BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF009C03

Length=751
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006359499.1|  PREDICTED: heparanase-like protein 3-like          281   2e-87   Solanum tuberosum [potatoes]
ref|XP_009625836.1|  PREDICTED: heparanase-like protein 3               278   2e-86   Nicotiana tomentosiformis
ref|XP_009757548.1|  PREDICTED: heparanase-like protein 3               278   2e-86   Nicotiana sylvestris
ref|XP_004242732.1|  PREDICTED: heparanase-like protein 3               271   2e-83   Solanum lycopersicum
emb|CBI25561.3|  unnamed protein product                                268   2e-82   Vitis vinifera
ref|XP_010100865.1|  Heparanase-like protein 3                          266   7e-82   
ref|XP_002263173.1|  PREDICTED: heparanase-like protein 3               264   9e-81   Vitis vinifera
ref|XP_010687865.1|  PREDICTED: heparanase-like protein 3               263   1e-80   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010250274.1|  PREDICTED: heparanase-like protein 3               263   1e-80   Nelumbo nucifera [Indian lotus]
emb|CDP10485.1|  unnamed protein product                                263   2e-80   Coffea canephora [robusta coffee]
emb|CAN81917.1|  hypothetical protein VITISV_038549                     265   3e-80   Vitis vinifera
ref|XP_006381083.1|  hypothetical protein POPTR_0006s06100g             262   5e-80   
ref|XP_006381082.1|  hypothetical protein POPTR_0006s06100g             262   5e-80   
gb|KDO73428.1|  hypothetical protein CISIN_1g008762mg                   261   1e-79   Citrus sinensis [apfelsine]
ref|XP_007203617.1|  hypothetical protein PRUPE_ppa003883mg             260   2e-79   Prunus persica
ref|XP_006453123.1|  hypothetical protein CICLE_v10007919mg             260   2e-79   Citrus clementina [clementine]
gb|KDO73427.1|  hypothetical protein CISIN_1g008762mg                   260   2e-79   Citrus sinensis [apfelsine]
ref|XP_008242878.1|  PREDICTED: heparanase-like protein 3               259   4e-79   Prunus mume [ume]
ref|XP_009358543.1|  PREDICTED: heparanase-like protein 3               259   7e-79   Pyrus x bretschneideri [bai li]
ref|XP_009338385.1|  PREDICTED: heparanase-like protein 3               259   8e-79   Pyrus x bretschneideri [bai li]
ref|XP_008457259.1|  PREDICTED: LOW QUALITY PROTEIN: heparanase-l...    258   1e-78   Cucumis melo [Oriental melon]
ref|XP_008336960.1|  PREDICTED: heparanase-like protein 3               258   2e-78   
ref|XP_009363939.1|  PREDICTED: heparanase-like protein 3               257   5e-78   Pyrus x bretschneideri [bai li]
gb|AFK44771.1|  unknown                                                 243   3e-77   Medicago truncatula
ref|XP_002533671.1|  heparanase, putative                               254   4e-77   Ricinus communis
ref|XP_011457618.1|  PREDICTED: heparanase-like protein 3               254   4e-77   Fragaria vesca subsp. vesca
ref|XP_006389405.1|  hypothetical protein POPTR_0025s00410g             254   5e-77   
ref|XP_011020240.1|  PREDICTED: heparanase-like protein 3               253   1e-76   Populus euphratica
gb|AFK40288.1|  unknown                                                 251   4e-76   Lotus japonicus
ref|XP_008385022.1|  PREDICTED: heparanase-like protein 3               251   6e-76   
ref|XP_003533856.1|  PREDICTED: heparanase-like protein 3-like          248   1e-74   Glycine max [soybeans]
ref|XP_008219534.1|  PREDICTED: heparanase-like protein 3 isoform X1    248   1e-74   Prunus mume [ume]
ref|XP_003546578.1|  PREDICTED: heparanase-like protein 3-like          246   3e-74   Glycine max [soybeans]
gb|AAC62794.1|  T2L5.6 gene product                                     236   3e-74   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007013614.1|  Glucuronidase 3 isoform 2                          247   4e-74   
