BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF009G13

Length=764
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

sp|P07145.1|CATA_IPOBA  RecName: Full=Catalase                          392   5e-131   Ipomoea batatas [batate]
gb|ADB03784.1|  catalase                                                391   6e-131   Ipomoea batatas [batate]
gb|AFY26882.1|  catalase                                                360   5e-123   Ipomoea batatas [batate]
emb|CAB56850.1|  catalase                                               321   3e-104   Prunus persica
ref|XP_009624788.1|  PREDICTED: catalase isozyme 3                      322   7e-104   Nicotiana tomentosiformis
ref|XP_010907090.1|  PREDICTED: catalase isozyme 1-like                 320   5e-103   Elaeis guineensis
ref|XP_010061172.1|  PREDICTED: catalase isozyme 3-like                 320   7e-103   Eucalyptus grandis [rose gum]
ref|XP_006473789.1|  PREDICTED: catalase-like isoform X1                319   8e-103   Citrus sinensis [apfelsine]
ref|XP_008237989.1|  PREDICTED: catalase isozyme 1-like                 319   8e-103   Prunus mume [ume]
ref|XP_010061174.1|  PREDICTED: catalase isozyme 3-like isoform X2      318   2e-102   Eucalyptus grandis [rose gum]
ref|XP_006435361.1|  hypothetical protein CICLE_v10000948mg             318   2e-102   Citrus clementina [clementine]
gb|AGC65520.1|  catalase                                                318   3e-102   Eriobotrya japonica [loquat]
dbj|BAF91369.1|  catalase                                               318   4e-102   Capsicum annuum
ref|XP_007210576.1|  hypothetical protein PRUPE_ppa004763mg             318   4e-102   Prunus persica
gb|AIX10947.1|  putative catalase                                       317   6e-102   Gardenia jasminoides
ref|XP_009794469.1|  PREDICTED: catalase isozyme 3                      317   7e-102   Nicotiana sylvestris
gb|ABY19573.1|  catalase                                                308   1e-101   Manihot esculenta [manioc]
sp|Q9M5L6.1|CATA_CAPAN  RecName: Full=Catalase; AltName: Full=CaCat1    316   1e-101   Capsicum annuum
gb|AAX84671.1|  catalase CAT2                                           308   2e-101   Manihot esculenta [manioc]
sp|Q9AXH0.1|CATA_AVIMR  RecName: Full=Catalase                          316   2e-101   Avicennia marina
emb|CAD42909.1|  catalase                                               316   2e-101   Prunus persica
ref|XP_010918244.1|  PREDICTED: catalase isozyme 1                      315   3e-101   Elaeis guineensis
ref|XP_008237987.1|  PREDICTED: catalase isozyme 1                      315   3e-101   Prunus mume [ume]
gb|AAB88173.1|  catalase                                                309   4e-101   Glycine max [soybeans]
gb|AAA57551.1|  catalase                                                311   4e-101   Nicotiana sylvestris
ref|XP_007209948.1|  hypothetical protein PRUPE_ppa004776mg             315   4e-101   Prunus persica
gb|ABR15776.1|  catalase                                                308   5e-101   Litchi
ref|XP_010536470.1|  PREDICTED: catalase-2-like                         315   5e-101   Tarenaya hassleriana [spider flower]
emb|CAD42908.1|  catalase                                               315   5e-101   Prunus persica
ref|NP_001289779.1|  catalase isozyme 1                                 314   8e-101   Nelumbo nucifera [Indian lotus]
gb|KJB57963.1|  hypothetical protein B456_009G187600                    314   9e-101   Gossypium raimondii
ref|XP_002306976.2|  catalase family protein                            314   9e-101   
emb|CDP07287.1|  unnamed protein product                                313   2e-100   Coffea canephora [robusta coffee]
sp|P55311.1|CATA_SOLME  RecName: Full=Catalase                          313   2e-100   Solanum melongena [aubergine]
ref|XP_009413057.1|  PREDICTED: catalase isozyme 2-like                 313   2e-100   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009590727.1|  PREDICTED: catalase isozyme 1                      313   2e-100   Nicotiana tomentosiformis
ref|XP_011041225.1|  PREDICTED: catalase isozyme 1                      313   2e-100   Populus euphratica
ref|XP_008348924.1|  PREDICTED: catalase isozyme 1                      313   3e-100   
gb|KJB14249.1|  hypothetical protein B456_002G115900                    308   3e-100   Gossypium raimondii
ref|XP_008365915.1|  PREDICTED: catalase isozyme 1                      313   3e-100   
ref|XP_009600533.1|  PREDICTED: catalase isozyme 3-like                 313   4e-100   Nicotiana tomentosiformis
sp|P49319.2|CATA1_TOBAC  RecName: Full=Catalase isozyme 1; AltNam...    313   4e-100   Nicotiana tabacum [American tobacco]
ref|XP_009792372.1|  PREDICTED: catalase isozyme 1                      312   4e-100   Nicotiana sylvestris
ref|XP_008802866.1|  PREDICTED: catalase isozyme 1                      312   6e-100   Phoenix dactylifera
ref|XP_010061175.1|  PREDICTED: catalase-like                           312   6e-100   Eucalyptus grandis [rose gum]
ref|XP_003631925.1|  PREDICTED: catalase isozyme 1-like                 312   7e-100   Vitis vinifera
ref|NP_001268098.1|  catalase                                           312   7e-100   Vitis vinifera
emb|CAI43948.1|  catalase                                               311   9e-100   Populus deltoides
ref|XP_009400996.1|  PREDICTED: catalase isozyme 2                      311   1e-99    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008789355.1|  PREDICTED: catalase isozyme 1-like                 311   1e-99    Phoenix dactylifera
sp|P49317.1|CATA3_NICPL  RecName: Full=Catalase isozyme 3               311   1e-99    Nicotiana plumbaginifolia [leadwort-leaved tobacco]
ref|XP_011034872.1|  PREDICTED: catalase isozyme 1-like                 311   1e-99    Populus euphratica
ref|XP_002301920.1|  catalase family protein                            311   1e-99    Populus trichocarpa [western balsam poplar]
gb|AHF27428.1|  catalase                                                306   1e-99    Cucurbita moschata [ayote]
ref|XP_010242894.1|  PREDICTED: catalase isozyme 1-like isoform X1      311   1e-99    Nelumbo nucifera [Indian lotus]
ref|XP_009773579.1|  PREDICTED: catalase isozyme 3-like                 311   1e-99    Nicotiana sylvestris
ref|XP_011074091.1|  PREDICTED: catalase isozyme 3 isoform X2           311   2e-99    
ref|XP_011074092.1|  PREDICTED: catalase isozyme 3 isoform X3           311   2e-99    Sesamum indicum [beniseed]
gb|ACJ11733.1|  catalase                                                311   2e-99    Gossypium hirsutum [American cotton]
gb|AIS20825.1|  CAT                                                     310   2e-99    Pyrus x bretschneideri [bai li]
gb|ADC95629.1|  catalase                                                310   3e-99    Bruguiera gymnorhiza [Burma mangrove]
gb|AAM97542.1|  catalase 3                                              310   3e-99    Capsicum annuum
emb|CAC04509.1|  catalase                                               302   4e-99    Digitalis lanata [Grecian foxglove]
ref|XP_008373403.1|  PREDICTED: catalase isozyme 1                      310   4e-99    
sp|P49316.1|CATA2_NICPL  RecName: Full=Catalase isozyme 2               310   4e-99    Nicotiana plumbaginifolia [leadwort-leaved tobacco]
sp|O24339.1|CATA_SOLAP  RecName: Full=Catalase                          310   5e-99    Soldanella alpina
dbj|BAC79443.1|  catalase                                               310   6e-99    Acacia ampliceps
ref|NP_001237571.1|  catalase-4                                         309   7e-99    Glycine max [soybeans]
gb|KCW68095.1|  hypothetical protein EUGRSUZ_F01777                     312   8e-99    Eucalyptus grandis [rose gum]
gb|KHG25152.1|  Catalase isozyme 1                                      309   8e-99    Gossypium arboreum [tree cotton]
gb|AGV54297.1|  peroxisomal catalase                                    309   1e-98    Phaseolus vulgaris [French bean]
ref|NP_001240021.1|  catalase                                           309   1e-98    Glycine max [soybeans]
ref|XP_007136018.1|  hypothetical protein PHAVU_009G011100g             309   1e-98    Phaseolus vulgaris [French bean]
gb|AJE26131.1|  catalase                                                309   1e-98    Salix matsudana [tortured willow]
ref|NP_001291326.1|  catalase isozyme 1                                 309   1e-98    Sesamum indicum [beniseed]
gb|AAF19965.1|AF207906_1  catalase 1                                    309   1e-98    Zantedeschia aethiopica [arum-lily]
gb|ACJ73906.1|  CAT2                                                    303   1e-98    Solanum nigrum
gb|AGE15298.2|  catalase 1                                              308   2e-98    Eriobotrya japonica [loquat]
ref|XP_007160597.1|  hypothetical protein PHAVU_001G001000g             308   2e-98    Phaseolus vulgaris [French bean]
dbj|BAJ33995.1|  unnamed protein product                                308   2e-98    Eutrema halophilum
ref|XP_006412153.1|  hypothetical protein EUTSA_v10024932mg             308   3e-98    Eutrema salsugineum [saltwater cress]
gb|ABM47415.1|  catalase                                                308   3e-98    Prunus avium [gean]
gb|KJB14250.1|  hypothetical protein B456_002G115900                    308   3e-98    Gossypium raimondii
gb|AAC48918.1|  salicylic acid binding catalase                         308   3e-98    Nicotiana tabacum [American tobacco]
gb|AAR84578.1|  catalase 1a                                             308   3e-98    Lotus japonicus
ref|XP_008452956.1|  PREDICTED: catalase isozyme 1                      307   4e-98    Cucumis melo [Oriental melon]
ref|XP_007018034.1|  Catalase 2                                         307   4e-98    
ref|NP_001234827.1|  catalase isozyme 1                                 307   4e-98    Solanum lycopersicum
gb|ACJ76836.3|  catalase                                                307   4e-98    Dimocarpus longan [longan]
ref|NP_001237556.1|  catalase-1/2                                       307   5e-98    Glycine max [soybeans]
ref|XP_011074090.1|  PREDICTED: catalase isoform X1                     308   5e-98    Sesamum indicum [beniseed]
gb|AET97564.1|  catalase                                                307   5e-98    Ziziphus jujuba [Chinese jujube]
ref|XP_010530333.1|  PREDICTED: catalase-2                              307   7e-98    Tarenaya hassleriana [spider flower]
gb|AAD50974.1|AF170272_1  catalase CAT1                                 306   8e-98    Manihot esculenta [manioc]
ref|XP_004238430.1|  PREDICTED: catalase isozyme 3                      306   8e-98    Solanum lycopersicum
emb|CDP07288.1|  unnamed protein product                                306   9e-98    Coffea canephora [robusta coffee]
ref|XP_006828714.1|  hypothetical protein AMTR_s00001p00022550          306   1e-97    Amborella trichopoda
gb|AEQ30070.1|  catalase                                                306   1e-97    Litchi chinensis [litchi]
ref|XP_006435363.1|  hypothetical protein CICLE_v10000951mg             306   1e-97    Citrus clementina [clementine]
ref|XP_006473794.1|  PREDICTED: catalase isozyme 1-like isoform X4      306   1e-97    Citrus sinensis [apfelsine]
sp|P48350.1|CATA1_CUCPE  RecName: Full=Catalase isozyme 1               306   1e-97    Cucurbita pepo
ref|XP_010498496.1|  PREDICTED: catalase-3                              306   2e-97    Camelina sativa [gold-of-pleasure]
ref|XP_010663966.1|  PREDICTED: catalase isozyme 1                      306   2e-97    Vitis vinifera
dbj|BAQ21275.1|  catalase                                               305   2e-97    Citrus tamurana
ref|XP_006473791.1|  PREDICTED: catalase isozyme 1-like isoform X1      306   2e-97    
pir||S40265  catalase (EC 1.11.1.6) - eggplant                          306   2e-97 
emb|CDX76313.1|  BnaA08g10870D                                          305   2e-97    
ref|NP_001235974.1|  catalase-3                                         305   2e-97    Glycine max [soybeans]
ref|XP_009110221.1|  PREDICTED: catalase-3                              305   2e-97    Brassica rapa
gb|AFU90822.1|  catalase                                                305   2e-97    Populus tomentosa [Chinese white poplar]
ref|NP_001031072.3|  catalase 3                                         301   2e-97    Arabidopsis thaliana [mouse-ear cress]
gb|ACV92695.1|  catalase                                                305   2e-97    Brassica oleracea
sp|P17598.2|CATA1_GOSHI  RecName: Full=Catalase isozyme 1               305   3e-97    Gossypium hirsutum [American cotton]
ref|XP_002867092.1|  hypothetical protein ARALYDRAFT_491144             305   3e-97    
gb|AFU90823.1|  catalase                                                304   3e-97    Populus x beijingensis
gb|KGN55499.1|  hypothetical protein Csa_4G658590                       305   3e-97    Cucumis sativus [cucumbers]
gb|AIA61608.1|  catalase                                                305   3e-97    Gynostemma pentaphyllum [jiaogulan]
emb|CAA64220.1|  catalase                                               305   3e-97    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006283612.1|  hypothetical protein CARUB_v10004668mg             305   3e-97    Capsella rubella
ref|XP_004500877.1|  PREDICTED: catalase-4-like isoform X2              305   4e-97    Cicer arietinum [garbanzo]
gb|AAF71742.1|AF248491_1  catalase                                      305   4e-97    Raphanus sativus
emb|CDY31488.1|  BnaC05g15970D                                          305   4e-97    Brassica napus [oilseed rape]
gb|AAB86582.2|  catalase                                                305   4e-97    Raphanus sativus
gb|AAK96854.1|  catalase                                                305   4e-97    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004500876.1|  PREDICTED: catalase-4-like isoform X1              305   4e-97    
prf||1906388A  catalase                                                 305   5e-97 
emb|CAA45564.1|  catalase                                               305   5e-97    Arabidopsis thaliana [mouse-ear cress]
gb|AAD37788.1|AF149283_1  catalase 1                                    302   5e-97    Phaseolus vulgaris [French bean]
ref|NP_195235.1|  catalase 2                                            305   5e-97    Arabidopsis thaliana [mouse-ear cress]
gb|AAD17935.1|  catalase                                                305   5e-97    Brassica juncea [brown mustard]
ref|XP_006342134.1|  PREDICTED: catalase isozyme 3-like                 305   5e-97    Solanum tuberosum [potatoes]
gb|ABC01913.1|  catalase isozyme 1-like protein                         304   5e-97    Solanum tuberosum [potatoes]
ref|XP_006828715.1|  hypothetical protein AMTR_s00001p00024160          304   6e-97    Amborella trichopoda
emb|CDY29519.1|  BnaA06g14510D                                          304   6e-97    Brassica napus [oilseed rape]
ref|XP_006382992.1|  hypothetical protein POPTR_0005s10340g             304   6e-97    
ref|XP_009103334.1|  PREDICTED: catalase-3-like                         304   6e-97    Brassica rapa
ref|XP_010941422.1|  PREDICTED: catalase isozyme B                      304   7e-97    Elaeis guineensis
prf||2104177A  catalase                                                 304   7e-97 
emb|CDY40645.1|  BnaA03g53180D                                          304   7e-97    Brassica napus [oilseed rape]
sp|P45739.1|CATA_HELAN  RecName: Full=Catalase                          304   8e-97    Helianthus annuus
gb|KFK30147.1|  catalase                                                304   8e-97    Arabis alpina [alpine rockcress]
sp|P32290.1|CATA_VIGRR  RecName: Full=Catalase                          304   8e-97    Vigna radiata var. radiata [golden gram]
ref|XP_002306427.1|  hypothetical protein POPTR_0005s10340g             304   8e-97    Populus trichocarpa [western balsam poplar]
ref|XP_009138342.1|  PREDICTED: catalase-2                              304   8e-97    Brassica rapa
ref|XP_009149539.1|  PREDICTED: catalase-3                              305   1e-96    Brassica rapa
emb|CDY33636.1|  BnaC08g19360D                                          303   1e-96    Brassica napus [oilseed rape]
gb|AAD17936.1|  catalase                                                303   1e-96    Brassica juncea [brown mustard]
gb|ACA50528.1|  putative catalase 2                                     303   1e-96    Brassica napus [oilseed rape]
emb|CDY17510.1|  BnaC03g65530D                                          303   1e-96    Brassica napus [oilseed rape]
dbj|BAH20307.1|  AT1G20620                                              303   1e-96    Arabidopsis thaliana [mouse-ear cress]
ref|XP_011022275.1|  PREDICTED: catalase-like                           303   1e-96    Populus euphratica
ref|NP_001274863.1|  catalase isozyme 1                                 303   1e-96    Solanum tuberosum [potatoes]
ref|XP_010934843.1|  PREDICTED: catalase isozyme 2                      303   1e-96    
sp|P49284.1|CATA1_SOLTU  RecName: Full=Catalase isozyme 1               303   2e-96    Solanum tuberosum [potatoes]
ref|XP_008791900.1|  PREDICTED: catalase isozyme 2                      303   2e-96    Phoenix dactylifera
emb|CCP37650.1|  catalase-1                                             303   2e-96    Nicotiana tabacum [American tobacco]
emb|CDY01364.1|  BnaA07g11370D                                          305   2e-96    
gb|ACL27272.1|  catalase                                                303   2e-96    Nicotiana benthamiana
gb|AFU48609.1|  catalase 1                                              303   2e-96    Nicotiana benthamiana
gb|AFW69584.1|  catalase1                                               298   2e-96    
gb|KHG12976.1|  Catalase isozyme 2                                      303   2e-96    Gossypium arboreum [tree cotton]
ref|XP_010536468.1|  PREDICTED: catalase-3-like                         303   2e-96    Tarenaya hassleriana [spider flower]
ref|XP_010094556.1|  Catalase isozyme 1                                 303   2e-96    Morus notabilis
ref|XP_011022153.1|  PREDICTED: catalase-2-like isoform X2              303   2e-96    Populus euphratica
emb|CAA85470.1|  catalase                                               303   3e-96    Solanum tuberosum [potatoes]
gb|AAR97905.1|  catalase                                                303   3e-96    Solanum tuberosum [potatoes]
sp|P55312.1|CATA2_SOLTU  RecName: Full=Catalase isozyme 2               303   3e-96    Solanum tuberosum [potatoes]
gb|ABQ44283.1|  catalase                                                298   3e-96    Saccharum hybrid cultivar NCo 376
ref|NP_564120.1|  catalase 3                                            303   3e-96    Arabidopsis thaliana [mouse-ear cress]
gb|AAM65021.1|  unknown                                                 303   3e-96    Arabidopsis thaliana [mouse-ear cress]
gb|AAB62892.1|  catalase-1                                              302   3e-96    Nicotiana glutinosa
ref|XP_010432341.1|  PREDICTED: catalase-2-like                         302   3e-96    Camelina sativa [gold-of-pleasure]
ref|XP_010437527.1|  PREDICTED: catalase-2                              302   3e-96    Camelina sativa [gold-of-pleasure]
emb|CDY31878.1|  BnaC07g15280D                                          302   4e-96    Brassica napus [oilseed rape]
dbj|BAA34205.1|  catalase                                               302   4e-96    Oryza sativa Japonica Group [Japonica rice]
gb|AAB71764.1|  catalase 1                                              302   4e-96    Nicotiana tabacum [American tobacco]
sp|P49318.1|CATA2_RICCO  RecName: Full=Catalase isozyme 2               302   4e-96    Ricinus communis
ref|XP_011022152.1|  PREDICTED: catalase-2-like isoform X1              303   4e-96    Populus euphratica
gb|KFK44175.1|  hypothetical protein AALP_AA1G224300                    302   4e-96    Arabis alpina [alpine rockcress]
ref|NP_001048861.1|  Os03g0131200                                       302   4e-96    
ref|XP_009106100.1|  PREDICTED: catalase-2                              302   4e-96    Brassica rapa
dbj|BAJ87148.1|  predicted protein                                      296   5e-96    Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDX72514.1|  BnaC07g45360D                                          301   5e-96    
sp|P30567.1|CATA2_GOSHI  RecName: Full=Catalase isozyme 2               301   7e-96    Gossypium hirsutum [American cotton]
gb|ADZ45555.1|  catalase                                                301   1e-95    Vigna radiata [mung bean]
sp|A2YH64.2|CATA2_ORYSI  RecName: Full=Catalase isozyme B; Short=...    301   1e-95    Oryza sativa Indica Group [Indian rice]
gb|AAY59707.1|  catalase                                                301   1e-95    Oryza sativa Indica Group [Indian rice]
ref|XP_008452957.1|  PREDICTED: catalase isozyme 1-like                 301   1e-95    Cucumis melo [Oriental melon]
ref|XP_006656514.1|  PREDICTED: catalase isozyme B-like                 301   1e-95    Oryza brachyantha
ref|XP_006306495.1|  hypothetical protein CARUB_v10012481mg             301   1e-95    Capsella rubella
gb|KDP43757.1|  hypothetical protein JCGZ_22384                         301   2e-95    Jatropha curcas
gb|AAG43363.1|AF151368_1  catalase                                      300   2e-95    Hevea brasiliensis [jebe]
gb|ACB11496.1|  catalase                                                300   2e-95    Pinus sylvestris [Scotch pine]
gb|EYU30275.1|  hypothetical protein MIMGU_mgv1a005250mg                300   2e-95    Erythranthe guttata [common monkey flower]
ref|XP_009794245.1|  PREDICTED: catalase isozyme 1                      300   3e-95    Nicotiana sylvestris
gb|AIU99479.1|  catalase                                                300   3e-95    Saccharum arundinaceum
ref|XP_010446982.1|  PREDICTED: catalase-2-like                         300   3e-95    Camelina sativa [gold-of-pleasure]
dbj|BAA34204.1|  catalase                                               300   3e-95    Oryza sativa Japonica Group [Japonica rice]
gb|AAO17721.1|  catalase                                                300   3e-95    Hypericum perforatum
gb|ADZ45556.1|  catalase                                                300   3e-95    Vigna radiata [mung bean]
dbj|BAA05494.1|  catalase                                               300   3e-95    Oryza sativa Japonica Group [Japonica rice]
ref|NP_001058635.1|  Os06g0727200                                       300   3e-95    
ref|XP_006649332.1|  PREDICTED: catalase-1-like                         300   3e-95    Oryza brachyantha
ref|XP_009597278.1|  PREDICTED: catalase isozyme 1                      300   4e-95    Nicotiana tomentosiformis
gb|AAC19397.1|  leaf catalase                                           300   5e-95    Mesembryanthemum crystallinum
ref|XP_007046520.1|  Catalase 2                                         299   5e-95    Theobroma cacao [chocolate]
ref|XP_010523643.1|  PREDICTED: catalase-2-like                         299   6e-95    Tarenaya hassleriana [spider flower]
gb|AAD30292.1|AF139539_1  catalase 3                                    299   6e-95    Raphanus sativus
gb|AAD30291.2|AF139538_1  catalase 2                                    299   6e-95    Raphanus sativus
gb|AAR14052.2|  catalase                                                299   6e-95    Solanum tuberosum [potatoes]
ref|XP_009108683.1|  PREDICTED: catalase-2-like isoform X2              299   6e-95    
gb|ABK24453.1|  unknown                                                 299   6e-95    Picea sitchensis
gb|ACJ22771.1|  catalase 1                                              299   7e-95    Jatropha curcas
gb|KJB17473.1|  hypothetical protein B456_003G002800                    299   8e-95    Gossypium raimondii
ref|NP_001241808.1|  catalase isozyme B                                 299   8e-95    Zea mays [maize]
emb|CAA42720.1|  catalase-1                                             299   8e-95    Zea mays [maize]
gb|AAD17933.1|  catalase                                                299   9e-95    Brassica juncea [brown mustard]
ref|XP_010534184.1|  PREDICTED: catalase isozyme 3-like                 299   9e-95    Tarenaya hassleriana [spider flower]
sp|P49315.1|CATA1_NICPL  RecName: Full=Catalase isozyme 1               298   1e-94    Nicotiana plumbaginifolia [leadwort-leaved tobacco]
gb|AIU99485.1|  catalase                                                298   1e-94    Saccharum spontaneum [fodder cane]
emb|CDP01803.1|  unnamed protein product                                298   1e-94    Coffea canephora [robusta coffee]
ref|XP_010692544.1|  PREDICTED: catalase-like                           298   1e-94    Beta vulgaris subsp. vulgaris [field beet]
gb|AIU99484.1|  catalase                                                298   1e-94    Saccharum arundinaceum
gb|AIM43584.1|  catalase                                                298   1e-94    Saccharum hybrid cultivar Yacheng05-179
gb|AIU99481.1|  catalase                                                298   1e-94    Saccharum spontaneum [fodder cane]
sp|Q01297.2|CATA1_RICCO  RecName: Full=Catalase isozyme 1               298   1e-94    Ricinus communis
gb|AIU99488.1|  catalase                                                298   1e-94    Saccharum hybrid cultivar ROC22
gb|KGN55500.1|  hypothetical protein Csa_4G658600                       295   2e-94    Cucumis sativus [cucumbers]
gb|AAC49807.1|  catalase 3                                              298   2e-94    Arabidopsis thaliana [mouse-ear cress]
gb|AAC17729.1|  catalase 1                                              295   2e-94    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AFN81243.1|  catalase 1                                              298   2e-94    Brassica rapa subsp. pekinensis [bai cai]
ref|XP_002437631.1|  hypothetical protein SORBIDRAFT_10g030840          298   2e-94    
ref|XP_006340832.1|  PREDICTED: catalase isozyme 2                      297   3e-94    Solanum tuberosum [potatoes]
gb|AHF21552.1|  catalase                                                297   3e-94    Hylocereus undatus [dragon fruit]
ref|XP_003563243.1|  PREDICTED: catalase isozyme 1                      297   3e-94    Brachypodium distachyon [annual false brome]
gb|KEH36312.1|  catalase heme-binding enzyme                            297   3e-94    Medicago truncatula
gb|AIU99480.1|  catalase                                                297   5e-94    Saccharum spontaneum [fodder cane]
emb|CDX69111.1|  BnaC01g03420D                                          296   6e-94    
emb|CAG23920.1|  catalase                                               296   6e-94    Festuca arundinacea [tall fescue]
gb|ACL35349.1|  catalase                                                296   7e-94    Picea glauca
gb|AHF27433.1|  catalase                                                296   7e-94    Cucurbita maxima [Boston marrow]
gb|EPS69543.1|  catalase                                                296   9e-94    Genlisea aurea
gb|AHF27430.1|  catalase                                                296   1e-93    Cucurbita moschata [ayote]
gb|ACN36234.1|  unknown                                                 291   1e-93    Zea mays [maize]
gb|AFR53082.1|  CAT                                                     296   1e-93    Anthurium andraeanum [flamingo-lily]
gb|AHA50082.1|  catalase                                                296   1e-93    Eleutherococcus senticosus
ref|XP_003558892.1|  PREDICTED: catalase-1                              296   1e-93    Brachypodium distachyon [annual false brome]
gb|AIU99482.1|  catalase                                                296   1e-93    Saccharum hybrid cultivar ROC22
gb|EMT05040.1|  Catalase-1                                              297   1e-93    
gb|AIU99486.1|  catalase                                                296   1e-93    Saccharum spontaneum [fodder cane]
gb|AAF61732.1|AF243517_1  catalase 2                                    295   2e-93    Helianthus annuus
gb|AAL00886.1|  catalase                                                288   2e-93    Suaeda salsa
gb|AAM97541.1|  catalase 2                                              295   2e-93    Capsicum annuum
ref|XP_004985840.1|  PREDICTED: catalase-1-like                         295   2e-93    Setaria italica
sp|P55307.1|CATA1_HORVU  RecName: Full=Catalase isozyme 1               295   2e-93    Hordeum vulgare [barley]
sp|Q43206.1|CATA1_WHEAT  RecName: Full=Catalase-1                       295   3e-93    Triticum aestivum [Canadian hard winter wheat]
emb|CAE82295.1|  catalase                                               295   3e-93    Homogyne alpina
ref|NP_001105415.1|  catalase isozyme 1                                 294   4e-93    
gb|AIU99487.1|  catalase                                                294   5e-93    Saccharum hybrid cultivar ROC22
gb|AAF61733.1|AF243518_1  catalase 3                                    294   5e-93    Helianthus annuus
dbj|BAJ90861.1|  predicted protein                                      294   6e-93    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004966515.1|  PREDICTED: catalase isozyme 1-like                 296   6e-93    
ref|NP_001234186.1|  catalase isozyme 2                                 294   6e-93    
ref|XP_006412154.1|  hypothetical protein EUTSA_v10024932mg             295   7e-93    Eutrema salsugineum [saltwater cress]
gb|ABB72796.1|  catalase isozyme 1-like protein                         294   8e-93    Solanum tuberosum [potatoes]
gb|EYU36566.1|  hypothetical protein MIMGU_mgv1a005245mg                293   1e-92    Erythranthe guttata [common monkey flower]
gb|AIU99483.1|  catalase                                                293   1e-92    Saccharum hybrid cultivar ROC22
dbj|BAJ88747.1|  predicted protein                                      294   1e-92    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008464839.1|  PREDICTED: catalase isozyme 3                      293   1e-92    Cucumis melo [Oriental melon]
gb|AAC17731.1|  catalase 1                                              293   1e-92    Arabidopsis thaliana [mouse-ear cress]
gb|AHF27429.1|  catalase                                                292   2e-92    Cucurbita moschata [ayote]
sp|P48352.1|CATA3_CUCPE  RecName: Full=Catalase isozyme 3               293   2e-92    Cucurbita pepo
gb|ADU56198.1|  catalase                                                293   2e-92    Musa acuminata AAA Group [Cavendish banana]
gb|AHF27432.1|  catalase                                                291   2e-92    Cucurbita maxima [Boston marrow]
ref|NP_564121.1|  catalase 1                                            293   2e-92    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004144240.1|  PREDICTED: catalase isozyme 3-like                 292   2e-92    
gb|AAF61734.1|AF243519_1  catalase 4                                    292   3e-92    Helianthus annuus
emb|CDP01802.1|  unnamed protein product                                291   3e-92    Coffea canephora [robusta coffee]
ref|XP_002521709.1|  catalase, putative                                 292   3e-92    Ricinus communis
gb|ADM96039.1|  catalase                                                292   4e-92    
ref|XP_004158284.1|  PREDICTED: catalase isozyme 3-like                 292   4e-92    
ref|XP_010063132.1|  PREDICTED: LOW QUALITY PROTEIN: catalase iso...    291   5e-92    
gb|AIP93616.1|  CAT1                                                    291   5e-92    
gb|AIZ77475.1|  catalase                                                291   5e-92    
ref|XP_010692546.1|  PREDICTED: catalase                                291   5e-92    
ref|XP_004300681.1|  PREDICTED: catalase isozyme 1                      291   6e-92    
ref|XP_009392261.1|  PREDICTED: catalase isozyme A-like isoform X2      291   8e-92    
sp|P48351.1|CATA2_CUCPE  RecName: Full=Catalase isozyme 2               291   8e-92    
gb|AAC19398.1|  root catalase                                           291   1e-91    
gb|KFK44176.1|  hypothetical protein AALP_AA1G224400                    291   1e-91    
ref|XP_010061173.1|  PREDICTED: catalase isozyme 2-like isoform X1      291   1e-91    
gb|ADU56199.1|  catalase                                                290   1e-91    
gb|AAK67359.2|AF390210_1  catalase                                      290   2e-91    
tpg|DAA43177.1|  TPA: catalase2                                         290   2e-91    
sp|P55313.1|CATA2_WHEAT  RecName: Full=Catalase                         290   2e-91    
gb|AAF79625.1|AC027665_26  F5M15.5                                      302   2e-91    
gb|AAG61140.2|AF332973_1  catalase 2                                    290   3e-91    
prf||1803522A  catalase                                                 290   3e-91 
sp|P12365.3|CATA2_MAIZE  RecName: Full=Catalase isozyme 2               290   3e-91    
ref|NP_001105310.1|  catalase isozyme 2                                 290   3e-91    
ref|XP_002510677.1|  catalase, putative                                 301   3e-91    
emb|CDY01363.1|  BnaA07g11360D                                          289   4e-91    
emb|CDY52649.1|  BnaAnng11640D                                          288   4e-91    
emb|CDY31877.1|  BnaC07g15270D                                          289   5e-91    
ref|XP_009103333.1|  PREDICTED: catalase-1                              289   5e-91    
dbj|BAH37035.1|  catalase 1                                             288   1e-90    
sp|P18122.1|CATA1_MAIZE  RecName: Full=Catalase isozyme 1               288   1e-90    
gb|ADK25939.1|  catalase                                                279   2e-90    
ref|XP_002963086.1|  hypothetical protein SELMODRAFT_438313             288   2e-90    
gb|AFD29285.1|  catalase                                                288   2e-90    
gb|ADN94253.1|  catalase                                                288   2e-90    
ref|XP_002890395.1|  F5M15.5                                            299   2e-90    
ref|XP_002961779.1|  hypothetical protein SELMODRAFT_140901             288   2e-90    
tpg|DAA43178.1|  TPA: catalase2                                         289   2e-90    
ref|XP_004145541.1|  PREDICTED: catalase isozyme 1-like                 298   2e-90    
gb|AHB72694.1|  catalase                                                287   2e-90    
gb|ABV55108.1|  catalase 2                                              287   2e-90    
gb|ABY21704.1|  catalase-1 precursor                                    287   3e-90    
ref|XP_009398521.1|  PREDICTED: catalase isozyme A                      287   4e-90    
ref|XP_006416378.1|  hypothetical protein EUTSA_v10007472mg             286   4e-90    
ref|XP_002980247.1|  hypothetical protein SELMODRAFT_178171             286   9e-90    
gb|ACH63223.1|  catalase                                                286   9e-90    
gb|KDO85095.1|  hypothetical protein CISIN_1g044386mg                   287   4e-89    
gb|AAB07026.1|  catalase 1                                              284   4e-89    
gb|KHG21219.1|  Catalase isozyme 1                                      281   7e-89    
ref|NP_001031073.1|  catalase 3                                         282   3e-88    
sp|P25890.1|CATA_PEA  RecName: Full=Catalase                            281   6e-88    
gb|ACL81498.1|  catalase                                                278   8e-87    
gb|AJF34884.1|  catalase                                                277   2e-86    
gb|ACV30589.1|  catalase                                                266   2e-86    
emb|CDY31490.1|  BnaC05g15990D                                          275   1e-85    
emb|CDY29518.1|  BnaA06g14520D                                          275   1e-85    
ref|XP_009149540.1|  PREDICTED: catalase-1                              275   1e-85    
ref|XP_010498497.1|  PREDICTED: catalase-1-like                         275   2e-85    
gb|ACJ73905.1|  CAT1                                                    263   2e-85    
ref|XP_009108684.1|  PREDICTED: catalase-2-like isoform X3              274   3e-85    
ref|XP_006382986.1|  hypothetical protein POPTR_0005s10340g             275   4e-85    
ref|XP_010105996.1|  Catalase isozyme 1                                 269   6e-85    
ref|XP_010459749.1|  PREDICTED: catalase-1-like                         273   8e-85    
ref|NP_001031791.1|  catalase 2                                         272   1e-84    
dbj|BAH19523.1|  AT4G35090                                              272   1e-84    
ref|XP_001779509.1|  predicted protein                                  272   1e-84    
ref|XP_010477308.1|  PREDICTED: catalase-1                              272   2e-84    
ref|XP_008778560.1|  PREDICTED: catalase isozyme 2-like                 271   2e-84    
gb|AAC17730.1|  catalase 2                                              267   1e-83    
ref|XP_001752315.1|  predicted protein                                  270   2e-83    
gb|AAX88799.1|  catalase                                                270   2e-83    
ref|NP_001045673.1|  Os02g0115700                                       270   2e-83    
gb|EAZ21490.1|  hypothetical protein OsJ_05114                          270   3e-83    
gb|ABN71233.2|  catalase                                                269   3e-83    
dbj|BAJ92414.1|  predicted protein                                      269   3e-83    
emb|CAH61266.1|  catalase                                               268   6e-83    
gb|EMS51034.1|  Catalase isozyme 2                                      269   6e-83    
gb|ADY02963.1|  catalase                                                268   7e-83    
ref|XP_008812256.1|  PREDICTED: catalase isozyme B                      267   9e-83    
sp|P55308.1|CATA2_HORVU  RecName: Full=Catalase isozyme 2               268   1e-82    
dbj|BAH56915.1|  AT1G20620                                              268   1e-82    
ref|XP_001784759.1|  predicted protein                                  267   1e-82    
gb|AGI65617.1|  catalase                                                265   5e-82    
gb|AAZ29552.1|  catalase-C                                              266   6e-82    
gb|EMS61345.1|  Catalase isozyme 1                                      269   7e-82    
gb|ABK24449.1|  unknown                                                 265   8e-82    
ref|XP_004952158.1|  PREDICTED: catalase isozyme 3-like isoform X2      265   2e-81    
ref|XP_003573241.1|  PREDICTED: catalase isozyme 2                      264   2e-81    
gb|ADQ28492.1|  catalase                                                264   2e-81    
gb|EMT06167.1|  Catalase isozyme 2                                      267   9e-81    
ref|XP_002453177.1|  hypothetical protein SORBIDRAFT_04g001130          260   3e-80    
gb|AII23739.1|  catalase                                                259   8e-80    
pir||CSRZ  catalase (EC 1.11.1.6) catA - rice                           259   1e-79 
emb|CAA43814.1|  catalase                                               259   1e-79    
gb|ABR16304.1|  unknown                                                 259   1e-79    
ref|XP_006646781.1|  PREDICTED: LOW QUALITY PROTEIN: catalase iso...    259   2e-79    
gb|AGT16203.1|  catalase                                                259   2e-79    
gb|ABK24543.1|  unknown                                                 259   2e-79    
sp|P55310.1|CATA_SECCE  RecName: Full=Catalase                          257   1e-78    
ref|XP_005645077.1|  catalase                                           255   6e-78    
gb|AGT16188.1|  catalase                                                249   8e-76    
gb|AGT16310.1|  catalase                                                249   8e-76    
gb|AGT16054.1|  catalase                                                249   9e-76    
gb|AGT15888.1|  catalase                                                249   9e-76    
gb|ABK41476.1|  catalase                                                249   1e-75    
gb|AFW66787.1|  catalase3                                               249   1e-75    
sp|P18123.2|CATA3_MAIZE  RecName: Full=Catalase isozyme 3               249   2e-75    
gb|AHZ13843.1|  catalase                                                249   2e-75    
dbj|BAH20283.1|  AT1G20620                                              237   3e-75    
ref|XP_005847557.1|  hypothetical protein CHLNCDRAFT_57817              248   4e-75    
gb|KCW70315.1|  hypothetical protein EUGRSUZ_F03557                     246   2e-74    
gb|EMS35721.1|  Catalase isozyme 1                                      239   4e-74    
gb|KIY96954.1|  catalase                                                241   5e-74    
gb|AFW66785.1|  catalase3 isoform 1                                     249   1e-73    
gb|AFR42410.1|  catalase                                                231   5e-73    
gb|AEY70510.1|  catalase                                                235   1e-72    
ref|XP_004952157.1|  PREDICTED: catalase isozyme 3-like isoform X1      239   1e-71    
gb|AFR42412.1|  catalase                                                226   2e-71    
ref|XP_011396830.1|  Catalase isozyme 2                                 238   3e-71    
ref|XP_002950455.1|  catalase                                           237   5e-71    
dbj|BAA34714.1|  catalase                                               236   1e-70    
ref|XP_001696763.1|  catalase/peroxidase                                236   2e-70    
gb|AAA33441.1|  catalase isozyme 3 (EC 1.11.1.6)                        235   4e-70    
ref|NP_001105416.1|  catalase isozyme 3                                 235   4e-70    
gb|AFW66789.1|  catalase3                                               228   8e-70    
emb|CAA73663.1|  catalase                                               233   3e-69    
gb|AAB70006.1|  catalase                                                232   7e-69    
ref|XP_005708279.1|  catalase                                           230   2e-68    
ref|XP_006382990.1|  hypothetical protein POPTR_0005s10340g             229   4e-68    
pir||A55092  catalase (EC 1.11.1.6) CAT-2 - maize (fragment)            229   6e-68 
gb|AFW66788.1|  catalase3                                               228   2e-67    
dbj|BAD07937.1|  catalase catA-like protein                             216   5e-67    
ref|XP_009108682.1|  PREDICTED: catalase-2-like isoform X1              225   3e-66    
gb|AAR84577.1|  catalase 1b                                             223   5e-66    
ref|XP_009392260.1|  PREDICTED: catalase isozyme A-like isoform X1      223   2e-65    
gb|KJB10391.1|  hypothetical protein B456_001G198700                    219   1e-64    
gb|KJB17474.1|  hypothetical protein B456_003G002800                    218   7e-64    
gb|AID50071.1|  catalase                                                204   1e-62    
emb|CAA10286.1|  catalase                                               200   4e-61    
gb|KDD77132.1|  catalase                                                209   5e-60    
gb|ABB88582.1|  catalase                                                207   1e-59    
gb|AFI48111.1|  catalase isozyme B                                      194   5e-59    
gb|ABY68162.1|  catalase                                                194   1e-58    
gb|ABY68159.1|  catalase                                                193   1e-58    
gb|ABY68158.1|  catalase                                                193   2e-58    
gb|ABY68164.1|  catalase                                                193   2e-58    
gb|AFI48054.1|  catalase isozyme B                                      192   5e-58    
gb|ABY68160.1|  catalase                                                192   5e-58    
gb|ABY68161.1|  catalase                                                191   1e-57    
gb|AFI48068.1|  catalase isozyme B                                      191   2e-57    
gb|AFI48101.1|  catalase isozyme B                                      190   2e-57    
gb|ABB51561.1|  truncated catalase 2                                    198   1e-56    
ref|XP_005536240.1|  catalase                                           199   1e-56    
gb|AGS17821.1|  catalase 2                                              196   2e-56    
gb|AFI48131.1|  catalase isozyme B                                      188   2e-56    
gb|AAP57673.1|  catalase                                                192   2e-56    
gb|AFI48098.1|  catalase isozyme B                                      187   4e-56    
gb|AFH53190.1|  catalase                                                191   4e-56    
gb|AFH53189.1|  catalase                                                191   4e-56    
gb|AFH53187.1|  catalase                                                190   1e-55    
gb|AFI48130.1|  catalase isozyme B                                      185   3e-55    
gb|AAO16182.1|  catalase-1                                              184   7e-55    
ref|XP_006435362.1|  hypothetical protein CICLE_v10000948mg             192   3e-54    
emb|CBI29556.3|  unnamed protein product                                179   3e-53    
ref|XP_008348922.1|  PREDICTED: catalase isozyme 1-like                 189   4e-53    
ref|XP_010242895.1|  PREDICTED: catalase isozyme 1-like isoform X2      189   4e-53    
ref|XP_008382478.1|  PREDICTED: catalase isozyme 1-like                 189   5e-53    
ref|XP_006382987.1|  hypothetical protein POPTR_0005s10340g             187   3e-52    
gb|ACU23083.1|  unknown                                                 180   4e-52    
ref|XP_005712277.1|  unnamed protein product                            185   3e-51    
emb|CDP22058.1|  unnamed protein product                                174   2e-50    
gb|AFK46618.1|  unknown                                                 171   4e-50    
dbj|BAD94702.1|  catalase                                               169   2e-49    
gb|AEA86295.1|  putative catalase                                       171   3e-49    
gb|ABS89000.1|  catalase                                                169   2e-48    
gb|ABY68163.1|  catalase                                                167   2e-48    
gb|AAR25790.1|  catalase                                                166   3e-48    
gb|KEH36313.1|  catalase heme-binding enzyme                            176   3e-48    
ref|NP_973873.1|  catalase 3                                            174   2e-47    
gb|AFA36510.1|  catalase                                                162   8e-45    
gb|KJE89728.1|  catalase isozyme 2                                      165   2e-43    
ref|XP_004366029.2|  catalase isozyme 2                                 164   3e-43    
ref|XP_005644653.1|  catalase-domain-containing protein                 164   4e-43    
gb|ACJ71245.1|  catalase 2                                              160   2e-42    
gb|ACY30463.1|  catalase                                                157   4e-42    
gb|ACJ71244.1|  catalase 2                                              157   2e-41    
gb|KCW68093.1|  hypothetical protein EUGRSUZ_F01775                     157   3e-41    
gb|ADR01107.1|  catalase 3                                              155   9e-41    
gb|AAZ03546.1|  Catalase                                                149   1e-40    
gb|ABN79860.2|  catalase                                                148   2e-39    
ref|WP_032664185.1|  catalase                                           152   3e-39    
ref|WP_032632526.1|  catalase                                           152   5e-39    
gb|KIQ35234.1|  catalase                                                151   8e-39    
ref|WP_043304355.1|  catalase                                           151   8e-39    
ref|XP_005647994.1|  catalase-domain-containing protein                 151   8e-39    
gb|KGS11078.1|  catalase                                                147   1e-38    
ref|WP_004887231.1|  catalase                                           151   1e-38    
ref|WP_032610664.1|  catalase                                           150   2e-38    
gb|EGH29791.1|  catalase                                                145   2e-38    
gb|AAY22485.1|  catalase                                                144   4e-38    
ref|WP_032632922.1|  catalase                                           149   5e-38    
ref|WP_015881004.1|  catalase                                           149   6e-38    
ref|WP_038401366.1|  catalase                                           149   6e-38    
ref|WP_026826608.1|  catalase                                           149   7e-38    
gb|ABS72010.1|  putative catalase                                       139   7e-38    
gb|AHG41775.1|  catalase                                                149   9e-38    
ref|WP_032622880.1|  catalase                                           148   1e-37    
ref|WP_043193175.1|  catalase                                           148   1e-37    
ref|WP_016429054.1|  hypothetical protein                               148   1e-37    
ref|WP_029723487.1|  catalase                                           148   1e-37    
ref|WP_044323073.1|  catalase                                           148   2e-37    
ref|XP_002963084.1|  hypothetical protein SELMODRAFT_404656             140   2e-37    
ref|WP_044321845.1|  catalase                                           148   2e-37    
ref|WP_032606634.1|  catalase                                           147   2e-37    
gb|EGH10006.1|  catalase                                                147   2e-37    
ref|WP_041924592.1|  catalase                                           147   3e-37    
ref|WP_005734719.1|  catalase                                           147   3e-37    
ref|WP_010214971.1|  catalase                                           147   3e-37    
ref|WP_004665787.1|  MULTISPECIES: catalase                             147   3e-37    
ref|WP_044319236.1|  catalase                                           147   3e-37    
ref|WP_040261142.1|  catalase                                           147   4e-37    
gb|AAZ34709.1|  catalase KatB                                           147   4e-37    
gb|EFH98883.1|  Catalase                                                147   4e-37    
ref|WP_037022052.1|  catalase                                           146   5e-37    



