BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF009I22

Length=781
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006342964.1|  PREDICTED: casein kinase I isoform delta-like      152   5e-39   Solanum tuberosum [potatoes]
ref|XP_009631548.1|  PREDICTED: casein kinase I isoform delta-like      145   9e-37   
ref|XP_009798249.1|  PREDICTED: casein kinase I-like isoform X1         145   1e-36   Nicotiana sylvestris
ref|XP_004235583.1|  PREDICTED: casein kinase I isoform delta-like      142   2e-35   Solanum lycopersicum
ref|XP_009795173.1|  PREDICTED: casein kinase I isoform delta-like      137   7e-34   Nicotiana sylvestris
ref|XP_009631851.1|  PREDICTED: casein kinase I isoform delta-like      135   3e-33   Nicotiana tomentosiformis
emb|CDO97889.1|  unnamed protein product                                132   5e-32   Coffea canephora [robusta coffee]
ref|XP_006357391.1|  PREDICTED: casein kinase I isoform delta-like      130   2e-31   Solanum tuberosum [potatoes]
ref|XP_004241866.1|  PREDICTED: casein kinase I-like                    125   2e-29   Solanum lycopersicum
ref|XP_009372402.1|  PREDICTED: casein kinase I isoform delta-like      122   3e-28   Pyrus x bretschneideri [bai li]
ref|XP_002277513.2|  PREDICTED: casein kinase I isoform delta-like      119   2e-27   Vitis vinifera
ref|XP_008338711.1|  PREDICTED: casein kinase I isoform delta-like      114   2e-26   
ref|XP_008391353.1|  PREDICTED: casein kinase I isoform delta-like      116   2e-26   Malus domestica [apple tree]
ref|XP_009335830.1|  PREDICTED: casein kinase I isoform delta-like      115   5e-26   Pyrus x bretschneideri [bai li]
ref|XP_007024533.1|  Casein kinase 1-like protein 2                     113   3e-25   Theobroma cacao [chocolate]
gb|KDO65164.1|  hypothetical protein CISIN_1g010674mg                   112   5e-25   Citrus sinensis [apfelsine]
ref|XP_010262044.1|  PREDICTED: casein kinase I isoform delta-like      112   5e-25   Nelumbo nucifera [Indian lotus]
gb|KDO65160.1|  hypothetical protein CISIN_1g010674mg                   111   1e-24   Citrus sinensis [apfelsine]
ref|XP_007217223.1|  hypothetical protein PRUPE_ppa005139mg             111   2e-24   Prunus persica
ref|XP_008228258.1|  PREDICTED: casein kinase I isoform delta-like      110   2e-24   Prunus mume [ume]
gb|KDO65163.1|  hypothetical protein CISIN_1g010674mg                   110   2e-24   Citrus sinensis [apfelsine]
ref|XP_006465998.1|  PREDICTED: casein kinase I isoform delta-like      110   2e-24   Citrus sinensis [apfelsine]
gb|KDO65159.1|  hypothetical protein CISIN_1g010674mg                   110   2e-24   Citrus sinensis [apfelsine]
gb|KDO65156.1|  hypothetical protein CISIN_1g010674mg                   110   2e-24   Citrus sinensis [apfelsine]
gb|KDO65158.1|  hypothetical protein CISIN_1g010674mg                   110   5e-24   Citrus sinensis [apfelsine]
ref|XP_006426585.1|  hypothetical protein CICLE_v10025527mg             109   6e-24   Citrus clementina [clementine]
ref|XP_010242267.1|  PREDICTED: casein kinase I isoform delta-like      107   2e-23   Nelumbo nucifera [Indian lotus]
ref|XP_002521378.1|  casein kinase, putative                            107   3e-23   
ref|XP_010087711.1|  Casein kinase I isoform delta-like protein         107   3e-23   
gb|KDP40745.1|  hypothetical protein JCGZ_24744                         104   3e-22   Jatropha curcas
gb|EYU45867.1|  hypothetical protein MIMGU_mgv1a005939mg                102   1e-21   Erythranthe guttata [common monkey flower]
ref|XP_008242376.1|  PREDICTED: casein kinase I isoform delta-like      100   7e-21   Prunus mume [ume]
ref|XP_003543581.1|  PREDICTED: casein kinase I isoform delta-lik...    100   8e-21   Glycine max [soybeans]
ref|XP_007201986.1|  hypothetical protein PRUPE_ppa004932mg             100   8e-21   
gb|KHN30066.1|  Casein kinase I isoform delta-like                      100   9e-21   Glycine soja [wild soybean]
ref|XP_002281345.2|  PREDICTED: casein kinase I isoform delta-like      100   2e-20   Vitis vinifera
ref|XP_004303659.1|  PREDICTED: casein kinase I                       99.0    3e-20   Fragaria vesca subsp. vesca
ref|XP_008447619.1|  PREDICTED: casein kinase I isoform delta-like    99.0    4e-20   Cucumis melo [Oriental melon]
ref|XP_002514130.1|  casein kinase, putative                          96.7    2e-19   
gb|KHN32707.1|  Casein kinase I isoform delta-like                    94.4    3e-19   Glycine soja [wild soybean]
ref|XP_004151319.1|  PREDICTED: casein kinase I isoform delta-like    96.3    3e-19   Cucumis sativus [cucumbers]
ref|XP_011079987.1|  PREDICTED: casein kinase I-like                  95.5    5e-19   Sesamum indicum [beniseed]
ref|XP_007012783.1|  Casein kinase 1-like protein 2 isoform 1         95.1    7e-19   
gb|KDO53221.1|  hypothetical protein CISIN_1g011819mg                 93.2    9e-19   Citrus sinensis [apfelsine]
ref|XP_010049456.1|  PREDICTED: casein kinase I isoform delta-like    94.7    1e-18   Eucalyptus grandis [rose gum]
ref|XP_010696534.1|  PREDICTED: casein kinase I isoform delta-like    94.4    1e-18   Beta vulgaris subsp. vulgaris [field beet]
gb|KDO53220.1|  hypothetical protein CISIN_1g011819mg                 93.2    2e-18   Citrus sinensis [apfelsine]
gb|KDO53219.1|  hypothetical protein CISIN_1g011819mg                 93.2    2e-18   Citrus sinensis [apfelsine]
gb|KDP33855.1|  hypothetical protein JCGZ_07426                       94.0    2e-18   Jatropha curcas
ref|XP_006597037.1|  PREDICTED: uncharacterized protein LOC100795...  93.6    3e-18   Glycine max [soybeans]
ref|NP_001242599.1|  uncharacterized protein LOC100795570             93.6    3e-18   Glycine max [soybeans]
gb|KJB56939.1|  hypothetical protein B456_009G142600                  93.2    3e-18   Gossypium raimondii
ref|XP_010062656.1|  PREDICTED: casein kinase I isoform delta-lik...  92.8    4e-18   Eucalyptus grandis [rose gum]
gb|KHG04850.1|  hypothetical protein F383_30273                       93.2    4e-18   Gossypium arboreum [tree cotton]
gb|KDO53216.1|  hypothetical protein CISIN_1g011819mg                 92.8    5e-18   Citrus sinensis [apfelsine]
gb|KDO53218.1|  hypothetical protein CISIN_1g011819mg                 92.4    5e-18   Citrus sinensis [apfelsine]
ref|XP_010062655.1|  PREDICTED: casein kinase I isoform delta-lik...  92.4    6e-18   Eucalyptus grandis [rose gum]
ref|XP_006451505.1|  hypothetical protein CICLE_v10008160mg           92.4    7e-18   Citrus clementina [clementine]
ref|XP_004486851.1|  PREDICTED: casein kinase I isoform delta-like    92.0    9e-18   Cicer arietinum [garbanzo]
ref|XP_007012784.1|  Casein kinase 1 isoform 2                        91.7    1e-17   
gb|KJB06828.1|  hypothetical protein B456_001G013300                  90.1    1e-17   Gossypium raimondii
ref|XP_004510406.1|  PREDICTED: casein kinase I isoform delta-like    91.7    1e-17   Cicer arietinum [garbanzo]
ref|XP_011013818.1|  PREDICTED: casein kinase I isoform delta-like    91.7    1e-17   Populus euphratica
ref|XP_011009742.1|  PREDICTED: casein kinase I isoform delta-lik...  90.9    2e-17   Populus euphratica
emb|CCM43976.1|  Caesin kinase I isoform delta like protein           90.9    2e-17   Cucumis sativus [cucumbers]
ref|XP_004141059.1|  PREDICTED: casein kinase I isoform delta-like    90.9    2e-17   
emb|CDP03143.1|  unnamed protein product                              90.5    3e-17   Coffea canephora [robusta coffee]
ref|XP_009361635.1|  PREDICTED: casein kinase I isoform delta-like    90.1    5e-17   Pyrus x bretschneideri [bai li]
gb|KHG18061.1|  hypothetical protein F383_22405                       89.7    5e-17   Gossypium arboreum [tree cotton]
ref|XP_010090074.1|  Casein kinase I isoform delta-like protein       89.7    5e-17   Morus notabilis
ref|XP_011009776.1|  PREDICTED: casein kinase I isoform delta-lik...  89.4    7e-17   Populus euphratica
ref|XP_009597979.1|  PREDICTED: casein kinase I isoform delta-like    89.4    8e-17   Nicotiana tomentosiformis
ref|XP_008459457.1|  PREDICTED: casein kinase I isoform delta-like    89.4    8e-17   Cucumis melo [Oriental melon]
gb|AFV33949.1|  casein kinase I                                       89.0    1e-16   Gossypium hirsutum [American cotton]
gb|KJB06827.1|  hypothetical protein B456_001G013300                  89.0    1e-16   Gossypium raimondii
ref|XP_008354554.1|  PREDICTED: casein kinase I isoform delta-like    87.8    1e-16   
gb|KHN11262.1|  Casein kinase I isoform delta-like                    88.6    2e-16   Glycine soja [wild soybean]
ref|XP_011009775.1|  PREDICTED: casein kinase I isoform delta-lik...  88.2    2e-16   Populus euphratica
ref|XP_006585503.1|  PREDICTED: casein kinase I isoform delta-lik...  88.2    2e-16   Glycine max [soybeans]
gb|KJB06826.1|  hypothetical protein B456_001G013300                  87.8    3e-16   Gossypium raimondii
ref|XP_006385411.1|  hypothetical protein POPTR_0003s04170g           87.4    3e-16   
ref|XP_004157925.1|  PREDICTED: casein kinase I isoform delta-like    87.4    4e-16   
ref|XP_009764702.1|  PREDICTED: casein kinase I isoform delta-like    87.0    5e-16   Nicotiana sylvestris
ref|XP_011003341.1|  PREDICTED: casein kinase I isoform delta-like    87.0    6e-16   Populus euphratica
gb|KHN39324.1|  Casein kinase I isoform delta-like                    86.7    6e-16   Glycine soja [wild soybean]
ref|XP_003529731.1|  PREDICTED: casein kinase I isoform delta-lik...  86.7    6e-16   
ref|XP_010924972.1|  PREDICTED: casein kinase I isoform delta-lik...  86.7    7e-16   Elaeis guineensis
ref|XP_002309212.1|  casein kinase family protein                     86.7    7e-16   Populus trichocarpa [western balsam poplar]
ref|XP_006371997.1|  casein kinase family protein                     86.3    8e-16   
ref|XP_006585502.1|  PREDICTED: casein kinase I isoform delta-lik...  86.3    9e-16   Glycine max [soybeans]
ref|XP_010033765.1|  PREDICTED: casein kinase I isoform delta-like    85.1    2e-15   Eucalyptus grandis [rose gum]
gb|KHG04851.1|  hypothetical protein F383_30273                       84.0    5e-15   Gossypium arboreum [tree cotton]
ref|XP_003533767.1|  PREDICTED: casein kinase I isoform delta-like    83.2    8e-15   Glycine max [soybeans]
gb|KHG23724.1|  hypothetical protein F383_04752                       82.4    2e-14   Gossypium arboreum [tree cotton]
ref|XP_007138711.1|  hypothetical protein PHAVU_009G230800g           81.6    3e-14   Phaseolus vulgaris [French bean]
ref|XP_002456234.1|  hypothetical protein SORBIDRAFT_03g032560        81.6    3e-14   Sorghum bicolor [broomcorn]
gb|KHN28842.1|  Casein kinase I isoform delta-like                    81.3    3e-14   Glycine soja [wild soybean]
gb|KJB83050.1|  hypothetical protein B456_013G227100                  80.9    6e-14   Gossypium raimondii
ref|XP_009800558.1|  PREDICTED: casein kinase I isoform delta-like    80.5    7e-14   Nicotiana sylvestris
ref|XP_009606359.1|  PREDICTED: casein kinase I isoform delta-like    80.1    9e-14   Nicotiana tomentosiformis
ref|XP_003546462.1|  PREDICTED: casein kinase I isoform delta-lik...  80.1    1e-13   Glycine max [soybeans]
ref|XP_008806949.1|  PREDICTED: casein kinase I isoform delta-lik...  80.1    1e-13   Phoenix dactylifera
ref|XP_003597566.1|  Casein kinase I isoform delta-like protein       79.7    1e-13   
ref|XP_003542336.1|  PREDICTED: casein kinase I isoform delta-lik...  79.7    1e-13   Glycine max [soybeans]
gb|KHN17681.1|  Casein kinase I isoform delta-like                    78.6    2e-13   Glycine soja [wild soybean]
ref|XP_003597565.1|  Casein kinase I isoform delta-like protein       79.3    2e-13   Medicago truncatula
gb|AHA84221.1|  casein kinase I isoform delta-like protein            79.0    3e-13   Phaseolus vulgaris [French bean]
ref|XP_003549210.1|  PREDICTED: casein kinase I isoform delta-lik...  78.6    4e-13   Glycine max [soybeans]
gb|ACJ85725.1|  unknown                                               78.6    4e-13   Medicago truncatula
ref|XP_003627159.1|  Casein kinase I isoform delta-like protein       78.6    4e-13   Medicago truncatula
gb|EAY75552.1|  hypothetical protein OsI_03457                        78.2    4e-13   Oryza sativa Indica Group [Indian rice]
pdb|3SV0|A  Chain A, Crystal Structure Of Casein Kinase-1 Like Pr...  78.2    4e-13   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008675117.1|  PREDICTED: casein kinase I isoform delta-like    76.3    5e-13   
ref|XP_006644591.1|  PREDICTED: casein kinase I isoform delta-lik...  78.2    5e-13   Oryza brachyantha
dbj|BAB92346.1|  casein kinase I-like                                 78.2    5e-13   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007154635.1|  hypothetical protein PHAVU_003G135100g           77.4    7e-13   Phaseolus vulgaris [French bean]
ref|XP_010925469.1|  PREDICTED: casein kinase I isoform delta-lik...  76.6    1e-12   
ref|XP_007135523.1|  hypothetical protein PHAVU_010G136500g           76.6    2e-12   Phaseolus vulgaris [French bean]
gb|EAZ13276.1|  hypothetical protein OsJ_03201                        75.9    3e-12   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008793206.1|  PREDICTED: casein kinase I isoform delta-lik...  75.5    3e-12   Phoenix dactylifera
ref|XP_006357711.1|  PREDICTED: casein kinase I isoform delta-like    75.5    4e-12   Solanum tuberosum [potatoes]
ref|XP_008813454.1|  PREDICTED: casein kinase I isoform delta-like    75.5    4e-12   Phoenix dactylifera
gb|KFK41692.1|  hypothetical protein AALP_AA2G160600                  75.1    5e-12   Arabis alpina [alpine rockcress]
ref|XP_006853888.1|  hypothetical protein AMTR_s00036p00147120        73.9    1e-11   Amborella trichopoda
ref|XP_006338113.1|  PREDICTED: casein kinase I isoform delta-like    73.9    1e-11   Solanum tuberosum [potatoes]
ref|NP_177415.1|  casein kinase 1-like protein 2                      73.9    1e-11   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011078008.1|  PREDICTED: casein kinase I isoform delta-like    73.9    1e-11   Sesamum indicum [beniseed]
ref|XP_010909190.1|  PREDICTED: casein kinase I isoform delta-like    73.9    1e-11   Elaeis guineensis
ref|XP_002887448.1|  hypothetical protein ARALYDRAFT_476408           73.6    2e-11   
emb|CDX72938.1|  BnaC06g33860D                                        72.8    3e-11   
ref|XP_009395780.1|  PREDICTED: casein kinase I-like                  72.4    3e-11   Musa acuminata subsp. malaccensis [pisang utan]
gb|EPS61015.1|  hypothetical protein M569_13784                       72.0    4e-11   Genlisea aurea
ref|XP_009105937.1|  PREDICTED: casein kinase I isoform delta-lik...  72.4    4e-11   Brassica rapa
ref|XP_004969708.1|  PREDICTED: casein kinase I isoform delta-like    72.0    5e-11   Setaria italica
ref|XP_004287578.1|  PREDICTED: casein kinase I isoform delta-like    71.6    6e-11   Fragaria vesca subsp. vesca
ref|XP_004239254.1|  PREDICTED: casein kinase I isoform delta-like    71.2    9e-11   Solanum lycopersicum
gb|KJB54401.1|  hypothetical protein B456_009G032600                  69.7    3e-10   Gossypium raimondii
ref|XP_010416034.1|  PREDICTED: casein kinase I isoform delta-like    69.7    3e-10   Camelina sativa [gold-of-pleasure]
gb|KJB54403.1|  hypothetical protein B456_009G032600                  69.3    3e-10   Gossypium raimondii
gb|KJB83053.1|  hypothetical protein B456_013G227100                  69.3    4e-10   Gossypium raimondii
gb|EMS66353.1|  Casein kinase I isoform delta-like protein            69.3    4e-10   Triticum urartu
ref|XP_006302226.1|  hypothetical protein CARUB_v10020246mg           68.9    5e-10   Capsella rubella
ref|XP_009395820.1|  PREDICTED: casein kinase I isoform delta-lik...  69.3    5e-10   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009395821.1|  PREDICTED: casein kinase I-like isoform X2       68.9    5e-10   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006654877.1|  PREDICTED: casein kinase I isoform delta-like    68.9    6e-10   Oryza brachyantha
gb|EEC79796.1|  hypothetical protein OsI_21224                        68.6    8e-10   Oryza sativa Indica Group [Indian rice]
ref|NP_001056503.1|  Os05g0593800                                     68.2    8e-10   
emb|CDM83770.1|  unnamed protein product                              68.2    9e-10   Triticum aestivum [Canadian hard winter wheat]
ref|XP_008352372.1|  PREDICTED: casein kinase I isoform delta-like    68.2    1e-09   
ref|XP_008337722.1|  PREDICTED: casein kinase I isoform delta-like    68.2    1e-09   
ref|XP_004507950.1|  PREDICTED: casein kinase I isoform delta-lik...  67.8    1e-09   
ref|XP_009105934.1|  PREDICTED: casein kinase I isoform delta-lik...  67.4    2e-09   
ref|XP_004243748.1|  PREDICTED: casein kinase I isoform delta-like    67.4    2e-09   Solanum lycopersicum
ref|XP_009410794.1|  PREDICTED: casein kinase I-like                  67.0    2e-09   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009349379.1|  PREDICTED: casein kinase I isoform delta-like    67.0    2e-09   Pyrus x bretschneideri [bai li]
ref|XP_006390628.1|  hypothetical protein EUTSA_v10018502mg           66.6    3e-09   
ref|XP_004507951.1|  PREDICTED: casein kinase I isoform delta-lik...  66.2    4e-09   Cicer arietinum [garbanzo]
ref|XP_010428166.1|  PREDICTED: casein kinase I-like                  66.2    4e-09   Camelina sativa [gold-of-pleasure]
gb|AAF19807.1|  casein kinase I-like protein                          65.9    5e-09   Brassica oleracea
ref|XP_006390629.1|  hypothetical protein EUTSA_v10018502mg           65.9    5e-09   Eutrema salsugineum [saltwater cress]
emb|CDY53866.1|  BnaC02g46250D                                        65.9    5e-09   Brassica napus [oilseed rape]
ref|XP_009127947.1|  PREDICTED: casein kinase I isoform delta-like    65.9    5e-09   Brassica rapa
emb|CDY49859.1|  BnaA02g16080D                                        65.9    6e-09   Brassica napus [oilseed rape]
ref|XP_002299898.2|  hypothetical protein POPTR_0001s20450g           65.5    6e-09   
ref|XP_004960993.1|  PREDICTED: casein kinase I isoform delta-lik...  65.5    7e-09   Setaria italica
gb|EMT18264.1|  Casein kinase I isoform delta-like protein            65.5    8e-09   
ref|XP_010685356.1|  PREDICTED: casein kinase I isoform delta-like    65.1    1e-08   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010531866.1|  PREDICTED: casein kinase I isoform delta-like    64.7    1e-08   Tarenaya hassleriana [spider flower]
gb|KHG11372.1|  hypothetical protein F383_02311                       64.3    2e-08   Gossypium arboreum [tree cotton]
ref|XP_004513434.1|  PREDICTED: casein kinase I isoform delta-like    63.2    4e-08   Cicer arietinum [garbanzo]
ref|XP_007019361.1|  Casein kinase, putative                          59.7    5e-08   
gb|KHN35865.1|  Casein kinase I isoform delta-like                    62.8    5e-08   Glycine soja [wild soybean]
ref|XP_011009743.1|  PREDICTED: casein kinase I isoform delta-lik...  62.8    6e-08   Populus euphratica
ref|XP_008650083.1|  PREDICTED: casein kinase I isoform delta-like    62.0    1e-07   
ref|XP_010537581.1|  PREDICTED: casein kinase I                       61.6    1e-07   Tarenaya hassleriana [spider flower]
gb|KEH32501.1|  casein kinase I-like protein                          61.2    2e-07   Medicago truncatula
ref|NP_001136682.1|  uncharacterized protein LOC100216812             57.8    3e-07   
ref|XP_010497256.1|  PREDICTED: casein kinase I isoform delta-like    58.5    4e-07   Camelina sativa [gold-of-pleasure]
dbj|BAD45138.1|  protein kinase ADK1-like                             59.7    4e-07   Oryza sativa Japonica Group [Japonica rice]
gb|ACT34059.1|  putative protein kinase                               60.1    4e-07   Aegilops tauschii
ref|XP_010232213.1|  PREDICTED: casein kinase I-like                  60.1    5e-07   Brachypodium distachyon [annual false brome]
ref|XP_006413231.1|  hypothetical protein EUTSA_v10025148mg           60.1    5e-07   Eutrema salsugineum [saltwater cress]
gb|KCW69785.1|  hypothetical protein EUGRSUZ_F03150                   56.2    5e-07   Eucalyptus grandis [rose gum]
gb|EEC70925.1|  hypothetical protein OsI_02496                        59.7    6e-07   Oryza sativa Indica Group [Indian rice]
ref|XP_003567780.1|  PREDICTED: casein kinase I-like                  59.7    7e-07   Brachypodium distachyon [annual false brome]
ref|XP_009400540.1|  PREDICTED: casein kinase I-like isoform X1       59.3    9e-07   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009400542.1|  PREDICTED: casein kinase I isoform delta-lik...  59.3    9e-07   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009400541.1|  PREDICTED: casein kinase I isoform delta-lik...  59.3    9e-07   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001043372.1|  Os01g0570500                                     59.3    1e-06   
ref|XP_002441634.1|  hypothetical protein SORBIDRAFT_09g030690        58.9    1e-06   Sorghum bicolor [broomcorn]
gb|KDO65165.1|  hypothetical protein CISIN_1g010674mg                 58.5    2e-06   Citrus sinensis [apfelsine]
ref|XP_006413230.1|  hypothetical protein EUTSA_v10025148mg           57.0    6e-06   Eutrema salsugineum [saltwater cress]
gb|AAF19801.1|  CK1a protein                                          55.8    1e-05   Brassica oleracea
emb|CDY69293.1|  BnaA01g35300D                                        55.8    1e-05   Brassica napus [oilseed rape]
emb|CDX94377.1|  BnaC01g18070D                                        55.1    2e-05   
ref|XP_009139890.1|  PREDICTED: casein kinase I isoform delta-like    55.1    2e-05   Brassica rapa
gb|KFK29120.1|  hypothetical protein AALP_AA7G091500                  55.1    2e-05   Arabis alpina [alpine rockcress]
gb|AFW81337.1|  putative casein kinase family protein                 53.5    6e-05   
ref|XP_009407307.1|  PREDICTED: casein kinase I-like isoform X2       53.5    7e-05   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009407306.1|  PREDICTED: casein kinase I-like isoform X1       53.5    8e-05   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010438803.1|  PREDICTED: casein kinase I isoform delta-like    53.1    1e-04   Camelina sativa [gold-of-pleasure]
ref|XP_003627160.1|  Casein kinase I isoform delta-like protein       52.8    1e-04   
ref|XP_010433551.1|  PREDICTED: casein kinase I isoform delta-like    52.8    1e-04   Camelina sativa [gold-of-pleasure]
ref|XP_010448325.1|  PREDICTED: casein kinase I isoform delta-like    52.4    2e-04   Camelina sativa [gold-of-pleasure]
ref|XP_002867580.1|  hypothetical protein ARALYDRAFT_492204           52.4    2e-04   
ref|XP_008656113.1|  PREDICTED: casein kinase I isoform delta-lik...  52.0    3e-04   Zea mays [maize]
ref|XP_008793211.1|  PREDICTED: casein kinase I isoform delta-lik...  51.2    4e-04   
gb|KDO53222.1|  hypothetical protein CISIN_1g011819mg                 50.8    5e-04   Citrus sinensis [apfelsine]
ref|XP_004969013.1|  PREDICTED: casein kinase I isoform delta-like    50.4    8e-04   Setaria italica
emb|CDM83167.1|  unnamed protein product                              50.4    9e-04   Triticum aestivum [Canadian hard winter wheat]



>ref|XP_006342964.1| PREDICTED: casein kinase I isoform delta-like [Solanum tuberosum]
Length=471

 Score =   152 bits (383),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 108/182 (59%), Positives = 125/182 (69%), Gaps = 9/182 (5%)
 Frame = -3

Query  779  YQQSQLPSPPSCGHGGIGATSSGMPHTAANVDKQTGGEEGLPTGWSSGNLVNSRNTGLVL  600
            YQQSQL +PPS   GG    SSGMPH  AN ++Q+GGEEG PTGWSSGNL  +RNTGL  
Sbjct  295  YQQSQLANPPSRALGGTAGPSSGMPHALANAERQSGGEEGRPTGWSSGNLARNRNTGLQF  354

Query  599  SSGS--KQKGPV-HDSTMskglsssniiqssgssrrpavsSIRDSVTAGVESDPSRTRAA  429
            +SGS  KQKG V +D +M K LSSS+  ++S S+RRPAVSS RD V  GVE DPS  R  
Sbjct  355  NSGSLAKQKGTVANDLSMGKELSSSSFFRTSASARRPAVSSSRDPVITGVEPDPSHIRKT  414

Query  428  DTTHASPGAIPKMISTAERSSPVI-FDNKCSSSTRNSNIKNIESTLKGIEGLSFGNDEKS  252
            D    SPG + K  S A+RSSPV+  D K SSSTR    KN E+ LKGIEGLS  NDE+ 
Sbjct  415  D---ESPGHLRKTSSVAQRSSPVVSSDQKRSSSTRMD--KNFEAALKGIEGLSVKNDERL  469

Query  251  HY  246
            HY
Sbjct  470  HY  471



>ref|XP_009631548.1| PREDICTED: casein kinase I isoform delta-like, partial [Nicotiana 
tomentosiformis]
Length=434

 Score =   145 bits (366),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 105/174 (60%), Positives = 125/174 (72%), Gaps = 7/174 (4%)
 Frame = -3

Query  779  YQQSQLPSPPSCGHGGIGATSSGMPHTAANVDKQTGGEEGLPTGWSSGNLVNSRNTGLVL  600
            YQQSQL +PPS   GG    SSGMPH   NV++Q+GG+EG PTGWSS NL  +++TGL  
Sbjct  263  YQQSQLANPPSRALGGTAGPSSGMPHALVNVERQSGGDEGRPTGWSSSNLTRNKSTGLHF  322

Query  599  SSGS--KQKGPV-HDSTMskglsssniiqssgssrrpavsSIRDSVTAGVESDPSRTRAA  429
            +SGS  KQKG V +D +M K LSSSN  +SSG  RRP VSSIRD V AG E DPS T   
Sbjct  323  NSGSLLKQKGTVANDLSMGKELSSSNFFRSSGPLRRPVVSSIRDPVIAGGEPDPSGTLTK  382

Query  428  DTTHASPGAIPKMISTAERSSPVI-FDNKCSSSTRNSNIKNIESTLKGIEGLSF  270
            D   ASPG + K+ S A RSSPV+  D+K SSS +N+NIKN+EST+KGIEGLSF
Sbjct  383  D---ASPGPLRKVSSAARRSSPVVSSDHKRSSSIKNANIKNLESTVKGIEGLSF  433



>ref|XP_009798249.1| PREDICTED: casein kinase I-like isoform X1 [Nicotiana sylvestris]
 ref|XP_009798250.1| PREDICTED: casein kinase I-like isoform X1 [Nicotiana sylvestris]
 ref|XP_009798251.1| PREDICTED: casein kinase I-like isoform X2 [Nicotiana sylvestris]
 ref|XP_009798252.1| PREDICTED: casein kinase I-like isoform X3 [Nicotiana sylvestris]
 ref|XP_009798253.1| PREDICTED: casein kinase I-like isoform X3 [Nicotiana sylvestris]
Length=466

 Score =   145 bits (366),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 106/174 (61%), Positives = 126/174 (72%), Gaps = 7/174 (4%)
 Frame = -3

Query  779  YQQSQLPSPPSCGHGGIGATSSGMPHTAANVDKQTGGEEGLPTGWSSGNLVNSRNTGLVL  600
            YQQSQL +PPS   GG    SSGMPH   NV++Q+GG+EG PTGWSS NL  +++TGL  
Sbjct  295  YQQSQLANPPSRALGGTAGPSSGMPHALVNVERQSGGDEGRPTGWSSSNLTRNKSTGLHF  354

Query  599  SSGS--KQKGPV-HDSTMskglsssniiqssgssrrpavsSIRDSVTAGVESDPSRTRAA  429
            +SGS  KQKG V +D +M K LSSSN  +SSG SRRP VSSIRD V AG E D S TR  
Sbjct  355  NSGSLLKQKGTVANDLSMGKELSSSNFFRSSGPSRRPVVSSIRDPVIAGGEPDLSGTRTK  414

Query  428  DTTHASPGAIPKMISTAERSSPVI-FDNKCSSSTRNSNIKNIESTLKGIEGLSF  270
            D   ASPG + K+ S A RSSPV+  D+K SSS +N+NIKN+EST+KGIEGLSF
Sbjct  415  D---ASPGPLRKVSSAARRSSPVVSSDHKRSSSIKNANIKNLESTVKGIEGLSF  465



>ref|XP_004235583.1| PREDICTED: casein kinase I isoform delta-like [Solanum lycopersicum]
Length=470

 Score =   142 bits (358),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 107/182 (59%), Positives = 124/182 (68%), Gaps = 10/182 (5%)
 Frame = -3

Query  779  YQQSQLPSPPSCGHGGIGATSSGMPHTAANVDKQTGGEEGLPTGWSSGNLVNSRNTGLVL  600
            YQQSQL +PPS   GG    SSGMPH  AN ++ +GGEEG P GW SGNL  +RNTGL  
Sbjct  295  YQQSQLANPPSRALGGTAGPSSGMPHALANAERPSGGEEGRPAGW-SGNLARNRNTGLQF  353

Query  599  SSGS--KQKGPV-HDSTMskglsssniiqssgssrrpavsSIRDSVTAGVESDPSRTRAA  429
            +SGS  KQKG V +D +M K LSSS+  ++SGS+RRPAVSS RD V  GVE DPS  R  
Sbjct  354  NSGSLAKQKGTVANDLSMGKELSSSSFFRTSGSTRRPAVSSSRDPVITGVEPDPSHIRKT  413

Query  428  DTTHASPGAIPKMISTAERSSPVI-FDNKCSSSTRNSNIKNIESTLKGIEGLSFGNDEKS  252
            D   ASPG + K  S A+RSSPV+  D K SSSTR    KN E+ LKGIEGLS  NDE+ 
Sbjct  414  D---ASPGQLRKTSSVAQRSSPVMSSDQKRSSSTRMD--KNFEAALKGIEGLSVKNDERL  468

Query  251  HY  246
            HY
Sbjct  469  HY  470



>ref|XP_009795173.1| PREDICTED: casein kinase I isoform delta-like [Nicotiana sylvestris]
Length=472

 Score =   137 bits (346),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 108/183 (59%), Positives = 126/183 (69%), Gaps = 10/183 (5%)
 Frame = -3

Query  779  YQQSQLPSPPSCGHGGIGATSSGMPHTAANVDKQTGGEEGLPTGWSSGNLVNSRNTGLVL  600
            YQQSQL +PPS   GG    SSGMPH  ANV++Q+GGEEG P G+SS NL  +RNTGL  
Sbjct  295  YQQSQLANPPSRALGGTAGPSSGMPHALANVERQSGGEEGRPNGYSSANLTRNRNTGLHF  354

Query  599  SSGS--KQKGPV-HDSTMskglsssniiqssgssrrpavsSIRDSVTAGVESDPSRTRAA  429
            +SGS  KQKG V +D +M K LSSSN  ++SGSSRRPAVSS RD V AG E D S TR  
Sbjct  355  NSGSLAKQKGTVGNDLSMGKELSSSNFFRTSGSSRRPAVSSSRDPVFAGGEPDSSHTRKT  414

Query  428  DTTHASPGAIPKMISTAERSSPVI-FDNKCSSSTRNSNIKNIESTLKGIEGLSFG-NDEK  255
            D   ASPG + K  S A+RSSP++  D K SSST+    KN E+ LKGIEGLS   NDE+
Sbjct  415  D---ASPGHLRKTTSAAQRSSPILSSDQKRSSSTKMD--KNFEAALKGIEGLSVNKNDER  469

Query  254  SHY  246
             HY
Sbjct  470  LHY  472



>ref|XP_009631851.1| PREDICTED: casein kinase I isoform delta-like [Nicotiana tomentosiformis]
Length=472

 Score =   135 bits (341),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 106/183 (58%), Positives = 124/183 (68%), Gaps = 10/183 (5%)
 Frame = -3

Query  779  YQQSQLPSPPSCGHGGIGATSSGMPHTAANVDKQTGGEEGLPTGWSSGNLVNSRNTGLVL  600
            YQQSQL +PPS   GG    SSGMPH  ANV++Q+GGEEG P G+SS NL  +RNTGL  
Sbjct  295  YQQSQLANPPSRALGGTAGPSSGMPHALANVERQSGGEEGRPNGYSSANLTRNRNTGLHF  354

Query  599  SSGS--KQKGPV-HDSTMskglsssniiqssgssrrpavsSIRDSVTAGVESDPSRTRAA  429
            +SGS  KQKG V +D +  K LSSSN  ++SGSSR PAVSS RD V  G E DPS TR  
Sbjct  355  NSGSLAKQKGTVGNDLSTGKELSSSNFFRTSGSSRHPAVSSSRDPVFTGGEPDPSHTRKT  414

Query  428  DTTHASPGAIPKMISTAERSSPVI-FDNKCSSSTRNSNIKNIESTLKGIEGLSFG-NDEK  255
            D   ASPG + K  S A+RSSP++  D K SSST+    KN E+ LKGIEGLS   NDE+
Sbjct  415  D---ASPGHLRKTTSAAQRSSPILSSDQKRSSSTKMD--KNFEAALKGIEGLSVNKNDER  469

Query  254  SHY  246
             HY
Sbjct  470  LHY  472



>emb|CDO97889.1| unnamed protein product [Coffea canephora]
Length=467

 Score =   132 bits (333),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 100/180 (56%), Positives = 126/180 (70%), Gaps = 9/180 (5%)
 Frame = -3

Query  779  YQQSQLPSPPSCGHGGIGATSSGMPHTAANVDKQTGGEEGLPTGWSSGNLVNSRNTGLVL  600
            YQQSQL +PPS   G    TSSGM  +AAN D+Q GGE+G PTGWS+ N   SRNTG+ L
Sbjct  295  YQQSQLANPPSRALGTTVGTSSGMQVSAANHDRQQGGEDGRPTGWSTANQARSRNTGMQL  354

Query  599  SSGSKQKGPVHDSTMskglsssniiqssgssrrpavsSIRD-SVTAGVESDPSRTRAADT  423
            +SGS  +   +     K +SSS  ++SSGSS+RPAVSS RD ++  G ES+PSRTR AD 
Sbjct  355  NSGSFSRQKPNGLVTGKEVSSSMFLRSSGSSKRPAVSSSRDPAILVGNESEPSRTRTAD-  413

Query  422  THASPGAIPKMISTAERSSPVI-FDNKCSSSTRNSNIKNIESTLKGIEGLSFGNDEKSHY  246
              ASPG + K+ STA+R+SPV+  D+K SS    SN+K  EST+KGIEGLSFGN+E  H+
Sbjct  414  --ASPGVLRKISSTAQRTSPVVSSDHKHSS----SNVKIFESTIKGIEGLSFGNEETLHH  467



>ref|XP_006357391.1| PREDICTED: casein kinase I isoform delta-like [Solanum tuberosum]
Length=467

 Score =   130 bits (328),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 97/174 (56%), Positives = 122/174 (70%), Gaps = 6/174 (3%)
 Frame = -3

Query  779  YQQSQLPSPPSCGHGGIGATSSGMPHTAANVDKQTGGEEGLPTGWSSGNLVNSRNTGLVL  600
            YQQSQL + PS   GG    SSGMPH  ANV+K++G EEG PTGWSS NL  +++TGL  
Sbjct  295  YQQSQLANIPSRALGGTAGPSSGMPHGLANVEKKSGAEEGRPTGWSSSNLTRNKSTGLNF  354

Query  599  SSGS--KQKGPV-HDSTMskglsssniiqssgssrrpavsSIRDSVTAGVESDPSRTRAA  429
            +SGS  KQKG V +D +M K L SSN  QSSGS+R P VSS RD V AG E D SR +  
Sbjct  355  NSGSLLKQKGTVANDLSMGKELPSSNFFQSSGSARHPNVSSSRDPVIAGGEPDLSRNQTL  414

Query  428  DTTHASPGAIPKMISTAERSSPVI-FDNKCSSSTRNSNIKNIESTLKGIEGLSF  270
            D   A   ++ K+ + A+++SPV+  D+K SSSTRN+N+KN+ES +KGIEGLSF
Sbjct  415  DAAGAR--SLRKIFNAAQKTSPVVSSDHKRSSSTRNTNLKNLESAIKGIEGLSF  466



>ref|XP_004241866.1| PREDICTED: casein kinase I-like [Solanum lycopersicum]
Length=467

 Score =   125 bits (313),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 93/174 (53%), Positives = 122/174 (70%), Gaps = 6/174 (3%)
 Frame = -3

Query  779  YQQSQLPSPPSCGHGGIGATSSGMPHTAANVDKQTGGEEGLPTGWSSGNLVNSRNTGLVL  600
            YQQSQL + PS   GG    SSG PH  ANV+K++GGEEG PTGWSS NL  +R+TGL  
Sbjct  295  YQQSQLANIPSRALGGTAGPSSGTPHGLANVEKKSGGEEGRPTGWSSSNLTRNRSTGLNF  354

Query  599  SSGS--KQKGPV-HDSTMskglsssniiqssgssrrpavsSIRDSVTAGVESDPSRTRAA  429
            ++GS  KQKG V +D ++ K L SSN  +SSGS+R+P VSS RD V  G E D SR +  
Sbjct  355  NAGSLLKQKGTVANDLSVGKELPSSNFFRSSGSARQPNVSSSRDPVITGGEPDLSRPQTL  414

Query  428  DTTHASPGAIPKMISTAERSSPVI-FDNKCSSSTRNSNIKNIESTLKGIEGLSF  270
            D   A   ++ K+ +T +++SPV+  ++K SSSTRN+N+KN+ES +KGIEGLSF
Sbjct  415  DA--AGAASLRKIFNTTQKTSPVVSSEHKRSSSTRNTNLKNLESAIKGIEGLSF  466



>ref|XP_009372402.1| PREDICTED: casein kinase I isoform delta-like [Pyrus x bretschneideri]
 ref|XP_009340677.1| PREDICTED: casein kinase I isoform delta-like [Pyrus x bretschneideri]
Length=477

 Score =   122 bits (305),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 93/185 (50%), Positives = 121/185 (65%), Gaps = 11/185 (6%)
 Frame = -3

Query  779  YQQSQLPSPPSCGHGGIGATSSGMPHTAANVDKQTGGEEGLPTGWSSGNLVNSRNTGLVL  600
            YQQSQ+ +PP+  HG     SSG+P T AN ++Q+GGEEG PTGWS  +    RN+G +L
Sbjct  297  YQQSQIATPPTQSHGPNAGQSSGLPPTVANAERQSGGEEGRPTGWSLLDPSRRRNSGPIL  356

Query  599  SSG--SKQKGP-VHDSTMskglsssniiqssgs--srrpavsSIRDSVTAGVESDPSRTR  435
            +SG  S+QK P  +D ++SK    S+      S  SRR AVSS RD+V  G E+DPSR +
Sbjct  357  NSGNISRQKSPAANDRSLSKDAMLSSSNFMRSSGSSRRAAVSSSRDAVLVGSEADPSRPQ  416

Query  434  AADTTHASPGAIPKMISTAERSSPVI-FDNKCSSSTRN-SNIKNIESTLKGIEGLSFGND  261
               TT  SPG + K IS+ +RSSP++  +N  +SS RN SN KN+ESTLKGIE L F ND
Sbjct  417  ---TTELSPGTLGK-ISSGQRSSPIVPSENNRTSSGRNISNAKNLESTLKGIESLHFNND  472

Query  260  EKSHY  246
            E+  Y
Sbjct  473  ERVQY  477



>ref|XP_002277513.2| PREDICTED: casein kinase I isoform delta-like [Vitis vinifera]
 emb|CBI35912.3| unnamed protein product [Vitis vinifera]
Length=471

 Score =   119 bits (299),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 94/183 (51%), Positives = 116/183 (63%), Gaps = 11/183 (6%)
 Frame = -3

Query  779  YQQSQLPSPPSCGHGGIGATSSGMPHTAANVDKQTGGEEGLPTGWSSGNLVNSRNTGLVL  600
            YQQSQ+  PPS   G     S G+P   AN+D+Q+GGE+G P+GWSS +    R T   L
Sbjct  295  YQQSQISGPPSRALGPGAGPSHGIPPAVANMDRQSGGEDGRPSGWSSADPSRRRTTVPAL  354

Query  599  SSGS-KQKGPV-HDSTMskglsssniiqssgssrrpavsSIRDSVTAGVESDPSRTRAAD  426
            + GS KQK PV +DSTM+K   S+N+  S  S R    SS RD+V  G ESDPSR+RA  
Sbjct  355  NLGSLKQKSPVANDSTMAKDSLSANVRASGSSRRGAVSSS-RDAVIVGGESDPSRSRA--  411

Query  425  TTHASPGAIPKMISTAERSSPV-IFDNKCSSSTRN--SNIKNIESTLKGIEGLSFGNDEK  255
               ASPGA+ K IS+ +R SPV   ++K  SS RN  SNIKN ESTLKGIE L F N+E+
Sbjct  412  --DASPGALRK-ISSGQRGSPVHSSEHKRISSGRNTSSNIKNFESTLKGIESLHFNNEER  468

Query  254  SHY  246
              Y
Sbjct  469  VQY  471



>ref|XP_008338711.1| PREDICTED: casein kinase I isoform delta-like [Malus domestica]
Length=294

 Score =   114 bits (286),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 92/185 (50%), Positives = 120/185 (65%), Gaps = 11/185 (6%)
 Frame = -3