ref|XP_010533116.1|  PREDICTED: heparanase-like protein 3               246   9e-74   Tarenaya hassleriana [spider flower]
ref|XP_002324878.2|  hypothetical protein POPTR_0018s02050g             246   9e-74   
gb|KDP30214.1|  hypothetical protein JCGZ_16996                         246   1e-73   Jatropha curcas
ref|XP_011017900.1|  PREDICTED: heparanase-like protein 3 isoform X1    245   1e-73   Populus euphratica
ref|XP_007013613.1|  Glucuronidase 3 isoform 1                          247   1e-73   
ref|XP_009409980.1|  PREDICTED: heparanase-like protein 3               245   2e-73   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010435392.1|  PREDICTED: heparanase-like protein 3               238   3e-73   
ref|XP_007138475.1|  hypothetical protein PHAVU_009G212400g             244   3e-73   Phaseolus vulgaris [French bean]
ref|XP_008219535.1|  PREDICTED: heparanase-like protein 3 isoform X2    244   4e-73   Prunus mume [ume]
gb|ACJ85694.1|  unknown                                                 232   4e-73   Medicago truncatula
gb|KHG18442.1|  hypothetical protein F383_07597                         243   7e-73   Gossypium arboreum [tree cotton]
ref|XP_008801894.1|  PREDICTED: heparanase-like protein 3 isoform X2    241   1e-72   
ref|XP_007224283.1|  hypothetical protein PRUPE_ppa019445mg             241   2e-72   
gb|KJB64649.1|  hypothetical protein B456_010G059600                    242   2e-72   Gossypium raimondii
ref|XP_006283483.1|  hypothetical protein CARUB_v10004531mg             242   2e-72   Capsella rubella
gb|KEH37925.1|  glycoside hydrolase family 79 amino-terminal doma...    241   3e-72   Medicago truncatula
ref|XP_004159389.1|  PREDICTED: LOW QUALITY PROTEIN: heparanase-l...    241   3e-72   
ref|XP_004139281.1|  PREDICTED: heparanase-like protein 3-like          241   4e-72   Cucumis sativus [cucumbers]
ref|XP_008801893.1|  PREDICTED: heparanase-like protein 3 isoform X1    241   5e-72   Phoenix dactylifera
ref|XP_011081531.1|  PREDICTED: heparanase-like protein 3               241   8e-72   Sesamum indicum [beniseed]
gb|KHG18266.1|  hypothetical protein F383_21213                         239   1e-71   Gossypium arboreum [tree cotton]
ref|XP_011036604.1|  PREDICTED: heparanase-like protein 3 isoform X2    239   1e-71   Populus euphratica
ref|XP_002283260.2|  PREDICTED: heparanase-like protein 3               239   2e-71   
gb|EYU34947.1|  hypothetical protein MIMGU_mgv1a004017mg                239   2e-71   Erythranthe guttata [common monkey flower]
ref|XP_010906003.1|  PREDICTED: heparanase-like protein 3               239   2e-71   Elaeis guineensis
ref|XP_009355782.1|  PREDICTED: heparanase-like protein 3               239   3e-71   Pyrus x bretschneideri [bai li]
ref|XP_011036603.1|  PREDICTED: heparanase-like protein 3 isoform X1    239   3e-71   Populus euphratica
ref|NP_851092.1|  glucuronidase 3                                       235   3e-71   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010440690.1|  PREDICTED: heparanase-like protein 3               238   5e-71   Camelina sativa [gold-of-pleasure]
ref|XP_004488517.1|  PREDICTED: heparanase-like protein 3-like          238   6e-71   Cicer arietinum [garbanzo]
gb|EYU20239.1|  hypothetical protein MIMGU_mgv1a026019mg                238   7e-71   Erythranthe guttata [common monkey flower]
gb|KJB23649.1|  hypothetical protein B456_004G108900                    238   8e-71   Gossypium raimondii
emb|CDY12398.1|  BnaC08g08070D                                          238   8e-71   Brassica napus [oilseed rape]
gb|KJB23650.1|  hypothetical protein B456_004G108900                    238   8e-71   Gossypium raimondii
