-like protein [Oryza sativa Japonica Group]
 dbj|BAC98533.1| nodulin-like protein [Oryza sativa Japonica Group]
Length=569

 Score =   218 bits (554),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 120/202 (59%), Positives = 146/202 (72%), Gaps = 4/202 (2%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKAL-PRTIWMTFTQV  565
            VLNNLAQ+G+A G+ DTT+LLSLF+  NF GRLGGG +SE FVR   L PR IWM  TQ 
Sbjct  367  VLNNLAQIGVAAGIGDTTVLLSLFALGNFFGRLGGGAISEKFVRSTLLVPRPIWMALTQT  426

Query  564  VMIITYFLFASALNGTL-YVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGN  388
            V+++ Y   A  L   + Y  TA +G+CYGVQFS++IPTTSELFGLK+FGL  + M + N
Sbjct  427  VLVVAYLCLAYTLGPAVAYACTATVGLCYGVQFSVMIPTTSELFGLKNFGLFYNLMSLAN  486

Query  387  PLGAYLFSGLLAGYLYDIEAAK-QHS-DTCIGPNCFRVTFlvlaglcsagallsVVLTVR  214
            PLGA LFSG L G LYD EAA+ QHS   C+GP CFR  F+VLAG CS G  +S+VL  R
Sbjct  487  PLGAALFSGELTGRLYDEEAARQQHSGGVCLGPGCFRAAFVVLAGACSVGTAVSLVLAAR  546

Query  213  LKPVYQMLYAGGSFRLPQSSNH  148
            ++PVY  LY+GGSFRLP +S  
Sbjct  547  IQPVYMALYSGGSFRLPNASQQ  568



>ref|XP_010097162.1| hypothetical protein L484_025707 [Morus notabilis]
 gb|EXB67229.1| hypothetical protein L484_025707 [Morus notabilis]
Length=153

 Score =   205 bits (522),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 102/152 (67%), Positives = 130/152 (86%), Gaps = 1/152 (1%)
 Frame = -1

Query  600  LPRTIWMTFTQVVMIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHF  421
            +PRT+WMT   V+MI+ + L+ASAL+GTLY ATALLG+CYGVQ+S+++PT SELFGLKHF
Sbjct  2    IPRTVWMTCAHVLMILAFLLYASALSGTLYAATALLGVCYGVQYSMMVPTASELFGLKHF  61

Query  420  GLILSFMGIGNPLGAYLFSGLLAGYLYDIEAAKQ-HSDTCIGPNCFRVTFlvlaglcsag  244
            G+I SFM +GNP+GA LFS LLAG +YD EAAKQ    TC+GP+CFR+TF VLAG+C  G
Sbjct  62   GVISSFMQLGNPIGAVLFSALLAGSVYDAEAAKQGGGSTCLGPDCFRLTFQVLAGVCGLG  121

Query  243  allsVVLTVRLKPVYQMLYAGGSFRLPQSSNH  148
             ++ ++LT+R++PVYQMLYAGGSFRLPQSS+H
Sbjct  122  TIMGIILTIRIRPVYQMLYAGGSFRLPQSSSH  153



>ref|XP_006659251.1| PREDICTED: probable transporter mch1-like [Oryza brachyantha]
Length=563

 Score =   212 bits (540),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 114/203 (56%), Positives = 142/203 (70%), Gaps = 5/203 (2%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKAL-PRTIWMTFTQV  565
            VLNNLAQ+G+A G+ DTT+LLSLFS  NF+GRLGGG VSE FVR   L PR IWM  TQ 
Sbjct  360  VLNNLAQIGVAAGIGDTTVLLSLFSLGNFLGRLGGGAVSEKFVRSTLLVPRPIWMALTQT  419

Query  564  VMIITYFLFASALNG--TLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIG  391
            V+ + Y   A AL      +  TA +G+CYGVQFS++IPT SELFGL++FGL  + + + 
Sbjct  420  VLAVAYLSLAYALGAPAVAHACTAAVGLCYGVQFSVMIPTASELFGLRNFGLFYNLISLA  479

Query  390  NPLGAYLFSGLLAGYLYDIEAAKQH--SDTCIGPNCFRVTFlvlaglcsagallsVVLTV  217
            NPLG  LFSG L G LYD EA +Q      C+GP CFRV F+ LAG C+ G  +S+VL  
Sbjct  480  NPLGGALFSGELVGRLYDAEAERQSGGGSECLGPGCFRVAFVALAGACALGTAVSLVLAA  539

Query  216  RLKPVYQMLYAGGSFRLPQSSNH  148
            R++PVY+ LY+GGSFRLP +S  
Sbjct  540  RIRPVYRALYSGGSFRLPNASQQ  562



>ref|XP_001757080.1| predicted protein [Physcomitrella patens]
 gb|EDQ78311.1| predicted protein [Physcomitrella patens]
Length=566

 Score =   204 bits (520),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 103/191 (54%), Positives = 141/191 (74%), Gaps = 7/191 (4%)
 Frame = -1

Query  738  LNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVVM  559
            +NNL Q+  AQG ++  I +SL S  NF+GRLGGG +SEH VR  A+PRT+W+   Q+ +
Sbjct  361  INNLGQIAEAQGYHNVNIFVSLISIANFLGRLGGGSLSEHHVRKDAVPRTLWLALAQITL  420

Query  558  IITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPLG  379
            +  + +FASAL GTLYV + LLG+CYG+ FSI++PT SELFGLKHFG+I +F+ I +PLG
Sbjct  421  VFVHLMFASALPGTLYVGSVLLGLCYGIHFSIMVPTASELFGLKHFGMIYNFLTIASPLG  480

Query  378  AYLFSGLLAGYLYDIEAAKQH-------SDTCIGPNCFRVTFlvlaglcsagallsVVLT  220
            ++LFSGL+AGYLYDIEAAK          + C G +CFR+TF V+A + ++GAL++ VLT
Sbjct  481  SFLFSGLIAGYLYDIEAAKDSGGSQLFGKEVCNGAHCFRLTFYVMAAVSASGALMTTVLT  540

Query  219  VRLKPVYQMLY  187
             R++ VY  LY
Sbjct  541  YRIRSVYFALY  551



>ref|XP_002530466.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF31936.1| conserved hypothetical protein [Ricinus communis]
Length=510

 Score =   202 bits (515),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 104/162 (64%), Positives = 134/162 (83%), Gaps = 0/162 (0%)
 Frame = -1

Query  633  IVSEHFVRLKALPRTIWMTFTQVVMIITYFLFASALNGTLYVATALLGICYGVQFSILIP  454
            ++S  F   K +PRT+WMTF  ++MIIT+ LFA AL+G LYVATA++G+CYG+ +S+++P
Sbjct  349  LISGFFGWSKTIPRTLWMTFALIIMIITFILFAFALDGILYVATAMIGVCYGILYSVMVP  408

Query  453  TTSELFGLKHFGLILSFMGIGNPLGAYLFSGLLAGYLYDIEAAKQHSDTCIGPNCFRVTF  274
            T SELFGLKHFG+I + M +GNP+GA LFSG+LAG +YD EA KQ S +CIG  CFR+TF
Sbjct  409  TASELFGLKHFGIIYTTMLLGNPVGALLFSGILAGSIYDAEATKQGSSSCIGAGCFRLTF  468

Query  273  lvlaglcsagallsVVLTVRLKPVYQMLYAGGSFRLPQSSNH  148
            LVLAG+C  G +LS++LTVR++PVYQMLYAGGSFRLPQSS H
Sbjct  469  LVLAGICGLGTILSIILTVRIRPVYQMLYAGGSFRLPQSSGH  510



>gb|EEE65202.1| hypothetical protein OsJ_20331 [Oryza sativa Japonica Group]
Length=868

 Score =   205 bits (522),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 124/205 (60%), Positives = 149/205 (73%), Gaps = 12/205 (6%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            VLNNLAQVGIA GV DTTI L+LFSF NF GRLGGG VSE+ VR + LPRT  +T TQV+
Sbjct  406  VLNNLAQVGIAAGVADTTISLALFSFGNFFGRLGGGAVSEYLVRSRTLPRTTLITCTQVM  465

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            MII Y LFA   + TL+V+ ALLGICYG QFS+++ T+SELFGLKHFG I +F+ +GNPL
Sbjct  466  MIIIYLLFALGHHATLHVSVALLGICYGAQFSVMVSTSSELFGLKHFGKIFNFISLGNPL  525

Query  381  GAYLFSGLLAGYLYDIEAAKQHSDT------CIGPNCFRVTFlvlaglcsagallsVVLT  220
            GA LF+  LAGY+YD E  +QH+ T      C GPNCFR+TF VLAG+ S G LLS+VLT
Sbjct  526  GALLFNS-LAGYVYDQEVERQHATTMDTDIACHGPNCFRLTFCVLAGVASLGTLLSIVLT  584

Query  219  ---VRLKPVYQMLYAGG--SFRLPQ  160
               + LKP  Q  ++ G   FR  Q
Sbjct  585  AARILLKPHQQAEFSTGRWQFRFEQ  609



>ref|XP_001762698.1| predicted protein [Physcomitrella patens]
 gb|EDQ72497.1| predicted protein [Physcomitrella patens]
Length=571

 Score =   202 bits (515),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 107/193 (55%), Positives = 139/193 (72%), Gaps = 8/193 (4%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            V+NNL Q+G AQG  +  I +SLFS  NF+GRLGGG +SEH+VR  ALPR +WM   Q++
Sbjct  361  VINNLGQIGEAQGYYNINIFISLFSIANFLGRLGGGSLSEHYVRSDALPRPLWMGIAQII  420

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            +I  + +FASAL GTLYV + LLG+CYG  FSI++PT SELFGLKHFG I + + I NPL
Sbjct  421  LIFVHLIFASALPGTLYVGSILLGLCYGFHFSIMVPTASELFGLKHFGKIYNCLTISNPL  480

Query  381  GAYLFSGLLAGYLYDIEAAK--------QHSDTCIGPNCFRVTFlvlaglcsagallsVV  226
            G++LFSG +AGYLYD EA K        +  +TC G +CFR+TF VLA +CS G +L+ V
Sbjct  481  GSFLFSGFIAGYLYDAEAKKGSGFGSNLKDQETCTGSHCFRLTFYVLACVCSVGVILTGV  540

Query  225  LTVRLKPVYQMLY  187
            LT R++ VY  +Y
Sbjct  541  LTYRIRSVYTSMY  553



>ref|XP_002960946.1| hypothetical protein SELMODRAFT_266544 [Selaginella moellendorffii]
 gb|EFJ38485.1| hypothetical protein SELMODRAFT_266544 [Selaginella moellendorffii]
Length=551

 Score =   198 bits (504),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 102/188 (54%), Positives = 141/188 (75%), Gaps = 2/188 (1%)
 Frame = -1

Query  738  LNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVVM  559
            +NNL Q+G AQG  D TI ++L    NF+GRLGGG +SE +VR KA+PRT+W+   Q +M
Sbjct  358  INNLGQIGQAQGFTDVTIFVTLLGIWNFLGRLGGGAISEKYVR-KAVPRTLWLAGAQCLM  416

Query  558  IITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPLG  379
            ++ + LFA A   +L+V + LLG CYGV FS+++PT SELFGLKHFG I +F+ +G+P+G
Sbjct  417  VVAHLLFAWAGTSSLHVGSILLGFCYGVHFSVMVPTASELFGLKHFGKIYNFLTMGDPVG  476

Query  378  AYLFSGLLAGYLYDIEAAK-QHSDTCIGPNCFRVTFlvlaglcsagallsVVLTVRLKPV  202
            + LFSG++AGYLYD+EA     +D CIG +CFR+TFL++AG+C  G+  SV ++VR+KPV
Sbjct  477  SLLFSGVIAGYLYDMEARDGPQADQCIGAHCFRLTFLIMAGVCLVGSAASVYVSVRIKPV  536

Query  201  YQMLYAGG  178
            YQ LY  G
Sbjct  537  YQSLYKSG  544



>ref|XP_002967061.1| hypothetical protein SELMODRAFT_87151 [Selaginella moellendorffii]
 gb|EFJ31660.1| hypothetical protein SELMODRAFT_87151 [Selaginella moellendorffii]
Length=567

 Score =   196 bits (498),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 102/191 (53%), Positives = 141/191 (74%), Gaps = 4/191 (2%)
 Frame = -1

Query  738  LNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRL---KALPRTIWMTFTQ  568
            +NNL Q+G AQG  D TI ++L    NF+GRLGGG +SE +VR+   KA+PRT+W+   Q
Sbjct  370  INNLGQIGQAQGFTDVTIFVTLLGIWNFLGRLGGGAISEKYVRILCRKAVPRTLWLAGAQ  429

Query  567  VVMIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGN  388
             +M + + LFA A   +L+V + LLG CYGV FS+++PT SELFGLKHFG I +F+ +G+
Sbjct  430  CLMAVAHLLFAWAGTSSLHVGSILLGFCYGVHFSVMVPTASELFGLKHFGKIYNFLTMGD  489

Query  387  PLGAYLFSGLLAGYLYDIEAAK-QHSDTCIGPNCFRVTFlvlaglcsagallsVVLTVRL  211
            P+G+ LFSG++AGYLYD+EA     +D CIG +CFR+TFL++AG+C  G+  SV ++VR+
Sbjct  490  PVGSLLFSGVIAGYLYDMEARDGPQADQCIGAHCFRLTFLIMAGVCLVGSAASVYVSVRI  549

Query  210  KPVYQMLYAGG  178
            KPVYQ LY  G
Sbjct  550  KPVYQSLYKSG  560



>gb|EEC83207.1| hypothetical protein OsI_28473 [Oryza sativa Indica Group]
Length=1155

 Score =   190 bits (482),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 97/160 (61%), Positives = 116/160 (73%), Gaps = 4/160 (3%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKAL-PRTIWMTFTQV  565
            VLNNLAQ+G+A G+ DTT+LLSLF+  NF GRLGGG +SE FVR   L PR IWM  TQ 
Sbjct  432  VLNNLAQIGVAAGIGDTTVLLSLFALGNFFGRLGGGAISEKFVRSTLLVPRPIWMALTQT  491

Query  564  VMIITYFLFASALNGTL-YVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGN  388
            V+++ Y   A  L   + Y  TA +G+CYGVQFS++IPTTSELFGLK+FGL  + M + N
Sbjct  492  VLVVAYLCLAYTLGPAVAYACTAAVGLCYGVQFSVMIPTTSELFGLKNFGLFYNLMSLAN  551

Query  387  PLGAYLFSGLLAGYLYDIEAAK-QHS-DTCIGPNCFRVTF  274
            PLGA LFSG LAG LYD EAA+ QHS   C+GP CFR  F
Sbjct  552  PLGAALFSGELAGRLYDEEAARQQHSGGACLGPGCFRAAF  591



>ref|XP_001758479.1| predicted protein [Physcomitrella patens]
 gb|EDQ76881.1| predicted protein [Physcomitrella patens]
Length=550

 Score =   182 bits (461),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 97/187 (52%), Positives = 139/187 (74%), Gaps = 3/187 (2%)
 Frame = -1

Query  738  LNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVVM  559
            +NNL Q+G AQG  D +I +SL S   F GR+G G VSE++V+  A+PR +WM  +Q+ +
Sbjct  347  INNLGQIGEAQGFADVSIFISLISIWGFFGRVGAGAVSEYYVKKAAIPRPLWMAISQIFL  406

Query  558  IITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPLG  379
            ++ Y +FA A  G+LYV + ++GICYGV  SI +PT SELFGLKHFG++ +F+ +  PLG
Sbjct  407  LMGYIMFAMAAPGSLYVGSIVVGICYGVHISITVPTASELFGLKHFGMLYNFLILNIPLG  466

Query  378  AYLFSGLLAGYLYDIEAAK-QHSDT--CIGPNCFRVTFlvlaglcsagallsVVLTVRLK  208
            ++LFSG+LAG+LYD EA+K  H  T  C+G +CFR  F+V+AG+C+ G LL+VVL +R++
Sbjct  467  SFLFSGMLAGWLYDREASKVPHLSTILCVGSHCFRSVFIVMAGMCAFGILLNVVLILRIR  526

Query  207  PVYQMLY  187
            P+YQ LY
Sbjct  527  PLYQDLY  533



>ref|XP_009766430.1| PREDICTED: uncharacterized protein LOC104217799 [Nicotiana sylvestris]
Length=543

 Score =   168 bits (426),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 88/188 (47%), Positives = 131/188 (70%), Gaps = 2/188 (1%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            V+NNL Q+G+A G  D +I +SL S   F GR+  G VSE+F++  A+PR IW   +Q+V
Sbjct  343  VMNNLGQMGLALGYTDVSIFVSLTSIWGFFGRILSGSVSEYFIKKAAMPRPIWNAASQIV  402

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            M + Y L A A+ G+LY+ + ++GICYGV+ ++ +PT SELFGLK++GLI + + +  PL
Sbjct  403  MAVGYILMAMAMPGSLYIGSIVVGICYGVRLAVTVPTASELFGLKYYGLIYNVLILNLPL  462

Query  381  GAYLFSGLLAGYLYDIEAAKQH--SDTCIGPNCFRVTFlvlaglcsagallsVVLTVRLK  208
            G++LFSGLLAG LYD EA K     +TC+G +C+R+ F+V++  C  G  L ++LT+R K
Sbjct  463  GSFLFSGLLAGLLYDAEATKTAGGGNTCVGAHCYRLVFIVMSIACIVGFGLDILLTIRTK  522

Query  207  PVYQMLYA  184
             +Y  +YA
Sbjct  523  NLYAKIYA  530



>ref|XP_007150777.1| hypothetical protein PHAVU_005G179700g, partial [Phaseolus vulgaris]
 gb|ESW22771.1| hypothetical protein PHAVU_005G179700g, partial [Phaseolus vulgaris]
Length=293

 Score =   163 bits (412),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 87/154 (56%), Positives = 107/154 (69%), Gaps = 21/154 (14%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            VLNNLAQ+G+A GV DTT+LLS+FSFCNF+GRL  G+VSE+FV +               
Sbjct  159  VLNNLAQIGVALGVEDTTMLLSVFSFCNFIGRLDAGVVSEYFVSI---------------  203

Query  561  MIITYFLFASALNGTLYVA-TALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNP  385
                   +A AL+G+LY A TALL ICYGVQ SI+ PT SE+FGLKHFG+I SFM +GNP
Sbjct  204  -----LFYAYALDGSLYAAATALLSICYGVQCSIMAPTVSEIFGLKHFGVISSFMMLGNP  258

Query  384  LGAYLFSGLLAGYLYDIEAAKQHSDTCIGPNCFR  283
            +GA +FS  LA  +YD EAAKQ + TC G + FR
Sbjct  259  IGALIFSVFLAANVYDTEAAKQGNSTCYGADFFR  292



>ref|XP_008349349.1| PREDICTED: uncharacterized protein LOC103412580 [Malus domestica]
Length=552