Query  779  YQQSQLPSPPSCGHGGIGATSSGMPHTAANVDKQTGGEEGLPTGWSSGNLVNSRNTGLVL  600
            YQQSQ+ +PP+   G     SSG+P T AN ++Q+GGEEG PTGWSS +    RN+G ++
Sbjct  114  YQQSQIATPPTRPLGPNAGPSSGLPPTVANAERQSGGEEGRPTGWSSSDPSRRRNSGPLV  173

Query  599  SSG--SKQKGP-VHDSTMskglsssniiqssgs--srrpavsSIRDSVTAGVESDPSRTR  435
            +SG  S+QK P  +D ++SK    S+      S  SRR AVSS RD+V A  E+DPSR +
Sbjct  174  NSGNLSRQKSPAANDPSLSKDAMLSSSNFMRSSGSSRRAAVSSSRDAVFASSETDPSRLQ  233

Query  434  AADTTHASPGAIPKMISTAERSSPVI-FDNKCSSSTRN-SNIKNIESTLKGIEGLSFGND  261
               TT  SPG + K IS  +RSSPV+  D+  +SS RN SN KN+ESTLKGIE L F ND
Sbjct  234  ---TTEISPGTLGK-ISGGQRSSPVVPSDSNRTSSGRNISNTKNLESTLKGIESLHFNND  289

Query  260  EKSHY  246
            ++  Y
Sbjct  290  DRVQY  294



>ref|XP_008391353.1| PREDICTED: casein kinase I isoform delta-like [Malus domestica]
Length=477

 Score =   116 bits (290),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 92/185 (50%), Positives = 120/185 (65%), Gaps = 11/185 (6%)
 Frame = -3

Query  779  YQQSQLPSPPSCGHGGIGATSSGMPHTAANVDKQTGGEEGLPTGWSSGNLVNSRNTGLVL  600
            YQQSQ+ +PP+   G     SSG+P T AN ++Q+GGEEG PTGWS  +    RN+G +L
Sbjct  297  YQQSQIATPPTRPLGPNAGPSSGLPPTVANAERQSGGEEGRPTGWSLSDPSRRRNSGPIL  356

Query  599  SSG--SKQKGP-VHDSTMskglsssniiqssgs--srrpavsSIRDSVTAGVESDPSRTR  435
            +SG  S+QK P  +D ++SK    S+      S  SRR AVSS RD+V  G ++DPSR +
Sbjct  357  NSGNISRQKSPAANDRSLSKDAMLSSSNFMRSSGSSRRAAVSSSRDAVLVGSDADPSRPQ  416

Query  434  AADTTHASPGAIPKMISTAERSSPVI-FDNKCSSSTRN-SNIKNIESTLKGIEGLSFGND  261
               TT  SPG + K IS+ +RSSPV+  +N  +SS RN SN KN+ESTLKGIE L F ND
Sbjct  417  ---TTELSPGTLGK-ISSGQRSSPVVPSENNRTSSGRNISNAKNLESTLKGIESLHFNND  472

Query  260  EKSHY  246
            E+  Y
Sbjct  473  ERVQY  477



>ref|XP_009335830.1| PREDICTED: casein kinase I isoform delta-like [Pyrus x bretschneideri]
Length=476

 Score =   115 bits (288),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 97/184 (53%), Positives = 125/184 (68%), Gaps = 10/184 (5%)
 Frame = -3

Query  779  YQQSQLPSPPSCGHGGIGATSSGMPHTAANVDKQTGGEEGLPTGWSSGNLVNSRNTGLVL  600
            YQQSQ+ +PP    G     SSG+P T AN  +Q+GGEEG PTGWSS +    RN+G ++
Sbjct  297  YQQSQIATPPIRPLGPNAGPSSGLPPTVANAGRQSGGEEGRPTGWSSSDPSRRRNSGPLV  356

Query  599  SSG--SKQKGPVHDSTMskgls--ssniiqssgssrrpavsSIRDSVTAGVESDPSRTRA  432
            +SG  S+QK P +D ++SK     SSN ++SSGSSRR AVSS RD+V A  E+DPSR + 
Sbjct  357  NSGNLSRQKSPANDPSLSKDAMLPSSNFMRSSGSSRRAAVSSSRDAVFASSETDPSRLQ-  415

Query  431  ADTTHASPGAIPKMISTAERSSPVI-FDNKCSSSTRN-SNIKNIESTLKGIEGLSFGNDE  258
              TT  SPG + K IS+ +RSSPV+  D+  +SS RN SN KN+ESTLKGIE L F ND+
Sbjct  416  --TTDISPGTLGK-ISSGQRSSPVVPSDSNRTSSGRNISNTKNLESTLKGIESLHFNNDD  472

Query  257  KSHY  246
            +  Y
Sbjct  473  RVQY  476



>ref|XP_007024533.1| Casein kinase 1-like protein 2 [Theobroma cacao]
 gb|EOY27155.1| Casein kinase 1-like protein 2 [Theobroma cacao]
Length=477

 Score =   113 bits (282),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 87/187 (47%), Positives = 120/187 (64%), Gaps = 13/187 (7%)
 Frame = -3

Query  779  YQQSQLPSPPSCGHGGIGATSSGMPHTAANVDKQTGGEEGLPTGWSSGNLVNSRNTGLVL  600
            YQQSQ+ +PP+   G     SSG+P   A  D+Q+GGE+G P+GWSS +    R++G ++
Sbjct  295  YQQSQIANPPTRALGPGAGPSSGIPPAGAIADRQSGGEDGRPSGWSSTDPTRRRHSGPIV  354

Query  599  SSG--SKQKGPV-HDSTMskglsssniiqssgssr----rpavsSIRDSVTAGVESDPSR  441
            +SG  +KQK PV +D  ++K   +     +   S     R AVSS RD+   G +S+PSR
Sbjct  355  NSGNLAKQKSPVANDPPLAKDPMAMLSGSNFLRSSGSSRRAAVSSSRDAAIMGSDSEPSR  414

Query  440  TRAADTTHASPGAIPKMISTAERSSPVIF-DNKCSSSTRN-SNIKNIESTLKGIEGLSFG  267
             R+ DT   S G++PK IS+ +RSSPV+  + K SSS RN SN+KNIES L+GIEGL F 
Sbjct  415  LRSIDT---SAGSLPK-ISSGQRSSPVLSSEVKRSSSGRNTSNMKNIESALRGIEGLHFS  470

Query  266  NDEKSHY  246
            NDE+ HY
Sbjct  471  NDERLHY  477



>gb|KDO65164.1| hypothetical protein CISIN_1g010674mg [Citrus sinensis]
Length=368

 Score =   112 bits (279),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 81/185 (44%), Positives = 111/185 (60%), Gaps = 12/185 (6%)
 Frame = -3

Query  779  YQQSQLPSPPSCGHGGIGATSSGMPHTAANVDKQTGGEEGLPTGWSSGNLVNSRNTGLVL  600
            YQQSQ+ +P      G G  SSGMP  AANVD+Q+G EEG  TGWSS +    RN+G + 
Sbjct  189  YQQSQVSTPARAIGPGAGP-SSGMPPAAANVDRQSGAEEGRHTGWSSADPSRRRNSGPLG  247

Query  599  SSG--SKQKGPVHDSTMskglsssniiqssgssrrpavsSI---RDSVTAGVESDPSRTR  435
            +S   SKQK P+ +       +  +      SS      ++   R++   G ++DPSR R
Sbjct  248  NSANLSKQKSPMANDPAFSKDAMMSSYNLLRSSGSSRRVAVPNSREAAVVGSDTDPSRPR  307

Query  434  AADTTHASPGAIPKMISTAERSSPVI-FDNKCSSSTRN-SNIKNIESTLKGIEGLSFGND  261
               TT ASPGA  K IS+ +RSSPV+  +N+ ++S R+ SNIKN ESTL+GIE L F N+
Sbjct  308  ---TTDASPGAFQK-ISSGQRSSPVVSSENRHTTSGRSTSNIKNFESTLRGIESLHFNNN  363

Query  260  EKSHY  246
            E+ H+
Sbjct  364  ERVHH  368



>ref|XP_010262044.1| PREDICTED: casein kinase I isoform delta-like [Nelumbo nucifera]
Length=475

 Score =   112 bits (280),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 98/186 (53%), Positives = 122/186 (66%), Gaps = 13/186 (7%)
 Frame = -3

Query  779  YQQSQLPSPPSCGHGGIGATSSGMPHTAANVDKQTGGEEGLPTGWSSGNLVNSRNTGLVL  600
            YQQSQ+ +P      G G TSSGMP   AN D+Q+GGEEG P GWS+ +    R  G  +
Sbjct  295  YQQSQIATPSRAIGPGAG-TSSGMPPAIANADRQSGGEEGRPAGWSTMDPSRRRVPGPAI  353

Query  599  SSG--SKQKGPV-HDSTMskgls---ssniiqssgssrrpavsSIRDSVTAGVESDPSRT  438
            ++G  SKQKGPV +DS+++K      S+ + + SGSSRR AVSS RD+   G ESDPSR 
Sbjct  354  NAGTLSKQKGPVANDSSVTKDAMLPGSTFLGRPSGSSRRAAVSSSRDAAVLGSESDPSR-  412

Query  437  RAADTTHASPGAIPKMISTAERSSPV-IFDNKCSSSTRN-SNIKNIESTLKGIEGLSFGN  264
                TT ASPGA  K +S+ +RSSPV   D K +SS RN +NIKN E+TLKGIE L F N
Sbjct  413  --PHTTEASPGAFRK-VSSGQRSSPVGSSDPKRTSSGRNTTNIKNYETTLKGIESLHFDN  469

Query  263  DEKSHY  246
            DE+ HY
Sbjct  470  DERLHY  475



>gb|KDO65160.1| hypothetical protein CISIN_1g010674mg [Citrus sinensis]
 gb|KDO65161.1| hypothetical protein CISIN_1g010674mg [Citrus sinensis]
 gb|KDO65162.1| hypothetical protein CISIN_1g010674mg [Citrus sinensis]
Length=414

 Score =   111 bits (277),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 81/185 (44%), Positives = 111/185 (60%), Gaps = 12/185 (6%)
 Frame = -3

Query  779  YQQSQLPSPPSCGHGGIGATSSGMPHTAANVDKQTGGEEGLPTGWSSGNLVNSRNTGLVL  600
            YQQSQ+ +P      G G  SSGMP  AANVD+Q+G EEG  TGWSS +    RN+G + 
Sbjct  235  YQQSQVSTPARAIGPGAGP-SSGMPPAAANVDRQSGAEEGRHTGWSSADPSRRRNSGPLG  293

Query  599  SSG--SKQKGPVHDSTMskglsssniiqssgssrrpavsSI---RDSVTAGVESDPSRTR  435
            +S   SKQK P+ +       +  +      SS      ++   R++   G ++DPSR R
Sbjct  294  NSANLSKQKSPMANDPAFSKDAMMSSYNLLRSSGSSRRVAVPNSREAAVVGSDTDPSRPR  353

Query  434  AADTTHASPGAIPKMISTAERSSPVI-FDNKCSSSTRN-SNIKNIESTLKGIEGLSFGND  261
               TT ASPGA  K IS+ +RSSPV+  +N+ ++S R+ SNIKN ESTL+GIE L F N+
Sbjct  354  ---TTDASPGAFQK-ISSGQRSSPVVSSENRHTTSGRSTSNIKNFESTLRGIESLHFNNN  409

Query  260  EKSHY  246
            E+ H+
Sbjct  410  ERVHH  414



>ref|XP_007217223.1| hypothetical protein PRUPE_ppa005139mg [Prunus persica]
 gb|EMJ18422.1| hypothetical protein PRUPE_ppa005139mg [Prunus persica]
Length=475

 Score =   111 bits (277),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 88/185 (48%), Positives = 118/185 (64%), Gaps = 11/185 (6%)
 Frame = -3

Query  779  YQQSQLPSPPSCGHGGIGATSSGMPHTAANVDKQTGGEEGLPTGWSSGNLVNSRNTGLVL  600
            YQQSQ+ +PP+   G     SSG+P   AN ++Q+GGEEG PTGWS  +    RN+G ++
Sbjct  295  YQQSQIATPPARALGASAGPSSGLPPAVANAERQSGGEEGRPTGWSLSDPSRRRNSGPIV  354

Query  599  SSG--SKQKGP-VHDSTMskglsssniiqssgs--srrpavsSIRDSVTAGVESDPSRTR  435
            +SG  S+QK P  +D ++SK    S+      S  SRR AVSS RD+V  G ESD SR +
Sbjct  355  NSGNLSRQKSPAANDPSLSKDAMLSSSNFLRSSGSSRRAAVSSSRDAVIIGSESDLSRPQ  414

Query  434  AADTTHASPGAIPKMISTAERSSPVI-FDNKCSSSTRN-SNIKNIESTLKGIEGLSFGND  261
             +D    SPG + K IS+ +RSSPV+  +N  +SS RN SN+K +ESTL+GIE L F ND
Sbjct  415  TSDL---SPGTLGK-ISSGQRSSPVVPSENNRTSSGRNISNVKTLESTLRGIESLHFNND  470

Query  260  EKSHY  246
            E+  Y
Sbjct  471  ERVQY  475



>ref|XP_008228258.1| PREDICTED: casein kinase I isoform delta-like [Prunus mume]
Length=475

 Score =   110 bits (276),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 87/185 (47%), Positives = 118/185 (64%), Gaps = 11/185 (6%)
 Frame = -3

Query  779  YQQSQLPSPPSCGHGGIGATSSGMPHTAANVDKQTGGEEGLPTGWSSGNLVNSRNTGLVL  600
            YQQSQ+ +PP+   G     SSG+P   AN ++Q+GGEEG PTGWS  +    RN+G ++
Sbjct  295  YQQSQIATPPARALGASAGPSSGLPPAVANAERQSGGEEGRPTGWSLSDPSRRRNSGPIV  354

Query  599  SSG--SKQKGP-VHDSTMskglsssniiqssgs--srrpavsSIRDSVTAGVESDPSRTR  435
            +SG  S+QK P  +D ++SK    S+      S  SRR AVSS RD+V  G ESD SR +
Sbjct  355  NSGNLSRQKSPAANDPSLSKDAMLSSSNFLRSSGSSRRAAVSSSRDAVIVGSESDLSRPQ  414

Query  434  AADTTHASPGAIPKMISTAERSSPVI-FDNKCSSSTRN-SNIKNIESTLKGIEGLSFGND  261
             +D    SPG + K IS+ +RSSP++  +N  +SS RN SN+K +ESTL+GIE L F ND
Sbjct  415  TSDL---SPGTLGK-ISSGQRSSPIVPSENNRTSSGRNISNVKTLESTLRGIESLHFNND  470

Query  260  EKSHY  246
            E+  Y
Sbjct  471  ERVQY  475



>gb|KDO65163.1| hypothetical protein CISIN_1g010674mg [Citrus sinensis]
Length=444

 Score =   110 bits (276),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 81/185 (44%), Positives = 111/185 (60%), Gaps = 12/185 (6%)
 Frame = -3

Query  779  YQQSQLPSPPSCGHGGIGATSSGMPHTAANVDKQTGGEEGLPTGWSSGNLVNSRNTGLVL  600
            YQQSQ+ +P      G G  SSGMP  AANVD+Q+G EEG  TGWSS +    RN+G + 
Sbjct  265  YQQSQVSTPARAIGPGAGP-SSGMPPAAANVDRQSGAEEGRHTGWSSADPSRRRNSGPLG  323

Query  599  SSG--SKQKGPVHDSTMskglsssniiqssgssrrpavsSI---RDSVTAGVESDPSRTR  435
            +S   SKQK P+ +       +  +      SS      ++   R++   G ++DPSR R
Sbjct  324  NSANLSKQKSPMANDPAFSKDAMMSSYNLLRSSGSSRRVAVPNSREAAVVGSDTDPSRPR  383

Query  434  AADTTHASPGAIPKMISTAERSSPVI-FDNKCSSSTRN-SNIKNIESTLKGIEGLSFGND  261
               TT ASPGA  K IS+ +RSSPV+  +N+ ++S R+ SNIKN ESTL+GIE L F N+
Sbjct  384  ---TTDASPGAFQK-ISSGQRSSPVVSSENRHTTSGRSTSNIKNFESTLRGIESLHFNNN  439

Query  260  EKSHY  246
            E+ H+
Sbjct  440  ERVHH  444



>ref|XP_006465998.1| PREDICTED: casein kinase I isoform delta-like [Citrus sinensis]
 gb|KDO65157.1| hypothetical protein CISIN_1g010674mg [Citrus sinensis]
Length=474

 Score =   110 bits (276),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 81/185 (44%), Positives = 111/185 (60%), Gaps = 12/185 (6%)
 Frame = -3

Query  779  YQQSQLPSPPSCGHGGIGATSSGMPHTAANVDKQTGGEEGLPTGWSSGNLVNSRNTGLVL  600
            YQQSQ+ +P      G G  SSGMP  AANVD+Q+G EEG  TGWSS +    RN+G + 
Sbjct  295  YQQSQVSTPARAIGPGAGP-SSGMPPAAANVDRQSGAEEGRHTGWSSADPSRRRNSGPLG  353

Query  599  SSG--SKQKGPVHDSTMskglsssniiqssgssrrpavsSI---RDSVTAGVESDPSRTR  435
            +S   SKQK P+ +       +  +      SS      ++   R++   G ++DPSR R
Sbjct  354  NSANLSKQKSPMANDPAFSKDAMMSSYNLLRSSGSSRRVAVPNSREAAVVGSDTDPSRPR  413

Query  434  AADTTHASPGAIPKMISTAERSSPVI-FDNKCSSSTRN-SNIKNIESTLKGIEGLSFGND  261
               TT ASPGA  K IS+ +RSSPV+  +N+ ++S R+ SNIKN ESTL+GIE L F N+
Sbjct  414  ---TTDASPGAFQK-ISSGQRSSPVVSSENRHTTSGRSTSNIKNFESTLRGIESLHFNNN  469

Query  260  EKSHY  246
            E+ H+
Sbjct  470  ERVHH  474



>gb|KDO65159.1| hypothetical protein CISIN_1g010674mg [Citrus sinensis]
Length=475

 Score =   110 bits (276),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 81/185 (44%), Positives = 111/185 (60%), Gaps = 12/185 (6%)
 Frame = -3

Query  779  YQQSQLPSPPSCGHGGIGATSSGMPHTAANVDKQTGGEEGLPTGWSSGNLVNSRNTGLVL  600
            YQQSQ+ +P      G G  SSGMP  AANVD+Q+G EEG  TGWSS +    RN+G + 
Sbjct  296  YQQSQVSTPARAIGPGAGP-SSGMPPAAANVDRQSGAEEGRHTGWSSADPSRRRNSGPLG  354

Query  599  SSG--SKQKGPVHDSTMskglsssniiqssgssrrpavsSI---RDSVTAGVESDPSRTR  435
            +S   SKQK P+ +       +  +      SS      ++   R++   G ++DPSR R
Sbjct  355  NSANLSKQKSPMANDPAFSKDAMMSSYNLLRSSGSSRRVAVPNSREAAVVGSDTDPSRPR  414

Query  434  AADTTHASPGAIPKMISTAERSSPVI-FDNKCSSSTRN-SNIKNIESTLKGIEGLSFGND  261
               TT ASPGA  K IS+ +RSSPV+  +N+ ++S R+ SNIKN ESTL+GIE L F N+
Sbjct  415  ---TTDASPGAFQK-ISSGQRSSPVVSSENRHTTSGRSTSNIKNFESTLRGIESLHFNNN  470

Query  260  EKSHY  246
            E+ H+
Sbjct  471  ERVHH  475



>gb|KDO65156.1| hypothetical protein CISIN_1g010674mg [Citrus sinensis]
Length=473

 Score =   110 bits (276),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 81/185 (44%), Positives = 111/185 (60%), Gaps = 12/185 (6%)
 Frame = -3

Query  779  YQQSQLPSPPSCGHGGIGATSSGMPHTAANVDKQTGGEEGLPTGWSSGNLVNSRNTGLVL  600
            YQQSQ+ +P      G G  SSGMP  AANVD+Q+G EEG  TGWSS +    RN+G + 
Sbjct  294  YQQSQVSTPARAIGPGAGP-SSGMPPAAANVDRQSGAEEGRHTGWSSADPSRRRNSGPLG  352

Query  599  SSG--SKQKGPVHDSTMskglsssniiqssgssrrpavsSI---RDSVTAGVESDPSRTR  435
            +S   SKQK P+ +       +  +      SS      ++   R++   G ++DPSR R
Sbjct  353  NSANLSKQKSPMANDPAFSKDAMMSSYNLLRSSGSSRRVAVPNSREAAVVGSDTDPSRPR  412

Query  434  AADTTHASPGAIPKMISTAERSSPVI-FDNKCSSSTRN-SNIKNIESTLKGIEGLSFGND  261
               TT ASPGA  K IS+ +RSSPV+  +N+ ++S R+ SNIKN ESTL+GIE L F N+
Sbjct  413  ---TTDASPGAFQK-ISSGQRSSPVVSSENRHTTSGRSTSNIKNFESTLRGIESLHFNNN  468

Query  260  EKSHY  246
            E+ H+
Sbjct  469  ERVHH  473



>gb|KDO65158.1| hypothetical protein CISIN_1g010674mg [Citrus sinensis]
Length=504

 Score =   110 bits (274),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 81/185 (44%), Positives = 111/185 (60%), Gaps = 12/185 (6%)
 Frame = -3

Query  779  YQQSQLPSPPSCGHGGIGATSSGMPHTAANVDKQTGGEEGLPTGWSSGNLVNSRNTGLVL  600
            YQQSQ+ +P      G G  SSGMP  AANVD+Q+G EEG  TGWSS +    RN+G + 
Sbjct  325  YQQSQVSTPARAIGPGAGP-SSGMPPAAANVDRQSGAEEGRHTGWSSADPSRRRNSGPLG  383

Query  599  SSG--SKQKGPVHDSTMskglsssniiqssgssrrpavsSI---RDSVTAGVESDPSRTR  435
            +S   SKQK P+ +       +  +      SS      ++   R++   G ++DPSR R
Sbjct  384  NSANLSKQKSPMANDPAFSKDAMMSSYNLLRSSGSSRRVAVPNSREAAVVGSDTDPSRPR  443

Query  434  AADTTHASPGAIPKMISTAERSSPVI-FDNKCSSSTRN-SNIKNIESTLKGIEGLSFGND  261
               TT ASPGA  K IS+ +RSSPV+  +N+ ++S R+ SNIKN ESTL+GIE L F N+
Sbjct  444  ---TTDASPGAFQK-ISSGQRSSPVVSSENRHTTSGRSTSNIKNFESTLRGIESLHFNNN  499

Query  260  EKSHY  246
            E+ H+
Sbjct  500  ERVHH  504



>ref|XP_006426585.1| hypothetical protein CICLE_v10025527mg [Citrus clementina]
 gb|ESR39825.1| hypothetical protein CICLE_v10025527mg [Citrus clementina]
Length=474

 Score =   109 bits (273),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 80/185 (43%), Positives = 111/185 (60%), Gaps = 12/185 (6%)
 Frame = -3

Query  779  YQQSQLPSPPSCGHGGIGATSSGMPHTAANVDKQTGGEEGLPTGWSSGNLVNSRNTGLVL  600
            YQQSQ+ +P      G G  +SGMP  AANVD+Q+G EEG  TGWSS +    RN+G + 
Sbjct  295  YQQSQVSTPARAIGPGAGP-NSGMPPAAANVDRQSGAEEGRHTGWSSADPSRRRNSGPLG  353

Query  599  SSG--SKQKGPVHDSTMskglsssniiqssgssrrpavsSI---RDSVTAGVESDPSRTR  435
            +S   SKQK P+ +       +  +      SS      ++   R++   G ++DPSR R
Sbjct  354  NSANLSKQKSPMANDPAFSKDAMMSSYNLLRSSGSSRRVAVPNSREAAVVGSDTDPSRPR  413

Query  434  AADTTHASPGAIPKMISTAERSSPVI-FDNKCSSSTRN-SNIKNIESTLKGIEGLSFGND  261
               TT ASPGA  K IS+ +RSSPV+  +N+ ++S R+ SNIKN ESTL+GIE L F N+
Sbjct  414  ---TTDASPGAFQK-ISSGQRSSPVVSSENRHTTSGRSTSNIKNFESTLRGIESLHFNNN  469

Query  260  EKSHY  246
            E+ H+
Sbjct  470  ERVHH  474



>ref|XP_010242267.1| PREDICTED: casein kinase I isoform delta-like [Nelumbo nucifera]
Length=476

 Score =   107 bits (268),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 91/186 (49%), Positives = 114/186 (61%), Gaps = 12/186 (6%)
 Frame = -3

Query  779  YQQSQLPSPPSCGHGGIGATSSGMPHTAANVDKQTGGEEGLPTGWSSGNLVNSRNTGLVL  600
            YQQSQ+ +PP    G    TSSG+P   ANVD+Q+GGEEG   GWSS +    R  G  +
Sbjct  295  YQQSQIATPPPRALGPGAGTSSGLPPAVANVDRQSGGEEGRQAGWSSTDPSRRRIPGPAI  354

Query  599  SSG--SKQKGPV-HDSTMskglsssniiqssgs---srrpavsSIRDSVTAGVESDPSRT  438
            ++G  SKQK PV +DS ++K     + I    +   SRR AVSS RD+   G E DPSR 
Sbjct  355  NAGSLSKQKSPVANDSALTKDAMLPSSIYLGRTGGSSRRAAVSSSRDAAIVGGEPDPSRP  414

Query  437  RAADTTHASPGAIPKMISTAERSSPV-IFDNKCSSSTRN-SNIKNIESTLKGIEGLSFGN  264
            RA   T ASPGA  K + + +RSSP+   + + +SS RN SNIKN ESTLKGIE L F N
Sbjct  415  RA---TEASPGAFRK-VGSGQRSSPIGSSEPRRTSSGRNTSNIKNYESTLKGIECLHFDN  470

Query  263  DEKSHY  246
            DE+  Y
Sbjct  471  DERLQY  476



>ref|XP_002521378.1| casein kinase, putative [Ricinus communis]
 gb|EEF41046.1| casein kinase, putative [Ricinus communis]
Length=472

 Score =   107 bits (268),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 81/185 (44%), Positives = 104/185 (56%), Gaps = 14/185 (8%)
 Frame = -3

Query  779  YQQSQLPSPPSCGHGGIGATSSGMPHTAANVDKQTGGEEGLPTGWSSGNLVNSRNTGLVL  600
            YQQSQ+ +PP+   G     SSGMP + AN+D+Q GGEEG PT W S +    RN+G + 
Sbjct  295  YQQSQIANPPTRALGPGAGPSSGMPPSGANIDRQPGGEEGRPT-WPSMDPTRRRNSGPIT  353

Query  599  SS--GSKQKGPVHDSTMskglsssniiqssgssrrpavsSI---RDSVTAGVESDPSRTR  435
            SS   SKQKGPV +       +  +      SS      +I   RD+   G ESDP+ +R
Sbjct  354  SSVNFSKQKGPVANDLPLSKDAKLSSTNFLRSSGTSRRPAISSSRDAALTGNESDPTWSR  413

Query  434  AADTTHASPGAIPKMISTAERSSPVI-FDNKCSSSTRN-SNIKNIESTLKGIEGLSFGND  261
               TT ASP      IS  +RSSP++  + K  SS RN +NIK  ESTL+GIE L F ND
Sbjct  414  ---TTDASPAV---KISGGQRSSPIVSAEQKHLSSGRNTTNIKTFESTLRGIESLHFNND  467

Query  260  EKSHY  246
            E+  Y
Sbjct  468  ERVQY  472



>ref|XP_010087711.1| Casein kinase I isoform delta-like protein [Morus notabilis]
 gb|EXB29699.1| Casein kinase I isoform delta-like protein [Morus notabilis]
Length=503

 Score =   107 bits (268),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 76/185 (41%), Positives = 104/185 (56%), Gaps = 12/185 (6%)
 Frame = -3

Query  779  YQQSQLPSPPSCGHGGIGATSSGMPHTAANVDKQTGGEEGLPTGWSSGNLVNSRNTGLVL  600
            YQQSQ+ +PP+   G     SSG+P   AN D+   GE+G PTGWS  +    RN+G ++
Sbjct  324  YQQSQIATPPTRALGPGAGPSSGIPPVVANADRH-AGEDGRPTGWSPADPSRRRNSGPLI  382

Query  599  SSGS--KQKGPVHDSTMskglsssniiqssgssrrpavsSI---RDSVTAGVESDPSRTR  435
            +SGS  KQK PV +  +    +         S+      ++   RD +    ESD SR +
Sbjct  383  NSGSLSKQKSPVANDPVVSKDTMLTSSNFVRSTGSSRRPAVSSSRDPLMVSSESDLSRPQ  442

Query  434  AADTTHASPGAIPKMISTAERSSPVIFD--NKCSSSTRNSNIKNIESTLKGIEGLSFGND  261
              D   ASPG + K IS+ +RSSP++    N+ SSS   SNIKN+ESTL+GIE L F ND
Sbjct  443  NTD---ASPGTLRK-ISSGQRSSPIVSSEHNRTSSSRNISNIKNLESTLRGIESLHFNND  498

Query  260  EKSHY  246
            E+  Y
Sbjct  499  ERVQY  503



>gb|KDP40745.1| hypothetical protein JCGZ_24744 [Jatropha curcas]
Length=472

 Score =   104 bits (260),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 79/185 (43%), Positives = 105/185 (57%), Gaps = 14/185 (8%)
 Frame = -3

Query  779  YQQSQLPSPPSCGHGGIGATSSGMPHTAANVDKQTGGEEGLPTGWSSGNLVNSRNTGLVL  600
            YQQSQ+ +PP+   G     SSGMP   ANVD+ TGGEEG  +GW S +    RN+G + 
Sbjct  295  YQQSQIANPPTRALGPGAGPSSGMPPAGANVDRLTGGEEG-RSGWPSADPSRRRNSGPIT  353

Query  599  SSG--SKQKGPVHDSTMskglsssniiqssgssrrpavsSI---RDSVTAGVESDPSRTR  435
            +SG  SKQKGPV     S   +  +      SS      +I   RD+   G +S+P+RTR
Sbjct  354  TSGNLSKQKGPVASDLPSSKDAILSSSNFLRSSGTSRRPAISSSRDAAVIGNDSEPTRTR  413

Query  434  AADTTHASPGAIPKMISTAERSSPVI-FDNKCSSSTRNS-NIKNIESTLKGIEGLSFGND  261
               TT  SP      +S+ +RSSP++  + K S+S R S NIK  ESTL+GIE L F N+
Sbjct  414  ---TTDVSPAV---KVSSGQRSSPIVSAEQKNSTSGRTSTNIKTFESTLRGIESLHFNNE  467

Query  260  EKSHY  246
            E+  Y
Sbjct  468  ERIQY  472



>gb|EYU45867.1| hypothetical protein MIMGU_mgv1a005939mg [Erythranthe guttata]
Length=464

 Score =   102 bits (255),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 92/185 (50%), Positives = 115/185 (62%), Gaps = 22/185 (12%)
 Frame = -3

Query  779  YQQSQLPSPPSCGHGGIGATSSGMPHTAANVDKQTGGEEGLPTGWSS---GNLVNSRNTG  609
            YQQSQL +PPS   G    TSSG+PH  AN+D+ +GG+EG   GW++    NL NS N  
Sbjct  295  YQQSQLANPPSRALGTAAGTSSGIPH--ANIDRLSGGDEGKAAGWAATRGRNLYNSGNL-  351

Query  608  LVLSSGSKQKGPVH-DSTMskglsssniiqssgssrrpavsSIRDSVTAGVESDPSRTRA  432
                  S+QKGPV  DS +SK LSSSNI    GS+RRPAVS  RD   +G ++D    R 
Sbjct  352  ------SRQKGPVATDSALSKDLSSSNIFGQIGSARRPAVSGSRDPDISGTDNDLRHARD  405

Query  431  ADTTHASPGAIPKMISTAERSSPVIF-DNK-CSSSTRNS-NIKNIESTLKGIEGLSFGND  261
             D  H       + +S A+R+ P    DNK  SSSTRN  N+KN ESTLKG+E L+FGND
Sbjct  406  TDGPHH------RNLSDAQRTMPASSNDNKRSSSSTRNPPNVKNFESTLKGMESLNFGND  459

Query  260  EKSHY  246
            E++HY
Sbjct  460  ERTHY  464



>ref|XP_008242376.1| PREDICTED: casein kinase I isoform delta-like [Prunus mume]
Length=470

 Score =   100 bits (250),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 83/183 (45%), Positives = 105/183 (57%), Gaps = 12/183 (7%)
 Frame = -3

Query  779  YQQSQLPSPPSCGHGGIGATSSGMPHTAANVDKQTGGEEGLPTGWSSGNLVNSRNTGLVL  600
            YQQSQL +PP+   G    TSSG+PH AANVD+QTG E+G PTG +S +    R  G  L
Sbjct  295  YQQSQLATPPTRALGPGAGTSSGIPHAAANVDRQTGEEDGRPTGLTSLDSSRRRIPGPAL  354

Query  599  SSG--SKQKGPV-HDSTMskglsssniiqssgssrrpavsSIRDSVTA--GVESDPSRTR  435
            +S   SKQK PV +D+ +S+    SN      S+      ++  S  A  G ESDP R R
Sbjct  355  NSMSLSKQKNPVANDAPLSRETLMSNNNILGRSAGSSRRVAVSSSRDAFGGSESDPYRAR  414

Query  434  AADTTHASPGAIPKMISTAERSSPVIFDNKCSSSTRNSNIKNIESTLKGIEGLSFGNDEK  255
               TT ASPGA    IS+  RSSPV  ++   S    S  +N E+TLKGIEGL   N+E+
Sbjct  415  ---TTDASPGA--HRISSGRRSSPV--ESSDPSRRHTSQSRNYETTLKGIEGLHIDNEER  467

Query  254  SHY  246
             HY
Sbjct  468  VHY  470



>ref|XP_003543581.1| PREDICTED: casein kinase I isoform delta-like isoform X1 [Glycine 
max]
 ref|XP_006595083.1| PREDICTED: casein kinase I isoform delta-like isoform X2 [Glycine 
max]
Length=472

 Score =   100 bits (250),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 82/183 (45%), Positives = 108/183 (59%), Gaps = 10/183 (5%)
 Frame = -3

Query  779  YQQSQLPSPPSCGHGGIGATSSGMPHTAANVDKQTGGEEGLPTGWSSGNLVNSRNTGLVL  600
            YQQSQ+ +PP+   G     SSG+P    N D+QTGGE    TGWSS +    RN+G + 
Sbjct  295  YQQSQIATPPARAIGPAAGPSSGLPPAVVNADRQTGGENSRHTGWSSSDPARRRNSGPIA  354

Query  599  SSG--SKQKGPV-HDSTMskglsssniiqssgssrrpavsSIRDSVTAGVESDPSRTRAA  429
            + G  S+QK P   DST SK +  S+    S  S R  V S     T G E++PS     
Sbjct  355  NDGMLSRQKAPFPSDSTRSKDVMLSSSNFRSSGSTRRGVVSSSRDATVGNETEPSHPLTV  414

Query  428  DTTHASPGAIPKMISTAERSSPVI-FDNKCSSSTRN-SNIKNIESTLKGIEGLSFGNDEK  255
            D   AS GA+ K IS A+RSSP++ F++  +SS RN SN+KN EST++GIE L+F NDE+
Sbjct  415  D---ASQGALRK-ISGAQRSSPIMPFEHNRTSSGRNTSNMKNYESTIRGIETLNF-NDER  469

Query  254  SHY  246
              Y
Sbjct  470  LQY  472



>ref|XP_007201986.1| hypothetical protein PRUPE_ppa004932mg [Prunus persica]
 gb|EMJ03185.1| hypothetical protein PRUPE_ppa004932mg [Prunus persica]
Length=485

 Score =   100 bits (250),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 82/183 (45%), Positives = 104/183 (57%), Gaps = 12/183 (7%)
 Frame = -3

Query  779  YQQSQLPSPPSCGHGGIGATSSGMPHTAANVDKQTGGEEGLPTGWSSGNLVNSRNTGLVL  600
            YQQSQL +PP+   G    TSSG+PH AANVD+QTG E+G PTG +S +    R  G  L
Sbjct  310  YQQSQLATPPTRALGPGAGTSSGIPHAAANVDRQTGEEDGRPTGLTSLDSSRRRIPGPAL  369

Query  599  SSG--SKQKGPV-HDSTMskglsssniiqssgssrrpavsSIRDSVTA--GVESDPSRTR  435
            +S   SKQK PV +D+ +S+     N      S+      ++  S  A  G ESDP R R
Sbjct  370  NSMSLSKQKNPVANDAPLSRETLMLNNNILGRSAGSSRRVAVSSSRDAFGGSESDPYRAR  429

Query  434  AADTTHASPGAIPKMISTAERSSPVIFDNKCSSSTRNSNIKNIESTLKGIEGLSFGNDEK  255
               TT ASPGA    IS+  RSSPV  ++   S    S  +N E+TLKGIEGL   N+E+
Sbjct  430  ---TTDASPGA--HRISSGRRSSPV--ESSDPSRRHTSQSRNYETTLKGIEGLHIDNEER  482

Query  254  SHY  246
             HY
Sbjct  483  VHY  485



>gb|KHN30066.1| Casein kinase I isoform delta-like [Glycine soja]
Length=472

 Score =   100 bits (249),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 82/183 (45%), Positives = 108/183 (59%), Gaps = 10/183 (5%)
 Frame = -3

Query  779  YQQSQLPSPPSCGHGGIGATSSGMPHTAANVDKQTGGEEGLPTGWSSGNLVNSRNTGLVL  600
            YQQSQ+ +PP+   G     SSG+P    N D+QTGGE    TGWSS +    RN+G + 
Sbjct  295  YQQSQIATPPARAIGPAAGPSSGLPPAVVNADRQTGGENSRHTGWSSSDPARRRNSGPIA  354

Query  599  SSG--SKQKGPV-HDSTMskglsssniiqssgssrrpavsSIRDSVTAGVESDPSRTRAA  429
            + G  S+QK P   DST SK +  S+    S  S R  V S     T G E++PS     
Sbjct  355  NDGMLSRQKAPFPSDSTRSKDVMLSSSNFRSSGSTRRGVVSSSRDATVGNETEPSHPLTV  414

Query  428  DTTHASPGAIPKMISTAERSSPVI-FDNKCSSSTRN-SNIKNIESTLKGIEGLSFGNDEK  255
            D   AS GA+ K IS A+RSSP++ F++  +SS RN SN+KN EST++GIE L+F NDE+
Sbjct  415  D---ASQGALRK-ISGAQRSSPIMPFEHNRTSSGRNTSNMKNYESTIRGIETLNF-NDER  469

Query  254  SHY  246
              Y
Sbjct  470  LQY  472



>ref|XP_002281345.2| PREDICTED: casein kinase I isoform delta-like [Vitis vinifera]
 emb|CAN80417.1| hypothetical protein VITISV_024542 [Vitis vinifera]
 emb|CBI27888.3| unnamed protein product [Vitis vinifera]
Length=474

 Score =   100 bits (248),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 95/187 (51%), Positives = 114/187 (61%), Gaps = 16/187 (9%)
 Frame = -3

Query  779  YQQSQLPSPPSCGHGGIGATSSGMPHTA-ANVDKQTGGEEGLPTGWSSGNLVNSRNTGLV  603
            YQQSQL +PPS   G    TSSG+P  A AN D+Q+ GEEG P G SS +    R +G  
Sbjct  295  YQQSQLATPPSRVLGPGAGTSSGLPPPAVANADRQS-GEEGRPAGLSSMDPSRRRISG--  351

Query  602  LSSG--SKQKGPVHDSTMskglsssnii----qssgssrrpavsSIRDSVTAGVESDPSR  441
               G  SKQK PV         +  +      +SSGSSRR AVSS RD+   G ESDPSR
Sbjct  352  -DGGGLSKQKSPVASDLAVSKDAMLSSSHFLGRSSGSSRRAAVSSSRDAAIMGSESDPSR  410

Query  440  TRAADTTHASPGAIPKMISTAERSSPV-IFDNKCSSSTRN-SNIKNIESTLKGIEGLSFG  267
               A TT ASPGA  + IS+ +RSSPV   D K +SS RN +NIKN EST++GIE L+F 
Sbjct  411  ---AHTTEASPGAAVRRISSGQRSSPVGSSDPKRTSSGRNITNIKNYESTIRGIENLNFD  467

Query  266  NDEKSHY  246
            NDE+ HY
Sbjct  468  NDERVHY  474



>ref|XP_004303659.1| PREDICTED: casein kinase I [Fragaria vesca subsp. vesca]
Length=473

 Score = 99.0 bits (245),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 84/185 (45%), Positives = 117/185 (63%), Gaps = 13/185 (7%)
 Frame = -3

Query  779  YQQSQLPSPPSCGHGGIGATSSGMPHTAANVDKQTGGEEGLPTGWSSGNLVNSRNTGLVL  600
            YQQSQ+ +PP+   GG G  SSG+P   ANV++Q+GGEE  PTGWS  +    RN+G ++
Sbjct  295  YQQSQIATPPARAPGGAGP-SSGLP-PVANVERQSGGEEVRPTGWSLSDPSRRRNSGPIV  352

Query  599  SSG--SKQKGPVHDS---TMskglsssniiqssgssrrpavsSIRDSVTAGVESDPSRTR  435
            + G  S+QK PV +    +    LSSS+ ++S+GSSRR  VSS RD+V  G ES+PSR +
Sbjct  353  NPGSLSRQKSPVANDPSVSKDAMLSSSSFLRSTGSSRRAVVSSSRDAVIVGSESNPSRPQ  412

Query  434  AADTTHASPGAIPKMISTAERSSPVI--FDNKCSSSTRNSNIKNIESTLKGIEGLSFGND  261
              +T   + G     IS  +RSSPV+    N+ +S    S +KN+ESTL+GIE L F +D
Sbjct  413  TTETGSGTLGK----ISAVQRSSPVVSSEQNRTTSGRNISTVKNLESTLRGIETLHFNSD  468

Query  260  EKSHY  246
            E+  Y
Sbjct  469  ERVQY  473



>ref|XP_008447619.1| PREDICTED: casein kinase I isoform delta-like [Cucumis melo]
Length=470

 Score = 99.0 bits (245),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 90/184 (49%), Positives = 114/184 (62%), Gaps = 14/184 (8%)
 Frame = -3

Query  779  YQQSQLPSPPSCGHGGIGATSSGMPHTAANVDKQTGGEEGLP--TGWSSGNLVNSRNTGL  606
            YQQSQ+ +PP+   GG G  SSG+P   AN D+ TGGEEG P  +GW + + +  RN+G 
Sbjct  295  YQQSQITAPPTRAIGGAGP-SSGVPMAIANADRHTGGEEGRPPPSGWIAADPLRRRNSGP  353

Query  605  VLSSGSKQKGPV---HDSTMskglsssniiqssgssrrpavsSIRDSVTAGVESDPSRTR  435
            V +  +KQK PV   H     + L +SNIIQSSGSSRR A++S +D    G ESDP+R  
Sbjct  354  V-TGTAKQKPPVTNDHAIAKERILPNSNIIQSSGSSRRAAIASTQDIALLGCESDPTRLG  412

Query  434  AADTTHASPGAIPKMISTAERSSPVIFDNKCSSSTRN-SNIKNIESTLKGIEGLSFGNDE  258
              D    S GA+ K IS+A+R SP   D   S+S RN S I+N ESTL+GIE L F  DE
Sbjct  413  IPD---PSFGAVHK-ISSAQRHSPA--DQNRSTSARNISGIRNFESTLRGIESLHFNQDE  466

