BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF009F21

Length=690
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_007141612.1|  hypothetical protein PHAVU_008G210700g             228   1e-65   Phaseolus vulgaris [French bean]
ref|XP_006387596.1|  hypothetical protein POPTR_0796s00200g             211   4e-65   
gb|ABK96436.1|  unknown                                                 213   1e-64   Populus trichocarpa x Populus deltoides
gb|KHN38468.1|  Putative membrane protein C2G11.09                      221   2e-63   Glycine soja [wild soybean]
ref|XP_003519463.1|  PREDICTED: uncharacterized membrane protein ...    221   2e-63   Glycine max [soybeans]
ref|XP_011086200.1|  PREDICTED: calcium permeable stress-gated ca...    221   2e-63   Sesamum indicum [beniseed]
ref|XP_006396700.1|  hypothetical protein EUTSA_v10028449mg             221   3e-63   
dbj|BAF98597.1|  CM0545.360.nc                                          221   3e-63   Lotus japonicus
ref|XP_008459005.1|  PREDICTED: uncharacterized membrane protein ...    220   7e-63   Cucumis melo [Oriental melon]
ref|XP_011016279.1|  PREDICTED: CSC1-like protein At3g21620             217   8e-62   Populus euphratica
ref|XP_002317144.2|  early-responsive to dehydration family protein     216   1e-61   
ref|XP_006283166.1|  hypothetical protein CARUB_v10004197mg             216   1e-61   Capsella rubella
ref|XP_010252492.1|  PREDICTED: calcium permeable stress-gated ca...    216   2e-61   Nelumbo nucifera [Indian lotus]
ref|XP_009357481.1|  PREDICTED: calcium permeable stress-gated ca...    216   2e-61   Pyrus x bretschneideri [bai li]
ref|XP_002301612.2|  early-responsive to dehydration family protein     215   4e-61   
ref|XP_011007190.1|  PREDICTED: CSC1-like protein At3g21620             214   8e-61   Populus euphratica
ref|XP_009772361.1|  PREDICTED: CSC1-like protein At3g21620             214   8e-61   Nicotiana sylvestris
ref|XP_004158583.1|  PREDICTED: uncharacterized protein RSN1-like       214   1e-60   
ref|XP_009592755.1|  PREDICTED: CSC1-like protein At3g21620             214   1e-60   Nicotiana tomentosiformis
ref|XP_004151944.1|  PREDICTED: uncharacterized protein RSN1-like       214   1e-60   Cucumis sativus [cucumbers]
ref|XP_010099166.1|  Uncharacterized membrane protein                   213   2e-60   Morus notabilis
ref|XP_002321139.1|  early-responsive to dehydration family protein     213   2e-60   Populus trichocarpa [western balsam poplar]
ref|XP_011047222.1|  PREDICTED: CSC1-like protein At3g21620             213   2e-60   Populus euphratica
ref|XP_002518432.1|  conserved hypothetical protein                     213   3e-60   
ref|XP_006469645.1|  PREDICTED: uncharacterized membrane protein ...    210   3e-60   
ref|XP_011463550.1|  PREDICTED: calcium permeable stress-gated ca...    212   4e-60   Fragaria vesca subsp. vesca
ref|XP_006447608.1|  hypothetical protein CICLE_v10014696mg             210   4e-60   
ref|XP_002892667.1|  hypothetical protein ARALYDRAFT_312226             212   5e-60   
ref|XP_004289181.1|  PREDICTED: calcium permeable stress-gated ca...    212   5e-60   Fragaria vesca subsp. vesca
ref|XP_004491137.1|  PREDICTED: uncharacterized protein RSN1-like       211   9e-60   Cicer arietinum [garbanzo]
ref|XP_008384098.1|  PREDICTED: uncharacterized protein RSN1            211   1e-59   
ref|XP_006287117.1|  hypothetical protein CARUB_v10000278mg             211   1e-59   Capsella rubella
gb|KDO39720.1|  hypothetical protein CISIN_1g048588mg                   209   1e-59   Citrus sinensis [apfelsine]
ref|XP_003616997.1|  Transmembrane protein                              211   1e-59   Medicago truncatula
ref|XP_002264502.1|  PREDICTED: calcium permeable stress-gated ca...    211   1e-59   
ref|XP_008455928.1|  PREDICTED: uncharacterized membrane protein ...    209   1e-59   Cucumis melo [Oriental melon]
ref|XP_008455926.1|  PREDICTED: uncharacterized membrane protein ...    209   1e-59   
ref|NP_172660.5|  putative ERD4 protein                                 211   1e-59   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006447609.1|  hypothetical protein CICLE_v10014378mg             211   1e-59   Citrus clementina [clementine]
ref|XP_006417282.1|  hypothetical protein EUTSA_v10006870mg             211   2e-59   Eutrema salsugineum [saltwater cress]
gb|AAC17615.1|  Similar to hypothetical protein HYP1 gb|Z97338 fr...    211   2e-59   Arabidopsis thaliana [mouse-ear cress]
emb|CDP04437.1|  unnamed protein product                                210   3e-59   Coffea canephora [robusta coffee]
ref|XP_008363487.1|  PREDICTED: uncharacterized protein RSN1-like       207   3e-59   
emb|CAA18115.1|  putative protein                                       209   4e-59   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008455922.1|  PREDICTED: uncharacterized protein RSN1 isof...    209   4e-59   Cucumis melo [Oriental melon]
ref|XP_002867790.1|  hypothetical protein ARALYDRAFT_492658             209   5e-59   
ref|XP_009613689.1|  PREDICTED: calcium permeable stress-gated ca...    209   7e-59   Nicotiana tomentosiformis
emb|CDY21297.1|  BnaC03g29810D                                          209   7e-59   Brassica napus [oilseed rape]
ref|XP_010439363.1|  PREDICTED: calcium permeable stress-gated ca...    209   8e-59   
ref|XP_010434078.1|  PREDICTED: calcium permeable stress-gated ca...    209   8e-59   Camelina sativa [gold-of-pleasure]
ref|XP_010493595.1|  PREDICTED: LOW QUALITY PROTEIN: CSC1-like pr...    208   1e-58   
ref|XP_009772257.1|  PREDICTED: calcium permeable stress-gated ca...    208   1e-58   Nicotiana sylvestris
ref|NP_193943.2|  early-responsive to dehydration stress-related ...    208   1e-58   Arabidopsis thaliana [mouse-ear cress]
dbj|BAD93792.1|  hypothetical protein                                   208   1e-58   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006413690.1|  hypothetical protein EUTSA_v10024476mg             208   1e-58   Eutrema salsugineum [saltwater cress]
ref|XP_004166876.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    208   1e-58   
ref|XP_004145433.1|  PREDICTED: uncharacterized membrane protein ...    208   1e-58   Cucumis sativus [cucumbers]
ref|XP_011046977.1|  PREDICTED: calcium permeable stress-gated ca...    207   2e-58   Populus euphratica
emb|CDX82907.1|  BnaC01g13570D                                          207   2e-58   
ref|XP_006467388.1|  PREDICTED: uncharacterized membrane protein ...    207   2e-58   Citrus sinensis [apfelsine]
ref|XP_011046975.1|  PREDICTED: calcium permeable stress-gated ca...    207   3e-58   Populus euphratica
ref|XP_009135587.1|  PREDICTED: calcium permeable stress-gated ca...    207   3e-58   Brassica rapa
ref|XP_011014901.1|  PREDICTED: calcium permeable stress-gated ca...    207   3e-58   Populus euphratica
ref|XP_010476146.1|  PREDICTED: CSC1-like protein At1g11960             207   3e-58   Camelina sativa [gold-of-pleasure]
ref|XP_009148626.1|  PREDICTED: CSC1-like protein At1g11960             207   4e-58   Brassica rapa
emb|CDX98089.1|  BnaA06g08400D                                          207   4e-58   
ref|NP_192343.1|  early-responsive to dehydration stress-related ...    207   4e-58   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010448929.1|  PREDICTED: calcium permeable stress-gated ca...    207   4e-58   
ref|XP_009357605.1|  PREDICTED: calcium permeable stress-gated ca...    206   4e-58   Pyrus x bretschneideri [bai li]
ref|XP_011002577.1|  PREDICTED: calcium permeable stress-gated ca...    206   5e-58   Populus euphratica
ref|NP_001291223.1|  calcium permeable stress-gated cation channel 1    206   5e-58   Populus euphratica
gb|KDP30779.1|  hypothetical protein JCGZ_13722                         206   5e-58   Jatropha curcas
emb|CDY19541.1|  BnaC09g13620D                                          206   5e-58   Brassica napus [oilseed rape]
ref|XP_006348154.1|  PREDICTED: uncharacterized protein RSN1-like...    206   5e-58   Solanum tuberosum [potatoes]
ref|XP_007211353.1|  hypothetical protein PRUPE_ppa001728mg             206   5e-58   Prunus persica
ref|XP_008224710.1|  PREDICTED: uncharacterized membrane protein ...    206   6e-58   Prunus mume [ume]
ref|XP_003549667.1|  PREDICTED: uncharacterized membrane protein ...    206   6e-58   Glycine max [soybeans]
gb|KDP20707.1|  hypothetical protein JCGZ_21178                         205   6e-58   Jatropha curcas
ref|XP_010458617.1|  PREDICTED: CSC1-like protein At1g11960             206   8e-58   Camelina sativa [gold-of-pleasure]
ref|XP_010546606.1|  PREDICTED: CSC1-like protein At1g11960             206   8e-58   Tarenaya hassleriana [spider flower]
ref|XP_009108550.1|  PREDICTED: calcium permeable stress-gated ca...    206   8e-58   Brassica rapa
ref|XP_004243535.1|  PREDICTED: CSC1-like protein At3g21620             206   8e-58   Solanum lycopersicum
ref|XP_011046982.1|  PREDICTED: calcium permeable stress-gated ca...    205   8e-58   Populus euphratica
ref|XP_006348153.1|  PREDICTED: uncharacterized protein RSN1-like...    206   1e-57   Solanum tuberosum [potatoes]
ref|XP_010450765.1|  PREDICTED: protein OSCA1-like                      192   1e-57   Camelina sativa [gold-of-pleasure]
ref|XP_008229991.1|  PREDICTED: uncharacterized membrane protein ...    205   1e-57   
ref|XP_010686787.1|  PREDICTED: calcium permeable stress-gated ca...    205   2e-57   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002872689.1|  hypothetical protein ARALYDRAFT_911697             205   2e-57   Arabidopsis lyrata subsp. lyrata
emb|CDY30043.1|  BnaC05g09770D                                          205   2e-57   Brassica napus [oilseed rape]
ref|XP_004507664.1|  PREDICTED: uncharacterized membrane protein ...    204   2e-57   Cicer arietinum [garbanzo]
ref|XP_011046979.1|  PREDICTED: calcium permeable stress-gated ca...    204   2e-57   Populus euphratica
gb|AAL07154.1|  unknown protein                                         204   2e-57   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004232686.1|  PREDICTED: calcium permeable stress-gated ca...    204   2e-57   Solanum lycopersicum
ref|XP_006306821.1|  hypothetical protein CARUB_v10008363mg             204   3e-57   Capsella rubella
emb|CDY27443.1|  BnaC03g64830D                                          204   4e-57   Brassica napus [oilseed rape]
ref|XP_007026161.1|  ERD (early-responsive to dehydration stress)...    204   5e-57   
ref|XP_010035539.1|  PREDICTED: CSC1-like protein At3g21620             203   6e-57   Eucalyptus grandis [rose gum]
ref|XP_006350470.1|  PREDICTED: uncharacterized membrane protein ...    203   6e-57   Solanum tuberosum [potatoes]
ref|XP_010539247.1|  PREDICTED: calcium permeable stress-gated ca...    202   1e-56   Tarenaya hassleriana [spider flower]
ref|XP_009134294.1|  PREDICTED: CSC1-like protein At4g04340             202   1e-56   Brassica rapa
emb|CDX90856.1|  BnaA03g25360D                                          202   1e-56   
ref|XP_006363038.1|  PREDICTED: uncharacterized protein RSN1-like...    202   1e-56   Solanum tuberosum [potatoes]
ref|XP_007153987.1|  hypothetical protein PHAVU_003G081500g             202   2e-56   Phaseolus vulgaris [French bean]
ref|XP_006383870.1|  early-responsive to dehydration family protein     202   2e-56   
ref|XP_010422263.1|  PREDICTED: LOW QUALITY PROTEIN: protein OSCA...    201   3e-56   
ref|XP_010496174.1|  PREDICTED: protein OSCA1-like                      201   3e-56   Camelina sativa [gold-of-pleasure]
gb|EMS56194.1|  Uncharacterized membrane protein C2G11.09               199   4e-56   Triticum urartu
ref|XP_009418442.1|  PREDICTED: calcium permeable stress-gated ca...    201   5e-56   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003529649.1|  PREDICTED: uncharacterized membrane protein ...    201   5e-56   Glycine max [soybeans]
ref|XP_010089460.1|  Uncharacterized membrane protein                   201   5e-56   
ref|XP_002457968.1|  hypothetical protein SORBIDRAFT_03g023990          200   9e-56   Sorghum bicolor [broomcorn]
gb|KHG22816.1|  putative membrane C2G11.09                              199   1e-55   Gossypium arboreum [tree cotton]
ref|XP_011095994.1|  PREDICTED: calcium permeable stress-gated ca...    200   1e-55   Sesamum indicum [beniseed]
gb|KJB57786.1|  hypothetical protein B456_009G181100                    199   1e-55   Gossypium raimondii
ref|XP_007217157.1|  hypothetical protein PRUPE_ppa001757mg             199   2e-55   Prunus persica
ref|XP_003569164.1|  PREDICTED: calcium permeable stress-gated ca...    199   2e-55   Brachypodium distachyon [annual false brome]
sp|F4HYR3.2|CSCL6_ARATH  RecName: Full=CSC1-like protein At1g62320      199   2e-55   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004231619.1|  PREDICTED: calcium permeable stress-gated ca...    199   3e-55   
gb|EMT27455.1|  Putative membrane protein                               199   3e-55   
ref|XP_006383869.1|  hypothetical protein POPTR_0004s00750g             199   3e-55   
ref|XP_010473449.1|  PREDICTED: CSC1-like protein At1g62320             198   4e-55   Camelina sativa [gold-of-pleasure]
gb|KJB69238.1|  hypothetical protein B456_011G012200                    196   4e-55   Gossypium raimondii
ref|XP_007049121.1|  ERD (early-responsive to dehydration stress)...    198   4e-55   
ref|XP_003555683.1|  PREDICTED: uncharacterized membrane protein ...    198   5e-55   Glycine max [soybeans]
ref|XP_009619499.1|  PREDICTED: calcium permeable stress-gated ca...    198   6e-55   Nicotiana tomentosiformis
gb|KHN28986.1|  Putative membrane protein C2G11.09                      198   6e-55   Glycine soja [wild soybean]
ref|XP_010548889.1|  PREDICTED: CSC1-like protein At3g21620             198   6e-55   Tarenaya hassleriana [spider flower]
ref|XP_009803475.1|  PREDICTED: calcium permeable stress-gated ca...    197   7e-55   Nicotiana sylvestris
ref|XP_007145950.1|  hypothetical protein PHAVU_006G000300g             197   8e-55   Phaseolus vulgaris [French bean]
ref|XP_008363043.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    196   8e-55   
ref|XP_006387597.1|  hypothetical protein POPTR_0796s00210g             197   8e-55   
emb|CDY12941.1|  BnaA09g13330D                                          197   8e-55   Brassica napus [oilseed rape]
ref|XP_009113086.1|  PREDICTED: CSC1-like protein At1g62320             197   9e-55   Brassica rapa
gb|EYU27725.1|  hypothetical protein MIMGU_mgv1a001730mg                197   1e-54   Erythranthe guttata [common monkey flower]
ref|XP_010657219.1|  PREDICTED: CSC1-like protein At3g21620             197   1e-54   Vitis vinifera
gb|KJB69236.1|  hypothetical protein B456_011G012200                    197   1e-54   Gossypium raimondii
gb|KJB69243.1|  hypothetical protein B456_011G012200                    197   1e-54   Gossypium raimondii
gb|KJB69239.1|  hypothetical protein B456_011G012200                    197   1e-54   Gossypium raimondii
dbj|BAK03311.1|  predicted protein                                      196   2e-54   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008371060.1|  PREDICTED: transmembrane protein 63B-like          196   2e-54   
gb|EPS60017.1|  hypothetical protein M569_14787                         195   5e-54   Genlisea aurea
gb|KHG01808.1|  putative membrane C2G11.09                              195   5e-54   Gossypium arboreum [tree cotton]
gb|KJB10672.1|  hypothetical protein B456_001G215500                    194   6e-54   Gossypium raimondii
ref|XP_010430277.1|  PREDICTED: CSC1-like protein At1g62320             195   6e-54   Camelina sativa [gold-of-pleasure]
ref|XP_010418218.1|  PREDICTED: CSC1-like protein At1g62320             195   6e-54   Camelina sativa [gold-of-pleasure]
ref|XP_003542161.1|  PREDICTED: uncharacterized membrane protein ...    195   7e-54   Glycine max [soybeans]
gb|KCW77011.1|  hypothetical protein EUGRSUZ_D01358                     194   8e-54   Eucalyptus grandis [rose gum]
ref|XP_006644293.1|  PREDICTED: uncharacterized membrane protein ...    194   8e-54   Oryza brachyantha
ref|XP_006300401.1|  hypothetical protein CARUB_v10019839mg             194   1e-53   Capsella rubella
ref|XP_004293317.1|  PREDICTED: calcium permeable stress-gated ca...    194   1e-53   Fragaria vesca subsp. vesca
ref|XP_004295293.1|  PREDICTED: calcium permeable stress-gated ca...    194   2e-53   Fragaria vesca subsp. vesca
gb|KJB10673.1|  hypothetical protein B456_001G215500                    194   2e-53   Gossypium raimondii
ref|XP_010052882.1|  PREDICTED: calcium permeable stress-gated ca...    194   2e-53   Eucalyptus grandis [rose gum]
ref|XP_003610472.1|  Membrane protein, putative                         194   2e-53   Medicago truncatula
gb|KJB10674.1|  hypothetical protein B456_001G215500                    193   2e-53   Gossypium raimondii
gb|KHG30770.1|  putative membrane C2G11.09                              192   4e-53   Gossypium arboreum [tree cotton]
emb|CDP11354.1|  unnamed protein product                                192   4e-53   Coffea canephora [robusta coffee]
ref|NP_001043256.1|  Os01g0534900                                       192   7e-53   
ref|XP_006391905.1|  hypothetical protein EUTSA_v10023297mg             191   2e-52   
gb|EPS71959.1|  hypothetical protein M569_02795                         190   3e-52   Genlisea aurea
ref|NP_001056508.1|  Os05g0594700                                       189   5e-52   
gb|EEE64912.1|  hypothetical protein OsJ_19772                          189   1e-51   Oryza sativa Japonica Group [Japonica rice]
emb|CDY32438.1|  BnaC03g42220D                                          188   1e-51   Brassica napus [oilseed rape]
emb|CDY48898.1|  BnaA03g36370D                                          187   2e-51   Brassica napus [oilseed rape]
ref|XP_009135761.1|  PREDICTED: CSC1-like protein At3g21620             187   2e-51   Brassica rapa
ref|XP_010921296.1|  PREDICTED: calcium permeable stress-gated ca...    187   4e-51   Elaeis guineensis
ref|NP_176422.1|  ERD (early-responsive to dehydration stress) fa...    187   5e-51   
ref|XP_010924081.1|  PREDICTED: calcium permeable stress-gated ca...    186   5e-51   Elaeis guineensis
ref|XP_006850790.1|  hypothetical protein AMTR_s00025p00102970          186   5e-51   Amborella trichopoda
ref|XP_010924080.1|  PREDICTED: calcium permeable stress-gated ca...    186   5e-51   
ref|XP_010924079.1|  PREDICTED: calcium permeable stress-gated ca...    186   6e-51   
ref|XP_010924083.1|  PREDICTED: protein OSCA1-like isoform X6           186   7e-51   
gb|EYU33878.1|  hypothetical protein MIMGU_mgv1a018274mg                186   8e-51   Erythranthe guttata [common monkey flower]
ref|XP_010924075.1|  PREDICTED: calcium permeable stress-gated ca...    186   8e-51   Elaeis guineensis
ref|XP_008675529.1|  PREDICTED: calcium permeable stress-gated ca...    185   1e-50   
emb|CDY32032.1|  BnaA03g60360D                                          185   2e-50   Brassica napus [oilseed rape]
ref|XP_011046985.1|  PREDICTED: calcium permeable stress-gated ca...    187   3e-50   Populus euphratica
ref|XP_008803557.1|  PREDICTED: LOW QUALITY PROTEIN: calcium perm...    184   3e-50   Phoenix dactylifera
ref|XP_008799225.1|  PREDICTED: calcium permeable stress-gated ca...    184   3e-50   Phoenix dactylifera
emb|CDP03600.1|  unnamed protein product                                184   3e-50   Coffea canephora [robusta coffee]
ref|XP_009123383.1|  PREDICTED: CSC1-like protein At1g62320             184   3e-50   Brassica rapa
ref|XP_008673458.1|  PREDICTED: calcium permeable stress-gated ca...    184   3e-50   
ref|XP_006654880.1|  PREDICTED: uncharacterized membrane protein ...    184   5e-50   Oryza brachyantha
gb|KDO68804.1|  hypothetical protein CISIN_1g0209791mg                  172   5e-50   Citrus sinensis [apfelsine]
ref|XP_006843810.1|  hypothetical protein AMTR_s00007p00254340          184   6e-50   Amborella trichopoda
ref|XP_011046984.1|  PREDICTED: uncharacterized protein LOC105141...    187   7e-50   Populus euphratica
ref|XP_010255871.1|  PREDICTED: CSC1-like protein At4g02900             183   1e-49   Nelumbo nucifera [Indian lotus]
ref|XP_002440380.1|  hypothetical protein SORBIDRAFT_09g030770          182   1e-49   Sorghum bicolor [broomcorn]
ref|XP_011079804.1|  PREDICTED: CSC1-like protein At4g02900             182   3e-49   Sesamum indicum [beniseed]
ref|XP_010038117.1|  PREDICTED: CSC1-like protein At4g02900             181   4e-49   Eucalyptus grandis [rose gum]
gb|KEH23730.1|  ERD (early-responsive to dehydration stress) fami...    181   7e-49   Medicago truncatula
ref|XP_010488177.1|  PREDICTED: CSC1-like protein At3g21620 isofo...    178   3e-48   
ref|NP_001147493.1|  LOC100281102                                       179   3e-48   Zea mays [maize]
ref|XP_010466416.1|  PREDICTED: CSC1-like protein At3g21620 isofo...    178   3e-48   Camelina sativa [gold-of-pleasure]
ref|XP_010466415.1|  PREDICTED: CSC1-like protein At3g21620 isofo...    179   3e-48   
ref|XP_010488175.1|  PREDICTED: CSC1-like protein At3g21620 isofo...    179   3e-48   Camelina sativa [gold-of-pleasure]
gb|AFW81357.1|  HYP1 isoform 1                                          179   3e-48   
emb|CBI32349.3|  unnamed protein product                                178   4e-48   Vitis vinifera
ref|XP_002271834.1|  PREDICTED: CSC1-like protein At4g02900             178   4e-48   Vitis vinifera
ref|XP_006352784.1|  PREDICTED: uncharacterized membrane protein ...    178   4e-48   Solanum tuberosum [potatoes]
ref|XP_010510410.1|  PREDICTED: CSC1-like protein At3g21620             178   6e-48   Camelina sativa [gold-of-pleasure]
dbj|BAD94445.1|  hypothetical protein                                   178   6e-48   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006299035.1|  hypothetical protein CARUB_v10015172mg             177   7e-48   Capsella rubella
ref|NP_188799.1|  early-responsive to dehydration stress-related ...    177   7e-48   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006406250.1|  hypothetical protein EUTSA_v10020132mg             177   7e-48   Eutrema salsugineum [saltwater cress]
ref|XP_002886475.1|  F24O1.4                                            177   1e-47   Arabidopsis lyrata subsp. lyrata
ref|XP_003569103.1|  PREDICTED: CSC1-like protein At3g21620 isofo...    177   2e-47   Brachypodium distachyon [annual false brome]
ref|XP_010231849.1|  PREDICTED: calcium permeable stress-gated ca...    176   2e-47   
gb|KJB42871.1|  hypothetical protein B456_007G171500                    177   2e-47   Gossypium raimondii
ref|XP_002885454.1|  hypothetical protein ARALYDRAFT_342312             176   2e-47   Arabidopsis lyrata subsp. lyrata
gb|KJB42870.1|  hypothetical protein B456_007G171500                    176   3e-47   Gossypium raimondii
gb|EAY97938.1|  hypothetical protein OsI_19855                          176   4e-47   Oryza sativa Indica Group [Indian rice]
ref|NP_001055457.1|  Os05g0393800                                       176   5e-47   
ref|XP_008808245.1|  PREDICTED: CSC1-like protein At4g02900 isofo...    175   6e-47   Phoenix dactylifera
ref|XP_004493651.1|  PREDICTED: uncharacterized protein RSN1-like...    175   6e-47   Cicer arietinum [garbanzo]
ref|XP_004968885.1|  PREDICTED: uncharacterized membrane protein ...    175   9e-47   Setaria italica
ref|XP_009601393.1|  PREDICTED: CSC1-like protein At4g02900 isofo...    174   9e-47   Nicotiana tomentosiformis
ref|XP_009601331.1|  PREDICTED: CSC1-like protein At4g02900 isofo...    174   1e-46   Nicotiana tomentosiformis
ref|XP_006444131.1|  hypothetical protein CICLE_v10024532mg             174   1e-46   Citrus clementina [clementine]
ref|XP_006479762.1|  PREDICTED: uncharacterized membrane protein ...    174   2e-46   
ref|XP_006604421.1|  PREDICTED: uncharacterized protein RSN1-like...    174   2e-46   
ref|XP_003553451.1|  PREDICTED: uncharacterized protein RSN1-like...    174   2e-46   
ref|XP_007050676.1|  ERD (early-responsive to dehydration stress)...    173   3e-46   
gb|KHN19872.1|  Putative membrane protein C2G11.09                      173   3e-46   Glycine soja [wild soybean]
ref|XP_003520558.1|  PREDICTED: uncharacterized membrane protein ...    173   4e-46   Glycine max [soybeans]
ref|XP_006285697.1|  hypothetical protein CARUB_v10007167mg             173   4e-46   Capsella rubella
ref|XP_009396325.1|  PREDICTED: calcium permeable stress-gated ca...    172   5e-46   Musa acuminata subsp. malaccensis [pisang utan]
gb|EMS50375.1|  Transmembrane protein 63B                               172   5e-46   Triticum urartu
ref|XP_004242328.1|  PREDICTED: CSC1-like protein At4g02900 isofo...    172   9e-46   Solanum lycopersicum
ref|XP_010090368.1|  Uncharacterized membrane protein                   172   1e-45   
ref|XP_009147329.1|  PREDICTED: CSC1-like protein At4g15430 isofo...    171   1e-45   Brassica rapa
ref|XP_009147362.1|  PREDICTED: CSC1-like protein At4g15430 isofo...    171   1e-45   Brassica rapa
ref|XP_002870239.1|  hypothetical protein ARALYDRAFT_493346             171   2e-45   
ref|XP_006654360.1|  PREDICTED: uncharacterized protein C354.08c-...    170   3e-45   Oryza brachyantha
gb|EYU46618.1|  hypothetical protein MIMGU_mgv1a001779mg                170   4e-45   Erythranthe guttata [common monkey flower]
ref|XP_010326353.1|  PREDICTED: CSC1-like protein At4g02900             169   7e-45   Solanum lycopersicum
ref|XP_003568506.1|  PREDICTED: CSC1-like protein At4g02900             169   7e-45   Brachypodium distachyon [annual false brome]
ref|XP_004960982.1|  PREDICTED: uncharacterized membrane protein ...    169   8e-45   Setaria italica
ref|XP_002973564.1|  hypothetical protein SELMODRAFT_442177             168   1e-44   Selaginella moellendorffii
ref|XP_004293316.1|  PREDICTED: calcium permeable stress-gated ca...    168   2e-44   Fragaria vesca subsp. vesca
ref|XP_006854105.1|  hypothetical protein AMTR_s00048p00143150          167   3e-44   Amborella trichopoda
ref|XP_002441130.1|  hypothetical protein SORBIDRAFT_09g021010          167   3e-44   Sorghum bicolor [broomcorn]
ref|XP_002975592.1|  hypothetical protein SELMODRAFT_150725             167   5e-44   Selaginella moellendorffii
ref|XP_004962175.1|  PREDICTED: uncharacterized protein RSN1-like       167   6e-44   Setaria italica
ref|XP_007162399.1|  hypothetical protein PHAVU_001G148800g             167   6e-44   Phaseolus vulgaris [French bean]
gb|AAC79116.1|  hypothetical protein                                    166   7e-44   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008451390.1|  PREDICTED: uncharacterized membrane protein ...    166   8e-44   
ref|XP_008451392.1|  PREDICTED: uncharacterized membrane protein ...    166   8e-44   Cucumis melo [Oriental melon]
ref|XP_010110412.1|  Uncharacterized protein RSN1                       162   9e-44   
ref|XP_009393118.1|  PREDICTED: CSC1-like protein At4g02900             166   1e-43   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008451393.1|  PREDICTED: uncharacterized membrane protein ...    166   1e-43   Cucumis melo [Oriental melon]
ref|NP_192199.1|  ERD (early-responsive to dehydration stress) fa...    166   2e-43   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009625807.1|  PREDICTED: CSC1-like protein At4g02900             166   2e-43   Nicotiana tomentosiformis
ref|XP_004136187.1|  PREDICTED: uncharacterized membrane protein ...    165   2e-43   Cucumis sativus [cucumbers]
ref|XP_004164564.1|  PREDICTED: uncharacterized membrane protein ...    165   2e-43   
ref|XP_009347716.1|  PREDICTED: CSC1-like protein At4g02900             159   2e-43   Pyrus x bretschneideri [bai li]
gb|AFW78070.1|  hypothetical protein ZEAMMB73_829601                    165   2e-43   
ref|XP_010261636.1|  PREDICTED: CSC1-like protein At1g32090             165   3e-43   Nelumbo nucifera [Indian lotus]
ref|XP_008649660.1|  PREDICTED: LOW QUALITY PROTEIN: calcium perm...    165   3e-43   
dbj|BAJ96091.1|  predicted protein                                      164   4e-43   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006355875.1|  PREDICTED: uncharacterized protein C354.08c-...    164   4e-43   Solanum tuberosum [potatoes]
ref|XP_010490005.1|  PREDICTED: CSC1-like protein At3g21620             153   5e-43   Camelina sativa [gold-of-pleasure]
ref|XP_002874888.1|  hypothetical protein ARALYDRAFT_352535             164   7e-43   
gb|KFK30891.1|  hypothetical protein AALP_AA6G039600                    163   8e-43   Arabis alpina [alpine rockcress]
ref|XP_008234907.1|  PREDICTED: uncharacterized protein RSN1 isof...    164   9e-43   Prunus mume [ume]
gb|KFK30892.1|  hypothetical protein AALP_AA6G039600                    163   9e-43   Arabis alpina [alpine rockcress]
gb|EMT23208.1|  Putative membrane protein                               164   9e-43   
gb|EMT18085.1|  Putative membrane protein                               164   9e-43   
gb|EMS65241.1|  Uncharacterized membrane protein C2G11.09               164   1e-42   Triticum urartu
ref|XP_006604422.1|  PREDICTED: uncharacterized protein RSN1-like...    162   2e-42   
ref|XP_008238126.1|  PREDICTED: uncharacterized protein RSN1            163   2e-42   Prunus mume [ume]
ref|XP_010664612.1|  PREDICTED: CSC1-like protein At1g32090 isofo...    161   3e-42   Vitis vinifera
emb|CDY22920.1|  BnaA01g18580D                                          162   4e-42   Brassica napus [oilseed rape]
ref|XP_006396516.1|  hypothetical protein EUTSA_v10029277mg             162   4e-42   
ref|XP_002273732.1|  PREDICTED: CSC1-like protein At1g32090 isofo...    161   6e-42   Vitis vinifera
dbj|BAK05559.1|  predicted protein                                      161   6e-42   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010278586.1|  PREDICTED: CSC1-like protein At4g02900 isofo...    161   6e-42   Nelumbo nucifera [Indian lotus]
ref|XP_007210357.1|  hypothetical protein PRUPE_ppa001580mg             161   1e-41   Prunus persica
ref|XP_010422520.1|  PREDICTED: CSC1-like protein At4g02900             160   1e-41   
ref|XP_010430503.1|  PREDICTED: CSC1-like protein At4g02900             160   1e-41   
emb|CDY49293.1|  BnaC01g22480D                                          160   1e-41   
gb|KJB42062.1|  hypothetical protein B456_007G134700                    159   2e-41   
ref|XP_010522697.1|  PREDICTED: CSC1-like protein At4g02900 isofo...    160   2e-41   
ref|XP_010522696.1|  PREDICTED: CSC1-like protein At4g02900 isofo...    160   2e-41   
ref|XP_009147369.1|  PREDICTED: CSC1-like protein At4g15430 isofo...    160   2e-41   
gb|KJB42060.1|  hypothetical protein B456_007G134700                    159   2e-41   
ref|XP_010522695.1|  PREDICTED: CSC1-like protein At4g02900 isofo...    160   3e-41   
gb|KJB42059.1|  hypothetical protein B456_007G134700                    159   3e-41   
ref|XP_007200309.1|  hypothetical protein PRUPE_ppa001848mg             159   3e-41   
ref|XP_008808246.1|  PREDICTED: CSC1-like protein At4g02900 isofo...    159   3e-41   
emb|CDX90914.1|  BnaA03g25940D                                          159   3e-41   
ref|XP_009404947.1|  PREDICTED: calcium permeable stress-gated ca...    159   3e-41   
emb|CDY17981.1|  BnaC03g30530D                                          159   3e-41   
ref|XP_009134388.1|  PREDICTED: CSC1-like protein At4g02900             159   3e-41   
ref|XP_010276749.1|  PREDICTED: CSC1-like protein At1g32090             159   4e-41   
ref|XP_009404922.1|  PREDICTED: calcium permeable stress-gated ca...    159   4e-41   
ref|XP_008658829.1|  PREDICTED: uncharacterized protein RSN1            159   4e-41   
gb|KJB51550.1|  hypothetical protein B456_008G222200                    158   5e-41   
ref|XP_002464863.1|  hypothetical protein SORBIDRAFT_01g027810          159   5e-41   
gb|KDP21496.1|  hypothetical protein JCGZ_21967                         159   5e-41   
ref|XP_009395092.1|  PREDICTED: calcium permeable stress-gated ca...    159   6e-41   
ref|XP_010684236.1|  PREDICTED: CSC1-like protein At4g02900             158   7e-41   
ref|XP_010235059.1|  PREDICTED: CSC1-like protein At1g32090 isofo...    158   7e-41   
ref|XP_010434984.1|  PREDICTED: CSC1-like protein At4g15430 isofo...    158   8e-41   
gb|KJB51549.1|  hypothetical protein B456_008G222200                    158   1e-40   
ref|XP_008386531.1|  PREDICTED: uncharacterized protein RSN1            158   1e-40   
gb|EPS71707.1|  hypothetical protein M569_03051                         157   1e-40   
ref|XP_003574401.1|  PREDICTED: CSC1-like protein At1g32090 isofo...    158   1e-40   
gb|EYU38139.1|  hypothetical protein MIMGU_mgv1a022024mg                157   1e-40   
ref|XP_009356857.1|  PREDICTED: CSC1-like protein At4g02900             157   1e-40   
ref|XP_011074804.1|  PREDICTED: CSC1-like protein At1g32090             157   2e-40   
ref|XP_004300169.1|  PREDICTED: CSC1-like protein At1g32090             158   2e-40   
ref|XP_010449938.1|  PREDICTED: CSC1-like protein At4g15430 isofo...    157   2e-40   
ref|XP_009373514.1|  PREDICTED: CSC1-like protein At1g32090             157   2e-40   
ref|XP_010440309.1|  PREDICTED: CSC1-like protein At4g15430             157   2e-40   
ref|XP_010455942.1|  PREDICTED: CSC1-like protein At4g02900 isofo...    157   3e-40   
gb|KHG10946.1|  putative membrane C2G11.09                              156   4e-40   
ref|XP_010455941.1|  PREDICTED: CSC1-like protein At4g02900 isofo...    156   4e-40   
ref|XP_008373502.1|  PREDICTED: uncharacterized protein RSN1            156   5e-40   
ref|XP_006662108.1|  PREDICTED: uncharacterized membrane protein ...    156   5e-40   
ref|NP_001065504.1|  Os10g0579100                                       156   8e-40   
gb|EAY79648.1|  hypothetical protein OsI_34792                          156   8e-40   
gb|EMT13890.1|  Putative membrane protein                               155   1e-39   
ref|XP_004245915.1|  PREDICTED: CSC1-like protein At1g32090             155   2e-39   
ref|XP_006352918.1|  PREDICTED: uncharacterized protein RSN1-like       155   2e-39   
ref|XP_002533077.1|  conserved hypothetical protein                     154   2e-39   
gb|EMS63833.1|  Uncharacterized membrane protein C2G11.09               154   2e-39   
ref|XP_004983522.1|  PREDICTED: uncharacterized membrane protein ...    154   2e-39   
gb|EYU29074.1|  hypothetical protein MIMGU_mgv1a021500mg                154   2e-39   
gb|KHG26829.1|  putative membrane C2G11.09                              154   3e-39   
gb|KDP46674.1|  hypothetical protein JCGZ_12198                         154   3e-39   
ref|XP_010434983.1|  PREDICTED: CSC1-like protein At4g15430 isofo...    154   4e-39   
ref|XP_009603996.1|  PREDICTED: CSC1-like protein At1g32090             154   5e-39   
gb|EMS63788.1|  Uncharacterized membrane protein C2G11.09               153   6e-39   
emb|CAB10322.1|  hypothetical protein                                   152   7e-39   
gb|EMS66710.1|  Uncharacterized membrane protein C2G11.09               152   9e-39   
ref|XP_010449936.1|  PREDICTED: CSC1-like protein At4g15430 isofo...    152   9e-39   
ref|XP_009784323.1|  PREDICTED: CSC1-like protein At1g32090             152   1e-38   
ref|XP_007158205.1|  hypothetical protein PHAVU_002G133000g             152   1e-38   
ref|XP_007040776.1|  Early-responsive to dehydration stress prote...    152   2e-38   
ref|NP_001154237.1|  ERD (early-responsive to dehydration stress)...    151   2e-38   
gb|EMT22148.1|  Putative membrane protein                               151   2e-38   
ref|XP_007040777.1|  Early-responsive to dehydration stress prote...    151   4e-38   
ref|XP_004292602.1|  PREDICTED: CSC1-like protein At4g02900             150   4e-38   
ref|XP_008234908.1|  PREDICTED: uncharacterized protein RSN1 isof...    150   5e-38   
ref|XP_011082546.1|  PREDICTED: CSC1-like protein At4g02900             150   6e-38   
ref|XP_010677412.1|  PREDICTED: CSC1-like protein At1g32090             150   8e-38   
gb|KHG17938.1|  putative membrane C2G11.09                              149   1e-37   
ref|XP_003612662.1|  Membrane protein, putative                         150   1e-37   
emb|CDP11732.1|  unnamed protein product                                149   1e-37   
gb|KJB22581.1|  hypothetical protein B456_004G055300                    147   2e-37   
ref|XP_002519965.1|  Extensin-3 precursor, putative                     149   2e-37   
ref|XP_010920040.1|  PREDICTED: LOW QUALITY PROTEIN: CSC1-like pr...    149   2e-37   
gb|AFI41197.1|  dehydration stress protein                              148   6e-37   
ref|NP_193278.4|  ERD (early-responsive to dehydration stress) fa...    147   1e-36   
emb|CDY09064.1|  BnaC08g10180D                                          147   1e-36   
ref|XP_009107840.1|  PREDICTED: CSC1-like protein At4g15430             147   1e-36   
ref|XP_006414510.1|  hypothetical protein EUTSA_v10024504mg             144   4e-36   
ref|XP_010455943.1|  PREDICTED: CSC1-like protein At4g02900 isofo...    145   5e-36   
gb|EMT11783.1|  Putative membrane protein                               145   5e-36   
ref|XP_008788615.1|  PREDICTED: CSC1-like protein At1g32090             144   9e-36   
ref|XP_006414511.1|  hypothetical protein EUTSA_v10024504mg             144   9e-36   
emb|CDP11733.1|  unnamed protein product                                143   3e-35   
ref|XP_010056204.1|  PREDICTED: CSC1-like protein At1g32090             142   5e-35   
gb|EPS61105.1|  hypothetical protein M569_13694                         139   2e-34   
ref|XP_006432649.1|  hypothetical protein CICLE_v10000312mg             137   3e-33   
gb|KDO58806.1|  hypothetical protein CISIN_1g040696mg                   137   3e-33   
ref|XP_004146108.1|  PREDICTED: uncharacterized membrane protein ...    137   4e-33   
ref|XP_002969287.1|  hypothetical protein SELMODRAFT_91711              137   4e-33   
ref|XP_008448614.1|  PREDICTED: uncharacterized protein RSN1            137   4e-33   
gb|EPS74192.1|  hypothetical protein M569_00556                         136   7e-33   
ref|XP_010054102.1|  PREDICTED: CSC1-like protein At1g32090             134   2e-32   
ref|XP_011018446.1|  PREDICTED: CSC1-like protein At1g32090             134   3e-32   
emb|CDM81261.1|  unnamed protein product                                134   3e-32   
ref|XP_011082330.1|  PREDICTED: CSC1-like protein At1g32090             134   4e-32   
gb|EYU23284.1|  hypothetical protein MIMGU_mgv1a001448mg                133   7e-32   
ref|XP_006368323.1|  early-responsive to dehydration family protein     133   8e-32   
gb|KHN40403.1|  Putative membrane protein C2G11.09                      133   8e-32   
ref|XP_011028084.1|  PREDICTED: CSC1-like protein At1g32090             133   9e-32   
ref|XP_003516847.1|  PREDICTED: uncharacterized protein RSN1-like       133   9e-32   
emb|CDY27442.1|  BnaC03g64820D                                          123   2e-31   
ref|XP_004512449.1|  PREDICTED: uncharacterized membrane protein ...    131   3e-31   
ref|XP_003533453.1|  PREDICTED: uncharacterized protein RSN1-like       131   5e-31   
ref|XP_002304365.2|  hypothetical protein POPTR_0003s09900g             130   6e-31   
ref|XP_001782141.1|  predicted protein                                  130   8e-31   
ref|XP_002529341.1|  conserved hypothetical protein                     129   3e-30   
emb|CDX76386.1|  BnaA08g10140D                                          127   6e-30   
ref|XP_010461028.1|  PREDICTED: CSC1-like protein At1g32090             127   1e-29   
ref|XP_010478627.1|  PREDICTED: CSC1-like protein At1g32090             127   1e-29   
ref|XP_010499754.1|  PREDICTED: CSC1-like protein At1g32090             127   1e-29   
ref|XP_002893699.1|  hypothetical protein ARALYDRAFT_473392             126   2e-29   
gb|KFK44972.1|  hypothetical protein AALP_AA1G327200                    125   3e-29   
emb|CDY29933.1|  BnaC05g29030D                                          125   5e-29   
emb|CDY35541.1|  BnaA05g16450D                                          125   5e-29   
ref|XP_009145210.1|  PREDICTED: CSC1-like protein At1g32090             125   5e-29   
ref|XP_009409814.1|  PREDICTED: CSC1-like protein At1g32090             124   7e-29   
ref|NP_174489.1|  early-responsive to dehydration stress protein ...    125   7e-29   
ref|XP_006304000.1|  hypothetical protein CARUB_v10011444mg             124   9e-29   
ref|XP_006415254.1|  hypothetical protein EUTSA_v10006831mg             124   1e-28   
gb|AFW81356.1|  hypothetical protein ZEAMMB73_379943                    124   2e-28   
ref|XP_001754358.1|  predicted protein                                  123   2e-28   
emb|CDX79125.1|  BnaA01g11920D                                          123   2e-28   
gb|KHG01781.1|  putative membrane C2G11.09                              122   2e-28   
ref|XP_008360740.1|  PREDICTED: uncharacterized protein RSN1-like       119   3e-28   
ref|XP_010323041.1|  PREDICTED: CSC1-like protein At4g02900 isofo...    114   4e-25   
ref|XP_010518924.1|  PREDICTED: CSC1-like protein At1g32090             114   6e-25   
ref|XP_001770572.1|  predicted protein                                  113   6e-25   
ref|XP_002317143.2|  hypothetical protein POPTR_0011s01450g             110   7e-25   
gb|EPS60193.1|  hypothetical protein M569_14609                         113   8e-25   
ref|XP_010323040.1|  PREDICTED: CSC1-like protein At4g02900 isofo...    111   3e-24   
ref|XP_001757556.1|  predicted protein                                  110   1e-23   
ref|XP_001759032.1|  predicted protein                                  107   1e-22   
ref|XP_010278603.1|  PREDICTED: CSC1-like protein At4g02900 isofo...    100   1e-20   
ref|XP_002986828.1|  hypothetical protein SELMODRAFT_425683             100   2e-20   
ref|XP_006287199.1|  hypothetical protein CARUB_v10000374mg             100   2e-20   
gb|KJB25199.1|  hypothetical protein B456_004G180800                  96.7    2e-19   
gb|KJB22580.1|  hypothetical protein B456_004G055300                  94.4    1e-18   
ref|XP_006853160.1|  hypothetical protein AMTR_s00038p00185310        88.2    1e-16   
ref|XP_010921304.1|  PREDICTED: calcium permeable stress-gated ca...  87.8    3e-16   
ref|XP_010924082.1|  PREDICTED: calcium permeable stress-gated ca...  84.0    5e-15   
gb|ETO71891.1|  hypothetical protein, variant                         82.8    2e-14   
gb|ETO71890.1|  hypothetical protein F444_11873                       82.8    2e-14   
gb|ETI43237.1|  hypothetical protein F443_11789                       82.8    2e-14   
gb|ETK83293.1|  hypothetical protein, variant                         82.8    2e-14   
ref|XP_008907981.1|  hypothetical protein PPTG_12608                  82.8    2e-14   
gb|ETK83292.1|  hypothetical protein L915_11487                       82.8    2e-14   
gb|ETP41073.1|  hypothetical protein F442_11697                       82.8    2e-14   
ref|XP_008907982.1|  hypothetical protein, variant                    82.8    2e-14   
ref|XP_001764420.1|  predicted protein                                80.5    9e-14   
ref|XP_002898083.1|  conserved hypothetical protein                   79.7    2e-13   
ref|XP_011463530.1|  PREDICTED: protein OSCA1-like                    73.6    2e-13   
ref|XP_009525441.1|  hypothetical protein PHYSODRAFT_360288           78.6    4e-13   
gb|AAG50793.1|AC074309_10  hypothetical protein                       74.3    4e-13   
gb|EEC76105.1|  hypothetical protein OsI_13363                        76.6    1e-12   
gb|KJB80261.1|  hypothetical protein B456_013G089300                  76.3    2e-12   
gb|KJB80259.1|  hypothetical protein B456_013G089300                  76.3    2e-12   
ref|NP_001051134.1|  Os03g0726300                                     76.3    2e-12   
emb|CAA56145.1|  HYP1                                                 75.5    2e-12   
gb|EEE59847.1|  hypothetical protein OsJ_12422                        75.9    3e-12   
gb|AAF26164.1|AC008261_21  unknown protein                            75.1    3e-12   
ref|XP_007045993.1|  Early-responsive to dehydration stress prote...  75.5    4e-12   
dbj|BAD94293.1|  hypothetical protein                                 75.1    4e-12   
ref|NP_186759.2|  uncharacterized protein                             75.1    4e-12   
ref|XP_002960116.1|  hypothetical protein SELMODRAFT_450821           75.1    4e-12   
ref|XP_002984025.1|  hypothetical protein SELMODRAFT_156268           75.1    4e-12   
ref|XP_010088119.1|  Uncharacterized membrane protein                 75.1    5e-12   
gb|KDO83033.1|  hypothetical protein CISIN_1g0052161mg                70.5    5e-12   
ref|XP_010109429.1|  putative membrane protein                        74.7    7e-12   
ref|XP_008221566.1|  PREDICTED: uncharacterized membrane protein ...  74.7    7e-12   
ref|XP_001765646.1|  predicted protein                                74.3    7e-12   
ref|XP_004304272.1|  PREDICTED: CSC1-like protein HYP1                74.3    9e-12   
ref|XP_010029368.1|  PREDICTED: CSC1-like protein HYP1                73.9    1e-11   
gb|KDP27183.1|  hypothetical protein JCGZ_19882                       73.6    1e-11   
ref|XP_002882200.1|  hypothetical protein ARALYDRAFT_477418           73.2    2e-11   
emb|CDY37544.1|  BnaA05g34090D                                        73.2    2e-11   
ref|XP_011010302.1|  PREDICTED: CSC1-like protein HYP1                72.8    3e-11   
ref|XP_004981918.1|  PREDICTED: uncharacterized membrane protein ...  72.8    3e-11   
ref|XP_006391015.1|  hypothetical protein EUTSA_v10018196mg           72.8    3e-11   
ref|XP_008341608.1|  PREDICTED: phosphate metabolism protein 7-like   72.4    3e-11   
gb|EMT18535.1|  Putative membrane protein                             72.4    3e-11   
emb|CDX91963.1|  BnaC03g32650D                                        72.8    3e-11   
gb|KJB14676.1|  hypothetical protein B456_002G137000                  72.4    3e-11   
ref|XP_009147396.1|  PREDICTED: CSC1-like protein HYP1                72.4    3e-11   
gb|KJB14682.1|  hypothetical protein B456_002G137000                  72.4    3e-11   
gb|KJB14680.1|  hypothetical protein B456_002G137000                  72.4    3e-11   
ref|XP_002463956.1|  hypothetical protein SORBIDRAFT_01g009540        72.4    4e-11   
ref|XP_009134634.1|  PREDICTED: CSC1-like protein HYP1                72.4    4e-11   
emb|CDX74284.1|  BnaA03g27630D                                        72.4    4e-11   
gb|KJB14674.1|  hypothetical protein B456_002G137000                  72.4    4e-11   
gb|KHG29773.1|  Membrane protein                                      72.4    4e-11   
ref|XP_002305383.1|  HYPOTHETICAL protein 1                           72.0    4e-11   
ref|XP_001761096.1|  predicted protein                                72.0    4e-11   
gb|KJB14675.1|  hypothetical protein B456_002G137000                  72.0    4e-11   
emb|CDY43268.1|  BnaC05g48610D                                        72.0    4e-11   
gb|KHG30396.1|  putative membrane C2G11.09                            72.0    5e-11   
ref|XP_011098667.1|  PREDICTED: CSC1-like protein HYP1 isoform X1     72.0    5e-11   
ref|XP_006299849.1|  hypothetical protein CARUB_v10016052mg           72.0    5e-11   
ref|XP_009360589.1|  PREDICTED: CSC1-like protein HYP1                71.6    5e-11   
gb|EYU34204.1|  hypothetical protein MIMGU_mgv1a001911mg              71.6    6e-11   
ref|XP_006482641.1|  PREDICTED: uncharacterized membrane protein ...  71.6    6e-11   
gb|EYU26139.1|  hypothetical protein MIMGU_mgv1a022719mg              71.6    7e-11   
gb|KDO83034.1|  hypothetical protein CISIN_1g0052161mg                66.2    7e-11   
ref|XP_009105488.1|  PREDICTED: CSC1-like protein At1g69450           71.2    7e-11   
ref|XP_010430647.1|  PREDICTED: LOW QUALITY PROTEIN: CSC1-like pr...  71.2    8e-11   
ref|XP_010485425.1|  PREDICTED: CSC1-like protein HYP1                71.2    8e-11   
ref|XP_010943525.1|  PREDICTED: CSC1-like protein RXW8 isoform X2     70.9    9e-11   
ref|XP_010943516.1|  PREDICTED: CSC1-like protein RXW8 isoform X1     70.9    1e-10   
ref|XP_006483098.1|  PREDICTED: uncharacterized membrane protein ...  70.9    1e-10   
emb|CDY40924.1|  BnaC06g30620D                                        70.9    1e-10   
ref|XP_006483099.1|  PREDICTED: uncharacterized membrane protein ...  70.9    1e-10   
ref|XP_008339854.1|  PREDICTED: uncharacterized membrane protein ...  70.5    1e-10   
ref|XP_006408462.1|  hypothetical protein EUTSA_v10020163mg           70.5    2e-10   
ref|XP_007157718.1|  hypothetical protein PHAVU_002G092500g           70.5    2e-10   
ref|XP_006574918.1|  PREDICTED: uncharacterized membrane protein ...  70.1    2e-10   
ref|XP_006574916.1|  PREDICTED: uncharacterized membrane protein ...  70.1    2e-10   
gb|KHN36998.1|  Putative membrane protein                             70.1    2e-10   
ref|XP_006574920.1|  PREDICTED: uncharacterized membrane protein ...  69.7    2e-10   
ref|XP_007160962.1|  hypothetical protein PHAVU_001G031900g           70.1    2e-10   
ref|XP_004516572.1|  PREDICTED: uncharacterized membrane protein ...  70.1    2e-10   
ref|XP_007216321.1|  hypothetical protein PRUPE_ppa019884mg           70.1    2e-10   