emb|CDY47561.1|  BnaA08g07260D                                          237   1e-70   Brassica napus [oilseed rape]
ref|XP_009108062.1|  PREDICTED: heparanase-like protein 3               237   1e-70   Brassica rapa
ref|XP_010648741.1|  PREDICTED: heparanase-like protein 3               238   1e-70   Vitis vinifera
ref|XP_006852836.1|  hypothetical protein AMTR_s00033p00188330          237   1e-70   
ref|XP_009393723.1|  PREDICTED: heparanase-like protein 3               235   8e-70   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008394121.1|  PREDICTED: heparanase-like protein 3 isoform X2    235   9e-70   Malus domestica [apple tree]
ref|XP_002870409.1|  glycosyl hydrolase family 79 N-terminal doma...    234   1e-69   Arabidopsis lyrata subsp. lyrata
ref|NP_851093.1|  glucuronidase 3                                       234   2e-69   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007011804.1|  Glucuronidase 3 isoform 2                          233   2e-69   
dbj|BAB10787.1|  unnamed protein product                                234   2e-69   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003609474.1|  Heparanase-like protein                            234   2e-69   Medicago truncatula
ref|XP_008394120.1|  PREDICTED: heparanase-like protein 3 isoform X1    234   2e-69   Malus domestica [apple tree]
ref|XP_010450341.1|  PREDICTED: heparanase-like protein 3               234   3e-69   Camelina sativa [gold-of-pleasure]
ref|XP_007011803.1|  Glucuronidase 3 isoform 1                          233   5e-69   
ref|XP_006403100.1|  hypothetical protein EUTSA_v10003449mg             232   1e-68   
emb|CDP13545.1|  unnamed protein product                                230   4e-68   Coffea canephora [robusta coffee]
gb|KFK22707.1|  hypothetical protein AALP_AAs49083U000200               231   4e-68   Arabis alpina [alpine rockcress]
ref|XP_006483406.1|  PREDICTED: heparanase-like protein 3-like is...    230   8e-68   Citrus sinensis [apfelsine]
ref|XP_011078541.1|  PREDICTED: heparanase-like protein 3               229   1e-67   Sesamum indicum [beniseed]
ref|XP_008793957.1|  PREDICTED: heparanase-like protein 3               226   2e-67   Phoenix dactylifera
ref|XP_002452991.1|  hypothetical protein SORBIDRAFT_04g036200          228   3e-67   Sorghum bicolor [broomcorn]
ref|XP_010927354.1|  PREDICTED: heparanase-like protein 3 isoform X2    226   3e-67   
ref|NP_001241969.1|  uncharacterized protein LOC100792087 precursor     228   4e-67   
gb|EMT25528.1|  Heparanase-like protein 3                               226   4e-67   
ref|XP_002515478.1|  heparanase, putative                               228   4e-67   
ref|XP_004249602.1|  PREDICTED: heparanase-like protein 3               228   5e-67   Solanum lycopersicum
ref|XP_003542659.1|  PREDICTED: heparanase-like protein 3-like          227   6e-67   Glycine max [soybeans]
ref|XP_006450373.1|  hypothetical protein CICLE_v10010401mg             228   6e-67   
gb|EPS66918.1|  hypothetical protein M569_07858                         227   8e-67   Genlisea aurea
ref|XP_006338978.1|  PREDICTED: heparanase-like protein 3-like          227   9e-67   Solanum tuberosum [potatoes]
ref|XP_009792772.1|  PREDICTED: heparanase-like protein 3 isoform X2    227   1e-66   Nicotiana sylvestris
ref|XP_009623092.1|  PREDICTED: heparanase-like protein 3               227   1e-66   Nicotiana tomentosiformis
ref|XP_009792771.1|  PREDICTED: heparanase-like protein 3 isoform X1    227   1e-66   Nicotiana sylvestris
gb|KHN15030.1|  Heparanase-like protein 3                               226   2e-66   Glycine soja [wild soybean]
ref|XP_010927353.1|  PREDICTED: heparanase-like protein 3 isoform X1    225   4e-66   Elaeis guineensis