 Score =   168 bits (425),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 86/189 (46%), Positives = 132/189 (70%), Gaps = 2/189 (1%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            V+NN+ Q+G+A G  D +I +SL S   F GR+G G+VSE+F+R  A PR +W   +Q++
Sbjct  353  VMNNMGQIGLAMGYVDVSIFVSLTSIWGFFGRIGSGMVSENFIRKAATPRPLWNAASQIL  412

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            M + Y L A A+ G+LY+ + ++GICYG++ +I +PT SELFGLK++GLI + + +  PL
Sbjct  413  MAVGYILMAIAMPGSLYIGSIVVGICYGIRLAITVPTASELFGLKYYGLIYNILILNLPL  472

Query  381  GAYLFSGLLAGYLYDIEAAKQH--SDTCIGPNCFRVTFlvlaglcsagallsVVLTVRLK  208
            G++LFSGLLAG LYD+EA       +TC+G +C+R+ F+++A  C  G  L V+L++R K
Sbjct  473  GSFLFSGLLAGLLYDMEATTTEGGGNTCVGAHCYRLVFVIMAIACVIGFGLDVLLSIRTK  532

Query  207  PVYQMLYAG  181
             +Y  + AG
Sbjct  533  NLYTKIQAG  541



>dbj|BAH20083.1| AT4G34950 [Arabidopsis thaliana]
Length=312

 Score =   162 bits (410),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 85/200 (43%), Positives = 128/200 (64%), Gaps = 9/200 (5%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            V+NN+ Q+G+A G  D +I +S+ S   F GR+  G +SEHF++    PR +W    Q++
Sbjct  113  VMNNMGQIGLALGYTDVSIFVSMTSIWGFFGRILSGTISEHFIKKARTPRPLWNAAAQII  172

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            M + Y L A AL G+LY+ + ++G+CYGV+ +I +PT SELFGLK++GLI + + +  PL
Sbjct  173  MAVGYLLMALALPGSLYIGSMVVGVCYGVRLAITVPTASELFGLKYYGLIYNILILNMPL  232

Query  381  GAYLFSGLLAGYLYDIEAAKQH--SDTCIGPNCFRVTFlvlaglcsagallsVVLTVRLK  208
            G++LFSGLLAG LYD EA       +TC+G +CFR+ F+V+A     G  L ++L  R K
Sbjct  233  GSFLFSGLLAGLLYDAEATPTPGGGNTCVGAHCFRIVFIVMAFASIIGVGLDLLLAYRTK  292

Query  207  PVYQMLYA-------GGSFR  169
             +Y  ++A       GG+ R
Sbjct  293  GIYAKIHASKKTKKSGGNLR  312



>ref|XP_009349684.1| PREDICTED: uncharacterized protein LOC103941215 [Pyrus x bretschneideri]
Length=552

 Score =   167 bits (422),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 85/189 (45%), Positives = 132/189 (70%), Gaps = 2/189 (1%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            V+NN+ Q+G+A G  D +I ++L S   F GR+G G+VSE+F+R  A PR +W   +Q++
Sbjct  353  VMNNMGQIGLAMGYVDVSIFVALTSIWGFFGRIGSGMVSENFIRKAATPRPLWNAASQIL  412

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            M + Y L A A+ G+LY+ + ++GICYGV+ +I +PT SELFGLK++GLI + + +  PL
Sbjct  413  MAVGYILMAIAMPGSLYIGSIVVGICYGVRLAITVPTASELFGLKYYGLIYNILILNLPL  472

Query  381  GAYLFSGLLAGYLYDIEAAKQH--SDTCIGPNCFRVTFlvlaglcsagallsVVLTVRLK  208
            G++LFSGLLAG LYD+EA       +TC+G +C+R+ F+++A  C  G  L ++L++R K
Sbjct  473  GSFLFSGLLAGLLYDMEATTTEGGGNTCVGAHCYRLVFVIMAIACVIGFGLDILLSIRTK  532

Query  207  PVYQMLYAG  181
             +Y  + AG
Sbjct  533  NLYTKIQAG  541



>ref|XP_009622121.1| PREDICTED: probable transporter mch1 [Nicotiana tomentosiformis]
Length=543

 Score =   166 bits (421),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 86/188 (46%), Positives = 130/188 (69%), Gaps = 2/188 (1%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            V+NNL Q+G+A G  D +I +SL S   F GR+  G VSE+F++  A+PR IW   +Q+V
Sbjct  343  VMNNLGQMGLALGYTDVSIFVSLTSIWGFFGRILSGTVSEYFIKKAAMPRPIWNAASQIV  402

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            M + Y L A A+ G+LY+ + ++GICYGV+ ++ +PT SELFGLK++GLI + + +  PL
Sbjct  403  MAVGYILMAMAMPGSLYIGSIVVGICYGVRLAVTVPTASELFGLKYYGLIYNVLILNLPL  462

Query  381  GAYLFSGLLAGYLYDIEAAKQH--SDTCIGPNCFRVTFlvlaglcsagallsVVLTVRLK  208
            G++LFSGLLAG LYD +A K     +TC+G +C+R+ F+V++  C  G  L ++L +R K
Sbjct  463  GSFLFSGLLAGLLYDAQATKTAGGGNTCVGAHCYRLVFIVMSIACIVGFSLDILLAIRTK  522

Query  207  PVYQMLYA  184
             +Y  +YA
Sbjct  523  NLYAKIYA  530



>ref|XP_006367793.1| PREDICTED: uncharacterized protein LOC102602269 [Solanum tuberosum]
Length=541

 Score =   166 bits (421),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 88/188 (47%), Positives = 132/188 (70%), Gaps = 2/188 (1%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            V+NNL Q+G+A G  D +IL+S  S   F GR+  G VSE+F++  A+PR +W   +Q++
Sbjct  343  VMNNLGQMGLAMGYVDVSILVSFTSIWGFFGRILSGSVSEYFIKKAAIPRPVWNAASQIL  402

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            M I Y L A A+ G+LY+ + ++GICYGV+ ++ +PT SELFGLK++GLI + + +  PL
Sbjct  403  MAIGYILMAMAMPGSLYIGSIVVGICYGVRLAVTVPTASELFGLKYYGLIYNVLILNLPL  462

Query  381  GAYLFSGLLAGYLYDIEAAKQHS--DTCIGPNCFRVTFlvlaglcsagallsVVLTVRLK  208
            G++LFSGLLAG LYD +A K  S  +TCIG +C+R+ F+V+A  C  G  L V+L++R +
Sbjct  463  GSFLFSGLLAGLLYDAQATKTASGGNTCIGAHCYRLVFIVMAIACVVGFGLDVLLSIRTR  522

Query  207  PVYQMLYA  184
             +Y  +YA
Sbjct  523  SLYSKIYA  530



>gb|KHN33680.1| hypothetical protein glysoja_013686 [Glycine soja]
Length=344

 Score =   162 bits (411),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 84/183 (46%), Positives = 127/183 (69%), Gaps = 2/183 (1%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            V+NN+ Q+G+A G +D ++ +SL S   F GR+  G VSEHF++  A PR +W   +Q++
Sbjct  143  VMNNMGQIGLALGYSDVSLFVSLTSIWGFFGRIVSGSVSEHFIKKAATPRPLWNAASQIL  202

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            M + Y L A A+ G+LY+ + ++GICYGV+ +I +PT SELFGLK++GLI + + +  PL
Sbjct  203  MAVGYILLAMAMPGSLYIGSVVVGICYGVRLAITVPTASELFGLKYYGLIYNILILNLPL  262

Query  381  GAYLFSGLLAGYLYDIEAAKQ--HSDTCIGPNCFRVTFlvlaglcsagallsVVLTVRLK  208
            G++LFSGLLAG LYD+EA       +TCIG +C+R+ F+++A  C  G  L ++L+ R K
Sbjct  263  GSFLFSGLLAGILYDMEATTTVGGGNTCIGAHCYRLVFIIMAVACVVGFFLDILLSFRTK  322

Query  207  PVY  199
             VY
Sbjct  323  KVY  325



>ref|XP_008346339.1| PREDICTED: uncharacterized protein LOC103409309 [Malus domestica]
Length=616

 Score =   166 bits (420),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 83/189 (44%), Positives = 132/189 (70%), Gaps = 2/189 (1%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            V+NN+ Q+G+A G  D +I +SL S   F GR+G G++SE+F+R  A+PR +W   +Q++
Sbjct  417  VMNNMGQIGLALGYVDVSIFVSLTSIWGFFGRIGSGMISEYFIRKAAIPRPLWNAASQIL  476

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            M + Y L A A+ G+LY+ + ++GICYGV+ ++ +P  SELFGLK++GLI + + +  PL
Sbjct  477  MAVGYILMAIAMPGSLYIGSTIVGICYGVRLAVTVPVASELFGLKYYGLIYNILILNLPL  536

Query  381  GAYLFSGLLAGYLYDIEAAKQH--SDTCIGPNCFRVTFlvlaglcsagallsVVLTVRLK  208
            G++LFSGLLAG LYD+EA       +TC+G +C+R+ F+++A  C  G  L ++L++R K
Sbjct  537  GSFLFSGLLAGLLYDMEATTTEGGGNTCVGAHCYRLVFVIMAIACVIGFGLDILLSIRTK  596

Query  207  PVYQMLYAG  181
             +Y  + AG
Sbjct  597  NLYTRIQAG  605



>ref|XP_004248658.1| PREDICTED: probable transporter mch1 [Solanum lycopersicum]
Length=533

 Score =   165 bits (418),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 87/188 (46%), Positives = 131/188 (70%), Gaps = 2/188 (1%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            V+NNL Q+G+A G  D +I +S  S   F GR+  G VSE+F++  A+PR +W   +Q++
Sbjct  335  VMNNLGQMGLAMGYVDVSIFVSFTSIWGFFGRIFSGSVSEYFIKKAAIPRPVWNAASQIL  394

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            M + Y L A A+ G+LY+ + ++GICYGV+ ++ +PT SELFGLK++GLI S + +  PL
Sbjct  395  MAVGYILMAMAIPGSLYIGSIVVGICYGVRLAVTVPTASELFGLKYYGLIYSVLILNLPL  454

Query  381  GAYLFSGLLAGYLYDIEAAKQHS--DTCIGPNCFRVTFlvlaglcsagallsVVLTVRLK  208
            G++LFSGLLAG LYD +A K  S  +TCIG +C+R+ F+V+A  C  G  L V+L++R +
Sbjct  455  GSFLFSGLLAGLLYDAQATKTASGGNTCIGAHCYRLVFIVMAIACIVGFGLDVLLSIRTR  514

Query  207  PVYQMLYA  184
             +Y  +YA
Sbjct  515  SLYSKIYA  522



>gb|ABR18255.1| unknown [Picea sitchensis]
Length=626

 Score =   166 bits (419),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 90/216 (42%), Positives = 136/216 (63%), Gaps = 21/216 (10%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            V+NN+ Q+G+A G  D ++ +SL S   F GR+G G +SEHF+R   +PR +WM  +Q+ 
Sbjct  405  VINNMGQIGLAMGFVDVSMFVSLISIWGFFGRIGAGSISEHFIRKAGVPRPVWMAASQLF  464

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            MI+ Y   A  + G+LY+ + ++G+CYGV+ SI +PT SELFGLK++G+I +F+ +  P+
Sbjct  465  MIVGYIFMAIGMPGSLYLGSIVVGVCYGVRLSISVPTASELFGLKYYGMIYNFLILNLPI  524

Query  381  GAYLFSGLLAGYLYDIEAAKQH---------------------SDTCIGPNCFRVTFlvl  265
            G++LFSGLLAG LYDIEAAK H                     S+ C+G +C+R+ FLV+
Sbjct  525  GSFLFSGLLAGILYDIEAAKSHKVNARPYPVLLSGIYPSELEDSNNCVGAHCYRLVFLVM  584

Query  264  aglcsagallsVVLTVRLKPVYQMLYAGGSFRLPQS  157
            AG+C  G  L V+L+ R + +Y  ++     R  Q 
Sbjct  585  AGVCLLGFGLDVLLSFRTRNLYSNIHRSRKARESQK  620



>ref|XP_002462740.1| hypothetical protein SORBIDRAFT_02g031140 [Sorghum bicolor]
 gb|EER99261.1| hypothetical protein SORBIDRAFT_02g031140 [Sorghum bicolor]
Length=556

 Score =   164 bits (416),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 87/198 (44%), Positives = 135/198 (68%), Gaps = 4/198 (2%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            V+NNL Q+G+A G  D ++ +S+ S   F GR+  G +SEHF++ +A+PR +W   +QV+
Sbjct  355  VMNNLGQMGVAMGYVDVSLFVSMTSIWGFFGRIASGTISEHFIKTRAIPRPLWNAASQVL  414

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            M + Y + A A+ G+L++ + ++GICYGV+ ++ +PT SELFGLK++GLI + + +  PL
Sbjct  415  MAVGYIVMALAMPGSLFIGSVVVGICYGVRLAVTVPTASELFGLKYYGLIYNILILNLPL  474

Query  381  GAYLFSGLLAGYLYDIEAAK--QHSDTCIGPNCFRVTFlvlaglcsagallsVVLTVRLK  208
            G++LFSGLLAG LYD EA       +TC+G +C+R+ FL++A  C  G  L V+L VR K
Sbjct  475  GSFLFSGLLAGLLYDAEATAVPGGGNTCVGAHCYRLVFLIMALACVVGFGLDVLLCVRTK  534

Query  207  PVYQMLYAGGSFRLPQSS  154
             VY  ++   S RL +S+
Sbjct  535  RVYAKIHE--SKRLSRSA  550



>ref|XP_010266799.1| PREDICTED: probable transporter mch1 [Nelumbo nucifera]
Length=549

 Score =   164 bits (415),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 89/195 (46%), Positives = 129/195 (66%), Gaps = 2/195 (1%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            V+NN+ Q+G+A G  D +I +SL S   F GR+  G  SE+F++  A PR +W   +Q+V
Sbjct  346  VMNNMGQMGLALGYADVSIFVSLISIWGFFGRIISGTASEYFIKKAATPRPLWNAVSQIV  405

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            M + Y L A AL G+LY+ + ++G+CYGV+ +I + T SELFGLK++GLI + + +  PL
Sbjct  406  MAVGYVLLALALPGSLYIGSIIVGLCYGVRLAITVATASELFGLKYYGLIYNILILNLPL  465

Query  381  GAYLFSGLLAGYLYDIEAAK--QHSDTCIGPNCFRVTFlvlaglcsagallsVVLTVRLK  208
            G++LFSGLLAG+LYD EA    +  +TCIG +C+R+ F+V+A  C  G  L VVL  R K
Sbjct  466  GSFLFSGLLAGFLYDAEATSIAEGGNTCIGAHCYRLVFVVMALACVLGFGLDVVLAFRTK  525

Query  207  PVYQMLYAGGSFRLP  163
             VY  +YA    + P
Sbjct  526  NVYSKIYASKKSKKP  540



>ref|XP_010526802.1| PREDICTED: uncharacterized protein LOC104804268 [Tarenaya hassleriana]
Length=527

 Score =   164 bits (414),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 74/158 (47%), Positives = 113/158 (72%), Gaps = 2/158 (1%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            V+NN+AQ+ +AQG  D ++ +SL S   F GR+  G++SEH++R +  PR +W   +QV+
Sbjct  329  VMNNMAQMSLAQGFTDASVFISLISIWGFFGRIASGLMSEHYMRRRGTPRPVWNAVSQVL  388

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            M I Y + A A+ G+LY+ + L+GICYG + +I +P  SELFGLK++G++ + + +  PL
Sbjct  389  MTIGYAVMAFAIPGSLYIGSILVGICYGFRLTITVPVASELFGLKYYGMLYNILILNLPL  448

Query  381  GAYLFSGLLAGYLYDIEAAKQHS--DTCIGPNCFRVTF  274
            G++LFSGLLAGYLYD EA K  S  +TC+G +C+R+ F
Sbjct  449  GSFLFSGLLAGYLYDAEARKAGSGGNTCVGAHCYRLVF  486



>ref|XP_011092895.1| PREDICTED: probable transporter mch1 [Sesamum indicum]
Length=541

 Score =   164 bits (414),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 87/199 (44%), Positives = 132/199 (66%), Gaps = 2/199 (1%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            V+NNL Q+G+A G  D +I +SL S   F GR+  G  SE+F++    PR IW   +Q++
Sbjct  341  VMNNLGQMGLALGYADVSIFVSLTSIWGFFGRILSGSASEYFIKRAGTPRPIWNAASQIL  400

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            M + Y L A A+ G+LY+ + ++GICYGV+ ++ +PT SELFGLK++GLI + + +  PL
Sbjct  401  MAVGYILLAMAMPGSLYIGSIVVGICYGVRLAVTVPTASELFGLKYYGLIYNILILNLPL  460

Query  381  GAYLFSGLLAGYLYDIEAAKQH--SDTCIGPNCFRVTFlvlaglcsagallsVVLTVRLK  208
            G++LFSGLLAG+LYD +A +     +TCIG +C+R+ F+V+A  C  G  L V+L++R K
Sbjct  461  GSFLFSGLLAGFLYDAQATRTAGGGNTCIGAHCYRLVFMVMAIACVIGFGLDVLLSIRTK  520

Query  207  PVYQMLYAGGSFRLPQSSN  151
             +Y  +YA    +    SN
Sbjct  521  SIYGKIYASRKAKKSSVSN  539



>gb|AGT17215.1| Major facilitator superfamily domain, general substrate transporter 
[Saccharum hybrid cultivar R570]
Length=551

 Score =   164 bits (414),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 86/198 (43%), Positives = 135/198 (68%), Gaps = 4/198 (2%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            V+NNL Q+G+A G  D ++ +S+ S   F GR+  G +SEHF++ +A+PR +W   +Q++
Sbjct  350  VMNNLGQMGVAMGYVDVSLFVSMTSIWGFFGRIASGTISEHFIKTRAIPRPLWNAASQIL  409

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            M + Y + A A+ G+L++ + ++GICYGV+ ++ +PT SELFGLK++GLI + + +  PL
Sbjct  410  MAVGYIVMALAMPGSLFIGSVVVGICYGVRLAVTVPTASELFGLKYYGLIYNILILNLPL  469

Query  381  GAYLFSGLLAGYLYDIEAAK--QHSDTCIGPNCFRVTFlvlaglcsagallsVVLTVRLK  208
            G++LFSGLLAG LYD EA       +TC+G +C+R+ FL++A  C  G  L V+L VR K
Sbjct  470  GSFLFSGLLAGLLYDAEATAVPGGGNTCVGAHCYRLVFLIMALACVVGFGLDVLLCVRTK  529

Query  207  PVYQMLYAGGSFRLPQSS  154
             VY  ++   S RL +S+
Sbjct  530  RVYAKIHE--SKRLSRSA  545



>gb|KFK30131.1| hypothetical protein AALP_AA7G221100 [Arabis alpina]
Length=564

 Score =   164 bits (414),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 84/200 (42%), Positives = 131/200 (66%), Gaps = 4/200 (2%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            V+NN+ Q+G+A G  D +I +S+ S   F GR+  G +SEHF++    PR +W   +Q++
Sbjct  365  VMNNMGQIGLALGYTDVSIFVSMMSIWGFFGRILSGTISEHFIKKSGTPRPLWNAASQII  424