>ref|XP_007141612.1| hypothetical protein PHAVU_008G210700g [Phaseolus vulgaris]
 gb|ESW13606.1| hypothetical protein PHAVU_008G210700g [Phaseolus vulgaris]
Length=755

 Score =   228 bits (580),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 110/144 (76%), Positives = 124/144 (86%), Gaps = 2/144 (1%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQEYESAAAFWPDVHGRIIFAL+ SQ+  +GLLSTK AA S P LI LPVLTI+
Sbjct  606  QIINVYNQEYESAAAFWPDVHGRIIFALVISQLLLMGLLSTKEAANSTPLLITLPVLTIS  665

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            FHLYCKGRY+ AF KHPLQEA MKDTLE+AREPNFNLK +LQ AYIHPVFKG++D  D +
Sbjct  666  FHLYCKGRYQPAFIKHPLQEAMMKDTLERAREPNFNLKEFLQSAYIHPVFKGDDDS-DSE  724

Query  274  GISEKADE-ENVLVQTKRQSRKNT  206
             +SEK +E E V+VQTKRQSR+NT
Sbjct  725  VMSEKWEEQEPVVVQTKRQSRRNT  748



>ref|XP_006387596.1| hypothetical protein POPTR_0796s00200g [Populus trichocarpa]
 gb|ERP46510.1| hypothetical protein POPTR_0796s00200g [Populus trichocarpa]
Length=168

 Score =   211 bits (537),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 102/145 (70%), Positives = 122/145 (84%), Gaps = 1/145 (1%)
 Frame = -3

Query  637  LQIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTI  458
            +QIINVYNQEYES AAFWPDVHGR+I AL+ SQ++ +GL+STK AAQS PFLI LPVLTI
Sbjct  1    MQIINVYNQEYESGAAFWPDVHGRVITALVISQLALMGLMSTKEAAQSTPFLIALPVLTI  60

Query  457  TFHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDY  278
             FH +C GR++SAF K+PLQEA MKDTLE+AR+PNFNLK YLQ AY+HPVFKG +D+ D 
Sbjct  61   WFHRFCNGRHKSAFVKYPLQEAMMKDTLERARDPNFNLKAYLQSAYVHPVFKGGDDDIDE  120

Query  277  DG-ISEKADEENVLVQTKRQSRKNT  206
            D  +S K + E+VLV TKRQSR+NT
Sbjct  121  DDLLSGKMETESVLVPTKRQSRRNT  145



>gb|ABK96436.1| unknown [Populus trichocarpa x Populus deltoides]
Length=252

 Score =   213 bits (541),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 105/143 (73%), Positives = 121/143 (85%), Gaps = 1/143 (1%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQEYES AAFWPDVHGR+I AL+ SQ++ LGL+STK AAQSAPFLI LPVLTI 
Sbjct  88   QIINVYNQEYESGAAFWPDVHGRVITALVISQLALLGLMSTKEAAQSAPFLIALPVLTIW  147

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            FH +C GR++SAF K+PLQEA MKDTLE+AR+PNFNLK YLQDAYIHPVFK   D  + D
Sbjct  148  FHRFCNGRHKSAFVKYPLQEAMMKDTLERARDPNFNLKAYLQDAYIHPVFK-GGDGDEDD  206

Query  274  GISEKADEENVLVQTKRQSRKNT  206
             +S+K + E+VLV TKRQSRKNT
Sbjct  207  DLSKKLETESVLVPTKRQSRKNT  229



>gb|KHN38468.1| Putative membrane protein C2G11.09 [Glycine soja]
Length=758

 Score =   221 bits (564),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 107/143 (75%), Positives = 119/143 (83%), Gaps = 0/143 (0%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQEYESAAAFWPDVHGRIIFAL+ SQ+  +GLLSTK AA S P LI LP+LTI+
Sbjct  604  QIINVYNQEYESAAAFWPDVHGRIIFALVISQLLLMGLLSTKEAANSTPLLITLPILTIS  663

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            FHLYCKGRYE AF KHPLQEA MKDTLE+AREPNFNLK +LQ+AYIHPVFKG++D     
Sbjct  664  FHLYCKGRYEPAFVKHPLQEAMMKDTLERAREPNFNLKEFLQNAYIHPVFKGDDDSDSDV  723

Query  274  GISEKADEENVLVQTKRQSRKNT  206
                  ++E VLVQTKRQSRKNT
Sbjct  724  MSENWEEQEPVLVQTKRQSRKNT  746



>ref|XP_003519463.1| PREDICTED: uncharacterized membrane protein C2G11.09-like [Glycine 
max]
Length=760

 Score =   221 bits (564),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 107/143 (75%), Positives = 119/143 (83%), Gaps = 0/143 (0%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQEYESAAAFWPDVHGRIIFAL+ SQ+  +GLLSTK AA S P LI LP+LTI+
Sbjct  606  QIINVYNQEYESAAAFWPDVHGRIIFALVISQLLLMGLLSTKEAANSTPLLITLPILTIS  665

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            FHLYCKGRYE AF KHPLQEA MKDTLE+AREPNFNLK +LQ+AYIHPVFKG++D     
Sbjct  666  FHLYCKGRYEPAFVKHPLQEAMMKDTLERAREPNFNLKEFLQNAYIHPVFKGDDDSDSDV  725

Query  274  GISEKADEENVLVQTKRQSRKNT  206
                  ++E VLVQTKRQSRKNT
Sbjct  726  MSENWEEQEPVLVQTKRQSRKNT  748



>ref|XP_011086200.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Sesamum indicum]
 ref|XP_011086201.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Sesamum indicum]
 ref|XP_011086202.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Sesamum indicum]
Length=775

 Score =   221 bits (564),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 109/143 (76%), Positives = 119/143 (83%), Gaps = 1/143 (1%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQEYESAAAFWPDVHGRII AL+FSQ+  +GL+STK AAQS PFLI LPVLTI 
Sbjct  608  QIINVYNQEYESAAAFWPDVHGRIISALVFSQLVLMGLMSTKGAAQSTPFLIALPVLTIW  667

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            FH +CKGRYE AF ++PLQEA MKDTLE+AREPN NLK YL+ AYIHPVFK +ED    D
Sbjct  668  FHRFCKGRYEPAFIRYPLQEAMMKDTLERAREPNLNLKSYLRYAYIHPVFKNDEDGEHDD  727

Query  274  GISEKADEENVLVQTKRQSRKNT  206
             ISEK D E VLV TKRQSRKNT
Sbjct  728  DISEKLD-ETVLVPTKRQSRKNT  749



>ref|XP_006396700.1| hypothetical protein EUTSA_v10028449mg [Eutrema salsugineum]
 ref|XP_006396701.1| hypothetical protein EUTSA_v10028449mg [Eutrema salsugineum]
 gb|ESQ38153.1| hypothetical protein EUTSA_v10028449mg [Eutrema salsugineum]
 gb|ESQ38154.1| hypothetical protein EUTSA_v10028449mg [Eutrema salsugineum]
Length=770

 Score =   221 bits (563),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 104/143 (73%), Positives = 120/143 (84%), Gaps = 1/143 (1%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQEYES AAFWPDVHGR+I ALI SQ+  +GLL TKHAA +APFLIVLPVLTI 
Sbjct  607  QIINVYNQEYESGAAFWPDVHGRVISALIISQLLLMGLLGTKHAASAAPFLIVLPVLTIG  666

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            FH +CKGRYE AF ++PLQEA MKDTLE+A+EPN NLK YLQDAYIHPVFKG +D+ + D
Sbjct  667  FHRFCKGRYEPAFVRYPLQEAMMKDTLERAKEPNLNLKGYLQDAYIHPVFKGGDDDDESD  726

Query  274  GISEKADEENVLVQTKRQSRKNT  206
             +  K +EE V+V TKRQSR+NT
Sbjct  727  MLG-KLEEEVVIVPTKRQSRRNT  748



>dbj|BAF98597.1| CM0545.360.nc [Lotus japonicus]
Length=755

 Score =   221 bits (562),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 104/143 (73%), Positives = 121/143 (85%), Gaps = 1/143 (1%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQEYESAAAFWPD+HGRIIFAL+ SQ+  +GLLSTK AA S P LI+LPVLTI 
Sbjct  604  QIINVYNQEYESAAAFWPDIHGRIIFALVISQLLLMGLLSTKEAANSTPLLIILPVLTIW  663

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            FHL+CKGRYE AF +HPLQEA MKDTLE+AREP  N K +LQ+AYIHPVFK +ED  D D
Sbjct  664  FHLFCKGRYEPAFVQHPLQEAMMKDTLERAREPQLNYKEFLQNAYIHPVFKSDEDS-DSD  722

Query  274  GISEKADEENVLVQTKRQSRKNT  206
             +S++ ++E +LVQTKRQSRKNT
Sbjct  723  VMSQEFEDEPMLVQTKRQSRKNT  745



>ref|XP_008459005.1| PREDICTED: uncharacterized membrane protein C2G11.09-like [Cucumis 
melo]
 ref|XP_008459006.1| PREDICTED: uncharacterized membrane protein C2G11.09-like [Cucumis 
melo]
Length=773

 Score =   220 bits (560),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 105/143 (73%), Positives = 121/143 (85%), Gaps = 1/143 (1%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQEYESAAAFWPDVHGRII+ALIFSQV  +GLLSTK AAQS PFLI LPV+TI+
Sbjct  608  QIINVYNQEYESAAAFWPDVHGRIIYALIFSQVVLMGLLSTKKAAQSTPFLIALPVITIS  667

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            FHLYCKGRYE AF ++P+QEA MKDTLE+AREPN NLK YL  AY HPVFK +ED+ + +
Sbjct  668  FHLYCKGRYEPAFIRYPIQEAMMKDTLERAREPNLNLKGYLHAAYAHPVFKESEDDDEVE  727

Query  274  GISEKADEENVLVQTKRQSRKNT  206
              +E  + E+VLV TKRQSR+NT
Sbjct  728  S-NEAFETESVLVATKRQSRRNT  749



>ref|XP_011016279.1| PREDICTED: CSC1-like protein At3g21620 [Populus euphratica]
 ref|XP_011016280.1| PREDICTED: CSC1-like protein At3g21620 [Populus euphratica]
 ref|XP_011016281.1| PREDICTED: CSC1-like protein At3g21620 [Populus euphratica]
Length=768

 Score =   217 bits (552),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 105/143 (73%), Positives = 119/143 (83%), Gaps = 1/143 (1%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQEYESAAAFWPDVHGRII A+I SQ+  +GLLSTK AAQS P LI LPVLTI 
Sbjct  604  QIINVYNQEYESAAAFWPDVHGRIIVAVIVSQLLLMGLLSTKEAAQSTPLLITLPVLTIW  663

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            FHL+CKGRYE AF ++PLQEA MKDTLE+AREPN NLK +LQ+AY HPVFKG ED+ D D
Sbjct  664  FHLFCKGRYEPAFVRYPLQEAMMKDTLERAREPNLNLKSFLQNAYSHPVFKG-EDDSDSD  722

Query  274  GISEKADEENVLVQTKRQSRKNT  206
            G  E+ ++E  LV TKRQSR+NT
Sbjct  723  GAPEEFEKEPDLVPTKRQSRRNT  745



>ref|XP_002317144.2| early-responsive to dehydration family protein [Populus trichocarpa]
 gb|EEE97756.2| early-responsive to dehydration family protein [Populus trichocarpa]
Length=744

 Score =   216 bits (551),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 107/143 (75%), Positives = 124/143 (87%), Gaps = 1/143 (1%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQEYES AAFWPDVHGR+I AL+ SQ++ LGL+STK AAQSAPFLI LPVLTI 
Sbjct  580  QIINVYNQEYESGAAFWPDVHGRVITALVISQLALLGLMSTKEAAQSAPFLIALPVLTIW  639

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            FH +C GR++SAF K+PLQEA MKDTLE+AR+PNFNLK YLQDAYIHPVFKG +D+ D D
Sbjct  640  FHGFCNGRHKSAFVKYPLQEAMMKDTLERARDPNFNLKAYLQDAYIHPVFKGGDDDEDDD  699

Query  274  GISEKADEENVLVQTKRQSRKNT  206
             +S+K + E+VLV TKRQSRKNT
Sbjct  700  -LSKKLETESVLVPTKRQSRKNT  721



>ref|XP_006283166.1| hypothetical protein CARUB_v10004197mg [Capsella rubella]
 gb|EOA16064.1| hypothetical protein CARUB_v10004197mg [Capsella rubella]
Length=771

 Score =   216 bits (551),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 101/143 (71%), Positives = 118/143 (83%), Gaps = 0/143 (0%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQEYESAAAFWPDVHGR+I AL+ SQ+  +GLL TKHAA +APFLI LPVLTI 
Sbjct  608  QIINVYNQEYESAAAFWPDVHGRVIAALVISQLLLMGLLGTKHAALAAPFLIALPVLTIG  667

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            FH +CKGRYE AF ++PLQEA MKDTLE AREPN NLK YLQ+AYIHPVFKG+ED  + +
Sbjct  668  FHHFCKGRYEPAFIRYPLQEAMMKDTLENAREPNLNLKGYLQNAYIHPVFKGDEDGDNIN  727

Query  274  GISEKADEENVLVQTKRQSRKNT  206
                K ++E ++V TKRQSR+NT
Sbjct  728  DKLGKFEDEAIIVPTKRQSRRNT  750



>ref|XP_010252492.1| PREDICTED: calcium permeable stress-gated cation channel 1 [Nelumbo 
nucifera]
Length=770

 Score =   216 bits (550),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 106/143 (74%), Positives = 119/143 (83%), Gaps = 2/143 (1%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQEYESAAAFWPDVHGRII ALI SQ+  +GLLSTK AAQS P LI LPVLTI 
Sbjct  608  QIINVYNQEYESAAAFWPDVHGRIITALIISQLLLMGLLSTKRAAQSTPLLIALPVLTIW  667

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            FH +CK RYE AF ++PLQEA MKDTLE+AREPN NLK YLQ+AY+HPVFKG EDE D D
Sbjct  668  FHRFCKSRYEPAFIRYPLQEAMMKDTLERAREPNLNLKGYLQNAYVHPVFKG-EDE-DSD  725

Query  274  GISEKADEENVLVQTKRQSRKNT  206
              +E+  +E+VLV TKRQSR+NT
Sbjct  726  AFTEELQKESVLVPTKRQSRRNT  748



>ref|XP_009357481.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Pyrus x bretschneideri]
Length=772

 Score =   216 bits (550),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 105/143 (73%), Positives = 117/143 (82%), Gaps = 1/143 (1%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQEYESAAAFWPDVHGRII ALI SQ+   GLLSTK AAQS PFLI LPVLT+ 
Sbjct  608  QIINVYNQEYESAAAFWPDVHGRIITALIISQLLLFGLLSTKKAAQSTPFLIALPVLTLW  667

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            FH YCKGR+E AF ++PLQEA MKDTLEQAREPN NLK YLQ AYIHPVFK  +DE D++
Sbjct  668  FHRYCKGRFEPAFKRYPLQEAMMKDTLEQAREPNLNLKGYLQSAYIHPVFKECDDEEDHE  727

Query  274  GISEKADEENVLVQTKRQSRKNT  206
               EK + E+V+V TKR SR+NT
Sbjct  728  SF-EKGETESVIVATKRHSRRNT  749



>ref|XP_002301612.2| early-responsive to dehydration family protein [Populus trichocarpa]
 gb|EEE80885.2| early-responsive to dehydration family protein [Populus trichocarpa]
Length=763

 Score =   215 bits (548),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 104/143 (73%), Positives = 119/143 (83%), Gaps = 1/143 (1%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQEYESAAAFWPDVHGRII A+I SQ+  +GLLSTK AAQS P LI LPVLTI 
Sbjct  600  QIINVYNQEYESAAAFWPDVHGRIIVAVIVSQLLLMGLLSTKEAAQSTPLLITLPVLTIW  659

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            FHL+CKGRYE AF ++PLQEA MKDTLE+A+EPN NLK +LQ+AYIHPVFKG ED+ D D
Sbjct  660  FHLFCKGRYEPAFVRYPLQEAMMKDTLERAKEPNLNLKSFLQNAYIHPVFKG-EDDSDSD  718

Query  274  GISEKADEENVLVQTKRQSRKNT  206
               E+ ++E  LV TKRQSR+NT
Sbjct  719  EAPEEFEKEPDLVPTKRQSRRNT  741



>ref|XP_011007190.1| PREDICTED: CSC1-like protein At3g21620 [Populus euphratica]
 ref|XP_011007191.1| PREDICTED: CSC1-like protein At3g21620 [Populus euphratica]
 ref|XP_011007193.1| PREDICTED: CSC1-like protein At3g21620 [Populus euphratica]
Length=767

 Score =   214 bits (545),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 104/143 (73%), Positives = 118/143 (83%), Gaps = 1/143 (1%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQEYESAAAFWPDVHGRII A+I SQ+  +GLLSTK AAQS P LI LPVLTI 
Sbjct  604  QIINVYNQEYESAAAFWPDVHGRIIVAVIVSQLLLMGLLSTKEAAQSTPLLIALPVLTIW  663

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            FHL+CKGRYE AF ++PLQEA MKDTLE+AREP  NLK +LQ+AYIHPVFKG ED+ D D
Sbjct  664  FHLFCKGRYEPAFVRYPLQEAMMKDTLERAREPKLNLKSFLQNAYIHPVFKG-EDDSDSD  722

Query  274  GISEKADEENVLVQTKRQSRKNT  206
               E+ ++E  LV TKRQSR+NT
Sbjct  723  EAPEEFEKEPDLVPTKRQSRRNT  745



>ref|XP_009772361.1| PREDICTED: CSC1-like protein At3g21620 [Nicotiana sylvestris]
 ref|XP_009772362.1| PREDICTED: CSC1-like protein At3g21620 [Nicotiana sylvestris]
 ref|XP_009772364.1| PREDICTED: CSC1-like protein At3g21620 [Nicotiana sylvestris]
 ref|XP_009772365.1| PREDICTED: CSC1-like protein At3g21620 [Nicotiana sylvestris]
Length=768

 Score =   214 bits (545),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 106/143 (74%), Positives = 114/143 (80%), Gaps = 1/143 (1%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQEYESAAAFWPDVHGRII ALI SQ+  +GLLSTK A+ S P LI LPVLTI 
Sbjct  604  QIINVYNQEYESAAAFWPDVHGRIITALIVSQLLLMGLLSTKGASHSTPLLITLPVLTIW  663

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            FHL+CKGRYE AF ++PLQEA MKDTLE+ REPNFNLK YLQDAYIHPVFKG ED  + D
Sbjct  664  FHLFCKGRYEPAFIRYPLQEAVMKDTLERTREPNFNLKEYLQDAYIHPVFKGEED-IESD  722

Query  274  GISEKADEENVLVQTKRQSRKNT  206
              SE    E  LV TKRQSR NT
Sbjct  723  AASEDGKLEPSLVPTKRQSRFNT  745



>ref|XP_004158583.1| PREDICTED: uncharacterized protein RSN1-like [Cucumis sativus]
Length=768

 Score =   214 bits (544),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 100/143 (70%), Positives = 117/143 (82%), Gaps = 0/143 (0%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQEYESAAAFWPDVHGRII AL+ SQ+  +GLLSTK AAQS P LI LP+LTI 
Sbjct  604  QIINVYNQEYESAAAFWPDVHGRIIAALVVSQLLLMGLLSTKEAAQSTPLLIALPILTIW  663

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            FH +CKGRYE AF ++PLQEA MKDTLE+AREPN NLK +LQ+AY+HPVFK +ED+ + +
Sbjct  664  FHRFCKGRYEPAFVRYPLQEAMMKDTLERAREPNLNLKGFLQNAYVHPVFKHDEDDVEIE  723

Query  274  GISEKADEENVLVQTKRQSRKNT  206
              SE   +E  LV TKRQSR+NT
Sbjct  724  ADSEDWQQEPALVPTKRQSRRNT  746



>ref|XP_009592755.1| PREDICTED: CSC1-like protein At3g21620 [Nicotiana tomentosiformis]
 ref|XP_009592756.1| PREDICTED: CSC1-like protein At3g21620 [Nicotiana tomentosiformis]
Length=768

 Score =   214 bits (544),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 105/143 (73%), Positives = 115/143 (80%), Gaps = 1/143 (1%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQEYESAAAFWPDVHGRII ALI SQ+  +GLLSTK A+ S P LI LPVLTI 
Sbjct  604  QIINVYNQEYESAAAFWPDVHGRIITALIVSQLLLMGLLSTKGASHSTPLLITLPVLTIW  663

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            FHL+CKGRYE AF ++PLQEA MKDTLE+ REPNFNLK YLQDAYIHPVFKG ED  + D
Sbjct  664  FHLFCKGRYEPAFVRYPLQEAVMKDTLERTREPNFNLKEYLQDAYIHPVFKGEED-IESD  722

Query  274  GISEKADEENVLVQTKRQSRKNT  206
              S+  + E  LV TKRQSR NT
Sbjct  723  AASKDGELEPSLVPTKRQSRFNT  745



>ref|XP_004151944.1| PREDICTED: uncharacterized protein RSN1-like [Cucumis sativus]
 gb|KGN63220.1| hypothetical protein Csa_2G416110 [Cucumis sativus]
Length=768

 Score =   214 bits (544),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 100/143 (70%), Positives = 117/143 (82%), Gaps = 0/143 (0%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQEYESAAAFWPDVHGRII AL+ SQ+  +GLLSTK AAQS P LI LP+LTI 
Sbjct  604  QIINVYNQEYESAAAFWPDVHGRIIAALVVSQLLLMGLLSTKEAAQSTPLLIALPILTIW  663

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            FH +CKGRYE AF ++PLQEA MKDTLE+AREPN NLK +LQ+AY+HPVFK +ED+ + +
Sbjct  664  FHRFCKGRYEPAFVRYPLQEAMMKDTLERAREPNLNLKGFLQNAYVHPVFKHDEDDVEIE  723

Query  274  GISEKADEENVLVQTKRQSRKNT  206
              SE   +E  LV TKRQSR+NT
Sbjct  724  ADSEDWQQEPALVPTKRQSRRNT  746



>ref|XP_010099166.1| Uncharacterized membrane protein [Morus notabilis]
 gb|EXB77038.1| Uncharacterized membrane protein [Morus notabilis]
Length=779

 Score =   213 bits (543),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 107/143 (75%), Positives = 117/143 (82%), Gaps = 1/143 (1%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQEYES AAFWPDVH RII ALI SQV+ LGLL TK  AQS P LIVLPVLTI 
Sbjct  608  QIINVYNQEYESGAAFWPDVHLRIIIALITSQVALLGLLGTKENAQSTPVLIVLPVLTIW  667

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            F  +CKGRYESAF K+PLQEA MKDTLE+AREP+ NLK YLQ AYIHP+FK +EDE D D
Sbjct  668  FFRFCKGRYESAFVKYPLQEAMMKDTLERAREPHLNLKGYLQVAYIHPIFKESEDE-DDD  726

Query  274  GISEKADEENVLVQTKRQSRKNT  206
             +SEK D E+ LV TKRQSR+NT
Sbjct  727  VVSEKWDTESTLVPTKRQSRRNT  749



>ref|XP_002321139.1| early-responsive to dehydration family protein [Populus trichocarpa]
 gb|EEE99454.1| early-responsive to dehydration family protein [Populus trichocarpa]
Length=768

 Score =   213 bits (542),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 103/143 (72%), Positives = 118/143 (83%), Gaps = 1/143 (1%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQEYESAAAFWPDVHGRII A+I SQ+  +GLLSTK AAQS P LI LP+LTI 
Sbjct  604  QIINVYNQEYESAAAFWPDVHGRIIVAVIVSQLLLMGLLSTKEAAQSTPLLITLPILTIW  663

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            FHL+CKGRYE AF ++PLQEA MKDTLE+AREPN NLK +LQ+AY HPVFKG ED+ D D
Sbjct  664  FHLFCKGRYEPAFVRYPLQEAMMKDTLERAREPNLNLKSFLQNAYSHPVFKG-EDDSDSD  722

Query  274  GISEKADEENVLVQTKRQSRKNT  206
               E+ ++E  LV TKRQSR+NT
Sbjct  723  EAPEEFEKEPDLVPTKRQSRRNT  745



>ref|XP_011047222.1| PREDICTED: CSC1-like protein At3g21620 [Populus euphratica]
 ref|XP_011047223.1| PREDICTED: CSC1-like protein At3g21620 [Populus euphratica]
 ref|XP_011047224.1| PREDICTED: CSC1-like protein At3g21620 [Populus euphratica]
 ref|XP_011047225.1| PREDICTED: CSC1-like protein At3g21620 [Populus euphratica]
Length=768

 Score =   213 bits (542),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 103/143 (72%), Positives = 118/143 (83%), Gaps = 1/143 (1%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQEYESAAAFWPDVHGRII A+I SQ+  +GLLSTK AAQS P LI LP+LTI 
Sbjct  604  QIINVYNQEYESAAAFWPDVHGRIIVAVIVSQLLLMGLLSTKEAAQSTPLLITLPILTIW  663

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            FHL+CKGRYE AF ++PLQEA MKDTLE+AREPN NLK +LQ+AY HPVFKG ED+ D D
Sbjct  664  FHLFCKGRYEPAFVRYPLQEAMMKDTLERAREPNLNLKSFLQNAYSHPVFKG-EDDSDSD  722

Query  274  GISEKADEENVLVQTKRQSRKNT  206
               E+ ++E  LV TKRQSR+NT
Sbjct  723  EAPEEFEKEPDLVPTKRQSRRNT  745



>ref|XP_002518432.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF43819.1| conserved hypothetical protein [Ricinus communis]
Length=773

 Score =   213 bits (541),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 107/145 (74%), Positives = 121/145 (83%), Gaps = 2/145 (1%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVY+QEYES AAFWPDVHGR+I ALI SQV  +GLLSTK AAQS PFLIVLPVLTI 
Sbjct  606  QIINVYDQEYESGAAFWPDVHGRVITALIISQVLMIGLLSTKRAAQSTPFLIVLPVLTIW  665

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFK--GNEDEYD  281
            FH +CKGRYE AF K+PLQEA MKDTLE+AREPN NLKP+LQ+AY HPVFK    +D+ +
Sbjct  666  FHRFCKGRYEPAFVKYPLQEAMMKDTLERAREPNLNLKPFLQNAYRHPVFKNDDGDDDDE  725

Query  280  YDGISEKADEENVLVQTKRQSRKNT  206
             D ISEK + E+VLV TKRQSR+NT
Sbjct  726  NDDISEKLETESVLVPTKRQSRRNT  750



>ref|XP_006469645.1| PREDICTED: uncharacterized membrane protein C2G11.09-like isoform 
X3 [Citrus sinensis]
Length=599

 Score =   210 bits (535),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 103/143 (72%), Positives = 117/143 (82%), Gaps = 1/143 (1%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQEYESAAAFWPDVHGRII AL+ SQ+  +GLLSTK AAQS P LI LP+LTI 
Sbjct  444  QIINVYNQEYESAAAFWPDVHGRIITALVVSQLLLMGLLSTKEAAQSTPLLITLPILTIW  503

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            FH +CKGRYE AF ++PLQEA MKDTLE+AREPN NLK +LQ AYIHPVFK  E E + D
Sbjct  504  FHRFCKGRYEPAFVRYPLQEAMMKDTLERAREPNLNLKSFLQIAYIHPVFKEVE-ECESD  562

Query  274  GISEKADEENVLVQTKRQSRKNT  206
              SE++D+E VL+ TKRQSR NT
Sbjct  563  PASEESDQEPVLIPTKRQSRMNT  585



>ref|XP_011463550.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
isoform X2 [Fragaria vesca subsp. vesca]
Length=718

 Score =   212 bits (539),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 101/143 (71%), Positives = 116/143 (81%), Gaps = 1/143 (1%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQEYESAAAFWPDVHGRII AL+ SQ+  +GLLSTK AAQS P LI LPVLTI+
Sbjct  554  QIINVYNQEYESAAAFWPDVHGRIITALVVSQLLLMGLLSTKEAAQSTPLLITLPVLTIS  613