ref|XP_007155083.1|  hypothetical protein PHAVU_003G171800g             224   8e-66   Phaseolus vulgaris [French bean]
ref|XP_007155084.1|  hypothetical protein PHAVU_003G171800g             224   8e-66   Phaseolus vulgaris [French bean]
ref|XP_004508419.1|  PREDICTED: heparanase-like protein 3-like          224   1e-65   Cicer arietinum [garbanzo]
ref|XP_010099859.1|  Heparanase-like protein 3                          224   2e-65   Morus notabilis
gb|EMS60649.1|  Heparanase-like protein 3                               224   2e-65   Triticum urartu
gb|KDO61807.1|  hypothetical protein CISIN_1g037212mg                   224   2e-65   Citrus sinensis [apfelsine]
ref|XP_011459847.1|  PREDICTED: heparanase-like protein 3               220   2e-65   Fragaria vesca subsp. vesca
gb|KDP33563.1|  hypothetical protein JCGZ_07134                         223   3e-65   Jatropha curcas
emb|CBI21126.3|  unnamed protein product                                227   7e-65   Vitis vinifera
ref|XP_003561019.1|  PREDICTED: heparanase-like protein 3               221   1e-64   Brachypodium distachyon [annual false brome]
gb|KJB27355.1|  hypothetical protein B456_004G293000                    221   1e-64   Gossypium raimondii
gb|KJB27356.1|  hypothetical protein B456_004G293000                    221   2e-64   Gossypium raimondii
ref|XP_010048938.1|  PREDICTED: heparanase-like protein 3 isoform X2    220   2e-64   Eucalyptus grandis [rose gum]
ref|XP_006648064.1|  PREDICTED: heparanase-like protein 3-like          221   3e-64   Oryza brachyantha
ref|XP_010048937.1|  PREDICTED: heparanase-like protein 3 isoform X1    219   7e-64   Eucalyptus grandis [rose gum]
dbj|BAJ89245.1|  predicted protein                                      219   9e-64   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004954253.1|  PREDICTED: heparanase-like protein 3-like          219   2e-63   Setaria italica
gb|AFW77131.1|  hypothetical protein ZEAMMB73_462319                    212   2e-63   
ref|XP_004964694.1|  PREDICTED: heparanase-like protein 3-like          218   3e-63   Setaria italica
ref|XP_003570329.1|  PREDICTED: heparanase-like protein 3               218   4e-63   Brachypodium distachyon [annual false brome]
gb|AFW73900.1|  hypothetical protein ZEAMMB73_176333                    218   4e-63   
ref|NP_001048420.1|  Os02g0802200                                       217   5e-63   
ref|XP_006655848.1|  PREDICTED: heparanase-like protein 3-like          214   7e-63   Oryza brachyantha
ref|XP_010048935.1|  PREDICTED: heparanase-like protein 3               217   1e-62   Eucalyptus grandis [rose gum]
gb|EAY87898.1|  hypothetical protein OsI_09318                          216   2e-62   Oryza sativa Indica Group [Indian rice]
ref|XP_008647415.1|  PREDICTED: uncharacterized protein LOC100193...    210   1e-61   
ref|XP_008647414.1|  PREDICTED: uncharacterized protein LOC100193...    211   4e-61   Zea mays [maize]
ref|XP_010048934.1|  PREDICTED: heparanase-like protein 3 isoform X2    210   5e-61   Eucalyptus grandis [rose gum]
ref|NP_001132339.1|  uncharacterized protein LOC100193781 precursor     211   1e-60   
gb|EYU34948.1|  hypothetical protein MIMGU_mgv1a004017mg                211   1e-60   Erythranthe guttata [common monkey flower]
gb|ACF81144.1|  unknown                                                 211   2e-60   Zea mays [maize]
ref|NP_001056967.1|  Os06g0179000                                       209   3e-60   
gb|EAY99897.1|  hypothetical protein OsI_21892                          209   3e-60   Oryza sativa Indica Group [Indian rice]