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            M + Y L A A+ G+LY+ + ++G+CYGV+ +I +PT SELFGLK++GLI + + +  PL
Sbjct  425  MAVGYLLMALAMPGSLYIGSVVVGVCYGVRLAITVPTASELFGLKYYGLIYNILVLNLPL  484

Query  381  GAYLFSGLLAGYLYDIEAAKQH--SDTCIGPNCFRVTFlvlaglcsagallsVVLTVRLK  208
            G++LFSGLLAG LYD EA       +TC+G +C+R+ F+V+A     G  L +VL  R K
Sbjct  485  GSFLFSGLLAGLLYDAEATPTPGGGNTCVGAHCYRLVFIVMACTSIVGVGLDIVLAYRTK  544

Query  207  PVYQMLYAGGSFRLPQSSNH  148
             +Y  ++A  S +  +SS +
Sbjct  545  EIYAKIHA--SKKAKKSSGN  562



>ref|XP_006412170.1| hypothetical protein EUTSA_v10024800mg [Eutrema salsugineum]
 gb|ESQ53623.1| hypothetical protein EUTSA_v10024800mg [Eutrema salsugineum]
Length=450

 Score =   162 bits (409),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 80/188 (43%), Positives = 125/188 (66%), Gaps = 2/188 (1%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            V+NN+ Q+G+A G  D +I +S+ S   F GR+  G +SEHF++    PR +W   +Q++
Sbjct  251  VMNNMGQIGLALGYTDVSIFVSMMSIWGFFGRILSGTISEHFIKKSGTPRPLWNAASQII  310

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            M + Y L A A+ G+LY+ + ++G+CYGV+ +I +PT SELFGLK++GLI + + +  PL
Sbjct  311  MAVGYLLMALAMPGSLYIGSMVVGVCYGVRLAITVPTASELFGLKYYGLIYNILVLNLPL  370

Query  381  GAYLFSGLLAGYLYDIEAAKQH--SDTCIGPNCFRVTFlvlaglcsagallsVVLTVRLK  208
            G++LFSGLLAG LYD EA       +TC+G +C+R+ F+V+A     G  L ++L  R K
Sbjct  371  GSFLFSGLLAGLLYDAEATPTPGGGNTCVGAHCYRLIFIVMAFTSIIGVTLDILLAFRTK  430

Query  207  PVYQMLYA  184
             +Y  ++A
Sbjct  431  EIYAKIHA  438



>emb|CDO96930.1| unnamed protein product [Coffea canephora]
Length=198

 Score =   155 bits (393),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 83/187 (44%), Positives = 124/187 (66%), Gaps = 2/187 (1%)
 Frame = -1

Query  738  LNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVVM  559
            +NN+ Q+G+A G  D +I +SL S   F GR+  G VSEHF+R    PR IW   +Q++M
Sbjct  1    MNNMGQMGLALGYVDVSIFVSLTSIWGFFGRILSGWVSEHFIRKAGTPRPIWNAASQILM  60

Query  558  IITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPLG  379
             + Y   A A  G+LY+ + ++GICYGV+ ++ +PT SELFGLK++GLI + + +  PLG
Sbjct  61   AVGYVFMAMAFPGSLYIGSVVVGICYGVRLAVTVPTASELFGLKYYGLIYNILILNLPLG  120

Query  378  AYLFSGLLAGYLYDIEAAKQH--SDTCIGPNCFRVTFlvlaglcsagallsVVLTVRLKP  205
            ++LFSGLLAG LYD +A       +TCIG +C+R+ F+V+A  C  G  L V+L ++ K 
Sbjct  121  SFLFSGLLAGLLYDSQATPTAGGGNTCIGAHCYRLVFVVMAIACVVGFGLDVLLAIKTKA  180

Query  204  VYQMLYA  184
            +Y  ++A
Sbjct  181  LYTKIHA  187



>ref|XP_010436257.1| PREDICTED: uncharacterized protein LOC104719977, partial [Camelina 
sativa]
Length=396

 Score =   160 bits (406),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 84/200 (42%), Positives = 129/200 (65%), Gaps = 4/200 (2%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            V+NN+ Q+G+A G  D +  +S+ S   F GR+  G +SEHF++    PR +W    Q++
Sbjct  197  VMNNMGQIGLALGYTDVSKFVSMISIWGFFGRILSGTISEHFIKKAGTPRPLWNAAAQII  256

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            M + Y L A A+ G+LY+ + ++G+CYGV+ +I +PT SELFGLK++GLI + + +  PL
Sbjct  257  MAVGYLLMALAMPGSLYIGSMVVGVCYGVRLAITVPTASELFGLKYYGLIYNILILNMPL  316

Query  381  GAYLFSGLLAGYLYDIEAAKQH--SDTCIGPNCFRVTFlvlaglcsagallsVVLTVRLK  208
            G++LFSGLLAG LYD EA       +TC+G +CFR+ FLV+A     G  L ++L  R K
Sbjct  317  GSFLFSGLLAGLLYDAEATPTPGGGNTCVGAHCFRMVFLVMAFASIIGIGLDLLLAYRTK  376

Query  207  PVYQMLYAGGSFRLPQSSNH  148
             +Y  ++A  S +  +SS +
Sbjct  377  EIYAKIHA--SKKAKKSSGN  394



>ref|XP_011001982.1| PREDICTED: probable transporter mch1 [Populus euphratica]
Length=564

 Score =   163 bits (412),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 88/200 (44%), Positives = 136/200 (68%), Gaps = 3/200 (2%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            V+NN+ Q+G+A G  D ++ +SL S   F GR+  G VSE++++   +PR +W   +Q++
Sbjct  363  VMNNMGQIGLALGYADVSLFISLTSIWGFFGRIVSGSVSEYYIKKAGIPRPLWNAASQIL  422

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            M + Y L A AL G+LYV + ++GICYGV+ ++ +PT SELFGLK+FGLI + + +  PL
Sbjct  423  MAVGYILMAVALPGSLYVGSIVVGICYGVRLAVSVPTASELFGLKYFGLIYNILILNLPL  482

Query  381  GAYLFSGLLAGYLYDIEA--AKQHSDTCIGPNCFRVTFlvlaglcsagallsVVLTVRLK  208
            G++LFSGLLAG+LYD EA  A    +TC+G +C+R+ F+++A  C  G  L V+L +R K
Sbjct  483  GSFLFSGLLAGFLYDAEATPAPGGGNTCVGAHCYRLVFIIMAIACVIGFGLDVLLGIRTK  542

Query  207  PVYQMLY-AGGSFRLPQSSN  151
             +Y  +Y +  S +L  +SN
Sbjct  543  KIYNRIYMSRRSKKLAAASN  562



>ref|XP_006283706.1| hypothetical protein CARUB_v10004777mg [Capsella rubella]
 gb|EOA16604.1| hypothetical protein CARUB_v10004777mg [Capsella rubella]
Length=454

 Score =   161 bits (408),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 84/200 (42%), Positives = 130/200 (65%), Gaps = 4/200 (2%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            V+NN+ Q+G+A G  D ++ +S+ S   F GR+  G +SEHF++    PR +W    Q++
Sbjct  255  VMNNMGQIGLALGYTDVSMFVSMMSIWGFFGRILSGTISEHFIKKAGTPRPLWNAAAQII  314

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            M + Y L A A+ G+LY+ + ++G+CYGV+ +I +PT SELFGLK++GLI + + +  PL
Sbjct  315  MAVGYLLMALAMPGSLYIGSMVVGVCYGVRLAITVPTASELFGLKYYGLIYNILILNMPL  374

Query  381  GAYLFSGLLAGYLYDIEAAKQH--SDTCIGPNCFRVTFlvlaglcsagallsVVLTVRLK  208
            G++LFSGLLAG LYD EA       +TC+G +CFR+ FLV+A     G  L ++L  R K
Sbjct  375  GSFLFSGLLAGLLYDAEATPTPGGGNTCVGAHCFRLVFLVMAFASFIGIGLDLLLAFRTK  434

Query  207  PVYQMLYAGGSFRLPQSSNH  148
             +Y  ++A  S +  +SS +
Sbjct  435  EIYAKIHA--SKKTKKSSGN  452



>ref|XP_002306177.1| nodulin family protein [Populus trichocarpa]
 gb|EEE86688.1| nodulin family protein [Populus trichocarpa]
Length=564

 Score =   163 bits (412),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 87/200 (44%), Positives = 136/200 (68%), Gaps = 3/200 (2%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            V+NN+ Q+G+A G  D ++ +S+ S   F GR+  G VSE++++   +PR +W   +Q++
Sbjct  363  VMNNMGQIGLALGYADVSLFISMTSIWGFFGRIVSGSVSEYYIKKAGIPRPLWNAASQIL  422

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            M + Y L A AL G+LYV + ++GICYGV+ ++ +PT SELFGLK+FGLI + + +  PL
Sbjct  423  MAVGYILMAVALPGSLYVGSIVVGICYGVRLAVTVPTASELFGLKYFGLIYNILILNLPL  482

Query  381  GAYLFSGLLAGYLYDIEA--AKQHSDTCIGPNCFRVTFlvlaglcsagallsVVLTVRLK  208
            G++LFSGLLAG+LYD EA  A    +TC+G +C+R+ F+++A  C  G  L V+L +R K
Sbjct  483  GSFLFSGLLAGFLYDAEATPAPGGGNTCVGAHCYRLVFIIMAIACVIGFGLDVLLGIRTK  542

Query  207  PVYQMLY-AGGSFRLPQSSN  151
             +Y  +Y +  S +L  +SN
Sbjct  543  KIYNRIYMSRRSKKLAAASN  562



>ref|XP_010028707.1| PREDICTED: uncharacterized protein LOC104418927 [Eucalyptus grandis]
 gb|KCW55502.1| hypothetical protein EUGRSUZ_I01397 [Eucalyptus grandis]
Length=566

 Score =   163 bits (412),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 84/193 (44%), Positives = 129/193 (67%), Gaps = 2/193 (1%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            V+NN+ Q+G+A G  D ++ +SL S   F GR+G G +SE+F++    PR +W   +Q++
Sbjct  367  VMNNMGQMGLALGYADVSMFVSLTSIWGFFGRIGSGSLSEYFLKKAGTPRPLWNAASQIL  426

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            M + Y + A AL G+LY+ + ++G+CYGV+ ++ +PT SELFGLK++GLI + + +  PL
Sbjct  427  MAVGYVILAMALPGSLYIGSIVVGVCYGVRLAVTVPTASELFGLKYYGLIYNVLILNLPL  486

Query  381  GAYLFSGLLAGYLYDIEAAKQH--SDTCIGPNCFRVTFlvlaglcsagallsVVLTVRLK  208
            G++LFSGLLAG LYD +A       +TC+GP+C+R+ F+V+A  C  G    V+L VR K
Sbjct  487  GSFLFSGLLAGLLYDAQATSTAGGGNTCVGPHCYRLVFVVMAIACVVGFGFDVLLAVRTK  546

Query  207  PVYQMLYAGGSFR  169
             VY  +YA    R
Sbjct  547  KVYAKIYASKKSR  559



>ref|XP_008235996.1| PREDICTED: uncharacterized protein LOC103334808 [Prunus mume]
Length=553

 Score =   162 bits (411),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 82/189 (43%), Positives = 132/189 (70%), Gaps = 2/189 (1%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            V+NN+ Q+G+A G  D +I +SL S   F GR+  G+VSE+F+R    PR +W   +Q++
Sbjct  355  VMNNMGQIGLALGYVDVSIFVSLTSIWGFFGRIVSGMVSEYFIRKAGTPRPLWNAASQII  414

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            M + Y L A A+ G+LY+ + ++GICYG++ +I +PT SELFGLK++GLI + + +  PL
Sbjct  415  MAVGYILMAIAMPGSLYIGSIVVGICYGIRLAITVPTASELFGLKYYGLIYNILILNLPL  474

Query  381  GAYLFSGLLAGYLYDIEA--AKQHSDTCIGPNCFRVTFlvlaglcsagallsVVLTVRLK  208
            G++LFSGLLAG LYD++A    +  +TC+G +C+R+ F+++A  C  G  L ++L++R K
Sbjct  475  GSFLFSGLLAGILYDMQATTTSEGGNTCVGAHCYRLVFIIMAIACVIGFGLDILLSIRTK  534

Query  207  PVYQMLYAG  181
             +Y+ + AG
Sbjct  535  NLYKKIQAG  543



>ref|XP_004957481.1| PREDICTED: uncharacterized protein LOC101778324 [Setaria italica]
Length=557

 Score =   162 bits (411),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 84/198 (42%), Positives = 135/198 (68%), Gaps = 4/198 (2%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            V+NNL Q+G+A G  D +I +S+ S   F GR+  G +SEHF++ +A+PR +W   +QV+
Sbjct  356  VMNNLGQMGVAMGYADVSIFVSMTSIWGFFGRIASGTISEHFIKTRAIPRPLWNAASQVL  415

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            M + Y + A A+ G+L++ + ++G CYGV+ ++ +PT SELFGLK++GLI + + +  PL
Sbjct  416  MAVGYIVMALAIPGSLFIGSVVVGACYGVRLAVTVPTASELFGLKYYGLIYNILILNLPL  475

Query  381  GAYLFSGLLAGYLYDIEAA--KQHSDTCIGPNCFRVTFlvlaglcsagallsVVLTVRLK  208
            G++LFSG+LAG LYD EA       +TC+G +C+R+ FL++A  C+ G  + V+L+VR K
Sbjct  476  GSFLFSGMLAGLLYDAEATPVPGGGNTCVGAHCYRLVFLIMAVACAVGFGIDVLLSVRTK  535

Query  207  PVYQMLYAGGSFRLPQSS  154
             VY  ++   S R  +S+
Sbjct  536  RVYAKIHE--SKRASRSA  551



>ref|XP_009340231.1| PREDICTED: uncharacterized protein LOC103932378 [Pyrus x bretschneideri]
 ref|XP_009340232.1| PREDICTED: uncharacterized protein LOC103932378 [Pyrus x bretschneideri]
Length=528

 Score =   162 bits (410),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 78/183 (43%), Positives = 130/183 (71%), Gaps = 2/183 (1%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            V+NN+ Q+G+A G  D +I +SL S   F GR+G G++SE+F+R  A+PR++W   +Q++
Sbjct  345  VMNNMGQIGLALGYVDVSIFVSLMSIWGFFGRIGSGMISEYFIRKAAIPRSLWNAASQIL  404

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            M + Y L A A+ G+LY+ + ++GICYG++ ++ +P  SE+FGLK++G+I + + +  PL
Sbjct  405  MAVGYILMAIAMPGSLYIGSIVVGICYGIRLAVTVPAASEIFGLKYYGIIYNILILNLPL  464

Query  381  GAYLFSGLLAGYLYDIEAAKQH--SDTCIGPNCFRVTFlvlaglcsagallsVVLTVRLK  208
            G++LFSGLLAG LYD+EA       +TC+G +C+R+ F+++A  C  G  L ++L++R K
Sbjct  465  GSFLFSGLLAGLLYDMEATTTEGGGNTCVGAHCYRLVFVIMAIACVIGFGLDILLSIRTK  524

Query  207  PVY  199
             +Y
Sbjct  525  NLY  527



>ref|NP_195221.1| major facilitator family protein [Arabidopsis thaliana]
 emb|CAB45456.1| putative protein [Arabidopsis thaliana]
 emb|CAB80212.1| putative protein [Arabidopsis thaliana]
 gb|AEE86440.1| major facilitator family protein [Arabidopsis thaliana]
Length=567

 Score =   162 bits (411),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 85/200 (43%), Positives = 128/200 (64%), Gaps = 9/200 (5%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            V+NN+ Q+G+A G  D +I +S+ S   F GR+  G +SEHF++    PR +W    Q++
Sbjct  368  VMNNMGQIGLALGYTDVSIFVSMTSIWGFFGRILSGTISEHFIKKAGTPRPLWNAAAQII  427

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            M + Y L A AL G+LY+ + ++G+CYGV+ +I +PT SELFGLK++GLI + + +  PL
Sbjct  428  MAVGYLLMALALPGSLYIGSMVVGVCYGVRLAITVPTASELFGLKYYGLIYNILILNMPL  487

Query  381  GAYLFSGLLAGYLYDIEAAKQH--SDTCIGPNCFRVTFlvlaglcsagallsVVLTVRLK  208
            G++LFSGLLAG LYD EA       +TC+G +CFR+ F+V+A     G  L ++L  R K
Sbjct  488  GSFLFSGLLAGLLYDAEATPTPGGGNTCVGAHCFRIVFIVMAFASIIGVGLDLLLAYRTK  547

Query  207  PVYQMLYA-------GGSFR  169
             +Y  ++A       GG+ R
Sbjct  548  GIYAKIHASKKTKKSGGNLR  567



>ref|XP_003522712.1| PREDICTED: uncharacterized protein LOC100813607 [Glycine max]
Length=544

 Score =   162 bits (410),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 84/183 (46%), Positives = 127/183 (69%), Gaps = 2/183 (1%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            V+NN+ Q+G+A G +D ++ +SL S   F GR+  G VSEHF++  A PR +W   +Q++
Sbjct  343  VMNNMGQIGLALGYSDVSLFVSLTSIWGFFGRIVSGSVSEHFIKKAATPRPLWNAASQIL  402

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            M + Y L A A+ G+LY+ + ++GICYGV+ +I +PT SELFGLK++GLI + + +  PL
Sbjct  403  MAVGYILLAMAMPGSLYIGSVVVGICYGVRLAITVPTASELFGLKYYGLIYNILILNLPL  462

Query  381  GAYLFSGLLAGYLYDIEAAKQ--HSDTCIGPNCFRVTFlvlaglcsagallsVVLTVRLK  208
            G++LFSGLLAG LYD+EA       +TCIG +C+R+ F+++A  C  G  L ++L+ R K
Sbjct  463  GSFLFSGLLAGILYDMEATTTVGGGNTCIGAHCYRLVFIIMAVACVVGFFLDILLSFRTK  522

Query  207  PVY  199
             VY
Sbjct  523  KVY  525



>ref|XP_008457674.1| PREDICTED: uncharacterized protein LOC103497317 [Cucumis melo]
Length=543

 Score =   162 bits (410),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 86/200 (43%), Positives = 131/200 (66%), Gaps = 2/200 (1%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            V+NN+ Q+G+A G  D ++ +SL S   F GR+  G +SEHF++    PR +W   +Q++
Sbjct  341  VMNNMGQIGLALGYADVSMFVSLTSIWGFFGRILSGTLSEHFLKKAGTPRPLWNAASQIL  400

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            M + Y L A A+ G+LY+ + ++GICYGV+ SI +PT SELFGLK++GLI + + +  P+
Sbjct  401  MTVGYVLMAMAMPGSLYIGSVIVGICYGVRLSITVPTASELFGLKYYGLIYNILILNLPI  460

Query  381  GAYLFSGLLAGYLYDIEAAKQH--SDTCIGPNCFRVTFlvlaglcsagallsVVLTVRLK  208
            G++LFSGLLAG+LYD+EA       +TCIG +C+R+ FLV+A  C  G +L + L  R K
Sbjct  461  GSFLFSGLLAGFLYDMEATPTEGGGNTCIGGHCYRIVFLVMALACVIGFVLDIWLAFRTK  520