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            FH +CKGRYE AF K+PLQEA  KDTLE  REPN NLK +LQ AY+HPVFKG +D  D D
Sbjct  614  FHRFCKGRYEPAFKKNPLQEAMRKDTLEHVREPNLNLKGFLQSAYVHPVFKGADDS-DSD  672

Query  274  GISEKADEENVLVQTKRQSRKNT  206
            G +E+ + E  +V+TKRQSR+NT
Sbjct  673  GAAEELEVEPAVVRTKRQSRRNT  695



>ref|XP_006447608.1| hypothetical protein CICLE_v10014696mg [Citrus clementina]
 gb|ESR60848.1| hypothetical protein CICLE_v10014696mg [Citrus clementina]
Length=590

 Score =   210 bits (534),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 102/143 (71%), Positives = 116/143 (81%), Gaps = 1/143 (1%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            Q+INVYNQEYESAAAFWPDVHGRII ALI SQ+  +GLLSTK AAQS P LI LP+LTI 
Sbjct  435  QVINVYNQEYESAAAFWPDVHGRIITALIVSQLLLMGLLSTKEAAQSTPLLITLPILTIW  494

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            FH +CKGRYE AF ++PLQEA MKDTLE+AREPN NLK +LQ AYIHPVFK    E + D
Sbjct  495  FHRFCKGRYEPAFVRYPLQEAMMKDTLERAREPNLNLKSFLQIAYIHPVFK-EVQESESD  553

Query  274  GISEKADEENVLVQTKRQSRKNT  206
              SE++D+E VL+ TKRQSR NT
Sbjct  554  PASEESDQEPVLIPTKRQSRMNT  576



>ref|XP_002892667.1| hypothetical protein ARALYDRAFT_312226 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68926.1| hypothetical protein ARALYDRAFT_312226 [Arabidopsis lyrata subsp. 
lyrata]
Length=773

 Score =   212 bits (540),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 105/148 (71%), Positives = 120/148 (81%), Gaps = 5/148 (3%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQEYESAA FWPDVHGRII ALI SQ+  +GLLSTK AAQS PFL+VLP+LT  
Sbjct  609  QIINVYNQEYESAARFWPDVHGRIISALIISQILLMGLLSTKGAAQSTPFLLVLPILTFF  668

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNE-DEYDY  278
            FH +CKGRYE AF +HPL+EA +KDTLE+AREPNFNLKPYLQ AYIHPVFK N+ ++  +
Sbjct  669  FHRFCKGRYEPAFLRHPLKEAMVKDTLERAREPNFNLKPYLQKAYIHPVFKDNDYEDSRF  728

Query  277  DGIS----EKADEENVLVQTKRQSRKNT  206
            D IS    E +D+E V V TKRQSR NT
Sbjct  729  DEISGYCIEDSDDECVTVPTKRQSRINT  756



>ref|XP_004289181.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
isoform X1 [Fragaria vesca subsp. vesca]
Length=767

 Score =   212 bits (540),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 101/143 (71%), Positives = 116/143 (81%), Gaps = 1/143 (1%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQEYESAAAFWPDVHGRII AL+ SQ+  +GLLSTK AAQS P LI LPVLTI+
Sbjct  603  QIINVYNQEYESAAAFWPDVHGRIITALVVSQLLLMGLLSTKEAAQSTPLLITLPVLTIS  662

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            FH +CKGRYE AF K+PLQEA  KDTLE  REPN NLK +LQ AY+HPVFKG +D  D D
Sbjct  663  FHRFCKGRYEPAFKKNPLQEAMRKDTLEHVREPNLNLKGFLQSAYVHPVFKGADDS-DSD  721

Query  274  GISEKADEENVLVQTKRQSRKNT  206
            G +E+ + E  +V+TKRQSR+NT
Sbjct  722  GAAEELEVEPAVVRTKRQSRRNT  744



>ref|XP_004491137.1| PREDICTED: uncharacterized protein RSN1-like [Cicer arietinum]
Length=766

 Score =   211 bits (537),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 99/143 (69%), Positives = 117/143 (82%), Gaps = 1/143 (1%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQEYESA AFWPDVHGRI+FAL+ SQ+  +GLLSTK AA S P LI LP+LTI 
Sbjct  604  QIINVYNQEYESAGAFWPDVHGRIVFALVISQLLLMGLLSTKKAANSTPLLITLPILTIW  663

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            FH +CKG YE AF  HPLQEA +KDTLE+ +EPNFNLK +LQ+AYIHPVF G+ED  D D
Sbjct  664  FHRFCKGSYEPAFITHPLQEAMVKDTLERTKEPNFNLKEFLQNAYIHPVFNGDEDT-DSD  722

Query  274  GISEKADEENVLVQTKRQSRKNT  206
             +S++ ++E V VQTKRQSR+NT
Sbjct  723  VMSKEWEQEPVTVQTKRQSRRNT  745



>ref|XP_008384098.1| PREDICTED: uncharacterized protein RSN1 [Malus domestica]
Length=771

 Score =   211 bits (537),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 103/143 (72%), Positives = 115/143 (80%), Gaps = 1/143 (1%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVY QEYESAAAFWPDVHGRII ALI SQ+   GLLSTK AAQS PFLI LPVLT+ 
Sbjct  608  QIINVYKQEYESAAAFWPDVHGRIITALIISQLLLFGLLSTKKAAQSTPFLIALPVLTLX  667

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            FH YCKGR+E AF   PLQEA MKDTLEQAR+PN NLK YLQ AYIHPVFK   DE D +
Sbjct  668  FHRYCKGRFEPAFKTFPLQEAMMKDTLEQARDPNLNLKGYLQSAYIHPVFKECGDEXDNE  727

Query  274  GISEKADEENVLVQTKRQSRKNT  206
             + +K++ E+V+V TKRQSR+NT
Sbjct  728  SL-ZKSETESVIVATKRQSRRNT  749



>ref|XP_006287117.1| hypothetical protein CARUB_v10000278mg [Capsella rubella]
 gb|EOA20015.1| hypothetical protein CARUB_v10000278mg [Capsella rubella]
Length=772

 Score =   211 bits (537),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 103/143 (72%), Positives = 121/143 (85%), Gaps = 1/143 (1%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQEYESAAAFWPDVHGRII ALI SQ+  +GLL TKHAA +APFLI LPV+TI 
Sbjct  609  QIINVYNQEYESAAAFWPDVHGRIITALIISQLLLMGLLGTKHAASAAPFLIALPVITIG  668

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            FH +CKGRYE AF ++PLQEA MKDTLE+AREPN NLK YLQDAY+HPVFKG++D+ D D
Sbjct  669  FHRFCKGRYEPAFIRYPLQEAMMKDTLERAREPNLNLKGYLQDAYVHPVFKGDDDDDDSD  728

Query  274  GISEKADEENVLVQTKRQSRKNT  206
             +  K ++E ++V TKRQSR+NT
Sbjct  729  MVG-KLEDEVIIVPTKRQSRRNT  750



>gb|KDO39720.1| hypothetical protein CISIN_1g048588mg [Citrus sinensis]
Length=615

 Score =   209 bits (532),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 102/143 (71%), Positives = 116/143 (81%), Gaps = 1/143 (1%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            Q+INVYNQEYESAAAFWPDVHGRII ALI SQ+  +GLLSTK AAQS P LI LP+LTI 
Sbjct  428  QVINVYNQEYESAAAFWPDVHGRIITALIVSQLLLMGLLSTKEAAQSTPLLITLPILTIW  487

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            FH +CKGRYE AF ++PLQEA MKDTLE+AREPN NLK +LQ AYIHPVFK    E + D
Sbjct  488  FHRFCKGRYEPAFVRYPLQEAMMKDTLERAREPNLNLKSFLQIAYIHPVFK-EVQESESD  546

Query  274  GISEKADEENVLVQTKRQSRKNT  206
              SE++D+E VL+ TKRQSR NT
Sbjct  547  PASEESDQEPVLIPTKRQSRMNT  569



>ref|XP_003616997.1| Transmembrane protein [Medicago truncatula]
 gb|AES99955.1| ERD (early-responsive to dehydration stress) family protein [Medicago 
truncatula]
Length=766

 Score =   211 bits (537),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 101/143 (71%), Positives = 115/143 (80%), Gaps = 1/143 (1%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQEYESA AFWPDVHGRI+FAL+ SQ+  +GLLSTK AA S P LI LPVLTI 
Sbjct  604  QIINVYNQEYESAGAFWPDVHGRIVFALVVSQLLLMGLLSTKEAANSTPLLIALPVLTIW  663

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            FH +CKG YE AFT HPLQEA +KDTLE+ +EPNFNLK +L DAYIHPVF  + D  D D
Sbjct  664  FHRFCKGSYEPAFTTHPLQEAMVKDTLERTKEPNFNLKDFLHDAYIHPVFNDDGDT-DSD  722

Query  274  GISEKADEENVLVQTKRQSRKNT  206
             +S++  EE V+VQTKRQSRKNT
Sbjct  723  VMSQEWKEEPVIVQTKRQSRKNT  745



>ref|XP_002264502.1| PREDICTED: calcium permeable stress-gated cation channel 1 [Vitis 
vinifera]
 ref|XP_010655368.1| PREDICTED: calcium permeable stress-gated cation channel 1 [Vitis 
vinifera]
 ref|XP_010655369.1| PREDICTED: calcium permeable stress-gated cation channel 1 [Vitis 
vinifera]
 ref|XP_010655370.1| PREDICTED: calcium permeable stress-gated cation channel 1 [Vitis 
vinifera]
 emb|CBI23200.3| unnamed protein product [Vitis vinifera]
Length=771

 Score =   211 bits (537),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 105/153 (69%), Positives = 120/153 (78%), Gaps = 6/153 (4%)
 Frame = -3

Query  649  FCLTL-----QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPF  485
            FCL       QIINVYNQEYES AAFWPDVHGRII ALI SQ+  +GLLSTK AAQS PF
Sbjct  596  FCLAYVVFRHQIINVYNQEYESGAAFWPDVHGRIIGALIISQLLLMGLLSTKQAAQSTPF  655

Query  484  LIVLPVLTITFHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVF  305
            LI LP+LTI+FH YCKGR+E AF ++PLQEAKMKDTLE+AREP+ NLK YLQ AYIHPVF
Sbjct  656  LIALPILTISFHYYCKGRFEPAFIRYPLQEAKMKDTLERAREPHLNLKGYLQTAYIHPVF  715

Query  304  KGNEDEYDYDGISEKADEENVLVQTKRQSRKNT  206
            K  ED+ + + I  K + +  LV TKRQSR+NT
Sbjct  716  KSAEDD-EEEEIHGKWEHDAELVPTKRQSRRNT  747



>ref|XP_008455928.1| PREDICTED: uncharacterized membrane protein YLR241W isoform X3 
[Cucumis melo]
Length=629

 Score =   209 bits (532),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 99/143 (69%), Positives = 117/143 (82%), Gaps = 0/143 (0%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQEYESAAAFWPDVHGRII AL+ SQ+  +GLLSTK AAQS P LI LP+LTI 
Sbjct  465  QIINVYNQEYESAAAFWPDVHGRIIAALVVSQLLLMGLLSTKEAAQSTPLLIALPILTIW  524

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            F+ +CKGRYE AF ++PLQEA MKDTLE+AREPN NLK +LQ+AY+HPVFK +ED+ + +
Sbjct  525  FNRFCKGRYEPAFVQYPLQEAMMKDTLERAREPNLNLKGFLQNAYVHPVFKHDEDDVEIE  584

Query  274  GISEKADEENVLVQTKRQSRKNT  206
              SE   +E  LV TKRQSR+NT
Sbjct  585  TDSEDRQQEPALVPTKRQSRRNT  607



>ref|XP_008455926.1| PREDICTED: uncharacterized membrane protein YLR241W isoform X2 
[Cucumis melo]
 ref|XP_008455927.1| PREDICTED: uncharacterized membrane protein YLR241W isoform X2 
[Cucumis melo]
Length=649

 Score =   209 bits (533),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 99/143 (69%), Positives = 117/143 (82%), Gaps = 0/143 (0%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQEYESAAAFWPDVHGRII AL+ SQ+  +GLLSTK AAQS P LI LP+LTI 
Sbjct  485  QIINVYNQEYESAAAFWPDVHGRIIAALVVSQLLLMGLLSTKEAAQSTPLLIALPILTIW  544

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            F+ +CKGRYE AF ++PLQEA MKDTLE+AREPN NLK +LQ+AY+HPVFK +ED+ + +
Sbjct  545  FNRFCKGRYEPAFVQYPLQEAMMKDTLERAREPNLNLKGFLQNAYVHPVFKHDEDDVEIE  604

Query  274  GISEKADEENVLVQTKRQSRKNT  206
              SE   +E  LV TKRQSR+NT
Sbjct  605  TDSEDRQQEPALVPTKRQSRRNT  627



>ref|NP_172660.5| putative ERD4 protein [Arabidopsis thaliana]
 sp|B5TYT3.1|CSCL7_ARATH RecName: Full=CSC1-like protein At1g11960 [Arabidopsis thaliana]
 gb|ACI01072.1| putative membrane protein [Arabidopsis thaliana]
 gb|AEE28821.1| putative ERD4 protein [Arabidopsis thaliana]
 gb|AIU34615.1| hyperosmolality-gated Ca2+ permeable channel 1.3 [Arabidopsis 
thaliana]
Length=771

 Score =   211 bits (536),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 104/148 (70%), Positives = 119/148 (80%), Gaps = 5/148 (3%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQEYESAA FWPDVHGRII ALI +Q+  +GLLSTK AAQS PFL+ LP++T  
Sbjct  607  QIINVYNQEYESAARFWPDVHGRIISALIIAQILLMGLLSTKGAAQSTPFLLFLPIITFF  666

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNE-DEYDY  278
            FH YCKGRYE AF +HPL+EA +KDTLE+AREPNFNLKPYLQ AYIHPVFK N+ ++  +
Sbjct  667  FHRYCKGRYEPAFLRHPLKEAMVKDTLERAREPNFNLKPYLQKAYIHPVFKDNDYEDSRF  726

Query  277  DGIS----EKADEENVLVQTKRQSRKNT  206
            D IS    E +DEE V V TKRQSR NT
Sbjct  727  DEISGYCIEDSDEECVTVPTKRQSRINT  754



>ref|XP_006447609.1| hypothetical protein CICLE_v10014378mg [Citrus clementina]
 ref|XP_006469643.1| PREDICTED: uncharacterized membrane protein C2G11.09-like isoform 
X1 [Citrus sinensis]
 ref|XP_006469644.1| PREDICTED: uncharacterized membrane protein C2G11.09-like isoform 
X2 [Citrus sinensis]
 gb|ESR60849.1| hypothetical protein CICLE_v10014378mg [Citrus clementina]
Length=759

 Score =   211 bits (536),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 103/143 (72%), Positives = 117/143 (82%), Gaps = 1/143 (1%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQEYESAAAFWPDVHGRII AL+ SQ+  +GLLSTK AAQS P LI LP+LTI 
Sbjct  604  QIINVYNQEYESAAAFWPDVHGRIITALVVSQLLLMGLLSTKEAAQSTPLLITLPILTIW  663

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            FH +CKGRYE AF ++PLQEA MKDTLE+AREPN NLK +LQ AYIHPVFK  E E + D
Sbjct  664  FHRFCKGRYEPAFVRYPLQEAMMKDTLERAREPNLNLKSFLQIAYIHPVFKEVE-ECESD  722

Query  274  GISEKADEENVLVQTKRQSRKNT  206
              SE++D+E VL+ TKRQSR NT
Sbjct  723  PASEESDQEPVLIPTKRQSRMNT  745



>ref|XP_006417282.1| hypothetical protein EUTSA_v10006870mg [Eutrema salsugineum]
 gb|ESQ35635.1| hypothetical protein EUTSA_v10006870mg [Eutrema salsugineum]
Length=770

 Score =   211 bits (536),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 105/147 (71%), Positives = 116/147 (79%), Gaps = 4/147 (3%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQEYESAAAFWPDVHGRI  ALI SQ+  +GL+STK AAQS PFLI LPVLT  
Sbjct  607  QIINVYNQEYESAAAFWPDVHGRITSALIISQILLMGLMSTKGAAQSTPFLIALPVLTFF  666

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            FH +CKGRYE AF +HPLQEA +KDTLE+AREP+FNLKPYLQ AYIHPVFK ++ E    
Sbjct  667  FHRFCKGRYEPAFLRHPLQEAMIKDTLERAREPSFNLKPYLQKAYIHPVFKDDDYEDSRS  726

Query  274  GIS----EKADEENVLVQTKRQSRKNT  206
             IS    E +DEE V V TKRQSRK T
Sbjct  727  EISGYCFEDSDEECVTVPTKRQSRKTT  753



>gb|AAC17615.1| Similar to hypothetical protein HYP1 gb|Z97338 from A. thaliana 
[Arabidopsis thaliana]
Length=783

 Score =   211 bits (536),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 104/148 (70%), Positives = 119/148 (80%), Gaps = 5/148 (3%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQEYESAA FWPDVHGRII ALI +Q+  +GLLSTK AAQS PFL+ LP++T  
Sbjct  619  QIINVYNQEYESAARFWPDVHGRIISALIIAQILLMGLLSTKGAAQSTPFLLFLPIITFF  678

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNE-DEYDY  278
            FH YCKGRYE AF +HPL+EA +KDTLE+AREPNFNLKPYLQ AYIHPVFK N+ ++  +
Sbjct  679  FHRYCKGRYEPAFLRHPLKEAMVKDTLERAREPNFNLKPYLQKAYIHPVFKDNDYEDSRF  738

Query  277  DGIS----EKADEENVLVQTKRQSRKNT  206
            D IS    E +DEE V V TKRQSR NT
Sbjct  739  DEISGYCIEDSDEECVTVPTKRQSRINT  766



>emb|CDP04437.1| unnamed protein product [Coffea canephora]
Length=768

 Score =   210 bits (534),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 105/143 (73%), Positives = 121/143 (85%), Gaps = 1/143 (1%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQEYESAAAFWPDVHGRII A++ SQ+  +GL+STKHAA S PFL+ LP+LTI+
Sbjct  604  QIINVYNQEYESAAAFWPDVHGRIISAMVISQLLLMGLMSTKHAALSTPFLLALPILTIS  663

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            FHLYCKGRYE AF ++PLQEA MKDTLE+A+EPN NLK YLQ+AYIHPVFKG +D+ D D
Sbjct  664  FHLYCKGRYEPAFRRYPLQEAMMKDTLERAKEPNLNLKAYLQNAYIHPVFKGGDDDEDED  723

Query  274  GISEKADEENVLVQTKRQSRKNT  206
             I EK  E  VLV TKRQSR+NT
Sbjct  724  EIIEKL-EATVLVPTKRQSRRNT  745



>ref|XP_008363487.1| PREDICTED: uncharacterized protein RSN1-like [Malus domestica]
Length=567

 Score =   207 bits (526),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 99/143 (69%), Positives = 116/143 (81%), Gaps = 1/143 (1%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQEYESAAAFWPDVHGRII ALI SQ+  +GLLSTK AAQS P LI LPVLTI 
Sbjct  401  QIINVYNQEYESAAAFWPDVHGRIITALIVSQLLLMGLLSTKEAAQSTPLLITLPVLTIW  460

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            FH +CKGRYE AF +HPLQEA MKDTLE+ REPN N+K +LQ+AYIHPVFKG ED+ +  
Sbjct  461  FHXFCKGRYEPAFIRHPLQEAMMKDTLERTREPNLNMKGFLQNAYIHPVFKG-EDDSENX  519

Query  274  GISEKADEENVLVQTKRQSRKNT  206
              +++ ++E  +V TKR SR+NT
Sbjct  520  APAQEFEKEPXVVLTKRSSRRNT  542



>emb|CAA18115.1| putative protein [Arabidopsis thaliana]
 emb|CAB79167.1| putative protein [Arabidopsis thaliana]
Length=697

 Score =   209 bits (531),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 103/143 (72%), Positives = 120/143 (84%), Gaps = 0/143 (0%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQEYESAAAFWPDVHGR+I AL+ SQ+  +GLL TKHAA +APFLI LPVLTI 
Sbjct  534  QIINVYNQEYESAAAFWPDVHGRVIAALVISQLLLMGLLGTKHAALAAPFLIALPVLTIG  593

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            FH +CKGRYE AF ++PLQEA MKDTLE AREPN NLK YLQ+AY+HPVFKG+ED+YD D
Sbjct  594  FHHFCKGRYEPAFIRYPLQEAMMKDTLETAREPNLNLKGYLQNAYVHPVFKGDEDDYDID  653

Query  274  GISEKADEENVLVQTKRQSRKNT  206
                K ++E ++V TKRQSR+NT
Sbjct  654  DKLGKFEDEAIIVPTKRQSRRNT  676



>ref|XP_008455922.1| PREDICTED: uncharacterized protein RSN1 isoform X1 [Cucumis melo]
 ref|XP_008455924.1| PREDICTED: uncharacterized protein RSN1 isoform X1 [Cucumis melo]
 ref|XP_008455925.1| PREDICTED: uncharacterized protein RSN1 isoform X1 [Cucumis melo]
Length=768

 Score =   209 bits (533),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 99/143 (69%), Positives = 117/143 (82%), Gaps = 0/143 (0%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQEYESAAAFWPDVHGRII AL+ SQ+  +GLLSTK AAQS P LI LP+LTI 
Sbjct  604  QIINVYNQEYESAAAFWPDVHGRIIAALVVSQLLLMGLLSTKEAAQSTPLLIALPILTIW  663

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            F+ +CKGRYE AF ++PLQEA MKDTLE+AREPN NLK +LQ+AY+HPVFK +ED+ + +
Sbjct  664  FNRFCKGRYEPAFVQYPLQEAMMKDTLERAREPNLNLKGFLQNAYVHPVFKHDEDDVEIE  723

Query  274  GISEKADEENVLVQTKRQSRKNT  206
              SE   +E  LV TKRQSR+NT
Sbjct  724  TDSEDRQQEPALVPTKRQSRRNT  746



>ref|XP_002867790.1| hypothetical protein ARALYDRAFT_492658 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44049.1| hypothetical protein ARALYDRAFT_492658 [Arabidopsis lyrata subsp. 
lyrata]
Length=773

 Score =   209 bits (532),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 103/143 (72%), Positives = 119/143 (83%), Gaps = 0/143 (0%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQEYESAAAFWPDVHGR+I AL+ SQ+  +GLL TKHAA +APFLI LPVLTI 
Sbjct  610  QIINVYNQEYESAAAFWPDVHGRVIAALVISQLLLMGLLGTKHAALAAPFLIALPVLTIG  669

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            FH +CKGRYE AF ++PLQEA MKDTLE AREPN NLK YLQ+AYIHPVFKG+ED+ D D
Sbjct  670  FHHFCKGRYEPAFIRYPLQEAMMKDTLESAREPNLNLKGYLQNAYIHPVFKGDEDDDDID  729

Query  274  GISEKADEENVLVQTKRQSRKNT  206
                K ++E ++V TKRQSR+NT
Sbjct  730  DKLGKFEDEAIIVPTKRQSRRNT  752



>ref|XP_009613689.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Nicotiana tomentosiformis]
Length=767

 Score =   209 bits (531),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 110/143 (77%), Positives = 130/143 (91%), Gaps = 1/143 (1%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQEYESAAAFWPDVHGRI+FAL FSQ+S LGLLSTKHAAQSAPFLI LPVLTI+
Sbjct  604  QIINVYNQEYESAAAFWPDVHGRIVFALCFSQLSLLGLLSTKHAAQSAPFLIALPVLTIS  663

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            FHL+CKGRYE AFTK+P+QEA+M+DTLEQAREPNFNLK YLQ+AY+HPVFKG++++ D D
Sbjct  664  FHLFCKGRYEPAFTKYPIQEARMRDTLEQAREPNFNLKGYLQNAYVHPVFKGDDEDEDED  723

Query  274  GISEKADEENVLVQTKRQSRKNT  206
             ++ K + ++V+V TKRQSR NT
Sbjct  724  FLN-KLENDSVIVPTKRQSRLNT  745



>emb|CDY21297.1| BnaC03g29810D [Brassica napus]
Length=768

 Score =   209 bits (531),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 100/143 (70%), Positives = 118/143 (83%), Gaps = 0/143 (0%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQEYESAAAFWPDVHGRII ALI SQ+  +GLL TK AA +APF+I LPV+TI 
Sbjct  604  QIINVYNQEYESAAAFWPDVHGRIITALIISQLLLMGLLVTKRAALAAPFIIALPVITIG  663

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            FH +CKGRYE AF ++PLQEA MKDTLE+A+EPN NLK YLQDAYIHPVFKG +++ D D
Sbjct  664  FHRFCKGRYEPAFVRYPLQEAMMKDTLERAKEPNLNLKGYLQDAYIHPVFKGGDNDDDDD  723

Query  274  GISEKADEENVLVQTKRQSRKNT  206
             +  K + E ++V TKRQSR+NT
Sbjct  724  SVLGKLEGEVIIVPTKRQSRRNT  746



>ref|XP_010439363.1| PREDICTED: calcium permeable stress-gated cation channel 1 [Camelina 
sativa]
 ref|XP_010439364.1| PREDICTED: calcium permeable stress-gated cation channel 1 [Camelina 
sativa]
 ref|XP_010439365.1| PREDICTED: calcium permeable stress-gated cation channel 1 [Camelina 
sativa]
Length=771

 Score =   209 bits (531),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 103/143 (72%), Positives = 119/143 (83%), Gaps = 0/143 (0%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQEYESAAAFWPDVHGR+I AL+ SQ+  +GLL TKHAA +APFLI LPVLTI 
Sbjct  608  QIINVYNQEYESAAAFWPDVHGRVIAALVISQLLLMGLLGTKHAALAAPFLIALPVLTIG  667

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            FH +CKGRYE AF ++PLQEA MKDTLE AREPN NLK YLQ+AYIHPVFKG+ED+ D D
Sbjct  668  FHHFCKGRYEPAFIRYPLQEAMMKDTLETAREPNLNLKGYLQNAYIHPVFKGDEDDDDID  727

Query  274  GISEKADEENVLVQTKRQSRKNT  206
                K ++E ++V TKRQSR+NT
Sbjct  728  DKLGKFEDEAIIVPTKRQSRRNT  750



>ref|XP_010434078.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Camelina sativa]
 ref|XP_010434079.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Camelina sativa]
 ref|XP_010434080.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Camelina sativa]
 ref|XP_010434081.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Camelina sativa]
Length=771

 Score =   209 bits (531),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 103/143 (72%), Positives = 119/143 (83%), Gaps = 0/143 (0%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQEYESAAAFWPDVHGR+I AL+ SQ+  +GLL TKHAA +APFLI LPVLTI 
Sbjct  608  QIINVYNQEYESAAAFWPDVHGRVIAALVISQLLLMGLLGTKHAALAAPFLIALPVLTIG  667

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            FH +CKGRYE AF ++PLQEA MKDTLE AREPN NLK YLQ+AYIHPVFKG+ED+ D D
Sbjct  668  FHHFCKGRYEPAFIRYPLQEAMMKDTLETAREPNLNLKGYLQNAYIHPVFKGDEDDDDID  727

Query  274  GISEKADEENVLVQTKRQSRKNT  206
                K ++E ++V TKRQSR+NT
Sbjct  728  DKLGKFEDEAIIVPTKRQSRRNT  750



>ref|XP_010493595.1| PREDICTED: LOW QUALITY PROTEIN: CSC1-like protein At1g11960 [Camelina 
sativa]
Length=779

 Score =   208 bits (530),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 105/150 (70%), Positives = 119/150 (79%), Gaps = 9/150 (6%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQEYES A FWPDVHGRII ALI SQV  +GLLSTK AAQS PFL+VLP+LT  
Sbjct  617  QIINVYNQEYESGARFWPDVHGRIIAALIISQVLLMGLLSTKGAAQSTPFLLVLPILTFF  676

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYD--  281
            FH +CKGRYE AF +HPL+EA +KDTLE+AREPNFNLKPYLQ AYIHPVFK  +D Y+  
Sbjct  677  FHRFCKGRYEPAFLRHPLKEAMVKDTLEKAREPNFNLKPYLQKAYIHPVFK--DDHYEDS  734

Query  280  -YDGIS----EKADEENVLVQTKRQSRKNT  206
             +D +S    E +D+E V V TKRQSR NT
Sbjct  735  RFDDMSSYCGEDSDDECVTVPTKRQSRLNT  764



>ref|XP_009772257.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Nicotiana sylvestris]
Length=767

 Score =   208 bits (530),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 124/164 (76%), Positives = 143/164 (87%), Gaps = 1/164 (1%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQEYESAAAFWPDVHGRIIFAL FSQ+S LGLLSTKHAAQSAPFLI LPVLTI+
Sbjct  604  QIINVYNQEYESAAAFWPDVHGRIIFALCFSQLSLLGLLSTKHAAQSAPFLIALPVLTIS  663

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            FHL+CKGRYE AFTK+P+QEA+M+DTLEQAREPNFNLK YLQ+AY+HPVFKG++++ D D
Sbjct  664  FHLFCKGRYEPAFTKYPIQEARMRDTLEQAREPNFNLKGYLQNAYVHPVFKGDDEDEDED  723

Query  274  GISEKADEENVLVQTKRQSRKNTpapskgsggsspSFRVEVIHE  143
             ++ K + ++V+V TKR SR NTP PSK S GSSPS    VIHE
Sbjct  724  FMN-KLETDSVIVPTKRHSRLNTPVPSKVSAGSSPSLPDAVIHE  766



>ref|NP_193943.2| early-responsive to dehydration stress-related protein [Arabidopsis 
thaliana]
 ref|NP_001078425.1| early-responsive to dehydration stress-related protein [Arabidopsis 
thaliana]
 ref|NP_001119027.1| early-responsive to dehydration stress-related protein [Arabidopsis 
thaliana]
 ref|NP_001119028.1| early-responsive to dehydration stress-related protein [Arabidopsis 
thaliana]
 ref|NP_001119029.1| early-responsive to dehydration stress-related protein [Arabidopsis 
thaliana]
 ref|NP_001190796.1| early-responsive to dehydration stress-related protein [Arabidopsis 
thaliana]
 sp|Q5XEZ5.1|CSC1_ARATH RecName: Full=Calcium permeable stress-gated cation channel 1; 
Short=AtCSC1 [Arabidopsis thaliana]
 gb|AAU94384.1| At4g22120 [Arabidopsis thaliana]
 gb|AAW50707.1| At4g22120 [Arabidopsis thaliana]
 gb|AEE84554.1| early-responsive to dehydration stress-related protein [Arabidopsis 
thaliana]
 gb|AEE84555.1| early-responsive to dehydration stress-related protein [Arabidopsis 
thaliana]
 gb|AEE84556.1| early-responsive to dehydration stress-related protein [Arabidopsis 
thaliana]
 gb|AEE84557.1| early-responsive to dehydration stress-related protein [Arabidopsis 
thaliana]
 gb|AEE84558.1| early-responsive to dehydration stress-related protein [Arabidopsis 
thaliana]
 gb|AEE84559.1| early-responsive to dehydration stress-related protein [Arabidopsis 
thaliana]
 gb|AIU34614.1| hyperosmolality-gated Ca2+ permeable channel 1.2 [Arabidopsis 
thaliana]
Length=771

 Score =   208 bits (529),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 103/143 (72%), Positives = 120/143 (84%), Gaps = 0/143 (0%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQEYESAAAFWPDVHGR+I AL+ SQ+  +GLL TKHAA +APFLI LPVLTI 
Sbjct  608  QIINVYNQEYESAAAFWPDVHGRVIAALVISQLLLMGLLGTKHAALAAPFLIALPVLTIG  667

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            FH +CKGRYE AF ++PLQEA MKDTLE AREPN NLK YLQ+AY+HPVFKG+ED+YD D
Sbjct  668  FHHFCKGRYEPAFIRYPLQEAMMKDTLETAREPNLNLKGYLQNAYVHPVFKGDEDDYDID  727

Query  274  GISEKADEENVLVQTKRQSRKNT  206
                K ++E ++V TKRQSR+NT
Sbjct  728  DKLGKFEDEAIIVPTKRQSRRNT  750



>dbj|BAD93792.1| hypothetical protein [Arabidopsis thaliana]
Length=771

 Score =   208 bits (529),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 103/143 (72%), Positives = 120/143 (84%), Gaps = 0/143 (0%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQEYESAAAFWPDVHGR+I AL+ SQ+  +GLL TKHAA +APFLI LPVLTI 
Sbjct  608  QIINVYNQEYESAAAFWPDVHGRVIAALVISQLFLMGLLGTKHAALAAPFLIALPVLTIG  667

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            FH +CKGRYE AF ++PLQEA MKDTLE AREPN NLK YLQ+AY+HPVFKG+ED+YD D
Sbjct  668  FHHFCKGRYEPAFIRYPLQEAMMKDTLETAREPNLNLKGYLQNAYVHPVFKGDEDDYDID  727

Query  274  GISEKADEENVLVQTKRQSRKNT  206
                K ++E ++V TKRQSR+NT
Sbjct  728  DKLGKFEDEAIIVPTKRQSRRNT  750



>ref|XP_006413690.1| hypothetical protein EUTSA_v10024476mg [Eutrema salsugineum]
 gb|ESQ55143.1| hypothetical protein EUTSA_v10024476mg [Eutrema salsugineum]
Length=771

 Score =   208 bits (529),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 102/143 (71%), Positives = 118/143 (83%), Gaps = 0/143 (0%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQEYESAAAFWPDVHGR+I ALI SQ+  +GLL TKHAA +APFLI LPVLTI 
Sbjct  608  QIINVYNQEYESAAAFWPDVHGRVITALIISQLLLMGLLGTKHAALAAPFLIALPVLTIG  667

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            FH +CKGRYE AF ++PLQEA MKDTLE AREPN NLK YLQ AY+HPVF+G+ED+ D D
Sbjct  668  FHRFCKGRYEPAFIRYPLQEAMMKDTLESAREPNLNLKGYLQSAYVHPVFRGDEDDDDID  727

Query  274  GISEKADEENVLVQTKRQSRKNT  206
                K ++E ++V TKRQSR+NT
Sbjct  728  DKLGKFEDEAIIVPTKRQSRRNT  750



>ref|XP_004166876.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized membrane protein 
C2G11.09-like [Cucumis sativus]
Length=773

 Score =   208 bits (529),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 103/143 (72%), Positives = 117/143 (82%), Gaps = 1/143 (1%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQEYESAAAFWPDVHGRII+ALIFSQV  +GLLSTK AAQS PFL+ LPV+TI+
Sbjct  608  QIINVYNQEYESAAAFWPDVHGRIIYALIFSQVILMGLLSTKKAAQSTPFLLALPVITIS  667

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            FHLYCKGRYE AF ++P+QEA MKDTLE+AREPN NLK YL  AY HPV K   +E D  
Sbjct  668  FHLYCKGRYEPAFIRYPIQEAMMKDTLERAREPNLNLKGYLHAAYAHPVIK-ESEEDDEV  726

Query  274  GISEKADEENVLVQTKRQSRKNT  206
              +E  + E+VLV TKRQSR+NT
Sbjct  727  ESNEAFETESVLVATKRQSRRNT  749



>ref|XP_004145433.1| PREDICTED: uncharacterized membrane protein C2G11.09-like [Cucumis 
sativus]
 gb|KGN66856.1| hypothetical protein Csa_1G701320 [Cucumis sativus]
Length=773

 Score =   208 bits (529),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 103/143 (72%), Positives = 117/143 (82%), Gaps = 1/143 (1%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQEYESAAAFWPDVHGRII+ALIFSQV  +GLLSTK AAQS PFL+ LPV+TI+
Sbjct  608  QIINVYNQEYESAAAFWPDVHGRIIYALIFSQVILMGLLSTKKAAQSTPFLLALPVITIS  667

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            FHLYCKGRYE AF ++P+QEA MKDTLE+AREPN NLK YL  AY HPV K   +E D  
Sbjct  668  FHLYCKGRYEPAFIRYPIQEAMMKDTLERAREPNLNLKGYLHAAYAHPVIK-ESEEDDEV  726

Query  274  GISEKADEENVLVQTKRQSRKNT  206
              +E  + E+VLV TKRQSR+NT
Sbjct  727  ESNEAFETESVLVATKRQSRRNT  749



>ref|XP_011046977.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Populus euphratica]
 ref|XP_011046978.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Populus euphratica]
Length=774

 Score =   207 bits (528),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 101/144 (70%), Positives = 122/144 (85%), Gaps = 1/144 (1%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQEYES AAFWPDVHGR+I AL+ SQ++ +GL+STK AAQS PFLI LPVLTI 
Sbjct  608  QIINVYNQEYESGAAFWPDVHGRVITALVISQLALMGLMSTKEAAQSTPFLIALPVLTIW  667

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            FH++C GR++SAF K+PLQEA MKDTLE+AR+PNFNLK YLQ AY+HPVFK ++D+ D D
Sbjct  668  FHMFCNGRHKSAFVKYPLQEAMMKDTLERARDPNFNLKAYLQSAYVHPVFKVDDDDIDED  727

Query  274  G-ISEKADEENVLVQTKRQSRKNT  206
              +S K + E+VLV TKRQSR+NT
Sbjct  728  DLLSGKMETESVLVPTKRQSRRNT  751



>emb|CDX82907.1| BnaC01g13570D [Brassica napus]
Length=768

 Score =   207 bits (528),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 105/144 (73%), Positives = 120/144 (83%), Gaps = 1/144 (1%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQEYESAAAFWPDVHGR+I ALI SQ+  +GLL TKHAA +APFLI LPVLTI 
Sbjct  608  QIINVYNQEYESAAAFWPDVHGRVIAALIISQLLLMGLLGTKHAALAAPFLIALPVLTIG  667

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            FH +CKGRYE AF ++PLQEAKMKDTLE AREPN NL+ YLQ AY+HPVF+G+EDE DYD
Sbjct  668  FHHFCKGRYEPAFVRYPLQEAKMKDTLESAREPNLNLRGYLQSAYVHPVFRGDEDEDDYD  727

Query  274  GIS-EKADEENVLVQTKRQSRKNT  206
                 K +EE ++V TKRQSR+NT
Sbjct  728  DDKLGKFEEEAIIVPTKRQSRRNT  751



>ref|XP_006467388.1| PREDICTED: uncharacterized membrane protein C2G11.09-like [Citrus 
sinensis]
 gb|KDO78338.1| hypothetical protein CISIN_1g004125mg [Citrus sinensis]
Length=772

 Score =   207 bits (528),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 103/143 (72%), Positives = 114/143 (80%), Gaps = 2/143 (1%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQ YESAAAFWPDVH RII ALI SQ+  +GLLSTK AA S PFLI LPVLTI 
Sbjct  608  QIINVYNQRYESAAAFWPDVHRRIIAALIISQLLLMGLLSTKKAALSTPFLIALPVLTIW  667

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            FH + K RYESAF K+PLQEA MKDTLE+AREPN NLK YL++AYIHPVFKG +D  D D
Sbjct  668  FHYFSKDRYESAFVKYPLQEAMMKDTLERAREPNLNLKGYLRNAYIHPVFKGEDD--DDD  725

Query  274  GISEKADEENVLVQTKRQSRKNT  206
             +    + ENVLV TKRQSR+NT
Sbjct  726  ALFNNEENENVLVLTKRQSRRNT  748



>ref|XP_011046975.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Populus euphratica]
 ref|XP_011046976.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Populus euphratica]
Length=774

 Score =   207 bits (527),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 101/144 (70%), Positives = 122/144 (85%), Gaps = 1/144 (1%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQEYES AAFWPDVHGR+I AL+ SQ++ +GL+STK AAQS PFLI LPVLTI 
Sbjct  608  QIINVYNQEYESGAAFWPDVHGRVITALVISQLALMGLMSTKEAAQSTPFLIALPVLTIW  667

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            FH++C GR++SAF K+PLQEA MKDTLE+AR+PNFNLK YLQ AY+HPVFK ++D+ D D
Sbjct  668  FHMFCNGRHKSAFVKYPLQEAMMKDTLERARDPNFNLKAYLQSAYVHPVFKVDDDDIDED  727

Query  274  G-ISEKADEENVLVQTKRQSRKNT  206
              +S K + E+VLV TKRQSR+NT
Sbjct  728  DLLSGKMETESVLVPTKRQSRRNT  751



>ref|XP_009135587.1| PREDICTED: calcium permeable stress-gated cation channel 1 [Brassica 
rapa]
Length=768

 Score =   207 bits (527),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 104/144 (72%), Positives = 120/144 (83%), Gaps = 1/144 (1%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQEYESAAAFWPDVHGR+I ALI SQ+  +GLL TKHAA +APFLI LPVLTI 
Sbjct  608  QIINVYNQEYESAAAFWPDVHGRVISALIISQLLLMGLLGTKHAALAAPFLIALPVLTIG  667