gb|EAZ36024.1|  hypothetical protein OsJ_20330                          209   4e-60   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010665516.1|  PREDICTED: heparanase-like protein 3 isoform X2    209   5e-60   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010048933.1|  PREDICTED: heparanase-like protein 3 isoform X1    209   6e-60   Eucalyptus grandis [rose gum]
ref|XP_010665510.1|  PREDICTED: heparanase-like protein 3 isoform X1    209   2e-59   
dbj|BAJ90636.1|  predicted protein                                      207   3e-59   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010050122.1|  PREDICTED: heparanase-like protein 3               206   7e-59   Eucalyptus grandis [rose gum]
gb|EPS67583.1|  hypothetical protein M569_07189                         205   2e-58   Genlisea aurea
gb|EYU38304.1|  hypothetical protein MIMGU_mgv1a011158mg                197   9e-58   Erythranthe guttata [common monkey flower]
ref|XP_008658727.1|  PREDICTED: heparanase-like protein 3 isoform X1    202   2e-57   
ref|NP_001152083.1|  heparanase-like protein 3 precursor                201   5e-57   
ref|XP_002437942.1|  hypothetical protein SORBIDRAFT_10g005260          200   2e-56   Sorghum bicolor [broomcorn]
gb|ABR16706.1|  unknown                                                 193   2e-55   Picea sitchensis
gb|KCW81359.1|  hypothetical protein EUGRSUZ_C02741                     187   4e-52   Eucalyptus grandis [rose gum]
gb|ACN26863.1|  unknown                                                 183   5e-51   Zea mays [maize]
ref|XP_010936349.1|  PREDICTED: heparanase-like protein 1 isoform X2    185   1e-50   Elaeis guineensis
ref|XP_010936348.1|  PREDICTED: heparanase-like protein 1 isoform X1    184   2e-50   
ref|XP_011070961.1|  PREDICTED: heparanase-like protein 1 isoform X2    182   4e-50   Sesamum indicum [beniseed]
gb|ACG44916.1|  heparanase-like protein 2 precursor                     183   5e-50   Zea mays [maize]
gb|EAZ26032.1|  hypothetical protein OsJ_09885                          182   5e-50   Oryza sativa Japonica Group [Japonica rice]
dbj|BAJ97884.1|  predicted protein                                      182   5e-50   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ96463.1|  predicted protein                                      182   6e-50   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ84826.1|  predicted protein                                      182   6e-50   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_011070960.1|  PREDICTED: heparanase-like protein 2 isoform X1    182   6e-50   Sesamum indicum [beniseed]
ref|XP_002468296.1|  hypothetical protein SORBIDRAFT_01g043180          182   9e-50   Sorghum bicolor [broomcorn]
gb|KCW81358.1|  hypothetical protein EUGRSUZ_C02740                     181   1e-49   Eucalyptus grandis [rose gum]
ref|NP_001049350.1|  Os03g0211700                                       182   1e-49   
ref|XP_008393204.1|  PREDICTED: heparanase-like protein 1               182   1e-49   
ref|NP_001145968.1|  uncharacterized protein LOC100279495 precursor     181   2e-49   Zea mays [maize]
ref|XP_009338656.1|  PREDICTED: heparanase-like protein 1 isoform X1    181   2e-49   Pyrus x bretschneideri [bai li]
gb|AGV40186.2|  heparanase 1-like protein                               181   3e-49   Nicotiana tabacum [American tobacco]
ref|XP_009631958.1|  PREDICTED: heparanase-like protein 2               181   3e-49   Nicotiana tomentosiformis
ref|XP_003520103.1|  PREDICTED: heparanase-like protein 2-like          171   3e-49   
ref|XP_002284470.1|  PREDICTED: heparanase-like protein 1               180   4e-49   Vitis vinifera
ref|XP_003578591.1|  PREDICTED: heparanase-like protein 1               180   4e-49   Brachypodium distachyon [annual false brome]
ref|XP_008374597.1|  PREDICTED: heparanase-like protein 1               180   5e-49   Malus domestica [apple tree]