Query  257  KSHY  246
            K  Y
Sbjct  467  KVQY  470



>ref|XP_002514130.1| casein kinase, putative [Ricinus communis]
 gb|EEF48084.1| casein kinase, putative [Ricinus communis]
Length=446

 Score = 96.7 bits (239),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 91/189 (48%), Positives = 116/189 (61%), Gaps = 18/189 (10%)
 Frame = -3

Query  779  YQQSQLPSPPSCGHG-GIGATSSGMPHTAANVDKQTGGEEGLPTGWSSGNLVNSRNTGLV  603
            YQQSQL +PP+   G GIG TSSGMP    + D+QTGGEE    G S  +    R +G +
Sbjct  265  YQQSQLANPPARALGPGIG-TSSGMPPAIGSADRQTGGEEARQAGQSMDS-ARRRLSGPI  322

Query  602  LSSGS--KQKGPV-HDSTMskg----lsssniiqssgssrrpavsSIRDSVTAGVESDPS  444
            L++GS  KQK PV +DS +SK      S+     S  S +  AVSS RD V  G E+DP 
Sbjct  323  LNTGSFAKQKSPVANDSPVSKDPILPSSTFMGRSSRSSRQAAAVSSSRD-VYLGSEADPQ  381

Query  443  RTRAADTTHASPGAIPKMISTAERSSPVI--FDNKCSSSTRNS-NIKNIESTLKGIEGLS  273
            RTR   TT ASPGA+ K I + +RS P +   D + SSS RN+ ++K  ES LKGIEGL+
Sbjct  382  RTR---TTDASPGAMHK-IPSGQRSPPPLGSSDPRRSSSARNATHMKTYESALKGIEGLN  437

Query  272  FGNDEKSHY  246
            F +D+K HY
Sbjct  438  FDSDDKVHY  446



>gb|KHN32707.1| Casein kinase I isoform delta-like [Glycine soja]
Length=268

 Score = 94.4 bits (233),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 82/188 (44%), Positives = 107/188 (57%), Gaps = 21/188 (11%)
 Frame = -3

Query  779  YQQSQLPSP-----PSCGHGGIGATSSGMPHTAANVDKQTGGEEGLPTGWSSGNLVNSRN  615
            YQQSQ+ +P     P+ G       SSG+P    N D+QTGG     TGWSS +    RN
Sbjct  92   YQQSQIATPVRVIVPAAGQ------SSGLPPAVVNADRQTGGVNSRHTGWSSSDPARRRN  145

Query  614  TGLVLSSG--SKQKGPV-HDSTMskglsssniiqssgssrrpavsSIRDSVTAGVESDPS  444
            +G + + G  S+QK PV  DST SK +  S+    S  S R    S       G E++PS
Sbjct  146  SGPIANDGMSSRQKAPVPSDSTGSKDVMLSSSNFRSSGSTRRGAVSSSRDAAVGNETEPS  205

Query  443  RTRAADTTHASPGAIPKMISTAERSSPVI-FDNKCSSSTRN-SNIKNIESTLKGIEGLSF  270
                 D   ASPGA+ K IS A+RSSP++ F++  +SS RN SN+KN ESTL+GIE L+F
Sbjct  206  HPLTMD---ASPGALRK-ISNAQRSSPIMSFEHNRTSSGRNTSNMKNYESTLRGIETLNF  261

Query  269  GNDEKSHY  246
             NDE+  Y
Sbjct  262  -NDERLQY  268



>ref|XP_004151319.1| PREDICTED: casein kinase I isoform delta-like [Cucumis sativus]
 ref|XP_004154790.1| PREDICTED: casein kinase I isoform delta-like [Cucumis sativus]
 gb|KGN59801.1| hypothetical protein Csa_3G847620 [Cucumis sativus]
Length=471

 Score = 96.3 bits (238),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 89/185 (48%), Positives = 113/185 (61%), Gaps = 15/185 (8%)
 Frame = -3

Query  779  YQQSQLPSPPSCGHGGIGATSSGMPHTAANVDKQTGGEEGLP--TGWSSGNLVNSRNTGL  606
            YQQSQ+ +PP+   GG G  SSG+P   AN D+ TGGEEG P  +GW + + +  RN+G 
Sbjct  295  YQQSQITAPPTRAIGGAGP-SSGVPMAIANADRHTGGEEGRPPPSGWVAPDPLRRRNSGP  353

Query  605  VLSSGSKQKGPV---HDSTMskglsssniiqssgssrrpavsSIRDSVTAGVESDPSRTR  435
            V +  +KQK P    H     + L +SNIIQSSGSSRR A++S +D    G ESDP+R  
Sbjct  354  V-TGTAKQKPPATNDHAIAKERILPNSNIIQSSGSSRRAAIASTQDIALLGCESDPTRLG  412

Query  434  AADTTHASPGAIPKMISTAERSSPVIFDNKCSSSTRN--SNIKNIESTLKGIEGLSFGND  261
              D    S GA+ K IS+A+R SP   D   S+S RN  S I+N ESTL+GIE L F  D
Sbjct  413  IPD---PSFGAVQK-ISSAQRHSPA--DQNRSTSARNISSGIRNFESTLRGIESLHFNQD  466

Query  260  EKSHY  246
            EK  Y
Sbjct  467  EKVQY  471



>ref|XP_011079987.1| PREDICTED: casein kinase I-like [Sesamum indicum]
Length=461

 Score = 95.5 bits (236),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 81/184 (44%), Positives = 105/184 (57%), Gaps = 25/184 (14%)
 Frame = -3

Query  779  YQQSQLPSPPSCGHGGIGATSSGMPHTAANVDKQTGGEEGLPTGWSSGNLVNSRNTGLVL  600
            YQQSQL +PPS   G    TSSG+PH  A  D+Q+GGEEG   G  SG     RN    L
Sbjct  295  YQQSQLANPPSRALGTAAGTSSGIPHATA--DRQSGGEEGKAPG-GSGTATRGRN---FL  348

Query  599  SSG--SKQKGPV-HDSTMskglsssniiqssgssrrpavsSIRDSVTAGVESDPSRTRAA  429
            +SG  S+QKGP  +D+++S       I  S   +        RD+  +G   DPSR R +
Sbjct  349  NSGNLSRQKGPAANDASLSSSNIFRQIGSSRRPAVPST----RDAEGSG-NDDPSRARTS  403

Query  428  DTTHASPGAIPKMISTAERSSPVIFDN--KCSSSTRN-SNIKNIESTLKGIEGLSFG-ND  261
            D  H +        S A+RSSPV+  +  +  SSTRN +NIKN ++TLKGIEGL+FG ND
Sbjct  404  DALHRNS-------SGAQRSSPVVSSDHKRTLSSTRNPTNIKNFDATLKGIEGLNFGNND  456

Query  260  EKSH  249
            E+ H
Sbjct  457  ERVH  460



>ref|XP_007012783.1| Casein kinase 1-like protein 2 isoform 1 [Theobroma cacao]
 gb|EOY30402.1| Casein kinase 1-like protein 2 isoform 1 [Theobroma cacao]
Length=470

 Score = 95.1 bits (235),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 82/181 (45%), Positives = 106/181 (59%), Gaps = 8/181 (4%)
 Frame = -3

Query  779  YQQSQLPSPPSCGHGGIGATSSGMPHTAANVDKQTGGEEGLPTGWSSGNLVNSRNTGLVL  600
            YQQSQL +P +   G    TSS MP   AN D+ T GE+    G SS +    R +G ++
Sbjct  295  YQQSQLATPSARAVGPGAGTSSAMPPAIANADRHTVGEDARAAGLSSMDSSRRRTSGPLM  354

Query  599  SSGS--KQKGPVHDSTMskglsssniiqssgssrrpavsSIRDSVTAGVESDPSRTRAAD  426
            +SGS  KQK PV +  +    S         SSRR AVSS RD+  AG E++P R+R   
Sbjct  355  TSGSYAKQKSPVANDPVITKDSMFMGQSGGSSSRRVAVSSSRDAF-AGSEAEPQRSR---  410

Query  425  TTHASPGAIPKMISTAERSSPVIFDNKCSSSTRN-SNIKNIESTLKGIEGLSFGNDEKSH  249
            TT ASPGA+ K IS+ +RS     D K + S RN S++KN E+ LKGIEGL F +DE+ H
Sbjct  411  TTDASPGALHK-ISSQQRSPVESADAKRTLSGRNTSHVKNYEAALKGIEGLQFESDERVH  469

Query  248  Y  246
            Y
Sbjct  470  Y  470



>gb|KDO53221.1| hypothetical protein CISIN_1g011819mg [Citrus sinensis]
Length=317

 Score = 93.2 bits (230),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 86/189 (46%), Positives = 109/189 (58%), Gaps = 17/189 (9%)
 Frame = -3

Query  779  YQQSQLPSPPSCGHGGIGATSSGMPHTAANVDKQT-GGEEGLPTGWSSGNLVNSRNTGLV  603
            YQQSQL +PP+      GA +SG P   A+ D+QT GGEEG P G SS +    R +G V
Sbjct  135  YQQSQLATPPARALVP-GAGTSGAPPAIASGDRQTGGGEEGRPAGLSSMDSSRRRMSGPV  193

Query  602  LSSG--SKQKGPVHDS------TMskglsssniiqssgssrrpavsSIRDSVTAGVESDP  447
            ++SG  SKQK PV +       TM    +         S R  AVSS RD+   G E++P
Sbjct  194  INSGSFSKQKSPVVNEPTMTKDTMLSSSNFLGRSGGGSSRRAAAVSSSRDAF-VGSETEP  252

Query  446  SRTRAADTTHASPGAIPKMISTAERSSPV-IFDNKCSSSTRN-SNIKNIESTLKGIEGLS  273
             R+R   TT ASPGA+ + IS+  R SP+   D K SSS RN ++IK  E+TLKGIE L 
Sbjct  253  QRSR---TTEASPGAMHR-ISSGPRGSPIGSSDPKRSSSGRNTTHIKTYETTLKGIESLH  308

Query  272  FGNDEKSHY  246
            F  DE+ HY
Sbjct  309  FDTDERVHY  317



>ref|XP_010049456.1| PREDICTED: casein kinase I isoform delta-like [Eucalyptus grandis]
 gb|KCW82052.1| hypothetical protein EUGRSUZ_C03421 [Eucalyptus grandis]
Length=475

 Score = 94.7 bits (234),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 83/185 (45%), Positives = 108/185 (58%), Gaps = 11/185 (6%)
 Frame = -3

Query  779  YQQSQLPSPPSCGHGGIGATSSGMPHTAANVDKQTGGEEGLPTGWSSGNLVNSRNTGLVL  600
            YQQSQ+ +PPS   G     SSG+P  A +VDKQTGGE+  P G SS +    R +G   
Sbjct  295  YQQSQMATPPSRALGLGAGPSSGIPPVAGHVDKQTGGEDSRPVGLSSMDPSRRRLSGATA  354

Query  599  SSG--SKQKGPV-HDSTMskglsssniiqssgssrrpavsSIRDSVTA--GVESDPSRTR  435
            ++G  SKQK PV +D  +SK    S+      S      ++I  S  A  G ESD  R R
Sbjct  355  TAGSFSKQKSPVTNDGAISKEAMISSSAFLGRSGGSSRRAAISSSREAFMGGESDSHRAR  414

Query  434  AADTTHASPGAIPKMISTAERSSPV-IFDNKCSSSTRNS-NIKNIESTLKGIEGLSFGND  261
               TT ASPGA+ K IS+ +RSSPV   D + SSS RN+ ++KN E+ LKGIE L F +D
Sbjct  415  ---TTEASPGAVRK-ISSGQRSSPVGSSDPRQSSSGRNAVHLKNYENALKGIERLHFDSD  470

Query  260  EKSHY  246
            E+ H+
Sbjct  471  ERVHF  475



>ref|XP_010696534.1| PREDICTED: casein kinase I isoform delta-like [Beta vulgaris 
subsp. vulgaris]
 gb|ABM55249.1| casein kinase [Beta vulgaris]
Length=473

 Score = 94.4 bits (233),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 83/185 (45%), Positives = 116/185 (63%), Gaps = 14/185 (8%)
 Frame = -3

Query  779  YQQSQLPSPPSCGHGGIGATSSGMPH-TAANVDKQTGGEEGLPTGWSSGNLVNSRNTGLV  603
            YQQSQL +PP+    G G TS+G+P    AN +++ G EEG   G S+G+ +  R +G +
Sbjct  295  YQQSQLAAPPARTGAGAG-TSAGVPTPPVANPERKLGEEEGRAGGLSTGDGLRRRMSGSL  353

Query  602  LSSGS--KQKGPV-HDSTMskglsssniiqssgssrrpavsSI---RDSVTAGVESDPSR  441
            L+SGS  KQK P+ +D T+SK  + S+   +  SS     ++I   R++VT G ESDPSR
Sbjct  354  LNSGSLLKQKSPLANDPTVSKDPTLSSTNLTGRSSGFLKRAAIPSSREAVTGGNESDPSR  413

Query  440  TRAADTTHASPGAIPKMISTAERSSPV-IFDNKCSSSTRNSNIKNIESTLKGIEGLSFGN  264
            +R A+   ASP  + +  S+ +RSSPV   D K  SS R ++IKN ESTLKGIE L F +
Sbjct  414  SRTAE---ASPSTMQR-FSSGQRSSPVGSSDAKQQSSGRITSIKNYESTLKGIESLHF-D  468

Query  263  DEKSH  249
            DE+ H
Sbjct  469  DERVH  473



>gb|KDO53220.1| hypothetical protein CISIN_1g011819mg [Citrus sinensis]
Length=373

 Score = 93.2 bits (230),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 86/189 (46%), Positives = 109/189 (58%), Gaps = 17/189 (9%)
 Frame = -3

Query  779  YQQSQLPSPPSCGHGGIGATSSGMPHTAANVDKQT-GGEEGLPTGWSSGNLVNSRNTGLV  603
            YQQSQL +PP+      GA +SG P   A+ D+QT GGEEG P G SS +    R +G V
Sbjct  191  YQQSQLATPPARALVP-GAGTSGAPPAIASGDRQTGGGEEGRPAGLSSMDSSRRRMSGPV  249

Query  602  LSSG--SKQKGPVHDS------TMskglsssniiqssgssrrpavsSIRDSVTAGVESDP  447
            ++SG  SKQK PV +       TM    +         S R  AVSS RD+   G E++P
Sbjct  250  INSGSFSKQKSPVVNEPTMTKDTMLSSSNFLGRSGGGSSRRAAAVSSSRDAF-VGSETEP  308

Query  446  SRTRAADTTHASPGAIPKMISTAERSSPV-IFDNKCSSSTRN-SNIKNIESTLKGIEGLS  273
             R+R   TT ASPGA+ + IS+  R SP+   D K SSS RN ++IK  E+TLKGIE L 
Sbjct  309  QRSR---TTEASPGAMHR-ISSGPRGSPIGSSDPKRSSSGRNTTHIKTYETTLKGIESLH  364

Query  272  FGNDEKSHY  246
            F  DE+ HY
Sbjct  365  FDTDERVHY  373



>gb|KDO53219.1| hypothetical protein CISIN_1g011819mg [Citrus sinensis]
Length=396

 Score = 93.2 bits (230),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 86/189 (46%), Positives = 109/189 (58%), Gaps = 17/189 (9%)
 Frame = -3

Query  779  YQQSQLPSPPSCGHGGIGATSSGMPHTAANVDKQT-GGEEGLPTGWSSGNLVNSRNTGLV  603
            YQQSQL +PP+      GA +SG P   A+ D+QT GGEEG P G SS +    R +G V
Sbjct  214  YQQSQLATPPARALVP-GAGTSGAPPAIASGDRQTGGGEEGRPAGLSSMDSSRRRMSGPV  272

Query  602  LSSG--SKQKGPVHDS------TMskglsssniiqssgssrrpavsSIRDSVTAGVESDP  447
            ++SG  SKQK PV +       TM    +         S R  AVSS RD+   G E++P
Sbjct  273  INSGSFSKQKSPVVNEPTMTKDTMLSSSNFLGRSGGGSSRRAAAVSSSRDAF-VGSETEP  331

Query  446  SRTRAADTTHASPGAIPKMISTAERSSPV-IFDNKCSSSTRN-SNIKNIESTLKGIEGLS  273
             R+R   TT ASPGA+ + IS+  R SP+   D K SSS RN ++IK  E+TLKGIE L 
Sbjct  332  QRSR---TTEASPGAMHR-ISSGPRGSPIGSSDPKRSSSGRNTTHIKTYETTLKGIESLH  387

Query  272  FGNDEKSHY  246
            F  DE+ HY
Sbjct  388  FDTDERVHY  396



>gb|KDP33855.1| hypothetical protein JCGZ_07426 [Jatropha curcas]
Length=477

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 83/189 (44%), Positives = 117/189 (62%), Gaps = 17/189 (9%)
 Frame = -3

Query  779  YQQSQLPSPPSCGHG-GIGATSSGMPHTAANVDKQTGGEEGLPTGWSSGNLVNSRN-TGL  606
            YQQSQL +PP+   G GIG TSSG+P   A+ D+QTGGEE   TG S  +     + +G 
Sbjct  295  YQQSQLANPPARALGPGIG-TSSGVPPAIASADRQTGGEEARQTGQSIDSARRRLSGSGP  353

Query  605  VLSSG--SKQKGPVHDSTMskg-----lsssniiqssgssrrpavsSIRDSVTAGVESDP  447
            +L+SG  +KQK P+ + + +        S+     S  + +   VS+ RD + AG E+DP
Sbjct  354  ILNSGNYAKQKSPIANDSPASKDPLLPSSAFIGRSSRSTRQAGTVSTSRD-IFAGSEADP  412

Query  446  SRTRAADTTHASPGAIPKMISTAERSSPV-IFDNKCSSSTRNS-NIKNIESTLKGIEGLS  273
             R+R   TT ASPGA  K IS+ +RS P+   D + S+STRN+ ++K+ ES LKGIEGL+
Sbjct  413  QRSR---TTDASPGAAHK-ISSGQRSPPLGSADPRRSASTRNATHMKSYESALKGIEGLN  468

Query  272  FGNDEKSHY  246
            F +D+K HY
Sbjct  469  FDSDDKVHY  477



>ref|XP_006597037.1| PREDICTED: uncharacterized protein LOC100795570 isoform X1 [Glycine 
max]
Length=471

 Score = 93.6 bits (231),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 82/188 (44%), Positives = 107/188 (57%), Gaps = 21/188 (11%)
 Frame = -3

Query  779  YQQSQLPSP-----PSCGHGGIGATSSGMPHTAANVDKQTGGEEGLPTGWSSGNLVNSRN  615
            YQQSQ+ +P     P+ G       SSG+P    N D+QTGG     TGWSS +    RN
Sbjct  295  YQQSQIATPVRVIVPAAGQ------SSGLPPAVVNADRQTGGVNSRHTGWSSSDPARRRN  348

Query  614  TGLVLSSG--SKQKGPV-HDSTMskglsssniiqssgssrrpavsSIRDSVTAGVESDPS  444
            +G + + G  S+QK PV  DST SK +  S+    S  S R    S       G E++PS
Sbjct  349  SGPIANDGMSSRQKAPVPSDSTGSKDVMLSSSNFRSSGSTRRGAVSSSRDAAVGNETEPS  408

Query  443  RTRAADTTHASPGAIPKMISTAERSSPVI-FDNKCSSSTRN-SNIKNIESTLKGIEGLSF  270
                 D   ASPGA+ K IS A+RSSP++ F++  +SS RN SN+KN ESTL+GIE L+F
Sbjct  409  HPLTMD---ASPGALRK-ISNAQRSSPIMSFEHNRTSSGRNTSNMKNYESTLRGIETLNF  464

Query  269  GNDEKSHY  246
             NDE+  Y
Sbjct  465  -NDERLQY  471



>ref|NP_001242599.1| uncharacterized protein LOC100795570 [Glycine max]
 gb|ACU21096.1| unknown [Glycine max]
Length=471

 Score = 93.6 bits (231),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 82/188 (44%), Positives = 107/188 (57%), Gaps = 21/188 (11%)
 Frame = -3

Query  779  YQQSQLPSP-----PSCGHGGIGATSSGMPHTAANVDKQTGGEEGLPTGWSSGNLVNSRN  615
            YQQSQ+ +P     P+ G       SSG+P    N D+QTGG     TGWSS +    RN
Sbjct  295  YQQSQIATPVRVIVPTAGQ------SSGLPPAVVNADRQTGGVNSRHTGWSSSDPARRRN  348

Query  614  TGLVLSSG--SKQKGPV-HDSTMskglsssniiqssgssrrpavsSIRDSVTAGVESDPS  444
            +G + + G  S+QK PV  DST SK +  S+    S  S R    S       G E++PS
Sbjct  349  SGPIANDGMSSRQKAPVPSDSTGSKDVMLSSSNFRSSGSTRRGAVSSSRDAAVGNETEPS  408

Query  443  RTRAADTTHASPGAIPKMISTAERSSPVI-FDNKCSSSTRN-SNIKNIESTLKGIEGLSF  270
                 D   ASPGA+ K IS A+RSSP++ F++  +SS RN SN+KN ESTL+GIE L+F
Sbjct  409  HPLTMD---ASPGALRK-ISNAQRSSPIMSFEHNRTSSGRNTSNMKNYESTLRGIETLNF  464

Query  269  GNDEKSHY  246
             NDE+  Y
Sbjct  465  -NDERLQY  471



>gb|KJB56939.1| hypothetical protein B456_009G142600 [Gossypium raimondii]
Length=475

 Score = 93.2 bits (230),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 81/186 (44%), Positives = 108/186 (58%), Gaps = 13/186 (7%)
 Frame = -3

Query  779  YQQSQLPSPPSCGHGGIGATSSGMPHTAANVDKQTGGEEGLPTGWSSGNLVNSRNTGLVL  600
            YQQSQ+ +PP+   G    TSSG+P   A  D+Q+G EE  P+GWSS +    R++GL+ 
Sbjct  295  YQQSQIANPPTRALGSGAGTSSGLPPAGAIADRQSG-EETRPSGWSSADPTRRRHSGLIA  353

Query  599  SSGS--KQKGPVHD--STMskglsssniiqssgssrrpavsSIRDSVTAGVESDPSRT--  438
            +SGS  KQKGPV +  S     + SS+    S  S R A  S      A   S P R+  
Sbjct  354  NSGSLAKQKGPVANDLSAAKDPMLSSSNFLRSSGSSRRAAVSSSHEAAAIAVSGPERSHF  413

Query  437  RAADTTHASPGAIPKMISTAERSSPVIF-DNKCSSSTRNS-NIKNIESTLKGIEGLSFGN  264
            RA D   A+ G   K IS+ +R+SPV+  +NK  SS RNS NI N+ES ++GIE L F N
Sbjct  414  RATD---ATAGPFQK-ISSGQRNSPVLSSENKRPSSGRNSSNINNLESAVRGIESLHFRN  469

Query  263  DEKSHY  246
            +E+ HY
Sbjct  470  EERLHY  475



>ref|XP_010062656.1| PREDICTED: casein kinase I isoform delta-like isoform X2 [Eucalyptus 
grandis]
Length=425

 Score = 92.8 bits (229),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 69/181 (38%), Positives = 94/181 (52%), Gaps = 4/181 (2%)
 Frame = -3

Query  779  YQQSQLPSPPSCGHGGIGATSSGMPHTAANVDKQTGGEEGLPTGWSSGNLVNSRNTGLVL  600
            YQQSQ+ +PPS   G     SSG+P    N ++Q+GGE+G P  WS G     R++G + 
Sbjct  246  YQQSQIATPPSRALGNGAGPSSGVPPAVNNTERQSGGEDGRPAAWSLGEPSRRRHSGPIA  305

Query  599  SSGS--KQKGPVHDSTMskglsssniiqssgssrrpavsSIRDSVTAGVESDPSRTRAAD  426
            +SGS  K K PV + +++      +      SS      +   S  AGV           
Sbjct  306  TSGSLLKPKNPVTNDSVASKEVLLSSSNFLRSSSSSRKPAASGSRDAGVFKSELDASHRH  365

Query  425  TTHASPGAIPKMISTAERSSPVIFDNKCSSSTRN-SNIKNIESTLKGIEGLSFGNDEKSH  249
            TT  SPG I    S+A+R+SPV    +  +S+RN SNI N ESTL+GIE L F N E+  
Sbjct  366  TTDVSPG-INHKFSSAQRNSPVAPSEQKQASSRNASNINNFESTLRGIESLHFNNKERLQ  424

Query  248  Y  246
            Y
Sbjct  425  Y  425



>gb|KHG04850.1| hypothetical protein F383_30273 [Gossypium arboreum]
Length=480

 Score = 93.2 bits (230),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 74/187 (40%), Positives = 103/187 (55%), Gaps = 10/187 (5%)
 Frame = -3

Query  779  YQQSQLPSPPSCGHGGIGATSSGMPHTAANVDKQTG----GEEGLPTGWSSGNLVNSRNT  612
            YQQSQ+ +PP+   G    TSSG+P   A  D+Q+G    GEE  P+GWSS +    R++
Sbjct  295  YQQSQIANPPTRALGPGAGTSSGLPPAGAIADRQSGIFFTGEETRPSGWSSADPTRRRHS  354

Query  611  GLVLSSGS--KQKGPV-HDSTMskglsssniiqssgssrrpavsSIRDSVTAGVESDPSR  441
            GL+ +SGS  KQK PV +D + +K    S+      S      +       A +    S 
Sbjct  355  GLIANSGSLAKQKSPVANDLSAAKDPMLSSSNFLRSSGSSRRAAVSSSRDAAAIAVSDSE  414

Query  440  TRAADTTHASPGAIPKMISTAERSSPVIF-DNKCSSSTRN-SNIKNIESTLKGIEGLSFG  267
                 TT A+ G   K IS+ +R+SPV+  +NK  SS RN SNI N+ES ++GIE L F 
Sbjct  415  RSHFRTTDATAGPFQK-ISSGQRNSPVLSSENKRPSSGRNTSNINNVESAVRGIESLHFR  473

Query  266  NDEKSHY  246
            N+E+ HY
Sbjct  474  NEERLHY  480



>gb|KDO53216.1| hypothetical protein CISIN_1g011819mg [Citrus sinensis]
Length=445

 Score = 92.8 bits (229),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 86/189 (46%), Positives = 109/189 (58%), Gaps = 17/189 (9%)
 Frame = -3

Query  779  YQQSQLPSPPSCGHGGIGATSSGMPHTAANVDKQT-GGEEGLPTGWSSGNLVNSRNTGLV  603
            YQQSQL +PP+      GA +SG P   A+ D+QT GGEEG P G SS +    R +G V
Sbjct  263  YQQSQLATPPARALVP-GAGTSGAPPAIASGDRQTGGGEEGRPAGLSSMDSSRRRMSGPV  321

Query  602  LSSG--SKQKGPVHDS------TMskglsssniiqssgssrrpavsSIRDSVTAGVESDP  447
            ++SG  SKQK PV +       TM    +         S R  AVSS RD+   G E++P
Sbjct  322  INSGSFSKQKSPVVNEPTMTKDTMLSSSNFLGRSGGGSSRRAAAVSSSRDAF-VGSETEP  380

Query  446  SRTRAADTTHASPGAIPKMISTAERSSPV-IFDNKCSSSTRN-SNIKNIESTLKGIEGLS  273
             R+R   TT ASPGA+ + IS+  R SP+   D K SSS RN ++IK  E+TLKGIE L 
Sbjct  381  QRSR---TTEASPGAMHR-ISSGPRGSPIGSSDPKRSSSGRNTTHIKTYETTLKGIESLH  436

Query  272  FGNDEKSHY  246
            F  DE+ HY
Sbjct  437  FDTDERVHY  445



>gb|KDO53218.1| hypothetical protein CISIN_1g011819mg [Citrus sinensis]
Length=449

 Score = 92.4 bits (228),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 86/189 (46%), Positives = 109/189 (58%), Gaps = 17/189 (9%)
 Frame = -3

Query  779  YQQSQLPSPPSCGHGGIGATSSGMPHTAANVDKQT-GGEEGLPTGWSSGNLVNSRNTGLV  603
            YQQSQL +PP+      GA +SG P   A+ D+QT GGEEG P G SS +    R +G V
Sbjct  267  YQQSQLATPPARALVP-GAGTSGAPPAIASGDRQTGGGEEGRPAGLSSMDSSRRRMSGPV  325

Query  602  LSSG--SKQKGPVHDS------TMskglsssniiqssgssrrpavsSIRDSVTAGVESDP  447
            ++SG  SKQK PV +       TM    +         S R  AVSS RD+   G E++P
Sbjct  326  INSGSFSKQKSPVVNEPTMTKDTMLSSSNFLGRSGGGSSRRAAAVSSSRDAF-VGSETEP  384

Query  446  SRTRAADTTHASPGAIPKMISTAERSSPV-IFDNKCSSSTRN-SNIKNIESTLKGIEGLS  273
             R+R   TT ASPGA+ + IS+  R SP+   D K SSS RN ++IK  E+TLKGIE L 
Sbjct  385  QRSR---TTEASPGAMHR-ISSGPRGSPIGSSDPKRSSSGRNTTHIKTYETTLKGIESLH  440

Query  272  FGNDEKSHY  246
            F  DE+ HY
Sbjct  441  FDTDERVHY  449



>ref|XP_010062655.1| PREDICTED: casein kinase I isoform delta-like isoform X1 [Eucalyptus 
grandis]
Length=474

 Score = 92.4 bits (228),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 69/181 (38%), Positives = 94/181 (52%), Gaps = 4/181 (2%)
 Frame = -3

Query  779  YQQSQLPSPPSCGHGGIGATSSGMPHTAANVDKQTGGEEGLPTGWSSGNLVNSRNTGLVL  600
            YQQSQ+ +PPS   G     SSG+P    N ++Q+GGE+G P  WS G     R++G + 
Sbjct  295  YQQSQIATPPSRALGNGAGPSSGVPPAVNNTERQSGGEDGRPAAWSLGEPSRRRHSGPIA  354

Query  599  SSGS--KQKGPVHDSTMskglsssniiqssgssrrpavsSIRDSVTAGVESDPSRTRAAD  426
            +SGS  K K PV + +++      +      SS      +   S  AGV           
Sbjct  355  TSGSLLKPKNPVTNDSVASKEVLLSSSNFLRSSSSSRKPAASGSRDAGVFKSELDASHRH  414

Query  425  TTHASPGAIPKMISTAERSSPVIFDNKCSSSTRN-SNIKNIESTLKGIEGLSFGNDEKSH  249
            TT  SPG I    S+A+R+SPV    +  +S+RN SNI N ESTL+GIE L F N E+  
Sbjct  415  TTDVSPG-INHKFSSAQRNSPVAPSEQKQASSRNASNINNFESTLRGIESLHFNNKERLQ  473

Query  248  Y  246
            Y
Sbjct  474  Y  474



>ref|XP_006451505.1| hypothetical protein CICLE_v10008160mg [Citrus clementina]
 ref|XP_006475484.1| PREDICTED: casein kinase I isoform delta-like [Citrus sinensis]
 gb|ESR64745.1| hypothetical protein CICLE_v10008160mg [Citrus clementina]
 gb|KDO53217.1| hypothetical protein CISIN_1g011819mg [Citrus sinensis]
Length=477

 Score = 92.4 bits (228),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 86/189 (46%), Positives = 109/189 (58%), Gaps = 17/189 (9%)
 Frame = -3

Query  779  YQQSQLPSPPSCGHGGIGATSSGMPHTAANVDKQT-GGEEGLPTGWSSGNLVNSRNTGLV  603
            YQQSQL +PP+      GA +SG P   A+ D+QT GGEEG P G SS +    R +G V
Sbjct  295  YQQSQLATPPARALVP-GAGTSGAPPAIASGDRQTGGGEEGRPAGLSSMDSSRRRMSGPV  353

Query  602  LSSG--SKQKGPVHDS------TMskglsssniiqssgssrrpavsSIRDSVTAGVESDP  447
            ++SG  SKQK PV +       TM    +         S R  AVSS RD+   G E++P
Sbjct  354  INSGSFSKQKSPVVNEPTMTKDTMLSSSNFLGRSGGGSSRRAAAVSSSRDAF-VGSETEP  412

Query  446  SRTRAADTTHASPGAIPKMISTAERSSPV-IFDNKCSSSTRN-SNIKNIESTLKGIEGLS  273
             R+R   TT ASPGA+ + IS+  R SP+   D K SSS RN ++IK  E+TLKGIE L 
Sbjct  413  QRSR---TTEASPGAMHR-ISSGPRGSPIGSSDPKRSSSGRNTTHIKTYETTLKGIESLH  468

Query  272  FGNDEKSHY  246
            F  DE+ HY
Sbjct  469  FDTDERVHY  477



>ref|XP_004486851.1| PREDICTED: casein kinase I isoform delta-like [Cicer arietinum]
Length=480

 Score = 92.0 bits (227),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 79/192 (41%), Positives = 107/192 (56%), Gaps = 20/192 (10%)
 Frame = -3

Query  779  YQQSQLPSPPSCGHG-GIGAT-----SSGMPHTAANVDKQTGGEEGLPTGWSSGNLVNSR  618
            YQQSQ+ +PP+   G G G +     SSG+P    + D+  GGEEG   GWSS +L   R
Sbjct  295  YQQSQIATPPARAIGNGAGPSTGAGPSSGIPPAVVSADRPIGGEEGRHAGWSSSDLARRR  354

Query  617  NTGLVLSSG--SKQKGPVHDSTMskglsssniiqss----gssrrpavsSIRDSVTAGVE  456
            N+G + + G  S+QK PV    +      S+          + R  AVS+ RD+V  G E
Sbjct  355  NSGPIANDGNLSRQKAPVTSDLIGSKEVMSSSSNFFRPSGSTRRSGAVSNSRDAVV-GSE  413

Query  455  SDPSRTRAADTTHASPGAIPKMISTAERSSPVIFD--NKCSSSTRNSNIKNIESTLKGIE  282
             +PS   A D   ASPGA+ K  S+A+R+SP+     N+ S+    SN+KN ESTL+GIE
Sbjct  414  IEPSLPLARD---ASPGALLKN-SSAQRNSPITSSEHNRTSAGRNTSNVKNFESTLRGIE  469

Query  281  GLSFGNDEKSHY  246
             L+F NDEK  Y
Sbjct  470  SLNF-NDEKVQY  480



>ref|XP_007012784.1| Casein kinase 1 isoform 2 [Theobroma cacao]
 gb|EOY30403.1| Casein kinase 1 isoform 2 [Theobroma cacao]
Length=463

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 78/182 (43%), Positives = 103/182 (57%), Gaps = 17/182 (9%)
 Frame = -3

Query  779  YQQSQLPSPPSCGHGGIGATSSGMPHTAANVDKQTGGEEGLPTGWSSGNLVNSRNTGLVL  600
            YQQSQL +P +   G    TSS MP   AN D+ T GE+    G SS +    R +G ++
Sbjct  295  YQQSQLATPSARAVGPGAGTSSAMPPAIANADRHTVGEDARAAGLSSMDSSRRRTSGPLM  354

Query  599  SSGS--KQKGPV-HDSTMskglsssniiqssgssrrpavsSIRDSVTAGVESDPSRTRAA  429
            +SGS  KQK PV +D  M +   SS+   +  SSR            AG E++P R+R  
Sbjct  355  TSGSYAKQKSPVANDPFMGQSGGSSSRRVAVSSSR---------DAFAGSEAEPQRSR--  403

Query  428  DTTHASPGAIPKMISTAERSSPVIFDNKCSSSTRN-SNIKNIESTLKGIEGLSFGNDEKS  252
             TT ASPGA+ K IS+ +RS     D K + S RN S++KN E+ LKGIEGL F +DE+ 
Sbjct  404  -TTDASPGALHK-ISSQQRSPVESADAKRTLSGRNTSHVKNYEAALKGIEGLQFESDERV  461

Query  251  HY  246
            HY
Sbjct  462  HY  463



>gb|KJB06828.1| hypothetical protein B456_001G013300 [Gossypium raimondii]
Length=328

 Score = 90.1 bits (222),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 75/181 (41%), Positives = 99/181 (55%), Gaps = 15/181 (8%)
 Frame = -3

Query  779  YQQSQLPSPPSCGHGGIGATSSGMPHTAANVDKQTGGEEGLPTGWSSGNLVNSRNTGLVL  600
            YQQSQL +PP+   G    TSS +P   AN D+ T  E+    G SS +    R +G ++
Sbjct  160  YQQSQLTNPPARALGLGAGTSSPLPPAIANADRHTAMEDTRAAGLSSMDSSRRRASGPLM  219

Query  599  SSG--SKQKGPVHDSTMskglsssniiqssgssrrpavsSIRDSVTAGVESDPSRTRAAD  426
            SSG  +KQK PV +         S+  Q   SS        RD+  AG + DP R+R   
Sbjct  220  SSGNYAKQKSPVANDHFIGQSGGSSSRQVGVSSS-------RDAF-AGSDVDPQRSR---  268

Query  425  TTHASPGAIPKMISTAERSSPVIFDNKCSSSTRN-SNIKNIESTLKGIEGLSFGNDEKSH  249
            T +ASPGA+ K  S+ +RS     D K S S RN S++KN E+ LKGIEGL F +DE+ H
Sbjct  269  TAYASPGALQKN-SSRQRSPIDSADPKRSMSARNTSHVKNYEAALKGIEGLQFESDERIH  327

Query  248  Y  246
            Y
Sbjct  328  Y  328



>ref|XP_004510406.1| PREDICTED: casein kinase I isoform delta-like [Cicer arietinum]
Length=474

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 75/187 (40%), Positives = 109/187 (58%), Gaps = 16/187 (9%)
 Frame = -3

Query  779  YQQSQLPSPPSCGHGGIGATSSGMPHTAANVDKQTGGEEGLPTGWSSGNLVNSRNTGLVL  600
            YQQSQ+ +PPS   G     SSG+P  + N D Q+GG++G  TGWSS +    RN+G + 
Sbjct  295  YQQSQIATPPSRTIGLAAGPSSGLPLASPNADGQSGGKDGRHTGWSSSDPTRRRNSGPIA  354

Query  599  SSG--SKQKGPVHDSTMskglsssniiqssgssrrpavsSI---RDSVTAGVESDPSRTR  435
            + G  S++K P+ +       +  + ++   SS      +I   RD+V  G E++PSR  
Sbjct  355  NDGTLSREKAPLTNDLTGSKDAMLSSLKFFRSSGSARRGAILSSRDAV-VGSETEPSRPL  413

Query  434  AADTTHASPGAIPKMISTAERSSPVIFD--NKCSSSTRN--SNIKNIESTLKGIEGLSFG  267
              D+   S GA+ K  S A+RSSP++    N+ SS  RN  SNIKN++STL+GIE L F 
Sbjct  414  TLDS---SQGALRKS-SGAQRSSPIMSSEPNRVSSG-RNTSSNIKNLDSTLRGIESLHF-  467

Query  266  NDEKSHY  246
            NDE++ Y
Sbjct  468  NDERAQY  474



>ref|XP_011013818.1| PREDICTED: casein kinase I isoform delta-like [Populus euphratica]
Length=474

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 82/189 (43%), Positives = 107/189 (57%), Gaps = 20/189 (11%)
 Frame = -3

Query  779  YQQSQLPSPPSCGHG-GIGATSSGMPHTAANVDKQTGGEEGLPTGWSSGNLVNSRNTGLV  603
            YQQSQL +PP+ G G G+G TSSGMP    + D+QTGGEEG   G  S +    R +G +
Sbjct  295  YQQSQLANPPTRGIGTGVG-TSSGMP-PIVSADRQTGGEEGRAIG-QSMDSSRHRLSGPI  351

Query  602  LSSGS--KQKGPV-------HDSTMskglsssniiqssgssrrpavsSIRDSVTAGVESD  450
            L++GS  KQK PV        D+ +           S+  +   + S  RD   A  ESD
Sbjct  352  LNAGSYSKQKSPVANDYPITKDAVLPSSTFLGRSSGSARRAAGVSSS--RDVFAAASESD  409

Query  449  PSRTRAADTTHASPGAIPKMISTAERSSPVIFDNKCSSSTRN-SNIKNIESTLKGIEGLS  273
            P  +R  D   ASPGAI K IS+  RS     D + +SS+RN S++K  E+TLKGIE L+
Sbjct  410  PQWSRITD---ASPGAIHK-ISSGPRSPLGSSDPRRTSSSRNTSHMKTYETTLKGIESLN  465

Query  272  FGNDEKSHY  246
            F +DEK HY
Sbjct  466  FDSDEKVHY  474



>ref|XP_011009742.1| PREDICTED: casein kinase I isoform delta-like isoform X1 [Populus 
euphratica]
Length=464

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 69/174 (40%), Positives = 96/174 (55%), Gaps = 14/174 (8%)
 Frame = -3

Query  779  YQQSQLPSPPSCGHGGIGATSSGMPHTAANVDKQTGGEEGLPTGWSSGNLVNSRNTGLVL  600
            YQQSQ  +PP+   G     SSG+P  A NVD+Q+GGEEG P GWSS +    RN+G ++
Sbjct  295  YQQSQSANPPTRALGPGAGPSSGIPPGANNVDRQSGGEEGRP-GWSSTDHARRRNSGPIV  353

Query  599  SSG--SKQKGPVHDSTMskglsssniiqssgssrrpavsSIRDSVTAGV--ESDPSRTRA  432
            +SG  SKQK PV +       ++ +  +   S+      +I  S  A +  +SDPSR RA
Sbjct  354  NSGNLSKQKSPVINDLSLSKDATLSSSRFLRSNMSLRQPAISSSRGAALVNDSDPSRPRA  413

Query  431  ADTTHASPGAIPKMISTAERSSPVIF--DNKCSSSTRNSNIKNIESTLKGIEGL  276
             D   A       ++   +R SP +   + K S S RN+NIK +EST +GIE L
Sbjct  414  TDANFA-------VLQNGQRISPALLSSEQKPSFSGRNTNIKTLESTRRGIESL  460



>emb|CCM43976.1| Caesin kinase I isoform delta like protein [Cucumis sativus]
Length=479

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 74/188 (39%), Positives = 102/188 (54%), Gaps = 13/188 (7%)
 Frame = -3

Query  779  YQQSQLPSPPSCGHGGIGATSSGMPHTAANVDKQTGGEEGLPTGWSSGNLVNSRNTGLVL  600
            YQQSQL +PP+   G    TSSG+P   AN D+QTGGEE    G S  +    R +GL +
Sbjct  295  YQQSQLATPPTRALGAGAGTSSGIPPGIANPDRQTGGEEAQLAGMSLMDSSRRRASGLTM  354

Query  599  SSG--SKQKGPVHDSTMskglsssniiqssgssrrpavsSIRDSVT----AGVESDPSRT  438
            +SG  +KQK P+ + T +          +       +      S +     G E+DP R+
Sbjct  355  NSGTFAKQKSPIANDTAAVPKDGVFSGPNIVGRSSGSSRRAAVSSSRDPYVGSEADPHRS  414

Query  437  RAADTTHASPGAIPKMISTAERSSPV-IFDNKCSSSTRNS---NIKNIESTLKGIEGLSF  270
              + T  ASPGA+ K +S A+RS PV   D K S+S R++   ++KN +S LKGIEGL  
Sbjct  415  --SRTRDASPGALHKSMS-AQRSPPVGPADPKRSASGRHTGHGHVKNYDSALKGIEGLQL  471

Query  269  GNDEKSHY  246
             NDE+ HY
Sbjct  472  ENDERVHY  479



>ref|XP_004141059.1| PREDICTED: casein kinase I isoform delta-like [Cucumis sativus]
 gb|KGN60529.1| hypothetical protein Csa_2G000380 [Cucumis sativus]
Length=479