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            FH +CKGRYE AF ++PLQEAKMKDTLE AREPN NL+ YLQ AY+HPVF+G+ED+ DYD
Sbjct  668  FHHFCKGRYEPAFVRYPLQEAKMKDTLENAREPNLNLRGYLQSAYVHPVFRGDEDDDDYD  727

Query  274  GIS-EKADEENVLVQTKRQSRKNT  206
                 K +EE ++V TKRQSR+NT
Sbjct  728  DDKLGKFEEEAIIVPTKRQSRRNT  751



>ref|XP_011014901.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Populus euphratica]
Length=774

 Score =   207 bits (527),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 101/144 (70%), Positives = 122/144 (85%), Gaps = 1/144 (1%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQEYES AAFWPDVHGR+I AL+ SQ++ +GL+STK AAQS PFLI LPVLTI 
Sbjct  608  QIINVYNQEYESGAAFWPDVHGRVITALVISQLALMGLMSTKEAAQSTPFLIALPVLTIW  667

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            FH++C GR++SAF K+PLQEA MKDTLE+AR+PNFNLK YLQ AY+HPVFK ++D+ D D
Sbjct  668  FHMFCNGRHKSAFVKYPLQEAMMKDTLERARDPNFNLKAYLQSAYVHPVFKVDDDDIDED  727

Query  274  G-ISEKADEENVLVQTKRQSRKNT  206
              +S K + E+VLV TKRQSR+NT
Sbjct  728  DLLSGKMETESVLVPTKRQSRRNT  751



>ref|XP_010476146.1| PREDICTED: CSC1-like protein At1g11960 [Camelina sativa]
Length=772

 Score =   207 bits (527),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 104/150 (69%), Positives = 119/150 (79%), Gaps = 9/150 (6%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQEYES A FWPDVHGRII ALI SQV  +GLLSTK AAQS PFL+VLP+LT  
Sbjct  607  QIINVYNQEYESGARFWPDVHGRIIAALIISQVLLMGLLSTKGAAQSTPFLLVLPILTFF  666

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYD--  281
            FH +CKGRYE AF +HPL++A +KDTLE+AREPNFNLKPYLQ AYIHPVF+  +D Y+  
Sbjct  667  FHRFCKGRYEPAFLRHPLKDAMVKDTLEKAREPNFNLKPYLQKAYIHPVFR--DDHYEDS  724

Query  280  -YDGIS----EKADEENVLVQTKRQSRKNT  206
             +D IS    E +D+E V V TKRQSR NT
Sbjct  725  RFDDISSYCVEDSDDECVTVPTKRQSRLNT  754



>ref|XP_009148626.1| PREDICTED: CSC1-like protein At1g11960 [Brassica rapa]
Length=768

 Score =   207 bits (526),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 108/150 (72%), Positives = 116/150 (77%), Gaps = 10/150 (7%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQEYESA  FWPDVHGRII ALI SQV  LGL+STK AAQS PFLI LPVLT  
Sbjct  607  QIINVYNQEYESAGRFWPDVHGRIISALIISQVLLLGLMSTKGAAQSTPFLIALPVLTFF  666

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            FH +CKGRYE AF +HPLQEA +KDTLEQAREPNFNLKPYL+ AYIHPVFK  +DEY+ D
Sbjct  667  FHRFCKGRYEPAFLRHPLQEAMIKDTLEQAREPNFNLKPYLKKAYIHPVFK--DDEYE-D  723

Query  274  GISEKA-------DEENVLVQTKRQSRKNT  206
              SE +       DEE V V TKRQSR  T
Sbjct  724  VRSEVSGYYLGDTDEECVTVPTKRQSRITT  753



>emb|CDX98089.1| BnaA06g08400D [Brassica napus]
Length=768

 Score =   207 bits (526),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 108/150 (72%), Positives = 116/150 (77%), Gaps = 10/150 (7%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQEYESA  FWPDVHGRII ALI SQV  LGL+STK AAQS PFLI LPVLT  
Sbjct  607  QIINVYNQEYESAGRFWPDVHGRIISALIISQVLLLGLMSTKGAAQSTPFLIALPVLTFF  666

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            FH +CKGRYE AF +HPLQEA +KDTLEQAREPNFNLKPYL+ AYIHPVFK  +DEY+ D
Sbjct  667  FHRFCKGRYEPAFLRHPLQEAMIKDTLEQAREPNFNLKPYLKKAYIHPVFK--DDEYE-D  723

Query  274  GISEKA-------DEENVLVQTKRQSRKNT  206
              SE +       DEE V V TKRQSR  T
Sbjct  724  VRSEVSGYYLGDTDEECVTVPTKRQSRITT  753



>ref|NP_192343.1| early-responsive to dehydration stress-related protein [Arabidopsis 
thaliana]
 ref|NP_849296.1| early-responsive to dehydration stress-related protein [Arabidopsis 
thaliana]
 ref|NP_849297.1| early-responsive to dehydration stress-related protein [Arabidopsis 
thaliana]
 sp|Q9XEA1.1|CSCL5_ARATH RecName: Full=Protein OSCA1; AltName: Full=CSC1-like protein 
At4g04340; AltName: Full=Protein reduced hyperosmolality-induced 
[Ca(2+)]i increase 1 [Arabidopsis thaliana]
 gb|AAD36947.1|AF069441_7 predicted protein of unknown function [Arabidopsis thaliana]
 emb|CAB77902.1| predicted protein of unknown function [Arabidopsis thaliana]
 gb|AAM13208.1| unknown protein [Arabidopsis thaliana]
 gb|AEE82380.1| early-responsive to dehydration stress-related protein [Arabidopsis 
thaliana]
 gb|AEE82381.1| early-responsive to dehydration stress-related protein [Arabidopsis 
thaliana]
 gb|AEE82382.1| early-responsive to dehydration stress-related protein [Arabidopsis 
thaliana]
 gb|AIU34613.1| hyperosmolality-gated Ca2+ permeable channel 1.1 [Arabidopsis 
thaliana]
Length=772

 Score =   207 bits (526),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 102/143 (71%), Positives = 119/143 (83%), Gaps = 1/143 (1%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQEYESAAAFWPDVHGR+I ALI SQ+  +GLL TKHAA +APFLI LPV+TI 
Sbjct  609  QIINVYNQEYESAAAFWPDVHGRVITALIISQLLLMGLLGTKHAASAAPFLIALPVITIG  668

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            FH +CKGR+E AF ++PLQEA MKDTLE+AREPN NLK YLQDAYIHPVFKG +++ D D
Sbjct  669  FHRFCKGRFEPAFVRYPLQEAMMKDTLERAREPNLNLKGYLQDAYIHPVFKGGDNDDDGD  728

Query  274  GISEKADEENVLVQTKRQSRKNT  206
             I  K + E ++V TKRQSR+NT
Sbjct  729  MIG-KLENEVIIVPTKRQSRRNT  750



>ref|XP_010448929.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Camelina sativa]
 ref|XP_010448930.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Camelina sativa]
 ref|XP_010448931.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Camelina sativa]
 ref|XP_010448932.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Camelina sativa]
 ref|XP_010448933.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Camelina sativa]
 ref|XP_010448934.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Camelina sativa]
Length=771

 Score =   207 bits (526),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 101/143 (71%), Positives = 118/143 (83%), Gaps = 0/143 (0%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQEYESAAAFWPDVHGR+I AL+ SQ+  +GLL TKHAA +APFLI LPVLTI 
Sbjct  608  QIINVYNQEYESAAAFWPDVHGRVIAALVISQLLLMGLLGTKHAALAAPFLIALPVLTIG  667

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            FH +CKGRYE AF ++PLQEA MKDTLE AREPN NLK YLQ +YIHPVFKG+E++ D D
Sbjct  668  FHHFCKGRYEPAFIRYPLQEAMMKDTLETAREPNLNLKGYLQTSYIHPVFKGDEEDDDID  727

Query  274  GISEKADEENVLVQTKRQSRKNT  206
                K ++E ++V TKRQSR+NT
Sbjct  728  DKLGKFEDEAIIVPTKRQSRRNT  750



>ref|XP_009357605.1| PREDICTED: calcium permeable stress-gated cation channel 1 [Pyrus 
x bretschneideri]
Length=771

 Score =   206 bits (525),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 102/143 (71%), Positives = 116/143 (81%), Gaps = 2/143 (1%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQEYESAAAFWPDVHGRII ALI SQ+   GLLSTK AA S PFLI LPVLT+ 
Sbjct  608  QIINVYNQEYESAAAFWPDVHGRIITALIISQLLLFGLLSTKKAASSTPFLIALPVLTLW  667

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            F  YCKGR+E AFT +PLQEA MKDTLE+AREPN NLK YLQ AYIHPVF+  ++E D++
Sbjct  668  FRSYCKGRFEPAFTTYPLQEAMMKDTLERAREPNLNLKGYLQSAYIHPVFQECDEEEDHE  727

Query  274  GISEKADEENVLVQTKRQSRKNT  206
               EK + E+V+V TKRQSR+NT
Sbjct  728  --FEKDESESVIVPTKRQSRRNT  748



>ref|XP_011002577.1| PREDICTED: calcium permeable stress-gated cation channel 1 [Populus 
euphratica]
Length=772

 Score =   206 bits (525),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 102/143 (71%), Positives = 119/143 (83%), Gaps = 1/143 (1%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQEYES AAFWPDVHGR+I AL+ SQ++ LGL+STK AAQSAPFLI LPVLTI 
Sbjct  608  QIINVYNQEYESGAAFWPDVHGRVITALVISQLALLGLMSTKEAAQSAPFLIALPVLTIW  667

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            FH +  GR++SAF K+PLQEA MKDTLE+AR+PNFNLK YLQDAYIHPVFK    + + D
Sbjct  668  FHSFSNGRHKSAFVKYPLQEAMMKDTLERARDPNFNLKAYLQDAYIHPVFK-GGGDDEDD  726

Query  274  GISEKADEENVLVQTKRQSRKNT  206
             +S+  + E+VLV TKRQSRKNT
Sbjct  727  DLSKILETESVLVPTKRQSRKNT  749



>ref|NP_001291223.1| calcium permeable stress-gated cation channel 1 [Populus euphratica]
 gb|AEL95439.1| early-responsive to dehydration-related protein [Populus euphratica]
Length=772

 Score =   206 bits (525),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 102/143 (71%), Positives = 119/143 (83%), Gaps = 1/143 (1%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQEYES AAFWPDVHGR+I AL+ SQ++ LGL+STK AAQSAPFLI LPVLTI 
Sbjct  608  QIINVYNQEYESGAAFWPDVHGRVITALVISQLALLGLMSTKEAAQSAPFLIALPVLTIW  667

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            FH +  GR++SAF K+PLQEA MKDTLE+AR+PNFNLK YLQDAYIHPVFK    + + D
Sbjct  668  FHSFSNGRHKSAFVKYPLQEAMMKDTLERARDPNFNLKAYLQDAYIHPVFK-GGGDDEDD  726

Query  274  GISEKADEENVLVQTKRQSRKNT  206
             +S+  + E+VLV TKRQSRKNT
Sbjct  727  DLSKILETESVLVPTKRQSRKNT  749



>gb|KDP30779.1| hypothetical protein JCGZ_13722 [Jatropha curcas]
Length=770

 Score =   206 bits (525),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 99/143 (69%), Positives = 120/143 (84%), Gaps = 1/143 (1%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQ YESAAA+WPDVHGRII AL+ SQ+  +GLLSTKHAAQS P L+ LPVLTI 
Sbjct  604  QIINVYNQAYESAAAYWPDVHGRIIVALVVSQLLLMGLLSTKHAAQSTPLLVTLPVLTIW  663

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            FHL+CKGRYE AF ++PLQEA MKDTLE+AREPN NLK + Q+AYIHPVF G +D  D++
Sbjct  664  FHLFCKGRYEPAFVRYPLQEAMMKDTLERAREPNLNLKSFFQNAYIHPVFNGGDDS-DHE  722

Query  274  GISEKADEENVLVQTKRQSRKNT  206
             ++E+ ++E VLV T+RQSR+NT
Sbjct  723  EVTEELEKEPVLVPTRRQSRRNT  745



>emb|CDY19541.1| BnaC09g13620D [Brassica napus]
Length=779

 Score =   206 bits (525),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 100/145 (69%), Positives = 121/145 (83%), Gaps = 2/145 (1%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQEYESAAA+WPDVHGRII ALI SQ+  +GL+STK  AQS PFL++LP+LTI 
Sbjct  607  QIINVYNQEYESAAAYWPDVHGRIISALIISQILLIGLMSTKGKAQSTPFLVILPILTIG  666

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYD-Y  278
            FH +CKGRYESAF  +PLQE+ +KDTLE+AREPN NLK +LQ+AYIHPVFK  E E D Y
Sbjct  667  FHRFCKGRYESAFVVNPLQESMIKDTLERAREPNLNLKGFLQNAYIHPVFKDEECEDDQY  726

Query  277  DGISEKADEEN-VLVQTKRQSRKNT  206
            + ++E +D+EN V+V TKRQSR+ T
Sbjct  727  EELNEDSDDENCVVVPTKRQSRRTT  751



>ref|XP_006348154.1| PREDICTED: uncharacterized protein RSN1-like isoform X2 [Solanum 
tuberosum]
Length=703

 Score =   206 bits (523),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 123/165 (75%), Positives = 140/165 (85%), Gaps = 1/165 (1%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQEYESAAAFWPDVHGRIIFAL FSQ+S LGLL TKHA QSAPFLI LPVLTI+
Sbjct  540  QIINVYNQEYESAAAFWPDVHGRIIFALCFSQLSLLGLLGTKHATQSAPFLIALPVLTIS  599

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            FHLYCKGRYE AFTK+P+QEA+M+DTLEQAREPN NLK YLQ+AY+HPVFK ++++ D D
Sbjct  600  FHLYCKGRYEPAFTKYPIQEARMRDTLEQAREPNLNLKGYLQNAYVHPVFKDDDEDEDED  659

Query  274  GISEKADEENVLVQTKRQSRKNTpapskgsggsspSFRVEVIHEK  140
             +  K + ++VLV TKRQSR NTP PSK S GSSPS    VIHE+
Sbjct  660  FMM-KLETDSVLVPTKRQSRMNTPVPSKVSAGSSPSLPDVVIHEQ  703



>ref|XP_007211353.1| hypothetical protein PRUPE_ppa001728mg [Prunus persica]
 gb|EMJ12552.1| hypothetical protein PRUPE_ppa001728mg [Prunus persica]
Length=773

 Score =   206 bits (525),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 98/143 (69%), Positives = 116/143 (81%), Gaps = 1/143 (1%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQEYESAAAFWPDVHGR++ ALI SQ+   GLLSTK AAQS PFLI LPVLTI 
Sbjct  608  QIINVYNQEYESAAAFWPDVHGRVVSALIISQLLLFGLLSTKRAAQSTPFLIALPVLTIW  667

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            F+ YCKGR+E AF  +PLQEA MKDTLE+A+EPN NLK YLQ AY+HPVF+  +D+ D +
Sbjct  668  FYRYCKGRFEPAFVTYPLQEAMMKDTLERAKEPNLNLKGYLQSAYVHPVFRDCDDDEDNE  727

Query  274  GISEKADEENVLVQTKRQSRKNT  206
             I +K + E+V+V TKR SR+NT
Sbjct  728  SI-DKGENESVIVPTKRHSRRNT  749



>ref|XP_008224710.1| PREDICTED: uncharacterized membrane protein C2G11.09-like [Prunus 
mume]
Length=773

 Score =   206 bits (525),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 98/143 (69%), Positives = 116/143 (81%), Gaps = 1/143 (1%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQEYESAAAFWPDVHGR++ ALI SQ+   GLLSTK AAQS PFLI LPVLTI 
Sbjct  608  QIINVYNQEYESAAAFWPDVHGRVVSALIISQLLLFGLLSTKEAAQSTPFLIALPVLTIW  667

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            F+ YCKGR+E AF  +PLQEA MKDTLE+A+EPN NLK YLQ AY+HPVF+  +D+ D +
Sbjct  668  FYRYCKGRFEPAFVTYPLQEAMMKDTLERAKEPNLNLKGYLQSAYVHPVFRDCDDDEDNE  727

Query  274  GISEKADEENVLVQTKRQSRKNT  206
             I +K + E+V+V TKR SR+NT
Sbjct  728  SI-DKGENESVIVPTKRHSRRNT  749



>ref|XP_003549667.1| PREDICTED: uncharacterized membrane protein C2G11.09 isoform 
X1 [Glycine max]
 ref|XP_006600300.1| PREDICTED: uncharacterized membrane protein C2G11.09 isoform 
X2 [Glycine max]
 gb|KHN03500.1| Putative membrane protein C2G11.09 [Glycine soja]
Length=775

 Score =   206 bits (525),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 100/146 (68%), Positives = 119/146 (82%), Gaps = 4/146 (3%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQEYES AAFWPDVH R+I ALI SQ+  +GLL+TK AA S PFLIVLPVLTI 
Sbjct  606  QIINVYNQEYESGAAFWPDVHFRVIIALIVSQIVLMGLLTTKKAASSTPFLIVLPVLTIW  665

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKG---NEDEY  284
            FH+YCKGR+E AF ++PLQEA MKDTLE+A +PNFNLK YLQ+AY+HPVFK    +EDE 
Sbjct  666  FHIYCKGRFEPAFVRYPLQEAMMKDTLERATDPNFNLKAYLQNAYVHPVFKASLFDEDE-  724

Query  283  DYDGISEKADEENVLVQTKRQSRKNT  206
            D + +S K + E++ V TKRQSR+NT
Sbjct  725  DEEVMSLKLETESLTVPTKRQSRRNT  750



>gb|KDP20707.1| hypothetical protein JCGZ_21178 [Jatropha curcas]
Length=694

 Score =   205 bits (522),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 101/145 (70%), Positives = 118/145 (81%), Gaps = 2/145 (1%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQEYESAAA+WPDVHGR++ ALI SQV  +GLLSTK AA S PFLI LP+LTI 
Sbjct  526  QIINVYNQEYESAAAYWPDVHGRVVTALIISQVLMIGLLSTKRAALSTPFLIALPILTIW  585

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            FH +CKGRYE AF K+PLQEA M+DTLE+AREPN NLK YLQ+AY HPVFK  +D  + +
Sbjct  586  FHRFCKGRYEPAFVKYPLQEAMMRDTLERAREPNLNLKGYLQNAYAHPVFKEADDGDEDE  645

Query  274  G--ISEKADEENVLVQTKRQSRKNT  206
               +SEK + E+VLV TKRQSR+NT
Sbjct  646  DEILSEKLESESVLVPTKRQSRRNT  670



>ref|XP_010458617.1| PREDICTED: CSC1-like protein At1g11960 [Camelina sativa]
Length=772

 Score =   206 bits (524),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 103/150 (69%), Positives = 119/150 (79%), Gaps = 9/150 (6%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQEYES A FWPDVHGRII ALI SQV  +GLLSTK AAQS PFL+VLP+LT  
Sbjct  607  QIINVYNQEYESGARFWPDVHGRIISALIISQVLLMGLLSTKGAAQSTPFLLVLPILTFF  666

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYD--  281
            FH +CKGRYE AF +HPL++A +KDTLE+AREPNFNLKPYLQ AYIHPVF+  +D Y+  
Sbjct  667  FHRFCKGRYEPAFLRHPLKDAMVKDTLEKAREPNFNLKPYLQKAYIHPVFR--DDHYEDS  724

Query  280  -YDGIS----EKADEENVLVQTKRQSRKNT  206
             +D +S    E +D+E V V TKRQSR NT
Sbjct  725  RFDDMSSYCVEDSDDECVTVPTKRQSRLNT  754



>ref|XP_010546606.1| PREDICTED: CSC1-like protein At1g11960 [Tarenaya hassleriana]
 ref|XP_010546613.1| PREDICTED: CSC1-like protein At1g11960 [Tarenaya hassleriana]
 ref|XP_010546622.1| PREDICTED: CSC1-like protein At1g11960 [Tarenaya hassleriana]
 ref|XP_010546631.1| PREDICTED: CSC1-like protein At1g11960 [Tarenaya hassleriana]
Length=776

 Score =   206 bits (524),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 97/144 (67%), Positives = 117/144 (81%), Gaps = 2/144 (1%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQEYES AA+WPDVHGRII ALI SQ+  +GL+STK AAQS PFLI LP+LT+ 
Sbjct  607  QIINVYNQEYESGAAYWPDVHGRIITALIISQILLMGLMSTKKAAQSTPFLIALPILTLG  666

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKG-NEDEYDY  278
            FH +CKGRYE AF ++PLQEA +KDTLE+AREPN +LKPYLQ AYIHPVFK   ED +D 
Sbjct  667  FHRFCKGRYEPAFIRYPLQEAMIKDTLERAREPNLDLKPYLQKAYIHPVFKDEGEDRFD-  725

Query  277  DGISEKADEENVLVQTKRQSRKNT  206
            D + +  D++ ++V TKRQSR+ T
Sbjct  726  DMLEKSEDDKCLIVPTKRQSRRTT  749



>ref|XP_009108550.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Brassica rapa]
 ref|XP_009108551.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Brassica rapa]
Length=774

 Score =   206 bits (524),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 104/146 (71%), Positives = 119/146 (82%), Gaps = 3/146 (2%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQEYESAAAFWPDVHGR+I ALI SQV  +GLL TKHAA +APFLI LPVLTI 
Sbjct  608  QIINVYNQEYESAAAFWPDVHGRVIAALIISQVLLMGLLGTKHAALAAPFLIALPVLTIG  667

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            FH +CKGRYE AF ++PLQEAKMKDTLE AREPN NLK YLQ AY+HPVFKG ED+ D +
Sbjct  668  FHRFCKGRYEPAFVRYPLQEAKMKDTLESAREPNLNLKGYLQSAYVHPVFKGGEDDDDDE  727

Query  274  GISEKA---DEENVLVQTKRQSRKNT  206
               +K    ++E ++V TKRQSR+NT
Sbjct  728  YGDDKLGKFEDEAIIVPTKRQSRRNT  753



>ref|XP_004243535.1| PREDICTED: CSC1-like protein At3g21620 [Solanum lycopersicum]
 ref|XP_010323863.1| PREDICTED: CSC1-like protein At3g21620 [Solanum lycopersicum]
Length=767

 Score =   206 bits (523),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 99/143 (69%), Positives = 114/143 (80%), Gaps = 1/143 (1%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQEYESAAAFWPDVHGRII ALI SQ+  +GLLSTK A++S P LI LP+LTI 
Sbjct  604  QIINVYNQEYESAAAFWPDVHGRIITALIVSQLLLMGLLSTKEASKSTPLLITLPILTIW  663

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            FH++CKGR+E AF ++PLQE   KDTLE+ +EPNFNLK +LQ+AYIHPVFKG  D  + D
Sbjct  664  FHIFCKGRFEPAFVRYPLQETVRKDTLERTKEPNFNLKEFLQNAYIHPVFKGEVDS-EID  722

Query  274  GISEKADEENVLVQTKRQSRKNT  206
              SE  D E  LVQTKRQSR NT
Sbjct  723  AASEDGDLEPSLVQTKRQSRFNT  745



>ref|XP_011046982.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
isoform X2 [Populus euphratica]
Length=672

 Score =   205 bits (521),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 94/146 (64%), Positives = 118/146 (81%), Gaps = 3/146 (2%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQEYES AAFWP VHGR+I AL+ +Q+  +GLLSTK A+ S PFLI LPVLTI 
Sbjct  505  QIINVYNQEYESGAAFWPAVHGRVITALVIAQLLMMGLLSTKQASSSTPFLIALPVLTIW  564

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            FH++C GRY+SAF K+PLQEA MKD+LE+A  PNFN K YL+ AY+HPVFKGN ++ DY+
Sbjct  565  FHVFCNGRYKSAFVKYPLQEAMMKDSLERASSPNFNFKSYLEKAYVHPVFKGNGNDDDYE  624

Query  274  ---GISEKADEENVLVQTKRQSRKNT  206
                 +++AD ENVLV T+RQS++N+
Sbjct  625  QYLSENQEADAENVLVPTRRQSQRNS  650



>ref|XP_006348153.1| PREDICTED: uncharacterized protein RSN1-like isoform X1 [Solanum 
tuberosum]
Length=767

 Score =   206 bits (523),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 123/165 (75%), Positives = 140/165 (85%), Gaps = 1/165 (1%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQEYESAAAFWPDVHGRIIFAL FSQ+S LGLL TKHA QSAPFLI LPVLTI+
Sbjct  604  QIINVYNQEYESAAAFWPDVHGRIIFALCFSQLSLLGLLGTKHATQSAPFLIALPVLTIS  663

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            FHLYCKGRYE AFTK+P+QEA+M+DTLEQAREPN NLK YLQ+AY+HPVFK ++++ D D
Sbjct  664  FHLYCKGRYEPAFTKYPIQEARMRDTLEQAREPNLNLKGYLQNAYVHPVFKDDDEDEDED  723

Query  274  GISEKADEENVLVQTKRQSRKNTpapskgsggsspSFRVEVIHEK  140
             +  K + ++VLV TKRQSR NTP PSK S GSSPS    VIHE+
Sbjct  724  FMM-KLETDSVLVPTKRQSRMNTPVPSKVSAGSSPSLPDVVIHEQ  767



>ref|XP_010450765.1| PREDICTED: protein OSCA1-like [Camelina sativa]
Length=183

 Score =   192 bits (489),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 96/143 (67%), Positives = 114/143 (80%), Gaps = 1/143 (1%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQEYESAAAFWPDVHGR+I ALI SQ+  + LL+TK AA +APFLI LPV+TI 
Sbjct  20   QIINVYNQEYESAAAFWPDVHGRVISALIISQLLLMDLLATKRAALAAPFLIALPVITIG  79

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            FH + KGRYE AF ++PL+EA MKDTLE+AREPN NLK YLQDAYIHPVFK   D+ D  
Sbjct  80   FHRFSKGRYEPAFIRYPLEEAMMKDTLERAREPNLNLKGYLQDAYIHPVFK-GGDDDDDS  138

Query  274  GISEKADEENVLVQTKRQSRKNT  206
             +  K ++E ++V TKRQ R+NT
Sbjct  139  DVVGKLEDEVIIVPTKRQLRRNT  161



>ref|XP_008229991.1| PREDICTED: uncharacterized membrane protein C2G11.09 [Prunus 
mume]
Length=769

 Score =   205 bits (522),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 100/143 (70%), Positives = 117/143 (82%), Gaps = 1/143 (1%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQEYESAAAFWPDVHGRII ALI SQ+  +GLLSTK AAQS P LI LPVLTI 
Sbjct  604  QIINVYNQEYESAAAFWPDVHGRIITALIISQLLLMGLLSTKEAAQSTPLLITLPVLTIW  663

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            FH +CKG YE AF ++PLQEA MKDTLE+A EPN NLK +LQ+AYIHPVFKG ED+ + +
Sbjct  664  FHRFCKGCYEPAFIRYPLQEAMMKDTLERATEPNLNLKSFLQNAYIHPVFKG-EDDGENE  722

Query  274  GISEKADEENVLVQTKRQSRKNT  206
              +E+ ++E  +V TKRQSR+NT
Sbjct  723  TAAEECEKEPAVVPTKRQSRRNT  745



>ref|XP_010686787.1| PREDICTED: calcium permeable stress-gated cation channel 1 [Beta 
vulgaris subsp. vulgaris]
 ref|XP_010686788.1| PREDICTED: calcium permeable stress-gated cation channel 1 [Beta 
vulgaris subsp. vulgaris]
Length=764

 Score =   205 bits (521),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 97/143 (68%), Positives = 115/143 (80%), Gaps = 3/143 (2%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQEYESAAAFWP VHGRII A++FSQ+  +GL+ TK AA S+PFLI LP+LTI 
Sbjct  604  QIINVYNQEYESAAAFWPSVHGRIISAMVFSQLLLMGLIGTKKAASSSPFLIALPILTIW  663

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            FH +CKGR+E AF  +PLQEA MKDTLE+AR+PNFNLK YLQ+AYIHPVFK  +D+   D
Sbjct  664  FHRFCKGRFEPAFKTYPLQEAMMKDTLERARDPNFNLKGYLQNAYIHPVFKSEDDD---D  720

Query  274  GISEKADEENVLVQTKRQSRKNT  206
             I  K + E  LV T+RQSR+NT
Sbjct  721  IIQNKLEMETELVPTRRQSRRNT  743



>ref|XP_002872689.1| hypothetical protein ARALYDRAFT_911697 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48948.1| hypothetical protein ARALYDRAFT_911697 [Arabidopsis lyrata subsp. 
lyrata]
Length=771

 Score =   205 bits (521),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 100/143 (70%), Positives = 115/143 (80%), Gaps = 2/143 (1%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQEYESAAAFWPDVHGR+I ALI SQ+  +GLL TKHAA +APFLI LPV+TI 
Sbjct  609  QIINVYNQEYESAAAFWPDVHGRVITALIISQLLLMGLLGTKHAAFAAPFLIALPVITIG  668

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            FH +CKGRYE AF ++PLQEA MKDTLE+AREPN NLK YLQDAYIHPVFK    + D  
Sbjct  669  FHRFCKGRYEPAFIRYPLQEAMMKDTLERAREPNLNLKGYLQDAYIHPVFK--GGDDDDG  726

Query  274  GISEKADEENVLVQTKRQSRKNT  206
             +  K + E ++V TKRQSR+NT
Sbjct  727  DMIGKLENEVIIVPTKRQSRRNT  749



>emb|CDY30043.1| BnaC05g09770D [Brassica napus]
Length=768

 Score =   205 bits (521),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 106/150 (71%), Positives = 116/150 (77%), Gaps = 10/150 (7%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQEYESA  FWPDVHGRII ALI SQV  LGL+STK AAQS PFL+ LPVLT  
Sbjct  607  QIINVYNQEYESAGRFWPDVHGRIISALIISQVLLLGLMSTKGAAQSTPFLVALPVLTFF  666

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            FH +CKGRYE AF +HPLQEA +KDTLEQAREPNFNLKPYL+ AYIHPVFK  +DEY+ D
Sbjct  667  FHRFCKGRYEPAFLRHPLQEAMIKDTLEQAREPNFNLKPYLKKAYIHPVFK--DDEYE-D  723

Query  274  GISEKA-------DEENVLVQTKRQSRKNT  206
              SE +       D+E V V TKRQSR  T
Sbjct  724  VRSEVSGYYLGDTDDECVTVPTKRQSRITT  753



>ref|XP_004507664.1| PREDICTED: uncharacterized membrane protein YLR241W-like [Cicer 
arietinum]
Length=773

 Score =   204 bits (520),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 96/144 (67%), Positives = 116/144 (81%), Gaps = 1/144 (1%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            Q+INVYNQ+YESAAAFWPDVH R++ ALI SQ+  +GLL+TK AA S PFLIVLP+LTI 
Sbjct  606  QMINVYNQQYESAAAFWPDVHVRVVIALIVSQLVLMGLLTTKKAASSTPFLIVLPILTIW  665

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYD-Y  278
            FH YCKGR+ESAF K+PLQEA MKDTLE+A +PN N+K YLQ AY+HPVFK ++D+ D  
Sbjct  666  FHRYCKGRFESAFVKYPLQEAMMKDTLEKATDPNLNIKGYLQHAYVHPVFKASQDDVDEE  725

Query  277  DGISEKADEENVLVQTKRQSRKNT  206
            D IS K + E+  V TKR SR+NT
Sbjct  726  DAISLKWETESATVPTKRHSRRNT  749



>ref|XP_011046979.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
isoform X1 [Populus euphratica]
 ref|XP_011046980.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
isoform X1 [Populus euphratica]
 ref|XP_011046981.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
isoform X1 [Populus euphratica]
Length=775

 Score =   204 bits (520),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 94/146 (64%), Positives = 118/146 (81%), Gaps = 3/146 (2%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQEYES AAFWP VHGR+I AL+ +Q+  +GLLSTK A+ S PFLI LPVLTI 
Sbjct  608  QIINVYNQEYESGAAFWPAVHGRVITALVIAQLLMMGLLSTKQASSSTPFLIALPVLTIW  667

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            FH++C GRY+SAF K+PLQEA MKD+LE+A  PNFN K YL+ AY+HPVFKGN ++ DY+
Sbjct  668  FHVFCNGRYKSAFVKYPLQEAMMKDSLERASSPNFNFKSYLEKAYVHPVFKGNGNDDDYE  727

Query  274  GI---SEKADEENVLVQTKRQSRKNT  206
                 +++AD ENVLV T+RQS++N+
Sbjct  728  QYLSENQEADAENVLVPTRRQSQRNS  753



>gb|AAL07154.1| unknown protein [Arabidopsis thaliana]
Length=772

 Score =   204 bits (520),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 101/143 (71%), Positives = 118/143 (83%), Gaps = 1/143 (1%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQEYESAAAFWPDVHGR+I ALI SQ+  +GLL TKHAA +APFLI LPV+T  
Sbjct  609  QIINVYNQEYESAAAFWPDVHGRVITALIISQLLLMGLLGTKHAASAAPFLIALPVITTG  668

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            FH +CKGR+E AF ++PLQEA MKDTLE+AREPN NLK YLQDAYIHPVFKG +++ D D
Sbjct  669  FHRFCKGRFEPAFVRYPLQEAMMKDTLERAREPNLNLKGYLQDAYIHPVFKGGDNDDDGD  728

Query  274  GISEKADEENVLVQTKRQSRKNT  206
             I  K + E ++V TKRQSR+NT
Sbjct  729  MIG-KLENEVIIVPTKRQSRRNT  750



>ref|XP_004232686.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Solanum lycopersicum]
 ref|XP_010316569.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Solanum lycopersicum]
 ref|XP_010316570.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Solanum lycopersicum]
Length=767

 Score =   204 bits (520),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 110/143 (77%), Positives = 126/143 (88%), Gaps = 1/143 (1%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQEYESAAAFWPDVHGRIIFAL FSQ+S LGLLSTKHA QSAPFLI LPVLTI+
Sbjct  604  QIINVYNQEYESAAAFWPDVHGRIIFALCFSQLSLLGLLSTKHATQSAPFLIALPVLTIS  663

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            FHLYCKGRYE AFTK+P+QEA+M+DTLEQAREPN NLK YLQ+AY+HPVFK ++++ D D
Sbjct  664  FHLYCKGRYEPAFTKYPIQEARMRDTLEQAREPNLNLKGYLQNAYVHPVFKDDDEDEDED  723

Query  274  GISEKADEENVLVQTKRQSRKNT  206
             +  K + ++VLV TKRQSR NT
Sbjct  724  FMM-KLENDSVLVPTKRQSRMNT  745



>ref|XP_006306821.1| hypothetical protein CARUB_v10008363mg [Capsella rubella]
 gb|EOA39719.1| hypothetical protein CARUB_v10008363mg [Capsella rubella]
Length=771

 Score =   204 bits (519),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 100/148 (68%), Positives = 118/148 (80%), Gaps = 5/148 (3%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQEYES A FWPDVHGRII AL+ SQV  +GL+STK AAQS PFL+VLP+LT  
Sbjct  607  QIINVYNQEYESGARFWPDVHGRIISALMISQVLLMGLMSTKGAAQSTPFLLVLPILTFF  666

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNE-DEYDY  278
            FH +CKGRYE AF +HPL+EA +KDTLE+AR+P FNLKPYLQ AYIHPVF+ +  ++  +
Sbjct  667  FHRFCKGRYEPAFLRHPLKEAMVKDTLEKARDPYFNLKPYLQKAYIHPVFRDDHFEDSRF  726

Query  277  DGIS----EKADEENVLVQTKRQSRKNT  206
            D IS    E +DE+ V V TKRQSRKNT
Sbjct  727  DEISSYRAEDSDEDCVTVPTKRQSRKNT  754



>emb|CDY27443.1| BnaC03g64830D [Brassica napus]
Length=775

 Score =   204 bits (518),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 104/147 (71%), Positives = 119/147 (81%), Gaps = 4/147 (3%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQEYESAAAFWPDVHGR+I AL+ SQV  +GLL TKHAA +APFLI LPVLTI 
Sbjct  608  QIINVYNQEYESAAAFWPDVHGRVIAALMISQVLLMGLLGTKHAALAAPFLIALPVLTIG  667

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            FH +CKGRYE AF ++PLQEAKMKDTLE AREPN NLK YLQ AY+HPVFKG ED+ D D
Sbjct  668  FHRFCKGRYEPAFVRYPLQEAKMKDTLESAREPNLNLKGYLQSAYVHPVFKGGEDDDDDD  727

Query  274  GISE----KADEENVLVQTKRQSRKNT  206
               +    K ++E ++V TKRQSR+NT
Sbjct  728  DYGDDKLGKFEDEAIIVPTKRQSRRNT  754



>ref|XP_007026161.1| ERD (early-responsive to dehydration stress) family protein isoform 
1 [Theobroma cacao]
 gb|EOY28783.1| ERD (early-responsive to dehydration stress) family protein isoform 
1 [Theobroma cacao]
Length=771

 Score =   204 bits (518),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 101/143 (71%), Positives = 117/143 (82%), Gaps = 1/143 (1%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQEYESAAAFWPDVHGRII AL+ SQ++ +GLLST  AAQS PFLI L VLTI 
Sbjct  606  QIINVYNQEYESAAAFWPDVHGRIIIALLISQITLIGLLSTMQAAQSTPFLIALAVLTIW  665

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            F+ +CK RYE AF ++PLQEA MKDTLE+AREPN NLKPYL +AY+HPVFK  ED+ D D
Sbjct  666  FYRFCKARYEPAFVRYPLQEAMMKDTLERAREPNLNLKPYLHNAYVHPVFK-EEDDDDGD  724

Query  274  GISEKADEENVLVQTKRQSRKNT  206
                K++ E+VLV TKRQSR+NT
Sbjct  725  DFMFKSENESVLVPTKRQSRRNT  747



>ref|XP_010035539.1| PREDICTED: CSC1-like protein At3g21620 [Eucalyptus grandis]
 ref|XP_010035541.1| PREDICTED: CSC1-like protein At3g21620 [Eucalyptus grandis]
 gb|KCW46963.1| hypothetical protein EUGRSUZ_K00773 [Eucalyptus grandis]
Length=756

 Score =   203 bits (517),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 101/143 (71%), Positives = 112/143 (78%), Gaps = 1/143 (1%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQEYESAAAFWPDVHGRIIFA+I SQ+  +GLLSTK AAQS P LI LPVLTI 
Sbjct  604  QIINVYNQEYESAAAFWPDVHGRIIFAMIISQLLLMGLLSTKEAAQSTPLLITLPVLTIG  663

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            FHL+CKGRYE AF ++PLQEA MKDTLE+ REPN NLK +LQ AYIHPVFK  +D     
Sbjct  664  FHLFCKGRYEPAFRRYPLQEAMMKDTLEKVREPNLNLKGFLQTAYIHPVFKEGDDSDSDS  723

Query  274  GISEKADEENVLVQTKRQSRKNT  206
               E   EE VLV TKR SR++T
Sbjct  724  ATDEIV-EEPVLVPTKRHSRRST  745



>ref|XP_006350470.1| PREDICTED: uncharacterized membrane protein C2G11.09-like [Solanum 
tuberosum]
Length=767

 Score =   203 bits (517),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 98/149 (66%), Positives = 124/149 (83%), Gaps = 1/149 (1%)
 Frame = -3

Query  649  FCLTLQIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLP  470
            F    QIINVY+Q+YES AAFWPDVHGRIIFAL+FSQ+S LGLLSTK AAQSAPFLI LP
Sbjct  599  FVFRHQIINVYHQKYESGAAFWPDVHGRIIFALVFSQISLLGLLSTKRAAQSAPFLIALP  658

Query  469  VLTITFHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNED  290
            VLT++FH +CKGRYE AFT++PLQEAK KDT+EQA+E   NLK YLQ+AY+HPVF+G+++
Sbjct  659  VLTLSFHYFCKGRYEPAFTRYPLQEAKRKDTIEQAKESKLNLKYYLQNAYLHPVFRGDDE  718

Query  289  EYDYDGISEKADEEN-VLVQTKRQSRKNT  206
            + + + +++K +  + VL+  KRQSR NT
Sbjct  719  DDNEEELNDKLESNDIVLIPMKRQSRGNT  747



>ref|XP_010539247.1| PREDICTED: calcium permeable stress-gated cation channel 1 [Tarenaya 
hassleriana]
 ref|XP_010539248.1| PREDICTED: calcium permeable stress-gated cation channel 1 [Tarenaya 
hassleriana]
Length=771

 Score =   202 bits (515),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 106/143 (74%), Positives = 119/143 (83%), Gaps = 0/143 (0%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQEYES AAFWPDVHGRII ALI SQ+  LGLL TKHAA SAPFLI LPVLT+ 
Sbjct  608  QIINVYNQEYESGAAFWPDVHGRIIAALIISQLLLLGLLGTKHAAMSAPFLIALPVLTLG  667