>sp|P07145.1|CATA_IPOBA RecName: Full=Catalase [Ipomoea batatas]
 emb|CAA29063.1| unnamed protein product [Ipomoea batatas]
Length=492

 Score =   392 bits (1006),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 184/190 (97%), Positives = 190/190 (100%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGRMVLN+NIDNFFAENEM+AMDPAHIVPGIYFSDDKMLQAR+FAYADTHRHRLGPNYML
Sbjct  303  VGRMVLNKNIDNFFAENEMLAMDPAHIVPGIYFSDDKMLQARVFAYADTHRHRLGPNYML  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LPVNAPKCA+HNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTG+RDKCVI
Sbjct  363  LPVNAPKCAHHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGQRDKCVI  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            EKENNFKQPGDRYRSWAPDRQDRFINRWVK+LSEPRVTHEIRSTWISYLTQADRSLGQKV
Sbjct  423  EKENNFKQPGDRYRSWAPDRQDRFINRWVKALSEPRVTHEIRSTWISYLTQADRSLGQKV  482

Query  224  ASRLNIRPTM  195
            ASRLNIRPTM
Sbjct  483  ASRLNIRPTM  492



>gb|ADB03784.1| catalase [Ipomoea batatas]
Length=492

 Score =   391 bits (1005),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 184/190 (97%), Positives = 190/190 (100%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGRMVLN+NIDNFFAENEM+AMDPAHIVPGIYFSDDKMLQAR+FAYADTHRHRLGPNYML
Sbjct  303  VGRMVLNKNIDNFFAENEMLAMDPAHIVPGIYFSDDKMLQARVFAYADTHRHRLGPNYML  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LPVNAPKCA+HNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTG+RDKCVI
Sbjct  363  LPVNAPKCAHHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGQRDKCVI  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            EKENNFKQPGDRYRSWAPDRQDRFINRWVK+LSEPRVTHEIRSTWISYLTQADRSLGQKV
Sbjct  423  EKENNFKQPGDRYRSWAPDRQDRFINRWVKALSEPRVTHEIRSTWISYLTQADRSLGQKV  482

Query  224  ASRLNIRPTM  195
            ASRLNIRPTM
Sbjct  483  ASRLNIRPTM  492



>gb|AFY26882.1| catalase, partial [Ipomoea batatas]
Length=173

 Score =   360 bits (923),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 168/173 (97%), Positives = 173/173 (100%), Gaps = 0/173 (0%)
 Frame = -1

Query  713  EMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDG  534
            EM+AMDPAHIVPGIYFSDDKMLQAR+FAYADTHRHRLGPNYMLLPVNAPKCA+HNNSYDG
Sbjct  1    EMLAMDPAHIVPGIYFSDDKMLQARVFAYADTHRHRLGPNYMLLPVNAPKCAHHNNSYDG  60

Query  533  YMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWA  354
            YMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTG+RDKCVIEKENNFKQPGDRYRSWA
Sbjct  61   YMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGQRDKCVIEKENNFKQPGDRYRSWA  120

Query  353  PDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  195
            PDRQDRFINRWVK+LSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM
Sbjct  121  PDRQDRFINRWVKALSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  173



>emb|CAB56850.1| catalase [Prunus persica]
Length=423

 Score =   321 bits (822),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 142/190 (75%), Positives = 174/190 (92%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGR+VLN+NIDNFFAENE +A +PAH+VPGIY+SDDKMLQ RIFAY+DT RHRLGPNY+ 
Sbjct  234  VGRLVLNKNIDNFFAENEQLAFNPAHVVPGIYYSDDKMLQTRIFAYSDTQRHRLGPNYLQ  293

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LPVNAPKC +HNN ++G+MNF+HRDEEV+YFPS+ D  R+AER+P P  I++G+R+KCVI
Sbjct  294  LPVNAPKCPHHNNHHEGFMNFMHRDEEVNYFPSRHDPVRHAERYPIPSNILSGKREKCVI  353

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            EKENNFKQPG+RYRSWAPDRQ+RFI+RWV +LS+PRVTHEIRS WISY +QAD+SLGQK+
Sbjct  354  EKENNFKQPGERYRSWAPDRQERFIHRWVDALSDPRVTHEIRSVWISYWSQADKSLGQKL  413

Query  224  ASRLNIRPTM  195
            ASRLN+RP++
Sbjct  414  ASRLNVRPSI  423



>ref|XP_009624788.1| PREDICTED: catalase isozyme 3 [Nicotiana tomentosiformis]
Length=492

 Score =   322 bits (826),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 142/190 (75%), Positives = 174/190 (92%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGR+VLN+NIDNFFAENE +A  PA +VPG+Y+SDDK+LQ RIF+Y+DT RHRLGPNY+ 
Sbjct  303  VGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQ  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS+FD  R+AE++P PLR++TG+RDKC++
Sbjct  363  LPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPCRHAEQYPIPLRVLTGKRDKCIV  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            EKENNFKQPG+RYRSWAPDRQ+RFI RWV +LS+PRVTHEIRS WISY +QAD+SLGQK+
Sbjct  423  EKENNFKQPGERYRSWAPDRQERFICRWVDALSDPRVTHEIRSIWISYWSQADKSLGQKI  482

Query  224  ASRLNIRPTM  195
            ASRLNIRPTM
Sbjct  483  ASRLNIRPTM  492



>ref|XP_010907090.1| PREDICTED: catalase isozyme 1-like [Elaeis guineensis]
Length=492

 Score =   320 bits (820),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 142/190 (75%), Positives = 173/190 (91%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGRMVLN+NIDNFFAENE +A  PA +VPGIY+SDDK+LQ RIF+YADT RHRLGPNY++
Sbjct  303  VGRMVLNKNIDNFFAENEQLAFCPAIVVPGIYYSDDKLLQTRIFSYADTQRHRLGPNYLM  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LP NAPKCA+HNN +DG+MNF+HRDEEV+YFPS++D  R+AERFP P RI+TGRR+KCVI
Sbjct  363  LPANAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPVRHAERFPIPFRILTGRREKCVI  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
             KENNFKQPG+RYRSWAPDRQ+RFI RWV++LS+PRVT+EIR+ WISY +Q DRSLGQK+
Sbjct  423  HKENNFKQPGERYRSWAPDRQERFICRWVEALSDPRVTYEIRTIWISYWSQCDRSLGQKI  482

Query  224  ASRLNIRPTM  195
            A+RLN++P+M
Sbjct  483  ATRLNVKPSM  492



>ref|XP_010061172.1| PREDICTED: catalase isozyme 3-like [Eucalyptus grandis]
 gb|KCW68094.1| hypothetical protein EUGRSUZ_F01776 [Eucalyptus grandis]
Length=492

 Score =   320 bits (819),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 142/190 (75%), Positives = 175/190 (92%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGR+VLN+N+DNFFAENE +A +PA +VPGIY+S+DK+LQARIFAY+DTHR+RLGPNY+ 
Sbjct  303  VGRLVLNKNVDNFFAENEQLAFNPAFVVPGIYYSNDKLLQARIFAYSDTHRYRLGPNYLQ  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LPVNAPKCA+HNN +DG+MN +HRDEE++YFPSKFD  R+AER+P P +IVTG+R+K +I
Sbjct  363  LPVNAPKCAHHNNHHDGFMNIMHRDEEINYFPSKFDPVRHAERYPIPSQIVTGKREKVII  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            EKENNFKQPG+RYRSWAPDRQ+RFINRW+K+L+EPRVTHE RS WISY TQAD+SLGQK+
Sbjct  423  EKENNFKQPGERYRSWAPDRQERFINRWIKALTEPRVTHEHRSIWISYWTQADKSLGQKL  482

Query  224  ASRLNIRPTM  195
            ASRL+ RP+M
Sbjct  483  ASRLSARPSM  492



>ref|XP_006473789.1| PREDICTED: catalase-like isoform X1 [Citrus sinensis]
Length=477

 Score =   319 bits (817),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 140/190 (74%), Positives = 172/190 (91%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGR+VLN+NIDNFFAENEM+A +P  +VPGIY+S+DKMLQ RIFAY DT RHRLGPNY++
Sbjct  288  VGRLVLNKNIDNFFAENEMLAFNPGIVVPGIYYSNDKMLQCRIFAYGDTQRHRLGPNYLM  347

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LPVNAPKC + NN YDG+MNF+HRDEEVDYFPS++D TR+AER+P P  ++TGRR+K  I
Sbjct  348  LPVNAPKCPHRNNHYDGFMNFMHRDEEVDYFPSRYDPTRHAERYPIPSDVITGRREKACI  407

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            EKENNFKQPG+RYRSWAPDRQ+RF+NRW+K+L +PRVTHE+RS W+SY +QADRSLGQK+
Sbjct  408  EKENNFKQPGERYRSWAPDRQERFLNRWIKALCDPRVTHEVRSIWVSYWSQADRSLGQKL  467

Query  224  ASRLNIRPTM  195
            ASRLN+RP++
Sbjct  468  ASRLNVRPSI  477



>ref|XP_008237989.1| PREDICTED: catalase isozyme 1-like [Prunus mume]
Length=492

 Score =   319 bits (818),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 141/190 (74%), Positives = 173/190 (91%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGR+VLN+NIDNFFAENE +A +PAH+VPG+Y+SDDKMLQ RIFAY+DT RHRLGPNY+ 
Sbjct  303  VGRLVLNKNIDNFFAENEQLAFNPAHVVPGVYYSDDKMLQTRIFAYSDTQRHRLGPNYLQ  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LPVNAPKC +HNN ++G+MNF+HRDEEV+YFPS++D  R+AER+P P  I+ G+R+KCVI
Sbjct  363  LPVNAPKCPHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAERYPIPSNILYGKREKCVI  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            EKENNFKQPG+RYRSWAPDRQ+RFI RWV +LS+PRVTHEIRS WISY +QAD+SLGQK+
Sbjct  423  EKENNFKQPGERYRSWAPDRQERFIRRWVDALSDPRVTHEIRSIWISYWSQADKSLGQKL  482

Query  224  ASRLNIRPTM  195
            ASRLN+RP++
Sbjct  483  ASRLNVRPSI  492



>ref|XP_010061174.1| PREDICTED: catalase isozyme 3-like isoform X2 [Eucalyptus grandis]
 gb|KCW68092.1| hypothetical protein EUGRSUZ_F01775 [Eucalyptus grandis]
Length=492

 Score =   318 bits (816),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 142/190 (75%), Positives = 174/190 (92%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGR+VLNQN+DNFFAENE +A +PA +VPGIYFS+DK+LQARIFAY+DTHR+RLGPNY+ 
Sbjct  303  VGRLVLNQNVDNFFAENEQLAFNPAFVVPGIYFSNDKLLQARIFAYSDTHRYRLGPNYLQ  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LPVNAPKCA+HNN +DG+MNF+HRDEE++YFPSKFD  R+AER+P P +IVTG+R++ +I
Sbjct  363  LPVNAPKCAHHNNHHDGFMNFMHRDEEINYFPSKFDPVRHAERYPIPSQIVTGKRERVII  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            EKENNFKQ G+RYRSWAPDRQ+RFINRW+K+LSEPRVTHE RS WISY TQAD+S+GQK+
Sbjct  423  EKENNFKQAGERYRSWAPDRQERFINRWIKALSEPRVTHEHRSIWISYWTQADKSIGQKL  482

Query  224  ASRLNIRPTM  195
            AS L+ RP+M
Sbjct  483  ASSLSARPSM  492



>ref|XP_006435361.1| hypothetical protein CICLE_v10000948mg [Citrus clementina]
 ref|XP_006473790.1| PREDICTED: catalase-like isoform X2 [Citrus sinensis]
 gb|ESR48601.1| hypothetical protein CICLE_v10000948mg [Citrus clementina]
Length=493

 Score =   318 bits (816),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 140/190 (74%), Positives = 172/190 (91%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGR+VLN+NIDNFFAENEM+A +P  +VPGIY+S+DKMLQ RIFAY DT RHRLGPNY++
Sbjct  304  VGRLVLNKNIDNFFAENEMLAFNPGIVVPGIYYSNDKMLQCRIFAYGDTQRHRLGPNYLM  363

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LPVNAPKC + NN YDG+MNF+HRDEEVDYFPS++D TR+AER+P P  ++TGRR+K  I
Sbjct  364  LPVNAPKCPHRNNHYDGFMNFMHRDEEVDYFPSRYDPTRHAERYPIPSDVITGRREKACI  423

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            EKENNFKQPG+RYRSWAPDRQ+RF+NRW+K+L +PRVTHE+RS W+SY +QADRSLGQK+
Sbjct  424  EKENNFKQPGERYRSWAPDRQERFLNRWIKALCDPRVTHEVRSIWVSYWSQADRSLGQKL  483

Query  224  ASRLNIRPTM  195
            ASRLN+RP++
Sbjct  484  ASRLNVRPSI  493



>gb|AGC65520.1| catalase [Eriobotrya japonica]
 gb|AGC65522.1| catalase [Eriobotrya japonica]
 gb|AGC65523.1| catalase [Eriobotrya japonica]
 gb|AGC65524.1| catalase [Eriobotrya japonica]
 gb|AGE15297.2| catalase 2 [Eriobotrya japonica]
Length=492

 Score =   318 bits (815),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 141/190 (74%), Positives = 171/190 (90%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGR+VLN+NIDNFFAENE +A +PA +VPG+Y+S+DKMLQ R+FAY+DT RHRLGPNY+ 
Sbjct  303  VGRLVLNKNIDNFFAENEQLAFNPAFVVPGVYYSNDKMLQTRLFAYSDTQRHRLGPNYLQ  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LPVNAPKCA+HNN YDG+MNF+HRDEEVDYFPS++   R+AE FP P  I+TG+RDKCVI
Sbjct  363  LPVNAPKCAHHNNHYDGFMNFMHRDEEVDYFPSRYQPARHAETFPIPSNIITGKRDKCVI  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            EKENNFKQPG+RYRSWAPDRQ+RF++RWV  LSEPRVT+EIRS WISY +QADRS GQK+
Sbjct  423  EKENNFKQPGERYRSWAPDRQERFLHRWVDVLSEPRVTYEIRSIWISYWSQADRSFGQKL  482

Query  224  ASRLNIRPTM  195
            A+RLN+RP++
Sbjct  483  ATRLNVRPSI  492



>dbj|BAF91369.1| catalase [Capsicum annuum]
Length=492

 Score =   318 bits (814),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 143/190 (75%), Positives = 169/190 (89%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGR+VLN+NIDNFFAENE +A +P HIVPG+Y+S+DK+LQ RIFAYADT RHR+GPNYM 
Sbjct  303  VGRLVLNRNIDNFFAENEQLAFNPGHIVPGVYYSEDKLLQTRIFAYADTQRHRIGPNYMQ  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LPVNAPKCA+HNN  DG MNF+HRDEEVDY PS+FD  R AE++P P  ++TGRR+KCVI
Sbjct  363  LPVNAPKCAHHNNHRDGAMNFMHRDEEVDYLPSRFDPCRPAEQYPIPSCVLTGRREKCVI  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
             KENNFKQ G+RYRSWAPDRQDR+IN+WV+SLS+PRVTHEIRS WISYL+QAD+S GQKV
Sbjct  423  PKENNFKQAGERYRSWAPDRQDRYINKWVESLSDPRVTHEIRSIWISYLSQADKSCGQKV  482

Query  224  ASRLNIRPTM  195
            ASRL ++PTM
Sbjct  483  ASRLTVKPTM  492



>ref|XP_007210576.1| hypothetical protein PRUPE_ppa004763mg [Prunus persica]
 gb|EMJ11775.1| hypothetical protein PRUPE_ppa004763mg [Prunus persica]
Length=492

 Score =   318 bits (814),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 141/190 (74%), Positives = 172/190 (91%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGR+VLN+NIDNFFAENE +A +PAH+VPGIY+SDDKMLQ RIFAY+DT RHRLGPNY+ 
Sbjct  303  VGRLVLNKNIDNFFAENEQLAFNPAHVVPGIYYSDDKMLQTRIFAYSDTQRHRLGPNYLQ  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LPVNAPKC +HNN ++G+MNF+HRDEEV+YFPS+ D  R+AER+P P  I++G+R+KCVI
Sbjct  363  LPVNAPKCPHHNNHHEGFMNFMHRDEEVNYFPSRHDPVRHAERYPIPSNILSGKREKCVI  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            EKENNFKQPG+RYRSWAPDRQ+RFI RWV +LS+PRVTHEIRS WISY +QAD+SLGQK+
Sbjct  423  EKENNFKQPGERYRSWAPDRQERFIRRWVDALSDPRVTHEIRSIWISYWSQADKSLGQKL  482

Query  224  ASRLNIRPTM  195
             SRLN+RP++
Sbjct  483  LSRLNVRPSI  492



>gb|AIX10947.1| putative catalase [Gardenia jasminoides]
Length=492

 Score =   317 bits (812),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 141/190 (74%), Positives = 171/190 (90%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGR+VLN+NIDNFF ENE +A +PAH+VPGIY+S+DK+LQ RIFAY+DTHRHRLGPNY+ 
Sbjct  303  VGRLVLNKNIDNFFNENEQLAFNPAHVVPGIYYSEDKLLQGRIFAYSDTHRHRLGPNYLQ  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LPVNAPKCA+HNN YDGYMN +HRDEE+DYFPS++D  R+AER P P R++TGRR++ VI
Sbjct  363  LPVNAPKCAHHNNHYDGYMNIMHRDEEIDYFPSRYDPVRHAERHPIPTRVLTGRRERRVI  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            EKENNFKQP +RYRSWAPDRQ+RF+ RWV +LS+PR+THEIRS WISY +QAD+SLGQK+
Sbjct  423  EKENNFKQPVERYRSWAPDRQERFVRRWVDALSDPRLTHEIRSIWISYWSQADKSLGQKI  482

Query  224  ASRLNIRPTM  195
            A RLN+RPTM
Sbjct  483  AFRLNVRPTM  492



>ref|XP_009794469.1| PREDICTED: catalase isozyme 3 [Nicotiana sylvestris]
 emb|CCP37652.1| catalase-3 [Nicotiana tabacum]
Length=492

 Score =   317 bits (812),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 140/190 (74%), Positives = 172/190 (91%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGR+VLN+NIDNFFAENE +A  PA +VPG+Y+SDDK+LQ RIF+Y+DT RHRLGPNY+ 
Sbjct  303  VGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQ  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS+FD  R+AE+ P P R++TG+RDKC+I
Sbjct  363  LPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPCRHAEQHPIPPRVLTGKRDKCII  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            EKENNFKQPG+RYRSWAPDRQ+RFI RWV +LS+PRVTHEIRS WISY +QAD++LGQK+
Sbjct  423  EKENNFKQPGERYRSWAPDRQERFICRWVDALSDPRVTHEIRSIWISYWSQADKTLGQKI  482

Query  224  ASRLNIRPTM  195
            ASRLN+RPTM
Sbjct  483  ASRLNVRPTM  492



>gb|ABY19573.1| catalase [Manihot esculenta]
Length=261

 Score =   308 bits (790),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 137/190 (72%), Positives = 166/190 (87%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            +GR+VLN+NIDN+FAENEM+A DP H+VPGI++S+DK+ Q R FAYADT RHRLGPNY +
Sbjct  72   LGRLVLNRNIDNWFAENEMLAFDPGHVVPGIHYSNDKLFQLRTFAYADTQRHRLGPNYKM  131

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LPVNAPKC YHNN YDG+MNF+HRDEEVDYFPS++D  R+AER P P  I++GRR+KCVI
Sbjct  132  LPVNAPKCNYHNNHYDGFMNFMHRDEEVDYFPSRYDPVRHAERTPLPHAIISGRREKCVI  191

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            EKENNFKQPGDRYRSW PDRQ+RF+ R V +LS+PR+THEIRS W+SY +Q D+SLGQK+
Sbjct  192  EKENNFKQPGDRYRSWTPDRQERFLCRLVNALSDPRITHEIRSIWVSYWSQCDKSLGQKL  251

Query  224  ASRLNIRPTM  195
            ASRLN+RP  
Sbjct  252  ASRLNVRPNF  261



>sp|Q9M5L6.1|CATA_CAPAN RecName: Full=Catalase; AltName: Full=CaCat1 [Capsicum annuum]
 gb|AAF34718.1|AF227952_1 catalase [Capsicum annuum]
Length=492

 Score =   316 bits (810),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 142/190 (75%), Positives = 168/190 (88%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGR+VLN+NIDNFFAENE +A +P HIVPG+Y+S+DK+LQ RIFAYADT RHR+GPNYM 
Sbjct  303  VGRLVLNRNIDNFFAENEQLAFNPGHIVPGVYYSEDKLLQTRIFAYADTQRHRIGPNYMQ  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LPVNAPKCA+HNN  DG MNF+HRDEEVDY PS+FD  R AE++P P  ++TGRR+KCVI
Sbjct  363  LPVNAPKCAHHNNHRDGAMNFMHRDEEVDYLPSRFDPCRPAEQYPIPSCVLTGRREKCVI  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
             KENNFKQ G+RYRSWAPDRQDR+IN+WV+SLS+PR THEIRS WISYL+QAD+S GQKV
Sbjct  423  PKENNFKQAGERYRSWAPDRQDRYINKWVESLSDPRATHEIRSIWISYLSQADKSCGQKV  482

Query  224  ASRLNIRPTM  195
            ASRL ++PTM
Sbjct  483  ASRLTVKPTM  492



>gb|AAX84671.1| catalase CAT2, partial [Manihot esculenta]
Length=270

 Score =   308 bits (789),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 137/188 (73%), Positives = 166/188 (88%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            +GR+VLN+NIDN+FAENEM+A DP H+VPGI++S+DK+ Q R FAYADT RHRLGPNY +
Sbjct  81   LGRLVLNRNIDNWFAENEMLAFDPGHVVPGIHYSNDKLFQLRTFAYADTQRHRLGPNYKM  140

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LPVNAPKC YHNN YDG+MNF+HRDEEVDYFPS++D  R+AER P P  I++GRR+KCVI
Sbjct  141  LPVNAPKCNYHNNHYDGFMNFMHRDEEVDYFPSRYDPVRHAERTPLPHAIISGRREKCVI  200

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            EKENNFKQPGDRYRSW PDRQ+RF+ R V +LS+PR+THEIRS W+SY +Q D+SLGQK+
Sbjct  201  EKENNFKQPGDRYRSWTPDRQERFLCRLVNALSDPRITHEIRSIWVSYWSQCDKSLGQKL  260

Query  224  ASRLNIRP  201
            ASRLN+RP
Sbjct  261  ASRLNVRP  268



>sp|Q9AXH0.1|CATA_AVIMR RecName: Full=Catalase [Avicennia marina]
 gb|AAK06839.1|AF328861_1 catalase [Avicennia marina]
 gb|AAP13538.1| catalase [Avicennia marina]
Length=492

 Score =   316 bits (809),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 146/190 (77%), Positives = 168/190 (88%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGRMVLN+NIDNFFAENEM+A  P  IVPGI FS+DKMLQ RIFAY DT RHRLGPNY+L
Sbjct  303  VGRMVLNKNIDNFFAENEMLAFSPHMIVPGINFSNDKMLQTRIFAYGDTQRHRLGPNYLL  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LPVNAPKCAYHNN YDG+MNF+HRDEEVDYFPSK+D TR+AER P P  ++TGRRD+ VI
Sbjct  363  LPVNAPKCAYHNNHYDGFMNFMHRDEEVDYFPSKYDPTRHAERHPIPNAVITGRRDRRVI  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            EKE+NFKQ GDRYRSWAPDRQ+RF+ RWV +LS+PR+T EIRS W+SY +QAD+S GQK+
Sbjct  423  EKEDNFKQAGDRYRSWAPDRQERFLRRWVDALSDPRLTLEIRSIWVSYWSQADKSFGQKL  482

Query  224  ASRLNIRPTM  195
            ASRLN+RPTM
Sbjct  483  ASRLNVRPTM  492



>emb|CAD42909.1| catalase [Prunus persica]
Length=492

 Score =   316 bits (809),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 140/190 (74%), Positives = 172/190 (91%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGR+VLN+NIDNFFAENE +A +PAH+VPGIY+SDDK+LQ RIFAY+DT RHRLGPNY+ 
Sbjct  303  VGRLVLNKNIDNFFAENEQLAFNPAHVVPGIYYSDDKVLQTRIFAYSDTQRHRLGPNYLQ  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LPVNAPKC +HNN ++G+MNF+HRDEEV+YFPS+ D  R+AER+P P  I++G+R+KCVI
Sbjct  363  LPVNAPKCPHHNNHHEGFMNFMHRDEEVNYFPSRHDPVRHAERYPIPSNILSGKREKCVI  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            EKENNFKQPG+RYRSWAPDRQ+RFI RWV +LS+PRVTHEIRS WISY +QAD+SLGQK+
Sbjct  423  EKENNFKQPGERYRSWAPDRQERFIRRWVDALSDPRVTHEIRSIWISYWSQADKSLGQKL  482

Query  224  ASRLNIRPTM  195
             SRLN+RP++
Sbjct  483  LSRLNVRPSI  492



>ref|XP_010918244.1| PREDICTED: catalase isozyme 1 [Elaeis guineensis]
Length=492

 Score =   315 bits (808),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 140/190 (74%), Positives = 171/190 (90%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGRMVLN+NIDNFFAENE +A  PA +VPGIY+SDDK+LQ RIF+YADT RHRLGPNY++
Sbjct  303  VGRMVLNKNIDNFFAENEQLAFCPAIVVPGIYYSDDKLLQTRIFSYADTQRHRLGPNYLM  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LP NAPKCA+HNN +DG+MNF+HRDEEV+YFPS++D  R+AERFP P RI+TGRR+KCVI
Sbjct  363  LPANAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPVRHAERFPIPSRILTGRREKCVI  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
             KENNFKQPG+RYRSW P+RQ+RFI RWV++LS+PRVTHEI+S WISY +Q D+SLGQK+
Sbjct  423  HKENNFKQPGERYRSWDPNRQERFIRRWVEALSDPRVTHEIQSIWISYWSQCDKSLGQKI  482

Query  224  ASRLNIRPTM  195
            A+RLN++P M
Sbjct  483  ATRLNVKPCM  492



>ref|XP_008237987.1| PREDICTED: catalase isozyme 1 [Prunus mume]
Length=492

 Score =   315 bits (808),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 139/190 (73%), Positives = 173/190 (91%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGR+VLN+NIDNFFAENE +A  PA +VPG+Y+SDDK+LQ RIF+Y+DT RHRLGPNY+ 
Sbjct  303  VGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQ  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LPVNAPKC++HNN ++G+MNF+HRDEEV+YFPS++D  RNAERFP P  I++G+R+KC+I
Sbjct  363  LPVNAPKCSHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRNAERFPIPPNILSGKREKCII  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            EKENNFKQPG+RYRSWAPDRQ+RFI RWV +LS+PRVTHEIRS WISY +QAD+SLGQK+
Sbjct  423  EKENNFKQPGERYRSWAPDRQERFICRWVDALSDPRVTHEIRSIWISYWSQADKSLGQKL  482

Query  224  ASRLNIRPTM  195
            ASRLN+RP++
Sbjct  483  ASRLNVRPSI  492



>gb|AAB88173.1| catalase, partial [Glycine max]
Length=308

 Score =   309 bits (791),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 139/190 (73%), Positives = 167/190 (88%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGR+VLN+NIDNFFAENE +A  PA +VPG+Y+SDDKMLQ RIF+YAD+ RHRLGPNY+ 
Sbjct  119  VGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKMLQTRIFSYADSQRHRLGPNYLQ  178

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE FP P  I +GRR+KC I
Sbjct  179  LPANAPKCAHHNNHHEGFMNFIHRDEEVNYFPSRYDPVRHAETFPIPPAICSGRREKCGI  238

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            EKENNFKQPG+RYRSWAPDRQDRF  RWV +LS+PRVTHEIRS WISY +QADRSLGQK+
Sbjct  239  EKENNFKQPGERYRSWAPDRQDRFNRRWVDALSDPRVTHEIRSVWISYWSQADRSLGQKI  298

Query  224  ASRLNIRPTM  195
            ASRL++RP +
Sbjct  299  ASRLSMRPNI  308



>gb|AAA57551.1| catalase, partial [Nicotiana sylvestris]
Length=383

 Score =   311 bits (798),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 139/190 (73%), Positives = 169/190 (89%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGR+VLN+NIDNFFAENE +A +P HIVPG+Y+S+DK+LQ RIFAYADT RHR+GPNYM 
Sbjct  194  VGRLVLNRNIDNFFAENEQLAFNPGHIVPGLYYSEDKLLQTRIFAYADTQRHRIGPNYMQ  253

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LPVNAPKCA+HNN  DG MNF+HRDEEVDY PS+FD  R+AE++P P R++TGRR+ CVI
Sbjct  254  LPVNAPKCAHHNNHRDGAMNFMHRDEEVDYLPSRFDPCRHAEQYPIPSRVLTGRREMCVI  313

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            EKENNFKQ G+RYRSW PDRQDR++++WV+ LS+PRVT+EIRS WISYL+QAD+S GQKV
Sbjct  314  EKENNFKQAGERYRSWEPDRQDRYVSKWVEHLSDPRVTYEIRSIWISYLSQADKSCGQKV  373

Query  224  ASRLNIRPTM  195
            ASRL ++PTM
Sbjct  374  ASRLTLKPTM  383



>ref|XP_007209948.1| hypothetical protein PRUPE_ppa004776mg [Prunus persica]
 gb|EMJ11147.1| hypothetical protein PRUPE_ppa004776mg [Prunus persica]
Length=492

 Score =   315 bits (807),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 138/190 (73%), Positives = 174/190 (92%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGR+VLN+NIDNFFAENE +A  PA +VPG+Y+SDDK+LQ RIF+Y+DT RHRLGPNY+ 
Sbjct  303  VGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQ  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LPVNAPKC++HNN ++G+MNF+HRDEEV+YFPS++D  R+AERFP P  I++G+R+KC+I
Sbjct  363  LPVNAPKCSHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAERFPIPPNILSGKREKCII  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            EKENNFKQPG+RYRSWAPDRQ+RFI+RWV +LS+PRVTHEIRS WISY +QAD+SLGQK+
Sbjct  423  EKENNFKQPGERYRSWAPDRQERFIHRWVDALSDPRVTHEIRSVWISYWSQADKSLGQKL  482

Query  224  ASRLNIRPTM  195
            ASRLN+RP++
Sbjct  483  ASRLNVRPSI  492



>gb|ABR15776.1| catalase [Litchi chinensis]
Length=291

 Score =   308 bits (789),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 140/190 (74%), Positives = 163/190 (86%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGR+VLN+NIDNFF ENE +A +P  +VPGIY+SDDKMLQ RIFAY DT RHRLGPNY++
Sbjct  102  VGRLVLNRNIDNFFNENEQLAFNPGLVVPGIYYSDDKMLQCRIFAYGDTQRHRLGPNYLM  161

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LPVNAPKC +HNN YDG+MNF+HRDEEVDYFPSKF N  NAE+FP P RI +G+R+K  I
Sbjct  162  LPVNAPKCPHHNNHYDGFMNFMHRDEEVDYFPSKFTNVANAEKFPIPGRICSGKREKACI  221

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            EKENNFK PGDRYRSWAPDRQ+RFI R V  LS+PRVT EIRS W+SY +QAD+SLGQK+
Sbjct  222  EKENNFKLPGDRYRSWAPDRQERFIKRVVDGLSDPRVTFEIRSIWVSYWSQADKSLGQKI  281

Query  224  ASRLNIRPTM  195
            ASRLN+RP +
Sbjct  282  ASRLNVRPNI  291



>ref|XP_010536470.1| PREDICTED: catalase-2-like [Tarenaya hassleriana]
Length=492

 Score =   315 bits (806),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 140/190 (74%), Positives = 170/190 (89%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGR+VLN+NIDNFFAENE VA  PA +VPG+Y+SDDK+LQ RIF+YADT RHRLGPNY+ 
Sbjct  303  VGRLVLNKNIDNFFAENEQVAFCPALVVPGVYYSDDKLLQTRIFSYADTQRHRLGPNYLQ  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LPVNAPKC +HNN +DG+MNF+HRDEEV+YFPS+FD  R+AERFP+P  I +GRR+KC+I
Sbjct  363  LPVNAPKCVHHNNHHDGFMNFMHRDEEVNYFPSRFDPVRHAERFPSPPAICSGRREKCII  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            EKENNFKQPG+RYRSWAPDRQ+RF+ RWV++LS+ R THEIRS WISY +QAD+SLGQK+
Sbjct  423  EKENNFKQPGERYRSWAPDRQERFLKRWVEALSDKRCTHEIRSIWISYWSQADKSLGQKL  482

Query  224  ASRLNIRPTM  195
            ASRLN+RP+ 
Sbjct  483  ASRLNVRPSF  492



>emb|CAD42908.1| catalase [Prunus persica]
Length=492

 Score =   315 bits (806),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 138/190 (73%), Positives = 174/190 (92%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGR+VLN+NIDNFFAENE +A  PA +VPG+Y+SDDK+LQ RIF+Y+DT RHRLGPNY+ 
Sbjct  303  VGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQ  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LPVNAPKC++HNN ++G+MNF+HRDEEV+YFPS++D  R+AERFP P  I++G+R+KC+I
Sbjct  363  LPVNAPKCSHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAERFPIPPNILSGKREKCII  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            EKENNFKQPG+RYRSWAPDRQ+RFI+RWV +LS+PRVTHEIRS WISY +QAD+SLGQK+
Sbjct  423  EKENNFKQPGERYRSWAPDRQERFIHRWVDALSDPRVTHEIRSVWISYWSQADKSLGQKL  482

Query  224  ASRLNIRPTM  195
            ASRLN+RP++
Sbjct  483  ASRLNVRPSI  492



>ref|NP_001289779.1| catalase isozyme 1 [Nelumbo nucifera]
 gb|ADY11209.1| catalase [Nelumbo nucifera]
Length=492

 Score =   314 bits (805),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 137/190 (72%), Positives = 172/190 (91%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGR+VLN+NIDNFFAENE +A  P  +VPG+Y+SDDK+LQ RIF+Y+DT RHRLGPNY+L
Sbjct  303  VGRLVLNKNIDNFFAENEQLAFCPGIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLL  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LP NAPKCA+HNN ++G+MNF+HR+EEV+YFPS++D  R+AER+P P +I TG+R+KCVI
Sbjct  363  LPANAPKCAHHNNHHEGFMNFLHREEEVNYFPSRYDPVRHAERYPIPPQICTGKREKCVI  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            EKENNFKQPG+RYRSWAPDRQ+RFI RW+ +LS+PRVTHEIRS WISY +QAD+SLGQK+
Sbjct  423  EKENNFKQPGERYRSWAPDRQERFIKRWIDALSDPRVTHEIRSIWISYWSQADKSLGQKL  482

Query  224  ASRLNIRPTM  195
            ASRLN++P+M
Sbjct  483  ASRLNVKPSM  492



>gb|KJB57963.1| hypothetical protein B456_009G187600 [Gossypium raimondii]
Length=492

 Score =   314 bits (805),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 136/190 (72%), Positives = 173/190 (91%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGR+VLN+NIDNFFAENE +A  PA +VPGIY+SDDK+LQ R+F+Y+DT RHRLGPNY+ 
Sbjct  303  VGRLVLNKNIDNFFAENEQLAFCPAIVVPGIYYSDDKLLQTRVFSYSDTQRHRLGPNYLQ  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LP NAPKCA+HNN ++G+MNF+HRDEE++YFPS++D +R+AERFP P  + TG+R+KC+I
Sbjct  363  LPANAPKCAHHNNHHEGFMNFMHRDEEINYFPSRYDPSRHAERFPIPPALCTGKREKCII  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            EKENNFKQPG+RYRSWAPDRQ+RFINRWV ++S+PRVTHEIRS WI+Y +QAD+SLGQK+
Sbjct  423  EKENNFKQPGERYRSWAPDRQERFINRWVDAMSDPRVTHEIRSIWITYWSQADKSLGQKL  482