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 78/188 (41%), Positives = 104/188 (55%), Gaps = 13/188 (7%)
 Frame = -3

Query  779  YQQSQLPSPPSCGHGGIGATSSGMPHTAANVDKQTGGEEGLPTGWSSGNLVNSRNTGLVL  600
            YQQSQL +PP+   G    TSSG+P   AN D+QTGGEE    G S  +    R +GL +
Sbjct  295  YQQSQLATPPTRALGAGAGTSSGIPPGIANPDRQTGGEEAQLAGMSLMDSSRRRASGLTM  354

Query  599  SSG--SKQKGPVHDSTMskglsssni----iqssgssrrpavsSIRDSVTAGVESDPSRT  438
            +SG  +KQK P+ + T +            +  S  S R A  S       G E+DP R+
Sbjct  355  NSGTFAKQKSPIANDTAAVPKDGVFSGPNIVGRSSGSSRRAAVSSSRDPYVGSEADPHRS  414

Query  437  RAADTTHASPGAIPKMISTAERSSPV-IFDNKCSSSTRNS---NIKNIESTLKGIEGLSF  270
              + T  ASPGA+ K +S A+RS PV   D K S+S R++   ++KN +S LKGIEGL  
Sbjct  415  --SRTRDASPGALHKSMS-AQRSPPVGPADPKRSASGRHTGHGHVKNYDSALKGIEGLQL  471

Query  269  GNDEKSHY  246
             NDE+ HY
Sbjct  472  ENDERVHY  479



>emb|CDP03143.1| unnamed protein product [Coffea canephora]
Length=470

 Score = 90.5 bits (223),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 74/178 (42%), Positives = 105/178 (59%), Gaps = 12/178 (7%)
 Frame = -3

Query  779  YQQSQLPSPPSCGHGGIGATSSGMPHTAANVDKQTGGEEGLPTGWSSGNLVNSRNTGLVL  600
            YQQSQ+ +PPS   G    TSSGMP    N+++Q G E+G   G+SS +    R++G +L
Sbjct  295  YQQSQIAAPPSRAVGPSAGTSSGMPPAIPNIERQQGEEDGRQAGFSSADPSRRRSSGPLL  354

Query  599  SSG--SKQKGPVHDSTMskglsssniiqssgssrrpavsSI---RDSVTAGVESDPSRTR  435
            + G  SKQK P+ + + SK +  S+      SS      +I   R++ TAG +SDP+R+R
Sbjct  355  NVGSLSKQKSPIANDSTSKEVGLSSSAYLGRSSGSLRRGAIAGSRETFTAGNDSDPTRSR  414

Query  434  AADTTHASPGAIPKMISTAERSSPV--IFDNKCSSSTR-NSNIKNIESTLKGIEGLSF  270
               T  ASPG   K IS+ +R+ P+    D + +SS + NS +KN ESTLKGIE L F
Sbjct  415  ---TPEASPGTAQK-ISSGQRTLPLGGSSDPRHTSSGKNNSGVKNFESTLKGIESLRF  468



>ref|XP_009361635.1| PREDICTED: casein kinase I isoform delta-like [Pyrus x bretschneideri]
Length=466

 Score = 90.1 bits (222),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 82/183 (45%), Positives = 103/183 (56%), Gaps = 16/183 (9%)
 Frame = -3

Query  779  YQQSQLPSPPSCGHGGIGATSSGMPHTAANVDKQTGGEEGLPTGWSSGNLVNSRNTGLVL  600
            YQQSQL  PP+    G G TSSGMPH A N D+ TG E+G PTG +S +    R  G  L
Sbjct  295  YQQSQLAVPPTRALAGAG-TSSGMPHAAVNADRLTGEEDGRPTGLTSLDSSRRRIPGPAL  353

Query  599  SSG--SKQKGPV-HDSTMskglsssniiqssgssrrpavsSIRDSVTAGVESDPSRTRAA  429
            +S   S+QK P+ +D+++++  S+SNI   S  S R    S       G ESD  R R  
Sbjct  354  NSMSLSRQKNPIANDASLTRETSNSNIFGRSAGSSRRVAVSSSRDAFGGSESD-IRPR--  410

Query  428  DTTHASPGAIPKMISTAERSSPVIFDNKCSSSTRN--SNIKNIESTLKGIEGLSFGNDEK  255
             TT ASPG     IS+  RSSPV    + S  TR   S  +N E+TLKGIEGL   N+E+
Sbjct  411  -TTDASPGG--HRISSGRRSSPV----ESSDPTRRHTSQTRNYETTLKGIEGLHLDNEER  463

Query  254  SHY  246
             HY
Sbjct  464  VHY  466



>gb|KHG18061.1| hypothetical protein F383_22405 [Gossypium arboreum]
Length=463

 Score = 89.7 bits (221),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 75/181 (41%), Positives = 99/181 (55%), Gaps = 15/181 (8%)
 Frame = -3

Query  779  YQQSQLPSPPSCGHGGIGATSSGMPHTAANVDKQTGGEEGLPTGWSSGNLVNSRNTGLVL  600
            YQQSQL +PP+   G    TSS +P   AN D+ T  E+    G SS +    R +G ++
Sbjct  295  YQQSQLTNPPARALGLGAGTSSPLPPAIANADRHTAAEDTRAAGLSSMDSSRRRASGPLM  354

Query  599  SSG--SKQKGPVHDSTMskglsssniiqssgssrrpavsSIRDSVTAGVESDPSRTRAAD  426
            SSG  +KQK PV +         S+  Q   SS        RD+  AG + DP R+R   
Sbjct  355  SSGNYAKQKSPVANDHFIGQSGGSSSRQVGVSSS-------RDAF-AGSDVDPQRSR---  403

Query  425  TTHASPGAIPKMISTAERSSPVIFDNKCSSSTRN-SNIKNIESTLKGIEGLSFGNDEKSH  249
            T +ASPGA+ K  S+ +RS     D K S S RN S++KN E+ LKGIEGL F +DE+ H
Sbjct  404  TAYASPGALQKN-SSRQRSPIDSADPKRSMSARNTSHVKNYEAALKGIEGLQFESDERIH  462

Query  248  Y  246
            Y
Sbjct  463  Y  463



>ref|XP_010090074.1| Casein kinase I isoform delta-like protein [Morus notabilis]
 gb|EXB38871.1| Casein kinase I isoform delta-like protein [Morus notabilis]
Length=475

 Score = 89.7 bits (221),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 77/188 (41%), Positives = 99/188 (53%), Gaps = 17/188 (9%)
 Frame = -3

Query  779  YQQSQLPSPPSCGHGGIGATSSGMPHTAANVDKQTGGEEGLPTGWSSGNLVNSRNTGLVL  600
            YQQSQL +PP+   G    TSSG+P  AAN D+QTG EEG   G SS +    R +G +L
Sbjct  295  YQQSQLATPPTRALGPGAGTSSGLPIAAANADRQTGEEEGRLAGLSSMD-SRRRISGPIL  353

Query  599  SSG--SKQKGPVHDSTMskglsssniiqssgssr---rpavsSIRDSVTAGVESDPSRTR  435
            +SG  SKQK PV   +     +  +       S    R A  S       G ESDP R+R
Sbjct  354  TSGNFSKQKSPVAQESAFSKEALLSNSNILARSSGSSRRAAVSSSRDALVGSESDPHRSR  413

Query  434  AADTTHASPGAIPKMISTAERSSPV-----IFDNKCSSSTRNSNIKNIESTLKGIEGLSF  270
             A+   ASPGA  + IS+ +RSSPV     I   + SS    S+++  E  LKGIE L  
Sbjct  414  TAE---ASPGAAYR-ISSGQRSSPVGGSSEI--KRTSSGRHTSHVRIFEGALKGIESLQL  467

Query  269  GNDEKSHY  246
             N+EK H+
Sbjct  468  DNEEKVHH  475



>ref|XP_011009776.1| PREDICTED: casein kinase I isoform delta-like isoform X2 [Populus 
euphratica]
Length=470

 Score = 89.4 bits (220),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 70/184 (38%), Positives = 97/184 (53%), Gaps = 14/184 (8%)
 Frame = -3

Query  779  YQQSQLPSPPSCGHGGIGATSSGMPHTAA-NVDKQTGGEEGLPTGWSSGNLVNSRNTGLV  603
            YQQSQ+ +PP+   G     SSG+P   A N D+Q+GGEEG P GW S +    RN+G +
Sbjct  295  YQQSQIANPPTRAQGPGAGPSSGIPPPGANNADRQSGGEEGRP-GWPSIDHARRRNSGPI  353

Query  602  LSSG--SKQKGPVHDSTMskglsssniiqssgssrrpavsSIRDSVTAGV--ESDPSRTR  435
            ++SG  SKQK PV D        + +      S        +  S  A +  +SDPSR R
Sbjct  354  VNSGNLSKQKSPVADDLSLLKDVAVSSANLLRSIASSRNPVVSSSRGAALGNDSDPSRPR  413

Query  434  AADTTHASPGAIPKMISTAERSSPVI-FDNKCSSSTRNSNIKNIESTLKGIEGLSFGNDE  258
              D + A       ++   +RSS  +  + K SSS RN+NIK +ESTLKGIE L    + 
Sbjct  414  TTDASFA-------VLQNGQRSSAALSSEQKHSSSGRNTNIKTLESTLKGIESLHVNIEG  466

Query  257  KSHY  246
            + H+
Sbjct  467  RLHH  470



>ref|XP_009597979.1| PREDICTED: casein kinase I isoform delta-like [Nicotiana tomentosiformis]
Length=471

 Score = 89.4 bits (220),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 75/185 (41%), Positives = 104/185 (56%), Gaps = 16/185 (9%)
 Frame = -3

Query  779  YQQSQLPSPPSCGHGGIGATSSGMPHTAANVDKQTGGEEGLPTGWSSGNLVNSRNTGLVL  600
            YQQSQ+ +PPS   G    TSSGMP    N ++Q+G EEG      S      RN+G ++
Sbjct  295  YQQSQIAAPPSRPLGAGAGTSSGMPPAIPNAERQSGEEEGRQPADPS----RRRNSGPLI  350

Query  599  SSG--SKQKGPVHDSTMskglsssniiqssgssrrpavsSI---RDSVTAGVESDPSRTR  435
            ++G  SKQK P+ + + SK    S+      SS       +   R++ T G +SDP+R+R
Sbjct  351  NAGSLSKQKSPLRNDSTSKDAMLSSSTFLGRSSGSLRRGLVSGSRETFTMGNDSDPTRSR  410

Query  434  AADTTHASPGAIPKMISTAERSSPVI--FDNKCSSSTRN-SNIKNIESTLKGIEGLSFGN  264
               T  ASP  + K IS+ +RSSP +   D K +SS RN S IKN E+TLKGIE L F  
Sbjct  411  ---TPEASPATMHK-ISSGQRSSPFVGSSDAKHASSGRNTSGIKNYETTLKGIESLHFDE  466

Query  263  DEKSH  249
            +++ H
Sbjct  467  EDRGH  471



>ref|XP_008459457.1| PREDICTED: casein kinase I isoform delta-like [Cucumis melo]
Length=477

 Score = 89.4 bits (220),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 77/187 (41%), Positives = 101/187 (54%), Gaps = 13/187 (7%)
 Frame = -3

Query  779  YQQSQLPSPPSCGHGGIGATSSGMPHTAANVDKQTGGEEGLPTGWSSGNLVNSRNTGLVL  600
            YQQSQL +PP+   G    TSSG+P   AN D+QTGGEE    G S  +    R +GL +
Sbjct  295  YQQSQLATPPTRALGAGAGTSSGIPPGIANPDRQTGGEEAQLAGMSLMDSSRRRASGLAM  354

Query  599  -SSGSKQKGPVHDSTMskglsssni----iqssgssrrpavsSIRDSVTAGVESDPSRTR  435
             S+ +KQK P+ +   +            +  S  S R A  S       G E DP R+R
Sbjct  355  NSTFAKQKSPIANDAAAVPKDGVFSGPNIVGRSSGSSRRAAVSSSRDPYVGSELDPHRSR  414

Query  434  AADTTHASPGAIPKMISTAERSSPV-IFDNKCSSSTRNS---NIKNIESTLKGIEGLSFG  267
              D   ASPGA+ K +S A+RS PV   D K S+S R++   ++KN +S LKGIEGL   
Sbjct  415  TRD---ASPGALHKSMS-AQRSPPVGPADPKRSASGRHTGHGHVKNYDSALKGIEGLQLE  470

Query  266  NDEKSHY  246
            NDE+ HY
Sbjct  471  NDERVHY  477



>gb|AFV33949.1| casein kinase I [Gossypium hirsutum]
Length=463

 Score = 89.0 bits (219),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 75/181 (41%), Positives = 98/181 (54%), Gaps = 15/181 (8%)
 Frame = -3

Query  779  YQQSQLPSPPSCGHGGIGATSSGMPHTAANVDKQTGGEEGLPTGWSSGNLVNSRNTGLVL  600
            YQQSQL +PP+   G    TSS +P   AN D+ T  E+    G SS +    R +G ++
Sbjct  295  YQQSQLTNPPARALGLGAGTSSPLPPAIANADRHTAAEDTRAAGLSSMDSSRRRASGPLM  354

Query  599  SSG--SKQKGPVHDSTMskglsssniiqssgssrrpavsSIRDSVTAGVESDPSRTRAAD  426
            SSG  +KQK PV +         S+  Q   SS        RD+  AG + DP R+R   
Sbjct  355  SSGNYAKQKSPVANDHFIGQSGGSSSRQVGVSSS-------RDAF-AGSDVDPQRSR---  403

Query  425  TTHASPGAIPKMISTAERSSPVIFDNKCSSSTRN-SNIKNIESTLKGIEGLSFGNDEKSH  249
            T +ASPGA+ K  S+ +RS     D K S S RN S++KN E+ LKGIEGL F  DE+ H
Sbjct  404  TAYASPGALQKN-SSRQRSPIDSADPKRSISARNTSHVKNYEAALKGIEGLQFEGDERIH  462

Query  248  Y  246
            Y
Sbjct  463  Y  463



>gb|KJB06827.1| hypothetical protein B456_001G013300 [Gossypium raimondii]
Length=463

 Score = 89.0 bits (219),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 75/181 (41%), Positives = 99/181 (55%), Gaps = 15/181 (8%)
 Frame = -3

Query  779  YQQSQLPSPPSCGHGGIGATSSGMPHTAANVDKQTGGEEGLPTGWSSGNLVNSRNTGLVL  600
            YQQSQL +PP+   G    TSS +P   AN D+ T  E+    G SS +    R +G ++
Sbjct  295  YQQSQLTNPPARALGLGAGTSSPLPPAIANADRHTAMEDTRAAGLSSMDSSRRRASGPLM  354

Query  599  SSG--SKQKGPVHDSTMskglsssniiqssgssrrpavsSIRDSVTAGVESDPSRTRAAD  426
            SSG  +KQK PV +         S+  Q   SS        RD+  AG + DP R+R   
Sbjct  355  SSGNYAKQKSPVANDHFIGQSGGSSSRQVGVSSS-------RDAF-AGSDVDPQRSR---  403

Query  425  TTHASPGAIPKMISTAERSSPVIFDNKCSSSTRN-SNIKNIESTLKGIEGLSFGNDEKSH  249
            T +ASPGA+ K  S+ +RS     D K S S RN S++KN E+ LKGIEGL F +DE+ H
Sbjct  404  TAYASPGALQKN-SSRQRSPIDSADPKRSMSARNTSHVKNYEAALKGIEGLQFESDERIH  462

Query  248  Y  246
            Y
Sbjct  463  Y  463



>ref|XP_008354554.1| PREDICTED: casein kinase I isoform delta-like [Malus domestica]
Length=388

 Score = 87.8 bits (216),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 80/183 (44%), Positives = 102/183 (56%), Gaps = 16/183 (9%)
 Frame = -3

Query  779  YQQSQLPSPPSCGHGGIGATSSGMPHTAANVDKQTGGEEGLPTGWSSGNLVNSRNTGLVL  600
            YQQSQL  PP+    G G TSSGMPH A N D+ TG  +G PTG +S +    R  G  L
Sbjct  217  YQQSQLAVPPTRALAGAG-TSSGMPHAAVNADRLTGEVDGRPTGLTSLDSSRRRIPGPAL  275

Query  599  SSG--SKQKGPV-HDSTMskglsssniiqssgssrrpavsSIRDSVTAGVESDPSRTRAA  429
            +S   S+QK P+ +D+++++  S+SN+   S  S R    S       G ESD  R R  
Sbjct  276  NSMSLSRQKNPIANDASLTRETSNSNMFGRSAGSSRRVAVSSSRDAFGGSESD-IRPR--  332

Query  428  DTTHASPGAIPKMISTAERSSPVIFDNKCSSSTRN--SNIKNIESTLKGIEGLSFGNDEK  255
             TT ASPG     IS+  RSSPV    + S  TR   S  +N E+TLKGIEGL   N+E+
Sbjct  333  -TTDASPGG--HRISSGRRSSPV----ESSDPTRRHTSQTRNYETTLKGIEGLHLDNEER  385

Query  254  SHY  246
             HY
Sbjct  386  VHY  388



>gb|KHN11262.1| Casein kinase I isoform delta-like [Glycine soja]
Length=476

 Score = 88.6 bits (218),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 73/185 (39%), Positives = 100/185 (54%), Gaps = 10/185 (5%)
 Frame = -3

Query  779  YQQSQLPSPPSCGHGGIGATSSGMPHTAANVDKQTGGEE--GLPTGWSSGNLVNSRNTGL  606
            YQQS   + P+   G     SSGMP  A+N D Q GGE+  G PT WSS +    RN+G 
Sbjct  295  YQQSSSATAPARAIGPAAGPSSGMPPLASNGDGQLGGEDGNGRPTNWSSSDPTRRRNSGT  354

Query  605  VLSSG--SKQKGPV-HDSTMskglsssniiqssgssrrpavsSIRDSVTAGVESDPSRTR  435
            + + G  S+QKGPV +DST SK    S+      S      +   +    G E++ SR+ 
Sbjct  355  IANDGILSRQKGPVTYDSTGSKDAMLSSSNFFWSSGTAKRGAVSGNRDVVGSETEASRSL  414

Query  434  AADTTHASPGAIPKMISTAERSSPVIFD--NKCSSSTRNSNIKNIESTLKGIEGLSFGND  261
              D++  +   IP     A+RSS ++    N+ SS    SNIKN+E+TL+GIE L F ND
Sbjct  415  ILDSSQGALRKIPA--PGAQRSSAIMSSEHNRTSSGRNTSNIKNLETTLRGIESLHF-ND  471

Query  260  EKSHY  246
            E+ HY
Sbjct  472  ERVHY  476



>ref|XP_011009775.1| PREDICTED: casein kinase I isoform delta-like isoform X1 [Populus 
euphratica]
Length=470

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 70/184 (38%), Positives = 97/184 (53%), Gaps = 14/184 (8%)
 Frame = -3

Query  779  YQQSQLPSPPSCGHGGIGATSSGMPHTAA-NVDKQTGGEEGLPTGWSSGNLVNSRNTGLV  603
            YQQSQ+ +PP+   G     SSG+P   A N D+Q+GGEEG P GW S +    RN+G +
Sbjct  295  YQQSQIANPPTRALGPGAGPSSGIPPPGANNADRQSGGEEGRP-GWPSIDHARRRNSGPI  353

Query  602  LSSG--SKQKGPVHDSTMskglsssniiqssgssrrpavsSIRDSVTAGV--ESDPSRTR  435
            ++SG  SKQK PV D        + +      S        +  S  A +  +SDPSR R
Sbjct  354  VNSGNLSKQKSPVADDLSLLKDVAVSSANLLRSIASSRNPVVSSSRGAALGNDSDPSRPR  413

Query  434  AADTTHASPGAIPKMISTAERSSPVI-FDNKCSSSTRNSNIKNIESTLKGIEGLSFGNDE  258
              D + A       ++   +RSS  +  + K SSS RN+NIK +ESTLKGIE L    + 
Sbjct  414  TTDASFA-------VLQNGQRSSAALSSEQKHSSSGRNTNIKTLESTLKGIESLHVNIEG  466

Query  257  KSHY  246
            + H+
Sbjct  467  RLHH  470



>ref|XP_006585503.1| PREDICTED: casein kinase I isoform delta-like isoform X2 [Glycine 
max]
Length=476

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 73/185 (39%), Positives = 100/185 (54%), Gaps = 10/185 (5%)
 Frame = -3

Query  779  YQQSQLPSPPSCGHGGIGATSSGMPHTAANVDKQTGGEE--GLPTGWSSGNLVNSRNTGL  606
            YQQS   + P+   G     SSGMP  A+N D Q GGE+  G PT WSS +    RN+G 
Sbjct  295  YQQSSSVTAPARAIGPAAGPSSGMPPLASNGDGQLGGEDGNGRPTNWSSSDPTRRRNSGT  354

Query  605  VLSSG--SKQKGPV-HDSTMskglsssniiqssgssrrpavsSIRDSVTAGVESDPSRTR  435
            + + G  S+QKGPV +DST SK    S+      S      +   +    G E++ SR+ 
Sbjct  355  IANDGILSRQKGPVTYDSTGSKDAMLSSSNFFWSSGTAKRGAVSGNRDVVGSETEASRSL  414

Query  434  AADTTHASPGAIPKMISTAERSSPVI--FDNKCSSSTRNSNIKNIESTLKGIEGLSFGND  261
              D++  +   IP     A+RSS ++    N+ SS    SNIKN+E+TL+GIE L F ND
Sbjct  415  ILDSSQGALRKIPA--PGAQRSSAIMSSEHNRTSSGRNTSNIKNLETTLRGIESLHF-ND  471

Query  260  EKSHY  246
            E+ HY
Sbjct  472  ERVHY  476



>gb|KJB06826.1| hypothetical protein B456_001G013300 [Gossypium raimondii]
Length=459

 Score = 87.8 bits (216),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 74/181 (41%), Positives = 98/181 (54%), Gaps = 19/181 (10%)
 Frame = -3

Query  779  YQQSQLPSPPSCGHGGIGATSSGMPHTAANVDKQTGGEEGLPTGWSSGNLVNSRNTGLVL  600
            YQQSQL +PP+   G    TSS +P   AN D+ T  E+    G SS +    R +G ++
Sbjct  295  YQQSQLTNPPARALGLGAGTSSPLPPAIANADRHTAMEDTRAAGLSSMDSSRRRASGPLM  354

Query  599  SSG--SKQKGPVHDSTMskglsssniiqssgssrrpavsSIRDSVTAGVESDPSRTRAAD  426
            SSG  +KQK PV +       S    + SS           RD+  AG + DP R+R   
Sbjct  355  SSGNYAKQKSPVANDHSGGSSSRQVGVSSS-----------RDAF-AGSDVDPQRSR---  399

Query  425  TTHASPGAIPKMISTAERSSPVIFDNKCSSSTRN-SNIKNIESTLKGIEGLSFGNDEKSH  249
            T +ASPGA+ K  S+ +RS     D K S S RN S++KN E+ LKGIEGL F +DE+ H
Sbjct  400  TAYASPGALQKN-SSRQRSPIDSADPKRSMSARNTSHVKNYEAALKGIEGLQFESDERIH  458

Query  248  Y  246
            Y
Sbjct  459  Y  459



>ref|XP_006385411.1| hypothetical protein POPTR_0003s04170g [Populus trichocarpa]
 gb|ERP63208.1| hypothetical protein POPTR_0003s04170g [Populus trichocarpa]
Length=464

 Score = 87.4 bits (215),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 69/174 (40%), Positives = 93/174 (53%), Gaps = 14/174 (8%)
 Frame = -3

Query  779  YQQSQLPSPPSCGHGGIGATSSGMPHTAANVDKQTGGEEGLPTGWSSGNLVNSRNTGLVL  600
            YQQSQ  +PP+   G     SSG+P  A N D+Q+GGEEG P GWSS +    RN+G ++
Sbjct  295  YQQSQSANPPTRALGPGAGPSSGIPPGANNFDRQSGGEEGRP-GWSSTDHARRRNSGPIV  353

Query  599  SSG--SKQKGPVHDSTMskglsssniiqssgssrrpavsSIRDSVTAGV--ESDPSRTRA  432
            +SG  SKQK PV +       ++ +  +   SS       I  S  A +  +SDPS  RA
Sbjct  354  NSGNLSKQKSPVTNDLSLSKDATLSSSRFLRSSMSSRQPVISSSRGAALVNDSDPSHPRA  413

Query  431  ADTTHASPGAIPKMISTAERSSPVIF--DNKCSSSTRNSNIKNIESTLKGIEGL  276
             D   A       M+   +R SP +   + K S S RN+NIK +EST +GIE L
Sbjct  414  TDANFA-------MLQNGQRISPALLSSEQKPSFSGRNTNIKTLESTRRGIESL  460



>ref|XP_004157925.1| PREDICTED: casein kinase I isoform delta-like [Cucumis sativus]
Length=480

 Score = 87.4 bits (215),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 79/189 (42%), Positives = 105/189 (56%), Gaps = 14/189 (7%)
 Frame = -3

Query  779  YQQSQLPSPPSCGHGGIGA-TSSGMPHTAANVDKQTGGEEGLPTGWSSGNLVNSRNTGLV  603
            YQQSQL +PP+      GA TSSG+P   AN D+QTGGEE    G S  +    R +GL 
Sbjct  295  YQQSQLATPPTRALVRAGAGTSSGIPPGIANPDRQTGGEEAQLAGMSLMDSSRRRASGLT  354

Query  602  LSSG--SKQKGPVHDSTMskglsssni----iqssgssrrpavsSIRDSVTAGVESDPSR  441
            ++SG  +KQK P+ + T +            +  S  S R A  S       G E+DP R
Sbjct  355  MNSGTFAKQKSPIANDTAAVPKDGVFSGPNIVGRSSGSSRRAAVSSSRDPYVGSEADPHR  414

Query  440  TRAADTTHASPGAIPKMISTAERSSPV-IFDNKCSSSTRNS---NIKNIESTLKGIEGLS  273
            +  + T  ASPGA+ K +S A+RS PV   D K S+S R++   ++KN +S LKGIEGL 
Sbjct  415  S--SRTRDASPGALHKSMS-AQRSPPVGPADPKRSASGRHTGHGHVKNYDSALKGIEGLQ  471

Query  272  FGNDEKSHY  246
              NDE+ HY
Sbjct  472  LENDERVHY  480



>ref|XP_009764702.1| PREDICTED: casein kinase I isoform delta-like [Nicotiana sylvestris]
Length=471

 Score = 87.0 bits (214),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 75/185 (41%), Positives = 104/185 (56%), Gaps = 16/185 (9%)
 Frame = -3

Query  779  YQQSQLPSPPSCGHGGIGATSSGMPHTAANVDKQTGGEEGLPTGWSSGNLVNSRNTGLVL  600
            YQQSQ+ +PPS   G    TSSGMP    N ++Q+G EEG      S      RN+G  +
Sbjct  295  YQQSQIAAPPSRPLGAGVGTSSGMPPAIPNAERQSGEEEGRQPADPS----RRRNSGPPI  350

Query  599  SSG--SKQKGPVHDSTMskglsssniiqssgssrrpavsSI---RDSVTAGVESDPSRTR  435
            ++G  SKQK P+ + + SK    S+      SS       +   R++ T G +SDP+R+R
Sbjct  351  NAGSLSKQKSPLRNDSSSKDAMLSSSTFLGRSSGSLRRGLVSGSRETFTMGNDSDPTRSR  410

Query  434  AADTTHASPGAIPKMISTAERSSPVI--FDNKCSSSTRN-SNIKNIESTLKGIEGLSFGN  264
               T  ASP  + K IS+ +RSSP++   D K +SS RN S IKN E+TLKGIE L F  
Sbjct  411  ---TPEASPATMNK-ISSGQRSSPLVGSSDAKHASSDRNTSGIKNYETTLKGIESLHFDE  466

Query  263  DEKSH  249
            +++ H
Sbjct  467  EDRGH  471



>ref|XP_011003341.1| PREDICTED: casein kinase I isoform delta-like [Populus euphratica]
Length=475

 Score = 87.0 bits (214),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 77/189 (41%), Positives = 104/189 (55%), Gaps = 19/189 (10%)
 Frame = -3

Query  779  YQQSQLPSPPSCGHG-GIGATSSGMPHTAANVDKQTGGEEGLPTGWSSGNLVNSRNTGLV  603
            YQQSQL +PP+ G G G+G TSSGMP    + D+QTGGEE    G +  +    R +G +
Sbjct  295  YQQSQLANPPTRGLGLGVG-TSSGMPPPIVSADRQTGGEEARAAGQTMES-ARRRLSGQI  352

Query  602  LSSG--SKQK------GPVHDSTMskglsssniiqssgssrrpavsSIRDSVTAGVESDP  447
            +++G  SKQK       P+    M    +       S         S RD V  G ESDP
Sbjct  353  INAGSSSKQKSLVANESPITKDAMLPNSTFLGRSSGSSRRAAAVSCS-RD-VFVGSESDP  410

Query  446  SRTRAADTTHASPGAIPKMISTAERSSPVIFDN--KCSSSTRNSNIKNIESTLKGIEGLS  273
             R+  A+   ASPGAI K IS+ +RS P+   +  + SSS  NS++K  E+TLKG E L+
Sbjct  411  QRSCTAE---ASPGAIHK-ISSGQRSPPIGSSDPRRTSSSRNNSHMKTYETTLKGFESLN  466

Query  272  FGNDEKSHY  246
            F +DEK H+
Sbjct  467  FDSDEKVHH  475



>gb|KHN39324.1| Casein kinase I isoform delta-like [Glycine soja]
Length=474

 Score = 86.7 bits (213),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 70/183 (38%), Positives = 97/183 (53%), Gaps = 8/183 (4%)
 Frame = -3

Query  779  YQQSQLPSPPSCGHGGIGATSSGMPHTAANVDKQTGGEEGLPTGWSSGNLVNSRNTGLVL  600
            YQQS   + P+   G     SSG+P   AN D Q GGE+G P  WSS +    RN+G ++
Sbjct  295  YQQSSSATAPARAIGPAAGPSSGVPPLVANGDGQLGGEDGRPNNWSSSDPTRRRNSGPIV  354

Query  599  SSG--SKQKGPV-HDSTMskglsssniiqssgssrrpavsSIRDSVTAGVESDPSRTRAA  429
            + G  S+QKGPV +DS  SK    S+      S      +   +    G E++ SR+   
Sbjct  355  NDGILSRQKGPVTYDSNGSKDAMLSSSNFFRPSGSARRGAVSGNRDVVGSETEASRSLTL  414

Query  428  DTTHASPGAIPKMISTAERSSPVIFD--NKCSSSTRNSNIKNIESTLKGIEGLSFGNDEK  255
            D++  +   IP     A RSS ++    N+ SS    SNIKN+E+TL+GIE L F NDE+
Sbjct  415  DSSQGAFRKIP--FPGALRSSAIMTSEHNRTSSGRNTSNIKNLETTLRGIESLHF-NDER  471

Query  254  SHY  246
             HY
Sbjct  472  VHY  474



>ref|XP_003529731.1| PREDICTED: casein kinase I isoform delta-like isoform 1 [Glycine 
max]
Length=474

 Score = 86.7 bits (213),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 70/183 (38%), Positives = 97/183 (53%), Gaps = 8/183 (4%)
 Frame = -3

Query  779  YQQSQLPSPPSCGHGGIGATSSGMPHTAANVDKQTGGEEGLPTGWSSGNLVNSRNTGLVL  600
            YQQS   + P+   G     SSG+P   AN D Q GGE+G P  WSS +    RN+G ++
Sbjct  295  YQQSSSATAPARAIGPAAGPSSGVPPLVANGDGQLGGEDGRPNNWSSSDPTRRRNSGPIV  354

Query  599  SSG--SKQKGPV-HDSTMskglsssniiqssgssrrpavsSIRDSVTAGVESDPSRTRAA  429
            + G  S+QKGPV +DS  SK    S+      S      +   +    G E++ SR+   
Sbjct  355  NDGILSRQKGPVTYDSNGSKDAMLSSSNFFRPSGSARRGAVSGNRDVVGSETEASRSLTL  414

Query  428  DTTHASPGAIPKMISTAERSSPVIFD--NKCSSSTRNSNIKNIESTLKGIEGLSFGNDEK  255
            D++  +   IP     A RSS ++    N+ SS    SNIKN+E+TL+GIE L F NDE+
Sbjct  415  DSSQGAFRKIP--FPGALRSSAIMTSEHNRTSSGRNTSNIKNLETTLRGIESLHF-NDER  471

Query  254  SHY  246
             HY
Sbjct  472  VHY  474



>ref|XP_010924972.1| PREDICTED: casein kinase I isoform delta-like isoform X1 [Elaeis 
guineensis]
Length=476

 Score = 86.7 bits (213),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 84/188 (45%), Positives = 106/188 (56%), Gaps = 16/188 (9%)
 Frame = -3

Query  779  YQQSQLPSPPSCGHGGIGATSSGMPHTAANVDKQTGGEEGLPTGWSSGNLVNSR------  618
            YQQSQ+ S P    G     SSG+    AN D+Q+GGEEG  +GWS+ +    R      
Sbjct  295  YQQSQIASAPPRAVGPGAGPSSGLAPAVAN-DRQSGGEEGRTSGWSAMDPSRRRVPAPAP  353

Query  617  NTGLVLSSGSKQKGPVHD---STMskglsssniiqssgssrrpavsSIRDSVTAGVESDP  447
               +   S SKQK P+ +   +T    LSSS  +  S  S R A  S    V AG ESDP
Sbjct  354  APAITAGSLSKQKTPMGNDPAATKDVMLSSSTFLGRSSGSSRRAAVSSSRDVVAG-ESDP  412

Query  446  SRTRAADTTHASPGAIPKMISTAERSSPVI-FDNKCSSSTRNSNIKNIESTLKGIEGLSF  270
            S+TR A+   ASPG   + +S A+RSSPV   ++K SSS R SNIKN ESTLKG E L+F
Sbjct  413  SQTRTAE---ASPGTF-RRLSGAQRSSPVSSAEHKRSSSGRPSNIKNYESTLKGFECLNF  468

Query  269  GNDEKSHY  246
             +DE+  Y
Sbjct  469  NSDERVQY  476



>ref|XP_002309212.1| casein kinase family protein [Populus trichocarpa]
 gb|EEE92735.1| casein kinase family protein [Populus trichocarpa]
Length=475

 Score = 86.7 bits (213),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 80/189 (42%), Positives = 108/189 (57%), Gaps = 19/189 (10%)
 Frame = -3

Query  779  YQQSQLPSPPSCGHG-GIGATSSGMPHTAANVDKQTGGEEGLPTGWSSGNLVNSRNTGLV  603
            YQQSQL +PP+ G G G+G TSSGMP    + D+QTGGEE    G +  +    R +G +
Sbjct  295  YQQSQLANPPTRGLGLGVG-TSSGMPPPIVSADRQTGGEEVRAAGQTMES-SRRRLSGQI  352

Query  602  LSSGS--KQKG------PVHDSTMskglsssniiqssgssrrpavsSIRDSVTAGVESDP  447
            +++GS  KQK       P+    M    +       S        SS RD V  G ESDP
Sbjct  353  INAGSSSKQKSLVANESPITKDAMLPNSTFLGRSSGSSRRAAAVSSS-RD-VFVGSESDP  410

Query  446  SRTRAADTTHASPGAIPKMISTAERSSPV-IFDNKCSSSTRN-SNIKNIESTLKGIEGLS  273
             R+    TT ASPGAI K IS+ +RS P+   D + +SS+RN S++K  E+TLKG E L+
Sbjct  411  QRS---CTTEASPGAIHK-ISSGQRSPPLGSSDPRRTSSSRNTSHMKTYETTLKGFESLN  466

Query  272  FGNDEKSHY  246
            F +DEK+H+
Sbjct  467  FDSDEKAHH  475



>ref|XP_006371997.1| casein kinase family protein [Populus trichocarpa]
 gb|ERP49794.1| casein kinase family protein [Populus trichocarpa]
Length=475

 Score = 86.3 bits (212),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 81/190 (43%), Positives = 107/190 (56%), Gaps = 21/190 (11%)
 Frame = -3

Query  779  YQQSQLPSPPSCGHG-GIGATSSGMPHTAANVDKQTG-GEEGLPTGWSSGNLVNSRNTGL  606
            YQQSQL +PP+ G G G+G TSSGMP    + D+QTG GEEG   G  S +    R +G 
Sbjct  295  YQQSQLANPPTRGIGPGVG-TSSGMP-PIVSADRQTGSGEEGRAVG-QSMDSSRHRLSGP  351

Query  605  VLSSGS--KQKGPV-------HDSTMskglsssniiqssgssrrpavsSIRDSVTAGVES  453
            +L++GS  KQK PV        D+ +           S+  +   + S  RD   A  ES
Sbjct  352  ILNAGSYSKQKSPVANDYPITKDAVLPSSTFLGRSSGSARRAAGVSSS--RDVFAAASES  409

Query  452  DPSRTRAADTTHASPGAIPKMISTAERSSPVIFDNKCSSSTRNS-NIKNIESTLKGIEGL  276
            DP  +R  D   ASPGAI K IS+  RS     D + +SS+RN+ ++K  E+TLKGIE L
Sbjct  410  DPQWSRITD---ASPGAIHK-ISSGPRSPLGSSDPRRTSSSRNTTHMKTYETTLKGIESL  465

Query  275  SFGNDEKSHY  246
            +F +DEK HY
Sbjct  466  NFDSDEKVHY  475



>ref|XP_006585502.1| PREDICTED: casein kinase I isoform delta-like isoform X1 [Glycine 
max]
Length=478

 Score = 86.3 bits (212),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 76/189 (40%), Positives = 101/189 (53%), Gaps = 16/189 (8%)
 Frame = -3

Query  779  YQQSQLPSPPSCGHGGIGATSSGMPHTAANVDKQTGGEE--GLPTGWSSGNLVNSRNTGL  606
            YQQS   + P+   G     SSGMP  A+N D Q GGE+  G PT WSS +    RN+G 
Sbjct  295  YQQSSSVTAPARAIGPAAGPSSGMPPLASNGDGQLGGEDGNGRPTNWSSSDPTRRRNSGT  354

Query  605  VLSSG--SKQKGPV-HDSTMskglsssniiqssgssrrpavsSI----RDSVTAGVESDP  447
            + + G  S+QKGPV +DST SK         +   S   A        RD V  G E++ 
Sbjct  355  IANDGILSRQKGPVTYDSTGSKDAMVRLSSSNFFWSSGTAKRGAVSGNRDVV--GSETEA  412

Query  446  SRTRAADTTHASPGAIPKMISTAERSSPVI--FDNKCSSSTRNSNIKNIESTLKGIEGLS  273
            SR+   D++  +   IP     A+RSS ++    N+ SS    SNIKN+E+TL+GIE L 
Sbjct  413  SRSLILDSSQGALRKIPA--PGAQRSSAIMSSEHNRTSSGRNTSNIKNLETTLRGIESLH  470

Query  272  FGNDEKSHY  246
            F NDE+ HY
Sbjct  471  F-NDERVHY  478



>ref|XP_010033765.1| PREDICTED: casein kinase I isoform delta-like [Eucalyptus grandis]
 gb|KCW53569.1| hypothetical protein EUGRSUZ_J02844 [Eucalyptus grandis]
Length=475

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 89/190 (47%), Positives = 105/190 (55%), Gaps = 21/190 (11%)
 Frame = -3

Query  779  YQQSQL----PSPPSCGHG-GIGATSSGMPHTAANVDKQTGGEEGLPTGWSSGNLVNSRN  615
            YQQSQ+    P P   G G   G TS      A N DKQ GGE+  P GWSS       +
Sbjct  295  YQQSQIATAAPRPLGSGAGPSFGGTSP-----AVNADKQLGGEDNRPVGWSSAEPSRRMH  349

Query  614  TGLVLSSG--SKQKGPV---HDSTMskglsssniiqssgssrrpavsSIRDSVTAGVESD  450
            +G +++SG  SKQK P    H  +     SSSN + SSGSSRR A SS R+ V  G ESD
Sbjct  350  SGPIVTSGILSKQKNPAANEHAISRDAMPSSSNFLWSSGSSRRAAASSSREVVIPGKESD  409

Query  449  PSRTRAADTTHASPGAIPKMISTAERSSPV--IFDNKCSSSTRNSNIKNIESTLKGIEGL  276
             S  R   TT  +PGA+PK     +RSSP+     N+ S S   SN KN+ESTLKGIE L
Sbjct  410  LSTLR---TTDINPGALPKF-PGGQRSSPIGSSEQNRPSGSKSASNTKNLESTLKGIESL  465

Query  275  SFGNDEKSHY  246
             F NDEK  Y
Sbjct  466  HFNNDEKLRY  475



>gb|KHG04851.1| hypothetical protein F383_30273 [Gossypium arboreum]
Length=467

 Score = 84.0 bits (206),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 70/183 (38%), Positives = 97/183 (53%), Gaps = 15/183 (8%)
 Frame = -3

Query  779  YQQSQLPSPPSCGHGGIGATSSGMPHTAANVDKQTGGEEGLPTGWSSGNLVNSRNTGLVL  600
            YQQSQ+ +PP+   G    TSSG+P           GEE  P+GWSS +    R++GL+ 
Sbjct  295  YQQSQIANPPTRALGPGAGTSSGLP---------PAGEETRPSGWSSADPTRRRHSGLIA  345

Query  599  SSGS--KQKGPV-HDSTMskglsssniiqssgssrrpavsSIRDSVTAGVESDPSRTRAA  429
            +SGS  KQK PV +D + +K    S+      S      +       A +    S     
Sbjct  346  NSGSLAKQKSPVANDLSAAKDPMLSSSNFLRSSGSSRRAAVSSSRDAAAIAVSDSERSHF  405

Query  428  DTTHASPGAIPKMISTAERSSPVIF-DNKCSSSTRN-SNIKNIESTLKGIEGLSFGNDEK  255
             TT A+ G   K IS+ +R+SPV+  +NK  SS RN SNI N+ES ++GIE L F N+E+
Sbjct  406  RTTDATAGPFQK-ISSGQRNSPVLSSENKRPSSGRNTSNINNVESAVRGIESLHFRNEER  464

Query  254  SHY  246
             HY
Sbjct  465  LHY  467



>ref|XP_003533767.1| PREDICTED: casein kinase I isoform delta-like [Glycine max]
Length=456

 Score = 83.2 bits (204),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 70/182 (38%), Positives = 90/182 (49%), Gaps = 24/182 (13%)
 Frame = -3

Query  779  YQQSQLPSPPSCGHGGIGATSSGMPHTAANVDKQTGGEEGLPTGWSSGNLVNSRNTGLVL  600
            YQQSQL +PP+   G    TSS +P    N D+QTG EEG P G  SG+    R TG + 
Sbjct  295  YQQSQLAAPPARAIGPNVGTSSALPPAVTNADRQTGEEEGRPPGLVSGDSTRRRMTGPIP  354

Query  599  SSG--SKQKGPVHDSTMskglsssniiqssgssrrpavsSIRDSVTAGVESDPS-RTRAA  429
            +S   SKQK PV         +  +     G S     +++  S  A V SD   RTR  
Sbjct  355  NSVNISKQKNPVTTDAALNKEAMLSRPNVLGQSSGSRRAAVSSSRDAFVGSDLDLRTR--  412

Query  428  DTTHASPGAIPKMISTAERSSPVIFDNKCSSSTRN-SNIKNIESTLKGIEGLSFGNDEKS  252
             TT  +PG  PK                 +SS RN S++K+ E+ +KGIEGL   NDEK+
Sbjct  413  -TTETNPGTAPK-----------------TSSVRNASHVKSYETAVKGIEGLQLENDEKA  454