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            FH +CKGR+E AF K+PLQEA MKDTLE+AREPN NLK YLQ+AYIHPVFKG+ED+ D D
Sbjct  668  FHRFCKGRFEPAFVKYPLQEAMMKDTLERAREPNLNLKGYLQNAYIHPVFKGDEDDDDID  727

Query  274  GISEKADEENVLVQTKRQSRKNT  206
             +  K ++E V V TKRQSR+NT
Sbjct  728  DMFGKLEDEAVTVPTKRQSRRNT  750



>ref|XP_009134294.1| PREDICTED: CSC1-like protein At4g04340 [Brassica rapa]
 ref|XP_009134295.1| PREDICTED: CSC1-like protein At4g04340 [Brassica rapa]
 ref|XP_009134297.1| PREDICTED: CSC1-like protein At4g04340 [Brassica rapa]
Length=768

 Score =   202 bits (515),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 98/143 (69%), Positives = 117/143 (82%), Gaps = 0/143 (0%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQEYESAAAFWPDVHGRII AL+ SQ+  +GLL TK AA +APF+I LPV+TI 
Sbjct  604  QIINVYNQEYESAAAFWPDVHGRIITALVISQLLLMGLLVTKRAALAAPFIIALPVITIG  663

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            FH +CKGRYE AF ++PLQEA MKDTLE+A+EPN NLK YLQ+AYIHPVFKG + + D D
Sbjct  664  FHRFCKGRYEPAFVRYPLQEAMMKDTLERAKEPNLNLKGYLQEAYIHPVFKGGDGDDDDD  723

Query  274  GISEKADEENVLVQTKRQSRKNT  206
             +  K + E ++V TKRQSR+NT
Sbjct  724  SVLGKLEGEVIIVPTKRQSRRNT  746



>emb|CDX90856.1| BnaA03g25360D [Brassica napus]
Length=768

 Score =   202 bits (515),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 98/143 (69%), Positives = 117/143 (82%), Gaps = 0/143 (0%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQEYESAAAFWPDVHGRII AL+ SQ+  +GLL TK AA +APF+I LPV+TI 
Sbjct  604  QIINVYNQEYESAAAFWPDVHGRIITALVISQLLLMGLLVTKRAALAAPFIIALPVITIG  663

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            FH +CKGRYE AF ++PLQEA MKDTLE+A+EPN NLK YLQ+AYIHPVFKG + + D D
Sbjct  664  FHRFCKGRYEPAFVRYPLQEAMMKDTLERAKEPNLNLKGYLQEAYIHPVFKGGDGDDDDD  723

Query  274  GISEKADEENVLVQTKRQSRKNT  206
             +  K + E ++V TKRQSR+NT
Sbjct  724  SVLGKLEGEVIIVPTKRQSRRNT  746



>ref|XP_006363038.1| PREDICTED: uncharacterized protein RSN1-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006363039.1| PREDICTED: uncharacterized protein RSN1-like isoform X2 [Solanum 
tuberosum]
 ref|XP_006363040.1| PREDICTED: uncharacterized protein RSN1-like isoform X3 [Solanum 
tuberosum]
Length=768

 Score =   202 bits (514),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 97/143 (68%), Positives = 114/143 (80%), Gaps = 1/143 (1%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQEYESAAAFWPDVHGRII ALI SQ+  +GLLSTK A++S P LI LP+LTI 
Sbjct  604  QIINVYNQEYESAAAFWPDVHGRIITALIVSQLLLMGLLSTKEASKSTPLLITLPILTIW  663

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            FH++CKGRYE AF ++PLQE   KDTL++ +EPNF+LK +LQ+AYIHPVFKG  D  + D
Sbjct  664  FHIFCKGRYEPAFVRYPLQETVRKDTLDRTKEPNFDLKEFLQNAYIHPVFKGEVDS-EID  722

Query  274  GISEKADEENVLVQTKRQSRKNT  206
              SE  + E  LVQTKRQSR NT
Sbjct  723  AASEDGELEPSLVQTKRQSRFNT  745



>ref|XP_007153987.1| hypothetical protein PHAVU_003G081500g [Phaseolus vulgaris]
 gb|ESW25981.1| hypothetical protein PHAVU_003G081500g [Phaseolus vulgaris]
Length=774

 Score =   202 bits (513),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 103/146 (71%), Positives = 118/146 (81%), Gaps = 4/146 (3%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQEYES AAFWPDVH RII ALI SQ+  +GLL+TK AA S PFLIVLP+LTI 
Sbjct  606  QIINVYNQEYESGAAFWPDVHFRIILALIVSQIVLMGLLTTKKAASSTPFLIVLPILTIW  665

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFK---GNEDEY  284
            FH YCKGR+ESAF K+PLQEA MKDTLE+A EPN NLK YLQ+AY+HPVFK   G +D+ 
Sbjct  666  FHRYCKGRFESAFVKYPLQEAMMKDTLERATEPNLNLKAYLQNAYVHPVFKASLGEDDDE  725

Query  283  DYDGISEKADEENVLVQTKRQSRKNT  206
            D + IS K + E++ V TKRQSRKNT
Sbjct  726  DEEAISLKWETESI-VPTKRQSRKNT  750



>ref|XP_006383870.1| early-responsive to dehydration family protein [Populus trichocarpa]
 gb|ERP61667.1| early-responsive to dehydration family protein [Populus trichocarpa]
Length=775

 Score =   202 bits (513),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 93/146 (64%), Positives = 118/146 (81%), Gaps = 3/146 (2%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQEYES AAFWP VHGR+I AL+ +Q+  +GLLSTK A+ + PFLI LPVLTI 
Sbjct  608  QIINVYNQEYESGAAFWPAVHGRVITALVIAQLLMMGLLSTKQASSTTPFLIALPVLTIW  667

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFK--GNEDEYD  281
            FH++C GRY+SAF K+PLQEA MKD+LE+A  PNFN + YL+ AY+HPVFK  GN+D+Y+
Sbjct  668  FHVFCNGRYKSAFVKYPLQEAMMKDSLERASSPNFNFRSYLEKAYVHPVFKGDGNDDDYE  727

Query  280  -YDGISEKADEENVLVQTKRQSRKNT  206
             Y   +++AD ENVLV T+R SR+N+
Sbjct  728  QYLSENQEADAENVLVPTRRHSRRNS  753



>ref|XP_010422263.1| PREDICTED: LOW QUALITY PROTEIN: protein OSCA1-like [Camelina 
sativa]
Length=772

 Score =   201 bits (512),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 99/143 (69%), Positives = 117/143 (82%), Gaps = 1/143 (1%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQEYESAAAFWPDVHGR+I ALI SQ+  +GLL+TK AA +APFLI LPV+TI 
Sbjct  609  QIINVYNQEYESAAAFWPDVHGRVISALIISQLLLMGLLATKRAALAAPFLIALPVITIG  668

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            FH +CKGRYE AF ++PL+EA MKDTLE+AREPN NLK YLQDAYIHPVFK   D+ D  
Sbjct  669  FHRFCKGRYEPAFIRYPLEEAMMKDTLERAREPNLNLKGYLQDAYIHPVFK-GGDDDDDS  727

Query  274  GISEKADEENVLVQTKRQSRKNT  206
             +  K ++E ++V TKRQSR+NT
Sbjct  728  DVVGKLEDEVIIVPTKRQSRRNT  750



>ref|XP_010496174.1| PREDICTED: protein OSCA1-like [Camelina sativa]
Length=772

 Score =   201 bits (512),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 99/143 (69%), Positives = 117/143 (82%), Gaps = 1/143 (1%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQEYESAAAFWPDVHGR+I ALI SQ+  +GLL+TK AA +APFLI LPV+TI 
Sbjct  609  QIINVYNQEYESAAAFWPDVHGRVISALIISQLLLMGLLATKRAALAAPFLIALPVITIG  668

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            FH +CKGRYE AF ++PL+EA MKDTLE+AREPN NLK YLQDAYIHPVFK   D+ D  
Sbjct  669  FHRFCKGRYEPAFIRYPLEEAMMKDTLERAREPNLNLKGYLQDAYIHPVFK-GGDDDDDS  727

Query  274  GISEKADEENVLVQTKRQSRKNT  206
             +  K ++E ++V TKRQSR+NT
Sbjct  728  DVVGKLEDEVIIVPTKRQSRRNT  750



>gb|EMS56194.1| Uncharacterized membrane protein C2G11.09 [Triticum urartu]
Length=612

 Score =   199 bits (506),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 98/143 (69%), Positives = 113/143 (79%), Gaps = 1/143 (1%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQEYESAAAFWP VHGRII ALI SQ+  LGLLSTK A QS P L+VLPV+T  
Sbjct  448  QIINVYNQEYESAAAFWPSVHGRIITALIVSQLLFLGLLSTKGAGQSTPVLLVLPVVTFY  507

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            FH YCK RYE AF ++PLQEA  KDTLE+AREP F+LK YL  AYIHPVFKG++D+  + 
Sbjct  508  FHKYCKNRYEPAFVEYPLQEAMRKDTLERAREPGFDLKTYLASAYIHPVFKGDDDDEKFS  567

Query  274  GISEKADEENVLVQTKRQSRKNT  206
             + E A+ + VLV TKRQSR+NT
Sbjct  568  MMDE-AEADQVLVATKRQSRRNT  589



>ref|XP_009418442.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Musa acuminata subsp. malaccensis]
Length=768

 Score =   201 bits (511),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 102/143 (71%), Positives = 115/143 (80%), Gaps = 1/143 (1%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQEYESAAAFWPDVHGRII AL+ SQ+  LGLLSTK AA S PFLI LP+LTI 
Sbjct  605  QIINVYNQEYESAAAFWPDVHGRIISALVISQLLLLGLLSTKKAADSTPFLIALPILTIW  664

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            FH +CK RYESAF K+P+QEA MKDTLE+AREPN +LK YL +AY+HPVFK  EDE D  
Sbjct  665  FHRFCKNRYESAFVKYPIQEAMMKDTLERAREPNLDLKAYLSNAYVHPVFKDGEDE-DSV  723

Query  274  GISEKADEENVLVQTKRQSRKNT  206
               E+ + ENVLV TKR SR+NT
Sbjct  724  ATDEEKEVENVLVPTKRASRRNT  746



>ref|XP_003529649.1| PREDICTED: uncharacterized membrane protein C2G11.09-like isoform 
X1 [Glycine max]
 ref|XP_006584087.1| PREDICTED: uncharacterized membrane protein C2G11.09-like isoform 
X2 [Glycine max]
 gb|KHN35714.1| Putative membrane protein C2G11.09 [Glycine soja]
Length=777

 Score =   201 bits (511),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 101/146 (69%), Positives = 119/146 (82%), Gaps = 3/146 (2%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQEYES AAFWPDVH R+I ALI SQ+  +GLL+TK AA S PFLIVLPVLTI 
Sbjct  606  QIINVYNQEYESGAAFWPDVHFRVIIALIVSQIVLMGLLTTKEAASSTPFLIVLPVLTIW  665

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGN---EDEY  284
            FH+YCKGR+E AF ++PLQEA MKDTLE+A +PNFNLK YLQ+AY+HPVFK +   EDE 
Sbjct  666  FHIYCKGRFEPAFVRYPLQEAMMKDTLERATDPNFNLKAYLQNAYVHPVFKASLFDEDEE  725

Query  283  DYDGISEKADEENVLVQTKRQSRKNT  206
            D + +S K + E+V V TKRQSR+NT
Sbjct  726  DEEVMSLKLETESVTVPTKRQSRRNT  751



>ref|XP_010089460.1| Uncharacterized membrane protein [Morus notabilis]
 gb|EXB37853.1| Uncharacterized membrane protein [Morus notabilis]
Length=779

 Score =   201 bits (511),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 101/156 (65%), Positives = 114/156 (73%), Gaps = 14/156 (9%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQEYESAAAFWPDVH RII AL+ SQ+  +GLLSTK A QS P LI LPVLTI 
Sbjct  604  QIINVYNQEYESAAAFWPDVHRRIITALVVSQLLLMGLLSTKEATQSTPLLITLPVLTIW  663

Query  454  FHLYCKGRYESAFTKHPL-------------QEAKMKDTLEQAREPNFNLKPYLQDAYIH  314
            FH +CKGRYE AF  +PL             QEA MKDTLE+AREPN NLK +LQ+AY+H
Sbjct  664  FHFFCKGRYEPAFVTYPLQLFLLFVSSSAGSQEAMMKDTLERAREPNLNLKGFLQNAYVH  723

Query  313  PVFKGNEDEYDYDGISEKADEENVLVQTKRQSRKNT  206
            PVFKG ED+ D D  +E   EE  +V TKRQSR+NT
Sbjct  724  PVFKG-EDDSDSDAATEDLKEEPAIVPTKRQSRRNT  758



>ref|XP_002457968.1| hypothetical protein SORBIDRAFT_03g023990 [Sorghum bicolor]
 gb|EES03088.1| hypothetical protein SORBIDRAFT_03g023990 [Sorghum bicolor]
Length=768

 Score =   200 bits (509),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 99/143 (69%), Positives = 112/143 (78%), Gaps = 1/143 (1%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQEYESAAAFWP VHGRII ALI SQ   LGLLSTK A QS P L+VLPV+T  
Sbjct  604  QIINVYNQEYESAAAFWPSVHGRIITALIVSQFLLLGLLSTKGAGQSTPVLLVLPVVTFY  663

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            FH YCK RYE  F K PLQEA  KDTLE+AREP F+LK YL +AYIHPVFKG+ED+  + 
Sbjct  664  FHKYCKNRYEPTFVKCPLQEAMKKDTLERAREPGFDLKGYLMNAYIHPVFKGDEDDEKFS  723

Query  274  GISEKADEENVLVQTKRQSRKNT  206
             I+++ + E VLV TKRQSR+NT
Sbjct  724  -IADEPETEQVLVATKRQSRRNT  745



>gb|KHG22816.1| putative membrane C2G11.09 [Gossypium arboreum]
Length=649

 Score =   199 bits (505),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 96/143 (67%), Positives = 114/143 (80%), Gaps = 1/143 (1%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQEYESAAA+WPDVH RII ALI SQ+  +GLLSTK AA S P LI LPVLTI 
Sbjct  485  QIINVYNQEYESAAAYWPDVHLRIIVALIVSQLLLMGLLSTKEAASSTPLLITLPVLTIW  544

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            FH +CKGRYE AF ++PLQEA MKDTLE+AREPN NLK +LQ+AYIHPVFK  +D+   D
Sbjct  545  FHRFCKGRYEPAFVRNPLQEAMMKDTLERAREPNLNLKGFLQNAYIHPVFKSADDD-KID  603

Query  274  GISEKADEENVLVQTKRQSRKNT  206
             + E+ +EE  L+ TKR S+++T
Sbjct  604  VVMEEWEEEPSLIATKRTSKRST  626



>ref|XP_011095994.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Sesamum indicum]
Length=769

 Score =   200 bits (508),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 97/143 (68%), Positives = 115/143 (80%), Gaps = 1/143 (1%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQEYESA AFWPDVHGRIIFAL+FSQ+  +GL+STK AA S PFLI LPVLT  
Sbjct  608  QIINVYNQEYESAGAFWPDVHGRIIFALVFSQLVLMGLMSTKGAAASTPFLIALPVLTFF  667

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            FH +CKGRYE AF K+PLQEA +KDTLE+AREP  NLK YLQ AY+HPVFK N+++ + D
Sbjct  668  FHRFCKGRYEPAFVKYPLQEAMIKDTLERAREPGLNLKGYLQYAYVHPVFK-NDEDDEDD  726

Query  274  GISEKADEENVLVQTKRQSRKNT  206
             +  K +E   ++ TKRQSR+NT
Sbjct  727  DLHGKIEESITIIPTKRQSRRNT  749



>gb|KJB57786.1| hypothetical protein B456_009G181100 [Gossypium raimondii]
 gb|KJB57787.1| hypothetical protein B456_009G181100 [Gossypium raimondii]
Length=770

 Score =   199 bits (507),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 99/143 (69%), Positives = 118/143 (83%), Gaps = 2/143 (1%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQEYESAAAFWPDVHGRII AL+ S V+ +GLLSTKH AQ+AP LI L V+TI 
Sbjct  606  QIINVYNQEYESAAAFWPDVHGRIIIALLVSHVALIGLLSTKHLAQAAPLLITLAVVTIW  665

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            F+ +CK RYE AF ++PLQEA MKDTLE+AR+ NFNLKPYLQ+AYIHPVFK  ED+ + +
Sbjct  666  FYRFCKARYEPAFVRYPLQEAVMKDTLERARDSNFNLKPYLQNAYIHPVFKEEEDDEEEE  725

Query  274  GISEKADEENVLVQTKRQSRKNT  206
             +  K + E+VLV TKRQSR+NT
Sbjct  726  VV--KLENESVLVPTKRQSRRNT  746



>ref|XP_007217157.1| hypothetical protein PRUPE_ppa001757mg [Prunus persica]
 gb|EMJ18356.1| hypothetical protein PRUPE_ppa001757mg [Prunus persica]
Length=769

 Score =   199 bits (506),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 101/143 (71%), Positives = 118/143 (83%), Gaps = 1/143 (1%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQEYESAAAFWPDVHGRII ALI SQ+  +GLLSTK AAQS P LI LPVLTI 
Sbjct  604  QIINVYNQEYESAAAFWPDVHGRIITALIVSQLLLMGLLSTKEAAQSTPLLITLPVLTIW  663

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            FH +CKG YE AF ++PLQEA MKDTLE+AREPN NLK +LQ+AYIHPVFKG ED+ + +
Sbjct  664  FHRFCKGCYEPAFIRYPLQEAMMKDTLERAREPNLNLKGFLQNAYIHPVFKG-EDDSENE  722

Query  274  GISEKADEENVLVQTKRQSRKNT  206
              +E+ ++E  +V TKRQSR+NT
Sbjct  723  AAAEECEKEPAVVPTKRQSRRNT  745



>ref|XP_003569164.1| PREDICTED: calcium permeable stress-gated cation channel 1 [Brachypodium 
distachyon]
 ref|XP_010231890.1| PREDICTED: calcium permeable stress-gated cation channel 1 [Brachypodium 
distachyon]
Length=768

 Score =   199 bits (506),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 96/143 (67%), Positives = 114/143 (80%), Gaps = 1/143 (1%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQEYESAAAFWP VHGRII ALI SQ+  LGLLSTK A QS P L+VLPV+T  
Sbjct  604  QIINVYNQEYESAAAFWPSVHGRIITALIISQLLFLGLLSTKGAGQSTPVLLVLPVVTFY  663

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            FH YCK RYE AF ++PLQEA  KDTLE+AREP F+LK YL  AYIHPVFKG++D+  + 
Sbjct  664  FHKYCKNRYEPAFVEYPLQEAMRKDTLERAREPGFDLKTYLASAYIHPVFKGDDDDEKFS  723

Query  274  GISEKADEENVLVQTKRQSRKNT  206
             ++++ + + VLV TKRQSR+NT
Sbjct  724  -MADEVEADQVLVATKRQSRRNT  745



>sp|F4HYR3.2|CSCL6_ARATH RecName: Full=CSC1-like protein At1g62320 [Arabidopsis thaliana]
 gb|AAF70851.1|AC003113_18 F24O1.4 [Arabidopsis thaliana]
Length=778

 Score =   199 bits (506),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 98/145 (68%), Positives = 117/145 (81%), Gaps = 3/145 (2%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQ+YESA AFWPDVHGRII ALI SQ+  LGL+STK   QS PFL+VL +LT  
Sbjct  607  QIINVYNQKYESAGAFWPDVHGRIISALIISQILLLGLMSTKGKVQSTPFLLVLAILTFG  666

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            FH +CKGRYESAF  +PLQEA +KDTLE+AREPN NLK +LQ+AY+HPVFK  ED  D +
Sbjct  667  FHRFCKGRYESAFVINPLQEAMIKDTLERAREPNLNLKGFLQNAYVHPVFKDEEDS-DEE  725

Query  274  GISEKADEEN-VLVQTKRQ-SRKNT  206
            G+ E +D+E+ V+VQTKRQ SR+ T
Sbjct  726  GLIEDSDDEDCVVVQTKRQRSRRTT  750



>ref|XP_004231619.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Solanum lycopersicum]
 ref|XP_010315702.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Solanum lycopersicum]
Length=765

 Score =   199 bits (505),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 96/148 (65%), Positives = 116/148 (78%), Gaps = 0/148 (0%)
 Frame = -3

Query  649  FCLTLQIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLP  470
            F    QIINVY+QEYES AAFWPDVHGRIIFAL+FSQ+S LGLLSTK AAQSAPFLI LP
Sbjct  598  FVFRHQIINVYHQEYESGAAFWPDVHGRIIFALVFSQISLLGLLSTKRAAQSAPFLIALP  657

Query  469  VLTITFHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNED  290
            VLT++FH +CKGRYE AFT++PLQEAK KDT+EQA+E   NLK YLQ AY+HPVF+G++ 
Sbjct  658  VLTLSFHYFCKGRYEPAFTRYPLQEAKRKDTIEQAKESKLNLKYYLQKAYLHPVFRGDDV  717

Query  289  EYDYDGISEKADEENVLVQTKRQSRKNT  206
            + + D   +    +  L+  KR SR +T
Sbjct  718  DDNEDVNDKLESNDVELIPMKRHSRGST  745



>gb|EMT27455.1| Putative membrane protein [Aegilops tauschii]
Length=816

 Score =   199 bits (505),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 98/143 (69%), Positives = 112/143 (78%), Gaps = 1/143 (1%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQEYESAAAFWP VHGRII ALI SQ+  LGLLSTK A QS P L+VLPV+T  
Sbjct  652  QIINVYNQEYESAAAFWPSVHGRIITALIVSQLLFLGLLSTKGAGQSTPVLLVLPVVTFY  711

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            FH YCK RYE AF ++PLQEA  KDTLE+AREP F+LK YL  AYIHPVFKG +D+  + 
Sbjct  712  FHKYCKNRYEPAFVEYPLQEAMRKDTLERAREPGFDLKTYLASAYIHPVFKGGDDDEKFS  771

Query  274  GISEKADEENVLVQTKRQSRKNT  206
             + E A+ + VLV TKRQSR+NT
Sbjct  772  MMDE-AEADQVLVATKRQSRRNT  793



>ref|XP_006383869.1| hypothetical protein POPTR_0004s00750g [Populus trichocarpa]
 gb|ERP61666.1| hypothetical protein POPTR_0004s00750g [Populus trichocarpa]
Length=802

 Score =   199 bits (505),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 97/143 (68%), Positives = 118/143 (83%), Gaps = 2/143 (1%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQEYES AAFWPDVHGRII  L+ SQ++ +GLLSTK AAQS PFLI LPVLTI 
Sbjct  639  QIINVYNQEYESGAAFWPDVHGRIITGLVISQLALMGLLSTKEAAQSTPFLIALPVLTIW  698

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            FH +C GR++SAF K+PLQEA MKDTLE+AR+PNFNLK  L  AY+HP+FKG++D+ D  
Sbjct  699  FHRFCNGRHKSAFVKYPLQEAMMKDTLERARDPNFNLKACLHSAYVHPIFKGDDDDEDD-  757

Query  274  GISEKADEENVLVQTKRQSRKNT  206
             +S + + E+VLV TKRQS++NT
Sbjct  758  -LSVEMETESVLVPTKRQSQRNT  779



>ref|XP_010473449.1| PREDICTED: CSC1-like protein At1g62320 [Camelina sativa]
 ref|XP_010473450.1| PREDICTED: CSC1-like protein At1g62320 [Camelina sativa]
 ref|XP_010473451.1| PREDICTED: CSC1-like protein At1g62320 [Camelina sativa]
Length=779

 Score =   198 bits (504),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 99/146 (68%), Positives = 118/146 (81%), Gaps = 3/146 (2%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQEYESAAAFWPDVHGRII ALI SQ+  LGL+STK   QS PFL+VL +LT  
Sbjct  607  QIINVYNQEYESAAAFWPDVHGRIISALIISQILLLGLMSTKGKVQSTPFLLVLAILTFV  666

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYD-Y  278
            FH +CKGRYESAF  +PLQEA +KDTLE+AREPN NLK +LQ+AYIHPVFK  E E D +
Sbjct  667  FHRFCKGRYESAFVINPLQEAMIKDTLERAREPNLNLKGFLQNAYIHPVFKDEEFEDDQF  726

Query  277  DGISEKADEEN-VLVQTKRQS-RKNT  206
            +G++E +D+E+ V+V TKRQ  R+ T
Sbjct  727  EGLTEDSDDEDCVVVPTKRQRPRRKT  752



>gb|KJB69238.1| hypothetical protein B456_011G012200 [Gossypium raimondii]
 gb|KJB69240.1| hypothetical protein B456_011G012200 [Gossypium raimondii]
Length=610

 Score =   196 bits (499),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 101/143 (71%), Positives = 119/143 (83%), Gaps = 3/143 (2%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQEYESAAAFWPDVHGRII AL+ SQV+ +GLL++K AAQS PFLI L VLTI 
Sbjct  444  QIINVYNQEYESAAAFWPDVHGRIIIALLISQVALIGLLTSKKAAQSTPFLIALVVLTIW  503

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            F+ +CK RYE AF ++PLQEA MKDTLE+AREPN NLKPYLQ+AYIHPVFK  ++E ++D
Sbjct  504  FYTFCKARYEPAFVRYPLQEAMMKDTLERAREPNLNLKPYLQNAYIHPVFKEEDEEDEFD  563

Query  274  GISEKADEENVLVQTKRQSRKNT  206
              SE    E+VLV TKRQSR++T
Sbjct  564  FKSEN---ESVLVPTKRQSRRST  583



>ref|XP_007049121.1| ERD (early-responsive to dehydration stress) family protein [Theobroma 
cacao]
 gb|EOX93278.1| ERD (early-responsive to dehydration stress) family protein [Theobroma 
cacao]
Length=768

 Score =   198 bits (503),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 96/143 (67%), Positives = 111/143 (78%), Gaps = 1/143 (1%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQEYES AAFWPDVH RII ALI SQ+  +GLLSTK AAQS P LI LPVLTI 
Sbjct  604  QIINVYNQEYESGAAFWPDVHARIIVALIVSQLLLMGLLSTKEAAQSTPLLITLPVLTIW  663

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            FH +CKGRYE AF ++PLQEA MKDTLE+AREPN NLK +LQ AY HPVFK  +D  + D
Sbjct  664  FHRFCKGRYEPAFVRYPLQEAMMKDTLERAREPNLNLKGFLQSAYTHPVFKSADDS-ESD  722

Query  274  GISEKADEENVLVQTKRQSRKNT  206
               E++++E  L+ TKR SR+ T
Sbjct  723  ITMEESEQEPALIPTKRTSRRCT  745



>ref|XP_003555683.1| PREDICTED: uncharacterized membrane protein C2G11.09-like isoformX1 
[Glycine max]
 ref|XP_006605689.1| PREDICTED: uncharacterized membrane protein C2G11.09-like isoform 
X2 [Glycine max]
Length=774

 Score =   198 bits (503),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 99/145 (68%), Positives = 116/145 (80%), Gaps = 2/145 (1%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQEYES AAFWPDVH RI+ ALI SQ+  +GLL+TK AA S PFLIVLP+LTI 
Sbjct  606  QIINVYNQEYESGAAFWPDVHFRIVMALIVSQIVLMGLLTTKKAASSTPFLIVLPILTIW  665

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            FH YCKGR+ESAF K PLQEA MKDTLE+A EPN NLK YLQ+AY+HPVFK + D+ D +
Sbjct  666  FHRYCKGRFESAFVKFPLQEAMMKDTLERATEPNLNLKGYLQNAYVHPVFKDSMDDDDDE  725

Query  274  G--ISEKADEENVLVQTKRQSRKNT  206
               +S   + E+V V+TKRQSR+NT
Sbjct  726  EDRLSIDLETESVTVRTKRQSRRNT  750



>ref|XP_009619499.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Nicotiana tomentosiformis]
 ref|XP_009619500.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Nicotiana tomentosiformis]
Length=768

 Score =   198 bits (503),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 102/143 (71%), Positives = 122/143 (85%), Gaps = 0/143 (0%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQ+YES AAFWPDVHGR+IFAL+FSQ+S LGLLSTKHA QSAPFLI LPVLTI+
Sbjct  604  QIINVYNQKYESGAAFWPDVHGRVIFALVFSQLSLLGLLSTKHAVQSAPFLIALPVLTIS  663

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            FH +CKGRYE AFT++PLQEA+ KDTLE+A+EPN NLK YLQ+AY+HPVFKG++++ D +
Sbjct  664  FHKFCKGRYEPAFTRYPLQEARRKDTLERAKEPNLNLKAYLQNAYLHPVFKGDDEDEDEE  723

Query  274  GISEKADEENVLVQTKRQSRKNT  206
               +      VLV TKRQSR+NT
Sbjct  724  IDDKLESNGTVLVPTKRQSRENT  746



>gb|KHN28986.1| Putative membrane protein C2G11.09 [Glycine soja]
Length=774

 Score =   198 bits (503),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 99/145 (68%), Positives = 116/145 (80%), Gaps = 2/145 (1%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQEYES AAFWPDVH RI+ ALI SQ+  +GLL+TK AA S PFLIVLP+LTI 
Sbjct  606  QIINVYNQEYESGAAFWPDVHFRIVMALIVSQIVLMGLLTTKKAASSTPFLIVLPILTIW  665

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            FH YCKGR+ESAF K PLQEA MKDTLE+A EPN NLK YLQ+AY+HPVFK + D+ D +
Sbjct  666  FHRYCKGRFESAFVKFPLQEAMMKDTLERATEPNLNLKGYLQNAYVHPVFKDSMDDDDDE  725

Query  274  G--ISEKADEENVLVQTKRQSRKNT  206
               +S   + E+V V+TKRQSR+NT
Sbjct  726  EDRLSIDLETESVTVRTKRQSRRNT  750



>ref|XP_010548889.1| PREDICTED: CSC1-like protein At3g21620 [Tarenaya hassleriana]
Length=764

 Score =   198 bits (503),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 95/144 (66%), Positives = 110/144 (76%), Gaps = 1/144 (1%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            Q+INVYNQEYESA AFWPDVHGRII AL+ SQ+  +GLLSTK AAQS P LI LPVLTI 
Sbjct  607  QVINVYNQEYESAGAFWPDVHGRIIAALVVSQLLLMGLLSTKQAAQSTPLLITLPVLTIW  666

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            FH++C+GRYE AF K+PLQEA +KDTLE+ REPN NLK +L +AY HPVFK  E+E +  
Sbjct  667  FHVFCRGRYEPAFVKYPLQEAMIKDTLEKTREPNLNLKAFLGNAYAHPVFKAAENEREET  726

Query  274  GISEKADEENV-LVQTKRQSRKNT  206
            G+ E   E    LV TKR SR NT
Sbjct  727  GLEETRPERTPELVPTKRGSRMNT  750



>ref|XP_009803475.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Nicotiana sylvestris]
 ref|XP_009803477.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Nicotiana sylvestris]
Length=768

 Score =   197 bits (502),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 102/143 (71%), Positives = 121/143 (85%), Gaps = 0/143 (0%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQ+YES AAFWPDVHGRIIFAL+FSQ+S LGLL TKHAAQSAPFLI LPVLTI+
Sbjct  604  QIINVYNQKYESGAAFWPDVHGRIIFALVFSQLSLLGLLGTKHAAQSAPFLIALPVLTIS  663

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            FH +CKGRYE AFT++PLQEA+ KDTLE+A+EPN NLK YLQ+AY+HPVFK ++++ D +
Sbjct  664  FHKFCKGRYEPAFTRYPLQEARRKDTLERAKEPNLNLKAYLQNAYLHPVFKSDDEDEDEE  723

Query  274  GISEKADEENVLVQTKRQSRKNT  206
               +      VLV TKRQSR+NT
Sbjct  724  FDDKLESNGTVLVPTKRQSRENT  746



>ref|XP_007145950.1| hypothetical protein PHAVU_006G000300g [Phaseolus vulgaris]
 gb|ESW17944.1| hypothetical protein PHAVU_006G000300g [Phaseolus vulgaris]
Length=773

 Score =   197 bits (502),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 97/145 (67%), Positives = 115/145 (79%), Gaps = 2/145 (1%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQEYES AAFWPDVH RII ALI SQ+  +GLL+TK AA S PFLIVLP+LTI 
Sbjct  606  QIINVYNQEYESGAAFWPDVHFRIILALIVSQIVLMGLLTTKKAASSTPFLIVLPILTIW  665

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            FH YCKGR+ESAF K PLQEA MKDTLE+A EPN NLK YLQ+AY+HP+FK + +E   +
Sbjct  666  FHRYCKGRFESAFVKFPLQEAMMKDTLERAIEPNLNLKGYLQNAYVHPIFKDSMEEETDE  725

Query  274  G--ISEKADEENVLVQTKRQSRKNT  206
               +  + + E+ +V+TKRQSRKNT
Sbjct  726  EEILGMEFETESAIVRTKRQSRKNT  750



>ref|XP_008363043.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized membrane protein 
C2G11.09-like [Malus domestica]
Length=660

 Score =   196 bits (499),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 97/143 (68%), Positives = 113/143 (79%), Gaps = 1/143 (1%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQEYESAAAFWPDVHGRII ALI SQ+  +GLLSTK AA S P LI LPVLTI 
Sbjct  497  QIINVYNQEYESAAAFWPDVHGRIITALIVSQLLLMGLLSTKEAAXSTPLLITLPVLTIW  556

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            FH +CKGRY+ AF +HPLQEA MKDTLE  REPN NLK +LQ+AYIHPVFK +ED+   D
Sbjct  557  FHRFCKGRYKPAFIRHPLQEAMMKDTLECTREPNLNLKXFLQNAYIHPVFK-SEDDSKND  615

Query  274  GISEKADEENVLVQTKRQSRKNT  206
              +++ ++E  +V TK  SR+NT
Sbjct  616  APAQEFEKEPAVVLTKCSSRRNT  638



>ref|XP_006387597.1| hypothetical protein POPTR_0796s00210g [Populus trichocarpa]
 gb|ERP46511.1| hypothetical protein POPTR_0796s00210g [Populus trichocarpa]
Length=696

 Score =   197 bits (500),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 97/152 (64%), Positives = 119/152 (78%), Gaps = 2/152 (1%)
 Frame = -3

Query  661  SFTDFCLTLQIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFL  482
            +F       QIINVYN EYES AAFWPDVHGRII  L+ SQ++ +GLLSTK AAQS PFL
Sbjct  524  AFAYLVFRHQIINVYNHEYESGAAFWPDVHGRIITGLVISQLALMGLLSTKEAAQSTPFL  583

Query  481  IVLPVLTITFHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFK  302
            I LPVLTI FH +C GR++SAF K+PLQEA MKDTLE+AR+PNFNLK  L  AY+HP+FK
Sbjct  584  IALPVLTIWFHRFCNGRHKSAFVKYPLQEAMMKDTLERARDPNFNLKACLHSAYVHPIFK  643

Query  301  GNEDEYDYDGISEKADEENVLVQTKRQSRKNT  206
            G++D+ D   +S + + E+VLV TKRQS++NT
Sbjct  644  GDDDDEDD--LSVEMETESVLVPTKRQSQRNT  673



>emb|CDY12941.1| BnaA09g13330D [Brassica napus]
Length=779

 Score =   197 bits (502),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 98/145 (68%), Positives = 120/145 (83%), Gaps = 2/145 (1%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQEYESAAA+WPDVHGRII ALI SQ+  +GL+STK  AQS PFL++LP+LTI 
Sbjct  607  QIINVYNQEYESAAAYWPDVHGRIISALIISQILLIGLMSTKGKAQSTPFLVILPILTIG  666

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFK-GNEDEYDY  278
            FH +CKGRYESAF  +PLQEA +KDTLE+AREPN NLK +LQ+AYIHPVFK    ++ +Y
Sbjct  667  FHRFCKGRYESAFVVNPLQEAMIKDTLERAREPNLNLKGFLQNAYIHPVFKDEECEDDEY  726

Query  277  DGISEKADEEN-VLVQTKRQSRKNT  206
            + + E +D+EN V+V TKRQSR+ T
Sbjct  727  EELIEDSDDENCVVVPTKRQSRRTT  751



>ref|XP_009113086.1| PREDICTED: CSC1-like protein At1g62320 [Brassica rapa]
Length=779

 Score =   197 bits (501),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 98/145 (68%), Positives = 120/145 (83%), Gaps = 2/145 (1%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQEYESAAA+WPDVHGRII ALI SQ+  +GL+STK  AQS PFL++LP+LTI 
Sbjct  607  QIINVYNQEYESAAAYWPDVHGRIISALIISQILLIGLMSTKGKAQSTPFLVILPILTIG  666

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFK-GNEDEYDY  278
            FH +CKGRYESAF  +PLQEA +KDTLE+AREPN NLK +LQ+AYIHPVFK    ++ +Y
Sbjct  667  FHRFCKGRYESAFVVNPLQEAMIKDTLERAREPNLNLKGFLQNAYIHPVFKDEECEDDEY  726

Query  277  DGISEKADEEN-VLVQTKRQSRKNT  206
            + + E +D+EN V+V TKRQSR+ T
Sbjct  727  EELIEDSDDENCVVVPTKRQSRRTT  751



>gb|EYU27725.1| hypothetical protein MIMGU_mgv1a001730mg [Erythranthe guttata]
Length=768

 Score =   197 bits (500),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 95/143 (66%), Positives = 117/143 (82%), Gaps = 1/143 (1%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQEYESAAAFWP VHGRI+FALIFSQ+  +GL+STK A  + PFLI LP+++  
Sbjct  606  QIINVYNQEYESAAAFWPAVHGRIMFALIFSQIVLIGLMSTKRAVTTTPFLIALPIMSYF  665

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            FHL+C+GR+E AF  +PLQEA MKDTLE+AREPN NLK YLQ++Y+HPVFK  E+E D D
Sbjct  666  FHLFCRGRFEPAFVNYPLQEAMMKDTLERAREPNLNLKGYLQNSYVHPVFKDEEEEEDDD  725

Query  274  GISEKADEENVLVQTKRQSRKNT  206
             ++ K D +N +V TKRQSR+NT
Sbjct  726  HVNGKYD-DNAVVATKRQSRRNT  747



>ref|XP_010657219.1| PREDICTED: CSC1-like protein At3g21620 [Vitis vinifera]
 ref|XP_010657220.1| PREDICTED: CSC1-like protein At3g21620 [Vitis vinifera]
 ref|XP_010657221.1| PREDICTED: CSC1-like protein At3g21620 [Vitis vinifera]
 ref|XP_010657222.1| PREDICTED: CSC1-like protein At3g21620 [Vitis vinifera]
 ref|XP_010657223.1| PREDICTED: CSC1-like protein At3g21620 [Vitis vinifera]
 ref|XP_010657224.1| PREDICTED: CSC1-like protein At3g21620 [Vitis vinifera]
 emb|CBI28840.3| unnamed protein product [Vitis vinifera]
Length=766

 Score =   197 bits (500),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 94/144 (65%), Positives = 113/144 (78%), Gaps = 1/144 (1%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQEYESAAAFWPDVH RII AL+ SQ+  +GLLSTK AAQS P LI LPVLTI 
Sbjct  604  QIINVYNQEYESAAAFWPDVHMRIIVALVVSQLLLMGLLSTKQAAQSTPLLIALPVLTIW  663

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            FH +CKGRYE AF ++PLQEA MKDTLE+ REPN NLK YL++AY HP+FK  +D+ + D
Sbjct  664  FHFFCKGRYEPAFVRYPLQEAMMKDTLERVREPNLNLKGYLREAYFHPIFKAGDDDSEMD  723

Query  274  GISE-KADEENVLVQTKRQSRKNT  206
              +E +  ++  LV TKR SR++T
Sbjct  724  EANEVEMVQKPELVPTKRHSRRHT  747



>gb|KJB69236.1| hypothetical protein B456_011G012200 [Gossypium raimondii]
 gb|KJB69242.1| hypothetical protein B456_011G012200 [Gossypium raimondii]
 gb|KJB69244.1| hypothetical protein B456_011G012200 [Gossypium raimondii]
Length=772

 Score =   197 bits (500),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 101/143 (71%), Positives = 119/143 (83%), Gaps = 3/143 (2%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQEYESAAAFWPDVHGRII AL+ SQV+ +GLL++K AAQS PFLI L VLTI 
Sbjct  606  QIINVYNQEYESAAAFWPDVHGRIIIALLISQVALIGLLTSKKAAQSTPFLIALVVLTIW  665

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            F+ +CK RYE AF ++PLQEA MKDTLE+AREPN NLKPYLQ+AYIHPVFK  ++E ++D
Sbjct  666  FYTFCKARYEPAFVRYPLQEAMMKDTLERAREPNLNLKPYLQNAYIHPVFKEEDEEDEFD  725