ref|XP_010259074.1|  PREDICTED: heparanase-like protein 1               180   6e-49   Nelumbo nucifera [Indian lotus]
ref|XP_011012392.1|  PREDICTED: heparanase-like protein 2               179   6e-49   Populus euphratica
ref|XP_010688437.1|  PREDICTED: heparanase-like protein 3               177   9e-49   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003558511.1|  PREDICTED: heparanase-like protein 1               179   1e-48   Brachypodium distachyon [annual false brome]
ref|XP_009783167.1|  PREDICTED: heparanase-like protein 2               178   2e-48   Nicotiana sylvestris
ref|XP_004239465.2|  PREDICTED: heparanase-like protein 2               178   2e-48   
emb|CAD42650.1|  putative heparanase                                    178   2e-48   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004241591.1|  PREDICTED: heparanase-like protein 2               178   2e-48   Solanum lycopersicum
emb|CBI15157.3|  unnamed protein product                                177   3e-48   Vitis vinifera
ref|XP_009612848.1|  PREDICTED: heparanase-like protein 2               177   3e-48   Nicotiana tomentosiformis
ref|XP_010030437.1|  PREDICTED: heparanase-like protein 1               177   4e-48   Eucalyptus grandis [rose gum]
ref|XP_006348811.1|  PREDICTED: heparanase-like protein 2-like          177   5e-48   
gb|KDP31311.1|  hypothetical protein JCGZ_11687                         177   6e-48   Jatropha curcas
gb|EYU22381.1|  hypothetical protein MIMGU_mgv1a008019mg                174   7e-48   Erythranthe guttata [common monkey flower]
gb|EMS53277.1|  Heparanase-like protein 1                               175   8e-48   Triticum urartu
ref|XP_002315010.1|  hypothetical protein POPTR_0010s16820g             176   8e-48   
ref|XP_009339108.1|  PREDICTED: heparanase-like protein 1 isoform X1    176   9e-48   Pyrus x bretschneideri [bai li]
ref|XP_009761177.1|  PREDICTED: heparanase-like protein 2               176   9e-48   Nicotiana sylvestris
ref|XP_010678425.1|  PREDICTED: heparanase-like protein 2               176   9e-48   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008239880.1|  PREDICTED: heparanase-like protein 1               176   1e-47   Prunus mume [ume]
gb|ACV84153.1|  heparanase                                              176   1e-47   Oryza sativa Indica Group [Indian rice]
ref|XP_006354764.1|  PREDICTED: heparanase-like protein 2-like is...    176   2e-47   Solanum tuberosum [potatoes]
ref|XP_010936395.1|  PREDICTED: heparanase-like protein 2               175   3e-47   Elaeis guineensis
ref|XP_004298393.1|  PREDICTED: heparanase-like protein 2               175   3e-47   Fragaria vesca subsp. vesca
gb|EYU28837.1|  hypothetical protein MIMGU_mgv1a026758mg                174   4e-47   Erythranthe guttata [common monkey flower]
ref|XP_006664141.1|  PREDICTED: heparanase-like protein 1-like is...    175   4e-47   Oryza brachyantha
ref|XP_004299326.1|  PREDICTED: heparanase-like protein 1               174   6e-47   Fragaria vesca subsp. vesca
gb|KJB50982.1|  hypothetical protein B456_008G196400                    174   6e-47   Gossypium raimondii
ref|XP_009595357.1|  PREDICTED: heparanase-like protein 2 isoform X2    174   8e-47   Nicotiana tomentosiformis
ref|XP_008221534.1|  PREDICTED: heparanase-like protein 2               174   8e-47   Prunus mume [ume]
ref|XP_009595353.1|  PREDICTED: heparanase-like protein 2 isoform X1    174   9e-47   Nicotiana tomentosiformis
ref|XP_006574931.1|  PREDICTED: heparanase-like protein 2-like is...    169   9e-47   
ref|XP_002514696.1|  Heparanase-2, putative                             174   9e-47   Ricinus communis
ref|XP_007209868.1|  hypothetical protein PRUPE_ppa003813mg             174   1e-46   Prunus persica