Query  251  HY  246
            HY
Sbjct  455  HY  456



>gb|KHG23724.1| hypothetical protein F383_04752 [Gossypium arboreum]
Length=465

 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 75/182 (41%), Positives = 98/182 (54%), Gaps = 14/182 (8%)
 Frame = -3

Query  779  YQQSQLPSPPSCGHGGIGATSSGMPHTAANVDKQTGGEEGLPTGWSSGNLVNSRNTGLVL  600
            YQQSQL +PP+   G    TS+ MP   AN D+Q  G+     G SS N  + R T   L
Sbjct  294  YQQSQLTTPPARALGPGAGTSAAMPPAFANADRQAAGDNLRAAGLSSMN-SSRRKTSGPL  352

Query  599  SSGS--KQKGPVHDSTMskglsssniiqssgssrrpavsSIRDSVTAGVESDPSRTRAAD  426
            +SGS  KQKGPV +       +         SSR  A S  R++  AG E+DP R+R  D
Sbjct  353  NSGSHAKQKGPVANDPAITKDAMYMGQSGGSSSRHIAGS--REAF-AGSEADPQRSRTTD  409

Query  425  TTHASPGAIPKMISTAERSSPVI-FDNKCSSSTRN-SNIKNIESTLKGIEGLSFGNDEKS  252
             +H   G + +    + R SPV   D K +SS RN S+ KN E+ LKG+EGL F +DE+ 
Sbjct  410  ASH---GGLHR---NSSRQSPVESSDPKRASSMRNTSHAKNYEAALKGMEGLQFKSDERI  463

Query  251  HY  246
            HY
Sbjct  464  HY  465



>ref|XP_007138711.1| hypothetical protein PHAVU_009G230800g [Phaseolus vulgaris]
 gb|ESW10705.1| hypothetical protein PHAVU_009G230800g [Phaseolus vulgaris]
Length=456

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 68/182 (37%), Positives = 89/182 (49%), Gaps = 24/182 (13%)
 Frame = -3

Query  779  YQQSQLPSPPSCGHGGIGATSSGMPHTAANVDKQTGGEEGLPTGWSSGNLVNSRNTGLVL  600
            YQQSQL +PP+   G    TSS MP    N D+QTG EEG P G  SG+    R +G V 
Sbjct  295  YQQSQLAAPPARALGPTAGTSSAMPPAVTNADRQTGEEEGRPPGLISGDSTRRRMSGTVP  354

Query  599  SSG--SKQKGPVHDSTMskglsssniiqssgssrrpavsSIRDSVTAGVESD-PSRTRAA  429
            +S   S+QK PV         +  +     G S      ++  S  A   SD  SRTR  
Sbjct  355  NSVNISRQKNPVTTDAAFNKEAMLSKPNVLGQSSGSRRGAVSSSRDAFAGSDLDSRTR--  412

Query  428  DTTHASPGAIPKMISTAERSSPVIFDNKCSSSTRN-SNIKNIESTLKGIEGLSFGNDEKS  252
             T+ A+PG + K+                 SS RN S ++N ES +KGIEGL   ND+++
Sbjct  413  -TSEANPGTVRKI-----------------SSGRNASYVRNYESAVKGIEGLQLENDKRA  454

Query  251  HY  246
            HY
Sbjct  455  HY  456



>ref|XP_002456234.1| hypothetical protein SORBIDRAFT_03g032560 [Sorghum bicolor]
 gb|EES01354.1| hypothetical protein SORBIDRAFT_03g032560 [Sorghum bicolor]
Length=470

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 82/188 (44%), Positives = 105/188 (56%), Gaps = 22/188 (12%)
 Frame = -3

Query  779  YQQSQLP-SPPSCGHGGIGATSSGMPHTAANVDKQTGGEEGLPTGWSSGNLVNSRNTGLV  603
            YQQSQ+  +PP  GHG   A  SG+     N D+Q+G EE   +GWSS   ++ R   L 
Sbjct  295  YQQSQIATAPPRVGHG---AGPSGLAPALQN-DRQSGPEEARTSGWSS---MDRRRAPLP  347

Query  602  LSSG---SKQKGPV-HDSTMskglsssniiqssgssrrpavsSI---RDSVTAGVESDPS  444
            ++S    SKQK PV +D+T+S+    S       SS       I   RD V A   S+PS
Sbjct  348  ITSVGTLSKQKAPVGNDATVSRDAVISGPNFLGRSSGSSRRPVISTSRD-VVATDSSEPS  406

Query  443  RTRAADTTHASPGAIPKMISTAERSSPV-IFDNKCSSSTRN-SNIKNIESTLKGIEGLSF  270
            R R   TT ASPGA  +  S  +RSSPV   + K SSS R+ SN+KN +S LKGIEGL+F
Sbjct  407  RAR---TTDASPGAF-RRASGPQRSSPVHSAEQKRSSSGRHPSNVKNYDSALKGIEGLNF  462

Query  269  GNDEKSHY  246
              DE+  Y
Sbjct  463  DGDERVQY  470



>gb|KHN28842.1| Casein kinase I isoform delta-like [Glycine soja]
Length=456

 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 69/182 (38%), Positives = 89/182 (49%), Gaps = 24/182 (13%)
 Frame = -3

Query  779  YQQSQLPSPPSCGHGGIGATSSGMPHTAANVDKQTGGEEGLPTGWSSGNLVNSRNTGLVL  600
            YQQSQL +PP+   G    TSS MP    N D+QTG EEG P G  SG+    R +G + 
Sbjct  295  YQQSQLAAPPARAIGPNVGTSSAMPPAVTNADRQTGEEEGRPPGLVSGDSTRRRMSGPIT  354

Query  599  SSG--SKQKGPVHDSTMskglsssniiqssgssrrpavsSIRDSVTAGVESDPS-RTRAA  429
            +S   SKQK PV         +  +     G S     +++     A V SD   RTR  
Sbjct  355  NSVNISKQKNPVTTDAALNKEAMLSRPNVLGQSSGSRRAAVSSRRDAFVGSDLDLRTR--  412

Query  428  DTTHASPGAIPKMISTAERSSPVIFDNKCSSSTRN-SNIKNIESTLKGIEGLSFGNDEKS  252
             +T A+PG   K                 +SS RN S++KN E+ +KGIEGL   NDEK+
Sbjct  413  -STEANPGTAIK-----------------TSSARNASHVKNYETAIKGIEGLQLENDEKA  454

Query  251  HY  246
            HY
Sbjct  455  HY  456



>gb|KJB83050.1| hypothetical protein B456_013G227100 [Gossypium raimondii]
Length=465

 Score = 80.9 bits (198),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 73/181 (40%), Positives = 93/181 (51%), Gaps = 12/181 (7%)
 Frame = -3

Query  779  YQQSQLPSPPSCGHGGIGATSSGMPHTAANVDKQTGGEEGLPTGWSSGNLVNSRNTGLVL  600
            YQQSQL +PP+   G    TS+ MP   AN D+Q  G+     G SS N  + R T   L
Sbjct  294  YQQSQLTTPPARALGPGAGTSAAMPPAFANADRQAAGDNLRAAGLSSMN-SSRRKTSGPL  352

Query  599  SSGS--KQKGPVHDSTMskglsssniiqssgssrrpavsSIRDSVTAGVESDPSRTRAAD  426
            +SGS  KQKGPV +       +         SSR  A S  R++  AG E+DP R+R  D
Sbjct  353  NSGSHAKQKGPVANDPAITKDTMYMGQSGGSSSRHIAGS--REAF-AGSEADPQRSRTTD  409

Query  425  TTHASPGAIPKMISTAERSSPVIFDNKCSSSTRN-SNIKNIESTLKGIEGLSFGNDEKSH  249
             +H          S  E S P     K +SS RN S+ KN E+ LKG+EGL F +DE+ H
Sbjct  410  ASHGGLHRNSSRQSPVESSEP-----KRASSMRNTSHAKNYEAALKGMEGLQFESDERIH  464

Query  248  Y  246
            Y
Sbjct  465  Y  465



>ref|XP_009800558.1| PREDICTED: casein kinase I isoform delta-like, partial [Nicotiana 
sylvestris]
Length=432

 Score = 80.5 bits (197),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 70/185 (38%), Positives = 104/185 (56%), Gaps = 16/185 (9%)
 Frame = -3

Query  779  YQQSQLPSPPSCGHGGIGATSSGMPHTAANVDKQTGGEEGLPTGWSSGNLVNSRNTGLVL  600
            YQQSQ+ +PPS   G     SSGMP    NV++Q+G  EG  +   S      R++G ++
Sbjct  256  YQQSQIAAPPSRPLGPSAGPSSGMPPVIPNVERQSGEGEGRQSAEPS----RRRSSGPLI  311

Query  599  SSG--SKQKGPVHDSTMskglsssniiqssgssrrpavsSI---RDSVTAGVESDPSRTR  435
            ++G  S+QK P+ + + SK    S+      SS       +   R++ T G +SDP+ +R
Sbjct  312  NAGSLSRQKSPIENDSTSKDAMLSSSTFMGRSSGSLRRGLVSGSRETFTMGNDSDPTHSR  371

Query  434  AADTTHASPGAIPKMISTAERSSPV--IFDNKCSSSTRN-SNIKNIESTLKGIEGLSFGN  264
               T  ASPG + K+ S   RSSP+    D + +SS RN S IKN E+T+KGIE L F +
Sbjct  372  ---TPEASPGTMHKL-SGGHRSSPLGGSSDPRYASSGRNTSGIKNYETTIKGIEALHFDD  427

Query  263  DEKSH  249
            +E++H
Sbjct  428  EERAH  432



>ref|XP_009606359.1| PREDICTED: casein kinase I isoform delta-like [Nicotiana tomentosiformis]
Length=471

 Score = 80.1 bits (196),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 69/185 (37%), Positives = 105/185 (57%), Gaps = 16/185 (9%)
 Frame = -3

Query  779  YQQSQLPSPPSCGHGGIGATSSGMPHTAANVDKQTGGEEGLPTGWSSGNLVNSRNTGLVL  600
            YQQSQ+ +PPS   G     SSGMP    NV++Q+G EEG  +   S      R++G ++
Sbjct  295  YQQSQIAAPPSRPLGPSAGPSSGMPPVIPNVERQSGEEEGRQSAEPS----RRRSSGPLI  350

Query  599  SSG--SKQKGPVHDSTMskglsssniiqssgssrrpavsSI---RDSVTAGVESDPSRTR  435
            ++G  S+QK P+ + + S+    S+      SS       +   R++ T G +SDP+ +R
Sbjct  351  NAGSLSRQKSPIGNDSTSRDAMLSSSTFMGRSSGSLRRGLVSGSRETFTMGNDSDPTHSR  410

Query  434  AADTTHASPGAIPKMISTAERSSPV--IFDNKCSSSTRN-SNIKNIESTLKGIEGLSFGN  264
               T  ASPG + K+ S   RSSP+    D + +SS +N S IKN E+T+KGIE L F +
Sbjct  411  ---TPEASPGTMHKL-SGGHRSSPLGGSSDPRYASSGQNTSGIKNYETTIKGIEALHFDD  466

Query  263  DEKSH  249
            +E++H
Sbjct  467  EERAH  471



>ref|XP_003546462.1| PREDICTED: casein kinase I isoform delta-like isoform X1 [Glycine 
max]
Length=456

 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 69/182 (38%), Positives = 89/182 (49%), Gaps = 24/182 (13%)
 Frame = -3

Query  779  YQQSQLPSPPSCGHGGIGATSSGMPHTAANVDKQTGGEEGLPTGWSSGNLVNSRNTGLVL  600
            YQQSQL +PP+   G    TSS MP    N D+QTG EEG P G  SG+    R +G + 
Sbjct  295  YQQSQLAAPPARAIGPNVGTSSAMPPAVTNADRQTGEEEGRPPGLVSGDSTRRRMSGPIT  354

Query  599  SSG--SKQKGPVHDSTMskglsssniiqssgssrrpavsSIRDSVTAGVESDPS-RTRAA  429
            +S   SKQK PV         +  +     G S     +++     A V SD   RTR  
Sbjct  355  NSVNISKQKNPVTTDAALNKEAMLSRPNVLGQSSGSRRAAVSSRRDAFVGSDLDLRTR--  412

Query  428  DTTHASPGAIPKMISTAERSSPVIFDNKCSSSTRN-SNIKNIESTLKGIEGLSFGNDEKS  252
             +T A+PG   K                 +SS RN S++KN E+ +KGIEGL   NDEK+
Sbjct  413  -STGANPGTAIK-----------------TSSARNASHVKNYETAIKGIEGLQLENDEKA  454

Query  251  HY  246
            HY
Sbjct  455  HY  456



>ref|XP_008806949.1| PREDICTED: casein kinase I isoform delta-like isoform X1 [Phoenix 
dactylifera]
 ref|XP_008806957.1| PREDICTED: casein kinase I isoform delta-like isoform X2 [Phoenix 
dactylifera]
 ref|XP_008806963.1| PREDICTED: casein kinase I isoform delta-like isoform X1 [Phoenix 
dactylifera]
 ref|XP_008806971.1| PREDICTED: casein kinase I isoform delta-like isoform X1 [Phoenix 
dactylifera]
Length=474

 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 81/186 (44%), Positives = 102/186 (55%), Gaps = 14/186 (8%)
 Frame = -3

Query  779  YQQSQLPSPPSCGHGGIGATSSGMPHTAANVDKQTGGEEGLPTGWS----SGNLVNSRNT  612
            YQQSQ+ S P    G     SSG+    AN ++Q+GGEEG  +GWS    S     +   
Sbjct  295  YQQSQIASAPPRAPGPGAGPSSGLAPAVAN-ERQSGGEEGRTSGWSAMDPSRRRAPAPAP  353

Query  611  GLVLSSGSKQKGPVHD---STMskglsssniiqssgssrrpavsSIRDSVTAGVESDPSR  441
             +   S SKQK P+ +   +T    LSSS  +  S  S R A  S      AG ESDPS+
Sbjct  354  AINAGSLSKQKTPIGNDPAATKDVMLSSSAFLGRSSGSSRRAAVSSSRDAVAG-ESDPSQ  412

Query  440  TRAADTTHASPGAIPKMISTAERSSPV-IFDNKCSSSTRNSNIKNIESTLKGIEGLSFGN  264
            TR A+   ASPG   +  S A+RSSPV   ++K S S R SNIKN ESTLKG E L+F +
Sbjct  413  TRTAE---ASPGTF-RRFSGAQRSSPVSSAEHKRSPSGRPSNIKNYESTLKGFECLNFNS  468

Query  263  DEKSHY  246
            DE+  Y
Sbjct  469  DERVQY  474



>ref|XP_003597566.1| Casein kinase I isoform delta-like protein [Medicago truncatula]
 gb|AES67817.1| casein kinase I-like protein [Medicago truncatula]
Length=423

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 74/187 (40%), Positives = 108/187 (58%), Gaps = 15/187 (8%)
 Frame = -3

Query  779  YQQSQLPSPPSCGHGGIGATSSGMPHTAANVDKQTGGEEGLPTGWSSGNLVNSRNTGLVL  600
            YQQSQ+ +P +   G     SSG+P    + ++ +GGE+G   GWSS +    RN+G + 
Sbjct  243  YQQSQIATPSARAIGSGAGPSSGLPPAVVSAERPSGGEDGRHAGWSSSDPARRRNSGPIA  302

Query  599  SSG--SKQKGPV-HDSTMskglsssniiqssgssrrpavsSI---RDSVTAGVESDPSRT  438
            + G  S+QK PV  DS  SK +  S+      S     V ++   RD+V +  E +PS  
Sbjct  303  NDGNLSRQKAPVPSDSNGSKEVMLSSSNFFRPSGSTRRVGAVSNSRDAVVSS-EIEPSLP  361

Query  437  RAADTTHASPGAIPKMISTAERSSPVI-FDNKCSSST-RN-SNIKNIESTLKGIEGLSFG  267
             A D    SPGA+ K  S A+R+SP+   ++K ++S+ RN SN+KN EST++GIE L+F 
Sbjct  362  LARD---GSPGALLK-TSGAQRNSPITSSEHKATTSSGRNTSNMKNFESTIRGIESLNF-  416

Query  266  NDEKSHY  246
            NDEK  Y
Sbjct  417  NDEKVQY  423



>ref|XP_003542336.1| PREDICTED: casein kinase I isoform delta-like isoform 1 [Glycine 
max]
 gb|KHN06627.1| Casein kinase I isoform delta-like [Glycine soja]
Length=454

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 67/181 (37%), Positives = 93/181 (51%), Gaps = 24/181 (13%)
 Frame = -3

Query  779  YQQSQLPSPPSCGHGGIGATSSGMPHTAANVDKQTGGEEGLPTGWSSGNLVNSRNTGLVL  600
            YQQSQL +PP+   G    TSSGMP    N D+ TGGEEG P    S           V 
Sbjct  295  YQQSQLATPPTRAIGPSAGTSSGMPPAVTNADRHTGGEEGRPPALVS-----------VD  343

Query  599  SSGSKQKGPVHDSTMskglsssniiqssgssrrpavsSIRDSVTAGVESDPSRTRAADTT  420
            SS  +  GP+ ++  S      +   S   +   +  +       G ESD  RTR A+  
Sbjct  344  SSRRRMSGPILNTLSSANALGQSSGSSRRVAVSSSRDAF-----VGAESD-IRTRTAE--  395

Query  419  HASPGAIPKMISTAERSSPVIFDN--KCSSSTRN-SNIKNIESTLKGIEGLSFGNDEKSH  249
             ASPGA  + +S  +RSSP+   +  +  SS RN S++KN ++ L+G+EGL   NDE++H
Sbjct  396  -ASPGAAHRALS-GQRSSPIGSSDPKRVVSSGRNASHVKNYDTALRGMEGLQLENDERTH  453

Query  248  Y  246
            Y
Sbjct  454  Y  454



>gb|KHN17681.1| Casein kinase I isoform delta-like [Glycine soja]
Length=373

 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 67/181 (37%), Positives = 95/181 (52%), Gaps = 24/181 (13%)
 Frame = -3

Query  779  YQQSQLPSPPSCGHGGIGATSSGMPHTAANVDKQTGGEEGLPTGWSSGNLVNSRNTGLVL  600
            YQQSQL +PP+   G    TSSGMP    N D+ TGGEEG P    S           V 
Sbjct  214  YQQSQLATPPTRAIGPSAGTSSGMPPAVTNADRHTGGEEGRPPALVS-----------VD  262

Query  599  SSGSKQKGPVHDSTMskglsssniiqssgssrrpavsSIRDSVTAGVESDPSRTRAADTT  420
            SS  +  GP+ ++  S  +   +   S  ++   +  +       G ESD  RTR A+  
Sbjct  263  SSRRRMSGPILNTLSSANVLGQSSGSSRRAAVSSSRDAF-----VGAESD-IRTRTAE--  314

Query  419  HASPGAIPKMISTAERSSPVIFDN--KCSSSTRN-SNIKNIESTLKGIEGLSFGNDEKSH  249
             ASPGA  + +S  +RSSP+   +  +  SS RN S++KN ++ L+G+EGL   NDE++H
Sbjct  315  -ASPGAAHRGLS-GQRSSPIGSSDPKRVVSSGRNASHVKNYDTALRGMEGLQLENDERTH  372

Query  248  Y  246
            Y
Sbjct  373  Y  373



>ref|XP_003597565.1| Casein kinase I isoform delta-like protein [Medicago truncatula]
 gb|AES67816.1| casein kinase I-like protein [Medicago truncatula]
Length=475

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 74/187 (40%), Positives = 108/187 (58%), Gaps = 15/187 (8%)
 Frame = -3

Query  779  YQQSQLPSPPSCGHGGIGATSSGMPHTAANVDKQTGGEEGLPTGWSSGNLVNSRNTGLVL  600
            YQQSQ+ +P +   G     SSG+P    + ++ +GGE+G   GWSS +    RN+G + 
Sbjct  295  YQQSQIATPSARAIGSGAGPSSGLPPAVVSAERPSGGEDGRHAGWSSSDPARRRNSGPIA  354

Query  599  SSG--SKQKGPV-HDSTMskglsssniiqssgssrrpavsSI---RDSVTAGVESDPSRT  438
            + G  S+QK PV  DS  SK +  S+      S     V ++   RD+V +  E +PS  
Sbjct  355  NDGNLSRQKAPVPSDSNGSKEVMLSSSNFFRPSGSTRRVGAVSNSRDAVVSS-EIEPSLP  413

Query  437  RAADTTHASPGAIPKMISTAERSSPVI-FDNKCSSST-RN-SNIKNIESTLKGIEGLSFG  267
             A D    SPGA+ K  S A+R+SP+   ++K ++S+ RN SN+KN EST++GIE L+F 
Sbjct  414  LARD---GSPGALLK-TSGAQRNSPITSSEHKATTSSGRNTSNMKNFESTIRGIESLNF-  468

Query  266  NDEKSHY  246
            NDEK  Y
Sbjct  469  NDEKVQY  475



>gb|AHA84221.1| casein kinase I isoform delta-like protein [Phaseolus vulgaris]
Length=456

 Score = 79.0 bits (193),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 66/182 (36%), Positives = 87/182 (48%), Gaps = 24/182 (13%)
 Frame = -3

Query  779  YQQSQLPSPPSCGHGGIGATSSGMPHTAANVDKQTGGEEGLPTGWSSGNLVNSRNTGLVL  600
            YQQSQL +PP+   G    TSS MP    N D+QTG EEG P G  SG+    R +G V 
Sbjct  295  YQQSQLAAPPARALGPTAGTSSAMPPAVTNADRQTGEEEGRPPGLISGDSTRRRMSGTVP  354

Query  599  SSG--SKQKGPVHDSTMskglsssniiqssgssrrpavsSIRDSVTAGVESDPS-RTRAA  429
            +S   S+QK PV         +  +     G S      ++  S  A   SD   RTR  
Sbjct  355  NSVNISRQKNPVTTDAAFNKEAMLSKPNVLGQSSGSRRGAVFSSRDAFAGSDLDFRTR--  412

Query  428  DTTHASPGAIPKMISTAERSSPVIFDNKCSSSTRN-SNIKNIESTLKGIEGLSFGNDEKS  252
             T+ A+PG + K+                 S  RN S ++N ES +KGIEGL   ND+++
Sbjct  413  -TSEANPGTVRKI-----------------SFGRNASYVRNYESAVKGIEGLQLENDKRA  454

Query  251  HY  246
            HY
Sbjct  455  HY  456



>ref|XP_003549210.1| PREDICTED: casein kinase I isoform delta-like isoform 1 [Glycine 
max]
Length=454

 Score = 78.6 bits (192),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 67/181 (37%), Positives = 95/181 (52%), Gaps = 24/181 (13%)
 Frame = -3

Query  779  YQQSQLPSPPSCGHGGIGATSSGMPHTAANVDKQTGGEEGLPTGWSSGNLVNSRNTGLVL  600
            YQQSQL +PP+   G    TSSGMP    N D+ TGGEEG P    S           V 
Sbjct  295  YQQSQLATPPTRAIGPSAGTSSGMPPAVTNADRHTGGEEGRPPALVS-----------VD  343

Query  599  SSGSKQKGPVHDSTMskglsssniiqssgssrrpavsSIRDSVTAGVESDPSRTRAADTT  420
            SS  +  GP+ ++  S  +   +   S  ++   +  +       G ESD  RTR A+  
Sbjct  344  SSRRRMSGPILNTLSSANVLGQSSGSSRRAAVSSSRDAF-----VGAESD-IRTRTAE--  395

Query  419  HASPGAIPKMISTAERSSPVIFDN--KCSSSTRN-SNIKNIESTLKGIEGLSFGNDEKSH  249
             ASPGA  + +S  +RSSP+   +  +  SS RN S++KN ++ L+G+EGL   NDE++H
Sbjct  396  -ASPGAAHRGLS-GQRSSPIGSSDPKRVVSSGRNASHVKNYDTALRGMEGLQLENDERTH  453

Query  248  Y  246
            Y
Sbjct  454  Y  454



>gb|ACJ85725.1| unknown [Medicago truncatula]
 gb|AFK40133.1| unknown [Medicago truncatula]
Length=474

 Score = 78.6 bits (192),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 65/183 (36%), Positives = 97/183 (53%), Gaps = 7/183 (4%)
 Frame = -3

Query  779  YQQSQLPSPPSCGHGGIGATSSGMPHTAANVDKQT-GGEEGLPTGWSSGNLVNSRNTGLV  603
            YQQSQ+ +PPS G G     SSG+P  +AN D Q+ GG++G   GWSS +    R +G +
Sbjct  294  YQQSQIATPPSRGIGLAAGPSSGLPLASANADGQSGGGKDGRNIGWSSSDPTRRRTSGPI  353

Query  602  LSSG--SKQKGPVHDSTMskglsssniiqssgssrrpavsSIRDSVTAGVESDPSRTRAA  429
             + G  S++K P+ +       +  +      SS      ++  S  A V S+   +   
Sbjct  354  ANDGILSREKAPLTNDLTGSKDAMLSSSNFFRSSGSARRGAMLSSRDAAVGSETEPSSRP  413

Query  428  DTTHASPGAIPKMISTAERSSPVIFD--NKCSSSTRNSNIKNIESTLKGIEGLSFGNDEK  255
             T  +S GA+ K  S A+RSS ++    N+ SS    SNI N++STL+GIE L   NDE+
Sbjct  414  LTLDSSLGAVRKS-SGAQRSSHIMASEHNRVSSGRNTSNINNLDSTLRGIESLHL-NDER  471

Query  254  SHY  246
            + Y
Sbjct  472  AQY  474



>ref|XP_003627159.1| Casein kinase I isoform delta-like protein [Medicago truncatula]
 gb|AET01635.1| casein kinase I-like protein [Medicago truncatula]
Length=474

 Score = 78.6 bits (192),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 65/183 (36%), Positives = 97/183 (53%), Gaps = 7/183 (4%)
 Frame = -3

Query  779  YQQSQLPSPPSCGHGGIGATSSGMPHTAANVDKQT-GGEEGLPTGWSSGNLVNSRNTGLV  603
            YQQSQ+ +PPS G G     SSG+P  +AN D Q+ GG++G   GWSS +    R +G +
Sbjct  294  YQQSQIATPPSRGIGLAAGPSSGLPLASANADGQSGGGKDGRNIGWSSSDPTRRRTSGPI  353

Query  602  LSSG--SKQKGPVHDSTMskglsssniiqssgssrrpavsSIRDSVTAGVESDPSRTRAA  429
             + G  S++K P+ +       +  +      SS      ++  S  A V S+   +   
Sbjct  354  ANDGILSREKAPLTNDLTGSKDAMLSSSNFFRSSGSARRGAMLSSRDAAVGSETEPSSRP  413

Query  428  DTTHASPGAIPKMISTAERSSPVIFD--NKCSSSTRNSNIKNIESTLKGIEGLSFGNDEK  255
             T  +S GA+ K  S A+RSS ++    N+ SS    SNI N++STL+GIE L   NDE+
Sbjct  414  LTLDSSLGAVRKS-SGAQRSSHIMASEHNRVSSGRNTSNINNLDSTLRGIESLHL-NDER  471

Query  254  SHY  246
            + Y
Sbjct  472  AQY  474



>gb|EAY75552.1| hypothetical protein OsI_03457 [Oryza sativa Indica Group]
Length=472

 Score = 78.2 bits (191),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 76/185 (41%), Positives = 102/185 (55%), Gaps = 14/185 (8%)
 Frame = -3

Query  779  YQQSQLPSPP--SCGHGGIGATSSGMPHTAANVDKQTGGEEGLPTGWSSGNLVNSRNTGL  606
            YQQSQ+ S P  + GHG   A  SG+   A   D+Q+G +EG  +GWSS +   +     
Sbjct  295  YQQSQIASAPPRAVGHG---AGPSGLAPPALQNDRQSGVDEGRTSGWSSMDRRRAPPPIA  351

Query  605  VLSSGSKQKGPV-HDSTMskglsssniiqssgssrrpavsSIRDS--VTAGVESDPSRTR  435
             + + +KQK PV +D++ SK    S       SS      ++  S  V     S+PSRTR
Sbjct  352  SVGTLAKQKAPVGNDASFSKEPVISASNFLGRSSGSSRRPAVSSSRDVMPTDTSEPSRTR  411

Query  434  AADTTHASPGAIPKMISTAERSSPV-IFDNKCSSSTRNS-NIKNIESTLKGIEGLSFGND  261
            A D   ASPGA  +  S  ++SSPV   + K SSS R+S N+KN ES LKGIEGL+F  D
Sbjct  412  ATD---ASPGAF-RRTSGPQKSSPVNSAEPKHSSSARHSSNVKNYESALKGIEGLNFDGD  467

Query  260  EKSHY  246
            E+  Y
Sbjct  468  ERVQY  472



>pdb|3SV0|A Chain A, Crystal Structure Of Casein Kinase-1 Like Protein In 
Plant
Length=483

 Score = 78.2 bits (191),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 76/186 (41%), Positives = 103/186 (55%), Gaps = 16/186 (9%)
 Frame = -3

Query  779  YQQSQLPSPP--SCGHGGIGATSSGMPHTAANVDKQTGGEEGLPTGWSSGNLVNSRNTGL  606
            YQQSQ+ S P  + GHG   A  SG+   A   D+Q+G +EG  +GWSS +   +     
Sbjct  295  YQQSQIASAPPRAVGHG---AGPSGLAPPALQNDRQSGVDEGRTSGWSSMDRRRAPPPIA  351

Query  605  VLSSGSKQKGPV-HDSTMskglsssniiqssgssrrpavsSI---RDSVTAGVESDPSRT  438
             + + +KQK PV +D++ SK    S       SS      ++   RD +     S+PSRT
Sbjct  352  SVGTLAKQKAPVGNDASFSKEPVISASNFLGRSSGSSRRPAVSSSRDVMPIDT-SEPSRT  410

Query  437  RAADTTHASPGAIPKMISTAERSSPV-IFDNKCSSSTRN-SNIKNIESTLKGIEGLSFGN  264
            RA D   ASPGA  +  S  ++SSPV   + K SSS R+ SN+KN ES LKGIEGL+F  
Sbjct  411  RATD---ASPGAF-RRTSGPQKSSPVNSAEPKHSSSARHSSNVKNYESALKGIEGLNFDG  466

Query  263  DEKSHY  246
            DE+  Y
Sbjct  467  DERVQY  472



>ref|XP_008675117.1| PREDICTED: casein kinase I isoform delta-like [Zea mays]
Length=267

 Score = 76.3 bits (186),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 78/188 (41%), Positives = 101/188 (54%), Gaps = 22/188 (12%)
 Frame = -3

Query  779  YQQSQLP-SPPSCGHGGIGATSSGMPHTAANVDKQTGGEEGLPTGWSSGNLVNSRNTGLV  603
            YQQ+Q+  +PP  GHG   A  SG+     N D+Q G EE   +GWSS   ++ R   L 
Sbjct  92   YQQAQIATAPPRAGHG---AGPSGLAPALQN-DRQPGPEEARTSGWSS---MDRRRAPLP  144

Query  602  LSSG---SKQKGPV-HDSTMskglsssniiqssgssrrpavsSI---RDSVTAGVESDPS  444
            ++S    SKQK PV +D+T+S+    S       SS       I   RD+V     S+PS
Sbjct  145  ITSVGTLSKQKAPVGNDATVSRDAVISGPNFLGRSSGSSRRPVISSSRDAVVTD-SSEPS  203

Query  443  RTRAADTTHASPGAIPKMISTAERSSPV-IFDNKCSSSTRN-SNIKNIESTLKGIEGLSF  270
            R R   TT ASPG   +  S  +RSSPV   + K SSS R+ SN KN +S LKGIEGL+ 
Sbjct  204  RAR---TTDASPGVF-RRASGPQRSSPVHSAEQKRSSSGRHPSNAKNYDSALKGIEGLTL  259

Query  269  GNDEKSHY  246
              DE+  Y
Sbjct  260  DGDERVQY  267



>ref|XP_006644591.1| PREDICTED: casein kinase I isoform delta-like isoform X1 [Oryza 
brachyantha]
Length=472

 Score = 78.2 bits (191),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 76/185 (41%), Positives = 101/185 (55%), Gaps = 14/185 (8%)
 Frame = -3

Query  779  YQQSQLPSPP--SCGHGGIGATSSGMPHTAANVDKQTGGEEGLPTGWSSGNLVNSRNTGL  606
            YQQSQ+ S P  + GHG   A  SG+   A   D+Q+G +EG  +GWSS +   +     
Sbjct  295  YQQSQIASAPPRAVGHG---AGPSGLAPPALQNDRQSGVDEGRTSGWSSMDRRRAPPPIT  351

Query  605  VLSSGSKQKGPV-HDSTMskglsssniiqssgssrrpavsSIRDS--VTAGVESDPSRTR  435
             + + SKQK PV +D++ SK    S        S      ++  S  V     S+PSRTR
Sbjct  352  SVGTLSKQKAPVGNDASFSKEPVISAANFLGRPSGSSRRPAVSSSRDVMPTDSSEPSRTR  411

Query  434  AADTTHASPGAIPKMISTAERSSPV-IFDNKCSSSTRNS-NIKNIESTLKGIEGLSFGND  261
            A D   ASPGA  +  S  ++SSPV   + K SSS R+S N+KN ES LKGIEGL+F  D
Sbjct  412  ATD---ASPGAF-RRTSGPQKSSPVNSAEPKHSSSGRHSSNVKNYESALKGIEGLNFDGD  467

Query  260  EKSHY  246
            E+  Y
Sbjct  468  ERVQY  472



>dbj|BAB92346.1| casein kinase I-like [Oryza sativa Japonica Group]
Length=472

 Score = 78.2 bits (191),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 76/186 (41%), Positives = 103/186 (55%), Gaps = 16/186 (9%)
 Frame = -3

Query  779  YQQSQLPSPP--SCGHGGIGATSSGMPHTAANVDKQTGGEEGLPTGWSSGNLVNSRNTGL  606
            YQQSQ+ S P  + GHG   A  SG+   A   D+Q+G +EG  +GWSS +   +     
Sbjct  295  YQQSQIASAPPRAVGHG---AGPSGLAPPALQNDRQSGVDEGRTSGWSSMDRRRAPPPIA  351

Query  605  VLSSGSKQKGPV-HDSTMskglsssniiqssgssrrpavsSI---RDSVTAGVESDPSRT  438
             + + +KQK PV +D++ SK    S       SS      ++   RD +     S+PSRT
Sbjct  352  SVGTLAKQKAPVGNDASFSKEPVISASNFLGRSSGSSRRPAVSSSRDVMPIDT-SEPSRT  410

Query  437  RAADTTHASPGAIPKMISTAERSSPV-IFDNKCSSSTRN-SNIKNIESTLKGIEGLSFGN  264
            RA D   ASPGA  +  S  ++SSPV   + K SSS R+ SN+KN ES LKGIEGL+F  
Sbjct  411  RATD---ASPGAF-RRTSGPQKSSPVNSAEPKHSSSARHSSNVKNYESALKGIEGLNFDG  466

Query  263  DEKSHY  246
            DE+  Y
Sbjct  467  DERVQY  472



>ref|XP_007154635.1| hypothetical protein PHAVU_003G135100g [Phaseolus vulgaris]
 gb|ESW26629.1| hypothetical protein PHAVU_003G135100g [Phaseolus vulgaris]
Length=455

 Score = 77.4 bits (189),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 70/192 (36%), Positives = 96/192 (50%), Gaps = 45/192 (23%)
 Frame = -3

Query  779  YQQSQLPSPPSCGHGGIGATSSGMPHTAANVDKQTGGEEGLPTGW---------SSGNLV  627
            YQQSQL +PP+   G    TSSGMP    N D+ TGGEEG P             SG ++
Sbjct  295  YQQSQLATPPTRAIGPGAGTSSGMPPAVTNADRHTGGEEGRPPALVSVDSSRRRMSGPIL  354

Query  626  NSRNTGLVL--SSGSKQKGPVHDSTMskglsssniiqssgssrrpavsSIRDSVTAGVES  453
            N+ ++  VL  SSGS ++  V  S                          RD+   G ES
Sbjct  355  NTLSSANVLGQSSGSSRRVAVSGS--------------------------RDAFV-GTES  387

Query  452  DPSRTRAADTTHASPGAIPKMISTAERSSPVIFDN--KCSSSTRN-SNIKNIESTLKGIE  282
            +  RTR A+   ASPG +     +A+RSSP+   +  +  SS RN S+ KN +S L+G+E
Sbjct  388  E-IRTRTAE---ASPGGVAHRGLSAQRSSPIGSSDPKRVVSSGRNASHGKNYDSVLRGME  443

Query  281  GLSFGNDEKSHY  246
            GL   N+E++HY
Sbjct  444  GLQLENEERTHY  455



>ref|XP_010925469.1| PREDICTED: casein kinase I isoform delta-like isoform X2 [Elaeis 
guineensis]
Length=470

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 71/183 (39%), Positives = 93/183 (51%), Gaps = 17/183 (9%)
 Frame = -3

Query  779  YQQSQLPSPPSCGHGGIGATSSGMPHTAANVDKQTGGEEGLPTGWSSGNLVNSR--NTGL  606
            YQQSQ+ S P    G     SSG+    AN D+Q+GGEEG  +GWS+ +    R     +
Sbjct  295  YQQSQIASAPPRALGPGAGPSSGLAPAIANADRQSGGEEGRTSGWSAMDPSRRRIPAPAI  354

Query  605  VLSSGSKQKGP------VHDSTMskglsssniiqssgssrrpavsSIRDSVTAGVESDPS  444
              SS SKQK        V   TM    +       S      + ++  D++  G E++  
Sbjct  355  NASSLSKQKNSEGNDPGVTKETMLSSSTFLGWSNGSSRRAAVSSNA--DAII-GSEAEML  411

Query  443  RTRAADTTHASPGAIPKMISTAERSSPVI--FDNKCSSSTRNSNIKNIESTLKGIEGLSF  270
            R R   T  ASPG   K +S+A+RSSPV      + SS   +SNIKN ESTLKGIE L+F
Sbjct  412  RPR---TREASPGTFHK-VSSAQRSSPVTSAEQRRTSSGRYSSNIKNYESTLKGIERLNF  467

Query  269  GND  261
             ND
Sbjct  468  NND  470



>ref|XP_007135523.1| hypothetical protein PHAVU_010G136500g [Phaseolus vulgaris]
 gb|ESW07517.1| hypothetical protein PHAVU_010G136500g [Phaseolus vulgaris]
Length=479

 Score = 76.6 bits (187),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 74/190 (39%), Positives = 99/190 (52%), Gaps = 17/190 (9%)
 Frame = -3

Query  779  YQQSQLPSPPSCGHGGIGA-TSSGMPHTAANVDKQTGGEEGLPTGWSSGNLVNSRNTGLV  603
            YQQSQ  + P+   G   A  SSG+P  AAN D Q GGE+G    WSS +    RN    
Sbjct  295  YQQSQSATAPARAIGPPAAGPSSGVPPLAANADGQLGGEDGRHNNWSSSDPTRRRNPVPF  354

Query  602  LSSG--SKQKGPV-HDSTMskglsssniiqssgssrrpa-----vsSIRDSVTAGVESDP  447
             + G  S+QK PV  DST+SK ++ S+                     RD V  G ES+ 
Sbjct  355  ANDGVLSRQKSPVTFDSTLSKDVTLSSSNFFRPIGSARRGGVSGSRESRD-VVVGSESEV  413

Query  446  SRTRAADTTHASPGAIPKM-ISTAERSSPVI--FDNKCSSSTRNSNIKNIESTLKGIEGL  276
            SR    D+   S GA+ KM +  A+RSS +     N+ S+    SN+KN+E+TL+GIE L
Sbjct  414  SRPLTLDS---SQGALRKMSVPGAQRSSAITSSEQNRTSTGRNTSNVKNLETTLRGIESL  470

Query  275  SFGNDEKSHY  246
             F N+E+ HY
Sbjct  471  HF-NEERVHY  479



>gb|EAZ13276.1| hypothetical protein OsJ_03201 [Oryza sativa Japonica Group]
Length=472

 Score = 75.9 bits (185),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 78/188 (41%), Positives = 103/188 (55%), Gaps = 20/188 (11%)
 Frame = -3

Query  779  YQQSQLPSPP--SCGHGGIGATSSGMPHTAANVDKQTGGEEGLPTGWSSGNLVNSRNTGL  606
            YQQSQ+ S P  + GHG   A  SG+   A   D+Q+G +EG  +GWSS +    R    
Sbjct  295  YQQSQIASAPPRAVGHG---AGPSGLAPPALQNDRQSGVDEGRTSGWSSMD--RRRAPPP  349

Query  605  VLSSG--SKQKGPV-HDSTMskglsssniiqssgssrrpavsSI---RDSVTAGVESDPS  444
            + S G  + QK PV +D++ SK    S       SS      ++   RD +     S+PS
Sbjct  350  IASVGPWANQKAPVGNDASFSKEPVISASNFLGRSSGSSRRPAVSSSRDVMPIDT-SEPS  408

Query  443  RTRAADTTHASPGAIPKMISTAERSSPV-IFDNKCSSSTRN-SNIKNIESTLKGIEGLSF  270
            RTRA D   ASPGA  +  S  ++SSPV   + K SSS R+ SN+KN ES LKGIEGL+F
Sbjct  409  RTRATD---ASPGAF-RRTSGPQKSSPVNSAEPKHSSSARHSSNVKNYESALKGIEGLNF  464

Query  269  GNDEKSHY  246
              DE+  Y
Sbjct  465  DGDERVQY  472



>ref|XP_008793206.1| PREDICTED: casein kinase I isoform delta-like isoform X1 [Phoenix 
dactylifera]
 ref|XP_008793207.1| PREDICTED: casein kinase I isoform delta-like isoform X1 [Phoenix 
dactylifera]
 ref|XP_008793208.1| PREDICTED: casein kinase I isoform delta-like isoform X1 [Phoenix 
dactylifera]
Length=475

 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 72/187 (39%), Positives = 97/187 (52%), Gaps = 20/187 (11%)
 Frame = -3

Query  779  YQQSQLPSPPSCGHGGIGATSSGMPHTAANVDKQTGGEEGLPTGWSSGNLVNSRNTGLVL  600
            YQQSQ+ S P    G     SSG+     + D+Q+GGEEG P+GWS+ +    R +   +
Sbjct  295  YQQSQIASAPPRALGPGAGPSSGLAPAIVHADRQSGGEEGRPSGWSAMDPSRRRISAPAI  354

Query  599  --SSGSKQKGP------VHDSTMskglsssniiqssgssrrpavsSIRDSVTAG--VESD  450
              SS S+QK        V   TM   L+       S      + ++  D++  G  VE  
Sbjct  355  NASSLSRQKNSEGNDPGVTKETMLSSLTILGRSNGSSRRAAVSSTA--DAMIMGSVVELS  412

Query  449  PSRTRAADTTHASPGAIPKMISTAERSSPVI-FDNKCSSSTRN-SNIKNIESTLKGIEGL  276
              RTR      ASPG   K +S+A+RSSPV   + + +SS R  S IKN ESTLKGIE L
Sbjct  413  CPRTR-----EASPGTFHK-VSSAQRSSPVASAEQRHTSSGRYLSKIKNYESTLKGIERL  466

Query  275  SFGNDEK  255
            +F NDE+
Sbjct  467  NFNNDER  473



>ref|XP_006357711.1| PREDICTED: casein kinase I isoform delta-like [Solanum tuberosum]
Length=472

 Score = 75.5 bits (184),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 72/186 (39%), Positives = 101/186 (54%), Gaps = 17/186 (9%)
 Frame = -3