Query  274  GISEKADEENVLVQTKRQSRKNT  206
              SE    E+VLV TKRQSR++T
Sbjct  726  FKSE---NESVLVPTKRQSRRST  745



>gb|KJB69243.1| hypothetical protein B456_011G012200 [Gossypium raimondii]
Length=764

 Score =   197 bits (500),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 101/143 (71%), Positives = 119/143 (83%), Gaps = 3/143 (2%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQEYESAAAFWPDVHGRII AL+ SQV+ +GLL++K AAQS PFLI L VLTI 
Sbjct  598  QIINVYNQEYESAAAFWPDVHGRIIIALLISQVALIGLLTSKKAAQSTPFLIALVVLTIW  657

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            F+ +CK RYE AF ++PLQEA MKDTLE+AREPN NLKPYLQ+AYIHPVFK  ++E ++D
Sbjct  658  FYTFCKARYEPAFVRYPLQEAMMKDTLERAREPNLNLKPYLQNAYIHPVFKEEDEEDEFD  717

Query  274  GISEKADEENVLVQTKRQSRKNT  206
              SE    E+VLV TKRQSR++T
Sbjct  718  FKSE---NESVLVPTKRQSRRST  737



>gb|KJB69239.1| hypothetical protein B456_011G012200 [Gossypium raimondii]
Length=772

 Score =   197 bits (500),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 101/143 (71%), Positives = 119/143 (83%), Gaps = 3/143 (2%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQEYESAAAFWPDVHGRII AL+ SQV+ +GLL++K AAQS PFLI L VLTI 
Sbjct  606  QIINVYNQEYESAAAFWPDVHGRIIIALLISQVALIGLLTSKKAAQSTPFLIALVVLTIW  665

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            F+ +CK RYE AF ++PLQEA MKDTLE+AREPN NLKPYLQ+AYIHPVFK  ++E ++D
Sbjct  666  FYTFCKARYEPAFVRYPLQEAMMKDTLERAREPNLNLKPYLQNAYIHPVFKEEDEEDEFD  725

Query  274  GISEKADEENVLVQTKRQSRKNT  206
              SE    E+VLV TKRQSR++T
Sbjct  726  FKSE---NESVLVPTKRQSRRST  745



>dbj|BAK03311.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=767

 Score =   196 bits (498),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 97/143 (68%), Positives = 111/143 (78%), Gaps = 2/143 (1%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQEYESAAAFWP VHGRII ALI SQ+  LGLLSTK A QS P L+VLPV+T  
Sbjct  604  QIINVYNQEYESAAAFWPSVHGRIITALIVSQLLFLGLLSTKGAGQSTPVLLVLPVVTFY  663

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            FH YCK RYE AF ++PLQEA  KDTLE+AREP F+LK YL  AYIHPVFKG +DE    
Sbjct  664  FHKYCKNRYEPAFVEYPLQEAMRKDTLERAREPGFDLKTYLASAYIHPVFKGEDDE--KF  721

Query  274  GISEKADEENVLVQTKRQSRKNT  206
             + ++ + + VLV TKRQSR+NT
Sbjct  722  SMMDEGEADQVLVATKRQSRRNT  744



>ref|XP_008371060.1| PREDICTED: transmembrane protein 63B-like [Malus domestica]
Length=772

 Score =   196 bits (498),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 103/143 (72%), Positives = 114/143 (80%), Gaps = 1/143 (1%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQEYESAAAFWPDVHGRII ALI SQ+   GLLSTK AA S PFLI LPVLT++
Sbjct  608  QIINVYNQEYESAAAFWPDVHGRIITALIISQLLLFGLLSTKEAASSTPFLIALPVLTLS  667

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            FH YCKGR+E AFT +PLQEA MKDTLE+AREPN NLK YLQ AYIHPVF    DE +  
Sbjct  668  FHRYCKGRFEPAFTTYPLQEAMMKDTLERAREPNLNLKGYLQSAYIHPVFH-ECDEEEDH  726

Query  274  GISEKADEENVLVQTKRQSRKNT  206
               EK + E+V+V TKRQSR+NT
Sbjct  727  ESFEKEESESVIVPTKRQSRRNT  749



>gb|EPS60017.1| hypothetical protein M569_14787, partial [Genlisea aurea]
Length=762

 Score =   195 bits (496),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 97/148 (66%), Positives = 121/148 (82%), Gaps = 5/148 (3%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQEYESAA FWPDVHGRII A+IFSQ+  +GL+STK AA S PFL+VLPV+TI 
Sbjct  608  QIINVYNQEYESAAEFWPDVHGRIISAMIFSQLVLMGLMSTKGAAASTPFLLVLPVITIF  667

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            FH +CKGRYE AF K+PLQEA M+DTLE+AREPNFNLK ++++AY+HPVFK +ED+ + +
Sbjct  668  FHRFCKGRYEPAFLKYPLQEAMMRDTLERAREPNFNLKSFMRNAYVHPVFKNDEDDDEEE  727

Query  274  ---GISEKA--DEENVLVQTKRQSRKNT  206
               G + K   D+  V+V TKRQSR++T
Sbjct  728  DEVGSNRKNGDDDGGVIVPTKRQSRRST  755



>gb|KHG01808.1| putative membrane C2G11.09 [Gossypium arboreum]
Length=772

 Score =   195 bits (496),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 101/143 (71%), Positives = 118/143 (83%), Gaps = 3/143 (2%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQEYESAAAFWPDVHGRII AL+ SQV+ +GLL++K AAQS PFLI L VLTI 
Sbjct  606  QIINVYNQEYESAAAFWPDVHGRIIIALLISQVALIGLLTSKKAAQSTPFLIALVVLTIW  665

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            F+  CK RYE AF ++PLQEA MKDTLE+AREPN NLKPYLQ+AYIHPVFK  ++E ++D
Sbjct  666  FYTLCKARYEPAFVRYPLQEAMMKDTLERAREPNLNLKPYLQNAYIHPVFKEEDEEDEFD  725

Query  274  GISEKADEENVLVQTKRQSRKNT  206
              SE    E+VLV TKRQSR++T
Sbjct  726  FKSE---NESVLVPTKRQSRRST  745



>gb|KJB10672.1| hypothetical protein B456_001G215500 [Gossypium raimondii]
Length=608

 Score =   194 bits (492),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 94/143 (66%), Positives = 112/143 (78%), Gaps = 1/143 (1%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQEYESAAA+WPDVH RII ALI SQ+  +GLLSTK AA S P LI LP+LTI 
Sbjct  444  QIINVYNQEYESAAAYWPDVHLRIIVALIVSQLLLMGLLSTKEAASSTPLLITLPILTIW  503

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            FH +CKGRYE AF ++PLQEA MKDTLE+AREPN NLK +LQ+AYIHPVFK  + +   D
Sbjct  504  FHRFCKGRYEPAFVRNPLQEAMMKDTLERAREPNLNLKGFLQNAYIHPVFKSADGD-KID  562

Query  274  GISEKADEENVLVQTKRQSRKNT  206
               E+ +EE  L+ TKR S+++T
Sbjct  563  VAMEEWEEEPSLIATKRTSKRST  585



>ref|XP_010430277.1| PREDICTED: CSC1-like protein At1g62320 [Camelina sativa]
 ref|XP_010430278.1| PREDICTED: CSC1-like protein At1g62320 [Camelina sativa]
 ref|XP_010430279.1| PREDICTED: CSC1-like protein At1g62320 [Camelina sativa]
 ref|XP_010430280.1| PREDICTED: CSC1-like protein At1g62320 [Camelina sativa]
 ref|XP_010430281.1| PREDICTED: CSC1-like protein At1g62320 [Camelina sativa]
Length=780

 Score =   195 bits (495),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 98/148 (66%), Positives = 119/148 (80%), Gaps = 6/148 (4%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQEYESAAAFWPDVHGRII ALI SQ+  LGL+STK   QS PFL+VL +LT  
Sbjct  607  QIINVYNQEYESAAAFWPDVHGRIISALIISQILLLGLMSTKGKVQSTPFLLVLAILTFV  666

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNE---DEY  284
            FH +CKGRYESAF  +PLQEA +KDTLE+AREPN NLK +LQ+AYIHPVFK  E   D++
Sbjct  667  FHRFCKGRYESAFVINPLQEAMIKDTLERAREPNMNLKGFLQNAYIHPVFKDEEFEDDQF  726

Query  283  DYDGISEKADEEN-VLVQTKR-QSRKNT  206
            D +G++E +D+E+ V+V TKR + R+ T
Sbjct  727  D-EGLTEDSDDEDCVVVPTKRHRPRRKT  753



>ref|XP_010418218.1| PREDICTED: CSC1-like protein At1g62320 [Camelina sativa]
 ref|XP_010418219.1| PREDICTED: CSC1-like protein At1g62320 [Camelina sativa]
 ref|XP_010418220.1| PREDICTED: CSC1-like protein At1g62320 [Camelina sativa]
Length=780

 Score =   195 bits (495),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 98/148 (66%), Positives = 119/148 (80%), Gaps = 6/148 (4%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQEYESAAAFWPDVHGRII ALI SQ+  LGL+STK   QS PFL+VL +LT  
Sbjct  607  QIINVYNQEYESAAAFWPDVHGRIISALIISQILLLGLMSTKGKVQSTPFLLVLAILTFV  666

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNE---DEY  284
            FH +CKGRYESAF  +PLQEA +KDTLE+AREPN NLK +LQ+AYIHPVFK  E   D++
Sbjct  667  FHRFCKGRYESAFVINPLQEAMIKDTLERAREPNMNLKGFLQNAYIHPVFKDEEFEDDQF  726

Query  283  DYDGISEKADEEN-VLVQTKR-QSRKNT  206
            D +G++E +D+E+ V+V TKR + R+ T
Sbjct  727  D-EGLTEDSDDEDCVVVPTKRHRPRRKT  753



>ref|XP_003542161.1| PREDICTED: uncharacterized membrane protein C2G11.09-like [Glycine 
max]
 gb|KHN42234.1| Putative membrane protein C2G11.09 [Glycine soja]
Length=774

 Score =   195 bits (495),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 96/145 (66%), Positives = 115/145 (79%), Gaps = 2/145 (1%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQEYES AAFWPDVH RI+ AL+ SQ+  +GLL+TK AA S PFL+VLP+LTI 
Sbjct  606  QIINVYNQEYESGAAFWPDVHFRIVMALLVSQIVLMGLLTTKKAASSTPFLVVLPILTIW  665

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            FH YCKGR+ESAF K PLQEA MKDTLE+  EPN NLK YLQ+AY+HPVFK + D+ D +
Sbjct  666  FHRYCKGRFESAFVKFPLQEAMMKDTLERTTEPNLNLKGYLQNAYVHPVFKDSMDDDDDE  725

Query  274  G--ISEKADEENVLVQTKRQSRKNT  206
               +S   + E+V V+TKRQSR+NT
Sbjct  726  EDILSMDLETESVTVRTKRQSRRNT  750



>gb|KCW77011.1| hypothetical protein EUGRSUZ_D01358 [Eucalyptus grandis]
Length=663

 Score =   194 bits (492),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 97/144 (67%), Positives = 118/144 (82%), Gaps = 1/144 (1%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQEYESAAAFWPDVH R+I AL+ SQ+   GL++TK AA S PFLI LPVLTI 
Sbjct  497  QIINVYNQEYESAAAFWPDVHRRVIVALVVSQLLLFGLMATKQAANSTPFLIALPVLTIY  556

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFK-GNEDEYDY  278
            FH++CKGR+E AF ++PLQEA MKDTLE+AREP+ NLK +LQ+AY+HPVFK  ++D+ D 
Sbjct  557  FHMFCKGRFEPAFVRYPLQEAMMKDTLERAREPHVNLKSFLQNAYLHPVFKSADDDDEDD  616

Query  277  DGISEKADEENVLVQTKRQSRKNT  206
            D + EK D E+VLV TKR SR+NT
Sbjct  617  DDVDEKWDNESVLVPTKRSSRRNT  640



>ref|XP_006644293.1| PREDICTED: uncharacterized membrane protein YLR241W-like isoform 
X1 [Oryza brachyantha]
 ref|XP_006644294.1| PREDICTED: uncharacterized membrane protein YLR241W-like isoform 
X2 [Oryza brachyantha]
Length=769

 Score =   194 bits (494),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 94/143 (66%), Positives = 111/143 (78%), Gaps = 0/143 (0%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQEYESAAAFWP V+GRII ALI SQ   LGLLSTK A QS P L+VLPV+T  
Sbjct  604  QIINVYNQEYESAAAFWPSVNGRIIVALIVSQFLLLGLLSTKGAGQSTPVLLVLPVVTFY  663

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            F+ YCK RYE AF ++PLQEA  KDTLE+AREP  +LK YL +AY+HPVFKG  D+ +  
Sbjct  664  FYKYCKNRYEPAFVEYPLQEAMRKDTLERAREPGLDLKAYLMNAYVHPVFKGGGDDDERF  723

Query  274  GISEKADEENVLVQTKRQSRKNT  206
             +S++ + E VLV TKRQSR+NT
Sbjct  724  SMSDEPEAEQVLVATKRQSRRNT  746



>ref|XP_006300401.1| hypothetical protein CARUB_v10019839mg [Capsella rubella]
 gb|EOA33299.1| hypothetical protein CARUB_v10019839mg [Capsella rubella]
Length=774

 Score =   194 bits (493),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 97/146 (66%), Positives = 115/146 (79%), Gaps = 3/146 (2%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQEYESAAAFWPDVHGRII ALI SQ+  LGL+STK   QS PFL+VL +LT  
Sbjct  607  QIINVYNQEYESAAAFWPDVHGRIITALIISQILLLGLMSTKGKVQSTPFLLVLSILTFG  666

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYD--  281
            FH  CKGRYESAF  +PLQEA +KDTLE+AREPN NLK +LQ+AYIHPVFK  E E D  
Sbjct  667  FHRICKGRYESAFVINPLQEAMIKDTLERAREPNLNLKGFLQNAYIHPVFKDEEYEEDDQ  726

Query  280  YDGISEKADEEN-VLVQTKRQSRKNT  206
            ++ ++E +D+E+ V+V TKRQ  + T
Sbjct  727  FERLTEDSDDEDCVVVPTKRQKPRRT  752



>ref|XP_004293317.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Fragaria vesca subsp. vesca]
Length=776

 Score =   194 bits (493),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 101/145 (70%), Positives = 117/145 (81%), Gaps = 2/145 (1%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQEYESAAAFWPDVHGRI+ AL+ SQ+  LGLL+TK AAQS PFL+ LPVLT  
Sbjct  609  QIINVYNQEYESAAAFWPDVHGRILSALLISQLVLLGLLTTKKAAQSTPFLLALPVLTFA  668

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            F+ YC+GR+E AF ++PLQEAKMKDTLE AREPN NLK YLQ AY+HPVFK  +D+ D D
Sbjct  669  FYKYCQGRFEPAFVRYPLQEAKMKDTLESAREPNLNLKGYLQSAYVHPVFKECDDDDDED  728

Query  274  GIS-EKADEEN-VLVQTKRQSRKNT  206
              S EK + E+ V V TKRQSR+NT
Sbjct  729  HYSFEKYENESCVTVATKRQSRRNT  753



>ref|XP_004295293.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Fragaria vesca subsp. vesca]
Length=772

 Score =   194 bits (492),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 96/143 (67%), Positives = 112/143 (78%), Gaps = 3/143 (2%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQEYESAAAFWPDVHGR++ ALI SQ+  +GLLSTK A  S PFL+ LP++T+ 
Sbjct  609  QIINVYNQEYESAAAFWPDVHGRVVSALILSQLVLMGLLSTKGAKISTPFLLPLPIMTVA  668

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            F+ YC GRYE AF ++PLQEAKMKDTLE AREPN NLK YLQ AY+HPVFK   +  + D
Sbjct  669  FYKYCAGRYEPAFVRYPLQEAKMKDTLEHAREPNLNLKGYLQSAYVHPVFK---ECAEDD  725

Query  274  GISEKADEENVLVQTKRQSRKNT  206
               EKA  E V+V TKRQSR+NT
Sbjct  726  DEEEKALYETVIVATKRQSRRNT  748



>gb|KJB10673.1| hypothetical protein B456_001G215500 [Gossypium raimondii]
Length=768

 Score =   194 bits (492),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 94/143 (66%), Positives = 112/143 (78%), Gaps = 1/143 (1%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQEYESAAA+WPDVH RII ALI SQ+  +GLLSTK AA S P LI LP+LTI 
Sbjct  604  QIINVYNQEYESAAAYWPDVHLRIIVALIVSQLLLMGLLSTKEAASSTPLLITLPILTIW  663

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            FH +CKGRYE AF ++PLQEA MKDTLE+AREPN NLK +LQ+AYIHPVFK  + +   D
Sbjct  664  FHRFCKGRYEPAFVRNPLQEAMMKDTLERAREPNLNLKGFLQNAYIHPVFKSADGD-KID  722

Query  274  GISEKADEENVLVQTKRQSRKNT  206
               E+ +EE  L+ TKR S+++T
Sbjct  723  VAMEEWEEEPSLIATKRTSKRST  745



>ref|XP_010052882.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Eucalyptus grandis]
 gb|KCW77010.1| hypothetical protein EUGRSUZ_D01358 [Eucalyptus grandis]
Length=774

 Score =   194 bits (492),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 97/144 (67%), Positives = 118/144 (82%), Gaps = 1/144 (1%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQEYESAAAFWPDVH R+I AL+ SQ+   GL++TK AA S PFLI LPVLTI 
Sbjct  608  QIINVYNQEYESAAAFWPDVHRRVIVALVVSQLLLFGLMATKQAANSTPFLIALPVLTIY  667

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFK-GNEDEYDY  278
            FH++CKGR+E AF ++PLQEA MKDTLE+AREP+ NLK +LQ+AY+HPVFK  ++D+ D 
Sbjct  668  FHMFCKGRFEPAFVRYPLQEAMMKDTLERAREPHVNLKSFLQNAYLHPVFKSADDDDEDD  727

Query  277  DGISEKADEENVLVQTKRQSRKNT  206
            D + EK D E+VLV TKR SR+NT
Sbjct  728  DDVDEKWDNESVLVPTKRSSRRNT  751



>ref|XP_003610472.1| Membrane protein, putative [Medicago truncatula]
 ref|XP_003619262.1| Membrane protein, putative [Medicago truncatula]
 gb|AES92669.1| ERD (early-responsive to dehydration stress) family protein [Medicago 
truncatula]
Length=774

 Score =   194 bits (492),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 96/145 (66%), Positives = 113/145 (78%), Gaps = 2/145 (1%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQEYES AAFWPDVH R+I AL+ SQ+  +GLL+TK AA S PFLIVLP+LTI 
Sbjct  606  QIINVYNQEYESGAAFWPDVHFRVIIALLVSQIVLMGLLTTKKAASSTPFLIVLPILTIW  665

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNE--DEYD  281
            FH YCKGR+ESAF K PLQEA MKDTLE+A EPN N+K YLQ AY+HPVFK +   D  +
Sbjct  666  FHRYCKGRFESAFVKFPLQEAMMKDTLERATEPNLNVKGYLQHAYVHPVFKASHDDDADE  725

Query  280  YDGISEKADEENVLVQTKRQSRKNT  206
             D +S K + E+  V TKRQSR++T
Sbjct  726  EDAMSLKWETESATVATKRQSRRST  750



>gb|KJB10674.1| hypothetical protein B456_001G215500 [Gossypium raimondii]
Length=729

 Score =   193 bits (491),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 94/143 (66%), Positives = 112/143 (78%), Gaps = 1/143 (1%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQEYESAAA+WPDVH RII ALI SQ+  +GLLSTK AA S P LI LP+LTI 
Sbjct  565  QIINVYNQEYESAAAYWPDVHLRIIVALIVSQLLLMGLLSTKEAASSTPLLITLPILTIW  624

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            FH +CKGRYE AF ++PLQEA MKDTLE+AREPN NLK +LQ+AYIHPVFK  + +   D
Sbjct  625  FHRFCKGRYEPAFVRNPLQEAMMKDTLERAREPNLNLKGFLQNAYIHPVFKSADGD-KID  683

Query  274  GISEKADEENVLVQTKRQSRKNT  206
               E+ +EE  L+ TKR S+++T
Sbjct  684  VAMEEWEEEPSLIATKRTSKRST  706



>gb|KHG30770.1| putative membrane C2G11.09 [Gossypium arboreum]
Length=770

 Score =   192 bits (489),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 99/143 (69%), Positives = 117/143 (82%), Gaps = 2/143 (1%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQEYESAAAFWPDVHGRII AL+ S V+ +GLLSTKH AQ+AP LI L VLTI 
Sbjct  606  QIINVYNQEYESAAAFWPDVHGRIIIALLVSHVALIGLLSTKHLAQAAPLLITLAVLTIW  665

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            F+ +CK RYE AF ++PLQEA MKDTLE+AR+ NFNLKPYLQ+AYIHPVFK  ++E + +
Sbjct  666  FYRFCKARYEPAFVRYPLQEAVMKDTLERARDSNFNLKPYLQNAYIHPVFKEEDEEEEEE  725

Query  274  GISEKADEENVLVQTKRQSRKNT  206
                K + E+VLV TKRQSR+NT
Sbjct  726  --VVKLENESVLVPTKRQSRRNT  746



>emb|CDP11354.1| unnamed protein product [Coffea canephora]
Length=777

 Score =   192 bits (489),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 98/143 (69%), Positives = 114/143 (80%), Gaps = 1/143 (1%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QI+NVYNQEYESAAAFWPDVHGRII ALI SQ+  LGLLSTK A+QS PFLI LPVLTI 
Sbjct  613  QIMNVYNQEYESAAAFWPDVHGRIIIALIVSQLLLLGLLSTKDASQSTPFLITLPVLTIC  672

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            F  YCKGRYE AF ++PLQ+A MKD L + REPN NLK YL+ AYIHPVFK   D+Y+ +
Sbjct  673  FDRYCKGRYEPAFVRYPLQQAMMKDILNRTREPNVNLKDYLRSAYIHPVFKAG-DDYENN  731

Query  274  GISEKADEENVLVQTKRQSRKNT  206
             +SE  ++E  LV TKRQSR++T
Sbjct  732  LVSEDEEQEPTLVPTKRQSRRST  754



>ref|NP_001043256.1| Os01g0534900 [Oryza sativa Japonica Group]
 dbj|BAD87679.1| putative ERD4 protein [Oryza sativa Japonica Group]
 dbj|BAF05170.1| Os01g0534900 [Oryza sativa Japonica Group]
 dbj|BAG96168.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC70822.1| hypothetical protein OsI_02298 [Oryza sativa Indica Group]
 gb|EEE54743.1| hypothetical protein OsJ_02101 [Oryza sativa Japonica Group]
 gb|AIU34628.1| hyperosmolality-gated Ca2+ permeable channel 1.1 [Oryza sativa]
Length=768

 Score =   192 bits (487),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 98/143 (69%), Positives = 115/143 (80%), Gaps = 1/143 (1%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQEYESAAAFWP VHGRII ALI SQ+  LGLLSTK A QS P L+VLPV+T  
Sbjct  604  QIINVYNQEYESAAAFWPSVHGRIIVALIVSQLLLLGLLSTKGAGQSTPVLLVLPVVTFY  663

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            F+ YCK RYE AF ++PLQ+A  KDTLE+AREP F+LK YL +AYIHPVFKG+ED+  + 
Sbjct  664  FYKYCKNRYEPAFVEYPLQDAMRKDTLERAREPGFDLKGYLMNAYIHPVFKGDEDDEKFS  723

Query  274  GISEKADEENVLVQTKRQSRKNT  206
             IS++ + E VLV TKRQSR+NT
Sbjct  724  -ISDEPEAEQVLVATKRQSRRNT  745



>ref|XP_006391905.1| hypothetical protein EUTSA_v10023297mg [Eutrema salsugineum]
 gb|ESQ29191.1| hypothetical protein EUTSA_v10023297mg [Eutrema salsugineum]
Length=766

 Score =   191 bits (484),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 96/160 (60%), Positives = 120/160 (75%), Gaps = 2/160 (1%)
 Frame = -3

Query  679  VCRVQISFTDFCLTLQIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAA  500
            V  V + F  F      +   +QEYESAAA+WPDVHGRII ALI SQ+  +GL+S+K  A
Sbjct  583  VTPVLLPFIIFFFGFAYLIFRHQEYESAAAYWPDVHGRIISALIISQILLIGLMSSKGKA  642

Query  499  QSAPFLIVLPVLTITFHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAY  320
            QS PFL+VLP+LTI FH +CKGRYESAF  +PLQEA +KDTLE+A+EPN NLK +LQ+AY
Sbjct  643  QSTPFLVVLPILTIGFHRFCKGRYESAFVINPLQEAMIKDTLERAKEPNLNLKVFLQNAY  702

Query  319  IHPVFKGNEDEYD-YDGISEKADEEN-VLVQTKRQSRKNT  206
            IHPVFK  E E D ++  +E +D EN V+VQTKR+SR+ T
Sbjct  703  IHPVFKDEEYEDDRFEESTEDSDNENCVVVQTKRRSRRTT  742



>gb|EPS71959.1| hypothetical protein M569_02795, partial [Genlisea aurea]
Length=761

 Score =   190 bits (483),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 93/145 (64%), Positives = 115/145 (79%), Gaps = 2/145 (1%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSA-PFLIVLPVLTI  458
            QIINVYNQ YESAAAFWP VHGRIIF+L+FSQ+  LGLLS+K AAQ A PFLI LP+LTI
Sbjct  608  QIINVYNQVYESAAAFWPGVHGRIIFSLVFSQIVLLGLLSSKGAAQEATPFLIALPILTI  667

Query  457  TFHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNE-DEYD  281
             FH+ CKGRYE AF ++PLQEA +KDTLE+ RE N NLK YL+DAY+HPVFK ++ ++  
Sbjct  668  WFHIVCKGRYEPAFIRYPLQEAMIKDTLEKTRERNLNLKKYLRDAYVHPVFKNDDANDDH  727

Query  280  YDGISEKADEENVLVQTKRQSRKNT  206
                 + + ++N LV TKRQSR++T
Sbjct  728  GYDYDDDSTKDNNLVPTKRQSRRST  752



>ref|NP_001056508.1| Os05g0594700 [Oryza sativa Japonica Group]
 gb|AAV59379.1| putative early-responsive to dehydration stress protein (ERD4) 
[Oryza sativa Japonica Group]
 dbj|BAF18422.1| Os05g0594700 [Oryza sativa Japonica Group]
 gb|EAY99267.1| hypothetical protein OsI_21231 [Oryza sativa Indica Group]
 dbj|BAG93571.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|AIU34629.1| hyperosmolality-gated Ca2+ permeable channel 1.2 [Oryza sativa]
Length=766

 Score =   189 bits (481),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 92/143 (64%), Positives = 109/143 (76%), Gaps = 1/143 (1%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQ+YES A FWP VHGRII ALI SQ+  +GLLSTK   ++ P L+VLPVLT  
Sbjct  604  QIINVYNQQYESGAQFWPSVHGRIIIALIVSQLLLIGLLSTKGFEETTPVLVVLPVLTFW  663

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            F+ YCK R+E AF ++PLQEA  KDTLE+AREP F+LK YL +AY+HPVFKG E+E D  
Sbjct  664  FYKYCKNRFEPAFVRNPLQEAMRKDTLERAREPTFDLKAYLANAYLHPVFKGREEE-DNM  722

Query  274  GISEKADEENVLVQTKRQSRKNT  206
             ISE    E V+V TKRQSR+NT
Sbjct  723  SISEDVGMEEVIVPTKRQSRRNT  745



>gb|EEE64912.1| hypothetical protein OsJ_19772 [Oryza sativa Japonica Group]
Length=893

 Score =   189 bits (481),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 92/143 (64%), Positives = 109/143 (76%), Gaps = 1/143 (1%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQ+YES A FWP VHGRII ALI SQ+  +GLLSTK   ++ P L+VLPVLT  
Sbjct  604  QIINVYNQQYESGAQFWPSVHGRIIIALIVSQLLLIGLLSTKGFEETTPVLVVLPVLTFW  663

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            F+ YCK R+E AF ++PLQEA  KDTLE+AREP F+LK YL +AY+HPVFKG E+E D  
Sbjct  664  FYKYCKNRFEPAFVRNPLQEAMRKDTLERAREPTFDLKAYLANAYLHPVFKGREEE-DNM  722

Query  274  GISEKADEENVLVQTKRQSRKNT  206
             ISE    E V+V TKRQSR+NT
Sbjct  723  SISEDVGMEEVIVPTKRQSRRNT  745


 Score =   135 bits (340),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 66/108 (61%), Positives = 81/108 (75%), Gaps = 1/108 (1%)
 Frame = -3

Query  529  LGLLSTKHAAQSAPFLIVLPVLTITFHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNF  350
            +GLLSTK   ++ P L+VLPVLT  F+ YCK R+E AF ++PLQEA  KDTLE+AREP F
Sbjct  766  IGLLSTKGFEETTPVLVVLPVLTFWFYKYCKNRFEPAFVRNPLQEAMRKDTLERAREPTF  825

Query  349  NLKPYLQDAYIHPVFKGNEDEYDYDGISEKADEENVLVQTKRQSRKNT  206
            +LK YL +AY+HPVFKG E+E D   ISE    E V+V TKRQSR+NT
Sbjct  826  DLKAYLANAYLHPVFKGREEE-DNMSISEDVGMEEVIVPTKRQSRRNT  872



>emb|CDY32438.1| BnaC03g42220D [Brassica napus]
Length=756

 Score =   188 bits (478),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 88/144 (61%), Positives = 112/144 (78%), Gaps = 1/144 (1%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQEYESA AFWPDVH RI+ ALI SQ+  +GLLSTKHA++S P L +LPVLTI 
Sbjct  605  QIINVYNQEYESAGAFWPDVHRRIVIALIVSQLLLMGLLSTKHASRSTPLLFILPVLTIG  664

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            FH +CKGRYE  F ++PLQ+A +KDTLE+ +EPN NLK +LQ+AY+HPVFK  ++  D  
Sbjct  665  FHRFCKGRYEPVFVRYPLQDAMVKDTLERTKEPNLNLKTFLQNAYVHPVFKAADNVKDEM  724

Query  274  GISE-KADEENVLVQTKRQSRKNT  206
             + E +AD+   LV TKR S+++T
Sbjct  725  VVEEPRADQTPDLVATKRSSKRHT  748



>emb|CDY48898.1| BnaA03g36370D [Brassica napus]
Length=756

 Score =   187 bits (476),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 87/144 (60%), Positives = 112/144 (78%), Gaps = 1/144 (1%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQEYESA AFWPDVH R++ ALI SQ+  +GLLSTKHA++S P L +LPVLTI 
Sbjct  605  QIINVYNQEYESAGAFWPDVHRRVVIALIVSQLLLMGLLSTKHASRSTPLLFILPVLTIG  664

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            FH +CKGRYE  F ++PLQ+A +KDTLE+ +EPN NLK +LQ+AY+HPVFK  ++  D  
Sbjct  665  FHRFCKGRYEPVFVRYPLQDAMVKDTLERTKEPNLNLKTFLQNAYVHPVFKAADNVKDEM  724

Query  274  GISE-KADEENVLVQTKRQSRKNT  206
             + E +AD+   LV TKR S+++T
Sbjct  725  VVEEPRADQTPDLVATKRSSKRHT  748



>ref|XP_009135761.1| PREDICTED: CSC1-like protein At3g21620 [Brassica rapa]
Length=756

 Score =   187 bits (476),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 87/144 (60%), Positives = 112/144 (78%), Gaps = 1/144 (1%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQEYESA AFWPDVH R++ ALI SQ+  +GLLSTKHA++S P L +LPVLTI 
Sbjct  605  QIINVYNQEYESAGAFWPDVHRRVVIALIVSQLLLMGLLSTKHASRSTPLLFILPVLTIG  664

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            FH +CKGRYE  F ++PLQ+A +KDTLE+ +EPN NLK +LQ+AY+HPVFK  ++  D  
Sbjct  665  FHRFCKGRYEPVFVRYPLQDAMVKDTLERTKEPNLNLKTFLQNAYVHPVFKAADNVKDEM  724

Query  274  GISE-KADEENVLVQTKRQSRKNT  206
             + E +AD+   LV TKR S+++T
Sbjct  725  VVEEPRADQTPDLVATKRSSKRHT  748



>ref|XP_010921296.1| PREDICTED: calcium permeable stress-gated cation channel 1 isoform 
X1 [Elaeis guineensis]
Length=760

 Score =   187 bits (474),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 100/143 (70%), Positives = 115/143 (80%), Gaps = 1/143 (1%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQEYES AAFWPDVHGRII ALI SQ+  LGLLSTKHA+QS P LI LP+LTI 
Sbjct  604  QIINVYNQEYESGAAFWPDVHGRIITALIISQLLLLGLLSTKHASQSTPLLIALPILTIW  663

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            FH +CK RYE AF  +PLQEA MKDT+EQAREPN +LK YL +AYIHPVFK  ED+ ++ 
Sbjct  664  FHRFCKNRYEPAFVIYPLQEAMMKDTVEQAREPNLDLKAYLLNAYIHPVFKDGEDDDNFS  723

Query  274  GISEKADEENVLVQTKRQSRKNT  206
             I E+ + +N LV TKRQSR+NT
Sbjct  724  -IGEEQEYDNTLVPTKRQSRRNT  745



>ref|NP_176422.1| ERD (early-responsive to dehydration stress) family protein [Arabidopsis 
thaliana]
 gb|AEE33953.1| ERD (early-responsive to dehydration stress) family protein [Arabidopsis 
thaliana]
 gb|AIU34616.1| hyperosmolality-gated Ca2+ permeable channel 1.4 [Arabidopsis 
thaliana]
Length=769

 Score =   187 bits (474),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 95/160 (59%), Positives = 117/160 (73%), Gaps = 3/160 (2%)
 Frame = -3

Query  679  VCRVQISFTDFCLTLQIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAA  500
            V  V + F  F      +   +Q+YESA AFWPDVHGRII ALI SQ+  LGL+STK   
Sbjct  583  VTPVLLPFIIFFFGFAYLVFRHQKYESAGAFWPDVHGRIISALIISQILLLGLMSTKGKV  642

Query  499  QSAPFLIVLPVLTITFHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAY  320
            QS PFL+VL +LT  FH +CKGRYESAF  +PLQEA +KDTLE+AREPN NLK +LQ+AY
Sbjct  643  QSTPFLLVLAILTFGFHRFCKGRYESAFVINPLQEAMIKDTLERAREPNLNLKGFLQNAY  702

Query  319  IHPVFKGNEDEYDYDGISEKADEEN-VLVQTKRQ-SRKNT  206
            +HPVFK  ED  D +G+ E +D+E+ V+VQTKRQ SR+ T
Sbjct  703  VHPVFKDEEDS-DEEGLIEDSDDEDCVVVQTKRQRSRRTT  741



>ref|XP_010924081.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
isoform X4 [Elaeis guineensis]
Length=726

 Score =   186 bits (473),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 101/143 (71%), Positives = 115/143 (80%), Gaps = 1/143 (1%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQEYES AAFWPDVHGRII ALI SQ+  LGLLSTK AAQS PFLI LP+LTI 
Sbjct  564  QIINVYNQEYESGAAFWPDVHGRIITALIISQLLLLGLLSTKEAAQSTPFLIALPILTIW  623

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            FH +CK RYE AF K+PLQEA MKDTLE+A+EPN +LK YL +AY+HPVFK + DE D  
Sbjct  624  FHRFCKSRYEPAFVKYPLQEAMMKDTLERAKEPNLDLKAYLVNAYVHPVFK-DGDEDDSF  682

Query  274  GISEKADEENVLVQTKRQSRKNT  206
             + E+   +NVLV TKRQSR+NT
Sbjct  683  SVDEEVVYDNVLVPTKRQSRRNT  705



>ref|XP_006850790.1| hypothetical protein AMTR_s00025p00102970 [Amborella trichopoda]
 gb|ERN12371.1| hypothetical protein AMTR_s00025p00102970 [Amborella trichopoda]
Length=765

 Score =   186 bits (473),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 93/143 (65%), Positives = 108/143 (76%), Gaps = 2/143 (1%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQEYESAA+FWPDVHGRI+ A++ SQ+  +GL+ST+ AAQS   LI LP+LTI 
Sbjct  606  QIINVYNQEYESAASFWPDVHGRIVTAMVISQLVLMGLVSTRGAAQSTTVLIPLPILTIW  665

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            FHL CK R+ESAF K PLQEA MKDTLE+A EPN NLK YLQDAYIHPVFKG    +   
Sbjct  666  FHLVCKSRFESAFVKFPLQEAMMKDTLERATEPNLNLKVYLQDAYIHPVFKGGNGHHQPK  725

Query  274  GISEKADEENVLVQTKRQSRKNT  206
               E  +E N LV TKR S+ +T
Sbjct  726  PGFE--EETNPLVPTKRHSQLST  746



>ref|XP_010924080.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
isoform X3 [Elaeis guineensis]
Length=732

 Score =   186 bits (473),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 101/143 (71%), Positives = 115/143 (80%), Gaps = 1/143 (1%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQEYES AAFWPDVHGRII ALI SQ+  LGLLSTK AAQS PFLI LP+LTI 
Sbjct  570  QIINVYNQEYESGAAFWPDVHGRIITALIISQLLLLGLLSTKEAAQSTPFLIALPILTIW  629

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            FH +CK RYE AF K+PLQEA MKDTLE+A+EPN +LK YL +AY+HPVFK + DE D  
Sbjct  630  FHRFCKSRYEPAFVKYPLQEAMMKDTLERAKEPNLDLKAYLVNAYVHPVFK-DGDEDDSF  688

Query  274  GISEKADEENVLVQTKRQSRKNT  206
             + E+   +NVLV TKRQSR+NT
Sbjct  689  SVDEEVVYDNVLVPTKRQSRRNT  711



>ref|XP_010924079.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
isoform X2 [Elaeis guineensis]
Length=745

 Score =   186 bits (473),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 101/143 (71%), Positives = 115/143 (80%), Gaps = 1/143 (1%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQEYES AAFWPDVHGRII ALI SQ+  LGLLSTK AAQS PFLI LP+LTI 
Sbjct  583  QIINVYNQEYESGAAFWPDVHGRIITALIISQLLLLGLLSTKEAAQSTPFLIALPILTIW  642

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            FH +CK RYE AF K+PLQEA MKDTLE+A+EPN +LK YL +AY+HPVFK + DE D  
Sbjct  643  FHRFCKSRYEPAFVKYPLQEAMMKDTLERAKEPNLDLKAYLVNAYVHPVFK-DGDEDDSF  701

Query  274  GISEKADEENVLVQTKRQSRKNT  206
             + E+   +NVLV TKRQSR+NT
Sbjct  702  SVDEEVVYDNVLVPTKRQSRRNT  724



>ref|XP_010924083.1| PREDICTED: protein OSCA1-like isoform X6 [Elaeis guineensis]
Length=684

 Score =   186 bits (472),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 101/143 (71%), Positives = 115/143 (80%), Gaps = 1/143 (1%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQEYES AAFWPDVHGRII ALI SQ+  LGLLSTK AAQS PFLI LP+LTI 
Sbjct  522  QIINVYNQEYESGAAFWPDVHGRIITALIISQLLLLGLLSTKEAAQSTPFLIALPILTIW  581

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            FH +CK RYE AF K+PLQEA MKDTLE+A+EPN +LK YL +AY+HPVFK + DE D  
Sbjct  582  FHRFCKSRYEPAFVKYPLQEAMMKDTLERAKEPNLDLKAYLVNAYVHPVFK-DGDEDDSF  640

Query  274  GISEKADEENVLVQTKRQSRKNT  206
             + E+   +NVLV TKRQSR+NT
Sbjct  641  SVDEEVVYDNVLVPTKRQSRRNT  663



>gb|EYU33878.1| hypothetical protein MIMGU_mgv1a018274mg [Erythranthe guttata]
Length=770

 Score =   186 bits (472),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 93/147 (63%), Positives = 114/147 (78%), Gaps = 4/147 (3%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQEYESAAAFWP VHGRII AL+FSQ+  +GL+STK  AQS P LI LPVLTI 
Sbjct  609  QIINVYNQEYESAAAFWPGVHGRIISALVFSQLVLMGLMSTKGNAQSTPILIALPVLTIW  668

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            FH +CKGRYE AF ++PLQEA MKDTLE++REPN N+K YL+ AYIHPVFK  +++ + +
Sbjct  669  FHRFCKGRYEPAFIRYPLQEAMMKDTLERSREPNLNVKSYLEYAYIHPVFKNEDEDDEDE  728

Query  274  GI----SEKADEENVLVQTKRQSRKNT  206
                  + K  + +VLV TKR SR++T
Sbjct  729  YEGECNNGKLLDGSVLVPTKRHSRRHT  755