ref|XP_011072824.1|  PREDICTED: heparanase-like protein 1 isoform X1    174   1e-46   Sesamum indicum [beniseed]
ref|XP_011072825.1|  PREDICTED: heparanase-like protein 1 isoform X2    174   1e-46   
ref|XP_002512114.1|  Heparanase precursor, putative                     174   1e-46   
ref|XP_006374168.1|  hypothetical protein POPTR_0015s03440g             170   1e-46   
ref|XP_006649618.1|  PREDICTED: heparanase-like protein 2-like          173   2e-46   
gb|KDO83095.1|  hypothetical protein CISIN_1g041499mg                   172   2e-46   Citrus sinensis [apfelsine]
ref|XP_006345162.1|  PREDICTED: heparanase-like protein 1-like          173   2e-46   Solanum tuberosum [potatoes]
ref|XP_009801842.1|  PREDICTED: heparanase-like protein 1 isoform X2    172   2e-46   Nicotiana sylvestris
ref|XP_007209866.1|  hypothetical protein PRUPE_ppa003804mg             173   2e-46   Prunus persica
ref|XP_009801838.1|  PREDICTED: heparanase-like protein 2 isoform X1    173   2e-46   Nicotiana sylvestris
ref|XP_007226518.1|  hypothetical protein PRUPE_ppa025624mg             172   2e-46   
ref|XP_006837042.1|  hypothetical protein AMTR_s00110p00045590          172   3e-46   Amborella trichopoda
ref|XP_004985229.1|  PREDICTED: heparanase-like protein 1-like is...    172   3e-46   Setaria italica
ref|XP_009395254.1|  PREDICTED: heparanase-like protein 1               172   3e-46   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006477619.1|  PREDICTED: heparanase-like protein 1-like is...    172   3e-46   Citrus sinensis [apfelsine]
ref|XP_006440691.1|  hypothetical protein CICLE_v10019304mg             172   3e-46   
gb|KDO54577.1|  hypothetical protein CISIN_1g008834mg                   172   4e-46   Citrus sinensis [apfelsine]
ref|XP_008672060.1|  PREDICTED: uncharacterized protein LOC100192...    172   4e-46   Zea mays [maize]
ref|XP_002866422.1|  glycosyl hydrolase family 79 N-terminal doma...    172   4e-46   
ref|XP_010258148.1|  PREDICTED: heparanase-like protein 1 isoform X3    172   5e-46   Nelumbo nucifera [Indian lotus]
ref|XP_010258147.1|  PREDICTED: heparanase-like protein 1 isoform X2    172   5e-46   Nelumbo nucifera [Indian lotus]
ref|XP_010258146.1|  PREDICTED: heparanase-like protein 1 isoform X1    172   5e-46   
ref|XP_010258149.1|  PREDICTED: heparanase-like protein 1 isoform X4    172   5e-46   Nelumbo nucifera [Indian lotus]
gb|KJB38700.1|  hypothetical protein B456_006G267500                    172   6e-46   Gossypium raimondii
ref|XP_008785953.1|  PREDICTED: heparanase-like protein 2 isoform X2    171   6e-46   Phoenix dactylifera
ref|XP_004962990.1|  PREDICTED: heparanase-like protein 2-like          171   6e-46   Setaria italica
ref|XP_008672059.1|  PREDICTED: uncharacterized protein LOC100192...    172   7e-46   Zea mays [maize]
ref|NP_001130921.1|  uncharacterized protein LOC100192026 precursor     172   7e-46   Zea mays [maize]
ref|NP_001067122.1|  Os12g0578400                                       171   7e-46   
ref|XP_006440690.1|  hypothetical protein CICLE_v10019304mg             172   8e-46   
ref|XP_006438800.1|  hypothetical protein CICLE_v10033641mg             171   8e-46   
ref|XP_006483691.1|  PREDICTED: heparanase-like protein 2-like          171   9e-46   
gb|KHN02019.1|  Heparanase-like protein 2                               171   1e-45   Glycine soja [wild soybean]
ref|XP_011075654.1|  PREDICTED: heparanase-like protein 2               171   1e-45   Sesamum indicum [beniseed]
gb|EMT29716.1|  Heparanase-like protein 3                               170   1e-45   
ref|XP_008661167.1|  PREDICTED: heparanase-like protein 1               171   1e-45   Zea mays [maize]
ref|XP_011013080.1|  PREDICTED: heparanase-like protein 1 isoform X2    168   1e-45   Populus euphratica