Query  224  ASRLNIRPTM  195
            ASRLN+RP++
Sbjct  483  ASRLNVRPSI  492



>ref|XP_002306976.2| catalase family protein [Populus trichocarpa]
 gb|EEE93972.2| catalase family protein [Populus trichocarpa]
Length=492

 Score =   314 bits (805),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 139/190 (73%), Positives = 171/190 (90%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGR+VLN+NIDNFFAENE +A  PA +VPGIY+SDDK+LQ RIF+YADT RHRLGPNY+ 
Sbjct  303  VGRLVLNKNIDNFFAENEQLAFCPAIVVPGIYYSDDKLLQTRIFSYADTQRHRLGPNYLQ  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LPVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS+ D +R+AERFP P  + +GRR+KC+I
Sbjct  363  LPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRHDPSRHAERFPIPSAVCSGRREKCII  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            EKENNFKQPG+RYRSWAPDRQ+RF+ RWV +LSEPRVTHE+RS WISY +QAD+SLGQK+
Sbjct  423  EKENNFKQPGERYRSWAPDRQERFVRRWVDALSEPRVTHEVRSIWISYWSQADKSLGQKL  482

Query  224  ASRLNIRPTM  195
            AS LN+RP++
Sbjct  483  ASHLNVRPSV  492



>emb|CDP07287.1| unnamed protein product [Coffea canephora]
Length=492

 Score =   313 bits (803),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 141/190 (74%), Positives = 170/190 (89%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGR+VLN+NIDNFFAENE +A  PA IVPGIY+SDDK+LQ RIF+YADT RHRLGPNY+ 
Sbjct  303  VGRLVLNKNIDNFFAENEQLAFCPAIIVPGIYYSDDKLLQTRIFSYADTQRHRLGPNYLQ  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LP NAPKCA+HNN +DG+MNF+HRDEEV+YFPS++D  R+AER P P  +++G+RDKCVI
Sbjct  363  LPANAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPVRHAERHPIPPPVLSGKRDKCVI  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            +KENNFKQPG+RYRSWAPDRQ+RFI RWV +LS+ RVTHEIRS WISY +QAD+SLGQK+
Sbjct  423  QKENNFKQPGERYRSWAPDRQERFICRWVDALSDARVTHEIRSIWISYWSQADKSLGQKI  482

Query  224  ASRLNIRPTM  195
            A+RLN+RPTM
Sbjct  483  ATRLNVRPTM  492



>sp|P55311.1|CATA_SOLME RecName: Full=Catalase [Solanum melongena]
 emb|CAA50644.1| catalase [Solanum melongena]
Length=492

 Score =   313 bits (803),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 141/190 (74%), Positives = 168/190 (88%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGR+VLN+NIDNFFAENE +A +P HIVPG+Y+S+DK+LQ RIFAYADT RHR+GPNYM 
Sbjct  303  VGRLVLNRNIDNFFAENEQLAFNPGHIVPGVYYSEDKLLQTRIFAYADTQRHRIGPNYMQ  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LPVNAPKCA+HNN  DG MNF+HRDEEVDY PS+FD  R AE++P P  ++TGRR+KCVI
Sbjct  363  LPVNAPKCAHHNNHRDGAMNFMHRDEEVDYLPSRFDPCRPAEQYPIPSCVLTGRREKCVI  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
             KENNFKQ G+RYR+W PDRQDR+IN+WV+SLS+PRVTHEIRS WISYL+QAD+S GQKV
Sbjct  423  PKENNFKQAGERYRTWEPDRQDRYINKWVESLSDPRVTHEIRSIWISYLSQADKSCGQKV  482

Query  224  ASRLNIRPTM  195
            ASRL ++PTM
Sbjct  483  ASRLLVKPTM  492



>ref|XP_009413057.1| PREDICTED: catalase isozyme 2-like [Musa acuminata subsp. malaccensis]
Length=492

 Score =   313 bits (802),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 139/190 (73%), Positives = 170/190 (89%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGRMVLN+NIDNFF ENE +A  PA IVPGIY+SDDK+LQ RIF+Y+DT RHRLGPNY++
Sbjct  303  VGRMVLNKNIDNFFNENEQLAFCPAIIVPGIYYSDDKLLQTRIFSYSDTQRHRLGPNYLM  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LPVNAPKCA+HNN +DG+MNF+HRDEEV+YFPS++D  R+AERFP P  +VTGRR+K +I
Sbjct  363  LPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPVRHAERFPIPSSVVTGRREKSII  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
             KENNFKQPG+RYRSWAPDRQ+RF++RWV +LS+PRVTHEIR  WISY +Q D+SLGQK+
Sbjct  423  NKENNFKQPGERYRSWAPDRQERFVHRWVDALSDPRVTHEIRDIWISYWSQCDKSLGQKI  482

Query  224  ASRLNIRPTM  195
            A+RLN++PTM
Sbjct  483  ATRLNVKPTM  492



>ref|XP_009590727.1| PREDICTED: catalase isozyme 1 [Nicotiana tomentosiformis]
Length=492

 Score =   313 bits (802),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 139/190 (73%), Positives = 169/190 (89%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGR+VLN+NIDNFFAENE +A +P HIVPG+Y+S+DK+LQ RIFAYADT RHR+GPNYM 
Sbjct  303  VGRLVLNRNIDNFFAENEQLAFNPGHIVPGVYYSEDKLLQTRIFAYADTQRHRIGPNYMQ  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LPVNAPKCA+HNN  DG MNF+HRDEEVDY PS+FD  R+AE++P P R++TGRR+ CVI
Sbjct  363  LPVNAPKCAHHNNHRDGAMNFMHRDEEVDYLPSRFDPCRHAEQYPIPSRVLTGRREMCVI  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            EKENNFKQ G+RYRSW PDRQDR++++WV+ LS+PRVT+EIRS WISYL+QAD+S GQKV
Sbjct  423  EKENNFKQAGERYRSWEPDRQDRYVSKWVEHLSDPRVTYEIRSIWISYLSQADKSCGQKV  482

Query  224  ASRLNIRPTM  195
            ASRL ++PTM
Sbjct  483  ASRLTVKPTM  492



>ref|XP_011041225.1| PREDICTED: catalase isozyme 1 [Populus euphratica]
Length=492

 Score =   313 bits (802),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 138/190 (73%), Positives = 171/190 (90%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGR+VLN+NIDNFFAENE +A  PA +VPGIY+SDDK+LQ RIF+Y+DT RHRLGPNY+ 
Sbjct  303  VGRLVLNKNIDNFFAENEQLAFCPAIVVPGIYYSDDKLLQTRIFSYSDTQRHRLGPNYLQ  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LPVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS+ D +R+AERFP P  + +GRR+KC+I
Sbjct  363  LPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRHDPSRHAERFPIPSAVCSGRREKCII  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            EKENNFKQPG+RYRSWAPDRQ+RF+ RWV +LSEPRVTHE+RS WISY +QAD+SLGQK+
Sbjct  423  EKENNFKQPGERYRSWAPDRQERFVCRWVDALSEPRVTHEVRSIWISYWSQADKSLGQKL  482

Query  224  ASRLNIRPTM  195
            AS LN+RP++
Sbjct  483  ASHLNVRPSI  492



>ref|XP_008348924.1| PREDICTED: catalase isozyme 1 [Malus domestica]
Length=492

 Score =   313 bits (801),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 139/190 (73%), Positives = 170/190 (89%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGR+VLN+NIDNFFAENE +A  PA +VPG+Y+SDDK+LQ RIF+Y+DT RHRLGPNY+ 
Sbjct  303  VGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQ  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LPVNAPKC++HNN ++G+MNF+HRDEEV+YFPS++D  R+AE FP P  I TG+R+KCVI
Sbjct  363  LPVNAPKCSHHNNHHEGFMNFMHRDEEVNYFPSRYDPARHAETFPIPSNICTGKREKCVI  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            EKENNFKQPG+RYRSWAPDRQ+RF++RWV  LSEPRVTHEIRS WISY +QADRS GQK+
Sbjct  423  EKENNFKQPGERYRSWAPDRQERFLHRWVDVLSEPRVTHEIRSIWISYWSQADRSFGQKL  482

Query  224  ASRLNIRPTM  195
            ASRLN+RP++
Sbjct  483  ASRLNVRPSI  492



>gb|KJB14249.1| hypothetical protein B456_002G115900 [Gossypium raimondii]
Length=344

 Score =   308 bits (788),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 136/190 (72%), Positives = 169/190 (89%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGR+VLN+NIDNFFAENE +A  PA +VPGIY+SDDK+LQ RIF+Y+DT RHRLGPNY+ 
Sbjct  155  VGRLVLNKNIDNFFAENEQLAFCPAIVVPGIYYSDDKLLQTRIFSYSDTQRHRLGPNYLQ  214

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LP NAPKCA+HNN ++G+MNF+HRDEE++YFPS++D  R+AE FP P  + TGRR+KC+I
Sbjct  215  LPANAPKCAHHNNHHEGFMNFMHRDEEINYFPSRYDPVRHAEMFPIPPAVCTGRREKCII  274

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            EKENNFKQPG+RYRSWA DRQ+RFI RWV +LS+PRVTHEIRS WISY +QAD+S+GQK+
Sbjct  275  EKENNFKQPGERYRSWAADRQERFICRWVDALSDPRVTHEIRSIWISYWSQADKSVGQKL  334

Query  224  ASRLNIRPTM  195
            ASRLN+RP++
Sbjct  335  ASRLNVRPSI  344



>ref|XP_008365915.1| PREDICTED: catalase isozyme 1 [Malus domestica]
Length=492

 Score =   313 bits (801),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 139/190 (73%), Positives = 170/190 (89%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGR+VLN+NIDNFFAENE +A  PA +VPG+Y+SDDK+LQ RIF+Y+DT RHRLGPNY+ 
Sbjct  303  VGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQ  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LPVNAPKC++HNN ++G+MNF+HRDEEV+YFPS++D  R+AE FP P  I TG+R+KCVI
Sbjct  363  LPVNAPKCSHHNNHHEGFMNFMHRDEEVNYFPSRYDPARHAETFPIPSNICTGKREKCVI  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            EKENNFKQPG+RYRSWAPDRQ+RF++RWV  LSEPRVTHEIRS WISY +QADRS GQK+
Sbjct  423  EKENNFKQPGERYRSWAPDRQERFLHRWVDVLSEPRVTHEIRSIWISYWSQADRSFGQKL  482

Query  224  ASRLNIRPTM  195
            ASRLN+RP++
Sbjct  483  ASRLNVRPSI  492



>ref|XP_009600533.1| PREDICTED: catalase isozyme 3-like [Nicotiana tomentosiformis]
Length=492

 Score =   313 bits (801),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 138/190 (73%), Positives = 172/190 (91%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGR+VLN+NIDNFFAENE +A  PA IVPGI++SDDK+LQ RIF+Y+DT RHRLGPNY+ 
Sbjct  303  VGRLVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRIFSYSDTQRHRLGPNYLQ  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LPVNAPKCA+HNN ++G MNF+HRDEEV+YFPS+FD  R+AE++P P RI+TG+RD+C+I
Sbjct  363  LPVNAPKCAHHNNHHEGVMNFMHRDEEVNYFPSRFDPCRHAEQYPIPPRILTGKRDRCII  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            EKENNFKQPG+RYRSW+PDRQ+RFI RW+ +LS+PRVTHEI + WISY +QAD+SLG+K+
Sbjct  423  EKENNFKQPGERYRSWSPDRQERFICRWINALSDPRVTHEIHTIWISYWSQADKSLGEKI  482

Query  224  ASRLNIRPTM  195
            ASRLN+RPTM
Sbjct  483  ASRLNVRPTM  492



>sp|P49319.2|CATA1_TOBAC RecName: Full=Catalase isozyme 1; AltName: Full=Salicylic acid-binding 
protein; Short=SABP [Nicotiana tabacum]
 gb|AAA57552.1| catalase [Nicotiana tabacum]
Length=492

 Score =   313 bits (801),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 139/190 (73%), Positives = 169/190 (89%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGR+VLN+NIDNFFAENE +A +P HIVPG+Y+S+DK+LQ RIFAYADT RHR+GPNYM 
Sbjct  303  VGRLVLNRNIDNFFAENEQLAFNPGHIVPGLYYSEDKLLQTRIFAYADTQRHRIGPNYMQ  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LPVNAPKCA+HNN  DG MNF+HRDEEVDY PS+FD  R+AE++P P R++TGRR+ CVI
Sbjct  363  LPVNAPKCAHHNNHRDGAMNFMHRDEEVDYLPSRFDPCRHAEQYPIPSRVLTGRREMCVI  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            EKENNFKQ G+RYRSW PDRQDR++++WV+ LS+PRVT+EIRS WISYL+QAD+S GQKV
Sbjct  423  EKENNFKQAGERYRSWEPDRQDRYVSKWVEHLSDPRVTYEIRSIWISYLSQADKSCGQKV  482

Query  224  ASRLNIRPTM  195
            ASRL ++PTM
Sbjct  483  ASRLTLKPTM  492



>ref|XP_009792372.1| PREDICTED: catalase isozyme 1 [Nicotiana sylvestris]
Length=492

 Score =   312 bits (800),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 139/190 (73%), Positives = 169/190 (89%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGR+VLN+NIDNFFAENE +A +P HIVPG+Y+S+DK+LQ RIFAYADT RHR+GPNYM 
Sbjct  303  VGRLVLNRNIDNFFAENEQLAFNPGHIVPGLYYSEDKLLQTRIFAYADTQRHRIGPNYMQ  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LPVNAPKCA+HNN  DG MNF+HRDEEVDY PS+FD  R+AE++P P R++TGRR+ CVI
Sbjct  363  LPVNAPKCAHHNNHRDGAMNFMHRDEEVDYLPSRFDPCRHAEQYPIPSRVLTGRREMCVI  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            EKENNFKQ G+RYRSW PDRQDR++++WV+ LS+PRVT+EIRS WISYL+QAD+S GQKV
Sbjct  423  EKENNFKQAGERYRSWEPDRQDRYVSKWVEHLSDPRVTYEIRSIWISYLSQADKSCGQKV  482

Query  224  ASRLNIRPTM  195
            ASRL ++PTM
Sbjct  483  ASRLTLKPTM  492



>ref|XP_008802866.1| PREDICTED: catalase isozyme 1 [Phoenix dactylifera]
Length=492

 Score =   312 bits (799),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 138/190 (73%), Positives = 170/190 (89%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGRM+LN+NIDNFF+ENE +A  PA +VPGIY+SDDK+LQ RIF+YADT RHRLGPNY++
Sbjct  303  VGRMILNKNIDNFFSENEQLAFCPAIVVPGIYYSDDKLLQTRIFSYADTQRHRLGPNYLM  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LP NAPKCA+HNN +DG+MNF+HRDEEV+YFPS++D  R+AE FP P  ++TGRR+KCVI
Sbjct  363  LPANAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPVRHAETFPIPSCVLTGRREKCVI  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
             KENNFKQPG+RYRSWAPDRQ RFI RWV++LS+PRVT+EIRS WISY +Q DRSLGQK+
Sbjct  423  HKENNFKQPGERYRSWAPDRQGRFICRWVEALSDPRVTYEIRSIWISYWSQCDRSLGQKI  482

Query  224  ASRLNIRPTM  195
            A+RLN++P+M
Sbjct  483  ATRLNVKPSM  492



>ref|XP_010061175.1| PREDICTED: catalase-like [Eucalyptus grandis]
Length=492

 Score =   312 bits (799),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 138/190 (73%), Positives = 171/190 (90%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGR+VLN+NIDNFFAENE +A  PA +VPG+Y+SDDK+LQ+RIF+YADT RHRLGPNY+ 
Sbjct  303  VGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQSRIFSYADTQRHRLGPNYLQ  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LPVNAPKC +HNN ++G MNF+HRDEEV+YFPS+FD+ R+AE+FP P  ++ G+RD+C+I
Sbjct  363  LPVNAPKCTHHNNHHEGLMNFMHRDEEVNYFPSRFDSVRHAEKFPIPPPVLNGKRDRCMI  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            EKENNFKQPG+RYRSWAPDRQ+RFI RWV++LS+PRVT EIRS WISY TQAD+SLGQK+
Sbjct  423  EKENNFKQPGERYRSWAPDRQERFIGRWVEALSDPRVTQEIRSIWISYWTQADKSLGQKI  482

Query  224  ASRLNIRPTM  195
            AS LN+RP+M
Sbjct  483  ASCLNVRPSM  492



>ref|XP_003631925.1| PREDICTED: catalase isozyme 1-like [Vitis vinifera]
Length=492

 Score =   312 bits (799),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 142/188 (76%), Positives = 170/188 (90%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGR+VLN+NIDNFFAENEM+A +PA +VPGIY+++DKMLQ RIFAY+DT RHRLGPNY+ 
Sbjct  303  VGRLVLNKNIDNFFAENEMLAFNPALVVPGIYYTNDKMLQGRIFAYSDTQRHRLGPNYLQ  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LPVNAPKCA+HNN +DG MNF+HRDEEVDYFPS+FD  R+AE FP P  I  G+R+K VI
Sbjct  363  LPVNAPKCAFHNNHHDGSMNFMHRDEEVDYFPSRFDPVRHAETFPIPSTICHGKREKVVI  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            EKENNFKQPG+RYRS+APDRQ+RFINRWV++LS+PRVT+EIRS WISY +QADRSLGQK+
Sbjct  423  EKENNFKQPGERYRSFAPDRQERFINRWVETLSDPRVTYEIRSIWISYWSQADRSLGQKL  482

Query  224  ASRLNIRP  201
            ASRLN++P
Sbjct  483  ASRLNVKP  490



>ref|NP_001268098.1| catalase [Vitis vinifera]
 gb|AAL83720.1|AF236127_1 catalase [Vitis vinifera]
Length=492

 Score =   312 bits (799),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 142/188 (76%), Positives = 170/188 (90%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGR+VLN+NIDNFFAENEM+A +PA +VPGIY+++DKMLQ RIFAY+DT RHRLGPNY+ 
Sbjct  303  VGRLVLNKNIDNFFAENEMLAFNPALVVPGIYYTNDKMLQGRIFAYSDTQRHRLGPNYLQ  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LPVNAPKCA+HNN +DG MNF+HRDEEVDYFPS+FD  R+AE FP P  I  G+R+K VI
Sbjct  363  LPVNAPKCAFHNNHHDGSMNFMHRDEEVDYFPSRFDPVRHAETFPIPSTICHGKREKVVI  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            EKENNFKQPG+RYRS+APDRQ+RFINRWV++LS+PRVT+EIRS WISY +QADRSLGQK+
Sbjct  423  EKENNFKQPGERYRSFAPDRQERFINRWVETLSDPRVTYEIRSIWISYWSQADRSLGQKL  482

Query  224  ASRLNIRP  201
            ASRLN++P
Sbjct  483  ASRLNVKP  490



>emb|CAI43948.1| catalase [Populus deltoides]
 gb|ABK96317.1| unknown [Populus trichocarpa x Populus deltoides]
Length=492

 Score =   311 bits (798),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 138/190 (73%), Positives = 170/190 (89%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGR+VLN+NIDNFFAENE +A  PA +VPGIY+SDDK+LQ RIF+YADT RHRLGPNY+ 
Sbjct  303  VGRLVLNKNIDNFFAENEQLAFCPAIVVPGIYYSDDKLLQTRIFSYADTQRHRLGPNYLQ  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE FP P  + +G+R+KC+I
Sbjct  363  LPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAESFPIPPAVCSGKREKCII  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            EKENNFKQPG+RYRSWAPDRQ+RFI RWV +LS+PRVTHEIRS WISY +QAD+SLGQK+
Sbjct  423  EKENNFKQPGERYRSWAPDRQERFICRWVDALSDPRVTHEIRSIWISYWSQADKSLGQKL  482

Query  224  ASRLNIRPTM  195
            ASRLN+RP++
Sbjct  483  ASRLNVRPSI  492



>ref|XP_009400996.1| PREDICTED: catalase isozyme 2 [Musa acuminata subsp. malaccensis]
Length=492

 Score =   311 bits (798),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 135/190 (71%), Positives = 172/190 (91%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGRMVLN+NIDNFF ENE +A  PA +VPG+Y+SDDK+LQ RIF+Y+DT RHRLGPNY++
Sbjct  303  VGRMVLNKNIDNFFGENEQLAFCPALVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLM  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LPVNAPKCA+HNN YDG+MNF+HRDEEVDYFPS++D  R+AERFP P R++TG+R+KC+I
Sbjct  363  LPVNAPKCAHHNNHYDGFMNFMHRDEEVDYFPSRYDPVRHAERFPIPTRVLTGKREKCMI  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
             KENNFKQPG+RYRS++PDRQ+RFI RWV++LS+P+VTHEIRS WISY +Q D+SL QK+
Sbjct  423  SKENNFKQPGERYRSFSPDRQERFIRRWVEALSDPKVTHEIRSIWISYWSQCDKSLSQKL  482

Query  224  ASRLNIRPTM  195
            A+RL+++P+M
Sbjct  483  ATRLSVKPSM  492



>ref|XP_008789355.1| PREDICTED: catalase isozyme 1-like [Phoenix dactylifera]
Length=492

 Score =   311 bits (797),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 138/190 (73%), Positives = 171/190 (90%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGRMVLN+NIDNFFAENE +A  PA +VPGI++SDDK+LQ RIF+YADT RHRLGPNY++
Sbjct  303  VGRMVLNKNIDNFFAENEQLAFCPAIVVPGIHYSDDKLLQTRIFSYADTQRHRLGPNYLM  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LP NAPKCA+HNN +DG+MNF+HRDEEV+YFPS++D  R+AER P P RI+TGRR+KCVI
Sbjct  363  LPANAPKCAHHNNHHDGFMNFLHRDEEVNYFPSRYDPVRHAERCPIPSRILTGRREKCVI  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            +KENNFKQPG+RYRSW PDRQ RFI RWV++LS+PRVTHEI+S WISY +Q D+SLG+K+
Sbjct  423  QKENNFKQPGERYRSWDPDRQGRFIRRWVEALSDPRVTHEIQSIWISYWSQCDKSLGRKI  482

Query  224  ASRLNIRPTM  195
            A+RLN++P+M
Sbjct  483  ATRLNVKPSM  492



>sp|P49317.1|CATA3_NICPL RecName: Full=Catalase isozyme 3 [Nicotiana plumbaginifolia]
 emb|CAA85426.1| catalase [Nicotiana plumbaginifolia]
Length=492

 Score =   311 bits (797),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 138/190 (73%), Positives = 170/190 (89%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGR+VLN+NIDNFFAENE +A  PA +VPG+Y SDDK+LQ RIF+Y+D  RHRLGPNY+ 
Sbjct  303  VGRLVLNKNIDNFFAENEQLAFWPAIVVPGVYCSDDKLLQTRIFSYSDAQRHRLGPNYLQ  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LPVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS+FD  R+AE++P P  ++TG+RDKC+I
Sbjct  363  LPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPCRHAEQYPIPPCVLTGKRDKCII  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            EKENNFKQPG+RYRSWAPDRQ+RFI RWV +LS+PRVTHEIRS W SY +QAD++LGQK+
Sbjct  423  EKENNFKQPGERYRSWAPDRQERFICRWVDALSDPRVTHEIRSIWFSYWSQADKTLGQKI  482

Query  224  ASRLNIRPTM  195
            ASRLN+RPTM
Sbjct  483  ASRLNVRPTM  492



>ref|XP_011034872.1| PREDICTED: catalase isozyme 1-like [Populus euphratica]
Length=492

 Score =   311 bits (797),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 137/190 (72%), Positives = 170/190 (89%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGR+VLN+NIDNFFAENE +A  PA +VPGIY+SDDK+LQ RIF+YADT RHRLGPNY+ 
Sbjct  303  VGRLVLNKNIDNFFAENEQLAFCPAIVVPGIYYSDDKLLQTRIFSYADTQRHRLGPNYLQ  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE FP P  + +G+R+KC+I
Sbjct  363  LPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAESFPIPPAVCSGKREKCII  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            EKENNFKQPG+RYRSWAPDRQ+RF+ RWV +LS+PRVTHEIRS WISY +QAD+SLGQK+
Sbjct  423  EKENNFKQPGERYRSWAPDRQERFVCRWVDALSDPRVTHEIRSIWISYWSQADKSLGQKL  482

Query  224  ASRLNIRPTM  195
            ASRLN+RP++
Sbjct  483  ASRLNVRPSI  492



>ref|XP_002301920.1| catalase family protein [Populus trichocarpa]
 gb|ABK96479.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|EEE81193.1| catalase family protein [Populus trichocarpa]
Length=492

 Score =   311 bits (797),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 137/190 (72%), Positives = 170/190 (89%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGR+VLN+NIDNFFAENE +A  PA +VPG+Y+SDDK+LQ RIF+YADT RHRLGPNY+ 
Sbjct  303  VGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYADTQRHRLGPNYLQ  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE FP P  + +G+R+KC+I
Sbjct  363  LPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAESFPIPPAVCSGKREKCII  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            EKENNFKQPG+RYRSWAPDRQ+RFI RWV +LS+PRVTHEIRS WISY +QAD+SLGQK+
Sbjct  423  EKENNFKQPGERYRSWAPDRQERFICRWVDALSDPRVTHEIRSIWISYWSQADKSLGQKL  482

Query  224  ASRLNIRPTM  195
            ASRLN+RP++
Sbjct  483  ASRLNVRPSI  492



>gb|AHF27428.1| catalase, partial [Cucurbita moschata]
 gb|AHF27431.1| catalase, partial [Cucurbita maxima]
Length=344

 Score =   306 bits (784),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 135/190 (71%), Positives = 169/190 (89%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGRMVLN+NIDNFFAENE +A  PA IVPG+Y+SDDK+LQ RIF+YADT RHRLGPNY+ 
Sbjct  155  VGRMVLNKNIDNFFAENEQLAFCPAIIVPGVYYSDDKLLQTRIFSYADTQRHRLGPNYLQ  214

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS+FD +R+AER+P P  + +G+R++C+I
Sbjct  215  LPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPSRHAERYPHPPAVCSGKRERCII  274

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            EKENNFK+PG+RYRSW PDRQ+RF+ RWV +LS+ RVTHEIRS WISY +QADRSLGQK+
Sbjct  275  EKENNFKEPGERYRSWTPDRQERFVRRWVDALSDTRVTHEIRSIWISYWSQADRSLGQKL  334

Query  224  ASRLNIRPTM  195
            AS LN+RP++
Sbjct  335  ASHLNVRPSI  344



>ref|XP_010242894.1| PREDICTED: catalase isozyme 1-like isoform X1 [Nelumbo nucifera]
Length=492

 Score =   311 bits (797),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 138/190 (73%), Positives = 170/190 (89%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGR+VLN+NIDNFFAENE +A  P  +VPGIY+SDDK+LQ RIF+Y+DT RHRLGPNY++
Sbjct  303  VGRLVLNKNIDNFFAENEQLAFCPGVVVPGIYYSDDKLLQTRIFSYSDTQRHRLGPNYLM  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LP NAPKCA+HNN +DG+MNF+HRDEEV+YFPS++D  R+AERFP P RI TG+R+KCVI
Sbjct  363  LPANAPKCAHHNNHHDGFMNFLHRDEEVNYFPSRYDPVRHAERFPIPPRICTGKREKCVI  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            EKENNFKQPG+RYRS+ PDRQ+RFI RW  +LS+PRVTHEIRS WISY +QAD+SLGQK+
Sbjct  423  EKENNFKQPGERYRSFDPDRQERFIKRWFDALSDPRVTHEIRSIWISYWSQADKSLGQKL  482

Query  224  ASRLNIRPTM  195
            A+RLN++P+M
Sbjct  483  ATRLNVKPSM  492



>ref|XP_009773579.1| PREDICTED: catalase isozyme 3-like [Nicotiana sylvestris]
Length=492

 Score =   311 bits (797),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 138/190 (73%), Positives = 172/190 (91%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGR+VLN+NIDNFFAENE +A  PA IVPGI++SDDK+LQ RIF+Y+DT RHRLGPNY+ 
Sbjct  303  VGRLVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRIFSYSDTQRHRLGPNYLQ  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LPVNAPKCA+HNN ++G MNF++RDEEV+YFPS+FD  R+AE++P P RI+TG+RD+C+I
Sbjct  363  LPVNAPKCAHHNNHHEGVMNFMYRDEEVNYFPSRFDPCRHAEQYPIPPRILTGKRDRCII  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            EKENNFKQPG+RYRSW+PDRQ+RFI RW+ +LS+PRVTHEIR  WISY +QAD+SLG+K+
Sbjct  423  EKENNFKQPGERYRSWSPDRQERFICRWINALSDPRVTHEIRIIWISYWSQADKSLGEKI  482

Query  224  ASRLNIRPTM  195
            ASRLN+RPTM
Sbjct  483  ASRLNVRPTM  492



>ref|XP_011074091.1| PREDICTED: catalase isozyme 3 isoform X2 [Sesamum indicum]
Length=492

 Score =   311 bits (796),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 139/190 (73%), Positives = 171/190 (90%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGR+VLN+NIDNFFAENE +A  PA IVPGIY+SDDK+LQ RIF+YADT RHRLGPNY+ 
Sbjct  303  VGRLVLNKNIDNFFAENEQLAFCPAIIVPGIYYSDDKLLQTRIFSYADTQRHRLGPNYLQ  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LPVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D +R+AER+P P  +++G+R K  I
Sbjct  363  LPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPSRHAERYPIPPVVLSGKRGKICI  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            EKENNFKQPGDRYRSWAPDRQ+RFI RWV++LS+PR+THEIRS W+SY +QAD+SLGQK+
Sbjct  423  EKENNFKQPGDRYRSWAPDRQERFIRRWVEALSDPRLTHEIRSIWVSYWSQADKSLGQKL  482

Query  224  ASRLNIRPTM  195
            ASRLN+RP M
Sbjct  483  ASRLNVRPAM  492



>ref|XP_011074092.1| PREDICTED: catalase isozyme 3 isoform X3 [Sesamum indicum]
Length=492

 Score =   311 bits (796),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 139/190 (73%), Positives = 171/190 (90%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGR+VLN+NIDNFFAENE +A  PA IVPGIY+SDDK+LQ RIF+YADT RHRLGPNY+ 
Sbjct  303  VGRLVLNKNIDNFFAENEQLAFCPAIIVPGIYYSDDKLLQTRIFSYADTQRHRLGPNYLQ  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LPVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D +R+AER+P P  +++G+R K  I
Sbjct  363  LPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPSRHAERYPIPPVVLSGKRGKICI  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            EKENNFKQPGDRYRSWAPDRQ+RFI RWV++LS+PR+THEIRS W+SY +QAD+SLGQK+
Sbjct  423  EKENNFKQPGDRYRSWAPDRQERFIRRWVEALSDPRLTHEIRSIWVSYWSQADKSLGQKL  482

Query  224  ASRLNIRPTM  195
            AS LN+RPTM
Sbjct  483  ASHLNVRPTM  492



>gb|ACJ11733.1| catalase [Gossypium hirsutum]
Length=492

 Score =   311 bits (796),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 138/190 (73%), Positives = 170/190 (89%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGR+VLN+NIDNFFAENE +A  PA +VPGIY+SDDK+LQ RIF+YADT RHRLGPNY+ 
Sbjct  303  VGRLVLNKNIDNFFAENEQLAFCPAIVVPGIYYSDDKLLQTRIFSYADTQRHRLGPNYLQ  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LP NAPKCA+HNN ++G+MNF+HRDEE++YFPS++D  R+AE FP P  + TGRR+KC+I
Sbjct  363  LPANAPKCAHHNNHHEGFMNFMHRDEEINYFPSRYDPVRHAEMFPIPPAVCTGRREKCII  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            EKENNFKQPG+RYRSWA DRQ+RFI RWV++LS+PRVTHEIRS WISY +QAD+SLGQK+
Sbjct  423  EKENNFKQPGERYRSWAADRQERFICRWVEALSDPRVTHEIRSIWISYWSQADKSLGQKL  482

Query  224  ASRLNIRPTM  195
            ASRLN+RP++
Sbjct  483  ASRLNVRPSI  492



>gb|AIS20825.1| CAT [Pyrus x bretschneideri]
Length=492

 Score =   310 bits (795),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 137/190 (72%), Positives = 171/190 (90%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGR+VLN+NIDNFFAENE +A  PA +VPG+Y+SDDK+LQ RIF+Y+DT RHRLGPNY+ 
Sbjct  303  VGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQ  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LPVNAPKC++HNN ++G+MNF+HRDEEV+YFPS++D  R+AE FP P  I TG+R+KCVI
Sbjct  363  LPVNAPKCSHHNNHHEGFMNFMHRDEEVNYFPSRYDPARHAETFPIPSNICTGKREKCVI  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            EKENNFKQPG+RYRSWAPDRQ+RF++RWV +LS+PRVT+EIRS WISY +QADRS GQK+
Sbjct  423  EKENNFKQPGERYRSWAPDRQERFLHRWVDALSDPRVTYEIRSIWISYWSQADRSFGQKL  482

Query  224  ASRLNIRPTM  195
            ASRLN+RP++
Sbjct  483  ASRLNVRPSI  492



>gb|ADC95629.1| catalase [Bruguiera gymnorhiza]
Length=492

 Score =   310 bits (795),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 139/190 (73%), Positives = 168/190 (88%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGR+VLN+NIDNFFAENE +A  PA IVPGIY+SDDK+LQ RIF+YADT RHRLGPNY+ 
Sbjct  303  VGRLVLNKNIDNFFAENEQLAFCPAIIVPGIYYSDDKLLQTRIFSYADTQRHRLGPNYLQ  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LP NAPKCA+HNN +DG+MNF+HRDEEV+Y PS+FD  R+AERFP P  + TGRR+KC+I
Sbjct  363  LPANAPKCAHHNNHHDGFMNFMHRDEEVNYLPSRFDPVRHAERFPIPPAVCTGRREKCII  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            EKENNFKQPG+RYRSWAPDRQ+RF +RWV++LS+PRVTHEI S WISY TQ D+ LGQK+
Sbjct  423  EKENNFKQPGERYRSWAPDRQERFTHRWVEALSDPRVTHEICSIWISYWTQCDKFLGQKL  482

Query  224  ASRLNIRPTM  195
            A+RLN+RP++
Sbjct  483  ATRLNVRPSI  492



>gb|AAM97542.1| catalase 3 [Capsicum annuum]
Length=492

 Score =   310 bits (794),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 136/190 (72%), Positives = 171/190 (90%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGR+VLN+NIDNFF ENE +A  PA IVPGI++SDDK+LQ R+F+YADT RHRLGPNY+ 
Sbjct  303  VGRLVLNKNIDNFFVENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYADTQRHRLGPNYLQ  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS+FD  R+AE++P P R++ G+RD+C+I
Sbjct  363  LPPNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPCRHAEQYPIPPRVLNGKRDRCII  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            +KENNFKQPG+RYRSWAPDRQ+RFI RWV +LSEPRVTHEIR+ W+SY +QAD+SLGQK+
Sbjct  423  QKENNFKQPGERYRSWAPDRQERFICRWVDALSEPRVTHEIRTIWLSYWSQADKSLGQKL  482

Query  224  ASRLNIRPTM  195
            ASRLN++PTM
Sbjct  483  ASRLNVKPTM  492



>emb|CAC04509.1| catalase [Digitalis lanata]
Length=265

 Score =   302 bits (774),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 136/190 (72%), Positives = 167/190 (88%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGRMVLN+NIDNFFAENE +A  PA +VPG+Y+SDDK+LQ RIF+Y+DT RHRLGPNY+ 
Sbjct  76   VGRMVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQ  135

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AERFP P   + G+RD+  I
Sbjct  136  LPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPCRHAERFPHPPVALNGKRDRICI  195

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            EKENNFKQPG++YRS+ PDRQ+RFI RWV +LS+PR+THEIRS W+SY TQAD+SLGQK+
Sbjct  196  EKENNFKQPGEKYRSFPPDRQERFIKRWVDALSDPRLTHEIRSIWVSYWTQADKSLGQKL  255

Query  224  ASRLNIRPTM  195
            ASRLNIRPTM
Sbjct  256  ASRLNIRPTM  265



>ref|XP_008373403.1| PREDICTED: catalase isozyme 1 [Malus domestica]
Length=492

 Score =   310 bits (794),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 137/190 (72%), Positives = 171/190 (90%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGR+VLN+NIDNFFAENE +A  PA +VPG+Y+SDDK+LQ RIF+Y+DT RHRLGPNY+ 
Sbjct  303  VGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQ  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LPVNAPKC++HNN ++G+MNF+HRDEEV+YFPS++D  R+AE FP P  I TG+R+KCVI
Sbjct  363  LPVNAPKCSHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAETFPIPSNICTGKREKCVI  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            EKENNFKQPG+RYRSWAPDRQ+RF++RWV +LS+PRVT+EIRS WISY +QADRS GQK+
Sbjct  423  EKENNFKQPGERYRSWAPDRQERFLHRWVDALSDPRVTYEIRSIWISYWSQADRSFGQKL  482

Query  224  ASRLNIRPTM  195
            ASRLN+RP++
Sbjct  483  ASRLNVRPSI  492



>sp|P49316.1|CATA2_NICPL RecName: Full=Catalase isozyme 2 [Nicotiana plumbaginifolia]
 emb|CAA85425.1| catalase [Nicotiana plumbaginifolia]
Length=492

 Score =   310 bits (794),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 138/190 (73%), Positives = 168/190 (88%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGR+VLN+NIDNFFAENE +A +P HIVPG+Y+S+DK+LQ RIFAYADT RHR+GPNYM 
Sbjct  303  VGRLVLNRNIDNFFAENEQLAFNPGHIVPGLYYSEDKLLQTRIFAYADTQRHRIGPNYMQ  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LPVNAPKCA+HNN  DG MNF+HRDEEVDY PS+FD  R+AE++P P R++ GRR+ CVI
Sbjct  363  LPVNAPKCAHHNNHRDGAMNFMHRDEEVDYLPSRFDPCRHAEQYPIPSRVLNGRREMCVI  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            EKENNFKQ G+RYRSW PDRQDR++++WV+ LS+PRVT+EIRS WISYL+QAD+S GQKV
Sbjct  423  EKENNFKQAGERYRSWEPDRQDRYVSKWVEHLSDPRVTYEIRSIWISYLSQADKSCGQKV  482

Query  224  ASRLNIRPTM  195
            ASRL ++PTM
Sbjct  483  ASRLTLKPTM  492



>sp|O24339.1|CATA_SOLAP RecName: Full=Catalase [Soldanella alpina]
 emb|CAB16749.1| catalase [Soldanella alpina]
Length=492

 Score =   310 bits (793),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 140/190 (74%), Positives = 170/190 (89%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGR+VLN+NIDNFFAENE +A  PA IVPG+Y+SDDK+LQ RIF+YADT RHRLGPNY+ 
Sbjct  303  VGRLVLNKNIDNFFAENEQLAFCPALIVPGVYYSDDKLLQTRIFSYADTQRHRLGPNYLQ  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LP NAPKCA+HNN ++G MNF+HRDEEV+YFPS+FD  R+AER P P  ++TG+RD+C+I
Sbjct  363  LPPNAPKCAHHNNHHEGLMNFMHRDEEVNYFPSRFDPVRHAERHPIPPPVLTGKRDRCMI  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            EKENNFKQPG+RYR++APDRQ+RF+ RWV +LS+PRVTHEIRS WISY TQAD+SLGQK+
Sbjct  423  EKENNFKQPGERYRTFAPDRQERFVCRWVDALSDPRVTHEIRSIWISYWTQADKSLGQKL  482

Query  224  ASRLNIRPTM  195
            ASRLN+RPTM
Sbjct  483  ASRLNVRPTM  492



>dbj|BAC79443.1| catalase [Acacia ampliceps]
Length=492

 Score =   310 bits (793),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 140/190 (74%), Positives = 167/190 (88%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGR+VLN+NIDNFFAENE +A  P+ +VPGIYFSDDK+LQARIFAY DT RHR+GPNY+ 
Sbjct  303  VGRLVLNRNIDNFFAENEQLAFSPSLVVPGIYFSDDKVLQARIFAYGDTQRHRIGPNYLQ  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LPVNAPKCA+HNN YDG MNF+HRDEEVDYFPS++D  R+AE+FP P   + GRRD+ +I
Sbjct  363  LPVNAPKCAHHNNHYDGTMNFMHRDEEVDYFPSRYDTARHAEKFPIPPVNLIGRRDRRII  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            EKENNFKQPGD YR+WAPDRQ+RFI RW+  LS+P+VTHE+RS WISYL+QADRSLGQKV
Sbjct  423  EKENNFKQPGDLYRTWAPDRQERFIRRWIGVLSDPKVTHEVRSIWISYLSQADRSLGQKV  482

Query  224  ASRLNIRPTM  195
            AS LN+RP++
Sbjct  483  ASHLNMRPSI  492



>ref|NP_001237571.1| catalase-4 [Glycine max]
 sp|O48561.1|CATA4_SOYBN RecName: Full=Catalase-4 [Glycine max]
 gb|AAB88172.1| catalase [Glycine max]
 gb|KHN33801.1| Catalase-4 [Glycine soja]
Length=492