Query  779  YQQSQLPSPPSCGHGGIGATSSGMPHTAANVDKQTGGEEGLPTGWSSGNLVNSRNTG-LV  603
            YQQSQ+ +PPS   G    TSSGMP     V++Q G EEG      SG+    R+ G  +
Sbjct  295  YQQSQIAAPPSRPLGAGAGTSSGMPPVIPKVERQAGEEEGR----QSGDPSRRRSPGPPL  350

Query  602  LSSG--SKQKGPVHDSTMskglsssniiqssgssrrpavsSI---RDSVTAGVESDPSRT  438
            +SSG  SKQK P+ + + SK    S+       S       +   R++ T G +SDP+ +
Sbjct  351  ISSGSLSKQKSPIGNDSTSKEAMLSSSTFLGRPSGSLRQGLVSGSRETFTMGNDSDPTHS  410

Query  437  RAADTTHASPGAIPKMISTAERSSPV--IFDNKCSSSTRN-SNIKNIESTLKGIEGLSFG  267
            R  +   ASP  + K IS   RSS +    D + +SS++N S IKN ES LKGIE L F 
Sbjct  411  RMPE---ASPATMHK-ISGGHRSSLLGGSSDPRYASSSKNTSGIKNYESALKGIETLHFD  466

Query  266  NDEKSH  249
            ++E++H
Sbjct  467  DEERAH  472



>ref|XP_008813454.1| PREDICTED: casein kinase I isoform delta-like [Phoenix dactylifera]
Length=479

 Score = 75.5 bits (184),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 78/190 (41%), Positives = 104/190 (55%), Gaps = 17/190 (9%)
 Frame = -3

Query  779  YQQSQLPSPPSCGHGGIGATSSGMPHTAANVDKQTGGEEGLPTGWSSGNLVNSRNTGLV-  603
            YQQSQ+ S P    G     SSG+    AN D+Q+GGEEG  +GWS+ +    R +    
Sbjct  295  YQQSQISSAPPRAPGLGAGPSSGLAPAVAN-DRQSGGEEGRTSGWSAMDPSRRRVSAPAP  353

Query  602  -------LSSGSKQKGPVH-DSTMskglsssniiqssgssrrpavsSIRDSV-TAGVESD  450
                   + S SKQK P+  D T +K +  S+      SS     +++  S   A  E D
Sbjct  354  APAPAANVGSLSKQKTPMRKDPTATKDVMLSSSTFLGRSSGSSRRAAVSSSRDVAASEFD  413

Query  449  PSRTRAADTTHASPGAIPKMISTAERSSPVI-FDNKCSSSTRN-SNIKNIESTLKGIEGL  276
            PSRTR   TT AS G   K+ S A+RS PV   ++K +SS R+ SNIKN ESTL+GIE L
Sbjct  414  PSRTR---TTEASAGTFLKL-SGAQRSPPVSSAEHKRTSSGRHPSNIKNYESTLEGIECL  469

Query  275  SFGNDEKSHY  246
            +F +DE+  Y
Sbjct  470  NFDSDERVQY  479



>gb|KFK41692.1| hypothetical protein AALP_AA2G160600 [Arabis alpina]
Length=461

 Score = 75.1 bits (183),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 64/178 (36%), Positives = 96/178 (54%), Gaps = 18/178 (10%)
 Frame = -3

Query  779  YQQSQLPSPPSCGHG-GIGATSSGMPHTAANVDKQTGGEEGLPTGWSSGNLVNSRNTGLV  603
            YQQSQ+ +PP   H  G+G  SSG+P   A+ ++  GG+E  P+GWSSGN    R++G +
Sbjct  294  YQQSQISTPPPRHHVPGVGP-SSGLPPAIASAERPLGGDEARPSGWSSGN--PRRSSGQI  350

Query  602  LSSGS--KQKGPVHDSTMskglsssniiqssgssrrpavsSI---RDSVTAGVESDPSRT  438
             SSGS  KQK PV            +      ++     + +   R++   G++S+PS  
Sbjct  351  FSSGSLAKQKAPVSSDPAISKDVVLSSSSFVRATGSSRRAPVSSSREAGVLGIDSEPSNP  410

Query  437  RAADTTHASPGAIPKMISTAERSSPVI--FDNKCSSSTRNSNIKNIESTLKGIEGLSF  270
            +  +T     G+ PK+     RSSP++   +NK SS +R +  KN E+ LKGIE L F
Sbjct  411  QIIET---GSGSNPKI--QGVRSSPIVPSENNKLSSPSRVT--KNYEANLKGIESLHF  461



>ref|XP_006853888.1| hypothetical protein AMTR_s00036p00147120 [Amborella trichopoda]
 gb|ERN15355.1| hypothetical protein AMTR_s00036p00147120 [Amborella trichopoda]
Length=476

 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 71/182 (39%), Positives = 96/182 (53%), Gaps = 13/182 (7%)
 Frame = -3

Query  779  YQQSQLPSPPSCGHGGIGATSSGMPHTAANVDKQTGGEEGLPTGWSSGNLVNSRNTGLVL  600
            YQQSQ+ S P    G     SSG     AN ++  GGEEG P+GWS+ +    R +G  +
Sbjct  295  YQQSQIASVPQRAPGPGAGPSSGAVPAGANAERTLGGEEGRPSGWSTIDPSRRRVSGPAI  354

Query  599  SSG--SKQKGPVHDSTMskglsssniiqssgs---srrpavsSIRDSVTAGVESDP-SRT  438
            ++G  SKQK PV + + +    +            S R    S       G E+DP SR 
Sbjct  355  NAGSLSKQKSPVANESSTWTKDAMLSGAPFLRPSGSSRRVAVSSSREAMVGSEADPSSRP  414

Query  437  RAADTTHASPGAIPKMISTAERSSPV-IFDNKCSSSTRNSNIKNIESTLKGIEGLSFGND  261
            R   TT ASPG + K++S  +RSSPV   + K +SS R  N+KN ES LKGIE L+F  +
Sbjct  415  R---TTDASPGGLRKVVS-GQRSSPVGSSEPKRTSSGR--NMKNYESALKGIECLNFDAE  468

Query  260  EK  255
            E+
Sbjct  469  ER  470



>ref|XP_006338113.1| PREDICTED: casein kinase I isoform delta-like [Solanum tuberosum]
Length=468

 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 63/182 (35%), Positives = 98/182 (54%), Gaps = 13/182 (7%)
 Frame = -3

Query  779  YQQSQLPSPPSCGHGGIGATSSGMPHTAANVDKQTGGEEGLPTGWSSGNLVNSRNTGLVL  600
            YQQSQ+ +PPS   G    TSSGMP    + ++ +G EEG     +S      R +G ++
Sbjct  295  YQQSQIAAPPSRLLGTGAGTSSGMPPVIPSAERPSGEEEGRQPADAS----RRRYSGPLV  350

Query  599  SSGS--KQKGPVHDSTMskglsssniiqssgssrrpavsSI---RDSVTAGVESDPSRTR  435
            ++GS  KQK P+ + + SK  +  +      SS       +    ++ T G +SDP+R+R
Sbjct  351  NAGSLSKQKSPLRNDSTSKDATLPSSTFLGRSSGSLRRGLVSGSHETFTVGNDSDPTRSR  410

Query  434  AADTTHASPGAIPKMISTAERSSPVIFDNKCSSSTRNSNIKNIESTLKGIEGLSFGNDEK  255
            A +   ASP  + K IS+ +R SP++  +    ++    +KN ESTLKGIE L F  ++K
Sbjct  411  APE---ASPATMHK-ISSGQRISPLVGSSDPKHASSGPGVKNYESTLKGIESLHFDEEDK  466

Query  254  SH  249
             H
Sbjct  467  GH  468



>ref|NP_177415.1| casein kinase 1-like protein 2 [Arabidopsis thaliana]
 gb|AAG51841.1|AC010926_4 putative casein kinase I; 37964-34339 [Arabidopsis thaliana]
 gb|AAL24332.1| putative casein kinase I [Arabidopsis thaliana]
 gb|AAQ55279.1| At1g72710 [Arabidopsis thaliana]
 gb|AAY24533.1| casein kinase 1-like protein 2 [Arabidopsis thaliana]
 gb|AEE35363.1| casein kinase 1-like protein 2 [Arabidopsis thaliana]
Length=465

 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 72/179 (40%), Positives = 104/179 (58%), Gaps = 16/179 (9%)
 Frame = -3

Query  779  YQQSQLPSPPSCGHGGIGATSSGMPHTAANVDKQTGGEEGLPTGWSSGNLVNSRNTGLVL  600
            YQQSQ+ +PP   HG +   SS +P    + ++ +GG+E  P+GWSSG  +  RN+G + 
Sbjct  294  YQQSQISTPPPRHHGPVVGPSSALPPAITSAERPSGGDEARPSGWSSG--IPRRNSGQIF  351

Query  599  SSGS--KQKGPVHDS---TMskglsssniiqssgssrrpavsSIRDSVTAGVESDPSRTR  435
            +SGS  KQK PV      +    LSSS+ ++++GSSRR AVSS R++   G +S+PS  +
Sbjct  352  NSGSLAKQKAPVSSDPAISKDVVLSSSSFLRATGSSRRAAVSSSREAAVLGTDSEPSNPQ  411

Query  434  AADTTHASPGAIPKMISTAERSSPVIFD--NKCSSSTR--NSNIKNIESTLKGIEGLSF  270
              +    S   IP       R+SP++    NK SS +R   S +KN E+ LKGIE L F
Sbjct  412  IVEAGSGSNSKIP-----VSRNSPIVSSEINKLSSPSRATTSVMKNYEANLKGIESLHF  465



>ref|XP_011078008.1| PREDICTED: casein kinase I isoform delta-like [Sesamum indicum]
Length=474

 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 66/185 (36%), Positives = 107/185 (58%), Gaps = 13/185 (7%)
 Frame = -3

Query  779  YQQSQLPSPPSCGHGGIGATSSGMPHTAANVDKQTGGEEGLPTGWSSGNLVNSRNTGLVL  600
            YQQSQ+ +PPS   G    TSSG+P    + ++  G EEG   G +S +    R++G ++
Sbjct  295  YQQSQMAAPPSRALGPNAGTSSGLPPAVPSGERLPGEEEGRQAG-TSADPSRRRSSGQLV  353

Query  599  SSG--SKQKGPVHDSTMskglsssniiqssgssrrpavsSI---RDSVTAGVESDPSRTR  435
            ++G  S+QK P  + + SK    S+      SS     +++   R++ T G +S+P+R+R
Sbjct  354  NAGSLSRQKSPAANDSASKDAMLSSSTFFGRSSGTLRRTAVSGSRETFTLGNDSEPTRSR  413

Query  434  AADTTHASPGAIPKMISTAERSSPV--IFDNKCSSSTR-NSNIKNIESTLKGIEGLSFGN  264
               T  ASP  + K IS+ +R+SP+    + K +SS R N++IKN +S +KGIE L F +
Sbjct  414  ---TPEASPATVNK-ISSGQRTSPLGGSSEPKHTSSGRNNTSIKNYDSAIKGIESLHFDD  469

Query  263  DEKSH  249
            +E+ H
Sbjct  470  EERFH  474



>ref|XP_010909190.1| PREDICTED: casein kinase I isoform delta-like [Elaeis guineensis]
Length=479

 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 75/190 (39%), Positives = 97/190 (51%), Gaps = 17/190 (9%)
 Frame = -3

Query  779  YQQSQLPSPPSCGHGGIGATSSGMPHTAANVDKQTGGEEGLPTGWSSGNLVNSR------  618
            YQQSQ+ S P    G     SSG+     N D+Q+ GEEG  +GW + +    R      
Sbjct  295  YQQSQIASAPPRALGSGAGPSSGLAPAVVN-DRQSAGEEGRTSGWPAMDPSRRRVSAPAP  353

Query  617  NTGLVLSSG--SKQKGPVHDSTMskglsssniiqssgssrrpavsSIRDSVTAGV--ESD  450
                V S+G  SKQK P+     S   +  +     G S   +  +   S    V  E D
Sbjct  354  APAPVTSAGSLSKQKSPMGKDPASTKDAMLSSSTFLGRSSGSSRRAAVSSSREAVPSEFD  413

Query  449  PSRTRAADTTHASPGAIPKMISTAERSSPV-IFDNKCSSSTRN-SNIKNIESTLKGIEGL  276
             SRTR   TT ASPG   K+ S A+RSSPV   ++K +SS R+ SNIKN ESTLKG+E L
Sbjct  414  TSRTR---TTEASPGTFLKL-SGAQRSSPVSSAEHKRTSSGRHPSNIKNYESTLKGMECL  469

Query  275  SFGNDEKSHY  246
            +F  DE+  Y
Sbjct  470  NFDGDERVQY  479



>ref|XP_002887448.1| hypothetical protein ARALYDRAFT_476408 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH63707.1| hypothetical protein ARALYDRAFT_476408 [Arabidopsis lyrata subsp. 
lyrata]
Length=465

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 73/179 (41%), Positives = 105/179 (59%), Gaps = 16/179 (9%)
 Frame = -3

Query  779  YQQSQLPSPPSCGHGGIGATSSGMPHTAANVDKQTGGEEGLPTGWSSGNLVNSRNTGLVL  600
            YQQSQ+ +PP   HG +   SSG+P    + ++ +GG+E  P+GWSSG  +  R++G + 
Sbjct  294  YQQSQISTPPPRHHGPVVGPSSGLPPAITSAERPSGGDEARPSGWSSG--IPRRSSGQIF  351

Query  599  SSGS--KQKGPVHDS---TMskglsssniiqssgssrrpavsSIRDSVTAGVESDPSRTR  435
            +SGS  KQK PV      +    LSSS+ ++++GSSRR AVSS R++   G +S+PS  +
Sbjct  352  NSGSLAKQKAPVSSDPAISKDVVLSSSSFLRATGSSRRAAVSSSREAAVLGTDSEPSNPQ  411

Query  434  AADTTHASPGAIPKMISTAERSSPVIFD--NKCSSSTR--NSNIKNIESTLKGIEGLSF  270
              +    S   IP       RSSP++    NK SS +R   S +KN E+ LKGIE L F
Sbjct  412  IIEAGSGSNSKIP-----VGRSSPIVSSEINKLSSPSRATTSVMKNYEANLKGIESLHF  465



>emb|CDX72938.1| BnaC06g33860D [Brassica napus]
Length=473

 Score = 72.8 bits (177),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 62/179 (35%), Positives = 92/179 (51%), Gaps = 16/179 (9%)
 Frame = -3

Query  779  YQQSQLPSPPSCGHGGIGATSSGMPHTAANVDKQTGGEEGLPTGWSSGNLVNSRNTGLVL  600
            YQQSQ+ +PP   HG     SSG+P   A+ ++ +GGEE  P+GW  GN    R++G + 
Sbjct  302  YQQSQISAPPPRPHGAGVGPSSGLPPAIASAERPSGGEEVRPSGWLLGN--PRRSSGHIF  359

Query  599  SSGS--KQKGPVHDSTMskglsssniiqssgssrrpavsSI---RDSVTAGVESDPSRTR  435
            +SGS  KQK PV            +      ++     +++   R+    G +S+PS+ +
Sbjct  360  NSGSSAKQKAPVSSDPAISKDVVLSSSSFLRATGSSRRATVSSSREPAVPGTDSEPSKPQ  419

Query  434  AADTTHASPGAIPKMISTAERSSPVIF--DNKCSSSTR--NSNIKNIESTLKGIEGLSF  270
                  A   + PK+     RSSP++   +NK SS +R   S +KN ES LKGIE L F
Sbjct  420  ---NIEAGSSSNPKI--HGGRSSPIVSSDNNKLSSPSRGNTSVMKNYESNLKGIESLHF  473



>ref|XP_009395780.1| PREDICTED: casein kinase I-like [Musa acuminata subsp. malaccensis]
Length=473

 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 69/185 (37%), Positives = 94/185 (51%), Gaps = 17/185 (9%)
 Frame = -3

Query  776  QQSQLPSPPSCGHGGIGATSSGMPHTAANVDKQTGGEEGLPTGWSSGNLVNSRNTGLV--  603
            QQSQ+   P    G     SSG+    AN DKQ+GGEEG  +GW +   ++    G +  
Sbjct  296  QQSQIAGAPPRAIGPSVGPSSGLTPPIAN-DKQSGGEEGRASGWLA---MDPSRRGRITP  351

Query  602  ----LSSGSKQKGPVHD--STMskglsssniiqssgssrrpavsSIRDSVTAGVESDPSR  441
                + S SKQK PV +  S     + SS+      S      +        GVE+D SR
Sbjct  352  PSVNVGSLSKQKAPVGNDPSVNRDAMFSSSTFLGRSSGSSRRAAVSSSREVTGVEADQSR  411

Query  440  TRAADTTHASPGAIPKMISTAERSSPV-IFDNKCSSSTRNSNIKNIESTLKGIEGLSFGN  264
            +R AD   ASPG   K +S+A RSSP+   +++ +S    S IKN ESTLKGIE L+F  
Sbjct  412  SRTAD---ASPGTFRK-VSSARRSSPIGSMEHRYTSGRNVSTIKNYESTLKGIEALNFDG  467

Query  263  DEKSH  249
            +E+  
Sbjct  468  EERKQ  472



>gb|EPS61015.1| hypothetical protein M569_13784, partial [Genlisea aurea]
Length=353

 Score = 72.0 bits (175),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 72/197 (37%), Positives = 95/197 (48%), Gaps = 40/197 (20%)
 Frame = -3

Query  779  YQQSQLPSPPSCGHGGIGATSSGMPHTAANVDKQTGGEEGL-PTGWS-----SGNLVNSR  618
            YQQSQL +PPS   G +  TSS MPH  AN D+Q+GGEE   P GWS     S NL++S 
Sbjct  174  YQQSQLSNPPSRPLGAVAGTSSAMPH--ANADRQSGGEEDKGPPGWSVSANRSRNLLHST  231

Query  617  NTGLVLSSGSKQKGPVHDSTMskglsssniiqssgssrrpavsSIRDSVTAGVESDPSRT  438
            N         +QKGPV +         S     S      +    RD   +G ++D +R 
Sbjct  232  NL-------PRQKGPVPNDVAISKERLSQQTAPSRRPAGSSS---RDLDPSGNDNDTTRG  281

Query  437  RAADT----------------THASPGAIPKMISTAERSSPVIFDNKCSSSTRN-SNIKN  309
            RA+D                 TH   G+ P  I +++ ++        SS+ RN  NIKN
Sbjct  282  RASDALLLLQRNSTAAAAAAATH---GSSP--IDSSDHNNNNNNKRSSSSAPRNPPNIKN  336

Query  308  IESTLKGIEGLSFGNDE  258
             ESTLK +E L FGND+
Sbjct  337  FESTLKSMESLKFGNDD  353



>ref|XP_009105937.1| PREDICTED: casein kinase I isoform delta-like isoform X2 [Brassica 
rapa]
 emb|CDX96430.1| BnaA07g30410D [Brassica napus]
Length=465

 Score = 72.4 bits (176),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 62/179 (35%), Positives = 92/179 (51%), Gaps = 16/179 (9%)
 Frame = -3

Query  779  YQQSQLPSPPSCGHGGIGATSSGMPHTAANVDKQTGGEEGLPTGWSSGNLVNSRNTGLVL  600
            YQQSQ+ +PP   HG     SSG+P   A+ ++ +GGEE  P+GW  GN    R++G + 
Sbjct  294  YQQSQISTPPPRPHGAGVGPSSGLPPAIASAERPSGGEEVRPSGWLLGN--PRRSSGHIF  351

Query  599  SSGS--KQKGPVHDSTMskglsssniiqssgssrrpavsSI---RDSVTAGVESDPSRTR  435
            +SGS  KQK PV            +      ++     +++   R+    G +S+PS+ +
Sbjct  352  NSGSSAKQKAPVSSDPAISKDVVLSSSSFLRATGSSRRATVSSSREPAVPGTDSEPSKPQ  411

Query  434  AADTTHASPGAIPKMISTAERSSPVIF--DNKCSSSTR--NSNIKNIESTLKGIEGLSF  270
                  A   + PK+     RSSP++   +NK SS +R   S +KN ES LKGIE L F
Sbjct  412  ---NIEAGSSSNPKI--HGGRSSPIVSSDNNKLSSPSRGNTSVMKNYESNLKGIESLHF  465



>ref|XP_004969708.1| PREDICTED: casein kinase I isoform delta-like [Setaria italica]
Length=471

 Score = 72.0 bits (175),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 83/188 (44%), Positives = 106/188 (56%), Gaps = 21/188 (11%)
 Frame = -3

Query  779  YQQSQLPSPP--SCGHGGIGATSSGMPHTAANVDKQTGGEEGLPTGWSSGNLVNSRNTGL  606
            YQQSQ+ + P  + GHG   A  SG+     N D+Q+G EE   +GWSS   ++ R T  
Sbjct  295  YQQSQIATAPPRAVGHG---AGPSGLAPALQN-DRQSGLEEARTSGWSS---MDRRRTPP  347

Query  605  VLSSG---SKQKGPV-HDSTMskglsss--niiqssgssrrpavsSIRDSVTAGVESDPS  444
             ++S    SKQK PV +D T SK    S  N +  S  S R  V S    V A   S+PS
Sbjct  348  PITSVGTLSKQKAPVGNDVTASKDPVISGPNFLGRSSGSSRRPVVSSSRDVVATDSSEPS  407

Query  443  RTRAADTTHASPGAIPKMISTAERSSPV-IFDNKCSSSTRN-SNIKNIESTLKGIEGLSF  270
            RTR   TT ASPGA  +  S  +RSSPV   + K SSS R+ SN+KN +S LKGIEGL+F
Sbjct  408  RTR---TTDASPGAF-RRASGPQRSSPVHSAEQKRSSSGRHPSNVKNYDSALKGIEGLNF  463

Query  269  GNDEKSHY  246
              DE+  +
Sbjct  464  DGDERVQF  471



>ref|XP_004287578.1| PREDICTED: casein kinase I isoform delta-like [Fragaria vesca 
subsp. vesca]
Length=471

 Score = 71.6 bits (174),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 63/181 (35%), Positives = 92/181 (51%), Gaps = 7/181 (4%)
 Frame = -3

Query  779  YQQSQLPSPPSCGHGGIGATSSGMPHTAANVDKQTGGEEGLPTGWSSGNLVNSRNTGLVL  600
            YQQSQL +PP+   G    TSSGMPH  ANVD+ T  E+G   G SS +    R  G  L
Sbjct  295  YQQSQLATPPTRALGA--GTSSGMPHAPANVDRPTAEEDGRIAGLSSLDPTRRRIPGPAL  352

Query  599  SSGS--KQKGPVH-DSTMskglsssniiqssgssrrpavsSIRDSVTAGVESDPSRTRAA  429
            +S S  +Q+  +  DS +++  +  +     G S   +      S   G     S  R  
Sbjct  353  NSASVSRQRNSIATDSAITRENNLLSNPNMMGRSSGSSRRPAVSSSREGFGRSESEHRVR  412

Query  428  DTTHASPGAIPKMISTAERSSPVIFDNKCSSSTRNSNIKNIESTLKGIEGLSFGNDEKSH  249
             T  ASPG   + IS+ +RSSPV   +   +   +S I+N E+ ++G+EGL   ++E+ H
Sbjct  413  -TNDASPGTGHR-ISSGQRSSPVESSDPTRTGRHSSQIRNYETAIRGLEGLQLDHEERIH  470

Query  248  Y  246
            Y
Sbjct  471  Y  471



>ref|XP_004239254.1| PREDICTED: casein kinase I isoform delta-like [Solanum lycopersicum]
Length=469

 Score = 71.2 bits (173),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 66/186 (35%), Positives = 100/186 (54%), Gaps = 20/186 (11%)
 Frame = -3

Query  779  YQQSQLPSPPSCGHGGIGATSSGMPHTAANVDKQTGGEEGLPTGWSSGNLVNSRNTGLVL  600
            YQQSQ+ +PPS   G    TSSGMP    + ++ +G EEG     +S      R +G ++
Sbjct  295  YQQSQIAAPPSRPLGTGAGTSSGMPPVIPSAERPSGEEEGRQLADAS----RRRYSGPLV  350

Query  599  SSG--SKQKGPVHDSTMskglsssniiqssgssrrpavsSI---RDSVTAGVESDPSRTR  435
            ++G  SKQK P+ + + SK     +      SS       +   R++ + G  SDP+R+R
Sbjct  351  NAGSLSKQKSPLRNDSTSKNAMLPSSTFLGRSSGSLRRGLVSGSRETSSVGNGSDPTRSR  410

Query  434  AADTTHASPGAIPKMISTAERSSPVIFDNKCSSSTRNSN----IKNIESTLKGIEGLSFG  267
            A +   ASP  + K IS+ +R SP++     S  T++++    +KN ESTLKGIE L F 
Sbjct  411  APE---ASPATMHK-ISSGQRISPLV---GSSDPTKHASSVPGVKNYESTLKGIESLHFD  463

Query  266  NDEKSH  249
             +EK H
Sbjct  464  EEEKGH  469



>gb|KJB54401.1| hypothetical protein B456_009G032600 [Gossypium raimondii]
Length=418

 Score = 69.7 bits (169),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 66/181 (36%), Positives = 93/181 (51%), Gaps = 18/181 (10%)
 Frame = -3

Query  779  YQQSQLPSPPSCGHGGIGATSSGMPHTAANVDKQTGGEEGLPTGWSSGNLVNSRNT-GLV  603
            YQQSQL +PP+   G    TSSGMP    N D+   G++    G S  +    R T G +
Sbjct  253  YQQSQLTTPPARALGSGVGTSSGMPTAIGNADRHAAGQDVQAAGMSPMDNSRRRTTSGPL  312

Query  602  LSSGS--KQKGPVHDSTMskglsssniiqssgssrrpavsSIRDSVTAGVESDPSRTRAA  429
            + SGS  KQK P+ +   +K  + +     S           R++V AG E DP R+R  
Sbjct  313  MYSGSFAKQKNPIANDPATKDSAYTGQSGGSSKRASG-----REAV-AGSEFDPQRSR--  364

Query  428  DTTHASPGAIPKMISTAERSSPVIFDNKCSSSTRNSNIKNIESTLKGIEGLSFGNDEKSH  249
             TT ASPG   K ++  ++  PV   +    + RN+  KN E+ LKGIEGL F +DE++ 
Sbjct  365  -TTDASPGH--KHLN--QQRGPVESSSDPKQTGRNT--KNYEAALKGIEGLQFESDERNQ  417

Query  248  Y  246
            Y
Sbjct  418  Y  418



>ref|XP_010416034.1| PREDICTED: casein kinase I isoform delta-like [Camelina sativa]
Length=465

 Score = 69.7 bits (169),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 75/178 (42%), Positives = 106/178 (60%), Gaps = 14/178 (8%)
 Frame = -3

Query  779  YQQSQLPSPPSCGHG-GIGATSSGMPHTAANVDKQTGGEEGLPTGWSSGNLVNSRNTGLV  603
            YQQSQ+ +PP   HG G+G  SSG+P   A+ ++ +GG+E  P+GWSSG  +  R+ G +
Sbjct  294  YQQSQISTPPPRHHGPGVGP-SSGLPPAIASAERPSGGDEARPSGWSSG--IPRRSPGPI  350

Query  602  LSSG--SKQKGPVHDS---TMskglsssniiqssgssrrpavsSIRDSVTAGVESDPSRT  438
             +SG  SKQK PV      +    LSSS+ ++++GSSRR AVSS R++   G +S+PS  
Sbjct  351  FNSGSLSKQKAPVSSDPAISKDVVLSSSSFLRATGSSRRAAVSSSREAAVLGTDSEPSNP  410

Query  437  RAADTTHASPGAIPKMISTAERSSPVIFDNKCSSSTR--NSNIKNIESTLKGIEGLSF  270
            +  +    S   IP   S+   S+ +   NK SS TR   S +KN E+ LKGIE L F
Sbjct  411  QIFEAGSGSNSKIPVGRSSLIVSAEI---NKLSSPTRATTSVMKNYEANLKGIESLHF  465



>gb|KJB54403.1| hypothetical protein B456_009G032600 [Gossypium raimondii]
Length=460

 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 66/181 (36%), Positives = 93/181 (51%), Gaps = 18/181 (10%)
 Frame = -3

Query  779  YQQSQLPSPPSCGHGGIGATSSGMPHTAANVDKQTGGEEGLPTGWSSGNLVNSRNT-GLV  603
            YQQSQL +PP+   G    TSSGMP    N D+   G++    G S  +    R T G +
Sbjct  295  YQQSQLTTPPARALGSGVGTSSGMPTAIGNADRHAAGQDVQAAGMSPMDNSRRRTTSGPL  354

Query  602  LSSGS--KQKGPVHDSTMskglsssniiqssgssrrpavsSIRDSVTAGVESDPSRTRAA  429
            + SGS  KQK P+ +   +K  + +     S           R++V AG E DP R+R  
Sbjct  355  MYSGSFAKQKNPIANDPATKDSAYTGQSGGSSKRASG-----REAV-AGSEFDPQRSR--  406

Query  428  DTTHASPGAIPKMISTAERSSPVIFDNKCSSSTRNSNIKNIESTLKGIEGLSFGNDEKSH  249
             TT ASPG   K ++  ++  PV   +    + RN+  KN E+ LKGIEGL F +DE++ 
Sbjct  407  -TTDASPGH--KHLN--QQRGPVESSSDPKQTGRNT--KNYEAALKGIEGLQFESDERNQ  459

Query  248  Y  246
            Y
Sbjct  460  Y  460



>gb|KJB83053.1| hypothetical protein B456_013G227100 [Gossypium raimondii]
Length=444

 Score = 69.3 bits (168),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 67/179 (37%), Positives = 86/179 (48%), Gaps = 29/179 (16%)
 Frame = -3

Query  779  YQQSQLPSPPSCGHGGIGATSSGMPHTAANVDKQTGGEEGLPTGWSSGNLVNSRNTGLVL  600
            YQQSQL +PP+   G    TS+ MP   AN D+Q G     P            N+G   
Sbjct  294  YQQSQLTTPPARALGPGAGTSAAMPPAFANADRQAG-----PL-----------NSG---  334

Query  599  SSGSKQKGPVHDSTMskglsssniiqssgssrrpavsSIRDSVTAGVESDPSRTRAADTT  420
             S +KQKGPV +       +         SSR  A S  R++  AG E+DP R+R  D +
Sbjct  335  -SHAKQKGPVANDPAITKDTMYMGQSGGSSSRHIAGS--REAF-AGSEADPQRSRTTDAS  390

Query  419  HASPGAIPKMISTAERSSPVIFDNKCSSSTRN-SNIKNIESTLKGIEGLSFGNDEKSHY  246
            H          S  E S P     K +SS RN S+ KN E+ LKG+EGL F +DE+ HY
Sbjct  391  HGGLHRNSSRQSPVESSEP-----KRASSMRNTSHAKNYEAALKGMEGLQFESDERIHY  444



>gb|EMS66353.1| Casein kinase I isoform delta-like protein [Triticum urartu]
Length=476

 Score = 69.3 bits (168),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 68/184 (37%), Positives = 92/184 (50%), Gaps = 12/184 (7%)
 Frame = -3

Query  779  YQQSQLPS-PPSCGHGGIGATSSGMPHTAANVDKQTGGEEGLPTGWSSGNLVNSRNTGLV  603
            YQQSQ+ S PP     G GA  SG+       D Q+G  EG  +GWS+ +   +      
Sbjct  299  YQQSQIASAPPRVA--GHGAGPSGLTPPVLQNDSQSGAVEGRISGWSAMDRRRAPPPIAS  356

Query  602  LSSGSKQKGPVHDSTMskglsssniiqssgssrrpavsSIRDSVTAGVESD---PSRTRA  432
            + + +KQK PV +        + +     G S   +  +   S    V SD   PSR+R 
Sbjct  357  VGTSNKQKAPVGNDAPISKDPAISGSNFLGRSSGSSRRAAVSSSRDAVASDTFEPSRSR-  415

Query  431  ADTTHASPGAIPKMISTAERSSPV--IFDNKCSSSTRNSNIKNIESTLKGIEGLSFGNDE  258
              TT ASPGA  +  S A+RS PV      + SS+  +SN KN ES LKGIEGL+F  DE
Sbjct  416  --TTDASPGAF-RRTSGAQRSPPVDSAEPQRSSSARHSSNPKNYESALKGIEGLNFDGDE  472

Query  257  KSHY  246
            ++ Y
Sbjct  473  RAQY  476



>ref|XP_006302226.1| hypothetical protein CARUB_v10020246mg [Capsella rubella]
 gb|EOA35124.1| hypothetical protein CARUB_v10020246mg [Capsella rubella]
Length=466

 Score = 68.9 bits (167),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 75/181 (41%), Positives = 107/181 (59%), Gaps = 19/181 (10%)
 Frame = -3

Query  779  YQQSQLPSPPSCGHG-GIGATSSGMPHTAANVDKQTGGEEGLPTGWSSGNLVNSRNTGLV  603
            YQQSQ+ +PP   HG G+G  SS +P   A+ ++ +GG+E  P+GWSSG  +  R++G +
Sbjct  294  YQQSQISTPPPRHHGPGVGP-SSALPPAIASAERPSGGDEARPSGWSSG--IPRRSSGQI  350

Query  602  LSSGS--KQKGPVHDS----TMskglsssniiqssgssrrpavsSIRDSVTAGVESDPSR  441
             +SGS  KQK PV  S    +    LSSS+ ++++GSSRR AVSS R++   G +S+PS 
Sbjct  351  FNSGSLAKQKAPVSSSDPAISKDVMLSSSSFLRATGSSRRAAVSSSREAAVPGTDSEPSN  410

Query  440  TRAADTTHASPGAIPKMISTAERSSPVIFD--NKCSSSTR--NSNIKNIESTLKGIEGLS  273
             +  +    S    P       RSSP++    NK SS +R   S +KN E+ LKGIE L 
Sbjct  411  PQIIEAGSGSNSKTP-----VGRSSPIVSSEINKLSSPSRATTSVMKNYEANLKGIESLH  465

Query  272  F  270
            F
Sbjct  466  F  466



>ref|XP_009395820.1| PREDICTED: casein kinase I isoform delta-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=501

 Score = 69.3 bits (168),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 70/186 (38%), Positives = 100/186 (54%), Gaps = 20/186 (11%)
 Frame = -3

Query  779  YQQSQLPSPPSCGHGGIGATSSGMPHTAANVDKQTGGEEGLPTGWSSGNLVNSRNTGLV-  603
            YQQSQ+   P+   G     SSG+    AN D+Q+G EEG  +GW +   ++    G V 
Sbjct  326  YQQSQIAGAPARAIGASAGPSSGLAPAVAN-DRQSG-EEGRASGWLA---MDPSRRGRVT  380

Query  602  -----LSSGSKQKGPVHDSTMskglsssniiqssgssrrpavsSIRDSV--TAGVESDPS  444
                  SS SKQK PV + T +   +  +     G S   +  +   S     G ++D S
Sbjct  381  PPPVNASSSSKQKAPVGNDTSASKDAMFSSSTFMGRSSGSSRRAAVSSSRDMVGPDTDQS  440

Query  443  RTRAADTTHASPGAIPKMISTAERSSPVIFDNKCSSSTRN-SNIKNIESTLKGIEGLSFG  267
            RTR A+   ASP    K +S+A+R+SP   ++K +SS R  S IKN ESTLKGIEGL+F 
Sbjct  441  RTRTAE---ASPVTFHK-VSSAQRNSPA--EHKHTSSGRKPSAIKNYESTLKGIEGLNFD  494

Query  266  NDEKSH  249
            ++E++ 
Sbjct  495  SEERNQ  500



>ref|XP_009395821.1| PREDICTED: casein kinase I-like isoform X2 [Musa acuminata subsp. 
malaccensis]
Length=470

 Score = 68.9 bits (167),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 70/186 (38%), Positives = 100/186 (54%), Gaps = 20/186 (11%)
 Frame = -3

Query  779  YQQSQLPSPPSCGHGGIGATSSGMPHTAANVDKQTGGEEGLPTGWSSGNLVNSRNTGLV-  603
            YQQSQ+   P+   G     SSG+    AN D+Q+G EEG  +GW +   ++    G V 
Sbjct  295  YQQSQIAGAPARAIGASAGPSSGLAPAVAN-DRQSG-EEGRASGWLA---MDPSRRGRVT  349

Query  602  -----LSSGSKQKGPVHDSTMskglsssniiqssgssrrpavsSIRDSV--TAGVESDPS  444
                  SS SKQK PV + T +   +  +     G S   +  +   S     G ++D S
Sbjct  350  PPPVNASSSSKQKAPVGNDTSASKDAMFSSSTFMGRSSGSSRRAAVSSSRDMVGPDTDQS  409

Query  443  RTRAADTTHASPGAIPKMISTAERSSPVIFDNKCSSSTRN-SNIKNIESTLKGIEGLSFG  267
            RTR A+   ASP    K +S+A+R+SP   ++K +SS R  S IKN ESTLKGIEGL+F 
Sbjct  410  RTRTAE---ASPVTFHK-VSSAQRNSPA--EHKHTSSGRKPSAIKNYESTLKGIEGLNFD  463

Query  266  NDEKSH  249
            ++E++ 
Sbjct  464  SEERNQ  469



>ref|XP_006654877.1| PREDICTED: casein kinase I isoform delta-like [Oryza brachyantha]
Length=468

 Score = 68.9 bits (167),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 66/180 (37%), Positives = 91/180 (51%), Gaps = 16/180 (9%)
 Frame = -3

Query  779  YQQSQLPSPPSCGHGGIGATSSGMPHTAANVDKQTGGEEGLPTGWSSGNLVNSRNTGLVL  600
            YQQSQ+ S P          SSGM   A N ++ +  EEG  +GWS  + V  +     +
Sbjct  295  YQQSQMTSAPPRAIAPATGQSSGMAPIANN-NRLSATEEGRRSGWSDMDAVRRQVPPPAI  353

Query  599  SSGS--KQKGPV-HDSTMskglsssniiqssgssrrpavsSIRDSVTAGVESDPSRTRAA  429
            ++GS  KQK P+ H+ + SK    S+      SS       + +S    +E+D SR+R  
Sbjct  354  NAGSLAKQKSPIGHEQSTSKDAMFSSSTFLGWSSGSSRRPVVSNSRGPSIEADQSRSR--  411

Query  428  DTTHASPGAIPKMISTAERSSPVIFDNKCSSSTRNSNIKNIESTLKGIEGLSFGNDEKSH  249
             TT ASPGA         RSS    D + SS    SN KN EST++GI+GLSF  D++ H
Sbjct  412  -TTDASPGAFL-------RSSQ--HDRRTSSGRHTSNAKNYESTIRGIQGLSFDGDDRIH  461



>gb|EEC79796.1| hypothetical protein OsI_21224 [Oryza sativa Indica Group]
Length=473

 Score = 68.6 bits (166),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 67/186 (36%), Positives = 99/186 (53%), Gaps = 15/186 (8%)
 Frame = -3

Query  779  YQQSQLPS-PPSCGHGGIGATSSGMPHTAANVDKQTGGEEGLPTGWSSGNLVNSRNTGLV  603
            YQQSQ+ S PP       G +S+  P   AN ++ +  EEG  +GWS  + +  +     
Sbjct  295  YQQSQMTSAPPRAIAPATGQSSAMAP--IANNNRLSATEEGRRSGWSDMDAMRRQVPPPA  352

Query  602  LSSGS--KQKGPV-HDSTMskglsssniiqssgssrrpavsSIRDSVTAGVESDPSRTRA  432
            +++GS  KQK P+ H+ + SK    S+      SS      ++  S     E+D SR+R 
Sbjct  353  INAGSLAKQKSPIGHEQSTSKDAMFSSSTFLGRSSGSSRRPAVSSSREPSTEADQSRSR-  411

Query  431  ADTTHASPGAIPKMISTAERSSPVIFD---NKCSSSTRN-SNIKNIESTLKGIEGLSFGN  264
              TT ASPGA  +  S A R SP + D   N+ + S R+ SN KN EST++GI+GL+F  
Sbjct  412  --TTDASPGAFQR--SGAPRWSPQMVDSSDNRRTPSGRHPSNAKNYESTIRGIQGLNFDG  467

Query  263  DEKSHY  246
            D++  Y
Sbjct  468  DDRIQY  473



>ref|NP_001056503.1| Os05g0593800 [Oryza sativa Japonica Group]
 gb|AAT44307.1| putative protein kinase ADK1 [Oryza sativa Japonica Group]
 dbj|BAF18417.1| Os05g0593800 [Oryza sativa Japonica Group]
 dbj|BAG99503.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE64906.1| hypothetical protein OsJ_19766 [Oryza sativa Japonica Group]
Length=473

 Score = 68.2 bits (165),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 67/186 (36%), Positives = 99/186 (53%), Gaps = 15/186 (8%)
 Frame = -3

Query  779  YQQSQLPS-PPSCGHGGIGATSSGMPHTAANVDKQTGGEEGLPTGWSSGNLVNSRNTGLV  603
            YQQSQ+ S PP       G +S+  P   AN ++ +  EEG  +GWS  + +  +     
Sbjct  295  YQQSQMTSAPPRAIAPATGQSSAMAP--IANNNRLSATEEGRRSGWSDMDAMRRQVPPPA  352

Query  602  LSSGS--KQKGPV-HDSTMskglsssniiqssgssrrpavsSIRDSVTAGVESDPSRTRA  432
            +++GS  KQK P+ H+ + SK    S+      SS      ++  S     E+D SR+R 
Sbjct  353  INAGSLAKQKSPIGHEQSTSKDAVFSSSTFLGRSSGSSRRPAVSSSREPSTEADQSRSR-  411

Query  431  ADTTHASPGAIPKMISTAERSSPVIFD---NKCSSSTRN-SNIKNIESTLKGIEGLSFGN  264
              TT ASPGA  +  S A R SP + D   N+ + S R+ SN KN EST++GI+GL+F  
Sbjct  412  --TTDASPGAFQR--SGAPRWSPQMVDSSDNRRTPSGRHPSNAKNYESTIRGIQGLNFDG  467

Query  263  DEKSHY  246
            D++  Y
Sbjct  468  DDRIQY  473



>emb|CDM83770.1| unnamed protein product [Triticum aestivum]
Length=472

 Score = 68.2 bits (165),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 68/185 (37%), Positives = 92/185 (50%), Gaps = 14/185 (8%)
 Frame = -3

Query  779  YQQSQLPSPP--SCGHGGIGATSSGMPHTAANVDKQTGGEEGLPTGWSSGNLVNSRNTGL  606
            YQQSQ+ S P    GHG   A  SG+       D Q+G  EG  +GWS+ +   +     
Sbjct  295  YQQSQIASAPPRVAGHG---AGPSGLTPPVLQNDSQSGAVEGRISGWSAMDRRRAPPPIA  351

Query  605  VLSSGSKQKGPVHDSTMskglsssniiqssgssrrpavsSIRDSVTAGVESD---PSRTR  435
             + + +KQK PV +        + +     G S   +  +   S    V SD   PSR+R
Sbjct  352  SVGTSNKQKAPVGNDAPISKDPAISGSNFLGRSSGSSRRAAVSSSRDAVASDTFEPSRSR  411

Query  434  AADTTHASPGAIPKMISTAERSSPV--IFDNKCSSSTRNSNIKNIESTLKGIEGLSFGND  261
               TT ASPGA  +  S A+RS PV      + SS+  +SN KN ES LKGIEGL+F  D
Sbjct  412  ---TTDASPGAF-RRTSGAQRSPPVDSAEPQRSSSARHSSNPKNYESALKGIEGLNFDGD  467

Query  260  EKSHY  246
            E++ Y
Sbjct  468  ERAQY  472



>ref|XP_008352372.1| PREDICTED: casein kinase I isoform delta-like [Malus domestica]
Length=459

 Score = 68.2 bits (165),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 74/173 (43%), Positives = 93/173 (54%), Gaps = 16/173 (9%)
 Frame = -3