>ref|XP_010924075.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
isoform X1 [Elaeis guineensis]
 ref|XP_010924076.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
isoform X1 [Elaeis guineensis]
 ref|XP_010924077.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
isoform X1 [Elaeis guineensis]
Length=766

 Score =   186 bits (472),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 101/143 (71%), Positives = 115/143 (80%), Gaps = 1/143 (1%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQEYES AAFWPDVHGRII ALI SQ+  LGLLSTK AAQS PFLI LP+LTI 
Sbjct  604  QIINVYNQEYESGAAFWPDVHGRIITALIISQLLLLGLLSTKEAAQSTPFLIALPILTIW  663

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            FH +CK RYE AF K+PLQEA MKDTLE+A+EPN +LK YL +AY+HPVFK + DE D  
Sbjct  664  FHRFCKSRYEPAFVKYPLQEAMMKDTLERAKEPNLDLKAYLVNAYVHPVFK-DGDEDDSF  722

Query  274  GISEKADEENVLVQTKRQSRKNT  206
             + E+   +NVLV TKRQSR+NT
Sbjct  723  SVDEEVVYDNVLVPTKRQSRRNT  745



>ref|XP_008675529.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Zea mays]
 ref|XP_008675530.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Zea mays]
 tpg|DAA59084.1| TPA: hypothetical protein ZEAMMB73_475653 [Zea mays]
Length=768

 Score =   185 bits (470),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 96/143 (67%), Positives = 111/143 (78%), Gaps = 1/143 (1%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQEYESAAAFWP VHGRII ALI SQ+  LGLLSTK A QS P L+VLPV+T  
Sbjct  604  QIINVYNQEYESAAAFWPSVHGRIITALIVSQLLLLGLLSTKGAGQSTPVLLVLPVVTFY  663

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            FH YC  RY+  F K PLQEA  KDTLE+AREP F+LK YL +AYIHPVFKG+ D+ D  
Sbjct  664  FHKYCNNRYKPTFVKCPLQEAMKKDTLERAREPGFDLKGYLMNAYIHPVFKGDGDD-DKF  722

Query  274  GISEKADEENVLVQTKRQSRKNT  206
             ++++ + E VLV TKRQSR+NT
Sbjct  723  SVADEPEAEQVLVATKRQSRRNT  745



>emb|CDY32032.1| BnaA03g60360D [Brassica napus]
Length=796

 Score =   185 bits (470),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 91/142 (64%), Positives = 114/142 (80%), Gaps = 2/142 (1%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQ+YESAAA+WPDVHGRII ALI SQ+  +GL+STK  AQS PFL+VLP+LT  
Sbjct  608  QIINVYNQKYESAAAYWPDVHGRIISALIISQLLLIGLMSTKGKAQSTPFLVVLPILTFC  667

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYD-Y  278
            FH +CK RYES F  +PLQEA +KD++E+AREPN NLK +L++AYIHPVFK  E E D +
Sbjct  668  FHRFCKDRYESVFVINPLQEAMIKDSMERAREPNLNLKRFLKNAYIHPVFKDKEYEDDLH  727

Query  277  DGISEKADEEN-VLVQTKRQSR  215
            + + E +D+EN V+V TK QS+
Sbjct  728  EELIEDSDDENCVVVPTKHQSQ  749



>ref|XP_011046985.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
isoform X2 [Populus euphratica]
Length=1186

 Score =   187 bits (475),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 83/112 (74%), Positives = 96/112 (86%), Gaps = 0/112 (0%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQEYES AAFWPDVHGRII  L+ SQ++ +GLL TK AAQS PFLI LPVLTI 
Sbjct  608  QIINVYNQEYESGAAFWPDVHGRIITGLVISQLALMGLLGTKEAAQSTPFLISLPVLTIW  667

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKG  299
            FH++C GR++SAF K+PLQEA MKDTLE+AR+PNFNLK YL  AY+HP+FKG
Sbjct  668  FHMFCNGRHKSAFVKYPLQEAMMKDTLERARDPNFNLKSYLHSAYVHPIFKG  719



>ref|XP_008803557.1| PREDICTED: LOW QUALITY PROTEIN: calcium permeable stress-gated 
cation channel 1-like [Phoenix dactylifera]
Length=767

 Score =   184 bits (468),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 99/143 (69%), Positives = 116/143 (81%), Gaps = 1/143 (1%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQEYES AAFWPDVHGRII ALI SQ+  LGLLSTK AAQS PFLI LP+LTI 
Sbjct  604  QIINVYNQEYESGAAFWPDVHGRIITALIISQLLLLGLLSTKEAAQSTPFLIALPILTIW  663

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            FH +CK RYE AF K+PLQEA MKDTLE+A+EPN +LK YL +AYIHPVFK  E++ D  
Sbjct  664  FHRFCKSRYEPAFVKYPLQEAMMKDTLERAKEPNLDLKAYLINAYIHPVFKDGEED-DSF  722

Query  274  GISEKADEENVLVQTKRQSRKNT  206
             + ++ + +NVLV TKRQSR++T
Sbjct  723  AVGDEREYDNVLVPTKRQSRRST  745



>ref|XP_008799225.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Phoenix dactylifera]
Length=762

 Score =   184 bits (468),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 100/143 (70%), Positives = 114/143 (80%), Gaps = 1/143 (1%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQEYES AAFWP VHGRII ALI SQ+  LGLLSTK AAQS P LI LP+LTI+
Sbjct  604  QIINVYNQEYESGAAFWPAVHGRIICALIISQLLLLGLLSTKQAAQSTPLLIALPILTIS  663

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            FH +CK RYE AF K+PLQEA MKDTLE AREPN +LK YL +AYIHPVFK  ED+ ++ 
Sbjct  664  FHRFCKNRYEPAFVKYPLQEAMMKDTLEHAREPNLDLKSYLLNAYIHPVFKDEEDDDNFS  723

Query  274  GISEKADEENVLVQTKRQSRKNT  206
             + E+ + +N LV TKRQSRKNT
Sbjct  724  -MGEEREYDNTLVPTKRQSRKNT  745



>emb|CDP03600.1| unnamed protein product [Coffea canephora]
Length=756

 Score =   184 bits (468),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 94/144 (65%), Positives = 108/144 (75%), Gaps = 5/144 (3%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVY+Q+YES A FWPDVH RII AL+ SQ+  +GLLSTK AA S P LIVLPVLTI 
Sbjct  605  QIINVYDQKYESGAKFWPDVHRRIIVALVISQLLLMGLLSTKKAANSTPLLIVLPVLTIW  664

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            FHL+CKGR+ESAF K PLQ+A +KDTLE+A EPN NLK YL DAYIHPVFK  +     D
Sbjct  665  FHLFCKGRFESAFVKFPLQDAMVKDTLERATEPNLNLKAYLHDAYIHPVFKCVQ----LD  720

Query  274  GISEKADEE-NVLVQTKRQSRKNT  206
                  DEE N LV TKR SR+++
Sbjct  721  KPKAVDDEENNPLVATKRNSRRDS  744



>ref|XP_009123383.1| PREDICTED: CSC1-like protein At1g62320 [Brassica rapa]
Length=762

 Score =   184 bits (468),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 90/142 (63%), Positives = 114/142 (80%), Gaps = 2/142 (1%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQ+YESAAA+WPDVHGRI+ ALI SQ+  +GL+STK  AQS PFL+VLP+LT  
Sbjct  608  QIINVYNQKYESAAAYWPDVHGRIVSALIISQLLLIGLMSTKGKAQSTPFLVVLPILTFC  667

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYD-Y  278
            FH +CK RYES F  +PLQEA +KD++E+AREPN NLK +L++AYIHPVFK  E E D +
Sbjct  668  FHRFCKDRYESVFVINPLQEAMIKDSMERAREPNLNLKRFLKNAYIHPVFKDKEYEDDLH  727

Query  277  DGISEKADEEN-VLVQTKRQSR  215
            + + E +D+EN V+V TK QS+
Sbjct  728  EELIEDSDDENCVVVPTKHQSQ  749



>ref|XP_008673458.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Zea mays]
Length=768

 Score =   184 bits (468),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 96/143 (67%), Positives = 110/143 (77%), Gaps = 1/143 (1%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQEYESAAAFWP VHGRII ALI SQ+  LGLLSTK A QS P L+VLPV+T  
Sbjct  604  QIINVYNQEYESAAAFWPSVHGRIITALIVSQLLLLGLLSTKGAGQSTPVLLVLPVVTFY  663

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            FH YC  RY+  F K PLQEA  KDTLE+AREP F+LK YL +AYIHPVFKG+ D+ D  
Sbjct  664  FHKYCNNRYKPTFVKCPLQEAMKKDTLERAREPGFDLKGYLMNAYIHPVFKGDGDD-DKF  722

Query  274  GISEKADEENVLVQTKRQSRKNT  206
             + ++ + E VLV TKRQSR+NT
Sbjct  723  SVVDQPEAEQVLVATKRQSRRNT  745



>ref|XP_006654880.1| PREDICTED: uncharacterized membrane protein YLR241W-like [Oryza 
brachyantha]
Length=770

 Score =   184 bits (467),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 90/143 (63%), Positives = 108/143 (76%), Gaps = 1/143 (1%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQ+YES A FWP VHGRII ALI SQ+  +GLLSTK   +S P L+VLPVLT  
Sbjct  604  QIINVYNQQYESGAQFWPSVHGRIIVALIVSQLLLIGLLSTKGFEESTPVLLVLPVLTFW  663

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            F+ YCK R+E AF ++PLQEA  KDT+E+AREP F+LK YL +AY+HPVFK NE+E +  
Sbjct  664  FYKYCKNRFEPAFVRNPLQEAMRKDTVERAREPTFDLKAYLTNAYLHPVFKSNEEE-EKM  722

Query  274  GISEKADEENVLVQTKRQSRKNT  206
             ISE    E V+V TKRQSR+ T
Sbjct  723  SISEDIGMEEVIVPTKRQSRRTT  745



>gb|KDO68804.1| hypothetical protein CISIN_1g0209791mg, partial [Citrus sinensis]
Length=156

 Score =   172 bits (435),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 84/138 (61%), Positives = 105/138 (76%), Gaps = 2/138 (1%)
 Frame = -3

Query  631  IINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITF  452
            +INVY+Q YES AAFWPDVH RII  LI SQ+  +GLLST+ A +S P LI+LPV+TI F
Sbjct  1    VINVYDQIYESGAAFWPDVHRRIIINLIISQLLLMGLLSTRKADKSTPLLILLPVITIWF  60

Query  451  HLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDG  272
            H+YCKGR+E AF   PLQEA +KDTLE+A EPN NL+ YLQDAY+HPVFKG + E +   
Sbjct  61   HVYCKGRFEPAFVTFPLQEAMVKDTLERATEPNLNLRTYLQDAYVHPVFKGIQ-EQNPPA  119

Query  271  ISEKADEENVLVQTKRQS  218
            + E+ D  + LV TKR++
Sbjct  120  VEEEED-SSPLVATKRRN  136



>ref|XP_006843810.1| hypothetical protein AMTR_s00007p00254340 [Amborella trichopoda]
 gb|ERN05485.1| hypothetical protein AMTR_s00007p00254340 [Amborella trichopoda]
Length=763

 Score =   184 bits (466),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 95/144 (66%), Positives = 111/144 (77%), Gaps = 4/144 (3%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            Q+INVYNQEYES AAFWPDVHGRII AL+ SQ+  LGLLSTK AAQS P L+ LPVLTI 
Sbjct  604  QVINVYNQEYESGAAFWPDVHGRIITALVISQLLLLGLLSTKLAAQSTPLLLALPVLTIW  663

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            FH +CK R+ESAF K PL+EA +KDTLE+A +PN NLK YL +AYIHPVFKG E+    D
Sbjct  664  FHRFCKDRFESAFVKFPLEEAMIKDTLERATDPNLNLKGYLSNAYIHPVFKGGEES---D  720

Query  274  GIS-EKADEENVLVQTKRQSRKNT  206
             +S    +++  LV TKRQSR NT
Sbjct  721  SVSLADIEQDEALVPTKRQSRMNT  744



>ref|XP_011046984.1| PREDICTED: uncharacterized protein LOC105141455 isoform X1 [Populus 
euphratica]
Length=1759

 Score =   187 bits (474),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 83/112 (74%), Positives = 96/112 (86%), Gaps = 0/112 (0%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQEYES AAFWPDVHGRII  L+ SQ++ +GLL TK AAQS PFLI LPVLTI 
Sbjct  608  QIINVYNQEYESGAAFWPDVHGRIITGLVISQLALMGLLGTKEAAQSTPFLISLPVLTIW  667

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKG  299
            FH++C GR++SAF K+PLQEA MKDTLE+AR+PNFNLK YL  AY+HP+FKG
Sbjct  668  FHMFCNGRHKSAFVKYPLQEAMMKDTLERARDPNFNLKSYLHSAYVHPIFKG  719



>ref|XP_010255871.1| PREDICTED: CSC1-like protein At4g02900 [Nelumbo nucifera]
Length=759

 Score =   183 bits (464),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 92/143 (64%), Positives = 107/143 (75%), Gaps = 3/143 (2%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVY+Q+YESAAAFWPDVH R+I  +I SQ+  +GLLSTK A  S P L+VLP+LTI 
Sbjct  604  QIINVYDQKYESAAAFWPDVHWRLIIGMIISQLLLMGLLSTKDAELSTPLLVVLPILTIW  663

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            FH  CK R+ESAF K PLQ+A +KDTLE+A EPN NLK YLQDAYIHPVFK N+ E    
Sbjct  664  FHRICKNRFESAFVKFPLQDAMVKDTLERATEPNLNLKNYLQDAYIHPVFKDNQIEVP-T  722

Query  274  GISEKADEENVLVQTKRQSRKNT  206
             I E  DE N LV T+R S +NT
Sbjct  723  AIYE--DENNPLVPTRRTSNRNT  743



>ref|XP_002440380.1| hypothetical protein SORBIDRAFT_09g030770 [Sorghum bicolor]
 gb|EES18810.1| hypothetical protein SORBIDRAFT_09g030770 [Sorghum bicolor]
Length=766

 Score =   182 bits (463),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 89/144 (62%), Positives = 109/144 (76%), Gaps = 1/144 (1%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQ+YESAA FWP VHGRII ALI SQ+  LGL+ST    QS P L+VLPVLT  
Sbjct  604  QIINVYNQQYESAAQFWPSVHGRIITALIVSQLLLLGLMSTNDFEQSTPVLLVLPVLTFW  663

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            F+ YCK R+E AF ++PLQEA  KDTLE+AREPNF+LK YL ++Y+HPVFKG+E +  Y 
Sbjct  664  FYKYCKNRFEPAFVRNPLQEAMKKDTLERAREPNFDLKAYLANSYLHPVFKGDEGDDRYS  723

Query  274  GISEKA-DEENVLVQTKRQSRKNT  206
             + ++   EE V+V TKR SR+ T
Sbjct  724  VVDDEGWMEEEVIVPTKRHSRRTT  747



>ref|XP_011079804.1| PREDICTED: CSC1-like protein At4g02900 [Sesamum indicum]
 ref|XP_011079805.1| PREDICTED: CSC1-like protein At4g02900 [Sesamum indicum]
Length=765

 Score =   182 bits (461),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 87/142 (61%), Positives = 107/142 (75%), Gaps = 3/142 (2%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVY+Q YESAAAFWPDVH R++  L+ SQ+  +GLLSTK  A+S P L++LPVLTI 
Sbjct  605  QIINVYDQNYESAAAFWPDVHRRVVIGLVISQLLLMGLLSTKSIAKSTPVLLILPVLTIW  664

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            FH +CKGR+ESAF K PLQ+A +KDTLE+A EPN NLK YLQDAY+HPVF+  E E    
Sbjct  665  FHRFCKGRFESAFVKFPLQDAVVKDTLERATEPNLNLKAYLQDAYVHPVFRTIEIE---K  721

Query  274  GISEKADEENVLVQTKRQSRKN  209
              +   +E N LV+TKR SR +
Sbjct  722  AAAVDEEENNPLVETKRNSRMS  743



>ref|XP_010038117.1| PREDICTED: CSC1-like protein At4g02900 [Eucalyptus grandis]
 gb|KCW49929.1| hypothetical protein EUGRSUZ_K03391 [Eucalyptus grandis]
Length=756

 Score =   181 bits (460),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 87/143 (61%), Positives = 108/143 (76%), Gaps = 3/143 (2%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            Q+INVY+Q+YES AAFWPDV  R+I  ++ SQ+  +GL+STK A  S P LIVLP+LTI 
Sbjct  605  QVINVYDQKYESGAAFWPDVQRRLIIGMVISQLLLMGLMSTKGAKSSTPLLIVLPILTIW  664

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            FHL+CKGR+ESAF K PLQ+A +KDTLE+A EPN NLK YL DAY+HPVF+G E E    
Sbjct  665  FHLFCKGRFESAFVKFPLQDAMVKDTLERATEPNLNLKAYLHDAYVHPVFRGGELEKP-A  723

Query  274  GISEKADEENVLVQTKRQSRKNT  206
             I E  +E N LV TKR SR+++
Sbjct  724  VIDE--EENNPLVPTKRMSRRSS  744



>gb|KEH23730.1| ERD (early-responsive to dehydration stress) family protein [Medicago 
truncatula]
Length=764

 Score =   181 bits (458),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 84/142 (59%), Positives = 109/142 (77%), Gaps = 3/142 (2%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQ+YES A FWPDVH R++  LI SQ+  +GLLST+  ++S   L+  PVLTI 
Sbjct  607  QIINVYNQQYESGATFWPDVHRRVVIGLIISQILLMGLLSTRGTSKSTLLLVAQPVLTIW  666

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            FHLYCKGR+ESAF K+PL++A +KDTLE+A EPN NL+ YLQ+AY+HPVFKG+E E    
Sbjct  667  FHLYCKGRFESAFVKYPLEDAMVKDTLERAIEPNLNLRHYLQEAYVHPVFKGDEFE---K  723

Query  274  GISEKADEENVLVQTKRQSRKN  209
             ++ + +EEN L+QTKR  R +
Sbjct  724  QVNVEDEEENPLIQTKRACRSS  745



>ref|XP_010488177.1| PREDICTED: CSC1-like protein At3g21620 isoform X2 [Camelina sativa]
Length=682

 Score =   178 bits (452),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 84/142 (59%), Positives = 107/142 (75%), Gaps = 1/142 (1%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQEYESA AFWPDVH R++ ALI SQ+  +GLLSTK AA+S P L +LPVLTI 
Sbjct  530  QIINVYNQEYESAGAFWPDVHRRVVIALIVSQLLLMGLLSTKRAARSTPLLFILPVLTIG  589

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            FH +CKGRY+  F ++PLQ+A +KDTLE+ REPN NLKP+LQ+AY HPVFK  ++  +  
Sbjct  590  FHKFCKGRYQPVFVRYPLQDAMVKDTLERTREPNLNLKPFLQNAYAHPVFKAADNLANEM  649

Query  274  GISE-KADEENVLVQTKRQSRK  212
             + E + +    LV TKR S++
Sbjct  650  VVEEPEPNRTPDLVATKRGSKR  671



>ref|NP_001147493.1| LOC100281102 [Zea mays]
 gb|ACG27714.1| HYP1 [Zea mays]
Length=768

 Score =   179 bits (453),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 87/144 (60%), Positives = 107/144 (74%), Gaps = 1/144 (1%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQ+YESAA FWP VHGRII ALI SQ+  LGL+ST    Q+ P L+VLPVLT  
Sbjct  604  QIINVYNQQYESAAQFWPSVHGRIITALIVSQLLLLGLMSTNDFEQTTPVLLVLPVLTFG  663

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            F+ YCK R+E AF ++PLQEA  KDTLE+AREPN +LK YL ++Y+HPVFKG+E +  Y 
Sbjct  664  FYKYCKNRFEPAFVRNPLQEAMKKDTLERAREPNLDLKAYLANSYLHPVFKGDEGDDRYS  723

Query  274  GISEKA-DEENVLVQTKRQSRKNT  206
             + +    EE V+V TKR SR+ T
Sbjct  724  VMDDDGWMEEEVIVPTKRHSRRTT  747



>ref|XP_010466416.1| PREDICTED: CSC1-like protein At3g21620 isoform X2 [Camelina sativa]
Length=682

 Score =   178 bits (452),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 84/142 (59%), Positives = 107/142 (75%), Gaps = 1/142 (1%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQEYESA AFWPDVH R++ ALI SQ+  +GLLSTK AA+S P L +LPVLTI 
Sbjct  530  QIINVYNQEYESAGAFWPDVHRRVVIALIVSQLLLMGLLSTKRAARSTPLLFILPVLTIG  589

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            FH +CKGRY+  F ++PLQ+A +KDTLE+ REPN NLKP+LQ+AY HPVFK  ++  +  
Sbjct  590  FHKFCKGRYQPVFVRYPLQDAMVKDTLERTREPNLNLKPFLQNAYAHPVFKAADNLANEM  649

Query  274  GISE-KADEENVLVQTKRQSRK  212
             + E + +    LV TKR S++
Sbjct  650  VVEEPEPNRTPDLVATKRGSKR  671



>ref|XP_010466415.1| PREDICTED: CSC1-like protein At3g21620 isoform X1 [Camelina sativa]
Length=757

 Score =   179 bits (453),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 84/142 (59%), Positives = 107/142 (75%), Gaps = 1/142 (1%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQEYESA AFWPDVH R++ ALI SQ+  +GLLSTK AA+S P L +LPVLTI 
Sbjct  605  QIINVYNQEYESAGAFWPDVHRRVVIALIVSQLLLMGLLSTKRAARSTPLLFILPVLTIG  664

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            FH +CKGRY+  F ++PLQ+A +KDTLE+ REPN NLKP+LQ+AY HPVFK  ++  +  
Sbjct  665  FHKFCKGRYQPVFVRYPLQDAMVKDTLERTREPNLNLKPFLQNAYAHPVFKAADNLANEM  724

Query  274  GISE-KADEENVLVQTKRQSRK  212
             + E + +    LV TKR S++
Sbjct  725  VVEEPEPNRTPDLVATKRGSKR  746



>ref|XP_010488175.1| PREDICTED: CSC1-like protein At3g21620 isoform X1 [Camelina sativa]
 ref|XP_010488176.1| PREDICTED: CSC1-like protein At3g21620 isoform X1 [Camelina sativa]
Length=757

 Score =   179 bits (453),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 84/142 (59%), Positives = 107/142 (75%), Gaps = 1/142 (1%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQEYESA AFWPDVH R++ ALI SQ+  +GLLSTK AA+S P L +LPVLTI 
Sbjct  605  QIINVYNQEYESAGAFWPDVHRRVVIALIVSQLLLMGLLSTKRAARSTPLLFILPVLTIG  664

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            FH +CKGRY+  F ++PLQ+A +KDTLE+ REPN NLKP+LQ+AY HPVFK  ++  +  
Sbjct  665  FHKFCKGRYQPVFVRYPLQDAMVKDTLERTREPNLNLKPFLQNAYAHPVFKAADNLANEM  724

Query  274  GISE-KADEENVLVQTKRQSRK  212
             + E + +    LV TKR S++
Sbjct  725  VVEEPEPNRTPDLVATKRGSKR  746



>gb|AFW81357.1| HYP1 isoform 1 [Zea mays]
 gb|AFW81358.1| HYP1 isoform 2 [Zea mays]
Length=768

 Score =   179 bits (453),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 87/144 (60%), Positives = 107/144 (74%), Gaps = 1/144 (1%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQ+YESAA FWP VHGRII ALI SQ+  LGL+ST    Q+ P L+VLPVLT  
Sbjct  604  QIINVYNQQYESAAQFWPSVHGRIITALIVSQLLLLGLMSTNDFEQTTPVLLVLPVLTFG  663

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            F+ YCK R+E AF ++PLQEA  KDTLE+AREPN +LK YL ++Y+HPVFKG+E +  Y 
Sbjct  664  FYKYCKNRFEPAFVRNPLQEAMKKDTLERAREPNLDLKAYLANSYLHPVFKGDEGDDRYS  723

Query  274  GISEKA-DEENVLVQTKRQSRKNT  206
             + +    EE V+V TKR SR+ T
Sbjct  724  VMDDDGWMEEEVIVPTKRHSRRTT  747



>emb|CBI32349.3| unnamed protein product [Vitis vinifera]
Length=766

 Score =   178 bits (452),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 92/150 (61%), Positives = 106/150 (71%), Gaps = 7/150 (5%)
 Frame = -3

Query  661  SFTDFCLTLQIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFL  482
            SF       QIINVY+Q+YES AAFWP VH R+I  L+ SQ+  +GLL+TK  ++S PFL
Sbjct  606  SFAYMVFRHQIINVYDQKYESGAAFWPSVHQRVIIGLMISQLLLMGLLNTKDFSKSTPFL  665

Query  481  IVLPVLTITFHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFK  302
            IVLPVLT  FH +C GR+ESAF + PLQEA +KDTLE+A EPN NLK YLQDAYIHPVFK
Sbjct  666  IVLPVLTFWFHRFCNGRFESAFVRFPLQEAMVKDTLERATEPNLNLKNYLQDAYIHPVFK  725

Query  301  GNEDEYDYDGISEKADEE--NVLVQTKRQS  218
            G E E       E  DEE  N LV TKR S
Sbjct  726  GGEFER-----PEVIDEEENNPLVATKRSS  750



>ref|XP_002271834.1| PREDICTED: CSC1-like protein At4g02900 [Vitis vinifera]
Length=756

 Score =   178 bits (452),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 92/150 (61%), Positives = 106/150 (71%), Gaps = 7/150 (5%)
 Frame = -3

Query  661  SFTDFCLTLQIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFL  482
            SF       QIINVY+Q+YES AAFWP VH R+I  L+ SQ+  +GLL+TK  ++S PFL
Sbjct  596  SFAYMVFRHQIINVYDQKYESGAAFWPSVHQRVIIGLMISQLLLMGLLNTKDFSKSTPFL  655

Query  481  IVLPVLTITFHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFK  302
            IVLPVLT  FH +C GR+ESAF + PLQEA +KDTLE+A EPN NLK YLQDAYIHPVFK
Sbjct  656  IVLPVLTFWFHRFCNGRFESAFVRFPLQEAMVKDTLERATEPNLNLKNYLQDAYIHPVFK  715

Query  301  GNEDEYDYDGISEKADEE--NVLVQTKRQS  218
            G E E       E  DEE  N LV TKR S
Sbjct  716  GGEFER-----PEVIDEEENNPLVATKRSS  740



>ref|XP_006352784.1| PREDICTED: uncharacterized membrane protein C2G11.09-like [Solanum 
tuberosum]
Length=766

 Score =   178 bits (452),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 88/153 (58%), Positives = 112/153 (73%), Gaps = 5/153 (3%)
 Frame = -3

Query  661  SFTDFCLTLQIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFL  482
            +F+      QIINVY+Q+YES A+FWPDV+ RI+  L+ S +  +GLLSTK A+QS P L
Sbjct  597  AFSYMVFRHQIINVYDQKYESGASFWPDVNRRILIGLVISHLLLIGLLSTKDASQSTPLL  656

Query  481  IVLPVLTITFHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFK  302
            IVL VLTI FH +CKGR+ES F K PLQ+A +KDT+E+  EPNFNLK YLQDAY+HPV K
Sbjct  657  IVLTVLTIWFHKFCKGRFESVFVKFPLQDAVVKDTVERTTEPNFNLKEYLQDAYLHPVLK  716

Query  301  GNEDEYDYDGISEKADEE-NVLVQTKRQSRKNT  206
            G     D++ + E  DEE N LV TKR SR+++
Sbjct  717  G----VDFEVLKELDDEEKNSLVATKRTSRRSS  745



>ref|XP_010510410.1| PREDICTED: CSC1-like protein At3g21620 [Camelina sativa]
Length=757

 Score =   178 bits (451),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 84/142 (59%), Positives = 107/142 (75%), Gaps = 1/142 (1%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQEYESA AFWPDVH R++ ALI SQ+  +GLLSTK AA+S P L +LPVLTI 
Sbjct  605  QIINVYNQEYESAGAFWPDVHRRVVIALIVSQLLLMGLLSTKRAARSTPLLFILPVLTIG  664

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            FH +CKGR++  F ++PLQ+A +KDTLE+ REPN NLKP+LQ+AY HPVFK  +D  +  
Sbjct  665  FHKFCKGRHQPVFVRYPLQDAMVKDTLERTREPNLNLKPFLQNAYAHPVFKAADDLANEL  724

Query  274  GISE-KADEENVLVQTKRQSRK  212
             + E + +    LV TKR S++
Sbjct  725  VVEEPEPNRTPDLVATKRGSKR  746



>dbj|BAD94445.1| hypothetical protein [Arabidopsis thaliana]
Length=756

 Score =   178 bits (451),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 86/142 (61%), Positives = 107/142 (75%), Gaps = 1/142 (1%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQEYESAAAFWPDVH R++ ALI SQ+  +GLLSTK AA+S P L +LPVLTI 
Sbjct  605  QIINVYNQEYESAAAFWPDVHRRVVIALIVSQLLLMGLLSTKKAARSTPLLFILPVLTIG  664

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            FH +C+GRY+  F  +PLQ+A +KDTLE+ REPN NLK +LQ+AY HPVFK  ++  +  
Sbjct  665  FHKFCQGRYQPIFVTYPLQDAMVKDTLERMREPNLNLKTFLQNAYAHPVFKAADNLANEM  724

Query  274  GISEKA-DEENVLVQTKRQSRK  212
             + E A D+   LV TKR SR+
Sbjct  725  VVEEPAPDKTPDLVATKRGSRR  746



>ref|XP_006299035.1| hypothetical protein CARUB_v10015172mg [Capsella rubella]
 gb|EOA31933.1| hypothetical protein CARUB_v10015172mg [Capsella rubella]
Length=756

 Score =   177 bits (450),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 84/143 (59%), Positives = 106/143 (74%), Gaps = 3/143 (2%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQEYESA AFWPDVH R++ AL+ SQ+  +GLLSTK AA+S P L +LPVLTI 
Sbjct  605  QIINVYNQEYESAGAFWPDVHRRVVIALVVSQLLLMGLLSTKRAARSTPLLFILPVLTIG  664

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            FH +CKGRY+  F ++PLQ+A +KDTLE+ REPN NLKP+LQ+AY HPVFK   D    +
Sbjct  665  FHKFCKGRYQPVFVRYPLQDAMVKDTLERIREPNLNLKPFLQNAYAHPVFKA-ADNLALE  723

Query  274  GISEKADEENV--LVQTKRQSRK  212
             + E+ +      LV TKR S++
Sbjct  724  MVVEEPEPGRTPDLVATKRGSKR  746



>ref|NP_188799.1| early-responsive to dehydration stress-related protein [Arabidopsis 
thaliana]
 sp|Q9LVE4.1|CSCL4_ARATH RecName: Full=CSC1-like protein At3g21620 [Arabidopsis thaliana]
 dbj|BAB02357.1| unnamed protein product [Arabidopsis thaliana]
 gb|AEE76531.1| early-responsive to dehydration stress-related protein [Arabidopsis 
thaliana]
 gb|AIU34617.1| hyperosmolality-gated Ca2+ permeable channel 1.5 [Arabidopsis 
thaliana]
Length=756

 Score =   177 bits (450),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 86/142 (61%), Positives = 107/142 (75%), Gaps = 1/142 (1%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQEYESAAAFWPDVH R++ ALI SQ+  +GLLSTK AA+S P L +LPVLTI 
Sbjct  605  QIINVYNQEYESAAAFWPDVHRRVVIALIVSQLLLMGLLSTKKAARSTPLLFILPVLTIG  664

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            FH +C+GRY+  F  +PLQ+A +KDTLE+ REPN NLK +LQ+AY HPVFK  ++  +  
Sbjct  665  FHKFCQGRYQPIFVTYPLQDAMVKDTLERMREPNLNLKTFLQNAYAHPVFKAADNLANEM  724

Query  274  GISEKA-DEENVLVQTKRQSRK  212
             + E A D+   LV TKR SR+
Sbjct  725  VVEEPAPDKTPDLVATKRGSRR  746



>ref|XP_006406250.1| hypothetical protein EUTSA_v10020132mg [Eutrema salsugineum]
 gb|ESQ47703.1| hypothetical protein EUTSA_v10020132mg [Eutrema salsugineum]
Length=757

 Score =   177 bits (450),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 84/144 (58%), Positives = 107/144 (74%), Gaps = 1/144 (1%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQEYESA +FWPDVH R++ ALI SQ+  +GLLSTK AA+S P L +LPVLTI 
Sbjct  605  QIINVYNQEYESAGSFWPDVHRRVVIALIVSQLLLMGLLSTKRAARSTPLLFILPVLTIG  664

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            FH +CKGRY+  F  +PLQ+A +KDTLE+ REPN NLK +LQ+AY+HPVFK  ++  +  
Sbjct  665  FHRFCKGRYQPVFVTYPLQDAMVKDTLERTREPNLNLKTFLQNAYVHPVFKAADNIGNEM  724

Query  274  GISE-KADEENVLVQTKRQSRKNT  206
             + E + D    LV TKR SR++ 
Sbjct  725  VVEEPQPDRTPDLVATKRGSRRHV  748



>ref|XP_002886475.1| F24O1.4 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH62734.1| F24O1.4 [Arabidopsis lyrata subsp. lyrata]
Length=778

 Score =   177 bits (449),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 88/133 (66%), Positives = 106/133 (80%), Gaps = 0/133 (0%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVY+Q+YESAAAFWPDVHGRII ALI SQ+  LGL+STK   QS PFL+VL ++T  
Sbjct  607  QIINVYDQKYESAAAFWPDVHGRIISALIISQILLLGLMSTKGKVQSTPFLLVLAIVTFG  666

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            FH +CKGRYESAF  +PLQEA +KDTLE+A+EPN NLK +LQ+AYIHPVFK  EDE +  
Sbjct  667  FHRFCKGRYESAFVINPLQEAMIKDTLERAKEPNLNLKGFLQNAYIHPVFKDEEDEDEEG  726

Query  274  GISEKADEENVLV  236
             I +  DE+ V+V
Sbjct  727  LIEDSDDEDCVVV  739



>ref|XP_003569103.1| PREDICTED: CSC1-like protein At3g21620 isoform X1 [Brachypodium 
distachyon]
Length=768

 Score =   177 bits (448),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 91/143 (64%), Positives = 105/143 (73%), Gaps = 0/143 (0%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQ YES A FWP VH RII ALI SQ+  LGLLSTK   +S P LIVLP+LT  
Sbjct  603  QIINVYNQRYESGAQFWPSVHLRIIVALIVSQLLLLGLLSTKDFEESTPALIVLPILTFW  662

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            FH YCK RYE AF ++PLQEA  KDTLE+AREPNF+LK YL DAY+HPVFK + D  D  
Sbjct  663  FHRYCKNRYEPAFVRNPLQEAMRKDTLERAREPNFDLKAYLADAYLHPVFKSDLDGVDKF  722

Query  274  GISEKADEENVLVQTKRQSRKNT  206
             +++    E V+V TKRQSR+ T
Sbjct  723  YVADDPGAEEVIVATKRQSRRTT  745



>ref|XP_010231849.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
isoform X2 [Brachypodium distachyon]
Length=703

 Score =   176 bits (446),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 91/143 (64%), Positives = 105/143 (73%), Gaps = 0/143 (0%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQ YES A FWP VH RII ALI SQ+  LGLLSTK   +S P LIVLP+LT  
Sbjct  538  QIINVYNQRYESGAQFWPSVHLRIIVALIVSQLLLLGLLSTKDFEESTPALIVLPILTFW  597

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            FH YCK RYE AF ++PLQEA  KDTLE+AREPNF+LK YL DAY+HPVFK + D  D  
Sbjct  598  FHRYCKNRYEPAFVRNPLQEAMRKDTLERAREPNFDLKAYLADAYLHPVFKSDLDGVDKF  657

Query  274  GISEKADEENVLVQTKRQSRKNT  206
             +++    E V+V TKRQSR+ T
Sbjct  658  YVADDPGAEEVIVATKRQSRRTT  680



>gb|KJB42871.1| hypothetical protein B456_007G171500 [Gossypium raimondii]
Length=788

 Score =   177 bits (448),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 88/143 (62%), Positives = 107/143 (75%), Gaps = 2/143 (1%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVY+QEYESAAAFWPDVH R++ ALI SQ+  +GLLSTK A+QS P LI LPVLTI 
Sbjct  625  QIINVYHQEYESAAAFWPDVHVRVVAALIVSQLLLMGLLSTKEASQSTPLLITLPVLTIC  684

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            FH +CKGRYE AF ++PLQEA MKDTLE+A+E N NLK +LQ+AYIHPVFK  ++     
Sbjct  685  FHRFCKGRYEPAFVRYPLQEAMMKDTLERAKEANLNLKGFLQNAYIHPVFKSADESDSES  744

Query  274  GISEKADEENVLVQTKRQSRKNT  206
                + +    LV TKR S++ T
Sbjct  745  --ESEWERSPALVATKRTSKRFT  765



>ref|XP_002885454.1| hypothetical protein ARALYDRAFT_342312 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61713.1| hypothetical protein ARALYDRAFT_342312 [Arabidopsis lyrata subsp. 
lyrata]
Length=756

 Score =   176 bits (447),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 84/142 (59%), Positives = 106/142 (75%), Gaps = 1/142 (1%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            Q+INVYNQEYESAAAFWPDVH R++ ALI SQ+  +GLLSTK AA+S P L +LPVLTI 
Sbjct  605  QVINVYNQEYESAAAFWPDVHRRVVIALIVSQLLLMGLLSTKRAARSTPLLFILPVLTIG  664

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            FH +C+GRY+  F ++PLQ+A +KDTLE+ REPN NLK +LQ+AY HPVFK  ++  +  
Sbjct  665  FHKFCQGRYQPIFVRYPLQDAMVKDTLERMREPNLNLKTFLQNAYAHPVFKAADNLANEM  724

Query  274  GISEK-ADEENVLVQTKRQSRK  212
             + E   D    LV TKR SR+
Sbjct  725  VVEEPHPDRTPDLVATKRGSRR  746



>gb|KJB42870.1| hypothetical protein B456_007G171500 [Gossypium raimondii]
Length=768

 Score =   176 bits (446),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 88/143 (62%), Positives = 107/143 (75%), Gaps = 2/143 (1%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVY+QEYESAAAFWPDVH R++ ALI SQ+  +GLLSTK A+QS P LI LPVLTI 
Sbjct  605  QIINVYHQEYESAAAFWPDVHVRVVAALIVSQLLLMGLLSTKEASQSTPLLITLPVLTIC  664

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            FH +CKGRYE AF ++PLQEA MKDTLE+A+E N NLK +LQ+AYIHPVFK  ++     
Sbjct  665  FHRFCKGRYEPAFVRYPLQEAMMKDTLERAKEANLNLKGFLQNAYIHPVFKSADESDSES  724

Query  274  GISEKADEENVLVQTKRQSRKNT  206
                + +    LV TKR S++ T
Sbjct  725  --ESEWERSPALVATKRTSKRFT  745



>gb|EAY97938.1| hypothetical protein OsI_19855 [Oryza sativa Indica Group]
 gb|EEE63624.1| hypothetical protein OsJ_18441 [Oryza sativa Japonica Group]
Length=783

 Score =   176 bits (445),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 86/143 (60%), Positives = 108/143 (76%), Gaps = 3/143 (2%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQ+YES A FWPDV  R++ ALI SQ+  LGLLST+ A +S   L+ LPVL+I 
Sbjct  621  QIINVYNQQYESGAQFWPDVQRRLVIALIVSQILLLGLLSTQEAEKSTVALLPLPVLSIW  680

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            FH  CKGR+E AF K PLQ+A +KDTLE+A +P  NL+ YL+DAY+HPVF+ N D Y++ 
Sbjct  681  FHYVCKGRFEPAFIKFPLQDAMVKDTLERANDPTLNLREYLKDAYVHPVFQKN-DIYEFA  739

Query  274  GISEKADEENVLVQTKRQSRKNT  206
            GI E  +E+N +V TKRQSR NT
Sbjct  740  GIDE--EEKNPMVATKRQSRMNT  760



>ref|NP_001055457.1| Os05g0393800 [Oryza sativa Japonica Group]
 gb|AAT93895.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF17371.1| Os05g0393800 [Oryza sativa Japonica Group]
 dbj|BAG91241.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|AIU34630.1| hyperosmolality-gated Ca2+ permeable channel 1.3 [Oryza sativa]
Length=767

 Score =   176 bits (445),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 86/143 (60%), Positives = 108/143 (76%), Gaps = 3/143 (2%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQ+YES A FWPDV  R++ ALI SQ+  LGLLST+ A +S   L+ LPVL+I 
Sbjct  605  QIINVYNQQYESGAQFWPDVQRRLVIALIVSQILLLGLLSTQEAEKSTVALLPLPVLSIW  664