 Score =   309 bits (792),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 139/190 (73%), Positives = 166/190 (87%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGR+VLN+NIDNFFAENE +A  PA +VPG+Y+SDDKMLQ RIF+YAD+ RHRLGPNY+ 
Sbjct  303  VGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKMLQTRIFSYADSQRHRLGPNYLQ  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AERFP P  I +GRR+KC I
Sbjct  363  LPANAPKCAHHNNHHEGFMNFIHRDEEVNYFPSRYDPVRHAERFPIPPAICSGRREKCGI  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            EKENNFKQPG+RYRSWAPDRQDRF  RWV +LS+PRVTHEIRS WISY +QADRSLGQK+
Sbjct  423  EKENNFKQPGERYRSWAPDRQDRFARRWVDALSDPRVTHEIRSVWISYWSQADRSLGQKI  482

Query  224  ASRLNIRPTM  195
            AS L+ RP +
Sbjct  483  ASHLSTRPNI  492



>gb|KCW68095.1| hypothetical protein EUGRSUZ_F01777 [Eucalyptus grandis]
Length=584

 Score =   312 bits (799),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 138/190 (73%), Positives = 171/190 (90%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGR+VLN+NIDNFFAENE +A  PA +VPG+Y+SDDK+LQ+RIF+YADT RHRLGPNY+ 
Sbjct  395  VGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQSRIFSYADTQRHRLGPNYLQ  454

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LPVNAPKC +HNN ++G MNF+HRDEEV+YFPS+FD+ R+AE+FP P  ++ G+RD+C+I
Sbjct  455  LPVNAPKCTHHNNHHEGLMNFMHRDEEVNYFPSRFDSVRHAEKFPIPPPVLNGKRDRCMI  514

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            EKENNFKQPG+RYRSWAPDRQ+RFI RWV++LS+PRVT EIRS WISY TQAD+SLGQK+
Sbjct  515  EKENNFKQPGERYRSWAPDRQERFIGRWVEALSDPRVTQEIRSIWISYWTQADKSLGQKI  574

Query  224  ASRLNIRPTM  195
            AS LN+RP+M
Sbjct  575  ASCLNVRPSM  584



>gb|KHG25152.1| Catalase isozyme 1 [Gossypium arboreum]
Length=492

 Score =   309 bits (792),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 137/190 (72%), Positives = 169/190 (89%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGR+VLN+NIDNFFAENE +A  PA +VPGIY+SDDK+LQ RIF+YADT RHRLGPNY+ 
Sbjct  303  VGRLVLNKNIDNFFAENEQLAFCPAIVVPGIYYSDDKLLQTRIFSYADTQRHRLGPNYLQ  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LP NAPKCA+HNN ++G+MNF+HRDEE++YFPS++D  R+AE FP P  + TGRR+KC+I
Sbjct  363  LPANAPKCAHHNNHHEGFMNFMHRDEEINYFPSRYDPVRHAEMFPIPPAVCTGRREKCII  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            EKENNFKQPG+RYRSWA DRQ+RFI RWV++ S+PRVTHEIRS WISY +QAD+SLGQK+
Sbjct  423  EKENNFKQPGERYRSWAADRQERFICRWVEAFSDPRVTHEIRSIWISYWSQADKSLGQKL  482

Query  224  ASRLNIRPTM  195
            ASRLN+RP++
Sbjct  483  ASRLNVRPSI  492



>gb|AGV54297.1| peroxisomal catalase [Phaseolus vulgaris]
Length=492

 Score =   309 bits (791),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 138/190 (73%), Positives = 167/190 (88%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGR+VLN+NIDNFFAENE +A  PA +VPG+Y+SDDKMLQ RIF+YAD+ RHRLGPNY+ 
Sbjct  303  VGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKMLQTRIFSYADSQRHRLGPNYLQ  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D+ R+AE FP P  I +GRR+KC I
Sbjct  363  LPANAPKCAHHNNHHEGFMNFIHRDEEVNYFPSRYDSVRHAESFPIPPAICSGRREKCGI  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            EKENNFKQ G+R+RSWAPDRQDRFI RWV +LS+PRVTHEIRS WISY +QADRSLGQK+
Sbjct  423  EKENNFKQAGERFRSWAPDRQDRFIRRWVDALSDPRVTHEIRSVWISYWSQADRSLGQKI  482

Query  224  ASRLNIRPTM  195
            AS LN+RP +
Sbjct  483  ASHLNMRPNI  492



>ref|NP_001240021.1| catalase [Glycine max]
 dbj|BAG09375.1| peroxisomal catalase [Glycine max]
 gb|KHN20113.1| Catalase-4 [Glycine soja]
Length=492

 Score =   309 bits (791),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 139/190 (73%), Positives = 167/190 (88%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGR+VLN+NIDNFFAENE +A  PA +VPG+Y+SDDKMLQ RIF+YAD+ RHRLGPNY+ 
Sbjct  303  VGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKMLQTRIFSYADSQRHRLGPNYLQ  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE FP P  I +GRR+KC I
Sbjct  363  LPANAPKCAHHNNHHEGFMNFIHRDEEVNYFPSRYDPVRHAETFPIPPAICSGRREKCGI  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            EKENNFKQPG+RYRSWAPDRQDRF  RWV +LS+PRVTHEIRS WISY +QADRSLGQK+
Sbjct  423  EKENNFKQPGERYRSWAPDRQDRFNRRWVDALSDPRVTHEIRSVWISYWSQADRSLGQKI  482

Query  224  ASRLNIRPTM  195
            ASRL++RP +
Sbjct  483  ASRLSMRPNI  492



>ref|XP_007136018.1| hypothetical protein PHAVU_009G011100g [Phaseolus vulgaris]
 gb|ESW08012.1| hypothetical protein PHAVU_009G011100g [Phaseolus vulgaris]
Length=492

 Score =   309 bits (791),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 138/190 (73%), Positives = 167/190 (88%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGR+VLN+NIDNFFAENE +A  PA +VPG+Y+SDDKMLQ RIF+YAD+ RHRLGPNY+ 
Sbjct  303  VGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKMLQTRIFSYADSQRHRLGPNYLQ  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D+ R+AE FP P  I +GRR+KC I
Sbjct  363  LPANAPKCAHHNNHHEGFMNFIHRDEEVNYFPSRYDSVRHAESFPIPPAICSGRREKCGI  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            EKENNFKQ G+R+RSWAPDRQDRFI RWV +LS+PRVTHEIRS WISY +QADRSLGQK+
Sbjct  423  EKENNFKQAGERFRSWAPDRQDRFIRRWVDALSDPRVTHEIRSVWISYWSQADRSLGQKI  482

Query  224  ASRLNIRPTM  195
            AS LN+RP +
Sbjct  483  ASHLNMRPNI  492



>gb|AJE26131.1| catalase [Salix matsudana]
Length=492

 Score =   309 bits (791),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 136/190 (72%), Positives = 169/190 (89%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGR+VLN+NIDNFFAENE +A  PA +VPGIY+SDDK+LQ RIF+Y+DT RHRLGPNY+ 
Sbjct  303  VGRLVLNKNIDNFFAENEQLAFCPAIVVPGIYYSDDKLLQTRIFSYSDTQRHRLGPNYLQ  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE FP P  + +G+R+KC+I
Sbjct  363  LPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAESFPIPPAVCSGKREKCII  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            EKENNFKQPG+RYRSWAPDRQ+RFI RWV +LS+PR THEIRS WISY +QAD+SLGQK+
Sbjct  423  EKENNFKQPGERYRSWAPDRQERFICRWVDALSDPRATHEIRSIWISYWSQADKSLGQKL  482

Query  224  ASRLNIRPTM  195
            ASRLN+RP++
Sbjct  483  ASRLNVRPSI  492



>ref|NP_001291326.1| catalase isozyme 1 [Sesamum indicum]
 gb|AFJ42575.1| catalase [Sesamum indicum]
Length=492

 Score =   309 bits (791),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 139/190 (73%), Positives = 171/190 (90%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGRMVLN+NIDNFFAENE +A  PA IVPGIY+SDDK+LQ RIF+YADT RHRLGPNY+ 
Sbjct  303  VGRMVLNKNIDNFFAENEQLAFCPAIIVPGIYYSDDKLLQTRIFSYADTQRHRLGPNYLQ  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D TR++E +P P  +++G+R+K  I
Sbjct  363  LPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPTRHSEMYPIPPVVLSGKREKRCI  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            EKENNFKQPG+RYRSWAPDRQ+RFI RWV++LS+PR+THEIRS WISY +QAD+SLGQK+
Sbjct  423  EKENNFKQPGERYRSWAPDRQERFIRRWVEALSDPRLTHEIRSIWISYWSQADKSLGQKL  482

Query  224  ASRLNIRPTM  195
            ASRLN+RPTM
Sbjct  483  ASRLNVRPTM  492



>gb|AAF19965.1|AF207906_1 catalase 1 [Zantedeschia aethiopica]
Length=492

 Score =   309 bits (791),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 136/190 (72%), Positives = 169/190 (89%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGRMVLN+NIDNFFAENE +A  PA IVPGIY+SDDK+LQ RIF+YADT RHRLGPNY++
Sbjct  303  VGRMVLNKNIDNFFAENEQLAFCPAIIVPGIYYSDDKLLQTRIFSYADTQRHRLGPNYLM  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE+FP P RI+ G R+KC I
Sbjct  363  LPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEQFPIPPRILNGGREKCCI  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            +KENNFKQPG++YRSWAPDRQ+RFI RW+ +LS+PRVTHEIR+ WI+Y +Q D+ LGQK+
Sbjct  423  QKENNFKQPGEKYRSWAPDRQERFIKRWIDALSDPRVTHEIRTIWITYWSQCDKFLGQKL  482

Query  224  ASRLNIRPTM  195
            ASRLNI+PT+
Sbjct  483  ASRLNIKPTL  492



>gb|ACJ73906.1| CAT2 [Solanum nigrum]
Length=315

 Score =   303 bits (775),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 138/190 (73%), Positives = 162/190 (85%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGR+VLN+NIDNFFAENE +A +P HIVPGIY+S+DK+LQ RIFAYADT RHR+GPNYM 
Sbjct  126  VGRLVLNRNIDNFFAENEQLAFNPGHIVPGIYYSEDKLLQTRIFAYADTQRHRIGPNYMQ  185

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LPVNAPKCA+HNNS DG MNF+HRDEEVDY PS+FD  R AE++P P  ++ G R  CV 
Sbjct  186  LPVNAPKCAHHNNSRDGAMNFMHRDEEVDYLPSRFDPCRPAEQYPIPSCVLNGPRTMCVT  245

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
             KENNFKQ G+RYRSW PDRQDR+IN+WV+SLS+PRVTHEI S WISYL+QAD+S GQKV
Sbjct  246  PKENNFKQAGERYRSWEPDRQDRYINKWVESLSDPRVTHEIPSIWISYLSQADKSCGQKV  305

Query  224  ASRLNIRPTM  195
            ASRL ++P M
Sbjct  306  ASRLTVKPPM  315



>gb|AGE15298.2| catalase 1 [Eriobotrya japonica]
Length=492

 Score =   308 bits (789),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 137/190 (72%), Positives = 169/190 (89%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGR+VLN+NIDNFFAENE +A  PA +VPG+Y+SDDK+LQ RIF+YADT RHRLGPNY+ 
Sbjct  303  VGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYADTQRHRLGPNYLQ  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LPVNAPKC++HNN ++G+MNF+HRDEEV+YFPS++   R+AE FP P  I+TG+RDKCVI
Sbjct  363  LPVNAPKCSHHNNHHEGFMNFMHRDEEVNYFPSRYQPARHAETFPIPSSIITGKRDKCVI  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            EKENNFKQPG+RYRSWAPDRQ+RF++RWV  LSE RVT+EIRS WISY +QADRS GQK+
Sbjct  423  EKENNFKQPGERYRSWAPDRQERFLHRWVDVLSESRVTYEIRSIWISYWSQADRSFGQKL  482

Query  224  ASRLNIRPTM  195
            A+RLN+RP++
Sbjct  483  ATRLNVRPSI  492



>ref|XP_007160597.1| hypothetical protein PHAVU_001G001000g [Phaseolus vulgaris]
 gb|ESW32591.1| hypothetical protein PHAVU_001G001000g [Phaseolus vulgaris]
Length=492

 Score =   308 bits (789),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 137/190 (72%), Positives = 169/190 (89%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGRMVLN+NIDNFFAENE +A  PA IVPG+Y+SDDK+LQ RIF+YAD+ RHRLGPNY+ 
Sbjct  303  VGRMVLNKNIDNFFAENEQLAFCPAIIVPGVYYSDDKLLQTRIFSYADSQRHRLGPNYLQ  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            +P NAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AER P P RI+ G+R+KC+I
Sbjct  363  IPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAERIPVPPRILDGKREKCMI  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            EKENNFKQPG+RYRSWA DRQ+RF+ RWV +LSEPRVTHEIRS WISY +QADRSLGQK+
Sbjct  423  EKENNFKQPGERYRSWASDRQERFLRRWVDALSEPRVTHEIRSIWISYWSQADRSLGQKI  482

Query  224  ASRLNIRPTM  195
            AS LN++P++
Sbjct  483  ASHLNLKPSI  492



>dbj|BAJ33995.1| unnamed protein product [Thellungiella halophila]
Length=492

 Score =   308 bits (789),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 134/190 (71%), Positives = 174/190 (92%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGRMVLN+NIDNFFAENE +A  PA IVPGI++SDDK+LQ R+F+YADT RHRLGPNY+ 
Sbjct  303  VGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYADTQRHRLGPNYLQ  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LPVNAPKCA+HNN +DG+MNF+HRDEEV+YFPS++D  R+AE++PTP  + +G+R++C+I
Sbjct  363  LPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTPPAVCSGKRERCII  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            EKENNFK+PG+RYRS+AP+RQ+RFI RW+++LS+PR+THEIRS WISY +QAD+SLGQK+
Sbjct  423  EKENNFKEPGERYRSFAPERQERFIRRWIEALSDPRITHEIRSIWISYWSQADKSLGQKL  482

Query  224  ASRLNIRPTM  195
            ASRLN+RP++
Sbjct  483  ASRLNVRPSI  492



>ref|XP_006412153.1| hypothetical protein EUTSA_v10024932mg [Eutrema salsugineum]
 gb|ESQ53606.1| hypothetical protein EUTSA_v10024932mg [Eutrema salsugineum]
Length=492

 Score =   308 bits (788),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 134/190 (71%), Positives = 174/190 (92%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGRMVLN+NIDNFFAENE +A  PA IVPGI++SDDK+LQ R+F+YADT RHRLGPNY+ 
Sbjct  303  VGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYADTQRHRLGPNYLQ  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LPVNAPKCA+HNN +DG+MNF+HRDEEV+YFPS++D  R+AE++PTP  + +G+R++C+I
Sbjct  363  LPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTPPAVCSGKRERCII  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            EKENNFK+PG+RYRS+AP+RQ+RFI RW+++LS+PR+THEIRS WISY +QAD+SLGQK+
Sbjct  423  EKENNFKEPGERYRSFAPERQERFIRRWIEALSDPRITHEIRSIWISYWSQADKSLGQKL  482

Query  224  ASRLNIRPTM  195
            ASRLN+RP++
Sbjct  483  ASRLNVRPSI  492



>gb|ABM47415.1| catalase [Prunus avium]
Length=492

 Score =   308 bits (788),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 139/190 (73%), Positives = 170/190 (89%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGR+VLN+NIDNFFAENE +A +PA +VPGIY+SDDK+LQ RIFAY+DT RHRLGPNYM 
Sbjct  303  VGRLVLNKNIDNFFAENEQLAFNPAFVVPGIYYSDDKLLQTRIFAYSDTQRHRLGPNYMQ  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LPVNAPKC +HNN  DG+MNF+HRDEEV+YFPS++D  R+AERFP P  I+TG+R++ VI
Sbjct  363  LPVNAPKCPHHNNHQDGFMNFMHRDEEVNYFPSRYDPVRHAERFPIPSNILTGKRERRVI  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            EKENNFKQPG+RYRSWAPDRQ+RFI R V +LS+PRV+HEIRS WISY +QAD+SLGQK+
Sbjct  423  EKENNFKQPGERYRSWAPDRQERFIRRCVDALSDPRVSHEIRSIWISYWSQADKSLGQKI  482

Query  224  ASRLNIRPTM  195
            A+RLN+RP++
Sbjct  483  ATRLNVRPSI  492



>gb|KJB14250.1| hypothetical protein B456_002G115900 [Gossypium raimondii]
Length=492

 Score =   308 bits (788),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 136/190 (72%), Positives = 169/190 (89%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGR+VLN+NIDNFFAENE +A  PA +VPGIY+SDDK+LQ RIF+Y+DT RHRLGPNY+ 
Sbjct  303  VGRLVLNKNIDNFFAENEQLAFCPAIVVPGIYYSDDKLLQTRIFSYSDTQRHRLGPNYLQ  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LP NAPKCA+HNN ++G+MNF+HRDEE++YFPS++D  R+AE FP P  + TGRR+KC+I
Sbjct  363  LPANAPKCAHHNNHHEGFMNFMHRDEEINYFPSRYDPVRHAEMFPIPPAVCTGRREKCII  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            EKENNFKQPG+RYRSWA DRQ+RFI RWV +LS+PRVTHEIRS WISY +QAD+S+GQK+
Sbjct  423  EKENNFKQPGERYRSWAADRQERFICRWVDALSDPRVTHEIRSIWISYWSQADKSVGQKL  482

Query  224  ASRLNIRPTM  195
            ASRLN+RP++
Sbjct  483  ASRLNVRPSI  492



>gb|AAC48918.1| salicylic acid binding catalase, partial [Nicotiana tabacum]
Length=489

 Score =   308 bits (788),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 137/190 (72%), Positives = 167/190 (88%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGR+VLN+NIDNFFAENE +A +P HIVPG+Y+S+DK+LQ RIFAYADT RHR+GPNYM 
Sbjct  300  VGRLVLNRNIDNFFAENEQLAFNPGHIVPGLYYSEDKLLQTRIFAYADTQRHRIGPNYMQ  359

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LPVNAPKCA+HNN  DG MNF+HRDEEVDY PS+FD  R+AE++P P R++TGRR+ CVI
Sbjct  360  LPVNAPKCAHHNNHRDGAMNFMHRDEEVDYLPSRFDPCRHAEQYPIPSRVLTGRREMCVI  419

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            EKENNFKQ G+RYRSW PDRQDR++++WV+ LS+PRVT+EIRS WI  L+QAD+S GQKV
Sbjct  420  EKENNFKQAGERYRSWEPDRQDRYVSKWVEHLSDPRVTYEIRSIWICSLSQADKSCGQKV  479

Query  224  ASRLNIRPTM  195
            ASRL ++PTM
Sbjct  480  ASRLTLKPTM  489



>gb|AAR84578.1| catalase 1a [Lotus japonicus]
Length=492

 Score =   308 bits (788),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 139/190 (73%), Positives = 168/190 (88%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGRMVLN+NIDNFFAENE +A  PA +VPGI +SDDKMLQ RIF+YAD+ RHRLGPNY+ 
Sbjct  303  VGRMVLNKNIDNFFAENEQLAFCPAIVVPGISYSDDKMLQTRIFSYADSQRHRLGPNYLQ  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AER+P P  I TG R++C I
Sbjct  363  LPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAERYPIPPAICTGSRERCAI  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            EKENNFKQPG+RYRS+APDRQDRF+ RWV +LS+PRVTHEIRSTWISY +QADRSLGQK+
Sbjct  423  EKENNFKQPGERYRSFAPDRQDRFVRRWVDALSDPRVTHEIRSTWISYWSQADRSLGQKI  482

Query  224  ASRLNIRPTM  195
            AS LN+RP++
Sbjct  483  ASHLNLRPSI  492



>ref|XP_008452956.1| PREDICTED: catalase isozyme 1 [Cucumis melo]
Length=492

 Score =   307 bits (787),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 137/190 (72%), Positives = 169/190 (89%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGRMVLN+NIDNFFAENE +A  PA IVPGIY+SDDK+LQ RIF+Y+DT RHRLGPNY+ 
Sbjct  303  VGRMVLNKNIDNFFAENEQLAFCPAIIVPGIYYSDDKLLQTRIFSYSDTQRHRLGPNYLQ  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS+FD  R+AER+P P  + TG+R++CVI
Sbjct  363  LPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPARHAERYPHPPAVCTGKRERCVI  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            +KENNFK+PG+RYRSW PDRQ+RFI RWV +LS+PRVTHEIRS WISY +QADRS+GQK+
Sbjct  423  QKENNFKEPGERYRSWTPDRQERFIRRWVDALSDPRVTHEIRSIWISYWSQADRSVGQKL  482

Query  224  ASRLNIRPTM  195
            AS LN+RP++
Sbjct  483  ASHLNVRPSI  492



>ref|XP_007018034.1| Catalase 2 [Theobroma cacao]
 gb|EOY15259.1| Catalase 2 [Theobroma cacao]
Length=492

 Score =   307 bits (787),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 136/190 (72%), Positives = 169/190 (89%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGR+VLN+NIDNFFAENE +A  PA +VPGIY+SDDK+LQ RIF+YADT RHRLGPNY+ 
Sbjct  303  VGRLVLNKNIDNFFAENEQLAFCPAIVVPGIYYSDDKLLQTRIFSYADTQRHRLGPNYLQ  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LP NAPKCA+HNN ++G+MNF+HRDEE++YFPS++D  R+AERFP P  + +GRR+KC+I
Sbjct  363  LPPNAPKCAHHNNHHEGFMNFMHRDEEINYFPSRYDPVRHAERFPIPPAVCSGRREKCII  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            EKENNFKQPG+RYRSWAPDRQ+RFI RWV +LS+PRVTHEIRS WI+Y +QA +SLGQK+
Sbjct  423  EKENNFKQPGERYRSWAPDRQERFICRWVDALSDPRVTHEIRSIWITYWSQACKSLGQKL  482

Query  224  ASRLNIRPTM  195
            ASRLN++P +
Sbjct  483  ASRLNVKPNI  492



>ref|NP_001234827.1| catalase isozyme 1 [Solanum lycopersicum]
 sp|P30264.1|CATA1_SOLLC RecName: Full=Catalase isozyme 1 [Solanum lycopersicum]
 gb|AAA34145.1| catalase [Solanum lycopersicum]
 prf||1909364A catalase
Length=492

 Score =   307 bits (787),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 139/190 (73%), Positives = 162/190 (85%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGR+VLN+NIDNFFAENE +A +P HIVPGIY+S+DK+LQ RIFAYADT RHR+GPNYM 
Sbjct  303  VGRLVLNRNIDNFFAENEQLAFNPGHIVPGIYYSEDKLLQTRIFAYADTQRHRIGPNYMQ  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LPVNAPKC +HNN  DG MN  HRDEEVDY PS+FD  R AE++P P  ++ GRR  CVI
Sbjct  363  LPVNAPKCGHHNNHRDGAMNMTHRDEEVDYLPSRFDPCRPAEQYPIPSCVLNGRRTNCVI  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
             KENNFKQ G+RYRSW PDRQDR+IN+WV+SLS+PRVTHEIRS WISYL+QAD+S GQKV
Sbjct  423  PKENNFKQAGERYRSWEPDRQDRYINKWVESLSDPRVTHEIRSIWISYLSQADKSCGQKV  482

Query  224  ASRLNIRPTM  195
            ASRL ++PTM
Sbjct  483  ASRLTVKPTM  492



>gb|ACJ76836.3| catalase [Dimocarpus longan]
Length=492

 Score =   307 bits (787),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 139/190 (73%), Positives = 163/190 (86%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGR+VLN+NIDNFF ENE +A +P  +VPGIY+SDDKMLQ RIFAY DT RHRLGPNY++
Sbjct  303  VGRLVLNRNIDNFFNENEQLAFNPGLVVPGIYYSDDKMLQCRIFAYGDTQRHRLGPNYLM  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LPVNAPKC +HNN YDG+MNF+HRDEEVDYFPSKF N  NAE+FP P RI +G+R+K  I
Sbjct  363  LPVNAPKCPHHNNHYDGFMNFMHRDEEVDYFPSKFTNVANAEKFPIPSRICSGKREKACI  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            EKENNFK PGDRYRSWAPDRQ+RFI R V  LS+PRVT E+RS W+SY +QAD+SLGQK+
Sbjct  423  EKENNFKLPGDRYRSWAPDRQERFIKRVVDGLSDPRVTFELRSIWVSYWSQADKSLGQKI  482

Query  224  ASRLNIRPTM  195
            ASRLN+RP +
Sbjct  483  ASRLNVRPNI  492



>ref|NP_001237556.1| catalase-1/2 [Glycine max]
 sp|P29756.1|CATA1_SOYBN RecName: Full=Catalase-1/2 [Glycine max]
 emb|CAA78056.1| catalase [Glycine max]
 gb|AAB88169.1| catalase [Glycine max]
 gb|AAB88170.1| catalase [Glycine max]
 gb|KHN48523.1| Catalase-1/2 [Glycine soja]
Length=492

 Score =   307 bits (786),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 136/190 (72%), Positives = 168/190 (88%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGRMVLN+NIDNFFAENE +A  PA IVPG+Y+SDDK+LQ R+F+YADT RHRLGPNY+ 
Sbjct  303  VGRMVLNKNIDNFFAENEQLAFCPAIIVPGVYYSDDKLLQTRVFSYADTQRHRLGPNYLQ  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LP NAPKCA+HNN +DG+MNF+HRDEEV+YFPS++D  R+AE+ P P RI+ G+R+KC+I
Sbjct  363  LPANAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPVRHAEKVPVPPRILGGKREKCMI  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            EKENNFKQPG+RYRSW  DRQ+RF+ RWV +LS+PRVTHEIRS WISY +QADRSLGQK+
Sbjct  423  EKENNFKQPGERYRSWPSDRQERFVRRWVDALSDPRVTHEIRSIWISYWSQADRSLGQKI  482

Query  224  ASRLNIRPTM  195
            AS LN++P++
Sbjct  483  ASHLNLKPSI  492



>ref|XP_011074090.1| PREDICTED: catalase isoform X1 [Sesamum indicum]
Length=513

 Score =   308 bits (788),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 139/190 (73%), Positives = 168/190 (88%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGR+VLN+N+DNFFAENEM+A  P+ IVPGIYFS+DKMLQ RIFAYADT RHR+GPNY+ 
Sbjct  324  VGRLVLNRNVDNFFAENEMLAFSPSMIVPGIYFSNDKMLQTRIFAYADTQRHRIGPNYLQ  383

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LPVNAPKC +HNN +DG MNF+HRDEEV+YFPS++D  R+AE+FP P  +++G+R K VI
Sbjct  384  LPVNAPKCPHHNNHHDGAMNFMHRDEEVNYFPSRYDPCRHAEKFPIPPVVLSGQRVKTVI  443

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            EKENNFKQPGDRYRSWAPDRQ+RFI RW+ +LS+PR+T EIRS W+SY TQAD+SLGQK+
Sbjct  444  EKENNFKQPGDRYRSWAPDRQERFIRRWIDALSDPRLTAEIRSIWVSYWTQADKSLGQKL  503

Query  224  ASRLNIRPTM  195
            ASRLN+RP M
Sbjct  504  ASRLNVRPAM  513



>gb|AET97564.1| catalase [Ziziphus jujuba]
Length=492

 Score =   307 bits (786),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 135/190 (71%), Positives = 169/190 (89%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGR+VLN+NIDNFFAENE +A  PA +VPG+Y+SDDK+LQ RIF+Y+DT RHRLGPNY+ 
Sbjct  303  VGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQ  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE+ P P  I  G+R+KC+I
Sbjct  363  LPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEQHPIPSAIFNGKREKCII  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            EKENNFKQPG+RYRSWAPDRQ+RFI RW+ +LS+PRVTHEIRS WISY +QAD+SLGQK+
Sbjct  423  EKENNFKQPGERYRSWAPDRQERFIRRWIDALSDPRVTHEIRSIWISYWSQADKSLGQKL  482

Query  224  ASRLNIRPTM  195
            ASRLN+RP++
Sbjct  483  ASRLNVRPSI  492



>ref|XP_010530333.1| PREDICTED: catalase-2 [Tarenaya hassleriana]
Length=492

 Score =   307 bits (786),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 134/190 (71%), Positives = 172/190 (91%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGR+VLN+NIDNFFAENE +A  PA +VPG+Y+SDDK+LQ RIF+Y+DT RHRLGPNY+ 
Sbjct  303  VGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQ  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LPVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AER+P P  I +GRR++C+I
Sbjct  363  LPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAERYPIPPVICSGRRERCII  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            EKENNFKQPG+RYRS+ PDRQ+RFI RW+++LS+PR+THEIRS WISY +QAD+SLGQK+
Sbjct  423  EKENNFKQPGERYRSFTPDRQERFIRRWIEALSDPRITHEIRSIWISYWSQADQSLGQKL  482

Query  224  ASRLNIRPTM  195
            ASRLN+RP++
Sbjct  483  ASRLNVRPSI  492



>gb|AAD50974.1|AF170272_1 catalase CAT1 [Manihot esculenta]
Length=492

 Score =   306 bits (785),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 138/190 (73%), Positives = 166/190 (87%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            +GR+VLN+NIDN+FAENEM+A DP HIVPGI++S+DK+ Q R FAYADT RHRLGPNY +
Sbjct  303  IGRLVLNRNIDNWFAENEMLAFDPGHIVPGIHYSNDKLFQLRTFAYADTQRHRLGPNYKM  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LPVNAPKCAYHNN YDG+MNF+HRDEEVDYFPS++D  R+AER P P  I +GRR+KCVI
Sbjct  363  LPVNAPKCAYHNNHYDGFMNFMHRDEEVDYFPSRYDPVRHAERSPIPNAICSGRREKCVI  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            EKENNFKQPG+RYRSWAPDRQ+RF+ R V +LSEPR+T EIRS W+SY ++ D SLGQK+
Sbjct  423  EKENNFKQPGERYRSWAPDRQERFLCRLVNALSEPRITFEIRSIWVSYWSKCDASLGQKL  482

Query  224  ASRLNIRPTM  195
            ASRLN+RP +
Sbjct  483  ASRLNVRPNI  492



>ref|XP_004238430.1| PREDICTED: catalase isozyme 3 [Solanum lycopersicum]
Length=492

 Score =   306 bits (785),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 137/190 (72%), Positives = 168/190 (88%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGR+VLN+NIDNFFAENE +A  PA IVPG+Y+SDDK+LQ R+F+YADT RHRLGPNY+ 
Sbjct  303  VGRLVLNRNIDNFFAENEQLAFCPAIIVPGVYYSDDKLLQTRVFSYADTQRHRLGPNYLQ  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LPVNAPKCA+HNN ++G MNF+HRDEEV+Y PS+ D  R+AE++P P R++TG+R+K +I
Sbjct  363  LPVNAPKCAHHNNHHEGLMNFMHRDEEVNYLPSRLDPCRHAEQYPIPPRVLTGKREKVII  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            EKENNFKQPG+ YRSWAPDRQ+RF+ RWV +LS+PR THEIRS WISY +QAD+SLGQK+
Sbjct  423  EKENNFKQPGEHYRSWAPDRQERFLCRWVDALSDPRATHEIRSIWISYWSQADKSLGQKL  482

Query  224  ASRLNIRPTM  195
            ASRLNIRPTM
Sbjct  483  ASRLNIRPTM  492



>emb|CDP07288.1| unnamed protein product [Coffea canephora]
Length=492

 Score =   306 bits (785),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 138/190 (73%), Positives = 165/190 (87%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGR+VLN+NIDN+FAE E +A +PA +VPGIY+++DK+LQ RIFAY DT RHRLGPNYM 
Sbjct  303  VGRLVLNKNIDNYFAETEQLAFNPAFVVPGIYYTEDKLLQTRIFAYGDTQRHRLGPNYMQ  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LPVNAPKCA+HNN YDG+MNF+HRDEEVDYFPS+FD  R+A R P P  ++ G+RD+CVI
Sbjct  363  LPVNAPKCAHHNNHYDGFMNFMHRDEEVDYFPSRFDPVRHAARHPIPSTVLRGKRDRCVI  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
             KENNFKQ G+RYRSWAPDRQ+RFI RWV  LS+ RVTHEIRS WISY +QAD+SLGQK+
Sbjct  423  PKENNFKQAGERYRSWAPDRQERFICRWVDILSDARVTHEIRSIWISYWSQADKSLGQKM  482

Query  224  ASRLNIRPTM  195
            A+RLN+RPTM
Sbjct  483  ATRLNVRPTM  492



>ref|XP_006828714.1| hypothetical protein AMTR_s00001p00022550 [Amborella trichopoda]
 gb|ERM96130.1| hypothetical protein AMTR_s00001p00022550 [Amborella trichopoda]
Length=492

 Score =   306 bits (784),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 139/190 (73%), Positives = 166/190 (87%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGRMVLN+NIDNFF ENE +A +P  +VPGIY+SDDK LQAR FAY DT RHRLGPNY++
Sbjct  303  VGRMVLNRNIDNFFNENEQLAFNPGIVVPGIYYSDDKFLQARTFAYGDTQRHRLGPNYLM  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LPVNAPKCA+HNN YDG+MNF HRDEEVDYFPS+FD  R+AER P P ++V+G+R++CVI
Sbjct  363  LPVNAPKCAHHNNHYDGFMNFAHRDEEVDYFPSRFDPVRHAERCPLPPQLVSGKRERCVI  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            EKENNFKQPGDRYRS+APDRQ+RF+ R V +LS+ RVTHEIRS WISY +Q D+SLGQK+
Sbjct  423  EKENNFKQPGDRYRSFAPDRQERFVKRIVDALSDTRVTHEIRSIWISYWSQCDKSLGQKI  482

Query  224  ASRLNIRPTM  195
            A+RLNI+P M
Sbjct  483  ATRLNIKPHM  492



>gb|AEQ30070.1| catalase, partial [Litchi chinensis]
Length=487

 Score =   306 bits (784),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 139/190 (73%), Positives = 162/190 (85%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
             GR+VLN+NIDNFF ENE +A +P  +VPGIY+SDDKMLQ RIFAY DT RHRLGPNY++
Sbjct  298  AGRLVLNRNIDNFFNENEQLAFNPGLVVPGIYYSDDKMLQCRIFAYGDTQRHRLGPNYLM  357

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LPVNAPKC +HNN YDG+MNF+HRDEEVDYFPSKF N  NAE+FP P RI +G+R+K  I
Sbjct  358  LPVNAPKCPHHNNHYDGFMNFMHRDEEVDYFPSKFTNVANAEKFPIPGRICSGKREKACI  417

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            EKENNFK PGDRYRSWAPDRQ+RFI R V  LS+PRVT EIRS W+SY +QAD+SLGQK+
Sbjct  418  EKENNFKLPGDRYRSWAPDRQERFIKRVVDGLSDPRVTFEIRSIWVSYWSQADKSLGQKI  477

Query  224  ASRLNIRPTM  195
            ASRLN+RP +
Sbjct  478  ASRLNVRPNI  487



>ref|XP_006435363.1| hypothetical protein CICLE_v10000951mg [Citrus clementina]
 gb|ESR48603.1| hypothetical protein CICLE_v10000951mg [Citrus clementina]
 gb|KDO85096.1| hypothetical protein CISIN_1g042356mg [Citrus sinensis]
Length=492

 Score =   306 bits (784),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 139/190 (73%), Positives = 165/190 (87%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGR+VLN+NIDNFFAENE +A  PA +VPGIY+S+DK+LQ RIF+YADT RHRLGPNY+ 
Sbjct  303  VGRLVLNKNIDNFFAENEQLAFCPAIVVPGIYYSNDKLLQTRIFSYADTQRHRLGPNYLQ  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LPVNAPKCA HNN YDG+MNF+HRDEE+DYFPS++D  R+AE  PTP  I  GRR+KC+I
Sbjct  363  LPVNAPKCAQHNNHYDGFMNFMHRDEEIDYFPSRYDPVRHAEMHPTPPEICGGRREKCII  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
             KENNFKQPG+RYRSWAPDRQ+RFI RWV +LS+PRVTHEIR  WISY +QA +SLGQK+
Sbjct  423  PKENNFKQPGERYRSWAPDRQERFICRWVDALSDPRVTHEIRHIWISYWSQACKSLGQKL  482

Query  224  ASRLNIRPTM  195
            ASRLN+RP +
Sbjct  483  ASRLNVRPNI  492



>ref|XP_006473794.1| PREDICTED: catalase isozyme 1-like isoform X4 [Citrus sinensis]
Length=492

 Score =   306 bits (784),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 139/190 (73%), Positives = 165/190 (87%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGR+VLN+NIDNFFAENE +A  PA +VPGIY+S+DK+LQ RIF+YADT RHRLGPNY+ 
Sbjct  303  VGRLVLNKNIDNFFAENEQLAFCPAIVVPGIYYSNDKLLQTRIFSYADTQRHRLGPNYLQ  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LPVNAPKCA HNN YDG+MNF+HRDEE+DYFPS++D  R+AE  PTP  I  GRR+KC+I
Sbjct  363  LPVNAPKCAQHNNHYDGFMNFMHRDEEIDYFPSRYDPVRHAEMHPTPPEICGGRREKCII  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
             KENNFKQPG+RYRSWAPDRQ+RFI RWV +LS+PRVTHEIR  WISY +QA +SLGQK+
Sbjct  423  PKENNFKQPGERYRSWAPDRQERFICRWVDALSDPRVTHEIRHIWISYWSQACKSLGQKL  482

Query  224  ASRLNIRPTM  195
            ASRLN+RP +
Sbjct  483  ASRLNVRPNI  492



>sp|P48350.1|CATA1_CUCPE RecName: Full=Catalase isozyme 1 [Cucurbita pepo]
 dbj|BAA09506.1| catalase [Cucurbita pepo]
Length=492

 Score =   306 bits (783),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 135/190 (71%), Positives = 169/190 (89%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGRMVLN+NIDNFFAENE +A  PA IVPG+Y+SDDK+LQ RIF+YADT RHRLGPNY+ 
Sbjct  303  VGRMVLNKNIDNFFAENEQLAFCPAIIVPGVYYSDDKLLQTRIFSYADTQRHRLGPNYLQ  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS+FD +R+AER+P P  + +G+R++C+I
Sbjct  363  LPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPSRHAERYPHPPAVCSGKRERCII  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            EKENNFK+PG+RYRSW PDRQ+RF+ RWV +LS+ RVTHEIRS WISY +QADRSLGQK+
Sbjct  423  EKENNFKEPGERYRSWTPDRQERFVRRWVDALSDTRVTHEIRSIWISYWSQADRSLGQKL  482

Query  224  ASRLNIRPTM  195
            AS LN+RP++
Sbjct  483  ASHLNVRPSI  492



>ref|XP_010498496.1| PREDICTED: catalase-3 [Camelina sativa]
 ref|XP_010459748.1| PREDICTED: catalase-3 [Camelina sativa]
 ref|XP_010477307.1| PREDICTED: catalase-3 [Camelina sativa]
Length=492

 Score =   306 bits (783),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 136/190 (72%), Positives = 164/190 (86%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGR+VLN+ IDNFF E E +A +P  +VPGIY+SDDK+LQ RIFAY DT RHRLGPNY+ 
Sbjct  303  VGRLVLNRTIDNFFNETEQLAFNPGLVVPGIYYSDDKLLQCRIFAYGDTQRHRLGPNYLQ  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LPVNAPKCA+HNN ++G+MNF+HRDEE++Y+PSKFD  R AE+ P P +  TG R KC+I
Sbjct  363  LPVNAPKCAHHNNHHEGFMNFMHRDEEINYYPSKFDPVRCAEKVPIPTKSYTGIRTKCII  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            +KENNFKQPGDRYRSWAPDRQDRF+ RWV+ LSEPR+THEIRS WISY +QADRSLGQK+
Sbjct  423  KKENNFKQPGDRYRSWAPDRQDRFVKRWVEILSEPRLTHEIRSIWISYWSQADRSLGQKL  482

Query  224  ASRLNIRPTM  195
            ASRLN+RP++
Sbjct  483  ASRLNVRPSI  492



>ref|XP_010663966.1| PREDICTED: catalase isozyme 1 [Vitis vinifera]
 emb|CBI40714.3| unnamed protein product [Vitis vinifera]
Length=492

 Score =   306 bits (783),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 136/190 (72%), Positives = 171/190 (90%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGR+VLN+NIDNFFAENE +A  PA +VPG+Y+SDDK+LQ RIF+Y+DT RHRLGPNY+ 
Sbjct  303  VGRLVLNRNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQ  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AER+P P  I+TGRR+KC+I
Sbjct  363  LPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAERYPIPPAILTGRREKCII  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
             KENNFKQPG+RYRS+APDRQ+RFI RWV +LS+PRVT+EIRS WISY +QAD+SLGQK+
Sbjct  423  PKENNFKQPGERYRSFAPDRQERFIQRWVDALSDPRVTYEIRSIWISYWSQADKSLGQKL  482