Query  779  YQQSQLPSPPSCGHGGIGATSSGMPHTAANVDKQTGGEEGLPTGWSSGNLVNSRNTGLVL  600
            YQQSQL  PP+    G G TSSGMPH A N D+  G E+G  TG  S +    R  G  L
Sbjct  295  YQQSQLAVPPTRALPGAG-TSSGMPHAAVNADRLAGEEDGRLTGLRSLDASQRRIPGPAL  353

Query  599  S--SGSKQKGPV-HDSTMskglsssniiqssgssrrpavsSIRDSVTAGVESDPSRTRAA  429
            +  S S+QK P+ +D+++++  S+SN+   S  S R    S       G ESD  R R  
Sbjct  354  NSLSLSRQKNPIANDASLTRETSNSNMYGLSAGSSRRVAVSGSRDAFGGSESD-IRPR--  410

Query  428  DTTHASPGAIPKMISTAERSSPVIFDNKCSSSTRN--SNIKNIESTLKGIEGL  276
             TT ASPG     IS+  RSSPV    + S  TR   S   N E+T+KGIEGL
Sbjct  411  -TTDASPGG--HRISSGRRSSPV----ESSDPTRRHTSQTGNYETTVKGIEGL  456



>ref|XP_008337722.1| PREDICTED: casein kinase I isoform delta-like [Malus domestica]
Length=459

 Score = 68.2 bits (165),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 74/173 (43%), Positives = 93/173 (54%), Gaps = 16/173 (9%)
 Frame = -3

Query  779  YQQSQLPSPPSCGHGGIGATSSGMPHTAANVDKQTGGEEGLPTGWSSGNLVNSRNTGLVL  600
            YQQSQL  PP+    G G TSSGMPH A N D+  G E+G  TG  S +    R  G  L
Sbjct  295  YQQSQLAVPPTRALPGAG-TSSGMPHAAVNADRLAGEEDGRLTGLRSLDASQRRIPGPAL  353

Query  599  S--SGSKQKGPV-HDSTMskglsssniiqssgssrrpavsSIRDSVTAGVESDPSRTRAA  429
            +  S S+QK P+ +D+++++  S+SN+   S  S R    S       G ESD  R R  
Sbjct  354  NSLSLSRQKNPIANDASLTRETSNSNMYGLSAGSSRRVAVSGSRDAFGGSESD-IRPR--  410

Query  428  DTTHASPGAIPKMISTAERSSPVIFDNKCSSSTRN--SNIKNIESTLKGIEGL  276
             TT ASPG     IS+  RSSPV    + S  TR   S   N E+T+KGIEGL
Sbjct  411  -TTDASPGG--HRISSGRRSSPV----ESSDPTRRHTSQTGNYETTVKGIEGL  456



>ref|XP_004507950.1| PREDICTED: casein kinase I isoform delta-like isoform X1 [Cicer 
arietinum]
Length=471

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 66/182 (36%), Positives = 97/182 (53%), Gaps = 9/182 (5%)
 Frame = -3

Query  779  YQQSQLPSPPSCGHGGIGATSSGMPHTAANVDKQTGGEEGLPTGWSSGNLVNSRNTGLVL  600
            YQQSQL +PP+   G    TSS MP    N D+ TG EEG P G  S +    R +G +L
Sbjct  295  YQQSQLATPPARAIGPSAGTSSAMPPAVTNADRHTGAEEGQPPGLVSVDSSRRRMSGPIL  354

Query  599  SSGSKQKG-PVHDSTMskglsssniiqssgssrrpavsSIRDSVTAGVESDPSRTRAADT  423
            ++ +      +  S++   LSS+N++  S  S R    S       G ES+  RTR A+ 
Sbjct  355  NTVTFFFANSIFASSVIMQLSSANVLGQSSGSSRRVAVSSSRDAFVGAESE-VRTRTAE-  412

Query  422  THASPGAIPKMISTAERSSPVIFDN--KCSSSTRN-SNIKNIESTLKGIEGLSFGNDEKS  252
              ASPGA  +++   +RSSP+   +  + +   R+ S  KN +S L+G+EGL    DE++
Sbjct  413  --ASPGAAHRILG-GQRSSPIGSSDPKRVAPVGRSASQAKNYDSALRGMEGLQLETDERT  469

Query  251  HY  246
            HY
Sbjct  470  HY  471



>ref|XP_009105934.1| PREDICTED: casein kinase I isoform delta-like isoform X1 [Brassica 
rapa]
 ref|XP_009105935.1| PREDICTED: casein kinase I isoform delta-like isoform X1 [Brassica 
rapa]
 ref|XP_009105936.1| PREDICTED: casein kinase I isoform delta-like isoform X1 [Brassica 
rapa]
Length=467

 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 62/181 (34%), Positives = 91/181 (50%), Gaps = 18/181 (10%)
 Frame = -3

Query  779  YQQSQLPSPPSCGHGGIGATSSGMPHTAANVDK--QTGGEEGLPTGWSSGNLVNSRNTGL  606
            YQQSQ+ +PP   HG     SSG+P   A+ ++    GGEE  P+GW  GN    R++G 
Sbjct  294  YQQSQISTPPPRPHGAGVGPSSGLPPAIASAERPSAAGGEEVRPSGWLLGN--PRRSSGH  351

Query  605  VLSSGS--KQKGPVHDSTMskglsssniiqssgssrrpavsSI---RDSVTAGVESDPSR  441
            + +SGS  KQK PV            +      ++     +++   R+    G +S+PS+
Sbjct  352  IFNSGSSAKQKAPVSSDPAISKDVVLSSSSFLRATGSSRRATVSSSREPAVPGTDSEPSK  411

Query  440  TRAADTTHASPGAIPKMISTAERSSPVIF--DNKCSSSTR--NSNIKNIESTLKGIEGLS  273
             +      A   + PK+     RSSP++   +NK SS +R   S +KN ES LKGIE L 
Sbjct  412  PQ---NIEAGSSSNPKI--HGGRSSPIVSSDNNKLSSPSRGNTSVMKNYESNLKGIESLH  466

Query  272  F  270
            F
Sbjct  467  F  467



>ref|XP_004243748.1| PREDICTED: casein kinase I isoform delta-like [Solanum lycopersicum]
Length=472

 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 67/187 (36%), Positives = 99/187 (53%), Gaps = 19/187 (10%)
 Frame = -3

Query  779  YQQSQLPSPPSCGHGGIGATSSGMPHTAANVDKQTGGEEGLPTGWSSGNLVNSRNTGL--  606
            YQQSQ+ +PPS   G    TSSGMP      ++Q G +EG  +   S      R + +  
Sbjct  295  YQQSQIAAPPSRPLGAGAGTSSGMPPVIPKAERQAGEDEGRQSADPS-----RRRSPVPP  349

Query  605  VLSSG--SKQKGPVHDSTMskglsssniiqssgssrrpavsSI---RDSVTAGVESDPSR  441
            +++SG  S+QK P+ + + SK    S+       S       +   R++ T G +SDP+ 
Sbjct  350  LITSGSLSRQKSPIGNDSTSKEAMLSSSSFLGRPSGSLRQGLVSGSRETFTMGNDSDPTH  409

Query  440  TRAADTTHASPGAIPKMISTAERSSPV--IFDNKCSSSTRN-SNIKNIESTLKGIEGLSF  270
            +R   T  ASP  + K IS   RSS +    D + +SS++N S IKN ES LKGIE L F
Sbjct  410  SR---TPEASPATMHK-ISGGHRSSLLGGSSDPRYASSSKNTSGIKNYESALKGIETLHF  465

Query  269  GNDEKSH  249
             ++E++H
Sbjct  466  DDEERAH  472



>ref|XP_009410794.1| PREDICTED: casein kinase I-like [Musa acuminata subsp. malaccensis]
Length=473

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 67/184 (36%), Positives = 101/184 (55%), Gaps = 17/184 (9%)
 Frame = -3

Query  779  YQQSQLPSPPSCGHGGIGATSSGMPHTAANVDKQTGGEEGLPTGWSSGNLVNSRNTGLV-  603
            YQQSQ+   P    G     SSG+    AN D+Q+GGEEG  +GW +   ++S + G V 
Sbjct  295  YQQSQMSGAPPRAIGSSAEPSSGLVPAIAN-DRQSGGEEGQTSGWLA---MDSSHRGQVT  350

Query  602  -----LSSGSKQKGPV-HDSTMskglsssniiqssgssrrpavsSIRDSV-TAGVESDPS  444
                 + S SKQK P+ +D + S+    S+      SS     +++  S    G E+D +
Sbjct  351  QPAVTVGSLSKQKSPMGNDPSFSREAIFSSSAFLGRSSGSSRRAAVSSSRDILGSEADQT  410

Query  443  RTRAADTTHASPGAIPKMISTAERSSPVIFDNKCSSSTRNS-NIKNIESTLKGIEGLSFG  267
            R+R A+   ASPG   K +S+A++SSP+       +S RNS  IKN E+TL+GIE  +F 
Sbjct  411  RSRTAE---ASPGTFRK-VSSAQQSSPISSAEHKHASGRNSFTIKNYETTLRGIEAFNFD  466

Query  266  NDEK  255
            ++E+
Sbjct  467  SEER  470



>ref|XP_009349379.1| PREDICTED: casein kinase I isoform delta-like [Pyrus x bretschneideri]
Length=459

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 72/173 (42%), Positives = 91/173 (53%), Gaps = 16/173 (9%)
 Frame = -3

Query  779  YQQSQLPSPPSCGHGGIGATSSGMPHTAANVDKQTGGEEGLPTGWSSGNLVNSRNTGLVL  600
            YQQSQL  PP+    G G TSSGMPH A N D+    E+G PTG  S +    R  G  L
Sbjct  295  YQQSQLAVPPTRALPGTG-TSSGMPHAAVNADRLADEEDGRPTGLRSSDASQRRIPGPAL  353

Query  599  S--SGSKQKGPV-HDSTMskglsssniiqssgssrrpavsSIRDSVTAGVESDPSRTRAA  429
            +  S S+QK P+ +D+++++  S+SN+   S  S R    S         ESD  R R  
Sbjct  354  NSLSLSRQKNPIANDASLTRETSNSNMYGRSAGSSRRVAVSSSRDAFGRSESD-IRPR--  410

Query  428  DTTHASPGAIPKMISTAERSSPVIFDNKCSSSTRN--SNIKNIESTLKGIEGL  276
             TT ASPG     IS+  R SPV    + S  TR   S   N E+T+KGIEGL
Sbjct  411  -TTDASPGG--HRISSGRRRSPV----ESSDPTRRHTSQTGNYETTVKGIEGL  456



>ref|XP_006390628.1| hypothetical protein EUTSA_v10018502mg [Eutrema salsugineum]
 gb|ESQ27914.1| hypothetical protein EUTSA_v10018502mg [Eutrema salsugineum]
Length=366

 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 77/181 (43%), Positives = 109/181 (60%), Gaps = 19/181 (10%)
 Frame = -3

Query  779  YQQSQLPSPPSCGHG-GIGATSSGMPHTAANVDKQTGGEEGLPTGWSSGNLVNSRNTGLV  603
            YQQSQ+ +PP   HG G+G  SSG+P   A+ ++ +GG+E  P+G +SGN    R++G +
Sbjct  194  YQQSQISTPPPRQHGPGVGP-SSGLPPAIASAERPSGGDEARPSGCASGN--PRRSSGQI  250

Query  602  LSSGS--KQKGPVHDS----TMskglsssniiqssgssrrpavsSIRDSVTAGVESDPSR  441
             +SGS  KQK PV  S    +    LSSS+ ++++GSSRR AVSS RD+   G +S+PS 
Sbjct  251  FNSGSLAKQKTPVSSSDPAISKDVVLSSSSFLRATGSSRRAAVSSSRDAGVLGTDSEPSN  310

Query  440  TRAADTTHASPGAIPKMISTAERSSPVI--FDNKCSSSTR--NSNIKNIESTLKGIEGLS  273
             +  +     PG+         RSSP++   +NK SS +R   S +KN ES LKGIE L 
Sbjct  311  PQIFE-----PGSGSNTKMQGGRSSPIVSSENNKLSSPSRGNTSVMKNYESNLKGIESLH  365

Query  272  F  270
            F
Sbjct  366  F  366



>ref|XP_004507951.1| PREDICTED: casein kinase I isoform delta-like isoform X2 [Cicer 
arietinum]
Length=454

 Score = 66.2 bits (160),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 61/181 (34%), Positives = 89/181 (49%), Gaps = 24/181 (13%)
 Frame = -3

Query  779  YQQSQLPSPPSCGHGGIGATSSGMPHTAANVDKQTGGEEGLPTGWSSGNLVNSRNTGLVL  600
            YQQSQL +PP+   G    TSS MP    N D+ TG EEG P G  S           V 
Sbjct  295  YQQSQLATPPARAIGPSAGTSSAMPPAVTNADRHTGAEEGQPPGLVS-----------VD  343

Query  599  SSGSKQKGPVHDSTMskglsssniiqssgssrrpavsSIRDSVTAGVESDPSRTRAADTT  420
            SS  +  GP+ ++  S  +   +   S   +   +  +       G ES+  RTR A+  
Sbjct  344  SSRRRMSGPILNTLSSANVLGQSSGSSRRVAVSSSRDAF-----VGAESE-VRTRTAE--  395

Query  419  HASPGAIPKMISTAERSSPVIFDN--KCSSSTRN-SNIKNIESTLKGIEGLSFGNDEKSH  249
             ASPGA  +++   +RSSP+   +  + +   R+ S  KN +S L+G+EGL    DE++H
Sbjct  396  -ASPGAAHRILG-GQRSSPIGSSDPKRVAPVGRSASQAKNYDSALRGMEGLQLETDERTH  453

Query  248  Y  246
            Y
Sbjct  454  Y  454



>ref|XP_010428166.1| PREDICTED: casein kinase I-like [Camelina sativa]
 ref|XP_010428167.1| PREDICTED: casein kinase I-like [Camelina sativa]
 ref|XP_010428168.1| PREDICTED: casein kinase I-like [Camelina sativa]
Length=460

 Score = 66.2 bits (160),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 74/178 (42%), Positives = 104/178 (58%), Gaps = 19/178 (11%)
 Frame = -3

Query  779  YQQSQLPSPPSCGHG-GIGATSSGMPHTAANVDKQTGGEEGLPTGWSSGNLVNSRNTGLV  603
            YQQSQ+ +PP   HG G+G  SSG+P   A+ ++ +GG+E  P+GWSSG  +  R+   +
Sbjct  294  YQQSQISTPPPRHHGPGVGP-SSGLPPAIASAERPSGGDEARPSGWSSG--IPRRSPVQI  350

Query  602  LSSGSKQKGPVHDS---TMskglsssniiqssgssrrpavsSIRDSVTAGVESDPSRTRA  432
            L   S+QK PV      +    LSSS+ ++++GSSRR AVSS R++   G +S+PS  + 
Sbjct  351  L---SRQKAPVSSDPAISKDVVLSSSSFLRATGSSRRAAVSSSREAAVLGTDSEPSNPQI  407

Query  431  ADTTHASPGAIPKMISTAERSSPVIFD--NKCSSSTR--NSNIKNIESTLKGIEGLSF  270
             +    S   IP       RSSP++    NK SS TR   S +KN E+ LKGIE L F
Sbjct  408  FEAGSGSNSKIP-----IGRSSPIVSSEINKLSSPTRATTSVMKNYEANLKGIESLHF  460



>gb|AAF19807.1| casein kinase I-like protein [Brassica oleracea]
Length=426

 Score = 65.9 bits (159),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 62/180 (34%), Positives = 93/180 (52%), Gaps = 18/180 (10%)
 Frame = -3

Query  779  YQQSQLPSPPSCGHGGIGATSSGMPHTAANVDKQTGGEEGLPTGWSSGNLVNSRNTGLVL  600
            YQQSQL +PP     G+G  SSG+P   A+ ++ +GGEE   +GW SGN    R +G + 
Sbjct  255  YQQSQLSTPPRPNVPGVG-QSSGLPPAIASAERPSGGEEARTSGWPSGN--ARRISGQIF  311

Query  599  SSG--SKQKGPVHDSTMskglsssniiqssgssrrpavsSI---RDSVTAGVESDPSRTR  435
            +SG  +KQK PV            +      ++     +++   R++   G +S+PS  +
Sbjct  312  NSGNLAKQKAPVSSDPAISKNVMLSSSSFLRATGSSRRAAVSGSREAAVPGTDSEPSNPQ  371

Query  434  AADTTHASPGAIPKMISTAERSSPVI--FDNKCSSSTR--NSNIKNIESTL-KGIEGLSF  270
              +   A   + PK+     RSSP++   + K SS +R   S +KN ES L KGIEGL F
Sbjct  372  IIE---AGTSSNPKI--HGGRSSPIVSSENKKLSSPSRGNTSVMKNYESNLNKGIEGLHF  426



>ref|XP_006390629.1| hypothetical protein EUTSA_v10018502mg [Eutrema salsugineum]
 gb|ESQ27915.1| hypothetical protein EUTSA_v10018502mg [Eutrema salsugineum]
Length=466

 Score = 65.9 bits (159),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 77/181 (43%), Positives = 109/181 (60%), Gaps = 19/181 (10%)
 Frame = -3

Query  779  YQQSQLPSPPSCGHG-GIGATSSGMPHTAANVDKQTGGEEGLPTGWSSGNLVNSRNTGLV  603
            YQQSQ+ +PP   HG G+G  SSG+P   A+ ++ +GG+E  P+G +SGN    R++G +
Sbjct  294  YQQSQISTPPPRQHGPGVGP-SSGLPPAIASAERPSGGDEARPSGCASGN--PRRSSGQI  350

Query  602  LSSGS--KQKGPVHDS----TMskglsssniiqssgssrrpavsSIRDSVTAGVESDPSR  441
             +SGS  KQK PV  S    +    LSSS+ ++++GSSRR AVSS RD+   G +S+PS 
Sbjct  351  FNSGSLAKQKTPVSSSDPAISKDVVLSSSSFLRATGSSRRAAVSSSRDAGVLGTDSEPSN  410

Query  440  TRAADTTHASPGAIPKMISTAERSSPVI--FDNKCSSSTR--NSNIKNIESTLKGIEGLS  273
             +  +     PG+         RSSP++   +NK SS +R   S +KN ES LKGIE L 
Sbjct  411  PQIFE-----PGSGSNTKMQGGRSSPIVSSENNKLSSPSRGNTSVMKNYESNLKGIESLH  465

Query  272  F  270
            F
Sbjct  466  F  466



>emb|CDY53866.1| BnaC02g46250D [Brassica napus]
Length=446

 Score = 65.9 bits (159),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 62/180 (34%), Positives = 93/180 (52%), Gaps = 18/180 (10%)
 Frame = -3

Query  779  YQQSQLPSPPSCGHGGIGATSSGMPHTAANVDKQTGGEEGLPTGWSSGNLVNSRNTGLVL  600
            YQQSQL +PP     G+G  SSG+P   A+ ++ +GGEE   +GW SGN    R +G + 
Sbjct  275  YQQSQLSTPPRPNVPGVG-QSSGLPPAIASAERPSGGEEARTSGWPSGN--ARRISGQIF  331

Query  599  SSG--SKQKGPVHDSTMskglsssniiqssgssrrpavsSI---RDSVTAGVESDPSRTR  435
            +SG  +KQK PV            +      ++     +++   R++   G +S+PS  +
Sbjct  332  NSGNLAKQKAPVSSDPAISKNVMLSSSSFLRAAGSSRRAAVSGSREAAVPGTDSEPSNPQ  391

Query  434  AADTTHASPGAIPKMISTAERSSPVI--FDNKCSSSTR--NSNIKNIESTL-KGIEGLSF  270
              +   A   + PK+     RSSP++   + K SS +R   S +KN ES L KGIEGL F
Sbjct  392  IIE---AGTSSNPKI--HGGRSSPIVSSENKKLSSPSRGNTSVMKNYESNLNKGIEGLHF  446



>ref|XP_009127947.1| PREDICTED: casein kinase I isoform delta-like [Brassica rapa]
Length=465

 Score = 65.9 bits (159),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 62/180 (34%), Positives = 93/180 (52%), Gaps = 18/180 (10%)
 Frame = -3

Query  779  YQQSQLPSPPSCGHGGIGATSSGMPHTAANVDKQTGGEEG-LPTGWSSGNLVNSRNTGLV  603
            YQQSQL +PP     G+G  SSG+P    + ++ +GGEE    +GW SGN    R +G +
Sbjct  294  YQQSQLSTPPRPNVPGVG-QSSGLPPAITSAERPSGGEEARTSSGWPSGN--PRRISGQI  350

Query  602  LSSG--SKQKGPVHDSTMskglsssniiqssgssrrpavsSI---RDSVTAGVESDPSRT  438
             +SG  +KQK PV +          +      ++     +++   R++   G +S+PS  
Sbjct  351  FNSGNLAKQKAPVSNDPAISKDVMLSSSSFLRATGSSRRAAVSGSREAAVPGTDSEPSNP  410

Query  437  RAADTTHASPGAIPKMISTAERSSPVI--FDNKCSSSTR--NSNIKNIESTLKGIEGLSF  270
            +    T A   + PK+     RSSP++   + K SS +R   S +KN ES LKGIEGL F
Sbjct  411  Q---ITEAGTSSNPKI--HGGRSSPIVSSENKKLSSPSRGNTSVMKNYESNLKGIEGLHF  465



>emb|CDY49859.1| BnaA02g16080D [Brassica napus]
Length=465

 Score = 65.9 bits (159),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 62/180 (34%), Positives = 92/180 (51%), Gaps = 18/180 (10%)
 Frame = -3

Query  779  YQQSQLPSPPSCGHGGIGATSSGMPHTAANVDKQTGGEEG-LPTGWSSGNLVNSRNTGLV  603
            YQQSQL +PP     G+G  SSG+P    + ++ +GGEE    +GW SGN    R +G +
Sbjct  294  YQQSQLSTPPRPNVPGVG-QSSGLPPAITSAERPSGGEEARTSSGWPSGN--PRRISGQI  350

Query  602  LSSG--SKQKGPVHDSTMskglsssniiqssgssrrpavsSI---RDSVTAGVESDPSRT  438
             +SG  +KQK PV +          +      +      +++   R++   G +S+PS  
Sbjct  351  FNSGNLAKQKAPVSNDPAISKDVMLSSSSFLRAIGSSRRAAVSGSREAAVPGTDSEPSNP  410

Query  437  RAADTTHASPGAIPKMISTAERSSPVI--FDNKCSSSTR--NSNIKNIESTLKGIEGLSF  270
            +    T A   + PK+     RSSP++   + K SS +R   S +KN ES LKGIEGL F
Sbjct  411  Q---ITEAGTSSNPKI--HGGRSSPIVSSENKKLSSPSRGNTSVMKNYESNLKGIEGLHF  465



>ref|XP_002299898.2| hypothetical protein POPTR_0001s20450g [Populus trichocarpa]
 gb|EEE84703.2| hypothetical protein POPTR_0001s20450g [Populus trichocarpa]
Length=470

 Score = 65.5 bits (158),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 67/184 (36%), Positives = 97/184 (53%), Gaps = 14/184 (8%)
 Frame = -3

Query  779  YQQSQLPSPPSCGHGGIGATSSGMPHTAA-NVDKQTGGEEGLPTGWSSGNLVNSRNTGLV  603
            YQQSQ+ +PP+  HG     SSG+P   A N D+Q+GGEEG P   S  +    RN+G +
Sbjct  295  YQQSQIANPPTRAHGPGAGPSSGIPPPGANNADRQSGGEEGGPGWPSIDH-ARRRNSGPI  353

Query  602  LSSG--SKQKGPVHDSTMskglsssniiqssgssrrpavsSIRDSVTAGV--ESDPSRTR  435
            ++SG  SKQK PV +       ++ +      S        +  S  A +  +SDPSR R
Sbjct  354  VNSGNLSKQKSPVTNDLSLSKDATLSSSNFLRSIVSSRNPVVSSSRGAALGNDSDPSRPR  413

Query  434  AADTTHASPGAIPKMISTAERSSPVI-FDNKCSSSTRNSNIKNIESTLKGIEGLSFGNDE  258
              D +        +++   +RSS  +  + K SSS RN+NIK +ESTLKGIE L    + 
Sbjct  414  TTDASF-------EVLQNGQRSSAALSSEQKHSSSGRNTNIKTLESTLKGIESLHVNIEG  466

Query  257  KSHY  246
            + H+
Sbjct  467  RLHH  470



>ref|XP_004960993.1| PREDICTED: casein kinase I isoform delta-like isoform X1 [Setaria 
italica]
Length=474

 Score = 65.5 bits (158),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 64/187 (34%), Positives = 97/187 (52%), Gaps = 16/187 (9%)
 Frame = -3

Query  779  YQQSQLPS-PPSCGHGGIGATSSGMPHTAANVDKQTGGEEGLPTGWSSGNLVNSRNTGLV  603
            YQQSQ+ S PP      +G +S   P   AN ++ +G EEG  +GWS  +    +     
Sbjct  295  YQQSQMTSAPPRAIVPAVGQSSGMAP--VANNNRHSGNEEGRRSGWSDMDPTRRQVPPPA  352

Query  602  LSSGS--KQKGPV-HDSTMskglsssniiqssgssrrpavsSIRDSVTAGVESDPSRTRA  432
            +++GS  KQK PV H+ + SK    S+      SS      ++  S     E++ +R+R 
Sbjct  353  INAGSLAKQKSPVRHEQSTSKDAVFSSSTFLGRSSGSSRRPAVSSSREPSTEAEQTRSR-  411

Query  431  ADTTHASPGAIPKMISTAERSSPVIFDNKCSSSTRNS-----NIKNIESTLKGIEGLSFG  267
              TT ASPGA  +  S A R SP + D+  S  + +      N KN EST++G++GL+F 
Sbjct  412  --TTDASPGAFQR--SGAPRWSPQMLDSSDSRRSSSGRRHSSNPKNYESTIRGMQGLNFD  467

Query  266  NDEKSHY  246
             D++ HY
Sbjct  468  GDDRVHY  474



>gb|EMT18264.1| Casein kinase I isoform delta-like protein [Aegilops tauschii]
Length=472

 Score = 65.5 bits (158),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 66/185 (36%), Positives = 91/185 (49%), Gaps = 14/185 (8%)
 Frame = -3

Query  779  YQQSQLPSPP--SCGHGGIGATSSGMPHTAANVDKQTGGEEGLPTGWSSGNLVNSRNTGL  606
            YQQSQ+ S P    GHG   A  SG+       D Q+G  EG  +GWS+ +   +     
Sbjct  295  YQQSQIASAPPRVAGHG---AGPSGLTPPVLQNDSQSGAVEGRISGWSAMDRRRAPPPIA  351

Query  605  VLSSGSKQKGPVHDSTMskglsssniiqssgssrrpavsSIRDSVTAGVESD---PSRTR  435
             + + +KQK PV +        + +     G S   +  +   S    V SD   PSR+R
Sbjct  352  SVGTSNKQKAPVGNDAPISKDPAISGSNFLGRSSGSSRRAAVSSSRDAVASDTFEPSRSR  411

Query  434  AADTTHASPGAIPKMISTAERSSPV--IFDNKCSSSTRNSNIKNIESTLKGIEGLSFGND  261
               TT ASPGA  +  S A+RS PV      + SS+ ++   KN ES LKGIEGL+F  D
Sbjct  412  ---TTDASPGAF-RRTSGAQRSPPVDSAEPQRSSSALQSFQPKNYESALKGIEGLNFDGD  467

Query  260  EKSHY  246
            E++ Y
Sbjct  468  ERAQY  472



>ref|XP_010685356.1| PREDICTED: casein kinase I isoform delta-like [Beta vulgaris 
subsp. vulgaris]
Length=459

 Score = 65.1 bits (157),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 65/179 (36%), Positives = 97/179 (54%), Gaps = 19/179 (11%)
 Frame = -3

Query  779  YQQSQLPSPPSCGHGGIGATSSGMPHTAANVDKQTGGEEGLPTGWSSGNLVNSRNTGLVL  600
            YQQSQ+ +PP    G  G  SSG+PH A   D+Q G EEG P+ W S +    R     +
Sbjct  295  YQQSQIVAPPPRALGAAGP-SSGLPHGAN--DRQPGAEEGRPSNWLSADSSRRR-----M  346

Query  599  SSGSKQKGPVHD--STMskglsssniiqssgssrrpavsSIRDSVTAGVESDPSRTRAAD  426
            +S  KQK P  +  +     +  S+++++S S+RR A SS RD+V AG ++D SR    D
Sbjct  347  ASLPKQKSPAGNDPAAAKDPMLPSSLMRTSTSARRAAGSSSRDAVFAGSDADASRPATGD  406

Query  425  TTHASPGAIPKMISTAERSSPVIFDN--KCSSSTRNSNIKNIESTLKGIEGLSFGNDEK  255
             +        + +S+  R SP +     +  S+   SN  N+EST+K IEGL+  N+E+
Sbjct  407  PSL-------QKVSSGHRISPFVSSEHPRSFSARVASNEHNLESTIKKIEGLNVSNEER  458



>ref|XP_010531866.1| PREDICTED: casein kinase I isoform delta-like [Tarenaya hassleriana]
Length=462

 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 63/179 (35%), Positives = 93/179 (52%), Gaps = 20/179 (11%)
 Frame = -3

Query  779  YQQSQL-PSPPSCGHGGIGATSSGMPHTAANVDKQTGGEEGLPTGWSSGNLVNSRNTGLV  603
            YQQSQ+  +PP     G+G  SSG+P   A+ ++Q GG+E  P+GW+SG+    R++G +
Sbjct  295  YQQSQITATPPRPLRPGVGP-SSGLPPVIASAERQPGGDEARPSGWASGD--RRRSSGQI  351

Query  602  LSSG--SKQKGPVHDSTMskglsssniiqssgssrrpavsSI---RDSVTAG-VESDPSR  441
            L+SG  SKQK PV            +      +S     +++   R++   G  +S+PS 
Sbjct  352  LNSGSISKQKAPVSTDPSLSKDVMLSSSSFMRASGSSWRAAMPSGREAALVGTTDSEPSN  411

Query  440  TRAADTTHASPGAIPKMISTAERSSPVIFDNKCSSSTRN--SNIKNIESTLKGIEGLSF  270
             +    T A  G+ PK+I     S     +NK S S  N  S +KN ES LKG+E L F
Sbjct  412  PQ---VTEACLGSHPKIIHGVISS-----ENKLSPSGGNNTSVMKNYESNLKGMESLHF  462



>gb|KHG11372.1| hypothetical protein F383_02311 [Gossypium arboreum]
Length=459

 Score = 64.3 bits (155),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 65/181 (36%), Positives = 91/181 (50%), Gaps = 19/181 (10%)
 Frame = -3

Query  779  YQQSQLPSPPSCGHGGIGATSSGMPHTAANVDKQTGGEEGLPTGWSSGNLVNSRNT-GLV  603
            YQQSQL +P      G+G TSSGMP    N D+   G++    G S  +    R T G +
Sbjct  295  YQQSQLTTPARALGSGVG-TSSGMPPAIGNADRHAAGQDVQAAGMSPMDNSRRRTTSGPL  353

Query  602  LSSGS--KQKGPVHDSTMskglsssniiqssgssrrpavsSIRDSVTAGVESDPSRTRAA  429
            + SGS  KQK P+ +    K  + +     S           R++V+ G E DP R+R  
Sbjct  354  MYSGSFAKQKNPIANDPAIKDSAYTGQSGGSSKRASG-----REAVS-GSEFDPQRSR--  405

Query  428  DTTHASPGAIPKMISTAERSSPVIFDNKCSSSTRNSNIKNIESTLKGIEGLSFGNDEKSH  249
             TT ASPG   K ++  ++  PV   +    + RN+  KN E  LKGIEGL F +DE++ 
Sbjct  406  -TTEASPGH--KHLN--QQRGPVESSSDPKRTGRNT--KNYEVALKGIEGLQFESDERNQ  458

Query  248  Y  246
            Y
Sbjct  459  Y  459



>ref|XP_004513434.1| PREDICTED: casein kinase I isoform delta-like [Cicer arietinum]
Length=478

 Score = 63.2 bits (152),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 65/187 (35%), Positives = 90/187 (48%), Gaps = 18/187 (10%)
 Frame = -3

Query  779  YQQSQLPSPPSCGHGGIGATSSGMPHTAANVDKQTGGEEGL---PTGWSSGNLVNSRNTG  609
            YQQSQL +PP    G    TSSGMP    N D+QTG EEG    P G  S +  N R + 
Sbjct  295  YQQSQLATPPVRAIGPSPGTSSGMPPVMTNADRQTGREEGRHPPPHGLVSIDYSNGRMSE  354

Query  608  LVLSSG--SKQKGPVHDSTMskglsssniiqssgssrrpavsSI-----RDSVTAGVESD  450
             +L+S   SKQ+ PV         +  +   +       +   +     RD+    V+ D
Sbjct  355  PILNSSNISKQQNPVPSDAAVSKNAMLSSSANVLGESSGSSRRVALISSRDAFCC-VDLD  413

Query  449  PSRTRAADTTHASPGAIPKMISTAERSSPVIFDN--KCSSSTRN-SNIKNIESTLKGIEG  279
                R   TT A PGA  +  S+ +RSS +   N  + +SSTRN S++KN  + +K IEG
Sbjct  414  NLHAR---TTEAIPGAAHRN-SSWQRSSQIGTSNPKRVASSTRNGSHVKNYVTAVKSIEG  469

Query  278  LSFGNDE  258
            L    D+
Sbjct  470  LKIKKDD  476



>ref|XP_007019361.1| Casein kinase, putative [Theobroma cacao]
 gb|EOY16586.1| Casein kinase, putative [Theobroma cacao]
Length=129

 Score = 59.7 bits (143),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 58/128 (45%), Positives = 77/128 (60%), Gaps = 8/128 (6%)
 Frame = -3

Query  620  RNTGLVLSSGS--KQKGPVHDSTMskglsssniiqssgssrrpavsSIRDSVTAGVESDP  447
            R +G +++SGS  KQK PV +  +    S         SSRR AVSS RD+  AG E+DP
Sbjct  7    RTSGPLMNSGSNAKQKSPVANDPVITKDSMFMGQWGGSSSRRVAVSSSRDAF-AGSEADP  65

Query  446  SRTRAADTTHASPGAIPKMISTAERSSPVIFDNKCSSSTRN-SNIKNIESTLKGIEGLSF  270
             R+R  D   ASPGA+ K IS  ++S     D K + S RN S++KN E+ LKGIEGL F
Sbjct  66   QRSRRTD---ASPGALHK-ISRQQQSPVESADAKRTLSGRNTSHVKNYETALKGIEGLQF  121

Query  269  GNDEKSHY  246
             +D++ HY
Sbjct  122  ESDDRVHY  129



>gb|KHN35865.1| Casein kinase I isoform delta-like [Glycine soja]
Length=443

 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 61/169 (36%), Positives = 80/169 (47%), Gaps = 24/169 (14%)
 Frame = -3

Query  779  YQQSQLPSPPSCGHGGIGATSSGMPHTAANVDKQTGGEEGLPTGWSSGNLVNSRNTGLVL  600
            YQQSQL +PP+   G    TSS +P    N D+QTG EEG P G  SG+    R TG + 
Sbjct  295  YQQSQLAAPPARAIGPNVGTSSALPPAVTNADRQTGEEEGRPPGLVSGDSTRRRMTGPIP  354

Query  599  SSG--SKQKGPVHDSTMskglsssniiqssgssrrpavsSIRDSVTAGVESDPS-RTRAA  429
            +S   SKQK PV         +  +     G S     +++  S  A V SD   RTR  
Sbjct  355  NSVNISKQKNPVTTDAALNKEAMLSRPNVLGQSSGSRRAAVSSSRDAFVGSDLDLRTR--  412

Query  428  DTTHASPGAIPKMISTAERSSPVIFDNKCSSSTRN-SNIKNIESTLKGI  285
             TT  +PG  PK                 +SS RN S++K+ E+ +KGI
Sbjct  413  -TTETNPGTAPK-----------------TSSVRNASHVKSYETAVKGI  443



>ref|XP_011009743.1| PREDICTED: casein kinase I isoform delta-like isoform X2 [Populus 
euphratica]
Length=398

 Score = 62.8 bits (151),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 38/72 (53%), Positives = 48/72 (67%), Gaps = 3/72 (4%)
 Frame = -3

Query  779  YQQSQLPSPPSCGHGGIGATSSGMPHTAANVDKQTGGEEGLPTGWSSGNLVNSRNTGLVL  600
            YQQSQ  +PP+   G     SSG+P  A NVD+Q+GGEEG P GWSS +    RN+G ++
Sbjct  295  YQQSQSANPPTRALGPGAGPSSGIPPGANNVDRQSGGEEGRP-GWSSTDHARRRNSGPIV  353

Query  599  SSG--SKQKGPV  570
            +SG  SKQK PV
Sbjct  354  NSGNLSKQKSPV  365



>ref|XP_008650083.1| PREDICTED: casein kinase I isoform delta-like [Zea mays]
Length=474

 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 62/187 (33%), Positives = 99/187 (53%), Gaps = 16/187 (9%)
 Frame = -3

Query  779  YQQSQLP-SPPSCGHGGIGATSSGMPHTAANVDKQTGGEEGLPTGWSSGNLVNSRNTGLV  603
            YQQ+Q+  +PP      +G +S   P   AN ++ +G EEG  +GWS  + +  +    V
Sbjct  295  YQQAQMTTAPPRAIAPAVGQSSGMAP--VANNNRHSGTEEGRRSGWSDMDPMRRQAPPPV  352

Query  602  LSSGS--KQKGPVH-DSTMskglsssniiqssgssrrpavsSIRDSVTAGVESDPSRTRA  432
            +++GS  KQK PV  +++ SK    S+      SS      ++  S     E++ +R+R 
Sbjct  353  INAGSLAKQKSPVRPETSTSKDAVFSSSTFLGRSSGSSRRPAVSSSRELSTEAEQTRSR-  411

Query  431  ADTTHASPGAIPKMISTAERSSPVIFDNKCSSSTRNS-----NIKNIESTLKGIEGLSFG  267
              TT ASPGA  +  S A R SP + D+     + +S     N KN EST++G++GL+F 
Sbjct  412  --TTDASPGAFQR--SGAPRWSPQMPDSSDGRRSSSSRRHSSNPKNYESTIRGMQGLNFD  467

Query  266  NDEKSHY  246
             D++ HY
Sbjct  468  GDDRVHY  474



>ref|XP_010537581.1| PREDICTED: casein kinase I [Tarenaya hassleriana]
 ref|XP_010537582.1| PREDICTED: casein kinase I [Tarenaya hassleriana]
Length=463

 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 64/178 (36%), Positives = 92/178 (52%), Gaps = 17/178 (10%)
 Frame = -3

Query  779  YQQSQLPSPPSCGHGGIGATSSGMPHTAANVDKQTGGEEGLPTGWSSGNLVNSRNTGLVL  600
            YQQSQ+ +PP     G+G +S   P   A+ +KQ+G EE    GWSSG+   S  +G +L
Sbjct  295  YQQSQIATPPRPLGPGVGPSSGQRP-VIASAEKQSGDEEA-RPGWSSGDRRCS--SGQIL  350

Query  599  SSG--SKQKGPVHDSTMskglsssniiqssgssrrpavsSI---RDSVTAGVESDPSRTR  435
            +SG  SKQK PV            +      +S     +++   R++   G +S+PS  +
Sbjct  351  NSGSISKQKAPVSTDPALSKDVMLSSSSFLRASGSSRRAAMSSGREAALVGTDSEPSNPQ  410

Query  434  AADTTHASPGAIPKMISTAERSSPVI-FDNKCSSSTRN--SNIKNIESTLKGIEGLSF  270
              +   A  G+ P++     RSSP++  + K S S RN  S IKN ES LKGIE L F
Sbjct  411  VPE---AGSGSHPRI--HGGRSSPIVSTEKKLSPSGRNATSVIKNHESNLKGIESLHF  463



>gb|KEH32501.1| casein kinase I-like protein [Medicago truncatula]
Length=454

 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 61/181 (34%), Positives = 87/181 (48%), Gaps = 24/181 (13%)
 Frame = -3

Query  779  YQQSQLPSPPSCGHGGIGATSSGMPHTAANVDKQTGGEEGLPTGWSSGNLVNSRNTGLVL  600
            YQQSQL +PP+ G      TSS +P    N D+ TG  EG P G  S           V 
Sbjct  295  YQQSQLATPPARGIVPGAGTSSALPPAVTNADRHTGA-EGQPPGLVS-----------VD  342

Query  599  SSGSKQKGPVHDSTMskglsssniiqssgssrrpavsSIRDSVTAGVESDPSRTRAADTT  420
            SS  +  GP+ ++  S  +   +   S   +   +  +       G ESD  RTR A+  
Sbjct  343  SSRRRMSGPILNTLSSSNVLGQSSGSSRRVAVSSSRDAF-----VGAESD-VRTRTAE--  394

Query  419  HASPGAIPKMISTAERSSPVIFDN--KCSSSTRN-SNIKNIESTLKGIEGLSFGNDEKSH  249
             ASPGA    I + +RSS +   +  + + + RN S   N ES L+G++GL   NDE++H
Sbjct  395  -ASPGAAAHRILSGQRSSLIGSSDPQRVARAGRNASQGNNYESALRGMDGLQLENDERTH  453

Query  248  Y  246
            Y
Sbjct  454  Y  454



>ref|NP_001136682.1| uncharacterized protein LOC100216812 [Zea mays]
 ref|XP_008654480.1| PREDICTED: uncharacterized protein LOC100216812 isoform X1 [Zea 
mays]
 gb|ACF82392.1| unknown [Zea mays]
Length=132

 Score = 57.8 bits (138),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 39/72 (54%), Positives = 47/72 (65%), Gaps = 6/72 (8%)
 Frame = -3

Query  455  SDPSRTRAADTTHASPGAIPKMISTAERSSPV-IFDNKCSSSTRN-SNIKNIESTLKGIE  282
            S+PSR RA D   ASPGA  +  S  +RSSPV   + K SSS R+ SN+KN +S LKGIE
Sbjct  65   SEPSRARATD---ASPGAF-RRASGPQRSSPVHSAEQKRSSSGRHPSNVKNYDSALKGIE  120

Query  281  GLSFGNDEKSHY  246
            GL F  DE+  Y
Sbjct  121  GLHFDGDERVQY  132



>ref|XP_010497256.1| PREDICTED: casein kinase I isoform delta-like, partial [Camelina 
sativa]
Length=196

 Score = 58.5 bits (140),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 35/73 (48%), Positives = 49/73 (67%), Gaps = 6/73 (8%)
 Frame = -3

Query  779  YQQSQLPSPPSCGHG-GIGATSSGMPHTAANVDKQTGGEEGLPTGWSSGNLVNSRNTGLV  603
            YQQSQ+ +PP   HG G+G  SSG+P   A+ ++ +GG+E  P+GWSSG  +  R+ G +
Sbjct  114  YQQSQISTPPPRHHGPGVGP-SSGLPPAIASAERPSGGDEARPSGWSSG--IPRRSPGPI  170

Query  602  LSSG--SKQKGPV  570
             +SG  SKQK PV
Sbjct  171  FNSGSLSKQKAPV  183



>dbj|BAD45138.1| protein kinase ADK1-like [Oryza sativa Japonica Group]
Length=269

 Score = 59.7 bits (143),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 62/188 (33%), Positives = 89/188 (47%), Gaps = 20/188 (11%)
 Frame = -3