Query  207  PVYQMLYAGGSFRLPQSSNH  148
             +Y  L A       + +N+
Sbjct  521  ELYSKLKAANKRSTKKVNNN  540



>ref|XP_006660896.1| PREDICTED: uncharacterized protein LOC102701295 [Oryza brachyantha]
Length=553

 Score =   162 bits (409),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 80/187 (43%), Positives = 130/187 (70%), Gaps = 2/187 (1%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            V+NNL Q+G+A G +D ++ +S+ S   F GR+  G +SEHF++ +A+PR +W   +Q++
Sbjct  352  VMNNLGQMGVAMGYSDVSLFVSMTSIWGFFGRIASGTISEHFIKTRAIPRPLWNAASQIL  411

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            M + Y + A  + G+L++ + ++GICYGV+ ++ +PT SELFGLK++GLI + + +  PL
Sbjct  412  MAVGYIVMAFGMPGSLFIGSVVVGICYGVRLAVTVPTASELFGLKYYGLIYNILILNLPL  471

Query  381  GAYLFSGLLAGYLYDIEAAK--QHSDTCIGPNCFRVTFlvlaglcsagallsVVLTVRLK  208
            G++LFSGLLAG LYD +A K     +TC+G +C+R+ F+V+A  C  G  L V+L +R K
Sbjct  472  GSFLFSGLLAGLLYDAQATKVPGGGNTCVGAHCYRLVFVVMAIACVVGFGLDVLLCIRTK  531

Query  207  PVYQMLY  187
             VY  ++
Sbjct  532  RVYAKIH  538



>gb|KDP29628.1| hypothetical protein JCGZ_18790 [Jatropha curcas]
Length=564

 Score =   162 bits (410),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 86/200 (43%), Positives = 132/200 (66%), Gaps = 2/200 (1%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            V+NN+ Q+G+A G  D +I +SL S   F GR+  G VSE+F++    PR +W   +Q+V
Sbjct  360  VINNMGQIGLALGYADVSIFVSLTSIWGFFGRIASGTVSEYFIKKNGTPRPLWNAASQIV  419

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            M + Y L A AL G+LY+ + ++GICYGV+ ++ +PT SELFGLK++GLI + + +  PL
Sbjct  420  MAVGYILMAIALPGSLYIGSIVVGICYGVRLAVTVPTASELFGLKYYGLIYNILILNLPL  479

Query  381  GAYLFSGLLAGYLYDIEAAKQH--SDTCIGPNCFRVTFlvlaglcsagallsVVLTVRLK  208
            G++LFSGLLAG+LYD EA       +TC+G +C+R+ FL++A  C  G  L V+L +R K
Sbjct  480  GSFLFSGLLAGFLYDAEATPTAGGGNTCVGAHCYRLVFLIMAIACGVGLGLDVLLAIRTK  539

Query  207  PVYQMLYAGGSFRLPQSSNH  148
             VY  +++    +   ++ H
Sbjct  540  NVYYKIHSSKRSKKLAAAVH  559



>dbj|BAJ93070.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=555

 Score =   162 bits (409),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 83/187 (44%), Positives = 128/187 (68%), Gaps = 2/187 (1%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            V+NNL Q+G+A G  D ++ +S+ S   F GR+  G +SEHF++ +ALPR +W   +QV+
Sbjct  353  VMNNLGQMGVAMGYADVSLFVSMTSIWGFFGRIASGTISEHFIKTRALPRPVWNAASQVL  412

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            M   Y L A  + G+L+V + ++G+CYGV+ ++ +PT SELFGLK++GLI + + +  PL
Sbjct  413  MCAGYVLMAFGMPGSLFVGSVVVGVCYGVRLAVTVPTASELFGLKYYGLIYNILILNLPL  472

Query  381  GAYLFSGLLAGYLYDIEAAK--QHSDTCIGPNCFRVTFlvlaglcsagallsVVLTVRLK  208
            G++LFSGLLAG LYD EA K     +TC G +C+R+ F+V+A  C  G  L V+L++R +
Sbjct  473  GSFLFSGLLAGLLYDAEATKVPGGGNTCSGAHCYRLVFVVMAAACVVGFGLDVLLSLRTR  532

Query  207  PVYQMLY  187
             VY  ++
Sbjct  533  RVYAKIH  539



>emb|CDX69099.1| BnaC01g03540D [Brassica napus]
Length=548

 Score =   162 bits (409),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 82/200 (41%), Positives = 130/200 (65%), Gaps = 3/200 (2%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            V+NN+ Q+G+A G  D +I +S+ S   F GR+  G +SEHF++    PR +W   +Q++
Sbjct  349  VMNNMGQIGLALGYTDVSIFVSMTSIWGFFGRILSGTISEHFIKKYGTPRPLWNAASQII  408

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            M + Y + A A+ G+LY+ + ++G+CYGV+ +I +PT SELFGLK++GLI + + +  PL
Sbjct  409  MAVGYLVMALAMPGSLYIGSMVVGVCYGVRLAITVPTASELFGLKYYGLIYNILVLNLPL  468

Query  381  GAYLFSGLLAGYLYDIEAAKQH--SDTCIGPNCFRVTFlvlaglcsagallsVVLTVRLK  208
            G++LFSGLLAG LYD +A       +TC+G +CFR+ F+V+A     G  L ++L  R K
Sbjct  469  GSFLFSGLLAGLLYDAQATPTPGGGNTCVGAHCFRLIFIVMAITSIVGVALDILLAFRTK  528

Query  207  PVYQMLYAGGSFRLPQSSNH  148
             +Y  ++   + + P S NH
Sbjct  529  DIYAKIHGSKNAKKP-SGNH  547



>gb|KEH30508.1| nodulin-like/MFS transporter [Medicago truncatula]
Length=552

 Score =   162 bits (409),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 84/187 (45%), Positives = 128/187 (68%), Gaps = 2/187 (1%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            V+NN+ Q+G+A G  D ++ +SL S   F GR+  G VSEHF++    PR +W   +Q++
Sbjct  351  VMNNMGQIGLALGYTDVSLFVSLTSIWGFFGRIVSGSVSEHFIKKSGTPRPLWNAISQIL  410

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            M + Y L A A+ G+LY+ + ++GICYGV+ ++ +PT SELFGLK++GLI + + +  PL
Sbjct  411  MAVGYILLALAMPGSLYIGSIIVGICYGVRLAVTVPTASELFGLKYYGLIYNILILNLPL  470

Query  381  GAYLFSGLLAGYLYDIEAAKQH--SDTCIGPNCFRVTFlvlaglcsagallsVVLTVRLK  208
            G++LFSGLLAG LYD+EA       +TC+G +C+R+ F+V+AG C  G  L ++L+ R K
Sbjct  471  GSFLFSGLLAGILYDMEATTTEGGGNTCVGGHCYRLVFIVMAGACVVGFFLDILLSYRTK  530

Query  207  PVYQMLY  187
             VY  +Y
Sbjct  531  TVYNKIY  537



>ref|XP_006412169.1| hypothetical protein EUTSA_v10024800mg [Eutrema salsugineum]
 gb|ESQ53622.1| hypothetical protein EUTSA_v10024800mg [Eutrema salsugineum]
Length=564

 Score =   162 bits (409),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 80/188 (43%), Positives = 125/188 (66%), Gaps = 2/188 (1%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            V+NN+ Q+G+A G  D +I +S+ S   F GR+  G +SEHF++    PR +W   +Q++
Sbjct  365  VMNNMGQIGLALGYTDVSIFVSMMSIWGFFGRILSGTISEHFIKKSGTPRPLWNAASQII  424

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            M + Y L A A+ G+LY+ + ++G+CYGV+ +I +PT SELFGLK++GLI + + +  PL
Sbjct  425  MAVGYLLMALAMPGSLYIGSMVVGVCYGVRLAITVPTASELFGLKYYGLIYNILVLNLPL  484

Query  381  GAYLFSGLLAGYLYDIEAAKQH--SDTCIGPNCFRVTFlvlaglcsagallsVVLTVRLK  208
            G++LFSGLLAG LYD EA       +TC+G +C+R+ F+V+A     G  L ++L  R K
Sbjct  485  GSFLFSGLLAGLLYDAEATPTPGGGNTCVGAHCYRLIFIVMAFTSIIGVTLDILLAFRTK  544

Query  207  PVYQMLYA  184
             +Y  ++A
Sbjct  545  EIYAKIHA  552



>gb|ACJ85602.1| unknown [Medicago truncatula]
 gb|AFK37286.1| unknown [Medicago truncatula]
Length=552

 Score =   162 bits (409),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 84/187 (45%), Positives = 128/187 (68%), Gaps = 2/187 (1%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            V+NN+ Q+G+A G  D ++ +SL S   F GR+  G VSEHF++    PR +W   +Q++
Sbjct  351  VMNNMGQIGLALGYTDVSLFVSLTSIWGFFGRIVSGSVSEHFIKKSGTPRPLWNAISQIL  410

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            M + Y L A A+ G+LY+ + ++GICYGV+ ++ +PT SELFGLK++GLI + + +  PL
Sbjct  411  MAVGYILLALAMPGSLYIGSIIVGICYGVRLAVTVPTASELFGLKYYGLIYNILILNLPL  470

Query  381  GAYLFSGLLAGYLYDIEAAKQH--SDTCIGPNCFRVTFlvlaglcsagallsVVLTVRLK  208
            G++LFSGLLAG LYD+EA       +TC+G +C+R+ F+V+AG C  G  L ++L+ R K
Sbjct  471  GSFLFSGLLAGILYDMEATTTEGGGNTCVGGHCYRLVFIVMAGACVVGFFLDILLSYRTK  530

Query  207  PVYQMLY  187
             VY  +Y
Sbjct  531  TVYNKIY  537



>gb|EMT16371.1| hypothetical protein F775_20469 [Aegilops tauschii]
Length=381

 Score =   159 bits (401),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 82/186 (44%), Positives = 126/186 (68%), Gaps = 2/186 (1%)
 Frame = -1

Query  738  LNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVVM  559
            +NNL Q+G+A G  D ++ +S+ S   F GRL  G +SEHF++ +ALPR +W   +QV+M
Sbjct  168  MNNLGQMGVALGYTDVSLFVSMTSIWGFFGRLASGTISEHFIKTRALPRPVWNAASQVLM  227

Query  558  IITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPLG  379
               Y + A  + G+L+V + ++G+CYGV+ ++ +PT SELFGLK++GLI + + +  PLG
Sbjct  228  CAGYVVMAFGMPGSLFVGSVVVGVCYGVRLAVTVPTASELFGLKYYGLIYNILILNLPLG  287

Query  378  AYLFSGLLAGYLYDIEAAK--QHSDTCIGPNCFRVTFlvlaglcsagallsVVLTVRLKP  205
            ++LFSGLLAG LYD EA K     +TC G +C+R+ F+V+A  C  G  L V L++R + 
Sbjct  288  SFLFSGLLAGLLYDAEATKVPGGGNTCSGAHCYRLVFVVMAAACVVGFGLDVPLSLRTRR  347

Query  204  VYQMLY  187
            VY  ++
Sbjct  348  VYAKIH  353



>gb|EEC84958.1| hypothetical protein OsI_32184 [Oryza sativa Indica Group]
Length=549

 Score =   161 bits (408),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 81/187 (43%), Positives = 129/187 (69%), Gaps = 2/187 (1%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            V+NNL Q+G+A G +D ++ +S+ S   F GR+  G +SEHF++ +A+PR +W   +Q++
Sbjct  348  VMNNLGQMGVAMGYSDVSLFVSMTSIWGFFGRIASGTISEHFIKTRAIPRPLWNAASQIL  407

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            M + Y + A  + G+L+V + ++GICYGV+ ++ +PT SELFGLK++GLI + + +  PL
Sbjct  408  MAVGYVVMAVGMPGSLFVGSVVVGICYGVRLAVTVPTASELFGLKYYGLIYNILILNLPL  467

Query  381  GAYLFSGLLAGYLYDIEAAK--QHSDTCIGPNCFRVTFlvlaglcsagallsVVLTVRLK  208
            G++LFSGLLAG LYD +A K     +TC+G +C+R+ F+V+A  C  G  L V+L  R K
Sbjct  468  GSFLFSGLLAGLLYDAQATKVPGGGNTCVGAHCYRLVFVVMAIACVVGFGLDVLLCFRTK  527

Query  207  PVYQMLY  187
             VY  ++
Sbjct  528  RVYAKIH  534



>ref|NP_001063787.1| Os09g0536700 [Oryza sativa Japonica Group]
 dbj|BAD34227.1| putative nodulin-like protein [Oryza sativa Japonica Group]
 dbj|BAD34364.1| putative nodulin-like protein [Oryza sativa Japonica Group]
 dbj|BAF25701.1| Os09g0536700 [Oryza sativa Japonica Group]
 dbj|BAG94330.1| unnamed protein product [Oryza sativa Japonica Group]
Length=552

 Score =   161 bits (408),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 81/187 (43%), Positives = 129/187 (69%), Gaps = 2/187 (1%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            V+NNL Q+G+A G +D ++ +S+ S   F GR+  G +SEHF++ +A+PR +W   +Q++
Sbjct  351  VMNNLGQMGVAMGYSDVSLFVSMTSIWGFFGRIASGTISEHFIKTRAIPRPLWNAASQIL  410

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            M + Y + A  + G+L+V + ++GICYGV+ ++ +PT SELFGLK++GLI + + +  PL
Sbjct  411  MAVGYVVMAVGMPGSLFVGSVVVGICYGVRLAVTVPTASELFGLKYYGLIYNILILNLPL  470

Query  381  GAYLFSGLLAGYLYDIEAAK--QHSDTCIGPNCFRVTFlvlaglcsagallsVVLTVRLK  208
            G++LFSGLLAG LYD +A K     +TC+G +C+R+ F+V+A  C  G  L V+L  R K
Sbjct  471  GSFLFSGLLAGLLYDAQATKVPGGGNTCVGAHCYRLVFVVMAIACVVGFGLDVLLCFRTK  530

Query  207  PVYQMLY  187
             VY  ++
Sbjct  531  RVYAKIH  537



>gb|EYU40425.1| hypothetical protein MIMGU_mgv1a004038mg [Erythranthe guttata]
Length=548

 Score =   161 bits (407),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 84/188 (45%), Positives = 131/188 (70%), Gaps = 2/188 (1%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            V+NNL Q+G+A G +D ++ +SL S   F GR+  G +SE+F++    PR +W   +Q++
Sbjct  348  VMNNLGQMGLALGYSDVSMFVSLTSIWGFFGRILSGSISEYFIKRAGTPRPVWNAASQIL  407

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            M + Y + A AL G+LYV + ++GICYGV+ ++ +PT SELFGLK++GLI + + +  PL
Sbjct  408  MAVGYIVMAVALPGSLYVGSIVVGICYGVRLAVTVPTASELFGLKYYGLIYNILILNLPL  467

Query  381  GAYLFSGLLAGYLYDIEAAKQH--SDTCIGPNCFRVTFlvlaglcsagallsVVLTVRLK  208
            G++LFSGLLAG LYD +A +     +TCIG +C+R+ F+V+A  C  G  L V+L++R K
Sbjct  468  GSFLFSGLLAGLLYDSQATRTAGGGNTCIGAHCYRLVFVVMAIACVIGFGLDVLLSIRTK  527

Query  207  PVYQMLYA  184
             +Y+ +YA
Sbjct  528  GIYRKIYA  535



>gb|EEE50938.1| hypothetical protein OsJ_31482 [Oryza sativa Japonica Group]
Length=553

 Score =   161 bits (407),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 81/187 (43%), Positives = 129/187 (69%), Gaps = 2/187 (1%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            V+NNL Q+G+A G +D ++ +S+ S   F GR+  G +SEHF++ +A+PR +W   +Q++
Sbjct  352  VMNNLGQMGVAMGYSDVSLFVSMTSIWGFFGRIASGTISEHFIKTRAIPRPLWNAASQIL  411

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            M + Y + A  + G+L+V + ++GICYGV+ ++ +PT SELFGLK++GLI + + +  PL
Sbjct  412  MAVGYVVMAVGMPGSLFVGSVVVGICYGVRLAVTVPTASELFGLKYYGLIYNILILNLPL  471

Query  381  GAYLFSGLLAGYLYDIEAAK--QHSDTCIGPNCFRVTFlvlaglcsagallsVVLTVRLK  208
            G++LFSGLLAG LYD +A K     +TC+G +C+R+ F+V+A  C  G  L V+L  R K
Sbjct  472  GSFLFSGLLAGLLYDAQATKVPGGGNTCVGAHCYRLVFVVMAIACVVGFGLDVLLCFRTK  531

Query  207  PVYQMLY  187
             VY  ++
Sbjct  532  RVYAKIH  538



>ref|XP_004505781.1| PREDICTED: uncharacterized membrane protein YMR155W-like [Cicer 
arietinum]
Length=546

 Score =   160 bits (406),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 83/183 (45%), Positives = 127/183 (69%), Gaps = 2/183 (1%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            V+NN+ Q+G+A G  D ++ +SL S   F GR+  G VSEHF++    PR +W   +Q++
Sbjct  346  VMNNMGQIGLALGYTDVSLFVSLTSIWGFFGRIVSGSVSEHFIKKSGTPRPLWNAISQIL  405

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            M + Y L A A+ G+LY+ + ++GICYGV+ ++ +PT SELFGLK++GLI + + +  PL
Sbjct  406  MAVGYILLAMAMPGSLYIGSIIVGICYGVRLAVTVPTASELFGLKYYGLIYNILILNLPL  465

Query  381  GAYLFSGLLAGYLYDIEAAKQH--SDTCIGPNCFRVTFlvlaglcsagallsVVLTVRLK  208
            G++LFSGLLAG LYD+EA       +TC+G +C+R+ F+V+AG C  G  L ++L++R K
Sbjct  466  GSFLFSGLLAGILYDMEATTTEGGGNTCVGGHCYRLVFVVMAGACVVGFFLDILLSIRTK  525

Query  207  PVY  199
             VY
Sbjct  526  NVY  528



>ref|XP_006851905.1| hypothetical protein AMTR_s00041p00157100 [Amborella trichopoda]
 gb|ERN13372.1| hypothetical protein AMTR_s00041p00157100 [Amborella trichopoda]
Length=537

 Score =   160 bits (405),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 83/187 (44%), Positives = 126/187 (67%), Gaps = 2/187 (1%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            V+NN+AQ+G+A G  D +I +SL S   F GR+  G +SE F+R  A PR +W   +QV+
Sbjct  338  VMNNMAQIGLALGYVDVSIFVSLISIWGFFGRIASGTLSEFFIRKAATPRPMWNAVSQVL  397

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            M + Y + A AL G+LY+ + ++G+CYGV+ ++ +PT SELFGLK++GLI + + +  PL
Sbjct  398  MTVGYIILALALPGSLYIGSVIVGLCYGVRLAVSVPTASELFGLKYYGLIYNILILNLPL  457