Query  224  ASRLNIRPTM  195
            ASRLN+RP++
Sbjct  483  ASRLNVRPSI  492



>dbj|BAQ21275.1| catalase [Citrus tamurana]
Length=476

 Score =   305 bits (782),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 136/190 (72%), Positives = 166/190 (87%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGR+VLN+NIDNFFAENE +A  PA +VPGIY+S+DK+LQ RIF+YADT RHRLGPNY+ 
Sbjct  287  VGRLVLNKNIDNFFAENEQLAFCPAIVVPGIYYSNDKLLQTRIFSYADTQRHRLGPNYLQ  346

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LPVNAPKCA+HNN YDG+MNF+HRDEE+DYFPS++D  R+AE  PTP  I  GRR+KC+I
Sbjct  347  LPVNAPKCAHHNNHYDGFMNFMHRDEEIDYFPSRYDPVRHAEMHPTPPEICGGRREKCII  406

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
             KENNFKQPG+RYRSWAPDRQ+RF+ RWV +LS+PRVTHEIR  WISY +QA +SLGQK+
Sbjct  407  PKENNFKQPGERYRSWAPDRQERFVCRWVDALSDPRVTHEIRHIWISYWSQACKSLGQKL  466

Query  224  ASRLNIRPTM  195
             +RLN+RP++
Sbjct  467  TARLNVRPSI  476



>ref|XP_006473791.1| PREDICTED: catalase isozyme 1-like isoform X1 [Citrus sinensis]
 ref|XP_006473792.1| PREDICTED: catalase isozyme 1-like isoform X2 [Citrus sinensis]
 ref|XP_006473793.1| PREDICTED: catalase isozyme 1-like isoform X3 [Citrus sinensis]
Length=512

 Score =   306 bits (784),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 139/190 (73%), Positives = 165/190 (87%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGR+VLN+NIDNFFAENE +A  PA +VPGIY+S+DK+LQ RIF+YADT RHRLGPNY+ 
Sbjct  323  VGRLVLNKNIDNFFAENEQLAFCPAIVVPGIYYSNDKLLQTRIFSYADTQRHRLGPNYLQ  382

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LPVNAPKCA HNN YDG+MNF+HRDEE+DYFPS++D  R+AE  PTP  I  GRR+KC+I
Sbjct  383  LPVNAPKCAQHNNHYDGFMNFMHRDEEIDYFPSRYDPVRHAEMHPTPPEICGGRREKCII  442

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
             KENNFKQPG+RYRSWAPDRQ+RFI RWV +LS+PRVTHEIR  WISY +QA +SLGQK+
Sbjct  443  PKENNFKQPGERYRSWAPDRQERFICRWVDALSDPRVTHEIRHIWISYWSQACKSLGQKL  502

Query  224  ASRLNIRPTM  195
            ASRLN+RP +
Sbjct  503  ASRLNVRPNI  512



>pir||S40265 catalase (EC 1.11.1.6) - eggplant
Length=502

 Score =   306 bits (784),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 138/184 (75%), Positives = 163/184 (89%), Gaps = 0/184 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGR+VLN+NIDNFFAENE +A +P HIVPG+Y+S+DK+LQ RIFAYADT RHR+GPNYM 
Sbjct  303  VGRLVLNRNIDNFFAENEQLAFNPGHIVPGVYYSEDKLLQTRIFAYADTQRHRIGPNYMQ  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LPVNAPKCA+HNN  DG MNF+HRDEEVDY PS+FD  R AE++P P  ++TGRR+KCVI
Sbjct  363  LPVNAPKCAHHNNHRDGAMNFMHRDEEVDYLPSRFDPCRPAEQYPIPSCVLTGRREKCVI  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
             KENNFKQ G+RYR+W PDRQDR+IN+WV+SLS+PRVTHEIRS WISYL+QAD+S GQKV
Sbjct  423  PKENNFKQAGERYRTWEPDRQDRYINKWVESLSDPRVTHEIRSIWISYLSQADKSCGQKV  482

Query  224  ASRL  213
            ASRL
Sbjct  483  ASRL  486



>emb|CDX76313.1| BnaA08g10870D [Brassica napus]
Length=477

 Score =   305 bits (781),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 132/190 (69%), Positives = 173/190 (91%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGRMVLN+NIDNFFAENE +A  PA IVPGI++SDDK+LQ R+F+YADT RHRLGPNY+ 
Sbjct  288  VGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYADTQRHRLGPNYLQ  347

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LPVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE++PTP  + +G+R++CVI
Sbjct  348  LPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTPPAVCSGKRERCVI  407

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            EKENNFK+PG+RYRS+ P+RQ+RFI RW+++LS+PR+THEIRS WISY +QAD++LGQK+
Sbjct  408  EKENNFKEPGERYRSFTPERQERFIRRWIEALSDPRITHEIRSIWISYWSQADKTLGQKL  467

Query  224  ASRLNIRPTM  195
            ASRLN+RP++
Sbjct  468  ASRLNVRPSI  477



>ref|NP_001235974.1| catalase-3 [Glycine max]
 sp|O48560.1|CATA3_SOYBN RecName: Full=Catalase-3 [Glycine max]
 gb|AAB88171.1| catalase [Glycine max]
 gb|KHN12602.1| Catalase-3 [Glycine soja]
Length=492

 Score =   305 bits (782),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 136/190 (72%), Positives = 167/190 (88%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGRMVLN+NIDNFFAENE +A  PA IVPG+Y+SDDK+LQ RIF+YADT RHRLGPNY+ 
Sbjct  303  VGRMVLNKNIDNFFAENEQLAFCPAIIVPGVYYSDDKLLQTRIFSYADTQRHRLGPNYLQ  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LP N+PKCA+HNN +DG+MNF+HRDEEV+YFPS++D  R+AER P P R + G+R+KC+I
Sbjct  363  LPANSPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPVRHAERVPVPPRTLGGKREKCMI  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            EKENNFKQPG+RYRSW  DRQ+RF+ RWV +LS+PRVTHEIRS WISY +QADRSLGQK+
Sbjct  423  EKENNFKQPGERYRSWPSDRQERFVRRWVDALSDPRVTHEIRSIWISYWSQADRSLGQKI  482

Query  224  ASRLNIRPTM  195
            AS LN++P++
Sbjct  483  ASHLNLKPSI  492



>ref|XP_009110221.1| PREDICTED: catalase-3 [Brassica rapa]
 gb|AFN81244.1| catalase 2 [Brassica rapa subsp. pekinensis]
 emb|CDX96630.1| BnaA08g21730D [Brassica napus]
Length=492

 Score =   305 bits (782),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 136/190 (72%), Positives = 164/190 (86%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGR+VLN+ IDNFF E E +A +P  +VPGIY+SDDK+LQ RIFAY DT RHRLGPNY+ 
Sbjct  303  VGRLVLNRTIDNFFNETEQLAFNPGLVVPGIYYSDDKLLQCRIFAYGDTQRHRLGPNYLQ  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LPVNAPKCA+HNN ++G+MNF+HRDEE++Y+PSKFD  R AE+ P P +  TG R KC+I
Sbjct  363  LPVNAPKCAHHNNHHEGFMNFMHRDEEINYYPSKFDPVRCAEKVPIPTKSYTGIRTKCII  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            +KENNFKQPGDRYRSWAPDRQDRF+ RWV+ LSEPR+THEIRS WISY +QADRSLGQK+
Sbjct  423  KKENNFKQPGDRYRSWAPDRQDRFVKRWVEILSEPRLTHEIRSIWISYWSQADRSLGQKL  482

Query  224  ASRLNIRPTM  195
            ASRLN+RP++
Sbjct  483  ASRLNVRPSI  492



>gb|AFU90822.1| catalase, partial [Populus tomentosa]
Length=487

 Score =   305 bits (781),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 135/186 (73%), Positives = 166/186 (89%), Gaps = 0/186 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGR+VLN+NIDNFFAENE +A  PA +VPG+Y+SDDK+LQ RIF+YADT RHRLGPNY+ 
Sbjct  302  VGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYADTQRHRLGPNYLQ  361

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE FP P  + +G+R+KC+I
Sbjct  362  LPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAESFPIPPAVCSGKREKCII  421

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            EKENNFKQPG+RYRSWAPDRQ+RFI RWV +LS+PRVTHEIRS WISY +QAD+SLGQK+
Sbjct  422  EKENNFKQPGERYRSWAPDRQERFICRWVDALSDPRVTHEIRSIWISYWSQADKSLGQKL  481

Query  224  ASRLNI  207
            ASRLN+
Sbjct  482  ASRLNV  487



>ref|NP_001031072.3| catalase 3 [Arabidopsis thaliana]
 gb|AEE29996.1| catalase 3 [Arabidopsis thaliana]
Length=377

 Score =   301 bits (772),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 136/190 (72%), Positives = 162/190 (85%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGR+VLN+ IDNFF E E +A +P  +VPGIY+SDDK+LQ RIFAY DT RHRLGPNY+ 
Sbjct  188  VGRLVLNRTIDNFFNETEQLAFNPGLVVPGIYYSDDKLLQCRIFAYGDTQRHRLGPNYLQ  247

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LPVNAPKCA+HNN ++G+MNF+HRDEE++Y+PSKFD  R AE+ PTP    TG R KCVI
Sbjct  248  LPVNAPKCAHHNNHHEGFMNFMHRDEEINYYPSKFDPVRCAEKVPTPTNSYTGIRTKCVI  307

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            +KENNFKQ GDRYRSWAPDRQDRF+ RWV+ LSEPR+THEIR  WISY +QADRSLGQK+
Sbjct  308  KKENNFKQAGDRYRSWAPDRQDRFVKRWVEILSEPRLTHEIRGIWISYWSQADRSLGQKL  367

Query  224  ASRLNIRPTM  195
            ASRLN+RP++
Sbjct  368  ASRLNVRPSI  377



>gb|ACV92695.1| catalase [Brassica oleracea]
Length=492

 Score =   305 bits (782),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 133/190 (70%), Positives = 172/190 (91%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGRMVLN+NIDNFFAENE +A  PA IVPGI++SDDK+LQ R+F+YADT RHRLGPNY+ 
Sbjct  303  VGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYADTQRHRLGPNYLQ  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LPVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE++PTP  + +G+R++CVI
Sbjct  363  LPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTPPAVCSGKRERCVI  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            EKENNFK+PG+RYRS+ P+RQ+RFI RW+ +LS+PR+THEIRS WISY +QAD+SLGQK+
Sbjct  423  EKENNFKEPGERYRSFTPERQERFIGRWIDALSDPRITHEIRSIWISYWSQADKSLGQKL  482

Query  224  ASRLNIRPTM  195
            ASRLN+RP++
Sbjct  483  ASRLNVRPSI  492



>sp|P17598.2|CATA1_GOSHI RecName: Full=Catalase isozyme 1 [Gossypium hirsutum]
 emb|CAA36380.1| unnamed protein product [Gossypium hirsutum]
Length=492

 Score =   305 bits (782),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 135/190 (71%), Positives = 168/190 (88%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGR+VLN+NIDNFFAENE +A  PA +VPGIY+SDDK+LQ RIF+Y+DT RHRLGPNY+ 
Sbjct  303  VGRLVLNKNIDNFFAENEQLAFCPAIVVPGIYYSDDKLLQTRIFSYSDTQRHRLGPNYLQ  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LP NAPKCA+HNN ++G+MNF+HRDEE++YFPS++D  R+AE FP P  + TGRR+KC+I
Sbjct  363  LPANAPKCAHHNNHHEGFMNFMHRDEEINYFPSRYDPVRHAEMFPIPPAVCTGRREKCII  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            EKENNFKQPG+RYRSWA DRQ+RFI RWV +LS+PRVTHEIRS WISY +QAD+S+GQK+
Sbjct  423  EKENNFKQPGERYRSWAADRQERFICRWVDALSDPRVTHEIRSIWISYWSQADKSVGQKL  482

Query  224  ASRLNIRPTM  195
            AS LN+RP++
Sbjct  483  ASLLNVRPSI  492



>ref|XP_002867092.1| hypothetical protein ARALYDRAFT_491144 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43351.1| hypothetical protein ARALYDRAFT_491144 [Arabidopsis lyrata subsp. 
lyrata]
Length=492

 Score =   305 bits (782),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 132/190 (69%), Positives = 173/190 (91%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGRMVLN+NIDNFFAENE +A  PA IVPGI++SDDK+LQ R+F+YADT RHRLGPNY+ 
Sbjct  303  VGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYADTQRHRLGPNYLQ  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LPVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE++PTP  + +G+R++C+I
Sbjct  363  LPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTPPAVCSGKRERCII  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            EKENNFK+PG+RYRS+ P+RQ+RFI RW+++LS+PR+THEIRS WISY +QAD+SLGQK+
Sbjct  423  EKENNFKEPGERYRSFTPERQERFIQRWIEALSDPRITHEIRSIWISYWSQADKSLGQKL  482

Query  224  ASRLNIRPTM  195
            ASRLN+RP++
Sbjct  483  ASRLNVRPSI  492



>gb|AFU90823.1| catalase, partial [Populus x beijingensis]
Length=446

 Score =   304 bits (778),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 134/186 (72%), Positives = 166/186 (89%), Gaps = 0/186 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGR+VLN+NIDNFFAENE +A  PA +VPG+Y+SDDK+LQ RIF+YADT RHRLGPNY+ 
Sbjct  261  VGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYADTQRHRLGPNYLQ  320

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE FP P  + +G+R++C+I
Sbjct  321  LPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAESFPIPPAVCSGKRERCII  380

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            EKENNFKQPG+RYRSWAPDRQ+RFI RWV +LS+PRVTHEIRS WISY +QAD+SLGQK+
Sbjct  381  EKENNFKQPGERYRSWAPDRQERFICRWVDALSDPRVTHEIRSIWISYWSQADKSLGQKL  440

Query  224  ASRLNI  207
            ASRLN+
Sbjct  441  ASRLNV  446



>gb|KGN55499.1| hypothetical protein Csa_4G658590 [Cucumis sativus]
Length=492

 Score =   305 bits (781),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 135/190 (71%), Positives = 169/190 (89%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGRMVLN+NIDNFFAENE +A  PA IVPGIY+SDDK+LQ RIF+Y+DT RHRLGPNY+ 
Sbjct  303  VGRMVLNKNIDNFFAENEQLAFCPAIIVPGIYYSDDKLLQTRIFSYSDTQRHRLGPNYLQ  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AER+P P  + TG+R++CVI
Sbjct  363  LPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPARHAERYPHPPAVCTGKRERCVI  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            +KENNFK+PG+RYRSW PDRQ+RFI RWV +LS+PRVTHEIRS WI+Y +QADRS+GQK+
Sbjct  423  QKENNFKEPGERYRSWTPDRQERFIRRWVDALSDPRVTHEIRSIWITYWSQADRSVGQKL  482

Query  224  ASRLNIRPTM  195
            AS LN+RP++
Sbjct  483  ASHLNVRPSI  492



>gb|AIA61608.1| catalase [Gynostemma pentaphyllum]
Length=492

 Score =   305 bits (781),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 134/190 (71%), Positives = 170/190 (89%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGR+VLN+NIDNFFAENE +A  PA IVPG+Y+SDDK+LQ R+F+Y+DT RHRLGPNY+ 
Sbjct  303  VGRLVLNKNIDNFFAENEQLAFCPAIIVPGVYYSDDKLLQTRVFSYSDTQRHRLGPNYLQ  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LP NAPKC++HNN ++G+MNF+HRDEEV+YFPS++D  R+AER+P P  + TG+R++CVI
Sbjct  363  LPANAPKCSHHNNHHEGFMNFMHRDEEVNYFPSRYDPARHAERYPHPPAVCTGKRERCVI  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            +KENNFKQPG+RYRSWAPDRQ+RFI RWV +LS+PRVTHEIRS WISY +QADRS+GQK+
Sbjct  423  DKENNFKQPGERYRSWAPDRQERFIRRWVNALSDPRVTHEIRSIWISYWSQADRSVGQKL  482

Query  224  ASRLNIRPTM  195
            AS LN+RP++
Sbjct  483  ASHLNMRPSI  492



>emb|CAA64220.1| catalase [Arabidopsis thaliana]
Length=492

 Score =   305 bits (781),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 132/190 (69%), Positives = 172/190 (91%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGRMVLN+NIDNFFAENE +A  PA IVPGI++SDDK+LQ R+F+YADT RHRLGPNY+ 
Sbjct  303  VGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYADTQRHRLGPNYLQ  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LPVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE++PTP  + +G+R++CVI
Sbjct  363  LPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDQVRHAEKYPTPPAVCSGKRERCVI  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            EKENNFK+PG+RYR++ P+RQ+RFI RW+ +LS+PR+THEIRS WISY +QAD+SLGQK+
Sbjct  423  EKENNFKEPGERYRTFTPERQERFIQRWIDALSDPRITHEIRSIWISYWSQADKSLGQKL  482

Query  224  ASRLNIRPTM  195
            ASRLN+RP++
Sbjct  483  ASRLNVRPSI  492



>ref|XP_006283612.1| hypothetical protein CARUB_v10004668mg [Capsella rubella]
 gb|EOA16510.1| hypothetical protein CARUB_v10004668mg [Capsella rubella]
Length=492

 Score =   305 bits (781),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 133/190 (70%), Positives = 173/190 (91%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGRMVLN+NIDNFFAENE +A  PA IVPGI++SDDK+LQ R+F+YADT RHRLGPNY+ 
Sbjct  303  VGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYADTQRHRLGPNYLQ  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LPVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE++PTP  + +G+R++CVI
Sbjct  363  LPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTPPAVCSGKRERCVI  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            EKENNFK+PG+RYRS+ P+RQ+RFI RW+++LS+PR+THEIRS WISY +QAD+SLGQK+
Sbjct  423  EKENNFKEPGERYRSFPPERQERFIRRWIEALSDPRITHEIRSIWISYWSQADKSLGQKL  482

Query  224  ASRLNIRPTM  195
            ASRLN+RP++
Sbjct  483  ASRLNVRPSI  492



>ref|XP_004500877.1| PREDICTED: catalase-4-like isoform X2 [Cicer arietinum]
Length=492

 Score =   305 bits (781),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 134/190 (71%), Positives = 168/190 (88%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGR+VLN+NIDNFFAENE +A  PA IVPG+Y+SDDKMLQ RIF+YAD+ RHRLGPNY+ 
Sbjct  303  VGRLVLNKNIDNFFAENEQLAFCPAIIVPGVYYSDDKMLQTRIFSYADSQRHRLGPNYLQ  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS+ D  R+AERFPTP   ++G+R++C+ 
Sbjct  363  LPANAPKCAHHNNHHEGFMNFIHRDEEVNYFPSRHDPVRHAERFPTPPAALSGKRERCIR  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
             KENNFKQPG+RYR+WAPDRQDRF  RW+++LS+PRVTHE+RS WISY +QADRSLGQK+
Sbjct  423  PKENNFKQPGERYRTWAPDRQDRFARRWIEALSDPRVTHEVRSIWISYWSQADRSLGQKI  482

Query  224  ASRLNIRPTM  195
            AS LN+RP++
Sbjct  483  ASHLNMRPSI  492



>gb|AAF71742.1|AF248491_1 catalase [Raphanus sativus]
Length=492

 Score =   305 bits (780),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 132/190 (69%), Positives = 172/190 (91%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGRMVLN+NIDNFFAENE +A  PA IVPGI++SDDK+LQ R+F+YADT RHRLGPNY+ 
Sbjct  303  VGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYADTQRHRLGPNYLQ  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LPVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE++PTP  + +G+R++C+I
Sbjct  363  LPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTPPAVCSGKRERCII  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            EKENNFK+PG+RYRS+ P+RQ+RFI RW+ +LS+PR+THEIRS WISY +QAD+SLGQK+
Sbjct  423  EKENNFKEPGERYRSFTPERQERFIGRWIDALSDPRITHEIRSIWISYWSQADKSLGQKL  482

Query  224  ASRLNIRPTM  195
            ASRLN+RP++
Sbjct  483  ASRLNVRPSI  492



>emb|CDY31488.1| BnaC05g15970D [Brassica napus]
Length=500

 Score =   305 bits (781),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 136/190 (72%), Positives = 164/190 (86%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGR+VLN+ IDNFF E E +A +P  +VPGIY+SDDK+LQ RIFAY DT RHRLGPNY+ 
Sbjct  311  VGRLVLNRTIDNFFNETEQLAFNPGLVVPGIYYSDDKLLQCRIFAYGDTQRHRLGPNYLQ  370

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LPVNAPKCA+HNN ++G+MNF+HRDEE++Y+PSKFD  R AE+ P P +  TG R KC+I
Sbjct  371  LPVNAPKCAHHNNHHEGFMNFMHRDEEINYYPSKFDPVRCAEKVPIPNKSYTGIRTKCII  430

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            +KENNFKQPGDRYRSWAPDRQDRF+ RWV+ LSEPR+THEIRS WISY +QADRSLGQK+
Sbjct  431  KKENNFKQPGDRYRSWAPDRQDRFVKRWVEILSEPRLTHEIRSIWISYWSQADRSLGQKL  490

Query  224  ASRLNIRPTM  195
            ASRLN+RP++
Sbjct  491  ASRLNVRPSI  500



>gb|AAB86582.2| catalase [Raphanus sativus]
Length=491

 Score =   305 bits (780),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 132/190 (69%), Positives = 172/190 (91%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGRMVLN+NIDNFFAENE +A  PA IVPGI++SDDK+LQ R+F+YADT RHRLGPNY+ 
Sbjct  302  VGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYADTQRHRLGPNYLQ  361

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LPVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE++PTP  + +G+R++C+I
Sbjct  362  LPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTPPAVCSGKRERCII  421

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            EKENNFK+PG+RYRS+ P+RQ+RFI RW+ +LS+PR+THEIRS WISY +QAD+SLGQK+
Sbjct  422  EKENNFKEPGERYRSFTPERQERFIGRWIDALSDPRITHEIRSIWISYWSQADKSLGQKL  481

Query  224  ASRLNIRPTM  195
            ASRLN+RP++
Sbjct  482  ASRLNVRPSI  491



>gb|AAK96854.1| catalase [Arabidopsis thaliana]
Length=492

 Score =   305 bits (780),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 131/190 (69%), Positives = 172/190 (91%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGRMVLN+NIDNFFAENE +A  PA IVPGI++SDDK+LQ R+F+YADT RHRLGPNY+ 
Sbjct  303  VGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYADTQRHRLGPNYLQ  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LPVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE++PTP  + +G+R++C+I
Sbjct  363  LPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDQVRHAEKYPTPPAVCSGKRERCII  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            EKENNFK+PG+RYR++ P+RQ+RFI RW+ +LS+PR+THEIRS WISY +QAD+SLGQK+
Sbjct  423  EKENNFKEPGERYRTFTPERQERFIQRWIDALSDPRITHEIRSIWISYWSQADKSLGQKL  482

Query  224  ASRLNIRPTM  195
            ASRLN+RP++
Sbjct  483  ASRLNVRPSI  492



>ref|XP_004500876.1| PREDICTED: catalase-4-like isoform X1 [Cicer arietinum]
Length=493

 Score =   305 bits (780),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 134/190 (71%), Positives = 168/190 (88%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGR+VLN+NIDNFFAENE +A  PA IVPG+Y+SDDKMLQ RIF+YAD+ RHRLGPNY+ 
Sbjct  304  VGRLVLNKNIDNFFAENEQLAFCPAIIVPGVYYSDDKMLQTRIFSYADSQRHRLGPNYLQ  363

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS+ D  R+AERFPTP   ++G+R++C+ 
Sbjct  364  LPANAPKCAHHNNHHEGFMNFIHRDEEVNYFPSRHDPVRHAERFPTPPAALSGKRERCIR  423

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
             KENNFKQPG+RYR+WAPDRQDRF  RW+++LS+PRVTHE+RS WISY +QADRSLGQK+
Sbjct  424  PKENNFKQPGERYRTWAPDRQDRFARRWIEALSDPRVTHEVRSIWISYWSQADRSLGQKI  483

Query  224  ASRLNIRPTM  195
            AS LN+RP++
Sbjct  484  ASHLNMRPSI  493



>prf||1906388A catalase
Length=492

 Score =   305 bits (780),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 131/190 (69%), Positives = 172/190 (91%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGRMVLN+NIDNFFAENE +A  PA IVPGI++SDDK+LQ R+F+YADT RHRLGPNY+ 
Sbjct  303  VGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYADTQRHRLGPNYLQ  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LPVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE++PTP  + +G+R++C+I
Sbjct  363  LPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDQVRHAEKYPTPPAVCSGKRERCII  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            EKENNFK+PG+RYR++ P+RQ+RFI RW+ +LS+PR+THEIRS WISY +QAD+SLGQK+
Sbjct  423  EKENNFKEPGERYRTFTPERQERFIQRWIDALSDPRITHEIRSIWISYWSQADKSLGQKL  482

Query  224  ASRLNIRPTM  195
            ASRLN+RP++
Sbjct  483  ASRLNVRPSI  492



>emb|CAA45564.1| catalase [Arabidopsis thaliana]
Length=492

 Score =   305 bits (780),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 131/190 (69%), Positives = 172/190 (91%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGRMVLN+NIDNFFAENE +A  PA IVPGI++SDDK+LQ R+F+YADT RHRLGPNY+ 
Sbjct  303  VGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYADTQRHRLGPNYLQ  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LPVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE++PTP  + +G+R++C+I
Sbjct  363  LPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDQVRHAEKYPTPPAVCSGKRERCII  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            EKENNFK+PG+RYR++ P+RQ+RFI RW+ +LS+PR+THEIRS WISY +QAD+SLGQK+
Sbjct  423  EKENNFKEPGERYRTFTPERQERFIQRWIDALSDPRITHEIRSIWISYWSQADKSLGQKL  482

Query  224  ASRLNIRPTM  195
            ASRLN+RP++
Sbjct  483  ASRLNVRPSI  492



>gb|AAD37788.1|AF149283_1 catalase 1 [Phaseolus vulgaris]
Length=428

 Score =   302 bits (774),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 136/185 (74%), Positives = 164/185 (89%), Gaps = 0/185 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGRMVLN+NIDNFFAENE +A  PA IVPG+Y+SDDK+LQ RIF+YAD+ RHRLGPNY+ 
Sbjct  244  VGRMVLNKNIDNFFAENEQLAFCPAIIVPGVYYSDDKLLQTRIFSYADSQRHRLGPNYLQ  303

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            +P NAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AER P P RI+ G+R+KC+I
Sbjct  304  IPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAERIPVPPRILDGKREKCMI  363

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            EKENNFKQPG+RYRSWA DRQ+RF+ RWV +LSEPRVTHEIRS WISY +QADRSLGQK+
Sbjct  364  EKENNFKQPGERYRSWASDRQERFLRRWVDALSEPRVTHEIRSIWISYWSQADRSLGQKI  423

Query  224  ASRLN  210
            AS LN
Sbjct  424  ASHLN  428



>ref|NP_195235.1| catalase 2 [Arabidopsis thaliana]
 sp|P25819.3|CATA2_ARATH RecName: Full=Catalase-2 [Arabidopsis thaliana]
 emb|CAA17773.1| catalase [Arabidopsis thaliana]
 emb|CAB80226.1| catalase [Arabidopsis thaliana]
 gb|AAL66998.1| putative catalase [Arabidopsis thaliana]
 gb|AAM44902.1| putative catalase [Arabidopsis thaliana]
 gb|AEE86462.1| catalase 2 [Arabidopsis thaliana]
Length=492

 Score =   305 bits (780),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 131/190 (69%), Positives = 172/190 (91%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGRMVLN+NIDNFFAENE +A  PA IVPGI++SDDK+LQ R+F+YADT RHRLGPNY+ 
Sbjct  303  VGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYADTQRHRLGPNYLQ  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LPVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE++PTP  + +G+R++C+I
Sbjct  363  LPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDQVRHAEKYPTPPAVCSGKRERCII  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            EKENNFK+PG+RYR++ P+RQ+RFI RW+ +LS+PR+THEIRS WISY +QAD+SLGQK+
Sbjct  423  EKENNFKEPGERYRTFTPERQERFIQRWIDALSDPRITHEIRSIWISYWSQADKSLGQKL  482

Query  224  ASRLNIRPTM  195
            ASRLN+RP++
Sbjct  483  ASRLNVRPSI  492



>gb|AAD17935.1| catalase [Brassica juncea]
Length=492

 Score =   305 bits (780),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 132/190 (69%), Positives = 173/190 (91%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGRMVLN+NIDNFFAENE +A  PA IVPGI++SDDK+LQ R+F+YADT RHRLGPNY+ 
Sbjct  303  VGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYADTQRHRLGPNYLQ  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LPVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE++PTP  + +G+R++CVI
Sbjct  363  LPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTPPAVCSGKRERCVI  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            EKENNFK+PG+RYRS+ P+RQ+RFI RW+++LS+PR+THEIRS WISY +QAD++LGQK+
Sbjct  423  EKENNFKEPGERYRSFTPERQERFIRRWIEALSDPRITHEIRSIWISYWSQADKTLGQKL  482

Query  224  ASRLNIRPTM  195
            ASRLN+RP++
Sbjct  483  ASRLNVRPSI  492



>ref|XP_006342134.1| PREDICTED: catalase isozyme 3-like [Solanum tuberosum]
Length=492

 Score =   305 bits (780),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 136/190 (72%), Positives = 168/190 (88%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGR+VLN+NIDNFFAENE +A  PA IVPG+Y+SDDK+LQ R+F+YADT RHRLGPNY+ 
Sbjct  303  VGRLVLNKNIDNFFAENEQLAFCPAIIVPGVYYSDDKLLQTRVFSYADTQRHRLGPNYLQ  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LPVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS+ D  R+AE++P P R++TG+R+K +I
Sbjct  363  LPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRLDPCRHAEQYPIPPRVLTGKREKVII  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            EKENNFKQPG+ YRSWAP RQ+RF+ RWV +LS+ R THEIRS WISY +QAD+SLGQK+
Sbjct  423  EKENNFKQPGEHYRSWAPGRQERFVCRWVDALSDLRATHEIRSIWISYWSQADKSLGQKL  482

Query  224  ASRLNIRPTM  195
            ASRLNIRPTM
Sbjct  483  ASRLNIRPTM  492



>gb|ABC01913.1| catalase isozyme 1-like protein [Solanum tuberosum]
Length=492

 Score =   304 bits (779),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 138/190 (73%), Positives = 161/190 (85%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGR+VLN+NIDNFFAENE +A +P HIVPGIY+S+DK+LQ RIFAYADT RHR+GPNYM 
Sbjct  303  VGRLVLNRNIDNFFAENEQLAFNPGHIVPGIYYSEDKLLQTRIFAYADTQRHRIGPNYMQ  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LPVNAPKC +HNN  DG MN  HRDEEVDY PS+FD  R AE++P P  ++ GRR  CVI
Sbjct  363  LPVNAPKCGHHNNHRDGAMNMTHRDEEVDYLPSRFDPCRPAEQYPIPACVLNGRRTNCVI  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
             KENNFKQ G+RYRSW  DRQDR+IN+WV+SLS+PRVTHEIRS WISYL+QAD+S GQKV
Sbjct  423  PKENNFKQAGERYRSWESDRQDRYINKWVESLSDPRVTHEIRSIWISYLSQADKSCGQKV  482

Query  224  ASRLNIRPTM  195
            ASRL ++PTM
Sbjct  483  ASRLTVKPTM  492



>ref|XP_006828715.1| hypothetical protein AMTR_s00001p00024160 [Amborella trichopoda]
 gb|ERM96131.1| hypothetical protein AMTR_s00001p00024160 [Amborella trichopoda]
Length=492

 Score =   304 bits (779),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 135/190 (71%), Positives = 166/190 (87%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGRMVLN+NIDNFF ENE +A  PA +VPG+Y+SDDK+LQ RIF+Y+DT RHRLGPNY++
Sbjct  303  VGRMVLNRNIDNFFTENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLM  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LP NAPKCA+HNN YDG+MNF HRDEEVDYFPS+FD  R+AE+FP P +I +G+R+KC+I
Sbjct  363  LPANAPKCAHHNNHYDGFMNFAHRDEEVDYFPSRFDPVRHAEKFPMPPQICSGKREKCMI  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            EKENNFKQPG+RYRS+A DRQ+RFI RWV +LS+PRVTHEI S WISY +Q D+SLGQK+
Sbjct  423  EKENNFKQPGERYRSFAIDRQERFIKRWVDALSDPRVTHEILSIWISYWSQCDKSLGQKL  482

Query  224  ASRLNIRPTM  195
            A+ LN++P M
Sbjct  483  ATHLNLKPNM  492



>emb|CDY29519.1| BnaA06g14510D [Brassica napus]
Length=492

 Score =   304 bits (779),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 136/190 (72%), Positives = 164/190 (86%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGR+VLN+ IDNFF E E +A +P  +VPGIY+SDDK+LQ RIFAY DT RHRLGPNY+ 
Sbjct  303  VGRLVLNRTIDNFFNETEQLAFNPGLVVPGIYYSDDKLLQCRIFAYGDTQRHRLGPNYLQ  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LPVNAPKCA+HNN ++G+MNF+HRDEE++Y+PSKFD  R AE+ P P +  TG R KC+I
Sbjct  363  LPVNAPKCAHHNNHHEGFMNFMHRDEEINYYPSKFDPVRCAEKVPIPNKSYTGIRTKCII  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            +KENNFKQPGDRYRSWAPDRQDRF+ RWV+ LSEPR+THEIRS WISY +QADRSLGQK+
Sbjct  423  KKENNFKQPGDRYRSWAPDRQDRFVKRWVEILSEPRLTHEIRSIWISYWSQADRSLGQKL  482

Query  224  ASRLNIRPTM  195
            ASRLN+RP++
Sbjct  483  ASRLNVRPSI  492



>ref|XP_006382992.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 gb|ERP60789.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
Length=490

 Score =   304 bits (779),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 136/190 (72%), Positives = 171/190 (90%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGR+VLN+NIDNFFAENE +A  PA IVPGIY+SDDK+LQ RIF+YADT RHRLGPNY+ 
Sbjct  301  VGRLVLNKNIDNFFAENEQLAFCPAIIVPGIYYSDDKLLQTRIFSYADTQRHRLGPNYLQ  360

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS+FD  R+AER+P P  I TG+R+KC+I
Sbjct  361  LPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPVRHAERYPNPSVIHTGKREKCII  420

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            EKENNFKQPG+RYRS++PDR++RF+ RWV++LS+PRVT+EIRS WISY +QAD+SLGQK+
Sbjct  421  EKENNFKQPGERYRSFSPDRKERFVRRWVEALSDPRVTYEIRSIWISYWSQADKSLGQKL  480

Query  224  ASRLNIRPTM  195
            AS LN+RP++
Sbjct  481  ASHLNMRPSI  490



>ref|XP_009103334.1| PREDICTED: catalase-3-like [Brassica rapa]
 gb|AAB53101.2| catalase [Brassica napus]
 gb|AET08935.1| catalase [Brassica napus]
Length=492

 Score =   304 bits (779),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 136/190 (72%), Positives = 164/190 (86%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGR+VLN+ IDNFF E E +A +P  +VPGIY+SDDK+LQ RIFAY DT RHRLGPNY+ 
Sbjct  303  VGRLVLNRTIDNFFNETEQLAFNPGLVVPGIYYSDDKLLQCRIFAYGDTQRHRLGPNYLQ  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LPVNAPKCA+HNN ++G+MNF+HRDEE++Y+PSKFD  R AE+ P P +  TG R KC+I
Sbjct  363  LPVNAPKCAHHNNHHEGFMNFMHRDEEINYYPSKFDPVRCAEKVPIPNKSYTGIRTKCII  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            +KENNFKQPGDRYRSWAPDRQDRF+ RWV+ LSEPR+THEIRS WISY +QADRSLGQK+
Sbjct  423  KKENNFKQPGDRYRSWAPDRQDRFVKRWVEILSEPRLTHEIRSIWISYWSQADRSLGQKL  482

Query  224  ASRLNIRPTM  195
            ASRLN+RP++
Sbjct  483  ASRLNVRPSI  492



>ref|XP_010941422.1| PREDICTED: catalase isozyme B [Elaeis guineensis]
Length=492

 Score =   304 bits (779),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 134/190 (71%), Positives = 171/190 (90%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGRMVLN+NIDNFFAENE +A  PA +VPGI++SDDK+LQ R+F+YADT RHRLGPNY++
Sbjct  303  VGRMVLNKNIDNFFAENEQLAFCPAIVVPGIHYSDDKLLQTRVFSYADTQRHRLGPNYLM  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LPVNAPKCA+HNN +DG+MNF+HRDEEV+YFPS++D  R+AERFP P R++TG+R+KCVI
Sbjct  363  LPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPVRHAERFPLPPRVLTGKREKCVI  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
             KENNFKQPG+RYRS+ P RQ+RF++RWV++LS+ RVTHEIR  WI+Y +Q D+SLGQK+
Sbjct  423  GKENNFKQPGERYRSFDPARQERFVHRWVEALSDTRVTHEIRGIWITYWSQCDKSLGQKL  482

Query  224  ASRLNIRPTM  195
            A+RLN+RP+M
Sbjct  483  ATRLNMRPSM  492



>prf||2104177A catalase
Length=492

 Score =   304 bits (779),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 136/188 (72%), Positives = 168/188 (89%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGR+VLN+NIDNFFAENE +A  PA IVPGIY+SDDK+LQ RIF+Y+DT RHRLGPNY+ 
Sbjct  303  VGRLVLNKNIDNFFAENEQLAFCPAIIVPGIYYSDDKLLQTRIFSYSDTQRHRLGPNYLQ  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LP NAPKCA+HNN YDG+MNF+HRDEE+DYFPS++D  R+AE++P P   ++G+RDKCVI
Sbjct  363  LPANAPKCAHHNNHYDGFMNFMHRDEEIDYFPSRYDPARHAEQYPIPPVRLSGKRDKCVI  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            EKENNFKQPG+RYRS++PDRQ+RFINR V  LS+PRVTHE+RS W+SY +QAD+SLGQK+
Sbjct  423  EKENNFKQPGERYRSFSPDRQERFINRVVGGLSDPRVTHEVRSIWVSYWSQADKSLGQKI  482

Query  224  ASRLNIRP  201
            ASRLN++P
Sbjct  483  ASRLNVKP  490



>emb|CDY40645.1| BnaA03g53180D [Brassica napus]
Length=485

 Score =   304 bits (778),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 132/190 (69%), Positives = 171/190 (90%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGRMVLN+NIDNFFAENE +A  PA IVPGI++SDDK+LQ R+F+YADT RHRLGPNY+ 
Sbjct  296  VGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYADTQRHRLGPNYLQ  355

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LPVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE++PTP  + +G+R++C+I
Sbjct  356  LPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTPPAVCSGKRERCII  415

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            EKENNFK+PG+RYRS+ P+RQ+RFI RW+ +LS+PR+THEIRS WISY +QAD+SLGQK+
Sbjct  416  EKENNFKEPGERYRSFTPERQERFIGRWIDALSDPRITHEIRSIWISYWSQADKSLGQKL  475

Query  224  ASRLNIRPTM  195
            ASRLN+RP +
Sbjct  476  ASRLNVRPNI  485



>sp|P45739.1|CATA_HELAN RecName: Full=Catalase [Helianthus annuus]
 gb|AAA69866.1| catalase [Helianthus annuus]
Length=492

 Score =   304 bits (779),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 136/188 (72%), Positives = 168/188 (89%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGR+VLN+NIDNFFAENE +A  PA IVPGIY+SDDK+LQ RIF+Y+DT RHRLGPNY+ 
Sbjct  303  VGRLVLNKNIDNFFAENEQLAFCPAIIVPGIYYSDDKLLQTRIFSYSDTQRHRLGPNYLQ  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LP NAPKCA+HNN YDG+MNF+HRDEE+DYFPS++D  R+AE++P P   ++G+RDKCVI
Sbjct  363  LPANAPKCAHHNNHYDGFMNFMHRDEEIDYFPSRYDPARHAEQYPIPPVRLSGKRDKCVI  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            EKENNFKQPG+RYRS++PDRQ+RFINR V  LS+PRVTHE+RS W+SY +QAD+SLGQK+
Sbjct  423  EKENNFKQPGERYRSFSPDRQERFINRVVGGLSDPRVTHEVRSIWVSYWSQADKSLGQKI  482

Query  224  ASRLNIRP  201
            ASRLN++P
Sbjct  483  ASRLNVKP  490



>gb|KFK30147.1| catalase [Arabis alpina]
Length=492

 Score =   304 bits (778),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 132/190 (69%), Positives = 172/190 (91%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGRMVLN+NIDNFFAENE +A  PA IVPGI++SDDK+LQ R+F+YADT RHRLGPNY+ 
Sbjct  303  VGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYADTQRHRLGPNYLQ  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LPVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE++P P  + +G+R++CVI
Sbjct  363  LPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDTVRHAEKYPAPPAVCSGKRERCVI  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            EKENNFK+PG+RYRS+ P+RQ+RFI RW+++LS+PR+THEIRS WISY +QAD+SLGQK+
Sbjct  423  EKENNFKEPGERYRSFPPERQERFIRRWIEALSDPRITHEIRSIWISYWSQADKSLGQKL  482

Query  224  ASRLNIRPTM  195
            ASRLN+RP++
Sbjct  483  ASRLNVRPSI  492



>sp|P32290.1|CATA_VIGRR RecName: Full=Catalase [Vigna radiata var. radiata]
 dbj|BAA02755.1| catalase [Vigna radiata var. radiata]
Length=492