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            FH  CKGR+E AF K PLQ+A +KDTLE+A +P  NL+ YL+DAY+HPVF+ N D Y++ 
Sbjct  665  FHYVCKGRFEPAFIKFPLQDAMVKDTLERANDPTLNLREYLKDAYVHPVFQKN-DIYEFA  723

Query  274  GISEKADEENVLVQTKRQSRKNT  206
            GI E  +E+N +V TKRQSR NT
Sbjct  724  GIDE--EEKNPMVATKRQSRMNT  744



>ref|XP_008808245.1| PREDICTED: CSC1-like protein At4g02900 isoform X1 [Phoenix dactylifera]
Length=759

 Score =   175 bits (444),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 83/143 (58%), Positives = 105/143 (73%), Gaps = 3/143 (2%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVY+QEYES AAFWPDVH R+I A+I SQ++ +GL+STK    + P LI LP+LTI 
Sbjct  605  QIINVYDQEYESGAAFWPDVHRRLIIAMIISQLTLMGLMSTKDPKHATPVLIALPILTIW  664

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            FH YCK R+E AF K PLQEA +KDTLE+A++PN NL+ YLQDAY+HPVF   + E    
Sbjct  665  FHKYCKSRFEPAFVKFPLQEAVVKDTLERAKDPNLNLRSYLQDAYVHPVFHSKDIE---R  721

Query  274  GISEKADEENVLVQTKRQSRKNT  206
             ++   +E N LV TKR S ++T
Sbjct  722  LVAIDEEENNPLVPTKRNSNRST  744



>ref|XP_004493651.1| PREDICTED: uncharacterized protein RSN1-like isoform X1 [Cicer 
arietinum]
 ref|XP_004493652.1| PREDICTED: uncharacterized protein RSN1-like isoform X2 [Cicer 
arietinum]
Length=759

 Score =   175 bits (443),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 88/154 (57%), Positives = 110/154 (71%), Gaps = 3/154 (2%)
 Frame = -3

Query  670  VQISFTDFCLTLQIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSA  491
            V  +F+      QIINVYNQ+YES A FWPDVH R+I  LI SQ+   GLLST+ A +S 
Sbjct  595  VFFAFSYMVFRHQIINVYNQQYESGATFWPDVHRRVIIGLIISQILLAGLLSTRGANKST  654

Query  490  PFLIVLPVLTITFHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHP  311
              LI  PVLTI FHLYCKGR+ESAF + PL++A +KDTLE+A EPN NL+ YLQDA++HP
Sbjct  655  LVLIAQPVLTIWFHLYCKGRFESAFVRFPLEDAMVKDTLERAVEPNLNLRLYLQDAFVHP  714

Query  310  VFKGNEDEYDYDGISEKADEENVLVQTKRQSRKN  209
            VFK   DE++   I +  +EEN L+QTKR  R +
Sbjct  715  VFKA--DEFEKPVIIDD-EEENPLIQTKRTCRSS  745



>ref|XP_004968885.1| PREDICTED: uncharacterized membrane protein YLR241W-like [Setaria 
italica]
Length=768

 Score =   175 bits (443),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 97/143 (68%), Positives = 111/143 (78%), Gaps = 1/143 (1%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQEYESAAAFWP VHGRII ALI SQ+  LGLLSTK A QS P L+VLPV+T  
Sbjct  604  QIINVYNQEYESAAAFWPSVHGRIITALIISQLLLLGLLSTKGAGQSTPVLLVLPVVTFY  663

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            FH YCK RYE  F K PLQEA  KDTLE+AREP F+LK YL +AYIHPVFK ++D+  + 
Sbjct  664  FHKYCKNRYEPTFVKCPLQEAMKKDTLERAREPGFDLKGYLMNAYIHPVFKVDDDDEKFS  723

Query  274  GISEKADEENVLVQTKRQSRKNT  206
             I+ + + E VLV TKRQSR+NT
Sbjct  724  -IAGEPEAEQVLVATKRQSRRNT  745



>ref|XP_009601393.1| PREDICTED: CSC1-like protein At4g02900 isoform X2 [Nicotiana 
tomentosiformis]
Length=642

 Score =   174 bits (441),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 85/143 (59%), Positives = 109/143 (76%), Gaps = 5/143 (3%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVY+Q+YES A+FWPDV+ RI+  L+ SQ+  +GLLSTK  A+S P LIVL VLTI 
Sbjct  493  QIINVYDQKYESGASFWPDVNRRILIGLVISQLLLIGLLSTKDTAKSTPLLIVLIVLTIW  552

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            FH  CKGR+ES F K PLQ+A +KDT+E++ EPNFNLK YLQDAY+HPV K  + E    
Sbjct  553  FHKLCKGRFESVFVKFPLQDAVVKDTVERSTEPNFNLKEYLQDAYLHPVLKVVKFE----  608

Query  274  GISEKADEENVLVQTKRQSRKNT  206
             +S++ DEEN LV TKR S++++
Sbjct  609  -VSKEIDEENPLVATKRTSQRSS  630



>ref|XP_009601331.1| PREDICTED: CSC1-like protein At4g02900 isoform X1 [Nicotiana 
tomentosiformis]
Length=755

 Score =   174 bits (441),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 85/143 (59%), Positives = 109/143 (76%), Gaps = 5/143 (3%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVY+Q+YES A+FWPDV+ RI+  L+ SQ+  +GLLSTK  A+S P LIVL VLTI 
Sbjct  606  QIINVYDQKYESGASFWPDVNRRILIGLVISQLLLIGLLSTKDTAKSTPLLIVLIVLTIW  665

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            FH  CKGR+ES F K PLQ+A +KDT+E++ EPNFNLK YLQDAY+HPV K  + E    
Sbjct  666  FHKLCKGRFESVFVKFPLQDAVVKDTVERSTEPNFNLKEYLQDAYLHPVLKVVKFE----  721

Query  274  GISEKADEENVLVQTKRQSRKNT  206
             +S++ DEEN LV TKR S++++
Sbjct  722  -VSKEIDEENPLVATKRTSQRSS  743



>ref|XP_006444131.1| hypothetical protein CICLE_v10024532mg [Citrus clementina]
 ref|XP_006479761.1| PREDICTED: uncharacterized membrane protein C2G11.09-like isoform 
X1 [Citrus sinensis]
 gb|ESR57371.1| hypothetical protein CICLE_v10024532mg [Citrus clementina]
Length=760

 Score =   174 bits (441),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 86/151 (57%), Positives = 110/151 (73%), Gaps = 2/151 (1%)
 Frame = -3

Query  670  VQISFTDFCLTLQIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSA  491
            V  +F+      Q+INVY+Q YES AAFWPDVH RII  LI SQ+  +GLLST+ A +S 
Sbjct  592  VFFAFSYVVFRHQVINVYDQIYESGAAFWPDVHRRIIINLIISQLLLMGLLSTRKADKST  651

Query  490  PFLIVLPVLTITFHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHP  311
            P LI+LPV+TI FH+YCKGR+E AF   PLQEA +KDTLE+A EPN NL+ YLQDAY+HP
Sbjct  652  PLLILLPVITIWFHVYCKGRFEPAFVTFPLQEAMVKDTLERATEPNLNLRTYLQDAYVHP  711

Query  310  VFKGNEDEYDYDGISEKADEENVLVQTKRQS  218
            VFKG +++ +   + E+ D    LV TKR++
Sbjct  712  VFKGIQEQ-NPPAVEEEEDSSP-LVATKRRN  740



>ref|XP_006479762.1| PREDICTED: uncharacterized membrane protein C2G11.09-like isoform 
X2 [Citrus sinensis]
Length=760

 Score =   174 bits (441),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 84/139 (60%), Positives = 106/139 (76%), Gaps = 2/139 (1%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            Q+INVY+Q YES AAFWPDVH RII  LI SQ+  +GLLST+ A +S P LI+LPV+TI 
Sbjct  604  QVINVYDQIYESGAAFWPDVHRRIIINLIISQLLLMGLLSTRKADKSTPLLILLPVITIW  663

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            FH+YCKGR+E AF   PLQEA +KDTLE+A EPN NL+ YLQDAY+HPVFKG +++ +  
Sbjct  664  FHVYCKGRFEPAFVTFPLQEAMVKDTLERATEPNLNLRTYLQDAYVHPVFKGIQEQ-NPP  722

Query  274  GISEKADEENVLVQTKRQS  218
             + E+ D    LV TKR++
Sbjct  723  AVEEEEDSSP-LVATKRRN  740



>ref|XP_006604421.1| PREDICTED: uncharacterized protein RSN1-like isoform X2 [Glycine 
max]
Length=756

 Score =   174 bits (440),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 82/143 (57%), Positives = 106/143 (74%), Gaps = 3/143 (2%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVY Q+YES  AFWPDVHGR++  LI SQ+  +GLL+T+   +S   LI  P+LT  
Sbjct  606  QIINVYAQQYESGGAFWPDVHGRVVMGLIISQILLMGLLTTRGTDKSTLVLIAQPILTFW  665

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            FH YCKGR+ESAF K PL+EA +KDTLE+A EPN NL+ YLQDAY+HPVFKG  D+++  
Sbjct  666  FHRYCKGRFESAFVKFPLEEAMVKDTLERAVEPNLNLRIYLQDAYVHPVFKG--DDFEKP  723

Query  274  GISEKADEENVLVQTKRQSRKNT  206
             I +  +E N L+QT R SR+++
Sbjct  724  AIIDD-EEGNPLIQTTRASRQDS  745



>ref|XP_003553451.1| PREDICTED: uncharacterized protein RSN1-like isoform X1 [Glycine 
max]
 gb|KHN45373.1| Putative membrane protein C2G11.09 [Glycine soja]
Length=756

 Score =   174 bits (440),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 82/143 (57%), Positives = 106/143 (74%), Gaps = 3/143 (2%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVY Q+YES  AFWPDVHGR++  LI SQ+  +GLL+T+   +S   LI  P+LT  
Sbjct  606  QIINVYAQQYESGGAFWPDVHGRVVMGLIISQILLMGLLTTRGTDKSTLVLIAQPILTFW  665

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            FH YCKGR+ESAF K PL+EA +KDTLE+A EPN NL+ YLQDAY+HPVFKG  D+++  
Sbjct  666  FHRYCKGRFESAFVKFPLEEAMVKDTLERAVEPNLNLRIYLQDAYVHPVFKG--DDFEKP  723

Query  274  GISEKADEENVLVQTKRQSRKNT  206
             I +  +E N L+QT R SR+++
Sbjct  724  AIIDD-EEGNPLIQTTRASRQDS  745



>ref|XP_007050676.1| ERD (early-responsive to dehydration stress) family protein [Theobroma 
cacao]
 gb|EOX94833.1| ERD (early-responsive to dehydration stress) family protein [Theobroma 
cacao]
Length=751

 Score =   173 bits (439),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 87/143 (61%), Positives = 106/143 (74%), Gaps = 3/143 (2%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            Q+INVY+Q YES A+FWPDVH R+I  LI SQ+  +GLLSTK   +S   L+ LP+LTI 
Sbjct  604  QVINVYDQRYESGASFWPDVHRRLIIGLIISQLLLMGLLSTKKIDKSTIALLPLPILTIW  663

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            FH YCKGR+ESAF K PLQ+A +KDTLE A EPN NLK YL+DAYIHPVFKG + E    
Sbjct  664  FHRYCKGRFESAFVKFPLQDAMIKDTLEHATEPNLNLKAYLKDAYIHPVFKGTDFERP-Q  722

Query  274  GISEKADEENVLVQTKRQSRKNT  206
             I E  +E+N LV TKR S++N+
Sbjct  723  LICE--EEDNPLVPTKRTSKQNS  743



>gb|KHN19872.1| Putative membrane protein C2G11.09 [Glycine soja]
Length=716

 Score =   173 bits (438),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 82/143 (57%), Positives = 105/143 (73%), Gaps = 3/143 (2%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQ+YES  +FWPD+HGR+I  LI SQ+  +GLLST+   +S   LI  P+LT+ 
Sbjct  566  QIINVYNQQYESGGSFWPDIHGRVISGLIISQILLMGLLSTRGTDKSTLVLIAQPILTLW  625

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            FH YCKGR+ESAF K PL+EA +KDTLE+A EPN NL+ YLQDAY+HP FKG  D++   
Sbjct  626  FHRYCKGRFESAFVKFPLEEAMVKDTLERAVEPNLNLRIYLQDAYVHPGFKG--DDFQKP  683

Query  274  GISEKADEENVLVQTKRQSRKNT  206
             I +  +E N L+QT R SR+ +
Sbjct  684  AIIDD-EENNPLIQTTRASRRGS  705



>ref|XP_003520558.1| PREDICTED: uncharacterized membrane protein C2G11.09-like [Glycine 
max]
Length=756

 Score =   173 bits (438),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 82/143 (57%), Positives = 105/143 (73%), Gaps = 3/143 (2%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQ+YES  +FWPD+HGR+I  LI SQ+  +GLLST+   +S   LI  P+LT+ 
Sbjct  606  QIINVYNQQYESGGSFWPDIHGRVISGLIISQILLMGLLSTRGTDKSTLVLIAQPILTLW  665

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            FH YCKGR+ESAF K PL+EA +KDTLE+A EPN NL+ YLQDAY+HP FKG  D++   
Sbjct  666  FHRYCKGRFESAFVKFPLEEAMVKDTLERAVEPNLNLRIYLQDAYVHPGFKG--DDFQKP  723

Query  274  GISEKADEENVLVQTKRQSRKNT  206
             I +  +E N L+QT R SR+ +
Sbjct  724  AIIDD-EENNPLIQTTRASRRGS  745



>ref|XP_006285697.1| hypothetical protein CARUB_v10007167mg [Capsella rubella]
 gb|EOA18595.1| hypothetical protein CARUB_v10007167mg [Capsella rubella]
Length=763

 Score =   173 bits (438),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 84/145 (58%), Positives = 110/145 (76%), Gaps = 2/145 (1%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            Q+INVYNQ+YESA  FWPDVH R++ ALI SQ+  +GLLSTKHA++S P L+VLP+LTI 
Sbjct  607  QVINVYNQKYESAGKFWPDVHRRVVTALIVSQLLLMGLLSTKHASKSTPLLLVLPMLTIG  666

Query  454  FHLYCKGRYESAFTKHPL-QEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDY  278
            FH++CK RY+ AF  +PL QEA +KDTLE+ REPN NLK +L+DAY HP F+  ED  + 
Sbjct  667  FHIHCKCRYQPAFVTYPLQQEAMIKDTLERTREPNLNLKAFLRDAYAHPEFRVGEDIDEE  726

Query  277  DGISE-KADEENVLVQTKRQSRKNT  206
             G+++ K+D    LV T+R S +NT
Sbjct  727  MGMTKAKSDMSPELVATRRGSWRNT  751



>ref|XP_009396325.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Musa acuminata subsp. malaccensis]
Length=762

 Score =   172 bits (437),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 97/143 (68%), Positives = 108/143 (76%), Gaps = 3/143 (2%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQEYESAAAFWPDV+ RII ALI SQ+  LGLLSTKHAA S P LI LPVLTI 
Sbjct  604  QIINVYNQEYESAAAFWPDVNRRIITALIISQLLLLGLLSTKHAAISTPLLIPLPVLTIW  663

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            FH +CK RYE AF K+PLQEA MKDTL+  REPN ++K YL +AY HPVFK  E E   D
Sbjct  664  FHRFCKNRYEPAFVKYPLQEAIMKDTLDHVREPNLDMKAYLLNAYTHPVFKNGETE---D  720

Query  274  GISEKADEENVLVQTKRQSRKNT  206
             +    + EN+LV TKRQSRK T
Sbjct  721  KVPGDEEFENILVPTKRQSRKGT  743



>gb|EMS50375.1| Transmembrane protein 63B [Triticum urartu]
Length=749

 Score =   172 bits (436),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 88/143 (62%), Positives = 104/143 (73%), Gaps = 2/143 (1%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQ YES A FWP+VH RII ALI SQ+  LGLLSTK   ++ P L+ LPVLTI 
Sbjct  588  QIINVYNQRYESGAQFWPNVHLRIITALIVSQLLFLGLLSTKGLEEATPALLALPVLTIW  647

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            FH YCK RYE AF ++PLQ+   KDTLE+ARE NF+LK YL DAY+HPVFK NE    Y 
Sbjct  648  FHKYCKHRYEPAFVRNPLQDVMRKDTLERARERNFDLKAYLADAYLHPVFKSNEAGKFY-  706

Query  274  GISEKADEENVLVQTKRQSRKNT  206
             +++    E V+V TKRQSR+ T
Sbjct  707  -VADDPGAEAVIVPTKRQSRRIT  728



>ref|XP_004242328.1| PREDICTED: CSC1-like protein At4g02900 isoform X1 [Solanum lycopersicum]
Length=766

 Score =   172 bits (435),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 85/153 (56%), Positives = 110/153 (72%), Gaps = 5/153 (3%)
 Frame = -3

Query  661  SFTDFCLTLQIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFL  482
            +F+      QIINVY+Q+YES A+FWPDV+ RI+  L+ S +  +GLLSTK A+QS P L
Sbjct  597  AFSYMVFRHQIINVYDQKYESGASFWPDVNRRILIGLVISHLLLIGLLSTKEASQSTPLL  656

Query  481  IVLPVLTITFHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFK  302
            IVL VLTI FH +CKGR+ES F + PLQ+A +KDT+E+  EPNFNLK YLQDAY+HPV K
Sbjct  657  IVLTVLTIWFHKFCKGRFESVFVRFPLQDAVVKDTVERTTEPNFNLKEYLQDAYLHPVLK  716

Query  301  GNEDEYDYDGISEKADE-ENVLVQTKRQSRKNT  206
            G     D++   E  DE +N LV TKR  R+++
Sbjct  717  G----VDFEVSREINDEGKNSLVATKRTCRRSS  745



>ref|XP_010090368.1| Uncharacterized membrane protein [Morus notabilis]
 gb|EXB39338.1| Uncharacterized membrane protein [Morus notabilis]
Length=878

 Score =   172 bits (437),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 85/155 (55%), Positives = 109/155 (70%), Gaps = 3/155 (2%)
 Frame = -3

Query  670  VQISFTDFCLTLQIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSA  491
            V  +F+      QIINVY+Q+YESAAAFWP VH R+I  LI +Q+  +GL STK  A+S 
Sbjct  593  VFFAFSFMVFRHQIINVYDQKYESAAAFWPHVHRRVIIGLIIAQLLLMGLFSTKGLAKST  652

Query  490  PFLIVLPVLTITFHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHP  311
              LI  P+LTI FH +CKGR+ESAF K PLQ+A +KDTLE+A +PN NL+ YL+DAY+HP
Sbjct  653  SLLIAQPILTIWFHRFCKGRFESAFLKFPLQDAMVKDTLERATQPNLNLRAYLKDAYVHP  712

Query  310  VFKGNEDEYDYDGISEKADEENVLVQTKRQSRKNT  206
            VFKG E E     ++   +E N LV TKR+S  N+
Sbjct  713  VFKGGELERP---VAIDEEESNPLVATKRKSSGNS  744



>ref|XP_009147329.1| PREDICTED: CSC1-like protein At4g15430 isoform X1 [Brassica rapa]
 ref|XP_009147337.1| PREDICTED: CSC1-like protein At4g15430 isoform X1 [Brassica rapa]
 ref|XP_009147346.1| PREDICTED: CSC1-like protein At4g15430 isoform X1 [Brassica rapa]
 ref|XP_009147353.1| PREDICTED: CSC1-like protein At4g15430 isoform X1 [Brassica rapa]
Length=762

 Score =   171 bits (434),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 82/143 (57%), Positives = 106/143 (74%), Gaps = 1/143 (1%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            Q+INVYNQ YESA  FWPDVH R++ ALI SQ+  +GLLSTK A++S PFL+VLPVLTI 
Sbjct  608  QVINVYNQNYESAGKFWPDVHRRVVTALIVSQLLLMGLLSTKQASKSTPFLLVLPVLTIG  667

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            FH++CK RY+ AF ++ LQEA +KDTLE+ REPN NLK + ++AY HP F+  ED  + +
Sbjct  668  FHMHCKCRYQPAFVRYSLQEAMIKDTLERTREPNLNLKAFFRNAYAHPEFRVGED-LELE  726

Query  274  GISEKADEENVLVQTKRQSRKNT  206
               EK ++   LV TKR S +NT
Sbjct  727  MAVEKPNKTPELVATKRGSWRNT  749



>ref|XP_009147362.1| PREDICTED: CSC1-like protein At4g15430 isoform X2 [Brassica rapa]
Length=761

 Score =   171 bits (434),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 82/143 (57%), Positives = 106/143 (74%), Gaps = 1/143 (1%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            Q+INVYNQ YESA  FWPDVH R++ ALI SQ+  +GLLSTK A++S PFL+VLPVLTI 
Sbjct  607  QVINVYNQNYESAGKFWPDVHRRVVTALIVSQLLLMGLLSTKQASKSTPFLLVLPVLTIG  666

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            FH++CK RY+ AF ++ LQEA +KDTLE+ REPN NLK + ++AY HP F+  ED  + +
Sbjct  667  FHMHCKCRYQPAFVRYSLQEAMIKDTLERTREPNLNLKAFFRNAYAHPEFRVGED-LELE  725

Query  274  GISEKADEENVLVQTKRQSRKNT  206
               EK ++   LV TKR S +NT
Sbjct  726  MAVEKPNKTPELVATKRGSWRNT  748



>ref|XP_002870239.1| hypothetical protein ARALYDRAFT_493346 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46498.1| hypothetical protein ARALYDRAFT_493346 [Arabidopsis lyrata subsp. 
lyrata]
Length=761

 Score =   171 bits (433),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 84/145 (58%), Positives = 110/145 (76%), Gaps = 4/145 (3%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            Q+INVYNQ+YESA  FWPDVH R++ AL+ SQ+  +GLLSTKHA++S PFL+VLP+LTI 
Sbjct  607  QVINVYNQKYESAGKFWPDVHRRVVTALVVSQLLLMGLLSTKHASKSTPFLLVLPLLTIG  666

Query  454  FHLYCKGRYESAFTKHPL-QEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDY  278
            FH++CK RY+ AF  +PL QEA +KDTL++ REPNFNLK +L+DAY HP F+  ED    
Sbjct  667  FHMHCKNRYQPAFVTYPLQQEAMIKDTLDRIREPNFNLKAFLRDAYAHPEFRVGEDPEPE  726

Query  277  DGI-SEKADEENVLVQTKRQSRKNT  206
            + + S+ +  E  LV TKR S +NT
Sbjct  727  EKLESDMSPPE--LVATKRGSWRNT  749



>ref|XP_006654360.1| PREDICTED: uncharacterized protein C354.08c-like [Oryza brachyantha]
Length=767

 Score =   170 bits (431),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 86/143 (60%), Positives = 105/143 (73%), Gaps = 3/143 (2%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVY Q+YES A FWPDV  R++ ALI SQ+  LGLLST+ A +S   LI LPVL+I 
Sbjct  605  QIINVYTQQYESGAQFWPDVQRRLVIALIVSQILLLGLLSTQEAEKSTVTLIPLPVLSIW  664

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            FH +CKGR+E AF K PLQ+A +KDTLE+A +P  NL+ YL+DAY+HPVF  N D Y+  
Sbjct  665  FHHFCKGRFEPAFIKFPLQDAMVKDTLERANDPTLNLREYLKDAYVHPVFHKN-DIYELV  723

Query  274  GISEKADEENVLVQTKRQSRKNT  206
             I E  +E+N LV TKRQSR NT
Sbjct  724  AIDE--EEKNPLVATKRQSRMNT  744



>gb|EYU46618.1| hypothetical protein MIMGU_mgv1a001779mg [Erythranthe guttata]
Length=760

 Score =   170 bits (430),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 80/129 (62%), Positives = 96/129 (74%), Gaps = 4/129 (3%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVY+Q+YES AAFWP VH R+I  L+ SQ   LGLLSTK  A++ PFLI LPVLTI 
Sbjct  605  QIINVYDQKYESGAAFWPAVHRRVIIGLVISQFLLLGLLSTKRIAKATPFLIALPVLTIW  664

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            FH +CKGR+ESAF K PLQ+  +KDTLE+A EPN NLK YLQD+Y+HPVFK     +D +
Sbjct  665  FHRFCKGRFESAFVKFPLQDTMVKDTLERATEPNLNLKAYLQDSYLHPVFKS----FDIE  720

Query  274  GISEKADEE  248
             +    DEE
Sbjct  721  RLGVAVDEE  729



>ref|XP_010326353.1| PREDICTED: CSC1-like protein At4g02900 [Solanum lycopersicum]
Length=751

 Score =   169 bits (429),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 93/156 (60%), Positives = 113/156 (72%), Gaps = 6/156 (4%)
 Frame = -3

Query  670  VQISFTDFCLTLQIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSA  491
            V  +F+      QIINVY+Q+YES AAFWPDVH RI+  L+ SQ+  LGLLSTK+ ++S 
Sbjct  593  VFFAFSYMVFRHQIINVYDQKYESGAAFWPDVHRRILTGLVISQLLLLGLLSTKNISKST  652

Query  490  PFLIVLPVLTITFHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHP  311
            P +I LPVLTI FH++CKGRYESAF K PLQ+A +KDTLE+A EP  NLK YL+ AY+HP
Sbjct  653  PVMIALPVLTIWFHIFCKGRYESAFVKFPLQDAMVKDTLERATEPTLNLKAYLKTAYVHP  712

Query  310  VFKGNEDEYDYDGISEKADEE-NVLVQTKRQSRKNT  206
            VFKG E     D  S   DEE N LV TKR SR+N+
Sbjct  713  VFKGVE----LDRPSAVDDEENNPLVPTKR-SRRNS  743



>ref|XP_003568506.1| PREDICTED: CSC1-like protein At4g02900 [Brachypodium distachyon]
Length=767

 Score =   169 bits (429),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 85/143 (59%), Positives = 105/143 (73%), Gaps = 3/143 (2%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQ+YES   FWPDV  RI+ ALI SQ+  LGLLST+ A +S   L+ LPVLTI 
Sbjct  605  QIINVYNQQYESGGLFWPDVQRRIVAALIVSQILLLGLLSTQEAEKSTVSLLPLPVLTIW  664

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            FH  CKGR+E A+ K PLQEA +KDTLE+A +P  NL+ YL+DAY+HPVF+ N D Y+  
Sbjct  665  FHYVCKGRFEPAYIKFPLQEAMVKDTLERANDPTLNLRDYLKDAYVHPVFQKN-DLYELV  723

Query  274  GISEKADEENVLVQTKRQSRKNT  206
             + E  +E+N LV T+RQSR NT
Sbjct  724  AMDE--EEKNPLVATRRQSRMNT  744



>ref|XP_004960982.1| PREDICTED: uncharacterized membrane protein YLR241W-like [Setaria 
italica]
Length=768

 Score =   169 bits (428),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 90/145 (62%), Positives = 107/145 (74%), Gaps = 2/145 (1%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQ+YES A FWP VHGRII ALI SQ+  LGLLSTK   ++ P L+VLPVLT  
Sbjct  605  QIINVYNQQYESGAQFWPSVHGRIITALIVSQLLLLGLLSTKGLEEATPVLLVLPVLTFW  664

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYD-Y  278
            F  YCK RYE AF ++PLQEA  KDTLE+AREPNF+LK YL ++Y+HPVFKG + + D Y
Sbjct  665  FFKYCKHRYEPAFVRNPLQEAMRKDTLERAREPNFDLKAYLANSYLHPVFKGTDHDDDRY  724

Query  277  DGISEKA-DEENVLVQTKRQSRKNT  206
              + +    EE VLV TKR SR+ T
Sbjct  725  STVDDDGWMEEEVLVPTKRHSRRTT  749



>ref|XP_002973564.1| hypothetical protein SELMODRAFT_442177 [Selaginella moellendorffii]
 gb|EFJ25224.1| hypothetical protein SELMODRAFT_442177 [Selaginella moellendorffii]
Length=759

 Score =   168 bits (426),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 79/155 (51%), Positives = 107/155 (69%), Gaps = 3/155 (2%)
 Frame = -3

Query  670  VQISFTDFCLTLQIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSA  491
            V ++F       Q+INVY+ EYESAAAFWP +H RII +L+  Q++  G+ + K AA S 
Sbjct  594  VYLAFAYVVYRHQVINVYDPEYESAAAFWPHIHNRIIVSLLVEQITLFGVFAGKRAAAST  653

Query  490  PFLIVLPVLTITFHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHP  311
            P LI LP++TI FH YCK R+E AF K+PL+EA  KD +++A  PN+N+K YLQ++Y+HP
Sbjct  654  PLLIGLPIMTIVFHYYCKNRFEPAFRKYPLEEAMSKDIVDRATHPNWNIKTYLQNSYMHP  713

Query  310  VFKGNEDEYDYDGISEKADEENVLVQTKRQSRKNT  206
            VFK +E+E D +G      E + LV TKR SR NT
Sbjct  714  VFKDSEEEMDEEGFDA---ERSTLVPTKRSSRSNT  745



>ref|XP_004293316.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Fragaria vesca subsp. vesca]
Length=734

 Score =   168 bits (425),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 79/119 (66%), Positives = 96/119 (81%), Gaps = 1/119 (1%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QI+NVY+QEYES AAFWPDVHGRI+ ALI SQ+  LGLLSTK AA + PFL+VLPV TI 
Sbjct  609  QIVNVYSQEYESGAAFWPDVHGRIVCALIISQLILLGLLSTKRAALATPFLLVLPVSTIV  668

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKG-NEDEYD  281
            F+ YC  R+E AF ++PLQEAKMKD LE AR+P+ N++ YLQ AY+HPVFK  +ED+ D
Sbjct  669  FYKYCADRFEPAFVRYPLQEAKMKDDLEHARDPDLNVRDYLQSAYVHPVFKVCDEDDED  727



>ref|XP_006854105.1| hypothetical protein AMTR_s00048p00143150 [Amborella trichopoda]
 gb|ERN15572.1| hypothetical protein AMTR_s00048p00143150 [Amborella trichopoda]
Length=760

 Score =   167 bits (424),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 78/115 (68%), Positives = 90/115 (78%), Gaps = 0/115 (0%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQEYES AAFWP VHGRII +L+ SQ   LGLLSTK AA S P LIVLPVLTI 
Sbjct  607  QIINVYNQEYESVAAFWPHVHGRIIASLLISQFLLLGLLSTKKAADSTPLLIVLPVLTIW  666

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNED  290
            FH YCK R+E AF K+PL+EA  +DT+E+A EPN NL  YL DAY+HP+F+  +D
Sbjct  667  FHKYCKSRFEPAFRKYPLEEAMARDTMERAEEPNLNLMAYLADAYLHPIFQSFDD  721



>ref|XP_002441130.1| hypothetical protein SORBIDRAFT_09g021010 [Sorghum bicolor]
 gb|EES19560.1| hypothetical protein SORBIDRAFT_09g021010 [Sorghum bicolor]
Length=768

 Score =   167 bits (424),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 83/143 (58%), Positives = 104/143 (73%), Gaps = 3/143 (2%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVY+Q YES A FWPDVH R+I ALI SQ+  LGLLST+ A +S   L+ LPVL+I 
Sbjct  605  QIINVYSQRYESGAQFWPDVHMRLIIALIVSQILLLGLLSTQEAEKSTVALLPLPVLSIW  664

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            FH  CKGR+E AF K PLQ+A +KDTLE AR+P  NL+ YL+ AY+HPVF+ N+    Y 
Sbjct  665  FHHVCKGRFEPAFVKFPLQDAMVKDTLELARDPTLNLREYLKGAYVHPVFQKND---IYK  721

Query  274  GISEKADEENVLVQTKRQSRKNT  206
             ++   +E+N +V TKRQSR NT
Sbjct  722  VVAMDEEEKNPIVVTKRQSRMNT  744



>ref|XP_002975592.1| hypothetical protein SELMODRAFT_150725 [Selaginella moellendorffii]
 gb|EFJ23221.1| hypothetical protein SELMODRAFT_150725 [Selaginella moellendorffii]
Length=759

 Score =   167 bits (423),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 78/155 (50%), Positives = 107/155 (69%), Gaps = 3/155 (2%)
 Frame = -3

Query  670  VQISFTDFCLTLQIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSA  491
            V ++F       Q+INVY+ EYESAAAFWP +H RII +L+  Q++  G+ + K AA S 
Sbjct  594  VYLAFAYVVYRHQVINVYDPEYESAAAFWPHIHNRIIVSLLVEQITLFGVFAGKRAAAST  653

Query  490  PFLIVLPVLTITFHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHP  311
            P LI LP++TI FH YCK R+E AF K+PL+EA  KD +++A  PN+N+K YLQ++Y+HP
Sbjct  654  PLLIGLPIMTIVFHYYCKNRFEPAFRKYPLEEAMSKDIVDRATHPNWNIKTYLQNSYMHP  713

Query  310  VFKGNEDEYDYDGISEKADEENVLVQTKRQSRKNT  206
            VFK +E+E D +G      E + LV TK+ SR NT
Sbjct  714  VFKDSEEEMDEEGFDA---ERSTLVPTKKSSRSNT  745



>ref|XP_004962175.1| PREDICTED: uncharacterized protein RSN1-like [Setaria italica]
Length=767

 Score =   167 bits (422),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 85/143 (59%), Positives = 103/143 (72%), Gaps = 3/143 (2%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQ+YES A FWPDVH R+I ALI SQ+  LGLLST+ A +S   L+ LPVL+I 
Sbjct  605  QIINVYNQQYESGAQFWPDVHMRLIIALIVSQILLLGLLSTQEAEKSTVALLPLPVLSIW  664

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            FH  CKGR+E AF K PLQ+A +KDTLE+A +P  NL+ YL+ AY+HPVF+ N D Y   
Sbjct  665  FHYVCKGRFEPAFVKFPLQDAMVKDTLERAHDPTLNLRDYLKGAYVHPVFQKN-DIYQLV  723

Query  274  GISEKADEENVLVQTKRQSRKNT  206
             I E  +E+N LV TKRQ R  T
Sbjct  724  AIDE--EEKNPLVVTKRQPRMTT  744



>ref|XP_007162399.1| hypothetical protein PHAVU_001G148800g [Phaseolus vulgaris]
 ref|XP_007162400.1| hypothetical protein PHAVU_001G148800g [Phaseolus vulgaris]
 gb|ESW34393.1| hypothetical protein PHAVU_001G148800g [Phaseolus vulgaris]
 gb|ESW34394.1| hypothetical protein PHAVU_001G148800g [Phaseolus vulgaris]
Length=753

 Score =   167 bits (422),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 80/142 (56%), Positives = 104/142 (73%), Gaps = 3/142 (2%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQ+YES AAFWPDVHGR++  LI SQ+  +GLLST+    S   LI  P+LT  
Sbjct  606  QIINVYNQQYESGAAFWPDVHGRVVTGLIISQILLMGLLSTRGTETSTLVLIAQPILTFW  665

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            FH YCKG +ESAF K PL+EA +KDTLE+A EPN NL+ YLQ AY+HPVFK  +D+++  
Sbjct  666  FHRYCKGLFESAFVKFPLEEAMVKDTLERAVEPNLNLRLYLQKAYVHPVFK--DDDFEKP  723

Query  274  GISEKADEENVLVQTKRQSRKN  209
             + +  +E+N L+QT R +R +
Sbjct  724  VVVDD-EEDNPLIQTTRPTRSS  744



>gb|AAC79116.1| hypothetical protein [Arabidopsis thaliana]
Length=680

 Score =   166 bits (420),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 81/143 (57%), Positives = 106/143 (74%), Gaps = 3/143 (2%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            Q+INVY+Q+YES A +WPDVH R+I  LI SQ+  +GLLSTK  A+    L+  P+LT  
Sbjct  500  QVINVYDQKYESGARYWPDVHRRLIICLIISQLLMMGLLSTKKFAKVTALLLPQPILTFW  559

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            F+ YC GR+ESAF+K PLQEA +KDTLE+A EPN NLK YL+DAY+HPVFKGN  ++D  
Sbjct  560  FYRYCAGRFESAFSKFPLQEAMVKDTLEKATEPNLNLKEYLKDAYVHPVFKGN--DFDRP  617

Query  274  GISEKADEENVLVQTKRQSRKNT  206
             + ++ +E N LV+TKR S+  T
Sbjct  618  RVVDE-EESNPLVRTKRTSQGTT  639



>ref|XP_008451390.1| PREDICTED: uncharacterized membrane protein C2G11.09 isoform 
X1 [Cucumis melo]
 ref|XP_008451391.1| PREDICTED: uncharacterized membrane protein C2G11.09 isoform 
X1 [Cucumis melo]
Length=761

 Score =   166 bits (421),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 82/155 (53%), Positives = 106/155 (68%), Gaps = 3/155 (2%)
 Frame = -3

Query  670  VQISFTDFCLTLQIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSA  491
            V  SF+      QIINVYNQ+YES AAFWP VH R+I  LI +Q+  +GL S + A +S+
Sbjct  592  VFFSFSYLVYRHQIINVYNQKYESGAAFWPHVHRRVIIGLILAQLLLMGLFSMREAEKSS  651

Query  490  PFLIVLPVLTITFHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHP  311
             FL+ LP+LTI  H +CKGR+ESAF K PLQ+A +KDTLE+A EPN +LK YL+DAY+HP
Sbjct  652  LFLVALPILTIWVHKFCKGRFESAFVKFPLQDAMVKDTLEKATEPNLDLKAYLKDAYVHP  711

Query  310  VFKGNEDEYDYDGISEKADEENVLVQTKRQSRKNT  206
            VFK +  E     +    +E N LV TKR S + +
Sbjct  712  VFKSSSIE---QTLLIDDEENNTLVPTKRTSHRGS  743



>ref|XP_008451392.1| PREDICTED: uncharacterized membrane protein C2G11.09 isoform 
X2 [Cucumis melo]
Length=759

 Score =   166 bits (421),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 82/155 (53%), Positives = 106/155 (68%), Gaps = 3/155 (2%)
 Frame = -3

Query  670  VQISFTDFCLTLQIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSA  491
            V  SF+      QIINVYNQ+YES AAFWP VH R+I  LI +Q+  +GL S + A +S+
Sbjct  592  VFFSFSYLVYRHQIINVYNQKYESGAAFWPHVHRRVIIGLILAQLLLMGLFSMREAEKSS  651

Query  490  PFLIVLPVLTITFHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHP  311
             FL+ LP+LTI  H +CKGR+ESAF K PLQ+A +KDTLE+A EPN +LK YL+DAY+HP
Sbjct  652  LFLVALPILTIWVHKFCKGRFESAFVKFPLQDAMVKDTLEKATEPNLDLKAYLKDAYVHP  711

Query  310  VFKGNEDEYDYDGISEKADEENVLVQTKRQSRKNT  206
            VFK +  E     +    +E N LV TKR S + +
Sbjct  712  VFKSSSIE---QTLLIDDEENNTLVPTKRTSHRGS  743



>ref|XP_010110412.1| Uncharacterized protein RSN1 [Morus notabilis]
 gb|EXC26244.1| Uncharacterized protein RSN1 [Morus notabilis]
Length=365

 Score =   162 bits (409),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 76/116 (66%), Positives = 91/116 (78%), Gaps = 0/116 (0%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVYNQ+YESAAAFWP VH RII +L  SQ+  +GLLSTK AA S P L+VLP+LTI 
Sbjct  163  QIINVYNQQYESAAAFWPHVHTRIIASLFISQLLLMGLLSTKKAANSTPLLVVLPILTIA  222

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDE  287
            FH YCK R+E AF K+PL+EA  KDT E+A EP+ NLK YL DAY+HP+F+  E+E
Sbjct  223  FHKYCKHRFEPAFRKYPLEEAMAKDTAERAAEPDLNLKAYLADAYLHPIFQSFEEE  278



>ref|XP_009393118.1| PREDICTED: CSC1-like protein At4g02900 [Musa acuminata subsp. 
malaccensis]
Length=758

 Score =   166 bits (420),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 83/143 (58%), Positives = 107/143 (75%), Gaps = 5/143 (3%)
 Frame = -3

Query  634  QIINVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTIT  455
            QIINVY QEYESAAAFWPDV  R+I A+I SQ+  +GL+STKH + + P L VLP+LTI 
Sbjct  605  QIINVYTQEYESAAAFWPDVIRRVIIAMIISQLLLMGLMSTKHGSLTVPIL-VLPLLTIW  663

Query  454  FHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD  275
            FH+YCK R+E AF K PLQ+A +KDTLE+A EP+ NL+ YLQDAY+HP F  + ++ ++ 
Sbjct  664  FHIYCKSRFEPAFIKFPLQDAMVKDTLERATEPHLNLRAYLQDAYVHPDF--HSEDVEHP  721

Query  274  GISEKADEENVLVQTKRQSRKNT  206
             I E  +E N LV T R SR++T
Sbjct  722  MIIE--EENNTLVPTIRTSRRST  742



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1158382918520