Query  381  GAYLFSGLLAGYLYDIEAAK--QHSDTCIGPNCFRVTFlvlaglcsagallsVVLTVRLK  208
            G++LFSGLLAG LYD +A +    S+TC+G +C+R  F+V A  C  G  L ++L  R +
Sbjct  458  GSFLFSGLLAGILYDTQATEGSDGSNTCVGAHCYRTVFIVTAFACLVGFGLDILLVFRTR  517

Query  207  PVYQMLY  187
             +Y  +Y
Sbjct  518  RIYAKIY  524



>ref|XP_009136319.1| PREDICTED: probable transporter mch1 [Brassica rapa]
Length=549

 Score =   160 bits (406),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 84/199 (42%), Positives = 129/199 (65%), Gaps = 3/199 (2%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            V+NN+ Q+G+A G  D +I +S+ S   F GR+  G +SEHF++    PR +W   +Q++
Sbjct  350  VMNNMGQIGLALGYTDVSIFVSMTSIWGFFGRILSGTLSEHFLKKAGTPRPLWNAASQIL  409

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            M + Y L A A+  +LY+ + ++G+CYGV+ +I +PT SELFGLKH+GLI + + +  PL
Sbjct  410  MAVGYLLMALAVPNSLYIGSMVVGVCYGVRLAITVPTASELFGLKHYGLIYNILVLNLPL  469

Query  381  GAYLFSGLLAGYLYDIEAAKQH--SDTCIGPNCFRVTFlvlaglcsagallsVVLTVRLK  208
            G++LFSGLLAG+LYD EA       +TC+G +C+R+ FLV+A     G  L ++L  R K
Sbjct  470  GSFLFSGLLAGFLYDAEATPTPGGGNTCVGAHCYRLIFLVMALASVIGVGLDILLAYRTK  529

Query  207  PVYQMLYAGGSFRLPQSSN  151
             +Y  ++A    +   SSN
Sbjct  530  EIYAKIHASKQVK-KSSSN  547



>emb|CDY02250.1| BnaA03g39170D [Brassica napus]
Length=549

 Score =   160 bits (406),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 84/199 (42%), Positives = 129/199 (65%), Gaps = 3/199 (2%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            V+NN+ Q+G+A G  D +I +S+ S   F GR+  G +SEHF++    PR +W   +Q++
Sbjct  350  VMNNMGQIGLALGYTDVSIFVSMTSIWGFFGRILSGTLSEHFLKKAGTPRPLWNAASQIL  409

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            M + Y L A A+  +LY+ + ++G+CYGV+ +I +PT SELFGLKH+GLI + + +  PL
Sbjct  410  MAVGYLLMALAVPNSLYIGSMVVGVCYGVRLAITVPTASELFGLKHYGLIYNILVLNLPL  469

Query  381  GAYLFSGLLAGYLYDIEAAKQH--SDTCIGPNCFRVTFlvlaglcsagallsVVLTVRLK  208
            G++LFSGLLAG+LYD EA       +TC+G +C+R+ FLV+A     G  L ++L  R K
Sbjct  470  GSFLFSGLLAGFLYDAEATPTPGGGNTCVGAHCYRLIFLVMALASVIGVGLDILLAYRTK  529

Query  207  PVYQMLYAGGSFRLPQSSN  151
             +Y  ++A    +   SSN
Sbjct  530  EIYAKIHASKQVK-KSSSN  547



>ref|XP_009107674.1| PREDICTED: probable transporter mch1 [Brassica rapa]
 emb|CDX75475.1| BnaA01g02270D [Brassica napus]
Length=548

 Score =   160 bits (405),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 82/200 (41%), Positives = 130/200 (65%), Gaps = 3/200 (2%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            V+NN+ Q+G+A G  D +I +S+ S   F GR+  G +SEHF++    PR +W   +Q++
Sbjct  349  VMNNMGQIGLALGYTDVSIFVSMTSIWGFFGRILSGTISEHFIKKYGTPRPLWNAASQII  408

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            M + Y + A A+ G+LY+ + ++G+CYGV+ +I +PT SELFGLK++GLI + + +  PL
Sbjct  409  MAVGYLVMALAMPGSLYIGSMVVGVCYGVRLAITVPTASELFGLKYYGLIYNILVLNLPL  468

Query  381  GAYLFSGLLAGYLYDIEAAKQH--SDTCIGPNCFRVTFlvlaglcsagallsVVLTVRLK  208
            G++LFSGLLAG LYD +A       +TC+G +CFR+ F+V+A     G  L ++L  R K
Sbjct  469  GSFLFSGLLAGLLYDAQATPTPGGGNTCVGAHCFRLIFIVMAITSIVGVALDILLAFRTK  528

Query  207  PVYQMLYAGGSFRLPQSSNH  148
             +Y  ++   + + P S NH
Sbjct  529  DIYAKIHGIKNAKKP-SGNH  547



>ref|XP_002867099.1| nodulin family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH43358.1| nodulin family protein [Arabidopsis lyrata subsp. lyrata]
Length=567

 Score =   160 bits (406),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 80/188 (43%), Positives = 123/188 (65%), Gaps = 2/188 (1%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            V+NN+ Q+G+A G  D +I +S+ S   F GR+  G +SEHF++    PR +W    Q++
Sbjct  368  VMNNMGQIGLALGYTDVSIFVSMTSIWGFFGRILSGTISEHFIKKAGTPRPLWNAAAQII  427

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            M + Y L A A+ G+LY+ + ++G+CYGV+ +I +PT SELFGLK++GLI + + +  PL
Sbjct  428  MAVGYLLMALAMPGSLYIGSMVVGVCYGVRLAITVPTASELFGLKYYGLIYNILVLNLPL  487

Query  381  GAYLFSGLLAGYLYDIEAAKQH--SDTCIGPNCFRVTFlvlaglcsagallsVVLTVRLK  208
            G++LFSGLLAG LYD EA       +TC+G +CFR+ F+V+      G  L ++L  R K
Sbjct  488  GSFLFSGLLAGLLYDAEATPTPGGGNTCVGAHCFRMVFIVMTLTSIIGVGLDLLLAYRTK  547

Query  207  PVYQMLYA  184
             +Y  ++A
Sbjct  548  GIYAKIHA  555



>ref|XP_010447017.1| PREDICTED: probable transporter mch1 [Camelina sativa]
Length=573

 Score =   160 bits (405),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 84/200 (42%), Positives = 129/200 (65%), Gaps = 4/200 (2%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            V+NN+ Q+G+A G  D +  +S+ S   F GR+  G +SEHF++    PR +W    Q++
Sbjct  374  VMNNMGQIGLALGYTDVSKFVSMISIWGFFGRILSGTISEHFIKKAGTPRPLWNAAAQII  433

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            M + Y L A A+ G+LY+ + ++G+CYGV+ +I +PT SELFGLK++GLI + + +  PL
Sbjct  434  MAVGYLLMALAMPGSLYIGSMVVGVCYGVRLAITVPTASELFGLKYYGLIYNILILNLPL  493

Query  381  GAYLFSGLLAGYLYDIEAAKQH--SDTCIGPNCFRVTFlvlaglcsagallsVVLTVRLK  208
            G++LFSGLLAG LYD EA       +TC+G +CFR+ FLV+A     G  L ++L  R K
Sbjct  494  GSFLFSGLLAGLLYDAEATPTPGGGNTCVGAHCFRMVFLVMALASVIGIGLDLLLAYRTK  553

Query  207  PVYQMLYAGGSFRLPQSSNH  148
             +Y  ++A  S +  +SS +
Sbjct  554  EIYAKIHA--SKKAKKSSGN  571



>ref|XP_003578521.1| PREDICTED: uncharacterized protein LOC100831486 [Brachypodium 
distachyon]
Length=560

 Score =   160 bits (405),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 86/191 (45%), Positives = 127/191 (66%), Gaps = 2/191 (1%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            V+NNL Q+G A G +D +I +S+ S   F GRL  G +SEHF++ +A PR  W   +QV+
Sbjct  361  VMNNLGQMGSAMGYSDVSIFVSMTSIWGFFGRLASGTISEHFIKTRATPRPAWNAASQVL  420

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            M   Y + A  + G+L+V + ++GICYGV+ ++ +PT SELFGLKH+GLI + + +  PL
Sbjct  421  MAAGYVVMALGMPGSLFVGSVVVGICYGVRVAVTVPTASELFGLKHYGLIYNILILNLPL  480

Query  381  GAYLFSGLLAGYLYDIEAA--KQHSDTCIGPNCFRVTFlvlaglcsagallsVVLTVRLK  208
            G++LFSGLLAG LYD EA       +TC G +C+R+ F+V+A  C AG  L V+L++R +
Sbjct  481  GSFLFSGLLAGLLYDAEATAVPGGGNTCAGAHCYRLVFVVMAVACVAGFALDVLLSLRTR  540

Query  207  PVYQMLYAGGS  175
             VY  ++   S
Sbjct  541  RVYAKIHQAKS  551



>ref|XP_007199775.1| hypothetical protein PRUPE_ppa003698mg [Prunus persica]
 gb|EMJ00974.1| hypothetical protein PRUPE_ppa003698mg [Prunus persica]
Length=555

 Score =   160 bits (404),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 81/189 (43%), Positives = 131/189 (69%), Gaps = 2/189 (1%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            V+NN+ Q+G+A G  D +I +SL S   F GR+  G+VSE+F+R    PR +W   +Q++
Sbjct  356  VMNNMGQIGLALGYVDVSIFVSLTSIWGFFGRIVSGMVSEYFIRKAGTPRPLWNAASQIL  415

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            M + Y L A A+ G+LY+ + ++GICYG++ +I +PT SELFGLK++GLI + + +  PL
Sbjct  416  MAVGYILMAIAMPGSLYIGSIVVGICYGIRLAITVPTASELFGLKYYGLIYNILILNLPL  475

Query  381  GAYLFSGLLAGYLYDIEA--AKQHSDTCIGPNCFRVTFlvlaglcsagallsVVLTVRLK  208
            G++LFSGLLAG LYD++A    +  +TC+G +C+R+ F+++A  C  G  L ++L++R K
Sbjct  476  GSFLFSGLLAGILYDMQATTTSEGGNTCVGAHCYRLVFIIMAIACVVGFGLDILLSIRTK  535

Query  207  PVYQMLYAG  181
             +Y+ +  G
Sbjct  536  NLYKKIQTG  544



>ref|XP_010526898.1| PREDICTED: uncharacterized protein LOC104804333 [Tarenaya hassleriana]
Length=571

 Score =   159 bits (403),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 81/193 (42%), Positives = 129/193 (67%), Gaps = 2/193 (1%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            V+NN+ Q+G+A G  D ++ +S+ S   F GR+  G VSE+F++    PR +W   +Q++
Sbjct  372  VMNNMGQIGLALGYTDVSMFVSMTSIWGFFGRILSGTVSEYFLKKAGTPRPLWNAASQII  431

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            M + Y L A A+ G+LY+ + ++G+CYGV+ +I +PT SELFGLK++GLI + + +  PL
Sbjct  432  MAVGYILMALAMPGSLYIGSMVVGVCYGVRLAITVPTASELFGLKYYGLIYNILVLNLPL  491

Query  381  GAYLFSGLLAGYLYDIEAAKQH--SDTCIGPNCFRVTFlvlaglcsagallsVVLTVRLK  208
            G++LFSGLLAG LYD EA       +TC+GP+C+R+ F+V+A  C  G  L ++L+ R K
Sbjct  492  GSFLFSGLLAGLLYDAEATPTPGGGNTCVGPHCYRLIFIVMAFACIVGVGLDILLSFRTK  551

Query  207  PVYQMLYAGGSFR  169
             +Y  +++    R
Sbjct  552  DIYAKIHSSKKAR  564



>gb|EAZ42068.1| hypothetical protein OsJ_26629 [Oryza sativa Japonica Group]
Length=538

 Score =   159 bits (402),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 88/154 (57%), Positives = 109/154 (71%), Gaps = 3/154 (2%)
 Frame = -1

Query  600  LPRTIWMTFTQVVMIITYFLFASALNGTL-YVATALLGICYGVQFSILIPTTSELFGLKH  424
            +PR IWM  TQ V+++ Y   A  L   + Y  TA +G+CYGVQFS++IPTTSELFGLK+
Sbjct  384  VPRPIWMALTQTVLVVAYLCLAYTLGPAVAYACTATVGLCYGVQFSVMIPTTSELFGLKN  443

Query  423  FGLILSFMGIGNPLGAYLFSGLLAGYLYDIEAAK-QHS-DTCIGPNCFRVTFlvlaglcs  250
            FGL  + M + NPLGA LFSG L G LYD EAA+ QHS   C+GP CFR  F+VLAG CS
Sbjct  444  FGLFYNLMSLANPLGAALFSGELTGRLYDEEAARQQHSGGVCLGPGCFRAAFVVLAGACS  503

Query  249  agallsVVLTVRLKPVYQMLYAGGSFRLPQSSNH  148
             G  +S+VL  R++PVY  LY+GGSFRLP +S  
Sbjct  504  VGTAVSLVLAARIQPVYMALYSGGSFRLPNASQQ  537



>ref|XP_011046453.1| PREDICTED: uncharacterized protein LOC105141056 [Populus euphratica]
Length=564

 Score =   159 bits (402),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 84/200 (42%), Positives = 134/200 (67%), Gaps = 3/200 (2%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            V+NN+ Q+G+A G  D ++ +S+ S   F GR+  G VSE++++    PR +W   +Q++
Sbjct  363  VMNNMGQIGLALGYADVSLFVSMTSIWGFFGRIISGTVSEYYIKKAGTPRPLWNAASQIL  422

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            M + Y L A AL G+LY+ + ++G+CYGV+ ++ +PT SELFGLK+FGLI + + +  PL
Sbjct  423  MAVGYILMAVALPGSLYIGSIVVGVCYGVRLAVSVPTASELFGLKYFGLIYNILILNLPL  482

Query  381  GAYLFSGLLAGYLYDIEAAKQH--SDTCIGPNCFRVTFlvlaglcsagallsVVLTVRLK  208
            G++LFSGLLAG+LYD EA       +TC+G +C+R+ F+++A  C  G  L V+L +R K
Sbjct  483  GSFLFSGLLAGFLYDAEATPTPGGGNTCVGAHCYRLVFIIMAVACVIGFGLDVLLGIRTK  542

Query  207  PVYQMLY-AGGSFRLPQSSN  151
             +Y  +Y +  S +L  +SN
Sbjct  543  KIYTKIYMSRRSKKLASASN  562



>ref|XP_010246855.1| PREDICTED: probable transporter mch1 [Nelumbo nucifera]
Length=547

 Score =   159 bits (402),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 84/193 (44%), Positives = 127/193 (66%), Gaps = 2/193 (1%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            V+NN+ Q+G+A G  D +I +SL S   F GR+  G  SE+F+   A PR +W   +Q++
Sbjct  345  VMNNMGQMGLALGYADVSIFVSLISIWGFFGRIISGTASEYFIEKAATPRPLWNASSQIL  404

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            M I Y L A A+ G+LY+ + ++GICYGV+ ++ +P  SELFGLK++GL+ + + +  P+
Sbjct  405  MTIGYVLLAMAMPGSLYIGSVVVGICYGVRLAVTVPIASELFGLKYYGLMYNILILNLPI  464

Query  381  GAYLFSGLLAGYLYDIEAAKQHS--DTCIGPNCFRVTFlvlaglcsagallsVVLTVRLK  208
            G++LFSGLLAG+LYD EA       +TCIG +C+R+ F+V+A  C  G +L V L +R +
Sbjct  465  GSFLFSGLLAGFLYDAEATSSGDGGNTCIGAHCYRLVFVVMALACVLGFVLDVFLAIRTR  524

Query  207  PVYQMLYAGGSFR  169
             VY  +YA    R
Sbjct  525  NVYSKIYATKKSR  537



>ref|XP_004147031.1| PREDICTED: uncharacterized protein LOC101216743 [Cucumis sativus]
 gb|KGN61919.1| hypothetical protein Csa_2G264630 [Cucumis sativus]
Length=540

 Score =   159 bits (401),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 82/184 (45%), Positives = 125/184 (68%), Gaps = 2/184 (1%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            V+NN+ Q+G+A G  D ++ +SL S   F GR+  G +SEHF++    PR +W   +Q++
Sbjct  341  VMNNMGQIGLALGYADVSMFVSLTSIWGFFGRILSGTISEHFLKKAGTPRPLWNAASQIL  400

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            M + Y L A A+ G+LY+ + ++GICYGV+ S+ +PT SELFGLK++GLI + + +  P+
Sbjct  401  MTVGYVLMAMAMPGSLYIGSVIVGICYGVRLSVTVPTASELFGLKYYGLIYNILILNLPI  460

Query  381  GAYLFSGLLAGYLYDIEAAKQH--SDTCIGPNCFRVTFlvlaglcsagallsVVLTVRLK  208
            G++LFSGLLAG+LYD+EA       +TCIG +C+R+ FLV+A  C  G +L + L  R K
Sbjct  461  GSFLFSGLLAGFLYDMEATPTEGGGNTCIGGHCYRIVFLVMALACVIGFVLDIWLAFRTK  520

Query  207  PVYQ  196
             +Y 
Sbjct  521  ELYS  524



>ref|XP_007137356.1| hypothetical protein PHAVU_009G120400g [Phaseolus vulgaris]
 gb|ESW09350.1| hypothetical protein PHAVU_009G120400g [Phaseolus vulgaris]
Length=537

 Score =   159 bits (401),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 84/186 (45%), Positives = 127/186 (68%), Gaps = 2/186 (1%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            V+NN+ Q+G+A G +D ++ +SL S   F GR+  G VSEHF++    PR +W   +Q++
Sbjct  340  VMNNMGQIGLALGYSDVSLFVSLTSIWGFFGRIVSGSVSEHFIKKAGTPRPLWNAASQIL  399

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            M + Y L A A+ G+LY+ + ++GICYGV+ +I +PT SELFGLK++GLI + + +  PL
Sbjct  400  MAVGYILLAMAMPGSLYIGSIMVGICYGVRLAITVPTASELFGLKYYGLIYNILILNLPL  459

Query  381  GAYLFSGLLAGYLYDIEA--AKQHSDTCIGPNCFRVTFlvlaglcsagallsVVLTVRLK  208
            G++LFSGLLAG LYD+EA       +TC+G +C+R+ F+V+   C  G  L VVL++R K
Sbjct  460  GSFLFSGLLAGILYDMEATTTTGGGNTCVGAHCYRLVFVVMTAACVVGFFLDVVLSIRTK  519

Query  207  PVYQML  190
             VY  +
Sbjct  520  MVYNKI  525



>ref|XP_004158381.1| PREDICTED: uncharacterized LOC101216743 [Cucumis sativus]
Length=541

 Score =   159 bits (401),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 82/184 (45%), Positives = 125/184 (68%), Gaps = 2/184 (1%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            V+NN+ Q+G+A G  D ++ +SL S   F GR+  G +SEHF++    PR +W   +Q++
Sbjct  341  VMNNMGQIGLALGYADVSMFVSLTSIWGFFGRILSGTISEHFLKKAGTPRPLWNAASQIL  400