 Score =   304 bits (778),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 137/190 (72%), Positives = 166/190 (87%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGR+VLN+NIDNFFAENE +A  PA IVPG+Y+SDDKMLQ RIF+YAD+ RHRLGPNY+L
Sbjct  303  VGRLVLNKNIDNFFAENEQLAFCPAIIVPGVYYSDDKMLQTRIFSYADSQRHRLGPNYLL  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LP NAPK A+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE+FP P  + +GRR+K  I
Sbjct  363  LPANAPKSAHHNNHHEGFMNFIHRDEEVNYFPSRYDPVRHAEKFPIPPAVFSGRREKIAI  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            EKENNFKQ G+R+RSWAPDRQDRFI RWV +LS+PRVTHEIRS WISY +QADRSLGQK+
Sbjct  423  EKENNFKQAGERFRSWAPDRQDRFIRRWVDALSDPRVTHEIRSVWISYWSQADRSLGQKI  482

Query  224  ASRLNIRPTM  195
            AS LN+RP +
Sbjct  483  ASHLNMRPNI  492



>ref|XP_002306427.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 ref|XP_006382993.1| catalase family protein [Populus trichocarpa]
 emb|CAI43950.1| catalase [Populus deltoides]
 gb|EEE93423.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 gb|ERP60790.1| catalase family protein [Populus trichocarpa]
Length=492

 Score =   304 bits (778),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 136/190 (72%), Positives = 171/190 (90%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGR+VLN+NIDNFFAENE +A  PA IVPGIY+SDDK+LQ RIF+YADT RHRLGPNY+ 
Sbjct  303  VGRLVLNKNIDNFFAENEQLAFCPAIIVPGIYYSDDKLLQTRIFSYADTQRHRLGPNYLQ  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS+FD  R+AER+P P  I TG+R+KC+I
Sbjct  363  LPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPVRHAERYPNPSVIHTGKREKCII  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            EKENNFKQPG+RYRS++PDR++RF+ RWV++LS+PRVT+EIRS WISY +QAD+SLGQK+
Sbjct  423  EKENNFKQPGERYRSFSPDRKERFVRRWVEALSDPRVTYEIRSIWISYWSQADKSLGQKL  482

Query  224  ASRLNIRPTM  195
            AS LN+RP++
Sbjct  483  ASHLNMRPSI  492



>ref|XP_009138342.1| PREDICTED: catalase-2 [Brassica rapa]
 gb|AAD17934.1| catalase [Brassica juncea]
Length=492

 Score =   304 bits (778),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 132/190 (69%), Positives = 171/190 (90%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGRMVLN+NIDNFFAENE +A  PA IVPGI++SDDK+LQ R+F+YADT RHRLGPNY+ 
Sbjct  303  VGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYADTQRHRLGPNYLQ  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LPVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE++PTP  + +G+R++C+I
Sbjct  363  LPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTPPAVCSGKRERCII  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            EKENNFK+PG+RYRS+ P+RQ+RFI RW+ +LS+PR+THEIRS WISY +QAD+SLGQK+
Sbjct  423  EKENNFKEPGERYRSFTPERQERFIGRWIDALSDPRITHEIRSIWISYWSQADKSLGQKL  482

Query  224  ASRLNIRPTM  195
            ASRLN+RP +
Sbjct  483  ASRLNVRPNI  492



>ref|XP_009149539.1| PREDICTED: catalase-3 [Brassica rapa]
Length=543

 Score =   305 bits (782),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 136/190 (72%), Positives = 164/190 (86%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGR+VLN+ IDNFF E E +A +P  +VPGIY+SDDK+LQ RIFAY DT RHRLGPNY+ 
Sbjct  354  VGRLVLNRTIDNFFNETEQLAFNPGLVVPGIYYSDDKLLQCRIFAYGDTQRHRLGPNYLQ  413

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LPVNAPKCA+HNN ++G+MNF+HRDEE++Y+PSKFD  R AE+ P P +  TG R KC+I
Sbjct  414  LPVNAPKCAHHNNHHEGFMNFMHRDEEINYYPSKFDPVRCAEKVPIPNKSYTGIRTKCII  473

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            +KENNFKQPGDRYRSWAPDRQDRF+ RWV+ LSEPR+THEIRS WISY +QADRSLGQK+
Sbjct  474  KKENNFKQPGDRYRSWAPDRQDRFVKRWVEILSEPRLTHEIRSIWISYWSQADRSLGQKL  533

Query  224  ASRLNIRPTM  195
            ASRLN+RP++
Sbjct  534  ASRLNVRPSI  543



>emb|CDY33636.1| BnaC08g19360D [Brassica napus]
Length=492

 Score =   303 bits (777),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 135/190 (71%), Positives = 164/190 (86%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGR+VLN+ +DNFF E E +A +P  +VPGIY+SDDK+LQ RIFAY DT RHRLGPNY+ 
Sbjct  303  VGRLVLNRTVDNFFNETEQLAFNPGLVVPGIYYSDDKLLQCRIFAYGDTQRHRLGPNYLQ  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LPVNAPKCA+HNN ++G+MNF+HRDEE++Y+PSKFD  R AE+ P P +  TG R KC+I
Sbjct  363  LPVNAPKCAHHNNHHEGFMNFMHRDEEINYYPSKFDPVRCAEKVPIPNKSYTGIRTKCII  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            +KENNFKQPGDRYRSWAPDRQDRF+ RWV+ LSEPR+THEIRS WISY +QADRSLGQK+
Sbjct  423  KKENNFKQPGDRYRSWAPDRQDRFVKRWVEILSEPRLTHEIRSIWISYWSQADRSLGQKL  482

Query  224  ASRLNIRPTM  195
            ASRLN+RP++
Sbjct  483  ASRLNVRPSI  492



>gb|AAD17936.1| catalase [Brassica juncea]
Length=492

 Score =   303 bits (777),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 132/190 (69%), Positives = 172/190 (91%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGRMVLN+NIDNFFAENE +A  PA IVPGI++SDDK+LQ R+F+YADT RHRLGPNY+ 
Sbjct  303  VGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYADTQRHRLGPNYLQ  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LPVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE++PTP  I +G+R++C+I
Sbjct  363  LPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTPPAICSGKRERCII  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            EKENNFK+PG+RYRS+ P+RQ+RFI RW+ +LS+PR+THEIRS WISY +QAD+SLGQK+
Sbjct  423  EKENNFKEPGERYRSFTPERQERFIGRWIDALSDPRITHEIRSIWISYWSQADKSLGQKL  482

Query  224  ASRLNIRPTM  195
            A+RLN+RP++
Sbjct  483  ANRLNVRPSI  492



>gb|ACA50528.1| putative catalase 2 [Brassica napus]
Length=492

 Score =   303 bits (777),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 134/188 (71%), Positives = 170/188 (90%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGRMVLN+NIDNFFAENE +A  PA IVPGI++SDDK+LQ R+F+YADT RHRLGPNY+ 
Sbjct  303  VGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYADTQRHRLGPNYLQ  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LPVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE++PTP  + +G+R++C+I
Sbjct  363  LPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTPPAVCSGKRERCII  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            EKENNF+QPG+RYRSW  DRQ+RF+ R+V++L+EPRVTHEIRS WISY TQAD+SLGQK+
Sbjct  423  EKENNFQQPGERYRSWDADRQERFVKRFVEALAEPRVTHEIRSIWISYWTQADKSLGQKL  482

Query  224  ASRLNIRP  201
            ASRLN+RP
Sbjct  483  ASRLNVRP  490



>emb|CDY17510.1| BnaC03g65530D [Brassica napus]
Length=477

 Score =   303 bits (776),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 131/190 (69%), Positives = 172/190 (91%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGRMVLN+NIDNFFAENE +A  PA IVPGI++SDDK+LQ R+F+YADT RHRLGPNY+ 
Sbjct  288  VGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYADTQRHRLGPNYLQ  347

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LPVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE++PTP  + +G+R++CVI
Sbjct  348  LPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTPPAVCSGKRERCVI  407

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            EKENNFK+PG+RYRS+ P+RQ+RFI RW+++LS+PR+THEIRS WISY +QAD++LGQK+
Sbjct  408  EKENNFKEPGERYRSFTPERQERFIRRWIEALSDPRITHEIRSIWISYWSQADKTLGQKL  467

Query  224  ASRLNIRPTM  195
            AS LN+RP++
Sbjct  468  ASHLNVRPSI  477



>dbj|BAH20307.1| AT1G20620 [Arabidopsis thaliana]
Length=458

 Score =   303 bits (775),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 136/190 (72%), Positives = 162/190 (85%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGR+VLN+ IDNFF E E +A +P  +VPGIY+SDDK+LQ RIFAY DT RHRLGPNY+ 
Sbjct  269  VGRLVLNRTIDNFFNETEQLAFNPGLVVPGIYYSDDKLLQCRIFAYGDTQRHRLGPNYLQ  328

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LPVNAPKCA+HNN ++G+MNF+HRDEE++Y+PSKFD  R AE+ PTP    TG R KCVI
Sbjct  329  LPVNAPKCAHHNNHHEGFMNFMHRDEEINYYPSKFDPVRCAEKVPTPTNSYTGIRTKCVI  388

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            +KENNFKQ GDRYRSWAPDRQDRF+ RWV+ LSEPR+THEIR  WISY +QADRSLGQK+
Sbjct  389  KKENNFKQAGDRYRSWAPDRQDRFVKRWVEILSEPRLTHEIRGIWISYWSQADRSLGQKL  448

Query  224  ASRLNIRPTM  195
            ASRLN+RP++
Sbjct  449  ASRLNVRPSI  458



>ref|XP_011022275.1| PREDICTED: catalase-like [Populus euphratica]
Length=476

 Score =   303 bits (775),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 136/190 (72%), Positives = 170/190 (89%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGR+VLN+NIDNFFAENE +A  PA IVPGIY+SDDK+LQ RIF+YADT RHRLGPNY+ 
Sbjct  287  VGRLVLNKNIDNFFAENEQLAFCPAIIVPGIYYSDDKLLQTRIFSYADTQRHRLGPNYLQ  346

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS+FD  R+AER+P P  I TG+R+KC+I
Sbjct  347  LPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPVRHAERYPNPSVIHTGKREKCII  406

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            EKENNFKQPG+RYRS++PDR++RF+ RWV++LS+PRVT+EIRS WISY +QAD+SLGQK+
Sbjct  407  EKENNFKQPGERYRSFSPDRKERFVRRWVEALSDPRVTYEIRSIWISYWSQADKSLGQKL  466

Query  224  ASRLNIRPTM  195
            AS LN+RP +
Sbjct  467  ASHLNMRPGI  476



>ref|NP_001274863.1| catalase isozyme 1 [Solanum tuberosum]
 gb|ABY21246.1| catalase isozyme [Solanum tuberosum]
Length=492

 Score =   303 bits (777),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 138/190 (73%), Positives = 161/190 (85%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGR+VLN+NIDNFFAENE +A +P HIVPGIY+S+DK+LQ RIFAYADT RHR+GPNYM 
Sbjct  303  VGRLVLNRNIDNFFAENEQLAFNPGHIVPGIYYSEDKLLQTRIFAYADTQRHRIGPNYMQ  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LPVNAPKC +HNN  DG MN  HRDEEVDYFPS+FD  R AE++P P  ++ GRR  CVI
Sbjct  363  LPVNAPKCGHHNNHRDGAMNMTHRDEEVDYFPSRFDPCRPAEQYPIPACVLNGRRTNCVI  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
             KENN KQ G+RYRSW  DRQDR+IN+WV+SLS+PRVTHEIRS WISYL+QAD+S GQKV
Sbjct  423  PKENNSKQAGERYRSWESDRQDRYINKWVESLSDPRVTHEIRSIWISYLSQADKSCGQKV  482

Query  224  ASRLNIRPTM  195
            ASRL ++PTM
Sbjct  483  ASRLTVKPTM  492



>ref|XP_010934843.1| PREDICTED: catalase isozyme 2 [Elaeis guineensis]
 gb|AFS65099.1| catalase 2 [Elaeis guineensis]
Length=492

 Score =   303 bits (777),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 134/190 (71%), Positives = 166/190 (87%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGR+VLN+NIDNFFAENE +A  P  +VPGIY+SDDKMLQ R+FAYADT R+RLGPNY++
Sbjct  303  VGRLVLNRNIDNFFAENEQLAFGPGLVVPGIYYSDDKMLQCRVFAYADTQRYRLGPNYLM  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LPVNAPKCA+HNN +DG MNF+ R+EEVDYFPS+ D  R+AERFP P R+VTG+R+K VI
Sbjct  363  LPVNAPKCAFHNNQFDGLMNFMQRNEEVDYFPSRHDPLRHAERFPIPSRVVTGKREKIVI  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
             K+N+FKQPG+RYRSWAPDRQ+RF+ RW +SL  P+V+HE+RS WI+YLTQ D SLGQKV
Sbjct  423  PKQNDFKQPGERYRSWAPDRQERFVRRWAESLGHPKVSHELRSIWITYLTQCDVSLGQKV  482

Query  224  ASRLNIRPTM  195
            A+RLN++P+M
Sbjct  483  ANRLNVKPSM  492



>sp|P49284.1|CATA1_SOLTU RecName: Full=Catalase isozyme 1 [Solanum tuberosum]
 gb|AAA80650.1| catalase [Solanum tuberosum]
Length=492

 Score =   303 bits (776),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 138/190 (73%), Positives = 161/190 (85%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGR+VLN+NIDNFFAENE +A +P HIVPGIY+S+DK+LQ RIFAYADT RHR+GPNYM 
Sbjct  303  VGRLVLNRNIDNFFAENEQLAFNPGHIVPGIYYSEDKLLQTRIFAYADTQRHRIGPNYMQ  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LPVNAPKC +HNN  DG MN  HRDEEVDYFPS+FD  R AE++P P  ++ GRR  CVI
Sbjct  363  LPVNAPKCGHHNNHRDGAMNMTHRDEEVDYFPSRFDPCRPAEQYPIPACVLNGRRTNCVI  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
             KENN KQ G+RYRSW  DRQDR+IN+WV+SLS+PRVTHEIRS WISYL+QAD+S GQKV
Sbjct  423  PKENNSKQAGERYRSWESDRQDRYINKWVESLSDPRVTHEIRSIWISYLSQADKSCGQKV  482

Query  224  ASRLNIRPTM  195
            ASRL ++PTM
Sbjct  483  ASRLTVKPTM  492



>ref|XP_008791900.1| PREDICTED: catalase isozyme 2 [Phoenix dactylifera]
Length=492

 Score =   303 bits (776),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 134/190 (71%), Positives = 166/190 (87%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGR+VLN+NIDNFFAENE +A  P  +VPGIY+SDDKMLQ R+FAYADT R+RLGPNY++
Sbjct  303  VGRLVLNRNIDNFFAENEQLAFGPGLVVPGIYYSDDKMLQCRVFAYADTQRYRLGPNYLM  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LPVNAPKCA+HNN +DG MNF+ R+EEVDYFPS+ D  R+AERFP P R+VTG+R+K VI
Sbjct  363  LPVNAPKCAFHNNQFDGLMNFMQRNEEVDYFPSRHDPLRHAERFPIPSRVVTGKREKTVI  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
             K+N+FKQPG+RYRSWAPDRQ+RF+ RW +SL  P+V+HE+RS WI+YLTQ D SLGQKV
Sbjct  423  PKQNDFKQPGERYRSWAPDRQERFVRRWAESLGHPKVSHELRSIWITYLTQCDVSLGQKV  482

Query  224  ASRLNIRPTM  195
            A+RLN++P+M
Sbjct  483  ANRLNVKPSM  492



>emb|CCP37650.1| catalase-1 [Nicotiana tabacum]
Length=492

 Score =   303 bits (776),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 133/190 (70%), Positives = 169/190 (89%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGR+VLN+NIDNFF ENE +A  P+ +VPG+Y+SDDKMLQ RIF+Y+DT R+RLGPNY+ 
Sbjct  303  VGRLVLNKNIDNFFNENEQLAFCPSIVVPGVYYSDDKMLQTRIFSYSDTQRYRLGPNYLQ  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LP NAPKCA+HNN YDG MNF+HRDEE+DYFPS++D  R+AE++P P  + TG+R+KCVI
Sbjct  363  LPANAPKCAHHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAEKYPIPSTMCTGKREKCVI  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            +KENNFKQPGDRYRS+ PDRQ+RFI RWV++LS+PR+T+EIRS WISY +QAD+SLGQK+
Sbjct  423  QKENNFKQPGDRYRSFTPDRQERFIRRWVEALSDPRITYEIRSIWISYWSQADKSLGQKL  482

Query  224  ASRLNIRPTM  195
            ASRLN+RP++
Sbjct  483  ASRLNVRPSI  492



>emb|CDY01364.1| BnaA07g11370D [Brassica napus]
Length=556

 Score =   305 bits (781),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 136/190 (72%), Positives = 164/190 (86%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGR+VLN+ IDNFF E E +A +P  +VPGIY+SDDK+LQ RIFAY DT RHRLGPNY+ 
Sbjct  367  VGRLVLNRTIDNFFNETEQLAFNPGLVVPGIYYSDDKLLQCRIFAYGDTQRHRLGPNYLQ  426

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LPVNAPKCA+HNN ++G+MNF+HRDEE++Y+PSKFD  R AE+ P P +  TG R KC+I
Sbjct  427  LPVNAPKCAHHNNHHEGFMNFMHRDEEINYYPSKFDPVRCAEKVPIPNKSYTGIRTKCII  486

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            +KENNFKQPGDRYRSWAPDRQDRF+ RWV+ LSEPR+THEIRS WISY +QADRSLGQK+
Sbjct  487  KKENNFKQPGDRYRSWAPDRQDRFVKRWVEILSEPRLTHEIRSIWISYWSQADRSLGQKL  546

Query  224  ASRLNIRPTM  195
            ASRLN+RP++
Sbjct  547  ASRLNVRPSI  556



>gb|ACL27272.1| catalase [Nicotiana benthamiana]
Length=492

 Score =   303 bits (776),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 133/190 (70%), Positives = 169/190 (89%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGR+VLN+NIDNFF ENE +A  P+ +VPG+Y+SDDKMLQ RIF+Y+DT R+RLGPNY+ 
Sbjct  303  VGRLVLNKNIDNFFNENEQLAFCPSIVVPGVYYSDDKMLQTRIFSYSDTQRYRLGPNYLQ  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LP NAPKCA+HNN YDG MNF+HRDEE+DYFPS++D  R+AE++P P  + TG+R+KCVI
Sbjct  363  LPANAPKCAHHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAEKYPIPSTMCTGKREKCVI  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            +KENNFKQPGDRYRS+ PDRQ+RFI RWV++LS+PR+T+EIRS WISY +QAD+SLGQK+
Sbjct  423  QKENNFKQPGDRYRSFTPDRQERFIRRWVEALSDPRITYEIRSIWISYWSQADKSLGQKL  482

Query  224  ASRLNIRPTM  195
            ASRLN+RP++
Sbjct  483  ASRLNVRPSI  492



>gb|AFU48609.1| catalase 1, partial [Nicotiana benthamiana]
Length=491

 Score =   303 bits (776),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 133/190 (70%), Positives = 169/190 (89%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGR+VLN+NIDNFF ENE +A  P+ +VPG+Y+SDDKMLQ RIF+Y+DT R+RLGPNY+ 
Sbjct  302  VGRLVLNKNIDNFFNENEQLAFCPSIVVPGVYYSDDKMLQTRIFSYSDTQRYRLGPNYLQ  361

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LP NAPKCA+HNN YDG MNF+HRDEE+DYFPS++D  R+AE++P P  + TG+R+KCVI
Sbjct  362  LPANAPKCAHHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAEKYPIPSTMCTGKREKCVI  421

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            +KENNFKQPGDRYRS+ PDRQ+RFI RWV++LS+PR+T+EIRS WISY +QAD+SLGQK+
Sbjct  422  QKENNFKQPGDRYRSFTPDRQERFIRRWVEALSDPRITYEIRSIWISYWSQADKSLGQKL  481

Query  224  ASRLNIRPTM  195
            ASRLN+RP++
Sbjct  482  ASRLNVRPSI  491



>gb|AFW69584.1| catalase1 [Zea mays]
Length=353

 Score =   298 bits (764),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 133/190 (70%), Positives = 167/190 (88%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGRMVLN+N+DNFFAENE +A  PA IVPGI++SDDK+LQ RIF+YADT RHRLGPNY++
Sbjct  164  VGRMVLNKNVDNFFAENEQIAFCPAIIVPGIHYSDDKLLQTRIFSYADTQRHRLGPNYLM  223

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LPVNAPKCA+HNN +DG+MNF+HRDEEV+YFPS+FD  R+AE+ P P R++TG R+KC+I
Sbjct  224  LPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRFDPARHAEKVPIPPRVLTGCREKCII  283

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            +KENNFKQ G+RYRS+ P RQDRFI RWV +L++PRVTHE R+ WISY +Q D +LGQK+
Sbjct  284  QKENNFKQAGERYRSFDPARQDRFIQRWVDALTDPRVTHEHRTIWISYWSQCDAALGQKL  343

Query  224  ASRLNIRPTM  195
            ASRLN++P+M
Sbjct  344  ASRLNLKPSM  353



>gb|KHG12976.1| Catalase isozyme 2 [Gossypium arboreum]
Length=492

 Score =   303 bits (776),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 133/190 (70%), Positives = 170/190 (89%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGRMVLN+NIDNFFAENE +A  P+ IVPGIY+SDDK+LQ RIF+Y+DT RHRLGPNY+ 
Sbjct  303  VGRMVLNKNIDNFFAENEQLAFCPSLIVPGIYYSDDKLLQTRIFSYSDTQRHRLGPNYLQ  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE+ P P  +++G+R+KC+I
Sbjct  363  LPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKHPIPSTVLSGKREKCII  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
             KENNFKQPG+RYRS++ DRQ+RFINRW+ +LS+PRVTHEIRS WISY +QAD+SLGQK+
Sbjct  423  GKENNFKQPGERYRSFSADRQERFINRWIDALSDPRVTHEIRSIWISYWSQADKSLGQKI  482

Query  224  ASRLNIRPTM  195
            ASRLN+RP++
Sbjct  483  ASRLNVRPSI  492



>ref|XP_010536468.1| PREDICTED: catalase-3-like [Tarenaya hassleriana]
Length=492

 Score =   303 bits (776),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 134/190 (71%), Positives = 166/190 (87%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGR+VLN+N+DNFFAE EM+A +P  +VPGIY+S DK+LQARIFAY DT R+RLGPNY+ 
Sbjct  303  VGRLVLNKNVDNFFAETEMLAFNPGLVVPGIYYSQDKLLQARIFAYGDTQRYRLGPNYLQ  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LPVNAPKCA+HNN +DG+MNF+HRDEEV+YFPS+FD+ R+A ++P P  I +G R KCVI
Sbjct  363  LPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRFDSVRHAAKYPIPSAICSGERVKCVI  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            EKENNFKQPGDRYRSWAPDRQ+R+ NRWV++LS+ RVT EIR  WISYL+Q+D+SLG KV
Sbjct  423  EKENNFKQPGDRYRSWAPDRQERYANRWVEALSDARVTDEIRGIWISYLSQSDKSLGMKV  482

Query  224  ASRLNIRPTM  195
            A+RLN+RP+ 
Sbjct  483  ANRLNVRPSF  492



>ref|XP_010094556.1| Catalase isozyme 1 [Morus notabilis]
 gb|EXB56310.1| Catalase isozyme 1 [Morus notabilis]
Length=492

 Score =   303 bits (775),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 135/190 (71%), Positives = 169/190 (89%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGRMVLN+NIDNFFAENE +A  P  +VPG+Y+SDDK+LQ RIF+Y+DT RHRLGPNY+ 
Sbjct  303  VGRMVLNKNIDNFFAENEQLAFCPGIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQ  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LP NAPKCA+HNN ++G+MNF+HR+EEV+YFPS++D  R+AER+P P  I TGRR++ VI
Sbjct  363  LPANAPKCAHHNNHHEGFMNFMHREEEVNYFPSRYDPVRHAERYPIPSAICTGRRERTVI  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            +KENNFKQPG+RYRS++PDRQ+RFI RWV +LS+PRVTHEIRS WISY +QADRSLGQK+
Sbjct  423  DKENNFKQPGERYRSFSPDRQERFIKRWVNALSDPRVTHEIRSIWISYWSQADRSLGQKL  482

Query  224  ASRLNIRPTM  195
            ASRLN+RP++
Sbjct  483  ASRLNVRPSI  492



>ref|XP_011022153.1| PREDICTED: catalase-2-like isoform X2 [Populus euphratica]
Length=492

 Score =   303 bits (775),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 136/190 (72%), Positives = 170/190 (89%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGR+VLN+NIDNFFAENE +A  PA IVPGIY+SDDK+LQ RIF+YADT RHRLGPNY+ 
Sbjct  303  VGRLVLNKNIDNFFAENEQLAFCPAIIVPGIYYSDDKLLQTRIFSYADTQRHRLGPNYLQ  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS+FD  R+AER+P P  I TG+R+KC+I
Sbjct  363  LPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPVRHAERYPNPSVIHTGKREKCII  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            EKENNFKQPG+RYRS++PDR++RF+ RWV++LS+PRVT+EIRS WISY +QAD+SLGQK+
Sbjct  423  EKENNFKQPGERYRSFSPDRKERFVRRWVEALSDPRVTYEIRSIWISYWSQADKSLGQKL  482

Query  224  ASRLNIRPTM  195
            AS LN+RP +
Sbjct  483  ASHLNMRPGI  492



>emb|CAA85470.1| catalase [Solanum tuberosum]
Length=491

 Score =   303 bits (775),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 137/190 (72%), Positives = 160/190 (84%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGR+VLN+NIDNFFAENE +A +P HIVPGIY+S+DK+LQ RIFAYADT RHR+GPNYM 
Sbjct  302  VGRLVLNRNIDNFFAENEQLAFNPGHIVPGIYYSEDKLLQTRIFAYADTQRHRIGPNYMQ  361

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LPVNAPKC +HNN  DG MN  HRDEEVDY PS+FD  R AE++P P  ++ GRR  CVI
Sbjct  362  LPVNAPKCGHHNNHRDGAMNMTHRDEEVDYLPSRFDPCRPAEQYPIPACVLNGRRTNCVI  421

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
             KENNFKQ G+RYRSW  DRQDR+I +WV+SLS+PRVTHEIRS WISYL+QAD+S GQKV
Sbjct  422  PKENNFKQAGERYRSWESDRQDRYITKWVESLSDPRVTHEIRSIWISYLSQADKSCGQKV  481

Query  224  ASRLNIRPTM  195
            ASRL ++PTM
Sbjct  482  ASRLTVKPTM  491



>gb|AAR97905.1| catalase [Solanum tuberosum]
Length=492

 Score =   303 bits (775),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 137/190 (72%), Positives = 160/190 (84%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGR+VLN+NIDNFFAENE +A +P HIVPGIY+S+DK+LQ RIFAYADT RHR+GPNYM 
Sbjct  303  VGRLVLNRNIDNFFAENEQLAFNPGHIVPGIYYSEDKLLQTRIFAYADTQRHRIGPNYMQ  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LPVNAPKC +HNN  DG MN  HRDEEVDY PS+FD  R AE++P P  ++ GRR  CVI
Sbjct  363  LPVNAPKCGHHNNHRDGAMNMTHRDEEVDYLPSRFDPCRPAEQYPIPACVLNGRRTNCVI  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
             KENNFKQ G+RYRSW  DRQDR+I +WV+SLS+PRVTHEIRS WISYL+QAD+S GQKV
Sbjct  423  PKENNFKQAGERYRSWESDRQDRYITKWVESLSDPRVTHEIRSIWISYLSQADKSCGQKV  482

Query  224  ASRLNIRPTM  195
            ASRL ++PTM
Sbjct  483  ASRLTVKPTM  492



>sp|P55312.1|CATA2_SOLTU RecName: Full=Catalase isozyme 2 [Solanum tuberosum]
Length=492

 Score =   303 bits (775),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 137/190 (72%), Positives = 160/190 (84%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGR+VLN+NIDNFFAENE +A +P HIVPGIY+S+DK+LQ RIFAYADT RHR+GPNYM 
Sbjct  303  VGRLVLNRNIDNFFAENEQLAFNPGHIVPGIYYSEDKLLQTRIFAYADTQRHRIGPNYMQ  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LPVNAPKC +HNN  DG MN  HRDEEVDY PS+FD  R AE++P P  ++ GRR  CVI
Sbjct  363  LPVNAPKCGHHNNHRDGAMNMTHRDEEVDYLPSRFDPCRPAEQYPIPACVLNGRRTNCVI  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
             KENNFKQ G+RYRSW  DRQDR+I +WV+SLS+PRVTHEIRS WISYL+QAD+S GQKV
Sbjct  423  PKENNFKQAGERYRSWESDRQDRYITKWVESLSDPRVTHEIRSIWISYLSQADKSCGQKV  482

Query  224  ASRLNIRPTM  195
            ASRL ++PTM
Sbjct  483  ASRLTVKPTM  492



>gb|ABQ44283.1| catalase [Saccharum hybrid cultivar NCo 376]
Length=339

 Score =   298 bits (762),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 136/190 (72%), Positives = 163/190 (86%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGRMVLN+NIDNFFAENE +A  P  IVPGIY+SDDK+LQ RIF+Y+DT RHRLGPNY+L
Sbjct  150  VGRMVLNRNIDNFFAENEQLAFCPGLIVPGIYYSDDKLLQTRIFSYSDTQRHRLGPNYLL  209

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LP NAPKCA+HNN YDG+MNF+HRDEEVDYFPS++D  +NA R+P P   +TGRRDK VI
Sbjct  210  LPANAPKCAHHNNHYDGFMNFMHRDEEVDYFPSRYDPAKNAPRYPIPTVHITGRRDKTVI  269

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
             KENNFKQPG+RYR+  P RQ+RFI RWV +LS+PR+THEIRS W+S  +QADRSLGQK+
Sbjct  270  AKENNFKQPGERYRAMDPARQERFIKRWVDALSDPRLTHEIRSIWLSNWSQADRSLGQKL  329

Query  224  ASRLNIRPTM  195
            ASRL+ +P+M
Sbjct  330  ASRLSAKPSM  339



>ref|NP_564120.1| catalase 3 [Arabidopsis thaliana]
 sp|Q42547.3|CATA3_ARATH RecName: Full=Catalase-3 [Arabidopsis thaliana]
 gb|AAL08303.1| At1g20620/F5M15_4 [Arabidopsis thaliana]
 gb|AAL24212.1| At1g20620/F5M15_4 [Arabidopsis thaliana]
 gb|AEE29995.1| catalase 3 [Arabidopsis thaliana]
Length=492

 Score =   303 bits (775),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 136/190 (72%), Positives = 162/190 (85%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGR+VLN+ IDNFF E E +A +P  +VPGIY+SDDK+LQ RIFAY DT RHRLGPNY+ 
Sbjct  303  VGRLVLNRTIDNFFNETEQLAFNPGLVVPGIYYSDDKLLQCRIFAYGDTQRHRLGPNYLQ  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LPVNAPKCA+HNN ++G+MNF+HRDEE++Y+PSKFD  R AE+ PTP    TG R KCVI
Sbjct  363  LPVNAPKCAHHNNHHEGFMNFMHRDEEINYYPSKFDPVRCAEKVPTPTNSYTGIRTKCVI  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            +KENNFKQ GDRYRSWAPDRQDRF+ RWV+ LSEPR+THEIR  WISY +QADRSLGQK+
Sbjct  423  KKENNFKQAGDRYRSWAPDRQDRFVKRWVEILSEPRLTHEIRGIWISYWSQADRSLGQKL  482

Query  224  ASRLNIRPTM  195
            ASRLN+RP++
Sbjct  483  ASRLNVRPSI  492



>gb|AAM65021.1| unknown [Arabidopsis thaliana]
Length=492

 Score =   303 bits (775),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 136/190 (72%), Positives = 162/190 (85%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGR+VLN+ IDNFF E E +A +P  +VPGIY+SDDK+LQ RIFAY DT RHRLGPNY+ 
Sbjct  303  VGRLVLNRTIDNFFNETEQLAFNPGLVVPGIYYSDDKLLQCRIFAYGDTQRHRLGPNYLQ  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LPVNAPKCA+HNN ++G+MNF+HRDEE++Y+PSKFD  R AE+ PTP    TG R KCVI
Sbjct  363  LPVNAPKCAHHNNHHEGFMNFMHRDEEINYYPSKFDPVRCAEKVPTPTNSYTGIRTKCVI  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            +KENNFKQ GDRYRSWAPDRQDRF+ RWV+ LSEPR+THEIR  WISY +QADRSLGQK+
Sbjct  423  KKENNFKQAGDRYRSWAPDRQDRFVKRWVEILSEPRLTHEIRGIWISYWSQADRSLGQKL  482

Query  224  ASRLNIRPTM  195
            ASRLN+RP++
Sbjct  483  ASRLNVRPSI  492



>gb|AAB62892.1| catalase-1 [Nicotiana glutinosa]
Length=492

 Score =   302 bits (774),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 133/190 (70%), Positives = 168/190 (88%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGR+VLN+NIDNFF ENE +A  P+ +VPG+Y+SDDKMLQ RIF+Y+DT R+RLGPNY+ 
Sbjct  303  VGRLVLNKNIDNFFNENEQLAFCPSIVVPGVYYSDDKMLQTRIFSYSDTQRYRLGPNYLQ  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LP NAPKCA+HNN YDG MNF+HRDEE+DYFPS++D  R+AE++P P  + TG+R+KCVI
Sbjct  363  LPANAPKCAHHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAEKYPIPSTMCTGKREKCVI  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
             KENNFKQPG+RYRS+ PDRQ+RFI RWV++LS+PR+THEIRS WISY +QAD+SLGQK+
Sbjct  423  LKENNFKQPGERYRSFTPDRQERFIRRWVEALSDPRITHEIRSIWISYWSQADKSLGQKL  482

Query  224  ASRLNIRPTM  195
            ASRLN+RP++
Sbjct  483  ASRLNVRPSI  492



>ref|XP_010432341.1| PREDICTED: catalase-2-like [Camelina sativa]
Length=492

 Score =   302 bits (774),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 132/190 (69%), Positives = 170/190 (89%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGRMVLN+NIDNFFAENE +A  PA IVPGI++SDDK+LQ R+F+YADT RHRLGPNY+ 
Sbjct  303  VGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYADTQRHRLGPNYLQ  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LPVNAPKCA+HNN +DG+MNF+HRDEEV+YFPS++D  R+AE++P P  + +G+R++CVI
Sbjct  363  LPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDQVRHAEKYPAPPAVCSGKRERCVI  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
             KENNFK+PG+RYRS+ P+RQ+RFI RW+ +LS+PR+THEIRS WISY +QAD+SLGQK+
Sbjct  423  AKENNFKEPGERYRSFPPERQERFICRWIDALSDPRITHEIRSIWISYWSQADKSLGQKL  482

Query  224  ASRLNIRPTM  195
            ASRLN+RP++
Sbjct  483  ASRLNVRPSI  492



>ref|XP_010437527.1| PREDICTED: catalase-2 [Camelina sativa]
Length=492

 Score =   302 bits (774),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 132/190 (69%), Positives = 170/190 (89%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGRMVLN+NIDNFFAENE +A  PA IVPGI++SDDK+LQ R+F+YADT RHRLGPNY+ 
Sbjct  303  VGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYADTQRHRLGPNYLQ  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LPVNAPKCA+HNN +DG+MNF+HRDEEV+YFPS++D  R+AE++P P  + +G+R++CVI
Sbjct  363  LPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDQVRHAEKYPAPPAVCSGKRERCVI  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
             KENNFK+PG+RYRS+ P+RQ+RFI RW+ +LS+PR+THEIRS WISY +QAD+SLGQK+
Sbjct  423  AKENNFKEPGERYRSFPPERQERFICRWIDALSDPRITHEIRSIWISYWSQADKSLGQKL  482

Query  224  ASRLNIRPTM  195
            ASRLN+RP++
Sbjct  483  ASRLNVRPSI  492



>emb|CDY31878.1| BnaC07g15280D [Brassica napus]
Length=492

 Score =   302 bits (774),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 135/190 (71%), Positives = 163/190 (86%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGR+VLN+ IDNFF E E +A +P  +VPGIY+SDDK+LQ RIFAY DT RHRLGPNY+ 
Sbjct  303  VGRLVLNRTIDNFFNETEQLAFNPGLVVPGIYYSDDKLLQCRIFAYGDTQRHRLGPNYLQ  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LPVNAPKCA+HNN ++G+MNF+HRDEE++Y+PSKFD  R AE+ P P +  TG R KC+I
Sbjct  363  LPVNAPKCAHHNNHHEGFMNFMHRDEEINYYPSKFDPVRCAEKAPIPNKSYTGIRTKCII  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            +KENNFKQPGDRYRSWAPDRQDRF+ RWV+ LSEPR+THEIR  WISY +QADRSLGQK+
Sbjct  423  KKENNFKQPGDRYRSWAPDRQDRFVKRWVEILSEPRLTHEIRGIWISYWSQADRSLGQKL  482

Query  224  ASRLNIRPTM  195
            ASRLN+RP++
Sbjct  483  ASRLNVRPSI  492



>dbj|BAA34205.1| catalase [Oryza sativa Japonica Group]
 gb|AAQ19030.1| catalase [Oryza sativa]
Length=492

 Score =   302 bits (774),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 136/190 (72%), Positives = 165/190 (87%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGRMVLN+NIDNFF+ENE +A  P  IVPGIY+SDDK+LQ RIF+Y+DT RHRLGPNY+L
Sbjct  303  VGRMVLNRNIDNFFSENEQLAFCPGIIVPGIYYSDDKLLQTRIFSYSDTQRHRLGPNYLL  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LP NAPKCA+HNN YDG+MNF+HRDEEVDYFPS++D  ++A R+P P   +TGRR+K VI
Sbjct  363  LPPNAPKCAHHNNHYDGFMNFMHRDEEVDYFPSRYDPAKHAPRYPIPSATLTGRREKVVI  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
             KENNFKQPG+RYRSW P RQDRFI RW+ +LS+PR+THEIRS W+SY +QADRSLGQK+
Sbjct  423  AKENNFKQPGERYRSWDPARQDRFIKRWIDALSDPRLTHEIRSIWLSYWSQADRSLGQKL  482

Query  224  ASRLNIRPTM  195
            ASRL+ +P+M
Sbjct  483  ASRLSAKPSM  492



>gb|AAB71764.1| catalase 1 [Nicotiana tabacum]
Length=492

 Score =   302 bits (774),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 132/190 (69%), Positives = 169/190 (89%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGR+VLN+NIDNFF ENE +A  P+ +VPG+Y+SDDKMLQ RIF+Y+DT R+RLGPNY+ 
Sbjct  303  VGRLVLNKNIDNFFNENEQLAFCPSIVVPGVYYSDDKMLQTRIFSYSDTQRYRLGPNYLQ  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LP NAPKCA+HNN YDG MNF+HRDEE+DYFPS++D  R+AE++P P  + TG+R+KCVI
Sbjct  363  LPANAPKCAHHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAEKYPIPSTMCTGKREKCVI  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            +KENNFKQPGDRYRS+ PDRQ+RFI RWV++LS+PR+T+EIR+ WISY +QAD+SLGQK+
Sbjct  423  QKENNFKQPGDRYRSFTPDRQERFIRRWVEALSDPRITYEIRTIWISYWSQADKSLGQKL  482

Query  224  ASRLNIRPTM  195
            ASRLN+RP++
Sbjct  483  ASRLNVRPSI  492



>sp|P49318.1|CATA2_RICCO RecName: Full=Catalase isozyme 2 [Ricinus communis]
 gb|AAB31538.1| catalase 2 [Ricinus communis=castor beans, hypocotyls, Peptide, 
492 aa]
 dbj|BAA04698.1| catalase CAT2 [Ricinus communis]
Length=492

 Score =   302 bits (774),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 134/190 (71%), Positives = 167/190 (88%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGR+VLN+NIDN+FAENEM+A +PAH+VPG+Y+S+DK+ Q R+FAY+DT RHRLG NY+ 
Sbjct  303  VGRLVLNRNIDNWFAENEMLAFNPAHVVPGVYYSNDKLFQLRLFAYSDTQRHRLGTNYLQ  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LPVNAPKC YHNN YDG+MNF+HRDEEVDYF S++D  R+AE+ P P  I +GRR+KCVI
Sbjct  363  LPVNAPKCPYHNNHYDGFMNFMHRDEEVDYFQSRYDPVRHAEKVPIPNAICSGRREKCVI  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            EKE+NF+QPGDRYRSWAPDRQ+RF+ R V +LSEPR+THEIRS W+S+ TQ D+SLGQK+
Sbjct  423  EKEDNFRQPGDRYRSWAPDRQERFLCRLVNALSEPRITHEIRSIWVSWWTQCDKSLGQKL  482

Query  224  ASRLNIRPTM  195
            ASRLN+RP +
Sbjct  483  ASRLNVRPNI  492



>ref|XP_011022152.1| PREDICTED: catalase-2-like isoform X1 [Populus euphratica]
Length=511