Query  779  YQQSQLPSPPSCGHGGIGATSSGMPHTAANVDKQTGGEEGLPTGWSSG-NLVNSRNTGLV  603
            YQQSQ+ S P          SSGM    AN ++ +  EEG  +GWS          TG+ 
Sbjct  92   YQQSQITSVPPRAIAAAAGQSSGM-SPIANNNRLSATEEGRRSGWSDDPTRRQVPPTGIN  150

Query  602  LSSGSKQKGPVH-------DSTMskglsssniiqssgssrrpavsSIRDSVTAGVESDPS  444
              S SKQK PV        D+  S          S       +   ++ S     E++PS
Sbjct  151  AGSLSKQKSPVRPDMSTSKDALFSSSTMLGRSSGSLRRPVVSSSRELQSS-----EAEPS  205

Query  443  RTRAADTTHASPGAIPKMISTAERSSPVI--FDNKCSSSTRNSNIKNIESTLKGIEGLSF  270
            R+R  D   ASPG   +  +   RSS ++   D + SSS R++  KN EST++GI+GL+F
Sbjct  206  RSRTPD---ASPGTFQRS-APPRRSSQMLDYSDPRHSSSGRHAANKNYESTIRGIQGLNF  261

Query  269  GNDEKSHY  246
              +++ HY
Sbjct  262  DANDRIHY  269



>gb|ACT34059.1| putative protein kinase [Aegilops tauschii]
Length=474

 Score = 60.1 bits (144),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 67/191 (35%), Positives = 100/191 (52%), Gaps = 24/191 (13%)
 Frame = -3

Query  779  YQQSQLPSPPSCGHGGIGATSSGMPHTAANVDKQTGGEEGLPTGWSSGNLVNSRNTGLVL  600
            YQQSQ+ S P          SSGM   A   ++Q+  EEG  +GWS  + +  +     +
Sbjct  295  YQQSQMTSAPPRAMAAAAGQSSGM---APMANRQSATEEGRRSGWSDMDGMRRQVPPPAI  351

Query  599  SSGS--KQKGPV-HDSTMskglsssniiqssgssrrpavsSIRDSVTAGVESDPSRTRAA  429
            ++GS  KQK P+ HD + SK    S+      SS      ++  S     +++ +R+R  
Sbjct  352  NAGSLAKQKSPIRHDQSTSKDAIFSSSTLLGRSSGSSRRPAVSSSREPSTDAEQTRSR--  409

Query  428  DTTHASPGAIPKMISTAERSSPVIFDNKCSSSTR---------NSNIKNIESTLKGIEGL  276
             TT ASPGA  +  S+A R SP + D   SS TR         +S+ KN EST++GI+GL
Sbjct  410  -TTDASPGAFQR--SSAPRWSPQVGD---SSDTRGRSSSGRHQSSSAKNYESTVRGIQGL  463

Query  275  SF-GNDEKSHY  246
            +F G+D ++HY
Sbjct  464  NFDGDDNRNHY  474



>ref|XP_010232213.1| PREDICTED: casein kinase I-like [Brachypodium distachyon]
Length=471

 Score = 60.1 bits (144),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 76/182 (42%), Positives = 100/182 (55%), Gaps = 13/182 (7%)
 Frame = -3

Query  779  YQQSQLPS-PPSCGHGGIGATSSGM-PHTAANVDKQTGGEEGLPTGWSSGNLVNSRNTGL  606
            YQQSQ+ S PP  G  G  A  SG+ P      D Q+G  +G  +GWS+ +   +     
Sbjct  295  YQQSQIASAPPRVG--GHAAGPSGLTPPALLQNDSQSGAVDGRISGWSAMDRRRAPPPIA  352

Query  605  VLSSGSKQKGPV-HDSTMsk--glsssniiqssgssrrpavsSIRDSVTAGVESDPSRTR  435
             + + +KQK PV +D+ +SK   +S SN +  S  S R A  S    V A    +PSR+R
Sbjct  353  SVGTLTKQKAPVGNDAPISKDPAISGSNFLGRSSGSSRRAAVSSSRDVVASDTYEPSRSR  412

Query  434  AADTTHASPGAIPKMISTAERSSPVI-FDNKCSSSTRNS-NIKNIESTLKGIEGLSFGND  261
               TT ASPGA  +  S  +RS PV   + K SSS R+S N KN ES LKGIEGL+F  D
Sbjct  413  ---TTDASPGAF-RRTSGPQRSPPVDSAEPKRSSSARHSSNTKNYESALKGIEGLNFEGD  468

Query  260  EK  255
            E+
Sbjct  469  ER  470



>ref|XP_006413231.1| hypothetical protein EUTSA_v10025148mg [Eutrema salsugineum]
 gb|ESQ54684.1| hypothetical protein EUTSA_v10025148mg [Eutrema salsugineum]
Length=461

 Score = 60.1 bits (144),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 63/181 (35%), Positives = 89/181 (49%), Gaps = 18/181 (10%)
 Frame = -3

Query  779  YQQSQLPSPPSCGHGGIGATSSGMPHTAANVDKQTGGEEGLPTGWSSGNLVNSRNTGLVL  600
            YQQS+L +PPS        TS+ +P   +N+D+ TG EEG P G+S       R +G + 
Sbjct  295  YQQSKLTAPPSRSLNPAVGTSAALPPGISNIDRYTGEEEGRPVGFSHTESSRRRVSGALD  354

Query  599  SSG---SKQKGPVHDSTMskglsssniiqssgssrrpavsSIRDSVTAGVESDPSRTRAA  429
            +SG   ++Q   +   +M    SS     +  S R  AVSS RD+   G E   SRT   
Sbjct  355  NSGNLSNQQTSSITRDSMQIPSSSLFAQSAGSSRRVTAVSSSRDNYVGGEELQRSRT--G  412

Query  428  DTTHASPGAIPKMISTAERSSPVIFDNKCSSSTRNSNIKNIESTLKGIEGLSFGNDEKSH  249
            D +    G IP       R+SPV    + SSSTR    +  ES +KGI+ L   +D+  H
Sbjct  413  DVSRG--GMIP-------RNSPVEAAKRSSSSTR----RQYESAIKGIDTLQVSDDKTHH  459

Query  248  Y  246
            +
Sbjct  460  H  460



>gb|KCW69785.1| hypothetical protein EUGRSUZ_F03150 [Eucalyptus grandis]
Length=433

 Score = 56.2 bits (134),  Expect(2) = 5e-07, Method: Compositional matrix adjust.
 Identities = 32/72 (44%), Positives = 43/72 (60%), Gaps = 2/72 (3%)
 Frame = -3

Query  779  YQQSQLPSPPSCGHGGIGATSSGMPHTAANVDKQTGGEEGLPTGWSSGNLVNSRNTGLVL  600
            YQQSQ+ +PPS   G     SSG+P    N ++Q+GGE+G P  WS G     R++G + 
Sbjct  295  YQQSQIATPPSRALGNGAGPSSGVPPAVNNTERQSGGEDGRPAAWSLGEPSRRRHSGPIA  354

Query  599  SSGS--KQKGPV  570
            +SGS  K K PV
Sbjct  355  TSGSLLKPKNPV  366


 Score = 25.0 bits (53),  Expect(2) = 5e-07, Method: Compositional matrix adjust.
 Identities = 20/42 (48%), Positives = 22/42 (52%), Gaps = 3/42 (7%)
 Frame = -1

Query  541  LVQILSNQAVHQGDLLCLASVIV*LLGLNLTPRAPGQQIQLM  416
            LVQI   QAVHQG L  LA   V +LG +     P   I LM
Sbjct  395  LVQISCGQAVHQGSLQLLA---VGMLGFSRVSWMPLTVIPLM  433



>gb|EEC70925.1| hypothetical protein OsI_02496 [Oryza sativa Indica Group]
Length=472

 Score = 59.7 bits (143),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 63/191 (33%), Positives = 88/191 (46%), Gaps = 26/191 (14%)
 Frame = -3

Query  779  YQQSQLPSPPSCGHGGIGATSSGMPHTAANVDKQTGGEEGLPTGWSSGNLVNSRN---TG  609
            YQQSQ+ S P          SSGM   A N ++ +  EEG  +GWS       R    TG
Sbjct  295  YQQSQITSVPPRAIAAAAGQSSGMSPIAIN-NRLSATEEGRRSGWSDDP--TRRQVPPTG  351

Query  608  LVLSSGSKQKGPVH-------DSTMskglsssniiqssgssrrpavsSIRDSVTAGVESD  450
            +   S SKQK PV        D+  S          S       +   ++ S     E++
Sbjct  352  INAGSLSKQKSPVRPDMSTSKDALFSSSTMLGRSSGSLRRPVVSSSRELQSS-----EAE  406

Query  449  PSRTRAADTTHASPGAIPKMISTAERSSPVIFDN---KCSSSTRNSNIKNIESTLKGIEG  279
            PSR+R  D   ASPG   +  S   R S  + D    + SSS R++  KN EST++GI+G
Sbjct  407  PSRSRTPD---ASPGTFQR--SAPPRRSSQMLDYSDPRHSSSGRHAANKNYESTIRGIQG  461

Query  278  LSFGNDEKSHY  246
            L+F  +++ HY
Sbjct  462  LNFDANDRIHY  472



>ref|XP_003567780.1| PREDICTED: casein kinase I-like [Brachypodium distachyon]
Length=473

 Score = 59.7 bits (143),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 63/186 (34%), Positives = 93/186 (50%), Gaps = 15/186 (8%)
 Frame = -3

Query  779  YQQSQLPSPPSCGHGGIGATSSGMPHTAANVDKQTGGEEGLPTGWSSGNLVNSRNTGLVL  600
            YQQSQ+ S P          SSGM   A N  +Q+  EEG  +GWS  + +  +     +
Sbjct  295  YQQSQMTSAPPRIMVPPAGQSSGMAPMANN--RQSATEEGRRSGWSDMDGMRRQVPPPAI  352

Query  599  SSGS--KQKGPV-HDSTMskglsssniiqssgssrrpavsSIRDSVTAGVESDPSRTRAA  429
            ++GS  KQK P+ HD + SK    S+      SS      ++  S     ++D +R+R  
Sbjct  353  NAGSLAKQKSPIRHDQSTSKEAVFSSSTFLGRSSGSSRRPAVSSSREPSTDADQTRSR--  410

Query  428  DTTHASPGAIPKMISTAERSSPVI-----FDNKCSSSTRNSNIKNIESTLKGIEGLSFGN  264
             TT ASPGA  +  S   R SP +          S    +S+ KN EST++GI+GL+F  
Sbjct  411  -TTDASPGAFQR--SAVPRWSPQMADSSDTRRSSSGRHPSSSAKNYESTVRGIQGLNFDG  467

Query  263  DEKSHY  246
            D+++HY
Sbjct  468  DDRNHY  473



>ref|XP_009400540.1| PREDICTED: casein kinase I-like isoform X1 [Musa acuminata subsp. 
malaccensis]
Length=471

 Score = 59.3 bits (142),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 35/72 (49%), Positives = 48/72 (67%), Gaps = 5/72 (7%)
 Frame = -3

Query  458  ESDPSRTRAADTTHASPGAIPKMISTAERSSPVI-FDNKCSSSTRNSNIKNIESTLKGIE  282
            E+D SRT  A+    SPG   K +S+++R SP    + KC+S+ RN NIKN ESTLKGI+
Sbjct  404  EADLSRTSTAEV---SPGTFRK-VSSSQRGSPFSSLEPKCTSAGRNPNIKNYESTLKGIQ  459

Query  281  GLSFGNDEKSHY  246
             LSF ++E+  Y
Sbjct  460  RLSFDDEERIQY  471



>ref|XP_009400542.1| PREDICTED: casein kinase I isoform delta-like isoform X3 [Musa 
acuminata subsp. malaccensis]
Length=379

 Score = 59.3 bits (142),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 35/72 (49%), Positives = 48/72 (67%), Gaps = 5/72 (7%)
 Frame = -3

Query  458  ESDPSRTRAADTTHASPGAIPKMISTAERSSPVI-FDNKCSSSTRNSNIKNIESTLKGIE  282
            E+D SRT  A+    SPG   K +S+++R SP    + KC+S+ RN NIKN ESTLKGI+
Sbjct  312  EADLSRTSTAEV---SPGTFRK-VSSSQRGSPFSSLEPKCTSAGRNPNIKNYESTLKGIQ  367

Query  281  GLSFGNDEKSHY  246
             LSF ++E+  Y
Sbjct  368  RLSFDDEERIQY  379



>ref|XP_009400541.1| PREDICTED: casein kinase I isoform delta-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=404

 Score = 59.3 bits (142),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 35/72 (49%), Positives = 48/72 (67%), Gaps = 5/72 (7%)
 Frame = -3

Query  458  ESDPSRTRAADTTHASPGAIPKMISTAERSSPVI-FDNKCSSSTRNSNIKNIESTLKGIE  282
            E+D SRT  A+    SPG   K +S+++R SP    + KC+S+ RN NIKN ESTLKGI+
Sbjct  337  EADLSRTSTAEV---SPGTFRK-VSSSQRGSPFSSLEPKCTSAGRNPNIKNYESTLKGIQ  392

Query  281  GLSFGNDEKSHY  246
             LSF ++E+  Y
Sbjct  393  RLSFDDEERIQY  404



>ref|NP_001043372.1| Os01g0570500 [Oryza sativa Japonica Group]
 dbj|BAD45137.1| putative protein kinase ADK1 [Oryza sativa Japonica Group]
 dbj|BAF05286.1| Os01g0570500 [Oryza sativa Japonica Group]
 dbj|BAG99373.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE54833.1| hypothetical protein OsJ_02280 [Oryza sativa Japonica Group]
Length=472

 Score = 59.3 bits (142),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 63/191 (33%), Positives = 88/191 (46%), Gaps = 26/191 (14%)
 Frame = -3

Query  779  YQQSQLPSPPSCGHGGIGATSSGMPHTAANVDKQTGGEEGLPTGWSSGNLVNSRN---TG  609
            YQQSQ+ S P          SSGM   A N ++ +  EEG  +GWS       R    TG
Sbjct  295  YQQSQITSVPPRAIAAAAGQSSGMSPIANN-NRLSATEEGRRSGWSDDP--TRRQVPPTG  351

Query  608  LVLSSGSKQKGPVH-------DSTMskglsssniiqssgssrrpavsSIRDSVTAGVESD  450
            +   S SKQK PV        D+  S          S       +   ++ S     E++
Sbjct  352  INAGSLSKQKSPVRPDMSTSKDALFSSSTMLGRSSGSLRRPVVSSSRELQSS-----EAE  406

Query  449  PSRTRAADTTHASPGAIPKMISTAERSSPVIFDN---KCSSSTRNSNIKNIESTLKGIEG  279
            PSR+R  D   ASPG   +  S   R S  + D    + SSS R++  KN EST++GI+G
Sbjct  407  PSRSRTPD---ASPGTFQR--SAPPRRSSQMLDYSDPRHSSSGRHAANKNYESTIRGIQG  461

Query  278  LSFGNDEKSHY  246
            L+F  +++ HY
Sbjct  462  LNFDANDRIHY  472



>ref|XP_002441634.1| hypothetical protein SORBIDRAFT_09g030690 [Sorghum bicolor]
 gb|EES20064.1| hypothetical protein SORBIDRAFT_09g030690 [Sorghum bicolor]
Length=474

 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 62/186 (33%), Positives = 95/186 (51%), Gaps = 14/186 (8%)
 Frame = -3

Query  779  YQQSQLPSPPSCGHGGIGATSSGMPHTAANVDKQTGGEEGLPTGWSSGNLVNSRNTGLVL  600
            YQQ+Q+ + P+         SSGM   A N ++ +G EEG  +GWS  +    +    V+
Sbjct  295  YQQAQMTTAPTRAIAPPVGQSSGMAPVANN-NRHSGTEEGRRSGWSDMDPTRRQAPPPVI  353

Query  599  SSGS--KQKGPVH-DSTMskglsssniiqssgssrrpavsSIRDSVTAGVESDPSRTRAA  429
            ++GS  KQK PV  +++ SK    S+      SS      ++  S     E++ +R+R  
Sbjct  354  NAGSLAKQKSPVRPETSTSKDAVFSSSTFLGRSSGSSRRPAVSSSREPSTEAEQTRSR--  411

Query  428  DTTHASPGAIPKMISTAERSSPVI-----FDNKCSSSTRNSNIKNIESTLKGIEGLSFGN  264
             TT ASPGA  +  S A R SP +          S    +SN KN EST++G++GL+F  
Sbjct  412  -TTDASPGAFQR--SGAPRWSPQMPDSSDGRRSSSGRRHSSNPKNYESTIRGMQGLNFDG  468

Query  263  DEKSHY  246
            D++ HY
Sbjct  469  DDRVHY  474



>gb|KDO65165.1| hypothetical protein CISIN_1g010674mg [Citrus sinensis]
Length=404

 Score = 58.5 bits (140),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 37/72 (51%), Positives = 46/72 (64%), Gaps = 3/72 (4%)
 Frame = -3

Query  779  YQQSQLPSPPSCGHGGIGATSSGMPHTAANVDKQTGGEEGLPTGWSSGNLVNSRNTGLVL  600
            YQQSQ+ +P      G G  SSGMP  AANVD+Q+G EEG  TGWSS +    RN+G + 
Sbjct  295  YQQSQVSTPARAIGPGAGP-SSGMPPAAANVDRQSGAEEGRHTGWSSADPSRRRNSGPLG  353

Query  599  SSG--SKQKGPV  570
            +S   SKQK P+
Sbjct  354  NSANLSKQKSPM  365



>ref|XP_006413230.1| hypothetical protein EUTSA_v10025148mg [Eutrema salsugineum]
 gb|ESQ54683.1| hypothetical protein EUTSA_v10025148mg [Eutrema salsugineum]
Length=460

 Score = 57.0 bits (136),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 59/181 (33%), Positives = 84/181 (46%), Gaps = 19/181 (10%)
 Frame = -3

Query  779  YQQSQLPSPPSCGHGGIGATSSGMPHTAANVDKQTGGEEGLPTGWSSGNLVNSRNTGLVL  600
            YQQS+L +PPS        TS+ +P   +N+D+ TG EEG P G+S       R +G + 
Sbjct  295  YQQSKLTAPPSRSLNPAVGTSAALPPGISNIDRYTGEEEGRPVGFSHTESSRRRVSGALD  354

Query  599  SSG---SKQKGPVHDSTMskglsssniiqssgssrrpavsSIRDSVTAGVESDPSRTRAA  429
            +SG   ++Q   +   +M    S       S        SS RD+   G E   SRT   
Sbjct  355  NSGNLSNQQTSSITRDSMIPSSSLFAQSAGSSRRVTAVSSS-RDNYVGGEELQRSRT--G  411

Query  428  DTTHASPGAIPKMISTAERSSPVIFDNKCSSSTRNSNIKNIESTLKGIEGLSFGNDEKSH  249
            D +    G IP       R+SPV    + SSSTR    +  ES +KGI+ L   +D+  H
Sbjct  412  DVSRG--GMIP-------RNSPVEAAKRSSSSTR----RQYESAIKGIDTLQVSDDKTHH  458

Query  248  Y  246
            +
Sbjct  459  H  459



>gb|AAF19801.1| CK1a protein [Brassica oleracea]
Length=333

 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 56/181 (31%), Positives = 82/181 (45%), Gaps = 20/181 (11%)
 Frame = -3

Query  779  YQQSQLPSPPSCGHGGIGATSSGMPHTAANVDKQTGGEEGLPTGWSSGNLVNSRNTGLVL  600
            YQQSQL +PPS        TS+ +P   +N+D+ TG EEG P G+S       R +G + 
Sbjct  168  YQQSQLTAPPSRNLNPAVGTSAALPPGVSNIDRYTGEEEGRPVGYSHMESSRRRASGTLD  227

Query  599  SSGS---KQKGPVHDSTMskglsssniiqssgssrrpavsSIRDSVTAGVESDPSRTRAA  429
             SG+   +Q    +  +M    S       S        S  RD++ +G E      R+ 
Sbjct  228  HSGNLSNQQTSSFNRDSMMPSSSMFAQSAGSSRRVAAVSS--RDNLLSGEEFQ----RSH  281

Query  428  DTTHASPGAIPKMISTAERSSPVIFDNKCSSSTRNSNIKNIESTLKGIEGLSFGNDEKSH  249
             T   S G +        R+SPV    + SSS R+      ES +KGI+ L   +D+K H
Sbjct  282  RTGDVSRGGV------ISRNSPVEAGKRSSSSRRH-----YESAIKGIDNLQVSSDDKFH  330

Query  248  Y  246
            +
Sbjct  331  H  331



>emb|CDY69293.1| BnaA01g35300D, partial [Brassica napus]
Length=348

 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 56/181 (31%), Positives = 82/181 (45%), Gaps = 20/181 (11%)
 Frame = -3

Query  779  YQQSQLPSPPSCGHGGIGATSSGMPHTAANVDKQTGGEEGLPTGWSSGNLVNSRNTGLVL  600
            YQQSQL +PPS        TS+ +P   +N+D+ TG EEG P G+S       R +G + 
Sbjct  183  YQQSQLTAPPSRNLNPAVGTSAALPPGVSNIDRYTGEEEGRPVGYSHMESSRRRASGTLD  242

Query  599  SSGS---KQKGPVHDSTMskglsssniiqssgssrrpavsSIRDSVTAGVESDPSRTRAA  429
             SG+   +Q    +  +M    S       S        S  RD++ +G E      R+ 
Sbjct  243  HSGNLSNQQTSSFNRDSMMPSSSMFAQSAGSSRRVAAVSS--RDNLLSGEEFQ----RSH  296

Query  428  DTTHASPGAIPKMISTAERSSPVIFDNKCSSSTRNSNIKNIESTLKGIEGLSFGNDEKSH  249
             T   S G +        R+SPV    + SSS R+      ES +KGI+ L   +D+K H
Sbjct  297  RTGDVSRGGV------ISRNSPVEAGKRSSSSRRH-----YESAIKGIDNLQVSSDDKFH  345

Query  248  Y  246
            +
Sbjct  346  H  346



>emb|CDX94377.1| BnaC01g18070D [Brassica napus]
Length=460

 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 56/181 (31%), Positives = 82/181 (45%), Gaps = 20/181 (11%)
 Frame = -3

Query  779  YQQSQLPSPPSCGHGGIGATSSGMPHTAANVDKQTGGEEGLPTGWSSGNLVNSRNTGLVL  600
            YQQSQL +PPS        TS+ +P   +N+D+ TG EEG P G+S       R +G + 
Sbjct  295  YQQSQLTAPPSRNLNPAVGTSAALPPGVSNIDRYTGEEEGRPVGYSHMESSRRRASGTLD  354

Query  599  SSG---SKQKGPVHDSTMskglsssniiqssgssrrpavsSIRDSVTAGVESDPSRTRAA  429
             SG   ++Q    +  +M    S       S        S  RD++ +G E      R+ 
Sbjct  355  HSGNLSNQQTSSFNRESMMPSSSMFAQSAGSSRRVAAVSS--RDNLLSGEEFQ----RSH  408

Query  428  DTTHASPGAIPKMISTAERSSPVIFDNKCSSSTRNSNIKNIESTLKGIEGLSFGNDEKSH  249
             T   S G +        R+SPV    + SSS R     + ES +KGI+ L   +D+K H
Sbjct  409  RTGDVSRGGV------ISRNSPVEAGKRSSSSRR-----HYESAIKGIDNLQVSSDDKFH  457

Query  248  Y  246
            +
Sbjct  458  H  458



>ref|XP_009139890.1| PREDICTED: casein kinase I isoform delta-like [Brassica rapa]
Length=460

 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 56/181 (31%), Positives = 82/181 (45%), Gaps = 20/181 (11%)
 Frame = -3

Query  779  YQQSQLPSPPSCGHGGIGATSSGMPHTAANVDKQTGGEEGLPTGWSSGNLVNSRNTGLVL  600
            YQQSQL +PPS        TS+ +P   +N+D+ TG EEG P G+S       R +G + 
Sbjct  295  YQQSQLTAPPSRNLNPAVGTSAALPPGVSNIDRYTGEEEGRPVGYSHMESSRRRASGTLD  354

Query  599  SSGS---KQKGPVHDSTMskglsssniiqssgssrrpavsSIRDSVTAGVESDPSRTRAA  429
             SG+   +Q    +  +M    S       S        S  RD++ +G E      R+ 
Sbjct  355  HSGNLSNQQTSSFNRDSMMPSSSMFAQSAGSSRRVAAVSS--RDNLLSGEEFQ----RSH  408

Query  428  DTTHASPGAIPKMISTAERSSPVIFDNKCSSSTRNSNIKNIESTLKGIEGLSFGNDEKSH  249
             T   S G +        R+SPV    + SSS R+      ES +KGI+ L   +D+K H
Sbjct  409  RTGDVSRGGV------ISRNSPVEAGKRSSSSRRH-----YESAIKGIDNLQVSSDDKFH  457

Query  248  Y  246
            +
Sbjct  458  H  458



>gb|KFK29120.1| hypothetical protein AALP_AA7G091500 [Arabis alpina]
Length=458

 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 54/178 (30%), Positives = 78/178 (44%), Gaps = 15/178 (8%)
 Frame = -3

Query  779  YQQSQLPSPPSCGHGGIGATSSGMPHTAANVDKQTGGEEGLPTGWSSGNLVNSRNTGLVL  600
            YQQSQL +PPS        TSS +P   +++D+  G EEG P G S       R +G + 
Sbjct  295  YQQSQLTAPPSRSLNPAVGTSSALPPGISSIDRYAGEEEGRPVGLSQVESSRRRVSGALD  354

Query  599  SSGSKQKGPVHDSTMskglsssniiqssgssrrpavsSIRDSVTAGVESDPSRTRAADTT  420
            +SG++Q   +   +M    S       S        SS RD+     E    RT      
Sbjct  355  NSGNQQTSSITRESMMPSSSLFAQSAGSSRRVTAVSSS-RDNFLGSEELQRCRT------  407

Query  419  HASPGAIPKMISTAERSSPVIFDNKCSSSTRNSNIKNIESTLKGIEGLSFGNDEKSHY  246
                G + +      R+SPV    + SS+TR    KN E+ +KGI+ L    D+  H+
Sbjct  408  ----GEVSRGGGVISRNSPVEASKRSSSTTR----KNYETAIKGIDNLQVSEDKFHHH  457



>gb|AFW81337.1| putative casein kinase family protein [Zea mays]
Length=271

 Score = 53.5 bits (127),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 59/187 (32%), Positives = 95/187 (51%), Gaps = 15/187 (8%)
 Frame = -3

Query  779  YQQSQLP-SPPSCGHGGIGATSSGMPHTAANVDKQTGGEEGLPTGWSSGNLVNSRNTGLV  603
            YQ +Q+  +PP      +G +S   P   AN ++ +G EEG  +GWS  +    +    V
Sbjct  91   YQHAQMTTAPPRAIAPAVGQSSGMAP--VANNNRHSGTEEGRRSGWSGVDPTRRQAPPPV  148

Query  602  LSSGS--KQKGPVH-DSTMskglsssniiqssgssrrpavsSIRDSVTAGVESDPSRTRA  432
            +++GS  KQK PV  +++ S+    S+      SS      ++  S    +E++ +R+R 
Sbjct  149  INAGSLAKQKSPVRPEASTSRDAVFSSSTLLGRSSGSSRRPAVSSSREPSIEAEQTRSR-  207

Query  431  ADTTHASPGAIPKMISTAERSSPVI-----FDNKCSSSTRNSNIKNIESTLKGIEGLSFG  267
              TT ASPGA  +  S A R S  +          S    +SN KN EST++G++GL+F 
Sbjct  208  --TTDASPGATFQR-SGAPRWSLQMPDSSDGRRSSSGRRHSSNPKNYESTIRGMQGLNFD  264

Query  266  NDEKSHY  246
             D++ HY
Sbjct  265  GDDRVHY  271



>ref|XP_009407307.1| PREDICTED: casein kinase I-like isoform X2 [Musa acuminata subsp. 
malaccensis]
Length=474

 Score = 53.5 bits (127),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 67/187 (36%), Positives = 92/187 (49%), Gaps = 18/187 (10%)
 Frame = -3

Query  776  QQSQLPS-PPSCGHGGIGATSSGMPHTAANVDKQTGGEEGLPTGWSSGN---LVNSRNTG  609
            QQSQ  S PP     G+G +S  +P TA   DK +GGEEG  +GW + +   L       
Sbjct  296  QQSQNASAPPRPIISGVGPSSGLVPATAN--DKHSGGEEGRISGWPAADSPHLARVPPPA  353

Query  608  LVLSSGSKQKGPVHD--STMskglsssniiqssgssrrpavsSIRDSVTAGVESDPSRTR  435
            +   + +KQK P+ +  S   +   SS+      S               G  +D S T 
Sbjct  354  VHAGTLAKQKTPLGNEPSVNKEAAFSSSTFLGQSSGSSRRAVVSSSQDMWGSGADQSCTH  413

Query  434  AADTTHASPGAIPKMISTAERSSPVIFDN---KCSSSTRN-SNIKNIESTLKGIEGLSFG  267
               TT  SP  I K +S++E +SP  FD+   +C SS RN +N KN E TLKGI GLSF 
Sbjct  414  ---TTEQSPRTICK-VSSSEGNSP--FDSADPRCISSGRNLANTKNYEFTLKGIRGLSFD  467

Query  266  NDEKSHY  246
            +D++  Y
Sbjct  468  HDKRIRY  474



>ref|XP_009407306.1| PREDICTED: casein kinase I-like isoform X1 [Musa acuminata subsp. 
malaccensis]
Length=506

 Score = 53.5 bits (127),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 67/187 (36%), Positives = 92/187 (49%), Gaps = 18/187 (10%)
 Frame = -3

Query  776  QQSQLPS-PPSCGHGGIGATSSGMPHTAANVDKQTGGEEGLPTGWSSGN---LVNSRNTG  609
            QQSQ  S PP     G+G +S  +P TA   DK +GGEEG  +GW + +   L       
Sbjct  328  QQSQNASAPPRPIISGVGPSSGLVPATAN--DKHSGGEEGRISGWPAADSPHLARVPPPA  385

Query  608  LVLSSGSKQKGPVHD--STMskglsssniiqssgssrrpavsSIRDSVTAGVESDPSRTR  435
            +   + +KQK P+ +  S   +   SS+      S               G  +D S T 
Sbjct  386  VHAGTLAKQKTPLGNEPSVNKEAAFSSSTFLGQSSGSSRRAVVSSSQDMWGSGADQSCTH  445

Query  434  AADTTHASPGAIPKMISTAERSSPVIFDN---KCSSSTRN-SNIKNIESTLKGIEGLSFG  267
               TT  SP  I K +S++E +SP  FD+   +C SS RN +N KN E TLKGI GLSF 
Sbjct  446  ---TTEQSPRTICK-VSSSEGNSP--FDSADPRCISSGRNLANTKNYEFTLKGIRGLSFD  499

Query  266  NDEKSHY  246
            +D++  Y
Sbjct  500  HDKRIRY  506



>ref|XP_010438803.1| PREDICTED: casein kinase I isoform delta-like [Camelina sativa]
Length=453

 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 60/182 (33%), Positives = 86/182 (47%), Gaps = 28/182 (15%)
 Frame = -3

Query  779  YQQSQLPSPPSCGHGGIGATSSGMPHTAANVDKQTGGEEGLPTGWS-----SGNLVNSRN  615
            YQQSQL +PPS        TS+ +P   +N+D+ TG EEG P   S     SG L NS N
Sbjct  295  YQQSQLTAPPSRAINPAVGTSAALPPGISNMDRYTGEEEGRPHMESSRRRVSGALENSAN  354

Query  614  TGLVLSSGSKQKGPVHDSTMskglsssniiqssgssrrpavsSIRDSVTAGVESDPSRTR  435
                 +S S +   +  S++    + S+   ++ SS        RD+     E    R+R
Sbjct  355  LSNQPTSSSARDSMIPSSSLFAQSAGSSRRVAAISSS-------RDNFPGSEEF--QRSR  405

Query  434  AADTTHASPGAIPKMISTAERSSPVIFDNKCSSSTRNSNIKNIESTLKGIEGLSFGNDEK  255
            A D    S GAIP       R++PV    + SSSTR    ++ ES +KGI+ L   ++  
Sbjct  406  AGDV---SRGAIP-------RNTPVEIAKRSSSSTR----RHYESAIKGIDNLQVSDEHH  451

Query  254  SH  249
             H
Sbjct  452  PH  453



>ref|XP_003627160.1| Casein kinase I isoform delta-like protein [Medicago truncatula]
 gb|AET01636.1| casein kinase I-like protein [Medicago truncatula]
Length=408

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 45/73 (62%), Gaps = 3/73 (4%)
 Frame = -3

Query  779  YQQSQLPSPPSCGHGGIGATSSGMPHTAANVDKQT-GGEEGLPTGWSSGNLVNSRNTGLV  603
            YQQSQ+ +PPS G G     SSG+P  +AN D Q+ GG++G   GWSS +    R +G +
Sbjct  294  YQQSQIATPPSRGIGLAAGPSSGLPLASANADGQSGGGKDGRNIGWSSSDPTRRRTSGPI  353

Query  602  LSSG--SKQKGPV  570
             + G  S++K P+
Sbjct  354  ANDGILSREKAPL  366



>ref|XP_010433551.1| PREDICTED: casein kinase I isoform delta-like [Camelina sativa]
Length=453

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 60/182 (33%), Positives = 86/182 (47%), Gaps = 28/182 (15%)
 Frame = -3

Query  779  YQQSQLPSPPSCGHGGIGATSSGMPHTAANVDKQTGGEEGLPTGWS-----SGNLVNSRN  615
            YQQSQL +PPS        TS+ +P   +N+D+ TG EEG P   S     SG L NS N
Sbjct  295  YQQSQLTAPPSRSINPAVGTSAALPPGISNMDRYTGEEEGRPHMESSRRRVSGALENSAN  354

Query  614  TGLVLSSGSKQKGPVHDSTMskglsssniiqssgssrrpavsSIRDSVTAGVESDPSRTR  435
                 +S S +   +  S++    + S+   ++ SS        RD+     E    R+R
Sbjct  355  LSNQPTSSSARDSMIPSSSLFAQSAGSSRRVAAVSSS-------RDNFPGSEEF--QRSR  405

Query  434  AADTTHASPGAIPKMISTAERSSPVIFDNKCSSSTRNSNIKNIESTLKGIEGLSFGNDEK  255
            A D    S GAIP       R++PV    + SSSTR    ++ ES +KGI+ L   ++  
Sbjct  406  AGDV---SRGAIP-------RNTPVEIAKRSSSSTR----RHYESAIKGIDNLQVSDEHH  451

Query  254  SH  249
             H
Sbjct  452  PH  453



>ref|XP_010448325.1| PREDICTED: casein kinase I isoform delta-like [Camelina sativa]
Length=453

 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 63/182 (35%), Positives = 83/182 (46%), Gaps = 28/182 (15%)
 Frame = -3

Query  779  YQQSQLPSPPSCGHGGIGATSSGMPHTAANVDKQTGGEEGLPTGWS-----SGNLVNSRN  615
            YQQSQL +PPS        TS+ +P   +N+D+ TG EEG P   S     SG L NS N
Sbjct  295  YQQSQLTAPPSRSINPAVGTSAALPPGISNMDRYTGEEEGRPHMESSRRRVSGALDNSAN  354

Query  614  TGLVLSSGSKQKGPVHDSTMskglsssniiqssgssrrpavsSIRDSVTAGVESDPSRTR  435
                 +S S +     DS M      +    SS      + S  RD+     E    R+R
Sbjct  355  LSNQPTSSSAR-----DSMMPSSSLFAQSAGSSRRVAAVSSS--RDNFPGSEEF--QRSR  405

Query  434  AADTTHASPGAIPKMISTAERSSPVIFDNKCSSSTRNSNIKNIESTLKGIEGLSFGNDEK  255
            A D    S GAIP       R+SPV    + SSSTR    ++ ES +KGI+ L   ++  
Sbjct  406  AGDV---SRGAIP-------RNSPVEIAKRSSSSTR----RHYESAIKGIDNLQVSDEHH  451

Query  254  SH  249
             H
Sbjct  452  PH  453



>ref|XP_002867580.1| hypothetical protein ARALYDRAFT_492204 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43839.1| hypothetical protein ARALYDRAFT_492204 [Arabidopsis lyrata subsp. 
lyrata]
Length=454

 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 59/182 (32%), Positives = 86/182 (47%), Gaps = 27/182 (15%)
 Frame = -3

Query  779  YQQSQLPSPPSCGHGGIGATSSGMPHTAANVDKQTGGEEGLPTGWS-----SGNLVNSRN  615
            YQQSQL +PPS G      TS+ +P   +N+++ TG EEG P   S     SG L NS N
Sbjct  295  YQQSQLTAPPSRGLNPAVGTSAALPPGISNIERYTGEEEGRPHMESSRRRVSGALDNSGN  354

Query  614  TGLVLSSGSKQKGPVHDSTMskglsssniiqssgssrrpavsSIRDSVTAGVESDPSRTR  435
                 +S S +   +  S++    + S+   ++ S         RD+   G E    R+R
Sbjct  355  ISNQQTSSSARDSMIPSSSLFAQSAGSSRRVTAVSGS-------RDNF-PGSEELLQRSR  406

Query  434  AADTTHASPGAIPKMISTAERSSPVIFDNKCSSSTRNSNIKNIESTLKGIEGLSFGNDEK  255
             +D    S G IP       R+SPV    + SSSTR    ++ ES +KGI+ L   ++  
Sbjct  407  TSD---VSRGVIP-------RNSPVEVGKRSSSSTR----RHYESAVKGIDNLQVSDEHH  452

Query  254  SH  249
             H
Sbjct  453  PH  454



>ref|XP_008656113.1| PREDICTED: casein kinase I isoform delta-like isoform X1 [Zea 
mays]
 gb|AFW81339.1| putative casein kinase family protein [Zea mays]
Length=475

 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 59/187 (32%), Positives = 95/187 (51%), Gaps = 15/187 (8%)
 Frame = -3

Query  779  YQQSQLP-SPPSCGHGGIGATSSGMPHTAANVDKQTGGEEGLPTGWSSGNLVNSRNTGLV  603
            YQ +Q+  +PP      +G +S   P   AN ++ +G EEG  +GWS  +    +    V
Sbjct  295  YQHAQMTTAPPRAIAPAVGQSSGMAP--VANNNRHSGTEEGRRSGWSGVDPTRRQAPPPV  352

Query  602  LSSGS--KQKGPVH-DSTMskglsssniiqssgssrrpavsSIRDSVTAGVESDPSRTRA  432
            +++GS  KQK PV  +++ S+    S+      SS      ++  S    +E++ +R+R 
Sbjct  353  INAGSLAKQKSPVRPEASTSRDAVFSSSTLLGRSSGSSRRPAVSSSREPSIEAEQTRSR-  411

Query  431  ADTTHASPGAIPKMISTAERSSPVI-----FDNKCSSSTRNSNIKNIESTLKGIEGLSFG  267
              TT ASPGA  +  S A R S  +          S    +SN KN EST++G++GL+F 
Sbjct  412  --TTDASPGATFQR-SGAPRWSLQMPDSSDGRRSSSGRRHSSNPKNYESTIRGMQGLNFD  468

Query  266  NDEKSHY  246
             D++ HY
Sbjct  469  GDDRVHY  475



>ref|XP_008793211.1| PREDICTED: casein kinase I isoform delta-like isoform X3 [Phoenix 
dactylifera]
Length=381

 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 33/59 (56%), Positives = 41/59 (69%), Gaps = 3/59 (5%)
 Frame = -3

Query  425  TTHASPGAIPKMISTAERSSPVI-FDNKCSSSTRN-SNIKNIESTLKGIEGLSFGNDEK  255
            T  ASPG   K +S+A+RSSPV   + + +SS R  S IKN ESTLKGIE L+F NDE+
Sbjct  322  TREASPGTFHK-VSSAQRSSPVASAEQRHTSSGRYLSKIKNYESTLKGIERLNFNNDER  379



>gb|KDO53222.1| hypothetical protein CISIN_1g011819mg [Citrus sinensis]
Length=407

 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 37/73 (51%), Positives = 46/73 (63%), Gaps = 4/73 (5%)
 Frame = -3

Query  779  YQQSQLPSPPSCGHGGIGATSSGMPHTAANVDKQT-GGEEGLPTGWSSGNLVNSRNTGLV  603
            YQQSQL +PP+      GA +SG P   A+ D+QT GGEEG P G SS +    R +G V
Sbjct  295  YQQSQLATPPARALVP-GAGTSGAPPAIASGDRQTGGGEEGRPAGLSSMDSSRRRMSGPV  353

Query  602  LSSG--SKQKGPV  570
            ++SG  SKQK PV
Sbjct  354  INSGSFSKQKSPV  366



>ref|XP_004969013.1| PREDICTED: casein kinase I isoform delta-like [Setaria italica]
Length=469

 Score = 50.4 bits (119),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 62/186 (33%), Positives = 81/186 (44%), Gaps = 19/186 (10%)
 Frame = -3

Query  779  YQQSQLPSPPSCGHGGIGATSSGMPHTAANVDKQTGGEEGLPTGWSSGNLVNSRN-TGLV  603
            YQQSQ+  PP       G  SSGM   A N  + +  EEG  +GWS+  L       G+ 
Sbjct  295  YQQSQMAVPPRAMAAAAGQ-SSGMAPMANN--RLSATEEGRRSGWSADPLRRQVPPAGIN  351

Query  602  LSSGSKQKGPVHDSTMskglsssniiqssgssrrpavsSIRDSVTAGVESDPSRTRAADT  423
            + S SKQK P+     S   +        G S          S         + +R  DT
Sbjct  352  VVSLSKQKSPIRQEQSSSKDAVFPSSTFLGRSSGSLRRPAVSSSRVPTGEAETHSRTPDT  411

Query  422  THASPGAI-----PKMIS-TAERSSPVIFDNKCSSSTR-NSNIKNIESTLKGIEGLSFGN  264
               SPG       P+  S T E S P     + SSS R   N KN ESTL+GI+GL+F  
Sbjct  412  ---SPGTFQRNAPPRRTSQTLEYSDP-----RLSSSGRLMPNSKNYESTLRGIQGLNFDA  463

Query  263  DEKSHY  246
            +++ HY
Sbjct  464  NDRIHY  469



>emb|CDM83167.1| unnamed protein product [Triticum aestivum]
Length=467

 Score = 50.4 bits (119),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 61/186 (33%), Positives = 89/186 (48%), Gaps = 21/186 (11%)
 Frame = -3

Query  779  YQQSQLPSPPSCGHGGIGATSSGMPHTAANVDKQTGGEEGLPTGWSSGNLVNSRN----T  612
            YQQSQ+ S P          SSGM   A+N ++ +  EEG  +GWS      +R     T
Sbjct  295  YQQSQMTSAPPRAIAAAAGQSSGMAPIASN-NRLSATEEGRRSGWSDDP---TRRQVPPT  350

Query  611  GLVLSSGSKQKGPVH-DSTMskglsssniiqssgssrrpavsSI---RDSVTAGVESDPS  444
            G+   S +KQK PV  D +  K    S+      S       ++   RD  ++  E++PS
Sbjct  351  GINAGSLAKQKSPVRPDVSAPKEAVLSSSTFLGRSGVSSRRPAVCSSRDLPSS--EAEPS  408

Query  443  RTRAADTTHASPGAIPKMISTAERSSPVIFDNKCSSSTRNSNIKNIESTLKGIEGLSFGN  264
            R+RA D    SPG   +  ++A R +    D   S     SN  N EST++GI GL+F  
Sbjct  409  RSRAPD---VSPGTFQR--NSAPRRTSQTLD--YSDPRHKSNSNNYESTIRGIRGLNFNA  461

Query  263  DEKSHY  246
            +++ HY
Sbjct  462  NDRIHY  467



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1521097577940