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            M + Y L A A+ G+LY+ + ++GICYGV+ S+ +PT SELFGLK++GLI + + +  P+
Sbjct  401  MTVGYILMAMAMPGSLYIGSVIVGICYGVRLSVTVPTASELFGLKYYGLIYNILILNLPI  460

Query  381  GAYLFSGLLAGYLYDIEAAKQH--SDTCIGPNCFRVTFlvlaglcsagallsVVLTVRLK  208
            G++LFSGLLAG+LYD+EA       +TCIG +C+R+ FLV+A  C  G +L + L  R K
Sbjct  461  GSFLFSGLLAGFLYDMEATPTEGGGNTCIGGHCYRIVFLVMALACVIGFVLDIWLAFRTK  520

Query  207  PVYQ  196
             +Y 
Sbjct  521  ELYS  524



>ref|XP_009412967.1| PREDICTED: probable transporter mch1 [Musa acuminata subsp. malaccensis]
Length=555

 Score =   159 bits (401),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 81/200 (41%), Positives = 131/200 (66%), Gaps = 2/200 (1%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            V+NN+ Q+G+A G  D +I +S+ S   F GR+  G +SE+F++  A PR +W   +Q++
Sbjct  352  VMNNMGQMGLALGYTDVSIFVSMLSIWGFFGRITSGTISEYFIKEHATPRPLWNAASQIL  411

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            M + Y + A A+ G+LY+ + ++G+CYGV+ ++ +PT SELFGLK++GLI + + +  PL
Sbjct  412  MAVGYVVMALAVPGSLYIGSVVVGLCYGVRLAVSVPTASELFGLKYYGLIYNILILNLPL  471

Query  381  GAYLFSGLLAGYLYDIEAAKQH--SDTCIGPNCFRVTFlvlaglcsagallsVVLTVRLK  208
            G++LFSGLLAG LYD +A K    ++TC+G +C+R+ F ++A  C  G  L VVL  R K
Sbjct  472  GSFLFSGLLAGLLYDAQATKTEGGANTCVGAHCYRMVFGIMALACIVGFGLDVVLAFRTK  531

Query  207  PVYQMLYAGGSFRLPQSSNH  148
             +Y+ + +    R   S + 
Sbjct  532  KLYRQIQSSKRTRKAASRHR  551



>ref|XP_010437548.1| PREDICTED: probable transporter mch1 [Camelina sativa]
Length=567

 Score =   159 bits (401),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 83/200 (42%), Positives = 128/200 (64%), Gaps = 4/200 (2%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            V+NN+ Q+G+A G  D +  +S+ S   F GR+  G +SEHF++    PR +W    Q++
Sbjct  368  VMNNMGQIGLALGYTDVSKFVSMISIWGFFGRILSGTISEHFIKKAGTPRPLWNAAAQII  427

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            M + Y L A A+ G+LY+ + ++G+CYGV+ +I +PT SELFGLK++GLI + + +  PL
Sbjct  428  MAVGYLLMALAMPGSLYIGSMVVGVCYGVRLAITVPTASELFGLKYYGLIYNILILNMPL  487

Query  381  GAYLFSGLLAGYLYDIEAAKQH--SDTCIGPNCFRVTFlvlaglcsagallsVVLTVRLK  208
            G++LFSGLLAG LYD EA       +TC+G +CFR+ FLV+A     G  L ++L  R  
Sbjct  488  GSFLFSGLLAGLLYDAEATPTPGGGNTCVGAHCFRMVFLVMAFASIIGIGLDLLLAYRTN  547

Query  207  PVYQMLYAGGSFRLPQSSNH  148
             +Y  ++A  S +  +SS +
Sbjct  548  EIYAKIHA--SKKAKKSSGN  565



>ref|XP_006409413.1| hypothetical protein EUTSA_v10022630mg [Eutrema salsugineum]
 gb|ESQ50866.1| hypothetical protein EUTSA_v10022630mg [Eutrema salsugineum]
Length=548

 Score =   158 bits (399),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 81/188 (43%), Positives = 125/188 (66%), Gaps = 2/188 (1%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            V+NN+ Q+G+A G  D +I +S+ S   F GR+  G +SEHF++    PR +W   +Q++
Sbjct  349  VMNNMGQIGLALGYTDVSIFVSMTSIWGFFGRILSGTLSEHFLKKAGTPRPLWNAASQIL  408

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            M + Y L A A+  +LY+ + ++G+CYGV+ +I +PT SELFGLK++GLI + + +  PL
Sbjct  409  MAVGYLLMALAVPNSLYIGSMVVGVCYGVRLAITVPTASELFGLKYYGLIYNILVLNLPL  468

Query  381  GAYLFSGLLAGYLYDIEAAKQH--SDTCIGPNCFRVTFlvlaglcsagallsVVLTVRLK  208
            G++LFSGLLAG+LYD EA       +TC+G +C+R+ FLV+A     G  L +VL  R K
Sbjct  469  GSFLFSGLLAGFLYDAEATPTPGGGNTCVGAHCYRLIFLVMALASVIGVGLDIVLAYRTK  528

Query  207  PVYQMLYA  184
             +Y  ++A
Sbjct  529  EIYAKIHA  536



>ref|XP_010935083.1| PREDICTED: probable transporter mch1 [Elaeis guineensis]
Length=540

 Score =   157 bits (398),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 86/193 (45%), Positives = 127/193 (66%), Gaps = 2/193 (1%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            V+NN+ Q+G+A G  D +I +S+ S   F GR+G G +SE+F++  A PR +W   +QV+
Sbjct  338  VMNNMGQMGLAMGYRDVSIFVSMISIWGFFGRIGSGSISEYFLKKTATPRPVWNAASQVL  397

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            M   Y + A A  G+LYV + ++GICYGV+ +I +PT SELFGLK++GLI + + +  PL
Sbjct  398  MASGYVVMALAWPGSLYVGSIVVGICYGVRIAITVPTASELFGLKYYGLIYNILILNLPL  457

Query  381  GAYLFSGLLAGYLYDIEAAKQH--SDTCIGPNCFRVTFlvlaglcsagallsVVLTVRLK  208
            G++LFSGLLAG LYD +A K     + C+G NC+R+ FL++A  C  G  L V+L VR +
Sbjct  458  GSFLFSGLLAGLLYDSQAIKMAGGGNMCVGTNCYRLVFLIMAFACLIGFGLDVLLAVRTR  517

Query  207  PVYQMLYAGGSFR  169
             VY  ++     R
Sbjct  518  KVYLKIHNDKKSR  530



>gb|KHN39887.1| hypothetical protein glysoja_020627 [Glycine soja]
Length=224

 Score =   151 bits (381),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 80/183 (44%), Positives = 124/183 (68%), Gaps = 2/183 (1%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            V+NN+ Q+G+A G  D ++ +SL S   F GR+  G VSE  ++    PR +W   +Q++
Sbjct  26   VMNNMGQIGLALGYPDVSLFVSLTSIFGFFGRIISGTVSEFTIKKAGTPRPLWNAASQLL  85

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            M + Y L A A+ G+LY+ + L+G+CYGV+ +I +PT SELFGLK++GLI + + +  PL
Sbjct  86   MAVGYILLAMAMPGSLYIGSILVGMCYGVRLAITVPTASELFGLKYYGLIYNILILNLPL  145

Query  381  GAYLFSGLLAGYLYDIEAAKQH--SDTCIGPNCFRVTFlvlaglcsagallsVVLTVRLK  208
            G++LFSGLLAG LYD+EA       +TC+G +C+R+ F+V+ G C  G  L ++L++R K
Sbjct  146  GSFLFSGLLAGILYDMEATTTEGGGNTCVGGHCYRLVFVVMTGACIVGFFLDILLSIRTK  205

Query  207  PVY  199
             +Y
Sbjct  206  NIY  208



>ref|XP_006422631.1| hypothetical protein CICLE_v10028125mg [Citrus clementina]
 gb|ESR35871.1| hypothetical protein CICLE_v10028125mg [Citrus clementina]
 gb|KDO68007.1| hypothetical protein CISIN_1g008778mg [Citrus sinensis]
Length=554

 Score =   157 bits (398),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 81/187 (43%), Positives = 126/187 (67%), Gaps = 2/187 (1%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            V+NN+ Q+G+A G  D +I +SL S   F GR+  G VSE+F++    PR IW   +Q++
Sbjct  351  VMNNMGQIGLALGYVDVSIFVSLTSIWGFFGRIISGSVSEYFIKRAGTPRPIWNAASQIL  410

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            M + Y L A AL G+LY+ + ++G+CYGV+ ++ +PT SELFGLK++GLI + + +  PL
Sbjct  411  MAVGYILMAVALPGSLYIGSIIVGLCYGVRLAVTVPTASELFGLKYYGLIYNILILNLPL  470

Query  381  GAYLFSGLLAGYLYDIEAAKQH--SDTCIGPNCFRVTFlvlaglcsagallsVVLTVRLK  208
            G++LFSGLLAGYLYD +A       +TC+G +C+R+ F+++A  C  G  L ++L  + K
Sbjct  471  GSFLFSGLLAGYLYDAQATPTAGGGNTCVGAHCYRLVFVIMAMACIVGFGLDILLAAKTK  530

Query  207  PVYQMLY  187
             +Y  +Y
Sbjct  531  NIYTKIY  537



>ref|XP_006486761.1| PREDICTED: uncharacterized membrane protein YMR155W-like [Citrus 
sinensis]
Length=557

 Score =   157 bits (398),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 81/187 (43%), Positives = 126/187 (67%), Gaps = 2/187 (1%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            V+NN+ Q+G+A G  D +I +SL S   F GR+  G VSE+F++    PR IW   +Q++
Sbjct  354  VMNNMGQIGLALGYVDVSIFVSLTSIWGFFGRIISGSVSEYFIKRAGTPRPIWNAASQIL  413

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            M + Y L A AL G+LY+ + ++G+CYGV+ ++ +PT SELFGLK++GLI + + +  PL
Sbjct  414  MAVGYILMAVALPGSLYIGSIIVGLCYGVRLAVTVPTASELFGLKYYGLIYNILILNLPL  473

Query  381  GAYLFSGLLAGYLYDIEAAKQH--SDTCIGPNCFRVTFlvlaglcsagallsVVLTVRLK  208
            G++LFSGLLAGYLYD +A       +TC+G +C+R+ F+++A  C  G  L ++L  + K
Sbjct  474  GSFLFSGLLAGYLYDAQATPTAGGGNTCVGAHCYRLVFVIMAMACIVGFGLDILLAAKTK  533

Query  207  PVYQMLY  187
             +Y  +Y
Sbjct  534  NIYTKIY  540



>gb|KFK40073.1| hypothetical protein AALP_AA3G326700 [Arabis alpina]
Length=546

 Score =   157 bits (398),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 79/188 (42%), Positives = 125/188 (66%), Gaps = 2/188 (1%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            V+NN+ Q+G+A G  D +I +S+ S   F GR+  G +SEHF++    PR +W   +Q++
Sbjct  347  VMNNMGQIGLALGYTDVSIFVSMTSIWGFFGRILSGTLSEHFLKKAGTPRPLWNAASQIL  406

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            M + Y L A A+  +LY+ + ++G+CYGV+ +I +PT SELFGLK++GLI + + +  PL
Sbjct  407  MAVGYILMALAVPNSLYIGSMVVGVCYGVRLAITVPTASELFGLKYYGLIYNILVLNLPL  466

Query  381  GAYLFSGLLAGYLYDIEAAKQH--SDTCIGPNCFRVTFlvlaglcsagallsVVLTVRLK  208
            G++LFSGLLAG+LYD EA       +TC+G +C+R+ F+V+A     G  L ++L  R K
Sbjct  467  GSFLFSGLLAGFLYDAEATPTPGGGNTCVGAHCYRLIFIVMALASVIGVGLDLILAYRTK  526

Query  207  PVYQMLYA  184
             +Y  ++A
Sbjct  527  EIYAKIHA  534



>ref|XP_009112395.1| PREDICTED: probable transporter mch1 [Brassica rapa]
Length=539

 Score =   157 bits (397),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 80/188 (43%), Positives = 125/188 (66%), Gaps = 2/188 (1%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            V+NN+ Q+G+A G  D +I +S+ S   F GR+  G +SEHF++    PR +W   +Q++
Sbjct  340  VMNNMGQIGLALGYTDVSIFVSMTSIWGFFGRILSGTLSEHFLKKAGTPRPLWNAASQIL  399

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            M + Y L A A+  +LY+ + ++G+CYGV+ +I +PT SELFGLK++GLI + + +  PL
Sbjct  400  MAVGYLLMALAVPNSLYIGSMVVGVCYGVRLAITVPTASELFGLKYYGLIYNILVLNLPL  459

Query  381  GAYLFSGLLAGYLYDIEAAKQH--SDTCIGPNCFRVTFlvlaglcsagallsVVLTVRLK  208
            G++LFSGLLAG+LYD EA       +TC+G +C+R+ FLV+A     G  L ++L  R K
Sbjct  460  GSFLFSGLLAGFLYDAEATPTPGGGNTCVGAHCYRLVFLVMALASIIGVGLDILLAYRTK  519

Query  207  PVYQMLYA  184
             +Y  ++A
Sbjct  520  EIYAKIHA  527



>gb|EMS65634.1| hypothetical protein TRIUR3_01886 [Triticum urartu]
Length=623

 Score =   157 bits (398),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 81/132 (61%), Positives = 102/132 (77%), Gaps = 1/132 (1%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            VLNNLAQVG A GV  TTI +SLFS  NF GRLGGG VS++FVR + LPRT+ +T TQVV
Sbjct  412  VLNNLAQVGTAAGVVGTTISVSLFSLGNFFGRLGGGAVSDYFVRSRTLPRTVLITCTQVV  471

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            MI+ Y +FA  L  TLY++ A+LG+CYGV FS+++ T+SELFGLK FG I +F+ + NPL
Sbjct  472  MIVNYLVFALGLKATLYISVAILGVCYGVHFSVMVSTSSELFGLKQFGKIYNFILLANPL  531

Query  381  GAYLFSGLLAGY  346
            GA +FS  LAG+
Sbjct  532  GALVFSS-LAGH  542



>ref|XP_006359676.1| PREDICTED: uncharacterized protein LOC102592169 [Solanum tuberosum]
Length=552

 Score =   157 bits (397),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 84/188 (45%), Positives = 128/188 (68%), Gaps = 2/188 (1%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            V+NNL Q+G+A G  D +I +SL S   F GR+  G VSE+F++  A+PR IW   +Q++
Sbjct  353  VMNNLGQMGLALGYVDVSIFVSLTSIWGFFGRIISGSVSEYFIKKAAVPRPIWNAASQIL  412

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            M + Y   A A+ G+LY+ + ++GICYGV+ +I +P  SELFGLK++GLI + + +  PL
Sbjct  413  MAVGYICLAMAMPGSLYIGSIVVGICYGVRLAISVPAASELFGLKYYGLIYNVLILNLPL  472

Query  381  GAYLFSGLLAGYLYDIEAAKQHS--DTCIGPNCFRVTFlvlaglcsagallsVVLTVRLK  208
            G++LFSGLLAG LYD +A       +TC+G +C+R+ F+V+A  C  G  L ++L++R K
Sbjct  473  GSFLFSGLLAGLLYDAQATTTADGGNTCVGAHCYRLVFIVMAIACIVGFGLDILLSIRTK  532

Query  207  PVYQMLYA  184
             +Y  +YA
Sbjct  533  SLYGKIYA  540



>emb|CDY47472.1| BnaA09g08810D [Brassica napus]
Length=539

 Score =   157 bits (396),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 80/188 (43%), Positives = 125/188 (66%), Gaps = 2/188 (1%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            V+NN+ Q+G+A G  D +I +S+ S   F GR+  G +SEHF++    PR +W   +Q++
Sbjct  340  VMNNMGQIGLALGYTDVSIFVSMTSIWGFFGRILSGTLSEHFLKKAGTPRPLWNAASQIL  399

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            M + Y L A A+  +LY+ + ++G+CYGV+ +I +PT SELFGLK++GLI + + +  PL
Sbjct  400  MAVGYLLMALAVPNSLYIGSMVVGVCYGVRLAITVPTASELFGLKYYGLIYNILVLNLPL  459

Query  381  GAYLFSGLLAGYLYDIEAAKQH--SDTCIGPNCFRVTFlvlaglcsagallsVVLTVRLK  208
            G++LFSGLLAG+LYD EA       +TC+G +C+R+ FLV+A     G  L ++L  R K
Sbjct  460  GSFLFSGLLAGFLYDAEATPTPGGGNTCVGAHCYRLIFLVMASASIIGVGLDILLAYRTK  519

Query  207  PVYQMLYA  184
             +Y  ++A
Sbjct  520  EIYAKIHA  527



>gb|EMS50901.1| hypothetical protein TRIUR3_11662 [Triticum urartu]
Length=150

 Score =   148 bits (373),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 68/140 (49%), Positives = 100/140 (71%), Gaps = 0/140 (0%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            V+NNL Q+G+A G  D +I +S+ S   F GRL  G +SEHF++ +ALPR +W   +QV+
Sbjct  9    VMNNLGQMGVAMGYTDVSIFVSMTSIWGFFGRLASGTISEHFIKTRALPRPVWNAASQVL  68

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            M   Y + A  + G+L+V + ++G+CYGV+ ++ +PT SELFGLK++GLI + + +  PL
Sbjct  69   MCAGYVVMAFGMPGSLFVGSVVVGVCYGVRLAVTVPTASELFGLKYYGLIYNILILNLPL  128

Query  381  GAYLFSGLLAGYLYDIEAAK  322
            G++LFSGLLAG LYD EA K
Sbjct  129  GSFLFSGLLAGLLYDAEATK  148



>ref|XP_004231025.1| PREDICTED: uncharacterized protein LOC101261467 [Solanum lycopersicum]
Length=553

 Score =   157 bits (396),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 84/198 (42%), Positives = 131/198 (66%), Gaps = 2/198 (1%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            V+NNL Q+G+A G  D +I +SL S   F GR+  G VSE+F++  A+PR IW   +Q++
Sbjct  353  VMNNLGQMGLALGYVDVSIFVSLTSIWGFFGRIISGSVSEYFIKKAAVPRPIWNAASQIL  412

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            M + Y   A A+ G+LY+ + ++GICYGV+ +I +P  SELFGLK++GLI + + +  PL
Sbjct  413  MAVGYICLAMAMPGSLYIGSIVVGICYGVRLAISVPAASELFGLKYYGLIYNVLILNLPL  472

Query  381  GAYLFSGLLAGYLYDIEAAKQHS--DTCIGPNCFRVTFlvlaglcsagallsVVLTVRLK  208
            G++LFSGLLAG LYD +A       +TC+G +C+R+ F+V+A  C  G  L ++L++R +
Sbjct  473  GSFLFSGLLAGLLYDAQATTTADGGNTCVGAHCYRLVFIVMAIACIIGFGLDILLSIRTR  532

Query  207  PVYQMLYAGGSFRLPQSS  154
             +Y  +YA    +   +S
Sbjct  533  SLYGKIYASKKAKKTSTS  550



>ref|XP_010090321.1| hypothetical protein L484_024986 [Morus notabilis]
 gb|EXB39291.1| hypothetical protein L484_024986 [Morus notabilis]
Length=522