 Score =   303 bits (775),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 136/190 (72%), Positives = 170/190 (89%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGR+VLN+NIDNFFAENE +A  PA IVPGIY+SDDK+LQ RIF+YADT RHRLGPNY+ 
Sbjct  322  VGRLVLNKNIDNFFAENEQLAFCPAIIVPGIYYSDDKLLQTRIFSYADTQRHRLGPNYLQ  381

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS+FD  R+AER+P P  I TG+R+KC+I
Sbjct  382  LPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPVRHAERYPNPSVIHTGKREKCII  441

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            EKENNFKQPG+RYRS++PDR++RF+ RWV++LS+PRVT+EIRS WISY +QAD+SLGQK+
Sbjct  442  EKENNFKQPGERYRSFSPDRKERFVRRWVEALSDPRVTYEIRSIWISYWSQADKSLGQKL  501

Query  224  ASRLNIRPTM  195
            AS LN+RP +
Sbjct  502  ASHLNMRPGI  511



>gb|KFK44175.1| hypothetical protein AALP_AA1G224300 [Arabis alpina]
Length=492

 Score =   302 bits (774),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 136/190 (72%), Positives = 162/190 (85%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGR+VLN+ IDNFF E E +A +P  + PGIY+SDDK+LQ RIFAY DT RHRLGPNY+ 
Sbjct  303  VGRLVLNRTIDNFFNETEQLAFNPGLVPPGIYYSDDKLLQCRIFAYGDTQRHRLGPNYLQ  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LPVNAPKCA+HNN ++G+MNF+HRDEE++Y+PSKFD  R AE+ P P +  TG R KCVI
Sbjct  363  LPVNAPKCAHHNNHHEGFMNFMHRDEEINYYPSKFDPVRCAEKVPVPSKSYTGIRTKCVI  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            +KENNFKQPGDRYRSWAPDRQDRFI RWV+ LSEPR+THEIR  WISY +QADRSLGQK+
Sbjct  423  KKENNFKQPGDRYRSWAPDRQDRFIKRWVEILSEPRLTHEIRGIWISYWSQADRSLGQKL  482

Query  224  ASRLNIRPTM  195
            ASRLN+RP++
Sbjct  483  ASRLNVRPSI  492



>ref|NP_001048861.1| Os03g0131200 [Oryza sativa Japonica Group]
 gb|ABF93810.1| Catalase-1, putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF10775.1| Os03g0131200 [Oryza sativa Japonica Group]
 dbj|BAG88238.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG89941.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC74449.1| hypothetical protein OsI_09857 [Oryza sativa Indica Group]
 gb|EEE58275.1| hypothetical protein OsJ_09293 [Oryza sativa Japonica Group]
Length=492

 Score =   302 bits (774),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 136/190 (72%), Positives = 165/190 (87%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGRMVLN+NIDNFF+ENE +A  P  IVPGIY+SDDK+LQ RIF+Y+DT RHRLGPNY+L
Sbjct  303  VGRMVLNRNIDNFFSENEQLAFCPGIIVPGIYYSDDKLLQTRIFSYSDTQRHRLGPNYLL  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LP NAPKCA+HNN YDG+MNF+HRDEEVDYFPS++D  ++A R+P P   +TGRR+K VI
Sbjct  363  LPPNAPKCAHHNNHYDGFMNFMHRDEEVDYFPSRYDPAKHAPRYPIPSATLTGRREKVVI  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
             KENNFKQPG+RYRSW P RQDRFI RW+ +LS+PR+THEIRS W+SY +QADRSLGQK+
Sbjct  423  AKENNFKQPGERYRSWDPARQDRFIKRWIDALSDPRLTHEIRSIWLSYWSQADRSLGQKL  482

Query  224  ASRLNIRPTM  195
            ASRL+ +P+M
Sbjct  483  ASRLSAKPSM  492



>ref|XP_009106100.1| PREDICTED: catalase-2 [Brassica rapa]
Length=492

 Score =   302 bits (774),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 131/190 (69%), Positives = 170/190 (89%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGRMVLN+NIDNF AENE +A  PA IVPGIY+SDDK+LQ R+F+YADT RHRLGPNY+ 
Sbjct  303  VGRMVLNKNIDNFLAENEQLAFCPAIIVPGIYYSDDKLLQTRVFSYADTQRHRLGPNYLQ  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LPVN+PKC++HNN ++G+MNF+HRDEEV+YFPS++D  R+AE++PTP  + +G+R++CVI
Sbjct  363  LPVNSPKCSHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTPPAVCSGKRERCVI  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            EKENNFK+PG+RYRS+ P+RQ+RFI RW+ +LS+PR+THEIRS WISY +QAD+SLGQK+
Sbjct  423  EKENNFKEPGERYRSFTPERQERFIGRWIDALSDPRITHEIRSIWISYWSQADKSLGQKL  482

Query  224  ASRLNIRPTM  195
            ASRLN+RP +
Sbjct  483  ASRLNVRPNI  492



>dbj|BAJ87148.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=302

 Score =   296 bits (757),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 132/190 (69%), Positives = 165/190 (87%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGRMVLN+NIDNFFAENE +A  PA  VPGI++SDDK+LQ RIF+YADT RHRLGPNY++
Sbjct  113  VGRMVLNKNIDNFFAENEQLAFCPAVTVPGIHYSDDKLLQTRIFSYADTQRHRLGPNYLM  172

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LPVNAPKCA+HNN +DG MNF+HRDEEV+YFPS+FD TR+AE++P P R+++G R+KC+I
Sbjct  173  LPVNAPKCAHHNNHHDGLMNFIHRDEEVNYFPSRFDPTRHAEKYPMPPRVLSGCREKCII  232

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            +KENNFKQ G+RYRS+ P RQDRF+ RWV +L++ RVTHEI+S W+SY +Q D SLGQK+
Sbjct  233  DKENNFKQAGERYRSFDPARQDRFLQRWVDALTDARVTHEIQSIWVSYWSQCDASLGQKL  292

Query  224  ASRLNIRPTM  195
            ASRL I+P M
Sbjct  293  ASRLKIKPNM  302



>emb|CDX72514.1| BnaC07g45360D [Brassica napus]
Length=480

 Score =   301 bits (772),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 131/190 (69%), Positives = 170/190 (89%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGRMVLN+NIDNFF ENE +A  PA IVPGI++SDDK+LQ R+F+YADT RHRLGPNY+ 
Sbjct  291  VGRMVLNKNIDNFFTENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYADTQRHRLGPNYLQ  350

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LPVNAPKCA+HNN ++G+MN +HRDEEV+YFPS++D  R+AE++PTP  + +G+R++CVI
Sbjct  351  LPVNAPKCAHHNNHHEGFMNVMHRDEEVNYFPSRYDPVRHAEKYPTPPAVCSGKRERCVI  410

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            EKENNFK+PG+RYRS+ P+RQ+RFI RW+ +LS+PR+THEIRS WISY +QAD+SLGQK+
Sbjct  411  EKENNFKEPGERYRSFTPERQERFIGRWIDALSDPRITHEIRSIWISYWSQADKSLGQKL  470

Query  224  ASRLNIRPTM  195
            ASRLN+RP++
Sbjct  471  ASRLNVRPSI  480



>sp|P30567.1|CATA2_GOSHI RecName: Full=Catalase isozyme 2 [Gossypium hirsutum]
 emb|CAA39998.1| subunit 2 of cotton catalase [Gossypium hirsutum]
Length=492

 Score =   301 bits (772),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 132/190 (69%), Positives = 170/190 (89%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            +GRMVLN+NIDNFFAENE +A  P+ IVPGIY+SDDK+LQ RIF+Y+DT RHRLGPNY+ 
Sbjct  303  MGRMVLNKNIDNFFAENEQLAFCPSLIVPGIYYSDDKLLQTRIFSYSDTQRHRLGPNYLQ  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE+ P P  +++G+R+KC+I
Sbjct  363  LPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKHPIPSTVLSGKREKCII  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
             KENNFKQPG+RYRS++ DRQ+RFINRW+ +LS+PRVTHEIRS WISY +QAD+SLGQK+
Sbjct  423  GKENNFKQPGERYRSFSADRQERFINRWIDALSDPRVTHEIRSIWISYWSQADKSLGQKI  482

Query  224  ASRLNIRPTM  195
            ASRLN+RP++
Sbjct  483  ASRLNVRPSI  492



>gb|ADZ45555.1| catalase [Vigna radiata]
Length=492

 Score =   301 bits (771),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 136/190 (72%), Positives = 165/190 (87%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGR+VLN+NIDNFFAENE +A  PA IVPG+Y+SDDKMLQ RIF+YAD+ RHRLGPNY+L
Sbjct  303  VGRLVLNKNIDNFFAENEQLAFCPAIIVPGVYYSDDKMLQTRIFSYADSQRHRLGPNYLL  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LP NAPK A+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE+FP P  I +GRR+K  I
Sbjct  363  LPANAPKSAHHNNHHEGFMNFIHRDEEVNYFPSRYDPVRHAEKFPIPPAICSGRREKIAI  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            EKENNFKQ G+R+RSWAPDRQDRF  RWV +LS+PRVTHEIRS WISY +QADRSLGQK+
Sbjct  423  EKENNFKQAGERFRSWAPDRQDRFTRRWVDALSDPRVTHEIRSVWISYWSQADRSLGQKI  482

Query  224  ASRLNIRPTM  195
            AS L++RP +
Sbjct  483  ASHLSMRPNI  492



>sp|A2YH64.2|CATA2_ORYSI RecName: Full=Catalase isozyme B; Short=CAT-B [Oryza sativa Indica 
Group]
 gb|EEC81340.1| hypothetical protein OsI_24526 [Oryza sativa Indica Group]
Length=492

 Score =   301 bits (771),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 136/190 (72%), Positives = 165/190 (87%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGRMVLN+NIDNFFAENE +A  PA IVPGI++SDDK+LQ RIF+YADT RHRLGPNY++
Sbjct  303  VGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRIFSYADTQRHRLGPNYLM  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LPVNAPKCAYHNN +DG MNF+HRDEEV+YFPS+FD  R+AE+ P P R++TG R+KCVI
Sbjct  363  LPVNAPKCAYHNNHHDGSMNFMHRDEEVNYFPSRFDAARHAEKVPIPPRVLTGCREKCVI  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            +KENNFKQ G+RYRS+ P RQDRF+ RWV +LS+PR+THE+R  WISY +Q D SLGQK+
Sbjct  423  DKENNFKQAGERYRSFDPARQDRFLQRWVDALSDPRITHELRGIWISYWSQCDASLGQKL  482

Query  224  ASRLNIRPTM  195
            ASRLN++P M
Sbjct  483  ASRLNLKPNM  492



>gb|AAY59707.1| catalase [Oryza sativa Indica Group]
Length=492

 Score =   301 bits (771),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 136/190 (72%), Positives = 165/190 (87%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGRMVLN+NIDNFFAENE +A  PA IVPGI++SDDK+LQ RIF+YADT RHRLGPNY++
Sbjct  303  VGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRIFSYADTQRHRLGPNYLM  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LPVNAPKCAYHNN +DG MNF+HRDEEV+YFPS+FD  R+AE+ P P R++TG R+KCVI
Sbjct  363  LPVNAPKCAYHNNHHDGSMNFMHRDEEVNYFPSRFDAARHAEKVPIPPRVLTGCREKCVI  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            +KENNFKQ G+RYRS+ P RQDRF+ RWV +LS+PR+THE+R  WISY +Q D SLGQK+
Sbjct  423  DKENNFKQAGERYRSFDPARQDRFLQRWVDALSDPRITHELRGIWISYWSQCDASLGQKL  482

Query  224  ASRLNIRPTM  195
            ASRLN++P M
Sbjct  483  ASRLNLKPNM  492



>ref|XP_008452957.1| PREDICTED: catalase isozyme 1-like [Cucumis melo]
Length=492

 Score =   301 bits (771),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 135/187 (72%), Positives = 165/187 (88%), Gaps = 0/187 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGR+VLN+NIDNFFAENE +A  PA IVPGIY+SDDK+LQ RIF+YADT RHRLGPNY+ 
Sbjct  303  VGRLVLNKNIDNFFAENEQLAFCPAIIVPGIYYSDDKLLQTRIFSYADTQRHRLGPNYLQ  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LPVNAPKCA+HNN +DG+MNF+HRDEEV+YFPS+ D   +AER+P P  + TG+R++CVI
Sbjct  363  LPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRIDPAHHAERYPQPPAVYTGKRERCVI  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            EKENNFKQPG+RYRSW  DRQ+RF+ RWV +LS+PRVTHEIR+ WISY +QAD+SLGQK+
Sbjct  423  EKENNFKQPGERYRSWPADRQERFVGRWVDALSDPRVTHEIRNIWISYWSQADKSLGQKL  482

Query  224  ASRLNIR  204
            ASRLN++
Sbjct  483  ASRLNVK  489



>ref|XP_006656514.1| PREDICTED: catalase isozyme B-like [Oryza brachyantha]
Length=492

 Score =   301 bits (770),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 136/190 (72%), Positives = 164/190 (86%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGRMVLN+NIDNFFAENE +A  PA IVPGI++SDDK+LQ R+F+YADT RHRLGPNY++
Sbjct  303  VGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYADTQRHRLGPNYLM  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LPVNAPKCAYHNN +DG MNF+HRDEEV+YFPS+FD  R+AE+ P P R++TG R+KCVI
Sbjct  363  LPVNAPKCAYHNNHHDGTMNFMHRDEEVNYFPSRFDAARHAEKVPVPPRVLTGCREKCVI  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
             KENNFKQ G+RYRS+ P RQDRFI RWV +LS+PR+THE+R  WISY +Q D SLGQK+
Sbjct  423  NKENNFKQAGERYRSFDPARQDRFIQRWVDALSDPRITHELRGIWISYWSQCDASLGQKL  482

Query  224  ASRLNIRPTM  195
            ASRLN++P M
Sbjct  483  ASRLNLKPNM  492



>ref|XP_006306495.1| hypothetical protein CARUB_v10012481mg [Capsella rubella]
 gb|EOA39393.1| hypothetical protein CARUB_v10012481mg [Capsella rubella]
Length=492

 Score =   301 bits (770),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 135/190 (71%), Positives = 161/190 (85%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGR+VLN+ IDNFF E E +A +P  +VPGIY+SDDK+LQ RIFAY DT RHRLGPNY+ 
Sbjct  303  VGRLVLNRTIDNFFNETEQLAFNPGLVVPGIYYSDDKLLQCRIFAYGDTQRHRLGPNYLQ  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LPVNAPKCA+HNN ++G+MNF+HRDEE++Y+PSKFD  R AE+ P P    TG R KCVI
Sbjct  363  LPVNAPKCAHHNNHHEGFMNFMHRDEEINYYPSKFDPVRCAEKVPIPTNSYTGIRTKCVI  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            +KENNFKQ GDRYRSWAPDRQDRF+ RWV+ LSEPR+THEIR  WISY +QADRSLGQK+
Sbjct  423  KKENNFKQAGDRYRSWAPDRQDRFVKRWVEILSEPRLTHEIRGIWISYWSQADRSLGQKL  482

Query  224  ASRLNIRPTM  195
            ASRLN+RP++
Sbjct  483  ASRLNVRPSI  492



>gb|KDP43757.1| hypothetical protein JCGZ_22384 [Jatropha curcas]
Length=492

 Score =   301 bits (770),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 136/190 (72%), Positives = 169/190 (89%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGRMVLN+NIDNFFAENE +A  PA IVPG+Y+SDDK+LQ RIF+Y+DT RHRLGPNY+ 
Sbjct  303  VGRMVLNRNIDNFFAENEQLAFCPAIIVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQ  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE++P P  ++TGRR+K VI
Sbjct  363  LPPNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPIPPPVLTGRREKTVI  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
             KENNFKQPG+RYRS+ PDR+DRFI RWV++LS+PRVT+EIRS WISY +QAD+SLGQK+
Sbjct  423  PKENNFKQPGERYRSFTPDRKDRFIRRWVEALSDPRVTYEIRSIWISYWSQADKSLGQKI  482

Query  224  ASRLNIRPTM  195
            AS LN+RPTM
Sbjct  483  ASHLNMRPTM  492



>gb|AAG43363.1|AF151368_1 catalase [Hevea brasiliensis]
Length=492

 Score =   300 bits (769),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 135/190 (71%), Positives = 165/190 (87%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGR+VLN+NIDNFFAENE +A  P  +VPGI +S+DK+LQ RIF+Y+DT RHRLG NY+ 
Sbjct  303  VGRLVLNKNIDNFFAENEQLAFCPGIVVPGISYSEDKLLQTRIFSYSDTQRHRLGSNYLQ  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LPVNAPKCA+HNN +DG+MNF+HRDEEV+YFPS+ D  R++ERFP P  I +GRRDKCVI
Sbjct  363  LPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRCDPVRHSERFPIPSTICSGRRDKCVI  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            EKENNF+QPG+RYRSWAPDRQ+RF+NR V  LS+PR+THE+RS WISY TQ DRSLGQK+
Sbjct  423  EKENNFEQPGERYRSWAPDRQERFLNRMVGCLSDPRITHELRSIWISYWTQCDRSLGQKL  482

Query  224  ASRLNIRPTM  195
            A RLN+RP++
Sbjct  483  AFRLNVRPSI  492



>gb|ACB11496.1| catalase [Pinus sylvestris]
Length=492

 Score =   300 bits (768),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 132/190 (69%), Positives = 166/190 (87%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGRMVLN+NIDNFFAENE +A  P  IVPG+Y+++DK+LQ RIF+Y+DT RHRLGPNY++
Sbjct  303  VGRMVLNKNIDNFFAENEQLAFGPGLIVPGVYYTEDKLLQTRIFSYSDTQRHRLGPNYLM  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS+FD  R+AERFP P    TG+R+KCVI
Sbjct  363  LPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPVRHAERFPIPSHTHTGKREKCVI  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            EKENNFKQPG+RYRS+AP+RQ+RF+ RWV +LS+PRVTHEI S WISY +Q D+SLGQK+
Sbjct  423  EKENNFKQPGERYRSFAPERQERFVKRWVAALSDPRVTHEICSIWISYWSQCDKSLGQKI  482

Query  224  ASRLNIRPTM  195
            A+RLN++  M
Sbjct  483  AARLNMKANM  492



>gb|EYU30275.1| hypothetical protein MIMGU_mgv1a005250mg [Erythranthe guttata]
Length=492

 Score =   300 bits (768),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 131/190 (69%), Positives = 169/190 (89%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGR+VLN+NIDNFFAENE +A  P  +VPG+++SDDKMLQ RIF+Y+D+ RHRLGPNY+ 
Sbjct  303  VGRLVLNKNIDNFFAENEQLAFCPGLVVPGVHYSDDKMLQTRIFSYSDSQRHRLGPNYLQ  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE+ P P  +++G+RD+C I
Sbjct  363  LPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPCRHAEKHPIPPVVLSGKRDRCCI  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            EKENNFKQPG+RYR+++PDRQ+RFI RWV +LS+PR+THEIRS WISY +QAD+SLGQK+
Sbjct  423  EKENNFKQPGERYRTFSPDRQERFIRRWVDALSDPRLTHEIRSIWISYWSQADKSLGQKL  482

Query  224  ASRLNIRPTM  195
            ASRLN+RPTM
Sbjct  483  ASRLNVRPTM  492



>ref|XP_009794245.1| PREDICTED: catalase isozyme 1 [Nicotiana sylvestris]
Length=492

 Score =   300 bits (768),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 132/190 (69%), Positives = 168/190 (88%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGR+VLN+NIDNFF ENE +A  P+ +VPG+Y+SDDKMLQ RIF+Y+DT R+RLGPNY+ 
Sbjct  303  VGRLVLNKNIDNFFNENEQLAFCPSIVVPGVYYSDDKMLQTRIFSYSDTQRYRLGPNYLQ  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LP NAPKCA+HNN YDG MNF+HRDEE+DYFPS++D  R+AE++P P  + TG+R+KCVI
Sbjct  363  LPANAPKCAHHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAEKYPIPSTMCTGKREKCVI  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            +KENNFKQ GDRYRS+ PDRQ+RFI RWV++LS+PR+T+EIRS WISY +QAD+SLGQK+
Sbjct  423  QKENNFKQAGDRYRSFTPDRQERFIRRWVEALSDPRITYEIRSIWISYWSQADKSLGQKL  482

Query  224  ASRLNIRPTM  195
            ASRLN+RP++
Sbjct  483  ASRLNVRPSI  492



>gb|AIU99479.1| catalase [Saccharum arundinaceum]
Length=492

 Score =   300 bits (768),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 135/190 (71%), Positives = 166/190 (87%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGRMVLN+NIDNFFAENE +A+ PA IVPGI++SDDK+LQ RIF+YADT RHRLGPNY++
Sbjct  303  VGRMVLNKNIDNFFAENEQIALCPAIIVPGIHYSDDKLLQTRIFSYADTQRHRLGPNYLM  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LPVNAPKCA+HNN +DG+MNF+HRDEEV+YFPS+FD  R+AE+ P P R++TG R+KC+I
Sbjct  363  LPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRFDPARHAEKVPIPSRVLTGCREKCII  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            +KENNFKQ G+RYRS+ P RQDRFI RWV +LS+PRVTHE  + WISY +Q D SLGQK+
Sbjct  423  QKENNFKQAGERYRSFDPARQDRFIQRWVDALSDPRVTHEHHTIWISYWSQCDASLGQKL  482

Query  224  ASRLNIRPTM  195
            ASRLN++P M
Sbjct  483  ASRLNLKPNM  492



>ref|XP_010446982.1| PREDICTED: catalase-2-like [Camelina sativa]
Length=492

 Score =   300 bits (768),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 132/190 (69%), Positives = 169/190 (89%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGRMVLN+NIDNFFAENE +A  PA IVPGI++SDDK+LQ R+F+YADT RHRLGPNY+ 
Sbjct  303  VGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYADTQRHRLGPNYLQ  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LPVNAPKCA+HNN +DG+MNF+HRDEEV+YFPS++D  R+AE++P P  + +G R++CVI
Sbjct  363  LPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPVRHAEKYPAPPAVCSGTRERCVI  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
             KENNFK+PG+RYRS+ P+RQ+RFI RW+ +LS+PR+THEIRS WISY +QAD+SLGQK+
Sbjct  423  AKENNFKEPGERYRSFPPERQERFICRWIDALSDPRITHEIRSIWISYWSQADKSLGQKL  482

Query  224  ASRLNIRPTM  195
            ASRLN+RP++
Sbjct  483  ASRLNVRPSI  492



>dbj|BAA34204.1| catalase [Oryza sativa Japonica Group]
Length=492

 Score =   300 bits (768),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 135/190 (71%), Positives = 165/190 (87%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGRMVLN+NIDNFFAENE +A  PA IVPGI++SDDK+LQ RIF+YADT RHRLGPNY++
Sbjct  303  VGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRIFSYADTQRHRLGPNYLM  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LPVNAPKCAYHNN +DG MNF+HRDEEV+YFPS+FD  R+AE+ P P R++TG R+KCVI
Sbjct  363  LPVNAPKCAYHNNHHDGSMNFMHRDEEVNYFPSRFDAARHAEKVPIPPRVLTGCREKCVI  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            +KENNF+Q G+RYRS+ P RQDRF+ RWV +LS+PR+THE+R  WISY +Q D SLGQK+
Sbjct  423  DKENNFQQAGERYRSFDPARQDRFLQRWVDALSDPRITHELRGIWISYWSQCDASLGQKL  482

Query  224  ASRLNIRPTM  195
            ASRLN++P M
Sbjct  483  ASRLNLKPNM  492



>gb|AAO17721.1| catalase [Hypericum perforatum]
Length=492

 Score =   300 bits (768),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 132/190 (69%), Positives = 169/190 (89%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGR+VLN+NIDNFFAENE +A  PA +VPGIY+SDDK+LQ RIF+Y+DT RHRLGPNY+ 
Sbjct  303  VGRLVLNKNIDNFFAENEQLAFCPAIVVPGIYYSDDKLLQTRIFSYSDTQRHRLGPNYLQ  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LPVNAPK A+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE++P P  ++ GRR+KC+I
Sbjct  363  LPVNAPKSAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPIPPVVLNGRREKCMI  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
             KENNFKQPG+RYRS++PDRQ+RF+NRW+ SLS+PRVTHEIR+ W++Y  QAD+SLGQK+
Sbjct  423  AKENNFKQPGERYRSFSPDRQERFLNRWISSLSDPRVTHEIRAIWVTYWYQADKSLGQKL  482

Query  224  ASRLNIRPTM  195
            ASRLN+RP M
Sbjct  483  ASRLNVRPNM  492



>gb|ADZ45556.1| catalase [Vigna radiata]
Length=492

 Score =   300 bits (768),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 136/190 (72%), Positives = 164/190 (86%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGR+VLN+NIDNFFAENE +A  PA IVPG+Y+SDDKMLQ RIF+YAD  RHRLGPNY+L
Sbjct  303  VGRLVLNKNIDNFFAENEQLAFCPAIIVPGVYYSDDKMLQTRIFSYADPQRHRLGPNYLL  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LP NAPK A+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE+FP P  I +GRR+K  I
Sbjct  363  LPANAPKSAHHNNHHEGFMNFIHRDEEVNYFPSRYDPVRHAEKFPIPPAICSGRREKIAI  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            EKENNFKQ G+R+RSWAPDRQDRF  RWV +LS+PRVTHEIRS WISY +QADRSLGQK+
Sbjct  423  EKENNFKQAGERFRSWAPDRQDRFTRRWVDALSDPRVTHEIRSVWISYWSQADRSLGQKI  482

Query  224  ASRLNIRPTM  195
            AS L++RP +
Sbjct  483  ASHLSMRPNI  492



>dbj|BAA05494.1| catalase [Oryza sativa Japonica Group]
Length=492

 Score =   300 bits (768),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 135/190 (71%), Positives = 165/190 (87%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGRMVLN+NIDNFFAENE +A  PA IVPGI++SDDK+LQ RIF+YADT RHRLGPNY++
Sbjct  303  VGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRIFSYADTQRHRLGPNYLM  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LPVNAPKCAYHNN +DG MNF+HRDEEV+YFPS+FD  R+AE+ P P R++TG R+KCVI
Sbjct  363  LPVNAPKCAYHNNHHDGSMNFMHRDEEVNYFPSRFDAARHAEKVPIPPRVLTGCREKCVI  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            +KENNF+Q G+RYRS+ P RQDRF+ RWV +LS+PR+THE+R  WISY +Q D SLGQK+
Sbjct  423  DKENNFQQAGERYRSFDPARQDRFLQRWVDALSDPRITHELRGIWISYWSQCDASLGQKL  482

Query  224  ASRLNIRPTM  195
            ASRLN++P M
Sbjct  483  ASRLNLKPNM  492



>ref|NP_001058635.1| Os06g0727200 [Oryza sativa Japonica Group]
 sp|Q0D9C4.1|CATA2_ORYSJ RecName: Full=Catalase isozyme B; Short=CAT-B [Oryza sativa Japonica 
Group]
 dbj|BAD61813.1| catalase [Oryza sativa Japonica Group]
 dbj|BAF20549.1| Os06g0727200 [Oryza sativa Japonica Group]
 gb|EAZ38347.1| hypothetical protein OsJ_22721 [Oryza sativa Japonica Group]
 dbj|BAG91437.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG94401.1| unnamed protein product [Oryza sativa Japonica Group]
Length=492

 Score =   300 bits (768),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 135/190 (71%), Positives = 165/190 (87%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGRMVLN+NIDNFFAENE +A  PA IVPGI++SDDK+LQ RIF+YADT RHRLGPNY++
Sbjct  303  VGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRIFSYADTQRHRLGPNYLM  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LPVNAPKCAYHNN +DG MNF+HRDEEV+YFPS+FD  R+AE+ P P R++TG R+KCVI
Sbjct  363  LPVNAPKCAYHNNHHDGSMNFMHRDEEVNYFPSRFDAARHAEKVPIPPRVLTGCREKCVI  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            +KENNF+Q G+RYRS+ P RQDRF+ RWV +LS+PR+THE+R  WISY +Q D SLGQK+
Sbjct  423  DKENNFQQAGERYRSFDPARQDRFLQRWVDALSDPRITHELRGIWISYWSQCDASLGQKL  482

Query  224  ASRLNIRPTM  195
            ASRLN++P M
Sbjct  483  ASRLNLKPNM  492



>ref|XP_006649332.1| PREDICTED: catalase-1-like [Oryza brachyantha]
Length=492

 Score =   300 bits (767),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 135/190 (71%), Positives = 165/190 (87%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGRMVLN+NIDNFF+ENE +A  P  IVPGIY+SDDK+LQ RIF+Y+DT RHRLGPNY+L
Sbjct  303  VGRMVLNRNIDNFFSENEQLAFCPGIIVPGIYYSDDKLLQTRIFSYSDTQRHRLGPNYLL  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LP NAPKCA+HNN YDG+MNF+HRDEEVDYFPS++D  ++A R+P P   +TGRR+K VI
Sbjct  363  LPANAPKCAHHNNHYDGFMNFMHRDEEVDYFPSRYDPAKHAPRYPIPSVNLTGRREKTVI  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
             KENNFKQPG+RYRSW P RQ+RFI RW+ +LS+PR+THEIRS W+SY +QADRSLGQK+
Sbjct  423  PKENNFKQPGERYRSWDPARQERFIKRWIDALSDPRLTHEIRSIWLSYWSQADRSLGQKL  482

Query  224  ASRLNIRPTM  195
            ASRL+ +P+M
Sbjct  483  ASRLSAKPSM  492



>ref|XP_009597278.1| PREDICTED: catalase isozyme 1 [Nicotiana tomentosiformis]
 emb|CCP37651.1| catalase-1 [Nicotiana tabacum]
Length=492

 Score =   300 bits (767),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 131/190 (69%), Positives = 168/190 (88%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGR+VLN+NIDNFF ENE +A  P+ +VPG+Y+SDDKMLQ RIF+Y+DT R+RLGPNY+ 
Sbjct  303  VGRLVLNKNIDNFFNENEQLAFCPSIVVPGVYYSDDKMLQTRIFSYSDTQRYRLGPNYLQ  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LP NAPKCA+HNN YDG MNF+HRDEE+DYFPS++D  R+AE++P P  + TG+R+KCVI
Sbjct  363  LPANAPKCAHHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAEKYPIPSTMCTGKREKCVI  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            +KENNF QPG+RYRS+ PDRQ+RFI RWV++LS+PR+T+EIRS WISY +QAD+SLGQK+
Sbjct  423  QKENNFNQPGERYRSFTPDRQERFIRRWVEALSDPRITYEIRSIWISYWSQADKSLGQKL  482

Query  224  ASRLNIRPTM  195
            ASRLN+RP++
Sbjct  483  ASRLNVRPSI  492



>gb|AAC19397.1| leaf catalase [Mesembryanthemum crystallinum]
Length=492

 Score =   300 bits (767),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 133/190 (70%), Positives = 165/190 (87%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGR+VLN+NIDNFFAENE +A  P  +VPG+Y+SDDK+LQ RIF+YADT RHRLGPNY+ 
Sbjct  303  VGRLVLNKNIDNFFAENEQLAFCPGIVVPGVYYSDDKLLQTRIFSYADTQRHRLGPNYLQ  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LPVNAPKCA+HNN YDG MNF+HRD+EVDYFPS++D  R+AER+P P  ++ G RD+ +I
Sbjct  363  LPVNAPKCAHHNNHYDGQMNFMHRDDEVDYFPSRYDPVRHAERYPIPPNVLNGNRDRQII  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            +KENNFKQPG+RYRSW P RQ+RFI RWV +LS+PR+THEIR+ WISY +QAD+S+G K+
Sbjct  423  QKENNFKQPGERYRSWDPARQERFICRWVDALSDPRITHEIRNIWISYWSQADKSVGMKL  482

Query  224  ASRLNIRPTM  195
            ASRLN+RPTM
Sbjct  483  ASRLNVRPTM  492



>ref|XP_007046520.1| Catalase 2 [Theobroma cacao]
 gb|EOX90677.1| Catalase 2 [Theobroma cacao]
Length=492

 Score =   299 bits (766),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 131/190 (69%), Positives = 171/190 (90%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGR+VLN+NIDNFFAENE +A  P+ IVPG+Y+SDDK+LQ RIF+Y+DT RHRLGPNY+ 
Sbjct  303  VGRLVLNKNIDNFFAENEQLAFCPSIIVPGLYYSDDKLLQTRIFSYSDTQRHRLGPNYLQ  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS+FD  R+AE++P P  I +G+R+KC+I
Sbjct  363  LPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPVRHAEKYPIPTAICSGKREKCII  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            +KENNF+QPG+RYRS+APDRQ+RFI RWV +LS+PRVT+EIRS WISY ++AD+SLGQK+
Sbjct  423  DKENNFQQPGERYRSFAPDRQERFIYRWVDALSDPRVTYEIRSIWISYWSKADKSLGQKL  482

Query  224  ASRLNIRPTM  195
            ASRL++RP++
Sbjct  483  ASRLSVRPSI  492



>ref|XP_010523643.1| PREDICTED: catalase-2-like [Tarenaya hassleriana]
Length=492

 Score =   299 bits (766),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 129/190 (68%), Positives = 170/190 (89%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGR+VLN+NID+FFAENE +A  P  IVPGI++SDDK+LQ R+F+Y+DT RHRLGPNY+ 
Sbjct  303  VGRLVLNKNIDSFFAENEQLAFCPGIIVPGIHYSDDKLLQTRVFSYSDTQRHRLGPNYLQ  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LPVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AER+P P  + +GRR++C+I
Sbjct  363  LPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAERYPVPSVVCSGRRERCII  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            EKENNFKQPG+RYRS+ PDR++RFI RW+++LS+PR+THEIRS WISY +QAD+SLGQK+
Sbjct  423  EKENNFKQPGERYRSFTPDRKERFIRRWIEALSDPRITHEIRSIWISYWSQADQSLGQKL  482

Query  224  ASRLNIRPTM  195
            ASR+N+RP +
Sbjct  483  ASRMNVRPNI  492



>gb|AAD30292.1|AF139539_1 catalase 3 [Raphanus sativus]
Length=492

 Score =   299 bits (766),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 134/190 (71%), Positives = 162/190 (85%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGR+VLN+ IDNFF E E +A +P  +VPGIY+SDDK+LQ RIFAY DT RHRLGPNY+ 
Sbjct  303  VGRLVLNRTIDNFFNETEQLAFNPGLVVPGIYYSDDKLLQCRIFAYGDTQRHRLGPNYLQ  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LPVNAPKCA+HNN ++G+MNF+HRDEE++Y+PSKFD  R AE+ P P +  TG R KC+I
Sbjct  363  LPVNAPKCAHHNNHHEGFMNFMHRDEEINYYPSKFDPVRCAEKVPIPNKSYTGIRTKCII  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            +KENNFKQ GDRYRSWAPDRQDRF+ RWV+ LSEPR+THEIRS WISY +QAD SLGQK+
Sbjct  423  KKENNFKQAGDRYRSWAPDRQDRFVKRWVEILSEPRLTHEIRSIWISYWSQADASLGQKL  482

Query  224  ASRLNIRPTM  195
            ASRLN+RP++
Sbjct  483  ASRLNVRPSI  492



>gb|AAD30291.2|AF139538_1 catalase 2 [Raphanus sativus]
Length=492

 Score =   299 bits (766),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 135/190 (71%), Positives = 162/190 (85%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGR+VLN+ IDNFF E E +A +P  +VPGIY+SDDK+LQ RIFAY DT RHRLGPNY+ 
Sbjct  303  VGRLVLNRTIDNFFNETEQLAFNPGLVVPGIYYSDDKLLQCRIFAYGDTQRHRLGPNYLQ  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LPVNAPKCA+HNN ++G+MNF+HRDEE++Y+PSKFD  R AE+ P P +  TG R KCVI
Sbjct  363  LPVNAPKCAHHNNHHEGFMNFMHRDEEINYYPSKFDPVRCAEKVPIPSKSYTGIRTKCVI  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            +KENNFKQ GDRYRSWAPDRQDRF+ RWV+ LSE R+THEIRS WISY +QADRSLGQK+
Sbjct  423  KKENNFKQAGDRYRSWAPDRQDRFVKRWVEILSELRLTHEIRSIWISYWSQADRSLGQKL  482

Query  224  ASRLNIRPTM  195
            ASRLN+RP++
Sbjct  483  ASRLNVRPSI  492



>gb|AAR14052.2| catalase [Solanum tuberosum]
Length=475

 Score =   299 bits (765),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 129/190 (68%), Positives = 168/190 (88%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGR+VLN+NIDNFF ENE +A  P+ +VPG+Y+SDDKMLQ RIF+Y+DT R+RLGPNY+ 
Sbjct  286  VGRLVLNKNIDNFFNENEQLAFCPSIVVPGVYYSDDKMLQTRIFSYSDTQRYRLGPNYLQ  345

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LP NAPKCA+HNN YDG MNF+HRDEE+DYFPS++D  R+AE +P P  + +G+R+KC+I
Sbjct  346  LPANAPKCAHHNNHYDGSMNFMHRDEEIDYFPSRYDQVRHAEVYPIPSTVCSGKREKCII  405

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            +KENNFKQPG+RYR++ PDRQ+RFI RWV++LS+PR+T+EIRS WISY +QAD+SLGQK+
Sbjct  406  QKENNFKQPGERYRTFTPDRQERFIRRWVEALSDPRITYEIRSIWISYWSQADKSLGQKL  465

Query  224  ASRLNIRPTM  195
            ASRLN+RP++
Sbjct  466  ASRLNVRPSI  475



>ref|XP_009108683.1| PREDICTED: catalase-2-like isoform X2 [Brassica rapa]
Length=496

 Score =   299 bits (766),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 133/194 (69%), Positives = 172/194 (89%), Gaps = 4/194 (2%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGRMVLN+NIDNFFAENE +A  PA IVPGI++SDDK+LQ R+F+YADT RHRLGPNY+ 
Sbjct  303  VGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYADTQRHRLGPNYLQ  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LPVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE++PTP  + +G+R++CVI
Sbjct  363  LPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTPPAVCSGKRERCVI  422

Query  404  EKENNFKQPGDRYRSWAPD----RQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  237
            EKENNFK+PG RYRS+ PD    RQ+RFI RW+++LS+PR+THEIRS WISY +QAD++L
Sbjct  423  EKENNFKEPGGRYRSFTPDSFDFRQERFIRRWIEALSDPRITHEIRSIWISYWSQADKTL  482

Query  236  GQKVASRLNIRPTM  195
            GQK+ASRLN+RP++
Sbjct  483  GQKLASRLNVRPSI  496



>gb|ABK24453.1| unknown [Picea sitchensis]
Length=492

 Score =   299 bits (766),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 132/190 (69%), Positives = 166/190 (87%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGRMVLN+NIDNFFAENE +A  PA +VPGIY+++DK+LQ RIF+Y+DT RHRLGPNY++
Sbjct  303  VGRMVLNKNIDNFFAENEQLAFSPALVVPGIYYTEDKLLQTRIFSYSDTQRHRLGPNYLM  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS+FD  R+AERFP P    +G R+KCVI
Sbjct  363  LPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPVRHAERFPIPSHTHSGMREKCVI  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            EKENNFKQPG+RYRS+ PDRQ+RF+ RWV +LS+PRVTHEI S WISY +Q+D+SLGQK+
Sbjct  423  EKENNFKQPGERYRSFEPDRQERFVKRWVAALSDPRVTHEICSIWISYWSQSDKSLGQKI  482

Query  224  ASRLNIRPTM  195
            A+RLN++  M
Sbjct  483  AARLNMKANM  492



>gb|ACJ22771.1| catalase 1 [Jatropha curcas]
 gb|KDP36790.1| hypothetical protein JCGZ_08081 [Jatropha curcas]
Length=492

 Score =   299 bits (766),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 131/190 (69%), Positives = 166/190 (87%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            +GR+VLN+NIDN+FAENEM+A +PAH+VPGI++S+DK+ Q R FAY+DT RHRLGPNYM 
Sbjct  303  IGRLVLNRNIDNWFAENEMLAFNPAHVVPGIHYSNDKLFQLRTFAYSDTQRHRLGPNYMQ  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LPVNAPKC +HNN YDG+MNF+HRDEE+DYF S++D  R+AER+P P  I++GRR+KCVI
Sbjct  363  LPVNAPKCPHHNNHYDGFMNFMHRDEEIDYFQSRYDPVRHAERYPIPNAIISGRREKCVI  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
             KENNFKQPG+RYRSW PDRQ+RF+ R V +LS+PR+THEIR  W+SY +Q D+SLGQK+
Sbjct  423  PKENNFKQPGERYRSWTPDRQERFLCRLVNALSDPRITHEIRGIWVSYWSQCDQSLGQKL  482

Query  224  ASRLNIRPTM  195
            ASRLN+RP +
Sbjct  483  ASRLNVRPNI  492



>gb|KJB17473.1| hypothetical protein B456_003G002800 [Gossypium raimondii]
Length=492