 Score =   156 bits (395),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 82/188 (44%), Positives = 127/188 (68%), Gaps = 2/188 (1%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            V+NN+ Q+G+A G  D +I +SL S   F GR+  G+VSE+F+R    PR +W   +Q++
Sbjct  324  VMNNMGQIGLALGYADVSIFVSLTSIWGFFGRIVSGLVSEYFIRRAGTPRPLWNAASQIL  383

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            M + Y L   A+ G+LY+ + ++GICYG++ ++ +PT SELFGLK++GLI + + +  PL
Sbjct  384  MAVGYILMTIAMPGSLYIGSIVVGICYGIRLAVTVPTASELFGLKYYGLIYNILILNLPL  443

Query  381  GAYLFSGLLAGYLYDIEAAKQH--SDTCIGPNCFRVTFlvlaglcsagallsVVLTVRLK  208
            G++LFSGLLAG LYD+EA       +TC+G +C+R+ FLV+A  C  G  L ++L+ R K
Sbjct  444  GSFLFSGLLAGLLYDMEATTTAGGGNTCVGAHCYRLVFLVMAIACIVGFGLDILLSFRTK  503

Query  207  PVYQMLYA  184
             +Y  + A
Sbjct  504  NLYNKIQA  511



>emb|CDX76306.1| BnaA08g10940D [Brassica napus]
Length=513

 Score =   156 bits (394),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 83/198 (42%), Positives = 126/198 (64%), Gaps = 4/198 (2%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            V+NN+ Q+G+A G  D +I +S+ S   F GR+  G +SEHF++    PR +W   +QVV
Sbjct  314  VMNNMGQIGLALGYTDVSIFVSMMSIWGFFGRILSGTISEHFIKKNGTPRPLWNAASQVV  373

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            M + Y L A A+ G+LY  + ++G CYGV+ +I +P  SELFGLK++GL+ + + +  PL
Sbjct  374  MAVGYLLMALAIPGSLYFGSVVVGACYGVRLAITVPIASELFGLKYYGLLYNILILNFPL  433

Query  381  GAYLFSGLLAGYLYDIEAAKQHS--DTCIGPNCFRVTFlvlaglcsagallsVVLTVRLK  208
            G++LFSGLLAG LYD EA       +TC+G +C+R+ F+V+A     G  L   L  R K
Sbjct  434  GSFLFSGLLAGLLYDAEATPTPDGGNTCVGAHCYRLVFIVMAFTSIIGVGLDFWLAFRTK  493

Query  207  PVYQMLYAGGSFRLPQSS  154
             +Y  ++A  S ++ +SS
Sbjct  494  EIYTKIHA--SKKVKRSS  509



>ref|XP_010941299.1| PREDICTED: uncharacterized protein LOC105059626 [Elaeis guineensis]
Length=542

 Score =   156 bits (394),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 82/193 (42%), Positives = 130/193 (67%), Gaps = 2/193 (1%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            V+NN+ Q+G+A G  D +I +S+ S   F GR+G G +SE+F++  A PR +W   +QV+
Sbjct  339  VMNNMGQMGLALGYTDVSIFVSMTSIWGFFGRIGSGSISEYFLKKSATPRPLWNAASQVL  398

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            M + Y + A AL G+LYV + ++G+CYGV+ ++ +PT SELFGLK++GL+ + + +  PL
Sbjct  399  MAVGYVVMALALPGSLYVGSIVVGLCYGVRVAVSVPTASELFGLKYYGLMYNILILNLPL  458

Query  381  GAYLFSGLLAGYLYDIEAAKQH--SDTCIGPNCFRVTFlvlaglcsagallsVVLTVRLK  208
            G++LFSGLLAG LYD +A K     +TC+G +C+R+ F+++A  C  G  L V+L +R +
Sbjct  459  GSFLFSGLLAGLLYDSQATKTAGGGNTCVGAHCYRLVFVIMAIACLIGFGLDVLLALRTR  518

Query  207  PVYQMLYAGGSFR  169
             VY  ++     R
Sbjct  519  KVYLKIHHSKKSR  531



>ref|XP_002312970.1| nodulin family protein [Populus trichocarpa]
 gb|EEE86925.1| nodulin family protein [Populus trichocarpa]
Length=564

 Score =   156 bits (394),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 83/200 (42%), Positives = 133/200 (67%), Gaps = 3/200 (2%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            V+NN+ Q+G+A G  D ++ +S+ S   F GR+  G VSE++++    PR +W   +Q++
Sbjct  363  VMNNMGQIGLALGYADVSLFVSMTSIWGFFGRIISGTVSEYYIKKAGTPRPLWNAASQIL  422

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            M + Y L A AL G+LY+ + ++G+CYGV+ ++ +PT SELFGLK+FGLI + + +  PL
Sbjct  423  MAVGYILMAVALPGSLYIGSIVVGVCYGVRLAVSVPTASELFGLKYFGLIYNILILNLPL  482

Query  381  GAYLFSGLLAGYLYDIEAAKQH--SDTCIGPNCFRVTFlvlaglcsagallsVVLTVRLK  208
            G++LFSGLLAG LYD +A       +TC+G +C+R+ F+++A  C  G  L V+L +R K
Sbjct  483  GSFLFSGLLAGLLYDAQATPTPGGGNTCVGAHCYRLVFIIMAVACVIGFGLDVLLGIRTK  542

Query  207  PVYQMLY-AGGSFRLPQSSN  151
             +Y  +Y +  S +L  +SN
Sbjct  543  KIYTKIYMSRRSKKLASASN  562



>ref|XP_009108692.1| PREDICTED: probable transporter mch1 [Brassica rapa]
Length=557

 Score =   156 bits (394),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 83/198 (42%), Positives = 126/198 (64%), Gaps = 4/198 (2%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            V+NN+ Q+G+A G  D +I +S+ S   F GR+  G +SEHF++    PR +W   +QVV
Sbjct  358  VMNNMGQIGLALGYTDVSIFVSMMSIWGFFGRILSGTISEHFIKKNGTPRPLWNAASQVV  417

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            M + Y L A A+ G+LY  + ++G CYGV+ +I +P  SELFGLK++GL+ + + +  PL
Sbjct  418  MAVGYLLMALAIPGSLYFGSVVVGACYGVRLAITVPIASELFGLKYYGLLYNILILNFPL  477

Query  381  GAYLFSGLLAGYLYDIEAAKQHS--DTCIGPNCFRVTFlvlaglcsagallsVVLTVRLK  208
            G++LFSGLLAG LYD EA       +TC+G +C+R+ F+V+A     G  L   L  R K
Sbjct  478  GSFLFSGLLAGLLYDAEATPTPDGGNTCVGAHCYRLVFIVMAFTSIIGVGLDFWLAFRTK  537

Query  207  PVYQMLYAGGSFRLPQSS  154
             +Y  ++A  S ++ +SS
Sbjct  538  EIYTKIHA--SKKVKRSS  553



>gb|KJB32647.1| hypothetical protein B456_005G253600 [Gossypium raimondii]
Length=556

 Score =   155 bits (393),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 79/198 (40%), Positives = 129/198 (65%), Gaps = 2/198 (1%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            V+NN+AQ+G+A G  D +I +SL S   F GR+  G VSE+F++    PR IW   +Q++
Sbjct  353  VMNNMAQIGLALGHADVSIFVSLISIWGFFGRITSGSVSEYFLKKAGTPRPIWNAASQIL  412

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            M + + L A A+ G +Y+ + ++G CYGV+ ++ +P  SELFGLK++GL+ + + +  P+
Sbjct  413  MAVGFLLMALAMPGCVYIGSIIVGACYGVRLAVSVPVASELFGLKYYGLLYNVLILNLPI  472

Query  381  GAYLFSGLLAGYLYDIEAAKQH--SDTCIGPNCFRVTFlvlaglcsagallsVVLTVRLK  208
            G++LFSGLLAGYLYD EA       +TC+G +C+R+ F+++A     G  L V+LT+R K
Sbjct  473  GSFLFSGLLAGYLYDAEATPTPGGGNTCVGSHCYRLVFIIMALASILGFGLDVLLTIRSK  532

Query  207  PVYQMLYAGGSFRLPQSS  154
             +Y  ++     + P ++
Sbjct  533  DIYTKIFTRRKSKKPSTT  550



>ref|XP_002277695.1| PREDICTED: probable transporter mch1 [Vitis vinifera]
 emb|CBI37892.3| unnamed protein product [Vitis vinifera]
Length=549

 Score =   155 bits (392),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 85/200 (43%), Positives = 128/200 (64%), Gaps = 2/200 (1%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            V+NN+ Q+G+A G  D +I +SL S   F GR+  G VSE+F+     PR  W   +Q++
Sbjct  348  VMNNMGQMGLALGYVDVSIFVSLTSIWGFFGRILSGSVSEYFIGKAGTPRPFWNAASQIL  407

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            M + Y + A AL G+LY+ + ++GICYGV+ ++ +P  SELFGLK++GLI + + +  PL
Sbjct  408  MAVGYVVMAMALPGSLYIGSVVVGICYGVRLAVTVPIASELFGLKYYGLIYNILILNLPL  467

Query  381  GAYLFSGLLAGYLYDIEAAKQH--SDTCIGPNCFRVTFlvlaglcsagallsVVLTVRLK  208
            G++LFSGLLAG LYD  A +      TCIGP+C+R+ F+V+A  C  G  L V+L +R K
Sbjct  468  GSFLFSGLLAGLLYDAHATRTAGGGTTCIGPHCYRLVFVVMALSCIIGFGLDVLLAIRTK  527

Query  207  PVYQMLYAGGSFRLPQSSNH  148
             VY  + A    + P + ++
Sbjct  528  NVYSKIRASKRSKKPAAPSN  547



>ref|XP_008808634.1| PREDICTED: probable transporter mch1 [Phoenix dactylifera]
Length=543

 Score =   155 bits (391),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 79/187 (42%), Positives = 127/187 (68%), Gaps = 2/187 (1%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            V+NN+ Q+G+A G  D +I +S+ S   F GR+G G +SE+F++    PR +W   +Q++
Sbjct  340  VMNNMGQMGLAMGYTDVSIFVSMTSIWGFFGRIGSGSISEYFLKRTGTPRPVWNAASQIL  399

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            M I Y + A AL G+LYV + ++G+CYGV+ ++ +PT SELFGLKH+GL+ + + +  PL
Sbjct  400  MAIGYVVMALALPGSLYVGSIVVGLCYGVRVAVTVPTASELFGLKHYGLMYNILILNLPL  459

Query  381  GAYLFSGLLAGYLYDIEAAKQH--SDTCIGPNCFRVTFlvlaglcsagallsVVLTVRLK  208
            G++LFSGLLAG LYD +A +     +TC+G +C+R+ F+++A  C  G  L V+L  R +
Sbjct  460  GSFLFSGLLAGLLYDSQATETAGGGNTCVGAHCYRLVFVIMAFACLIGFGLDVLLAFRTR  519

Query  207  PVYQMLY  187
             +Y  ++
Sbjct  520  KLYSKIH  526



>gb|AFG47257.1| hypothetical protein 0_6091_01, partial [Pinus taeda]
 gb|AFG47258.1| hypothetical protein 0_6091_01, partial [Pinus taeda]
 gb|AFG47259.1| hypothetical protein 0_6091_01, partial [Pinus taeda]
 gb|AFG47260.1| hypothetical protein 0_6091_01, partial [Pinus taeda]
 gb|AFG47261.1| hypothetical protein 0_6091_01, partial [Pinus taeda]
 gb|AFG47262.1| hypothetical protein 0_6091_01, partial [Pinus taeda]
 gb|AFG47264.1| hypothetical protein 0_6091_01, partial [Pinus taeda]
 gb|AFG47265.1| hypothetical protein 0_6091_01, partial [Pinus taeda]
 gb|AFG47266.1| hypothetical protein 0_6091_01, partial [Pinus taeda]
 gb|AFG47267.1| hypothetical protein 0_6091_01, partial [Pinus taeda]
 gb|AFG47268.1| hypothetical protein 0_6091_01, partial [Pinus taeda]
 gb|AFG47269.1| hypothetical protein 0_6091_01, partial [Pinus taeda]
 gb|AFG47270.1| hypothetical protein 0_6091_01, partial [Pinus taeda]
 gb|AFG47271.1| hypothetical protein 0_6091_01, partial [Pinus taeda]
Length=137

 Score =   146 bits (368),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 81/134 (60%), Positives = 104/134 (78%), Gaps = 11/134 (8%)
 Frame = -1

Query  510  VATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPLGAYLFSGLLAGYLYDIE  331
            V  ALLGICYGVQFS+++PT SELFGLKHFG+I +F+ IGNPLGA+ FSGLLA Y+YD E
Sbjct  1    VGCALLGICYGVQFSVMVPTASELFGLKHFGMIYNFLTIGNPLGAFFFSGLLAAYIYDKE  60

Query  330  AAKQ----------HSD-TCIGPNCFRVTFlvlaglcsagallsVVLTVRLKPVYQMLYA  184
            A KQ           SD  C+G +CFR+TFL++AG+C+ G LLS++LT R++PVY+MLYA
Sbjct  61   AEKQSGVFHPEFLTSSDVNCVGASCFRLTFLIMAGVCAVGTLLSMILTFRIRPVYEMLYA  120

Query  183  GGSFRLPQSSNH*H  142
            GGSFR+P ++   H
Sbjct  121  GGSFRIPGTAGSTH  134



>gb|AEW07590.1| hypothetical protein 0_6091_01, partial [Pinus lambertiana]
Length=137

 Score =   145 bits (367),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 81/134 (60%), Positives = 104/134 (78%), Gaps = 11/134 (8%)
 Frame = -1

Query  510  VATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPLGAYLFSGLLAGYLYDIE  331
            V  ALLGICYGVQFS+++PT SELFGLKHFG+I +F+ IGNPLGA+ FSGLLA Y+YD E
Sbjct  1    VGCALLGICYGVQFSVMVPTASELFGLKHFGMIYNFLTIGNPLGAFFFSGLLAAYIYDKE  60

Query  330  AAKQ----------HSD-TCIGPNCFRVTFlvlaglcsagallsVVLTVRLKPVYQMLYA  184
            A KQ           SD  C+G +CFR+TFL++AG+C+ G LLS++LT R++PVY+MLYA
Sbjct  61   AEKQSGVFHPEFLRSSDVNCVGASCFRLTFLIMAGVCAVGTLLSMILTFRIRPVYEMLYA  120

Query  183  GGSFRLPQSSNH*H  142
            GGSFR+P ++   H
Sbjct  121  GGSFRIPGTAGSTH  134



>gb|AEW07589.1| hypothetical protein 0_6091_01, partial [Pinus radiata]
Length=137

 Score =   145 bits (367),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 80/134 (60%), Positives = 104/134 (78%), Gaps = 11/134 (8%)
 Frame = -1

Query  510  VATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPLGAYLFSGLLAGYLYDIE  331
            V  ALLGICYGVQFS+++PT SELFGLKHFG+I +F+ IGNPLGA+ FSGLLA Y+YD E
Sbjct  1    VGCALLGICYGVQFSVMVPTASELFGLKHFGMIYNFLTIGNPLGAFFFSGLLAAYIYDKE  60

Query  330  AAKQ----HSD-------TCIGPNCFRVTFlvlaglcsagallsVVLTVRLKPVYQMLYA  184
            A KQ    H +        C+G +CFR+TFL++AG+C+ G LLS++LT R++PVY+MLYA
Sbjct  61   AEKQSGVFHPEFLTSSEVNCVGASCFRLTFLIMAGVCAVGTLLSMILTFRIRPVYEMLYA  120

Query  183  GGSFRLPQSSNH*H  142
            GGSFR+P ++   H
Sbjct  121  GGSFRIPGTAGSTH  134



>emb|CDY26781.1| BnaC09g09080D [Brassica napus]
Length=514

 Score =   154 bits (390),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 79/186 (42%), Positives = 123/186 (66%), Gaps = 2/186 (1%)
 Frame = -1

Query  735  NNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVVMI  556
            NN+ Q+G+A G  D +I +S+ S   F GR+  G +SEHF++    PR +W   +Q++M 
Sbjct  317  NNMGQIGLALGYTDVSIFVSMTSIWGFFGRILSGTLSEHFLKKAGTPRPLWNAASQILMA  376

Query  555  ITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPLGA  376
            + Y L A A+  +LY+ + ++G+CYGV+ +I +PT SELFGLK++GLI + + +  PLG+
Sbjct  377  VGYLLMALAVPNSLYIGSMVVGVCYGVRLAITVPTASELFGLKYYGLIYNILVLNLPLGS  436

Query  375  YLFSGLLAGYLYDIEAAKQH--SDTCIGPNCFRVTFlvlaglcsagallsVVLTVRLKPV  202
            +LFSGLLAG+LYD EA       +TC+G +C+R+ FLV+A     G  L ++L  R K +
Sbjct  437  FLFSGLLAGFLYDAEATPTPGGGNTCVGAHCYRLIFLVMALASIIGVGLDILLAYRTKEI  496

Query  201  YQMLYA  184
            Y  ++A
Sbjct  497  YAKIHA  502



>gb|AFG47255.1| hypothetical protein 0_6091_01, partial [Pinus taeda]
 gb|AFG47256.1| hypothetical protein 0_6091_01, partial [Pinus taeda]
 gb|AFG47263.1| hypothetical protein 0_6091_01, partial [Pinus taeda]
Length=137

 Score =   145 bits (366),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 80/134 (60%), Positives = 104/134 (78%), Gaps = 11/134 (8%)
 Frame = -1

Query  510  VATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPLGAYLFSGLLAGYLYDIE  331
            V  ALLGICYGVQFS+++PT SELFGLKHFG+I +F+ IGNPLGA+ FSGLLA Y+YD E
Sbjct  1    VGCALLGICYGVQFSVMVPTASELFGLKHFGMIYNFLTIGNPLGAFFFSGLLAAYIYDKE  60

Query  330  AAKQ----HSD-------TCIGPNCFRVTFlvlaglcsagallsVVLTVRLKPVYQMLYA  184
            A KQ    H +        C+G +CFR+TFL++AG+C+ G LLS++LT R++PVY+MLYA
Sbjct  61   AEKQSGVFHPEFLTSSGVNCVGASCFRLTFLIMAGVCAVGTLLSMILTFRIRPVYEMLYA  120

Query  183  GGSFRLPQSSNH*H  142
            GGSFR+P ++   H
Sbjct  121  GGSFRIPGTAGSTH  134



>ref|XP_008447967.1| PREDICTED: uncharacterized protein LOC103490296 [Cucumis melo]
Length=515

 Score =   154 bits (389),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 79/188 (42%), Positives = 124/188 (66%), Gaps = 2/188 (1%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            V+NN+ Q+G+A G  D +I +SL S   F GR+  G  SEHF++   +PR +W   +Q++
Sbjct  325  VMNNMGQIGLALGYEDVSIFISLMSIWGFFGRILSGSASEHFIKKAGMPRPLWNAASQIL  384

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            M + Y + A A+ G+LY+ + ++GICYGV+ +I +P  SE+FGLK++G+I + + +  PL
Sbjct  385  MALGYIVLAIAIPGSLYIGSIVVGICYGVRLAITVPMASEVFGLKNYGMIYNVLILNLPL  444

Query  381  GAYLFSGLLAGYLYDIEA--AKQHSDTCIGPNCFRVTFlvlaglcsagallsVVLTVRLK  208
            G++LFSGLLAG LYD+EA   K   +TC G +C+R+ F+V+A  C  G  + + L  R K
Sbjct  445  GSFLFSGLLAGILYDMEATTTKTGGNTCTGAHCYRLVFVVMACSCGIGFAMDLFLAFRTK  504

Query  207  PVYQMLYA  184
             +Y  + A
Sbjct  505  RLYSKMRA  512



>gb|KHN05409.1| Putative membrane protein YMR155W [Glycine soja]
Length=539

 Score =   154 bits (388),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 82/183 (45%), Positives = 125/183 (68%), Gaps = 2/183 (1%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            V+NN+ Q+G+A G  D ++ LSL S   F GR+  G VSE  ++  A PR +W   +Q++
Sbjct  338  VMNNMGQIGLALGYPDVSLFLSLTSIFGFFGRIISGTVSEFTIKKAATPRPLWNAASQLL  397

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            M + Y L A A+ G+LY+ + L+G+CYGV+ +I +PT SELFGLK++GLI + + +  PL
Sbjct  398  MAVGYILLAMAMPGSLYIGSILVGMCYGVRLAITVPTASELFGLKYYGLIYNILILNLPL  457

Query  381  GAYLFSGLLAGYLYDIEAAKQH--SDTCIGPNCFRVTFlvlaglcsagallsVVLTVRLK  208
            G++LFSGLLAG LYD+EA       +TC+G +C+R+ F+V+ G C  G  L ++L++R K
Sbjct  458  GSFLFSGLLAGILYDMEATTTEGGGNTCVGGHCYRLVFIVMTGACIVGFFLDILLSIRTK  517

Query  207  PVY  199
             +Y
Sbjct  518  NIY  520



>ref|XP_010467394.1| PREDICTED: uncharacterized protein LOC104747461 [Camelina sativa]
Length=547

 Score =   154 bits (388),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 78/188 (41%), Positives = 125/188 (66%), Gaps = 2/188 (1%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            V+NN+ Q+G+A G  + +I +S+ S   F GR+  G +SE+F++    PR +W   +Q++
Sbjct  347  VMNNMGQIGLALGYTNVSIFVSMTSIWGFFGRILSGTLSEYFLKKAGTPRPLWNAASQIL  406

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            M + Y L A A+  +LY+ + ++G+CYGV+ +I +PT SELFGLK++GLI + + +  PL
Sbjct  407  MAVGYILMALAVPNSLYIGSMVVGVCYGVRLAITVPTASELFGLKYYGLIYNILVLNLPL  466

Query  381  GAYLFSGLLAGYLYDIEAAKQH--SDTCIGPNCFRVTFlvlaglcsagallsVVLTVRLK  208
            G++LFSGLLAG+LYD EA       +TC+G +C+R+ F+V+A     G  L +VL  R K
Sbjct  467  GSFLFSGLLAGFLYDAEATPTPGGGNTCVGAHCYRLIFIVMALASVVGVGLDLVLAYRTK  526

Query  207  PVYQMLYA  184
             +Y  ++A
Sbjct  527  EIYAKIHA  534



>ref|XP_010516479.1| PREDICTED: uncharacterized protein LOC104792123 [Camelina sativa]
Length=547

 Score =   153 bits (387),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 78/188 (41%), Positives = 125/188 (66%), Gaps = 2/188 (1%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            V+NN+ Q+G+A G  + +I +S+ S   F GR+  G +SE+F++    PR +W   +Q++
Sbjct  347  VMNNMGQIGLALGYTNVSIFVSMTSIWGFFGRILSGTLSEYFLKKAGTPRPLWNAASQIL  406

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            M + Y L A A+  +LY+ + ++G+CYGV+ +I +PT SELFGLK++GLI + + +  PL
Sbjct  407  MAVGYILMALAVPNSLYIGSMVVGVCYGVRLAITVPTASELFGLKYYGLIYNILVLNLPL  466

Query  381  GAYLFSGLLAGYLYDIEAAKQH--SDTCIGPNCFRVTFlvlaglcsagallsVVLTVRLK  208
            G++LFSGLLAG+LYD EA       +TC+G +C+R+ F+V+A     G  L +VL  R K
Sbjct  467  GSFLFSGLLAGFLYDAEATPTPGGGNTCVGAHCYRLIFIVMALASVIGVGLDLVLAYRTK  526

Query  207  PVYQMLYA  184
             +Y  ++A
Sbjct  527  EIYAKIHA  534



>ref|XP_006296698.1| hypothetical protein CARUB_v10013397mg [Capsella rubella]
 gb|EOA29596.1| hypothetical protein CARUB_v10013397mg [Capsella rubella]
Length=545

 Score =   153 bits (387),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 78/188 (41%), Positives = 125/188 (66%), Gaps = 2/188 (1%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            V+NN+ Q+G+A G  + +I +S+ S   F GR+  G +SE+F++    PR +W   +Q++
Sbjct  346  VMNNMGQIGLALGYTNVSIFVSMTSIWGFFGRILSGTLSEYFLKKAGTPRPLWNAASQIL  405

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            M + Y L A A+  +LY+ + ++G+CYGV+ +I +PT SELFGLK++GLI + + +  PL
Sbjct  406  MAVGYILMALAVPNSLYIGSMVVGVCYGVRLAITVPTASELFGLKYYGLIYNILVLNLPL  465

Query  381  GAYLFSGLLAGYLYDIEAAKQH--SDTCIGPNCFRVTFlvlaglcsagallsVVLTVRLK  208
            G++LFSGLLAG+LYD EA       +TC+G +C+R+ F+V+A     G  L +VL  R K
Sbjct  466  GSFLFSGLLAGFLYDAEATPTPGGGNTCVGAHCYRLIFIVMALASVVGVGLDLVLAYRTK  525

Query  207  PVYQMLYA  184
             +Y  ++A
Sbjct  526  EIYAKIHA  533



>ref|NP_179257.1| Major facilitator superfamily protein [Arabidopsis thaliana]
 gb|AAD24599.1| nodulin-like protein [Arabidopsis thaliana]
 gb|AAL49867.1| putative nodulin protein [Arabidopsis thaliana]
 gb|AAM19945.1| At2g16660/T24I21.7 [Arabidopsis thaliana]
 gb|AAN33210.1| At2g16660/T24I21.7 [Arabidopsis thaliana]
 gb|AEC06523.1| Major facilitator superfamily protein [Arabidopsis thaliana]
Length=546

 Score =   153 bits (387),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 78/188 (41%), Positives = 125/188 (66%), Gaps = 2/188 (1%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            V+NN+ Q+G+A G  + +I +S+ S   F GR+  G +SE+F++    PR +W   +Q++
Sbjct  347  VMNNMGQIGLALGYTNVSIFVSMTSIWGFFGRILSGTLSEYFLKKAGTPRPLWNAASQIL  406

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            M + Y L A A+  +LY+ + ++G+CYGV+ +I +PT SELFGLK++GLI + + +  PL
Sbjct  407  MAVGYILMALAVPNSLYIGSMVVGVCYGVRLAITVPTASELFGLKYYGLIYNILVLNLPL  466

Query  381  GAYLFSGLLAGYLYDIEAAKQH--SDTCIGPNCFRVTFlvlaglcsagallsVVLTVRLK  208
            G++LFSGLLAG+LYD EA       +TC+G +C+R+ F+V+A     G  L +VL  R K
Sbjct  467  GSFLFSGLLAGFLYDAEATPTPGGGNTCVGAHCYRLIFIVMALASVIGVGLDLVLAYRTK  526

Query  207  PVYQMLYA  184
             +Y  ++A
Sbjct  527  EIYAKIHA  534



>ref|XP_002886064.1| nodulin family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH62323.1| nodulin family protein [Arabidopsis lyrata subsp. lyrata]
Length=545

 Score =   153 bits (387),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 78/188 (41%), Positives = 125/188 (66%), Gaps = 2/188 (1%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            V+NN+ Q+G+A G  + +I +S+ S   F GR+  G +SE+F++    PR +W   +Q++
Sbjct  346  VMNNMGQIGLALGYTNVSIFVSMTSIWGFFGRILSGTLSEYFLKKAGTPRPLWNAASQIL  405

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            M + Y L A A+  +LY+ + ++G+CYGV+ +I +PT SELFGLK++GLI + + +  PL
Sbjct  406  MAVGYILMALAVPNSLYIGSMVVGVCYGVRLAITVPTASELFGLKYYGLIYNILVLNLPL  465

Query  381  GAYLFSGLLAGYLYDIEAAKQH--SDTCIGPNCFRVTFlvlaglcsagallsVVLTVRLK  208
            G++LFSGLLAG+LYD EA       +TC+G +C+R+ F+V+A     G  L +VL  R K
Sbjct  466  GSFLFSGLLAGFLYDAEATPTPGGGNTCVGAHCYRLIFIVMALASVIGVGLDLVLAYRTK  525

Query  207  PVYQMLYA  184
             +Y  ++A
Sbjct  526  EIYAKIHA  533



>gb|KHG25802.1| Membrane protein [Gossypium arboreum]
Length=552

 Score =   153 bits (386),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 77/200 (39%), Positives = 129/200 (65%), Gaps = 2/200 (1%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            V+NN+AQ+G+A G  D +I +SL S   F GR+  G VSE+F++    PR +W   +Q++
Sbjct  349  VMNNMAQIGLALGHADVSIFVSLISIWGFFGRITSGSVSEYFLKKAGTPRPLWNAASQIL  408

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            M + + + A A+ G LY+ + ++G CYGV+ ++ +P  SELFGLK++GL+ + + +  P+
Sbjct  409  MAVGFLVMALAMPGCLYIGSIIIGACYGVRLAVSVPVASELFGLKYYGLLYNVLILNLPI  468

Query  381  GAYLFSGLLAGYLYDIEAAKQH--SDTCIGPNCFRVTFlvlaglcsagallsVVLTVRLK  208
            G++LFSGLLAGYLYD +A       +TC+G +C+R+ F+++A     G  L V+LT+R K
Sbjct  469  GSFLFSGLLAGYLYDAQATPTPGGGNTCVGSHCYRLVFIIMALASILGFGLDVLLTIRSK  528

Query  207  PVYQMLYAGGSFRLPQSSNH  148
             +Y  ++     + P ++  
Sbjct  529  YIYTKIFTRRKSKKPSTTTE  548



>ref|XP_003540845.1| PREDICTED: uncharacterized membrane protein YMR155W-like [Glycine 
max]
Length=550

 Score =   153 bits (386),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 82/183 (45%), Positives = 125/183 (68%), Gaps = 2/183 (1%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            V+NN+ Q+G+A G  D ++ LSL S   F GR+  G VSE  ++  A PR +W   +Q++
Sbjct  349  VMNNMGQIGLALGYPDISLFLSLTSIFGFFGRIISGTVSEFTIKKAATPRPLWNAASQLL  408

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            M + Y L A A+ G+LY+ + L+G+CYGV+ +I +PT SELFGLK++GLI + + +  PL
Sbjct  409  MAVGYILLAMAMPGSLYIGSILVGMCYGVRLAITVPTASELFGLKYYGLIYNILILNLPL  468

Query  381  GAYLFSGLLAGYLYDIEAAKQH--SDTCIGPNCFRVTFlvlaglcsagallsVVLTVRLK  208
            G++LFSGLLAG LYD+EA       +TC+G +C+R+ F+V+ G C  G  L ++L++R K
Sbjct  469  GSFLFSGLLAGILYDMEATTTEGGGNTCVGGHCYRLVFIVMTGACIVGFFLDILLSIRTK  528

Query  207  PVY  199
             +Y
Sbjct  529  NIY  531



>ref|XP_010489237.1| PREDICTED: uncharacterized protein LOC104766963 [Camelina sativa]
Length=547

 Score =   153 bits (386),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 78/188 (41%), Positives = 125/188 (66%), Gaps = 2/188 (1%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            V+NN+ Q+G+A G  + +I +S+ S   F GR+  G +SE+F++    PR +W   +Q++
Sbjct  347  VMNNMGQIGLALGYTNVSIFVSMTSIWGFFGRILSGTLSEYFLKKSGTPRPLWNAASQIL  406

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            M + Y L A A+  +LY+ + ++G+CYGV+ +I +PT SELFGLK++GLI + + +  PL
Sbjct  407  MAVGYILMALAVPNSLYIGSMVVGVCYGVRLAITVPTASELFGLKYYGLIYNILVLNLPL  466

Query  381  GAYLFSGLLAGYLYDIEAAKQH--SDTCIGPNCFRVTFlvlaglcsagallsVVLTVRLK  208
            G++LFSGLLAG+LYD EA       +TC+G +C+R+ F+V+A     G  L +VL  R K
Sbjct  467  GSFLFSGLLAGFLYDAEATPTPGGGNTCVGAHCYRLIFIVMALASVIGVGLDLVLAYRTK  526

Query  207  PVYQMLYA  184
             +Y  ++A
Sbjct  527  EIYVKIHA  534



>ref|XP_007041879.1| Major facilitator superfamily protein [Theobroma cacao]
 gb|EOX97710.1| Major facilitator superfamily protein [Theobroma cacao]
Length=556

 Score =   152 bits (385),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 77/187 (41%), Positives = 126/187 (67%), Gaps = 2/187 (1%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            V+NN+AQ+G+A G  D ++ +SL S   F GR+  G VSE+F++    PR +W   +Q++
Sbjct  355  VMNNMAQIGLALGHADVSMFVSLTSIWGFFGRIISGSVSEYFLKKAGTPRPLWNAASQIL  414

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            M + + L A A+ G+LY+ + ++GICYGV+ ++ +P  SELFGLK++GL+ + + +  P+
Sbjct  415  MAVGFLLMALAMPGSLYIGSIVVGICYGVRLAVTVPVASELFGLKYYGLLYNILVLNLPI  474

Query  381  GAYLFSGLLAGYLYDIEAAKQH--SDTCIGPNCFRVTFlvlaglcsagallsVVLTVRLK  208
            G++LFSGLLAGYLYD +A       +TC+G +C+R+ F+++A     G  L V+L +R K
Sbjct  475  GSFLFSGLLAGYLYDAQATPTPGGGNTCVGAHCYRLVFIIMAIASVIGFGLDVLLAIRTK  534

Query  207  PVYQMLY  187
             VY  ++
Sbjct  535  NVYTKIF  541



>emb|CDP01885.1| unnamed protein product [Coffea canephora]
Length=496

 Score =   152 bits (383),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 83/194 (43%), Positives = 124/194 (64%), Gaps = 3/194 (2%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            VLNNL Q+G A G ND +I +SL S   F GR+  G+ SE+ +  KA PR +W   +Q+V
Sbjct  293  VLNNLGQMGQALGYNDVSIFISLTSIWGFFGRIISGMASEYCIEKKATPRPMWNAVSQIV  352

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            M     + A A  G+LY+ + L+GICYGV+ +I +P  SELFGLK++GL+ + + +  PL
Sbjct  353  MAAGCVVMAVAFPGSLYIGSILVGICYGVRLAITVPVASELFGLKYYGLLYNILMLNLPL  412

Query  381  GAYLFSGLLAGYLYDIEAAKQHS---DTCIGPNCFRVTFlvlaglcsagallsVVLTVRL  211
            G++LFSGLLAGYLYD  A        ++C+GP+C+R+ F+++A  C  G  L ++L +R 
Sbjct  413  GSFLFSGLLAGYLYDARATTSIDGVGNSCLGPHCYRLVFIIMATTCVFGFGLDMLLALRT  472

Query  210  KPVYQMLYAGGSFR  169
            K +Y  ++    F 
Sbjct  473  KNLYLKIHEIKKFN  486



>ref|XP_001758608.1| predicted protein [Physcomitrella patens]
 gb|EDQ76586.1| predicted protein, partial [Physcomitrella patens]
Length=558

 Score =   152 bits (383),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 86/194 (44%), Positives = 119/194 (61%), Gaps = 9/194 (5%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            V++NL Q+  + G  D  I ++L S  NF+GRLGGG VSE   R  ALPR I +  +Q +
Sbjct  365  VIDNLGQISQSLGYKDAHIFVALISIWNFLGRLGGGYVSEVIAREHALPRPILLAASQTL  424

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            M + +   A A+ G LY  + L+G+ YG  ++I+  T SELFGLKHFG+I +F+ + NP 
Sbjct  425  MAVGHASLAVAMPGALYAGSLLVGMGYGAHWAIVPATASELFGLKHFGIIFNFLTMANPA  484

Query  381  GAYLFSGLLAGYLYDIEAAKQHSD---------TCIGPNCFRVTFlvlaglcsagallsV  229
            G+ +FSGL+AG LYD EA KQH +          C GP CFR T  ++ G+C  G  L+ 
Sbjct  485  GSLVFSGLIAGTLYDREAKKQHGEFAPGEVDVLKCEGPVCFRETLFIMTGMCMLGVALNC  544

Query  228  VLTVRLKPVYQMLY  187
            +L  R + VY MLY
Sbjct  545  LLVSRTQRVYTMLY  558



>ref|XP_007046677.1| Major facilitator superfamily protein [Theobroma cacao]
 gb|EOX90834.1| Major facilitator superfamily protein [Theobroma cacao]
Length=544

 Score =   151 bits (381),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 83/201 (41%), Positives = 131/201 (65%), Gaps = 3/201 (1%)
 Frame = -1

Query  741  VLNNLAQVGIAQGVNDTTILLSLFSFCNFVGRLGGGIVSEHFVRLKALPRTIWMTFTQVV  562
            V+NN+ Q+G+A G  D +I +SL S   F GR+  G++SE+++     PR +W   +QV+
Sbjct  338  VMNNMGQMGLALGYPDVSIFVSLTSIWGFFGRIASGLLSEYYIWKFGTPRPLWNAASQVL  397

Query  561  MIITYFLFASALNGTLYVATALLGICYGVQFSILIPTTSELFGLKHFGLILSFMGIGNPL  382
            M   Y + A AL G+LYV + L+GICYGV+ ++ +P  SELFGLK++GL+ + + +  PL
Sbjct  398  MSTGYVIMAFALPGSLYVGSILVGICYGVRLTVTVPVASELFGLKYYGLVYNILILNLPL  457

Query  381  GAYLFSGLLAGYLYDIEAAKQH--SDTCIGPNCFRVTFlvlaglcsagallsVVLTVRLK  208
            G++LFSGLLAGYLYD EAA      +TCIG +C+ + F+++A  C  G  L ++L  R +
Sbjct  458  GSFLFSGLLAGYLYDAEAAANDGGGNTCIGAHCYCLVFVIMAITCVLGLGLDMLLAARTR  517

Query  207  PVYQMLY-AGGSFRLPQSSNH  148
             VY  ++ +  S    ++++H
Sbjct  518  TVYAKIHESKKSIIATKTTDH  538



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1347639082210