 Score =   299 bits (765),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 132/190 (69%), Positives = 168/190 (88%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGRMVLN+NIDNFFAENE +A  P+ IVPGIY+SDDK+LQ RIF+Y+DT RHRLGPNY+ 
Sbjct  303  VGRMVLNKNIDNFFAENEQLAFCPSLIVPGIYYSDDKLLQTRIFSYSDTQRHRLGPNYLQ  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE+ P P  + +G+R+KC+I
Sbjct  363  LPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKHPIPSTVYSGKREKCII  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
             KENNFKQPG+RYRS++ DRQ+RFINRW+ +LS+ RVTHEIRS WISY +QAD+SLGQK+
Sbjct  423  GKENNFKQPGERYRSFSADRQERFINRWIDALSDSRVTHEIRSIWISYWSQADKSLGQKI  482

Query  224  ASRLNIRPTM  195
            ASRLN+RP++
Sbjct  483  ASRLNVRPSI  492



>ref|NP_001241808.1| catalase isozyme B [Zea mays]
 gb|ACG48924.1| catalase isozyme B [Zea mays]
 gb|ACN25578.1| unknown [Zea mays]
 gb|AFW69583.1| catalase1 [Zea mays]
Length=492

 Score =   299 bits (765),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 133/190 (70%), Positives = 167/190 (88%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGRMVLN+N+DNFFAENE +A  PA IVPGI++SDDK+LQ RIF+YADT RHRLGPNY++
Sbjct  303  VGRMVLNKNVDNFFAENEQIAFCPAIIVPGIHYSDDKLLQTRIFSYADTQRHRLGPNYLM  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LPVNAPKCA+HNN +DG+MNF+HRDEEV+YFPS+FD  R+AE+ P P R++TG R+KC+I
Sbjct  363  LPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRFDPARHAEKVPIPPRVLTGCREKCII  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            +KENNFKQ G+RYRS+ P RQDRFI RWV +L++PRVTHE R+ WISY +Q D +LGQK+
Sbjct  423  QKENNFKQAGERYRSFDPARQDRFIQRWVDALTDPRVTHEHRTIWISYWSQCDAALGQKL  482

Query  224  ASRLNIRPTM  195
            ASRLN++P+M
Sbjct  483  ASRLNLKPSM  492



>emb|CAA42720.1| catalase-1 [Zea mays]
Length=492

 Score =   299 bits (765),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 133/190 (70%), Positives = 167/190 (88%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGRMVLN+N+DNFFAENE +A  PA IVPGI++SDDK+LQ RIF+YADT RHRLGPNY++
Sbjct  303  VGRMVLNKNVDNFFAENEQIAFCPAIIVPGIHYSDDKLLQTRIFSYADTQRHRLGPNYLM  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LPVNAPKCA+HNN +DG+MNF+HRDEEV+YFPS+FD  R+AE+ P P R++TG R+KC+I
Sbjct  363  LPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRFDPARHAEKVPIPPRVLTGCREKCII  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            +KENNFKQ G+RYRS+ P RQDRFI RWV +L++PRVTHE R+ WISY +Q D +LGQK+
Sbjct  423  QKENNFKQAGERYRSFDPARQDRFIQRWVDALTDPRVTHEHRTIWISYWSQCDAALGQKL  482

Query  224  ASRLNIRPTM  195
            ASRLN++P+M
Sbjct  483  ASRLNLKPSM  492



>gb|AAD17933.1| catalase [Brassica juncea]
Length=496

 Score =   299 bits (765),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 132/194 (68%), Positives = 173/194 (89%), Gaps = 4/194 (2%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGRMVLN+NIDNFFAENE +A  PA IVPGI++SDDK+LQ R+F+YADT RHRLGPNY+ 
Sbjct  303  VGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYADTQRHRLGPNYLQ  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LPVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE++PTP  + +G+R++CVI
Sbjct  363  LPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTPPAVCSGKRERCVI  422

Query  404  EKENNFKQPGDRYRSWAPD----RQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  237
            EKENNFK+PG+RYRS+ P+    RQ+RFI RW+++LS+PR+THEIRS WISY +QAD++L
Sbjct  423  EKENNFKEPGERYRSFTPESFDFRQERFIRRWIEALSDPRITHEIRSIWISYWSQADKTL  482

Query  236  GQKVASRLNIRPTM  195
            GQK+ASRLN+RP++
Sbjct  483  GQKLASRLNVRPSI  496



>ref|XP_010534184.1| PREDICTED: catalase isozyme 3-like [Tarenaya hassleriana]
Length=492

 Score =   299 bits (765),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 131/190 (69%), Positives = 165/190 (87%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGR+VLN+N+DNFFAE EM+A +P  +VPGIY+S DK+LQARIFAY DT R+RLGPNY+ 
Sbjct  303  VGRLVLNKNVDNFFAETEMLAFNPGLVVPGIYYSQDKLLQARIFAYGDTQRYRLGPNYLQ  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LPVNAPKCA+HNN +DG+MNF+HRDEEV+YFPS+FD+ R+A ++P P  + +G R KCVI
Sbjct  363  LPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRFDSVRHAAKYPIPSAVCSGERIKCVI  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            EKENNFKQPG+RYRSWAPDRQ+R+  RWV++LS+ RVT EIR  WISYL+Q+D+SLG KV
Sbjct  423  EKENNFKQPGERYRSWAPDRQERYAKRWVEALSDARVTDEIRGVWISYLSQSDKSLGMKV  482

Query  224  ASRLNIRPTM  195
            A+RLN+RP+ 
Sbjct  483  ANRLNVRPSF  492



>sp|P49315.1|CATA1_NICPL RecName: Full=Catalase isozyme 1, partial [Nicotiana plumbaginifolia]
 emb|CAA85424.1| catalase [Nicotiana plumbaginifolia]
Length=485

 Score =   298 bits (764),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 131/190 (69%), Positives = 168/190 (88%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGR+VLN+NIDNF  ENE +A  P+ +VPG+Y+SDDKMLQ RIF+Y+DT R+RLGPNY+ 
Sbjct  296  VGRLVLNKNIDNFSNENEQLAFCPSIVVPGVYYSDDKMLQTRIFSYSDTQRYRLGPNYLQ  355

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LP NAPKCA+HNN YDG MNF+HRDEE+DYFPS++D  R+AE++P P  + TG+R+KCVI
Sbjct  356  LPANAPKCAHHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAEKYPIPSTMCTGKREKCVI  415

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            +KENNFKQPG+RYRS+ PDRQ+RFI RWV++LS+PR+T+EIRS WISY +QAD+SLGQK+
Sbjct  416  QKENNFKQPGERYRSFTPDRQERFIRRWVETLSDPRITYEIRSIWISYWSQADKSLGQKL  475

Query  224  ASRLNIRPTM  195
            ASRLN+RP++
Sbjct  476  ASRLNVRPSI  485



>gb|AIU99485.1| catalase [Saccharum spontaneum]
Length=492

 Score =   298 bits (764),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 135/190 (71%), Positives = 165/190 (87%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGRMVLN+NIDNFFAENE VA  PA IVPGI++SDDK+LQ RIF+YADT RHRLGPNY++
Sbjct  303  VGRMVLNKNIDNFFAENEQVAFCPAIIVPGIHYSDDKLLQTRIFSYADTQRHRLGPNYLM  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LPVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS+FD  R+AE+ P P R++TG R+KC+I
Sbjct  363  LPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPARHAEKVPIPTRVLTGCREKCII  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            +KENNFKQ G+RYRS+ P RQDRFI RWV +LS+PRVTHE  + WISY +Q D SLGQK+
Sbjct  423  QKENNFKQAGERYRSFDPARQDRFIQRWVDALSDPRVTHEHHTIWISYWSQCDASLGQKL  482

Query  224  ASRLNIRPTM  195
            ASRLN++P M
Sbjct  483  ASRLNLKPNM  492



>emb|CDP01803.1| unnamed protein product [Coffea canephora]
Length=492

 Score =   298 bits (764),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 136/190 (72%), Positives = 167/190 (88%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGR+VLN+NIDNFF ENE +A  PA +VPGI++SDDK+LQ RIF+YADT RHRLGPNY+ 
Sbjct  303  VGRLVLNRNIDNFFNENEQLAFCPAIVVPGIHYSDDKLLQTRIFSYADTQRHRLGPNYLQ  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LP NAPKCA+HNN +DG+MNF+HRDEEVDYFPS++D  R+AE  P P  ++TGRR+K +I
Sbjct  363  LPANAPKCAHHNNHHDGFMNFMHRDEEVDYFPSRYDPVRHAEMHPIPSAVLTGRREKTII  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
             KENNFKQPG+RYRS+APDRQ+RFI RWV +LS+PRVT+EIRS WISY +QAD+SLGQK+
Sbjct  423  PKENNFKQPGERYRSFAPDRQERFICRWVDALSDPRVTYEIRSIWISYWSQADKSLGQKL  482

Query  224  ASRLNIRPTM  195
            ASRLNIRP++
Sbjct  483  ASRLNIRPSI  492



>ref|XP_010692544.1| PREDICTED: catalase-like [Beta vulgaris subsp. vulgaris]
Length=492

 Score =   298 bits (764),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 139/190 (73%), Positives = 162/190 (85%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGR+VLN+N+DNFF ENE +A DPAH+VPGIYFS+DKMLQAR FAYADTHR+RLG NY+ 
Sbjct  303  VGRLVLNKNVDNFFTENEQLAFDPAHVVPGIYFSNDKMLQARTFAYADTHRYRLGINYLQ  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LPVNAPKC + N   DG MN VHRDEE+DYFPS+FD  R AERFP P  I+ GRR+K +I
Sbjct  363  LPVNAPKCPHTNMHRDGAMNMVHRDEEIDYFPSRFDPLREAERFPIPTAIIHGRREKQII  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
             KENNFK+PG RYRSW P RQDRF+ R+VK+LS+PR+T+EIRS W+SYLTQAD+SLG KV
Sbjct  423  PKENNFKEPGVRYRSWDPARQDRFVGRFVKALSDPRLTYEIRSIWVSYLTQADKSLGMKV  482

Query  224  ASRLNIRPTM  195
            ASRLNIRPTM
Sbjct  483  ASRLNIRPTM  492



>gb|AIU99484.1| catalase [Saccharum arundinaceum]
Length=492

 Score =   298 bits (764),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 135/190 (71%), Positives = 165/190 (87%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGRMVLN+NIDNFFAENE VA  PA IVPGI++SDDK+LQ RIF+YADT RHRLGPNY++
Sbjct  303  VGRMVLNKNIDNFFAENEQVAFCPAIIVPGIHYSDDKLLQTRIFSYADTQRHRLGPNYLM  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LPVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS+FD  R+AE+ P P R++TG R+KC+I
Sbjct  363  LPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPARHAEKVPIPTRVLTGCREKCII  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            +KENNFKQ G+RYRS+ P RQDRFI RWV +LS+PRVTHE  + WISY +Q D SLGQK+
Sbjct  423  QKENNFKQAGERYRSFDPARQDRFIQRWVDALSDPRVTHEHHTIWISYWSQCDASLGQKL  482

Query  224  ASRLNIRPTM  195
            ASRLN++P M
Sbjct  483  ASRLNLKPNM  492



>gb|AIM43584.1| catalase [Saccharum hybrid cultivar Yacheng05-179]
Length=492

 Score =   298 bits (764),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 135/190 (71%), Positives = 165/190 (87%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGRMVLN+NIDNFFAENE VA  PA IVPGI++SDDK+LQ RIF+YADT RHRLGPNY++
Sbjct  303  VGRMVLNKNIDNFFAENEQVAFCPAIIVPGIHYSDDKLLQTRIFSYADTQRHRLGPNYLM  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LPVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS+FD  R+AE+ P P R++TG R+KC+I
Sbjct  363  LPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPARHAEKVPIPTRVLTGCREKCII  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            +KENNFKQ G+RYRS+ P RQDRFI RWV +LS+PRVTHE  + WISY +Q D SLGQK+
Sbjct  423  QKENNFKQAGERYRSFDPARQDRFIQRWVDALSDPRVTHEHHTIWISYWSQCDASLGQKL  482

Query  224  ASRLNIRPTM  195
            ASRLN++P M
Sbjct  483  ASRLNLKPNM  492



>gb|AIU99481.1| catalase [Saccharum spontaneum]
Length=492

 Score =   298 bits (764),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 134/190 (71%), Positives = 165/190 (87%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGRMVLN+NIDNFFAENE +A  PA IVPGI++SDDK+LQ RIF+YADT RHRLGPNY++
Sbjct  303  VGRMVLNKNIDNFFAENEQIAFCPAIIVPGIHYSDDKLLQTRIFSYADTQRHRLGPNYLM  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LPVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS+FD  R+AE+ P P R++TG R+KC+I
Sbjct  363  LPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPARHAEKVPIPTRVLTGCREKCII  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            +KENNFKQ G+RYRS+ P RQDRFI RWV +LS+PRVTHE  + WISY +Q D SLGQK+
Sbjct  423  QKENNFKQAGERYRSFDPARQDRFIQRWVDALSDPRVTHEHHTIWISYWSQCDASLGQKL  482

Query  224  ASRLNIRPTM  195
            ASRLN++P M
Sbjct  483  ASRLNLKPNM  492



>sp|Q01297.2|CATA1_RICCO RecName: Full=Catalase isozyme 1 [Ricinus communis]
 gb|AAB31537.1| catalase 1 [Ricinus communis=castor beans, hypocotyls, Peptide, 
492 aa]
 dbj|BAA04697.1| catalase CAT1 [Ricinus communis]
Length=492

 Score =   298 bits (764),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 130/190 (68%), Positives = 165/190 (87%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGR+VLN+NIDNFFAENE +A  P  +VPG+ +S+DK+LQ RIF+Y+DT RHRLGPNY+ 
Sbjct  303  VGRLVLNKNIDNFFAENEQLAFCPGIVVPGVSYSEDKLLQTRIFSYSDTQRHRLGPNYLQ  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LPVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS+ D  RNAE FP P  I +G+R+KCVI
Sbjct  363  LPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRCDPARNAESFPVPSAICSGKREKCVI  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            EKENNFKQPG+RYRSWAPDRQ+RF+NR V  LS+PR+THE+R+ WISY  Q D+SLGQK+
Sbjct  423  EKENNFKQPGERYRSWAPDRQERFLNRLVGGLSDPRITHELRTIWISYWIQCDKSLGQKL  482

Query  224  ASRLNIRPTM  195
            A+RLN++P++
Sbjct  483  ATRLNVKPSI  492



>gb|AIU99488.1| catalase [Saccharum hybrid cultivar ROC22]
Length=492

 Score =   298 bits (763),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 134/190 (71%), Positives = 165/190 (87%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGRMVLN+NIDNFFAENE +A  PA IVPGI++SDDK+LQ RIF+YADT RHRLGPNY++
Sbjct  303  VGRMVLNKNIDNFFAENEQIAFCPAIIVPGIHYSDDKLLQTRIFSYADTQRHRLGPNYLM  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LPVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS+FD  R+AE+ P P R++TG R+KC+I
Sbjct  363  LPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPARHAEKVPIPTRVLTGCREKCII  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            +KENNFKQ G+RYRS+ P RQDRFI RWV +LS+PRVTHE  + WISY +Q D SLGQK+
Sbjct  423  QKENNFKQAGERYRSFDPARQDRFIQRWVGALSDPRVTHEHHTIWISYWSQCDASLGQKL  482

Query  224  ASRLNIRPTM  195
            ASRLN++P M
Sbjct  483  ASRLNLKPNM  492



>gb|KGN55500.1| hypothetical protein Csa_4G658600 [Cucumis sativus]
Length=405

 Score =   295 bits (756),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 132/187 (71%), Positives = 163/187 (87%), Gaps = 0/187 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGR+VLN+NIDNFFAENE +A  PA IVPGIY+SDDK+LQ RIF+YADT R+RLGPNY+ 
Sbjct  216  VGRLVLNKNIDNFFAENEQLAFCPAIIVPGIYYSDDKLLQTRIFSYADTQRYRLGPNYLQ  275

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LPVNAPKCAYHNN +DG+MNF+ RDEE++YFPS+ D TR+AER+P P  + TG+R++CVI
Sbjct  276  LPVNAPKCAYHNNHHDGFMNFMDRDEEINYFPSRIDPTRHAERYPQPSAVYTGKRERCVI  335

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            EKENNFKQPG+RYRSW  DRQ+RF+ RWV +LS+PRVTHEIR+ WISY +QAD+SLG K+
Sbjct  336  EKENNFKQPGERYRSWPSDRQERFVGRWVDALSDPRVTHEIRNIWISYWSQADKSLGHKL  395

Query  224  ASRLNIR  204
            AS  N++
Sbjct  396  ASHFNLK  402



>gb|AAC49807.1| catalase 3 [Arabidopsis thaliana]
 gb|AAC17732.1| catalase 3 [Arabidopsis thaliana]
Length=492

 Score =   298 bits (763),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 134/190 (71%), Positives = 160/190 (84%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGR+VLN+ IDNFF E E +A +P  +VPGIY+SDDK+LQ RIFAY DT RHRLGPNY+ 
Sbjct  303  VGRLVLNRTIDNFFNETEQLAFNPGLVVPGIYYSDDKLLQCRIFAYGDTQRHRLGPNYLQ  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LPVNAPKCA+HNN ++G+MNF+HRDEE++Y+PSKFD  R AE+ PTP    TG R KCVI
Sbjct  363  LPVNAPKCAHHNNHHEGFMNFMHRDEEINYYPSKFDPVRCAEKVPTPTNSYTGIRTKCVI  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            +KENNFKQ GDRYRSWAPDRQDRF+ RWV+ LSEPR+THEIR  W SY  +ADRSLGQK+
Sbjct  423  KKENNFKQAGDRYRSWAPDRQDRFVKRWVEILSEPRLTHEIRGIWTSYWLKADRSLGQKL  482

Query  224  ASRLNIRPTM  195
            ASRLN+RP++
Sbjct  483  ASRLNVRPSI  492



>gb|AAC17729.1| catalase 1, partial [Hordeum vulgare subsp. vulgare]
Length=398

 Score =   295 bits (755),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 132/190 (69%), Positives = 165/190 (87%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGRMVLN+NIDNFFAENE +A  PA  VPGI++SDDK+LQ RIF+YADT RHRLGPNY++
Sbjct  209  VGRMVLNKNIDNFFAENEQLAFCPAVTVPGIHYSDDKLLQTRIFSYADTQRHRLGPNYLM  268

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LPVNAPKCA+HNN +DG MNF+HRDEEV+YFPS+FD TR+AE++P P R+++G R+KC+I
Sbjct  269  LPVNAPKCAHHNNHHDGLMNFIHRDEEVNYFPSRFDPTRHAEKYPMPPRVLSGCREKCII  328

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            +KENNFKQ G+RYRS+ P RQDRF+ RWV +L++ RVTHEI+S W+SY +Q D SLGQK+
Sbjct  329  DKENNFKQAGERYRSFDPARQDRFLQRWVDALTDARVTHEIQSIWVSYWSQCDASLGQKL  388

Query  224  ASRLNIRPTM  195
            ASRL I+P M
Sbjct  389  ASRLKIKPNM  398



>gb|AFN81243.1| catalase 1 [Brassica rapa subsp. pekinensis]
Length=492

 Score =   298 bits (763),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 129/190 (68%), Positives = 170/190 (89%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGRMVLN+NIDNFFAENE +A  PA IVPGI++SDDK+LQ R+F+YADT RHRLGPNY+ 
Sbjct  303  VGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYADTQRHRLGPNYLQ  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LPVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE++PTP  + +G+R++CVI
Sbjct  363  LPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTPPAVCSGKRERCVI  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            EKENNFK+PG+RYRS+ P+RQ+RFI RW+++L +PR+THEIRS WI Y +QAD++ GQK+
Sbjct  423  EKENNFKEPGERYRSFTPERQERFIRRWIEALFDPRITHEIRSIWIFYWSQADKTFGQKL  482

Query  224  ASRLNIRPTM  195
            ASRLN+RP++
Sbjct  483  ASRLNVRPSI  492



>ref|XP_002437631.1| hypothetical protein SORBIDRAFT_10g030840 [Sorghum bicolor]
 gb|EER88998.1| hypothetical protein SORBIDRAFT_10g030840 [Sorghum bicolor]
Length=492

 Score =   298 bits (762),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 134/190 (71%), Positives = 166/190 (87%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGRMVLN+NIDNFFAENE +A  PA IVPGI++SDDK+LQ RIF+YADT RHRLGPNY++
Sbjct  303  VGRMVLNKNIDNFFAENEQIAFCPAIIVPGIHYSDDKLLQTRIFSYADTQRHRLGPNYLM  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LPVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS+FD TR+AE+ P P R++TG R+KC+I
Sbjct  363  LPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPTRHAEKVPIPSRVLTGCREKCII  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            EKENNFKQ G+R+RS+ P RQDRFI RWV +LS+PRVTHE  + WI+Y +Q D SLGQK+
Sbjct  423  EKENNFKQAGERFRSFDPARQDRFIQRWVDALSDPRVTHEHHTIWINYWSQCDASLGQKL  482

Query  224  ASRLNIRPTM  195
            ASRLN++P M
Sbjct  483  ASRLNLKPNM  492



>ref|XP_006340832.1| PREDICTED: catalase isozyme 2 [Solanum tuberosum]
Length=492

 Score =   297 bits (761),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 128/190 (67%), Positives = 168/190 (88%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGR+VLN+NIDNFF ENE +A  P+ +VPG+Y+SDDKMLQ RIF+Y+DT R+RLGPNY+ 
Sbjct  303  VGRLVLNKNIDNFFNENEQLAFCPSIVVPGVYYSDDKMLQTRIFSYSDTQRYRLGPNYLQ  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LP NAPKCA+HNN YDG MNF+HRDEE+DYFPS++D  R+AE +P P  + +G+R+KC+I
Sbjct  363  LPANAPKCAHHNNHYDGSMNFMHRDEEIDYFPSRYDQVRHAEVYPIPSTVCSGKREKCII  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            +KENNFKQPG+RYR++ PDRQ+RFI RWV++LS+PR+T+EIRS WI+Y +QAD+SLGQK+
Sbjct  423  QKENNFKQPGERYRTFTPDRQERFIRRWVEALSDPRITYEIRSIWITYWSQADKSLGQKL  482

Query  224  ASRLNIRPTM  195
            ASRLN+RP++
Sbjct  483  ASRLNVRPSI  492



>gb|AHF21552.1| catalase [Hylocereus undatus]
Length=492

 Score =   297 bits (761),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 133/190 (70%), Positives = 160/190 (84%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGR+VLN+N+DNFFAENE +A  P  +VPGIY+SDDK+LQ R+FAY D  R+RLG NYM+
Sbjct  303  VGRLVLNRNVDNFFAENEQLAFSPGVVVPGIYYSDDKLLQCRVFAYGDAQRYRLGANYMM  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LPVNAPKCA+HNN YDG MNF+HRDEE+DYFPSKFD  R AE++P   ++ TG+R+K VI
Sbjct  363  LPVNAPKCAHHNNQYDGVMNFMHRDEEIDYFPSKFDPARQAEKYPILTKVYTGKREKTVI  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
             KENNFKQPGDRYRSW P RQ+RF+ RWV  LS+PRVT E+RS W+SYL+Q DRSLG KV
Sbjct  423  PKENNFKQPGDRYRSWDPARQERFVKRWVDVLSDPRVTLELRSIWVSYLSQCDRSLGMKV  482

Query  224  ASRLNIRPTM  195
            A+RLN+RPTM
Sbjct  483  ATRLNMRPTM  492



>ref|XP_003563243.1| PREDICTED: catalase isozyme 1 [Brachypodium distachyon]
Length=492

 Score =   297 bits (761),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 132/190 (69%), Positives = 164/190 (86%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGRM+LN+NIDNFFAENE +A  PA IVPGI++SDDK+LQ RIF+YADT RHRLGPNY++
Sbjct  303  VGRMILNKNIDNFFAENEQIAFCPAIIVPGIHYSDDKLLQTRIFSYADTQRHRLGPNYLM  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LPVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS+FD TR+A+++P P R++TG R+KC+I
Sbjct  363  LPVNAPKCAHHNNHHEGFMNFIHRDEEVNYFPSRFDPTRHAQKYPIPTRVLTGCREKCII  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            EKENNFKQ G+RYRS+ P RQDRFI RWV +LS+ RVTHEI+  WISY +Q D SLGQK+
Sbjct  423  EKENNFKQAGERYRSFDPARQDRFIQRWVDALSDARVTHEIQGIWISYWSQCDTSLGQKL  482

Query  224  ASRLNIRPTM  195
             SRL  +P M
Sbjct  483  GSRLKAKPNM  492



>gb|KEH36312.1| catalase heme-binding enzyme [Medicago truncatula]
Length=492

 Score =   297 bits (761),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 134/190 (71%), Positives = 163/190 (86%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGR+VLN+NIDNFFAENE +A  PA IVPG+Y+SDDKMLQ RIF+YAD+ RHRLGPNY+ 
Sbjct  303  VGRLVLNKNIDNFFAENEQLAFCPAIIVPGVYYSDDKMLQTRIFSYADSQRHRLGPNYLQ  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS+ D  R+AE+ P P    +  R+KC I
Sbjct  363  LPANAPKCAHHNNHHEGFMNFIHRDEEVNYFPSRHDPVRHAEKVPIPTANFSACREKCNI  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
             K+NNFKQPG+RYRSWAPDRQDRF+ RWV +LS+PRVTHEIRS WISY +QADRSLGQK+
Sbjct  423  PKQNNFKQPGERYRSWAPDRQDRFLRRWVDALSDPRVTHEIRSIWISYWSQADRSLGQKI  482

Query  224  ASRLNIRPTM  195
            AS LN+RP++
Sbjct  483  ASHLNMRPSI  492



>gb|AIU99480.1| catalase [Saccharum spontaneum]
Length=492

 Score =   297 bits (760),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 134/190 (71%), Positives = 164/190 (86%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGRMVLN+NIDNFFAENE +A  PA IVPGI++SDDK+LQ RIF+YADT RHRLGPNY++
Sbjct  303  VGRMVLNKNIDNFFAENEQIAFCPAIIVPGIHYSDDKLLQTRIFSYADTQRHRLGPNYLM  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LPVNAPKCA+HNN ++G MNF+HRDEEV+YFPS+FD  R+AE+ P P R++TG R+KC+I
Sbjct  363  LPVNAPKCAHHNNHHEGLMNFMHRDEEVNYFPSRFDPARHAEKVPIPTRVLTGCREKCII  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            +KENNFKQ G+RYRS+ P RQDRFI RWV +LS+PRVTHE  + WISY +Q D SLGQK+
Sbjct  423  QKENNFKQAGERYRSFDPARQDRFIQRWVDALSDPRVTHEHHTIWISYWSQCDASLGQKL  482

Query  224  ASRLNIRPTM  195
            ASRLN++P M
Sbjct  483  ASRLNLKPNM  492



>emb|CDX69111.1| BnaC01g03420D [Brassica napus]
Length=480

 Score =   296 bits (758),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 129/190 (68%), Positives = 168/190 (88%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGRMVLN+NIDNFFAENE +A  PA IVPGI++SDDK+LQ R+F+YADT RHRLGPNY+ 
Sbjct  291  VGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYADTQRHRLGPNYLQ  350

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LPVNAPKC +HNN ++G+MNF+HRDEEV+YFPS+++  R+AE++PTP  +  G+R++CVI
Sbjct  351  LPVNAPKCGHHNNHHEGFMNFMHRDEEVNYFPSRYNPVRHAEKYPTPPAVCAGKRERCVI  410

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            EKENNFK+PG+RYR + P+RQ+RFI RW+++LS+PR+THEIRS WISY +QAD+SLGQK+
Sbjct  411  EKENNFKEPGERYRYFPPERQERFIRRWIEALSDPRITHEIRSIWISYWSQADKSLGQKL  470

Query  224  ASRLNIRPTM  195
            AS LN+RP +
Sbjct  471  ASHLNVRPNI  480



>emb|CAG23920.1| catalase [Festuca arundinacea]
Length=492

 Score =   296 bits (759),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 132/190 (69%), Positives = 164/190 (86%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGR+VLN+NIDNFFAENE +A  P  IVPG+Y+SDDK+LQ RIF+Y+DT RHRLGPNY+L
Sbjct  303  VGRLVLNRNIDNFFAENEQLAFCPGIIVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLL  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LP NAPKC++HNN YDG MNF+HRDEEVDYFPS+FD   +A R+P P R + GRR+K VI
Sbjct  363  LPANAPKCSHHNNHYDGLMNFMHRDEEVDYFPSRFDPATDAPRYPIPSRTLNGRREKMVI  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            EKENNFKQPG+RYRS  P RQ+RFINRW+ +LS+PR+THEI++ W+SY +QADRSLGQK+
Sbjct  423  EKENNFKQPGERYRSMDPARQERFINRWIDALSDPRLTHEIKAIWLSYWSQADRSLGQKL  482

Query  224  ASRLNIRPTM  195
            A RL+++P+M
Sbjct  483  AGRLSVKPSM  492



>gb|ACL35349.1| catalase [Picea glauca]
Length=492

 Score =   296 bits (759),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 131/190 (69%), Positives = 165/190 (87%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGRMVLN+NIDNFFAENE +A  PA +VPGIY+++DK+LQ RIF+Y+DT RHRLGPNY++
Sbjct  303  VGRMVLNKNIDNFFAENEQLAFSPALVVPGIYYTEDKLLQTRIFSYSDTQRHRLGPNYLM  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS+FD  R+AERFP P    +G R+KCVI
Sbjct  363  LPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPVRHAERFPIPSHTHSGMREKCVI  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            EKENNFKQPG+RYRS+ PDRQ+RF+ RWV +LS+PRVTHEI S WI Y +Q+D+SLGQK+
Sbjct  423  EKENNFKQPGERYRSFEPDRQERFVKRWVAALSDPRVTHEICSIWIFYWSQSDKSLGQKI  482

Query  224  ASRLNIRPTM  195
            A+RLN++  M
Sbjct  483  AARLNMKANM  492



>gb|AHF27433.1| catalase [Cucurbita maxima]
Length=492

 Score =   296 bits (759),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 136/191 (71%), Positives = 169/191 (88%), Gaps = 2/191 (1%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGR+VLN+NIDNFFAENEM+A     +VPGI++SDDKMLQAR FAYADT RHRLGPNY+ 
Sbjct  303  VGRLVLNKNIDNFFAENEMLAFS-MSLVPGIHYSDDKMLQARSFAYADTQRHRLGPNYLQ  361

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LPVNAPKC +HNN ++G+MNF+HRDEEV+YFPS++D  R+AE+FP P  ++TG+R++CVI
Sbjct  362  LPVNAPKCPHHNNHHEGFMNFMHRDEEVNYFPSRYDPCRHAEKFPMPPNVLTGKRERCVI  421

Query  404  EKE-NNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQK  228
             KE NNFKQ GDRYRSWAPDRQDRF+ R+V++LS+PRVTHE+R+ WISY +QADRSLGQK
Sbjct  422  PKENNNFKQAGDRYRSWAPDRQDRFVKRFVEALSDPRVTHEVRNIWISYWSQADRSLGQK  481

Query  227  VASRLNIRPTM  195
            +ASRLN+RP +
Sbjct  482  IASRLNVRPNI  492



>gb|EPS69543.1| catalase [Genlisea aurea]
Length=492

 Score =   296 bits (758),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 137/190 (72%), Positives = 165/190 (87%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGR+VLN+NIDNFFAENE +A  PA IVPGIY+SDDK+LQ RIF+YADT RHRLGPNY+ 
Sbjct  303  VGRLVLNRNIDNFFAENEQLAFCPAIIVPGIYYSDDKLLQTRIFSYADTQRHRLGPNYLQ  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LPVNAPK A+HNN ++G+MNF+HRDEEV+YFPS++D  R+A++ P P    +GRR+K  I
Sbjct  363  LPVNAPKNAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHADKVPIPSVPFSGRREKVSI  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            EKENNFKQPG+RYRSW PDRQ+RFI RWV +LS+PR+T EIRS WISY TQAD+SLGQK+
Sbjct  423  EKENNFKQPGERYRSWDPDRQERFIRRWVDALSDPRLTQEIRSIWISYWTQADKSLGQKL  482

Query  224  ASRLNIRPTM  195
            ASRLN+RPTM
Sbjct  483  ASRLNVRPTM  492



>gb|AHF27430.1| catalase [Cucurbita moschata]
Length=492

 Score =   296 bits (758),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 136/191 (71%), Positives = 169/191 (88%), Gaps = 2/191 (1%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGR+VLN+NIDNFFAENEM+A     +VPGI++SDDKMLQAR FAYADT RHRLGPNY+ 
Sbjct  303  VGRLVLNKNIDNFFAENEMLAFS-MSLVPGIHYSDDKMLQARSFAYADTQRHRLGPNYLQ  361

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LPVNAPKC +HNN ++G+MNF+HRDEEV+YFPS++D  R+AE+FP P  ++TG+R++CVI
Sbjct  362  LPVNAPKCPHHNNHHEGFMNFMHRDEEVNYFPSRYDPCRHAEKFPMPPNVLTGKRERCVI  421

Query  404  EKE-NNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQK  228
             KE NNFKQ GDRYRSWAPDRQDRF+ R+V++LS+PRVTHE+R+ WISY +QADRSLGQK
Sbjct  422  PKENNNFKQAGDRYRSWAPDRQDRFVKRFVEALSDPRVTHEVRNIWISYWSQADRSLGQK  481

Query  227  VASRLNIRPTM  195
            +ASRLN+RP +
Sbjct  482  IASRLNVRPNI  492



>gb|ACN36234.1| unknown [Zea mays]
Length=340

 Score =   291 bits (745),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 132/190 (69%), Positives = 160/190 (84%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGR+VLN+NIDNFFAENE +A  P  IVPGIY+SDDK+LQ RIF+Y+DT RHRLGPNY+L
Sbjct  151  VGRLVLNRNIDNFFAENEQLAFCPGLIVPGIYYSDDKLLQTRIFSYSDTQRHRLGPNYLL  210

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LP NAPKCA+HNN YDG MNF+HR EEVDYFPS++D  RNA R+P P   + GRR+K VI
Sbjct  211  LPANAPKCAHHNNHYDGSMNFMHRHEEVDYFPSRYDAVRNAPRYPIPTAHIAGRREKTVI  270

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
             KENNFKQPG+RYR+  P RQ+RFI RWV +LS+PR+THEIR+ W+S  +QADRSLGQK+
Sbjct  271  SKENNFKQPGERYRAMDPARQERFITRWVDALSDPRLTHEIRTIWLSNWSQADRSLGQKL  330

Query  224  ASRLNIRPTM  195
            ASRL+ +P+M
Sbjct  331  ASRLSAKPSM  340



>gb|AFR53082.1| CAT [Anthurium andraeanum]
Length=492

 Score =   296 bits (757),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 131/190 (69%), Positives = 167/190 (88%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGR+VLN+NIDNFF+ENE +A  P  +VPGIY+SDDKMLQ R FAY DT R+RLGPNY++
Sbjct  303  VGRLVLNRNIDNFFSENEQLAFSPGIVVPGIYYSDDKMLQCRTFAYGDTQRYRLGPNYLM  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LPVNAPKCA+ N+ YDG MNF+HRDEEV+YFPS+ D  R+AER+P   RIVTGRR+KC+I
Sbjct  363  LPVNAPKCAHKNSHYDGLMNFMHRDEEVNYFPSRHDPLRHAERYPINNRIVTGRREKCII  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            EK+N+FKQPGDRYRSWA DRQ+RF+ RWV++L+ P+V+HE+RS W+SYL+++D SLGQKV
Sbjct  423  EKQNDFKQPGDRYRSWAHDRQERFVRRWVEALAHPKVSHEVRSIWVSYLSKSDVSLGQKV  482

Query  224  ASRLNIRPTM  195
            A+RLN++P+M
Sbjct  483  ANRLNMKPSM  492



>gb|AHA50082.1| catalase [Eleutherococcus senticosus]
Length=492

 Score =   296 bits (757),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 134/190 (71%), Positives = 168/190 (88%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGR+VLN+NIDNFFAENE +A  PA IVPG+Y+SDDK+LQ RIF+YADT RHRLGPNY+ 
Sbjct  303  VGRLVLNKNIDNFFAENEQLAFCPAIIVPGVYYSDDKLLQTRIFSYADTQRHRLGPNYLQ  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LP NAPKCA+HNN ++G MNF+HRDEEV+YFPS+FD  R+AER P P  ++TGRRD+C++
Sbjct  363  LPANAPKCAHHNNHHEGLMNFMHRDEEVNYFPSRFDPVRHAERHPLPPPMLTGRRDRCMV  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            +KENNFKQPG+RYRS++ DRQ+RFI+R V +LS+PRVTHEIRS WISY TQA +SLGQK+
Sbjct  423  QKENNFKQPGERYRSFSTDRQERFISRLVDALSDPRVTHEIRSIWISYWTQACKSLGQKL  482

Query  224  ASRLNIRPTM  195
            ASRLN++P++
Sbjct  483  ASRLNVKPSI  492



>ref|XP_003558892.1| PREDICTED: catalase-1 [Brachypodium distachyon]
Length=492

 Score =   296 bits (757),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 134/190 (71%), Positives = 163/190 (86%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGR+VLN+NIDNFF+ENE +A  P  IVPGIY+SDDK+LQ RIF+Y+DT RHRLGPNY+L
Sbjct  303  VGRLVLNRNIDNFFSENEQLAFCPGIIVPGIYYSDDKLLQTRIFSYSDTQRHRLGPNYLL  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LP NAPKCA+HNN YDG MNF+HRDEEVDYFPS+FD  ++A R+P P     GRR+K VI
Sbjct  363  LPANAPKCAHHNNHYDGTMNFMHRDEEVDYFPSRFDPAKHAPRYPIPSSTCNGRREKMVI  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            EKENNFKQPG+RYRS  P RQ+RFINRW+ +LS+PR+THEI+S W+SY +QADRSLGQK+
Sbjct  423  EKENNFKQPGERYRSMDPARQERFINRWIDALSDPRLTHEIKSIWLSYWSQADRSLGQKL  482

Query  224  ASRLNIRPTM  195
            ASRL+ +P+M
Sbjct  483  ASRLSAKPSM  492



>gb|AIU99482.1| catalase [Saccharum hybrid cultivar ROC22]
Length=492

 Score =   296 bits (757),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 134/190 (71%), Positives = 164/190 (86%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGRMVLN+NIDNFFAENE VA  PA IVPGI++SDDK+LQ RIF+YADT RHRLGPNY++
Sbjct  303  VGRMVLNKNIDNFFAENEQVAFCPAIIVPGIHYSDDKLLQTRIFSYADTQRHRLGPNYLM  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LPV+APKCA+HNN ++G+MNF+HRDEEV+YFPS+FD  R+AE+ P P R+ TG R+KC+I
Sbjct  363  LPVDAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPARHAEKVPIPTRVQTGCREKCII  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            +KENNFKQ G+RYRS+ P RQDRFI RWV +LS+PRVTHE  + WISY +Q D SLGQK+
Sbjct  423  QKENNFKQAGERYRSFDPARQDRFIQRWVDALSDPRVTHEHHTIWISYWSQCDASLGQKL  482

Query  224  ASRLNIRPTM  195
            ASRLN++P M
Sbjct  483  ASRLNLKPNM  492



>gb|EMT05040.1| Catalase-1 [Aegilops tauschii]
Length=526

 Score =   297 bits (760),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 132/190 (69%), Positives = 165/190 (87%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGR+VLN+NIDNFFAENE +A  P  IVPG+Y+SDDK+LQ RIF+Y+DT RHRLGPNY+L
Sbjct  337  VGRLVLNRNIDNFFAENEQLAFCPGIIVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLL  396

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LP NAPKC++HNN YDG MNF+HRDEEVDYFPS+FD  ++A R+P P R + GRR+K VI
Sbjct  397  LPANAPKCSHHNNHYDGLMNFMHRDEEVDYFPSRFDPAKHAPRYPIPSRTLNGRREKMVI  456

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            EKENNFKQPG+RYRS  P RQ+RFINRW+ +LS+PR+THEI++ W+SY +QAD+SLGQK+
Sbjct  457  EKENNFKQPGERYRSMDPARQERFINRWIDALSDPRLTHEIKAIWLSYWSQADKSLGQKL  516

Query  224  ASRLNIRPTM  195
            ASRL+ +P+M
Sbjct  517  ASRLSSKPSM  526



>gb|AIU99486.1| catalase [Saccharum spontaneum]
Length=492

 Score =   296 bits (757),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 134/190 (71%), Positives = 164/190 (86%), Gaps = 0/190 (0%)
 Frame = -1

Query  764  VGRMVLNQNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYML  585
            VGRMVLN+NIDNFFAENE VA  PA IVPGI++SDDK+LQ RIF+YADT RHRLGPNY++
Sbjct  303  VGRMVLNKNIDNFFAENEQVAFCPAIIVPGIHYSDDKLLQTRIFSYADTQRHRLGPNYLM  362

Query  584  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  405
            LPVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS+FD  R+AE+ P P R++TG  +KC+I
Sbjct  363  LPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPARHAEKVPIPTRVLTGCGEKCII  422

Query  404  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  225
            +KENNFKQ G+RYRS+ P RQDRFI RWV +LS+PRVTHE  + WISY +Q D SLGQK+
Sbjct  423  QKENNFKQAGERYRSFDPARQDRFIRRWVDALSDPRVTHEHHTIWISYWSQCDASLGQKL  482

Query  224  ASRLNIRPTM  195
            ASRLN++P M
Sbjct  483  ASRLNLKPNM  492



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1441039810680