dbj|BAJ97219.1|  predicted protein                                      171   1e-45   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006374166.1|  hypothetical protein POPTR_0015s03440g             169   2e-45   
gb|ACR10240.1|  heparanase                                              170   2e-45   Oryza sativa Indica Group [Indian rice]
gb|KJB74275.1|  hypothetical protein B456_011G2845002                   163   2e-45   Gossypium raimondii
ref|XP_006574930.1|  PREDICTED: heparanase-like protein 2-like is...    169   2e-45   Glycine max [soybeans]
gb|KCW86528.1|  hypothetical protein EUGRSUZ_B03174                     169   3e-45   Eucalyptus grandis [rose gum]
ref|XP_002442385.1|  hypothetical protein SORBIDRAFT_08g019250          170   3e-45   Sorghum bicolor [broomcorn]
ref|XP_007037489.1|  Glucuronidase 2 isoform 3                          167   3e-45   
ref|XP_010046621.1|  PREDICTED: heparanase-like protein 2               169   3e-45   Eucalyptus grandis [rose gum]
ref|XP_008805083.1|  PREDICTED: heparanase-like protein 2               169   3e-45   Phoenix dactylifera
ref|XP_006374165.1|  hypothetical protein POPTR_0015s03440g             169   4e-45   Populus trichocarpa [western balsam poplar]
ref|XP_007157579.1|  hypothetical protein PHAVU_002G081000g             169   5e-45   Phaseolus vulgaris [French bean]
ref|XP_010096576.1|  Heparanase-like protein 2                          167   6e-45   
ref|XP_010923583.1|  PREDICTED: heparanase-like protein 2 isoform X2    168   8e-45   Elaeis guineensis
gb|KJB74286.1|  hypothetical protein B456_011G285200                    168   9e-45   Gossypium raimondii
ref|XP_004135441.1|  PREDICTED: heparanase-like protein 1-like          167   1e-44   
gb|KGN51965.1|  hypothetical protein Csa_5G606560                       167   1e-44   
ref|XP_007037487.1|  Glucuronidase 2 isoform 1                          167   2e-44   
ref|XP_009399121.1|  PREDICTED: heparanase-like protein 1               167   2e-44   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011013079.1|  PREDICTED: heparanase-like protein 1 isoform X1    167   2e-44   Populus euphratica
tpg|DAA47198.1|  TPA: hypothetical protein ZEAMMB73_798346              171   2e-44   
ref|XP_008340307.1|  PREDICTED: heparanase-like protein 2               167   2e-44   
ref|XP_008785952.1|  PREDICTED: heparanase-like protein 2 isoform X1    167   2e-44   Phoenix dactylifera
ref|XP_010068782.1|  PREDICTED: heparanase-like protein 1               167   3e-44   Eucalyptus grandis [rose gum]
ref|XP_004235980.1|  PREDICTED: heparanase-like protein 1               167   3e-44   Solanum lycopersicum
ref|XP_006837041.1|  hypothetical protein AMTR_s00110p00044140          166   4e-44   
ref|XP_008792775.1|  PREDICTED: heparanase-like protein 2               166   4e-44   
ref|XP_008446419.1|  PREDICTED: heparanase-like protein 1               166   4e-44   Cucumis melo [Oriental melon]
gb|KJB74280.1|  hypothetical protein B456_011G285000                    166   5e-44   Gossypium raimondii
ref|XP_006281918.1|  hypothetical protein CARUB_v10028123mg             166   5e-44   Capsella rubella
ref|XP_009397277.1|  PREDICTED: heparanase-like protein 1               166   9e-44   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010443938.1|  PREDICTED: heparanase-like protein 2               166   9e-44   Camelina sativa [gold-of-pleasure]
ref|XP_008447189.1|  PREDICTED: heparanase-like protein 1               166   1e-43   Cucumis melo [Oriental melon]
ref|XP_004154950.1|  PREDICTED: LOW QUALITY PROTEIN: heparanase-l...    166   1e-43   
ref|XP_008453243.1|  PREDICTED: heparanase-like protein 1               165   1e-43   
dbj|BAB08480.1|  unnamed protein product                                165   1e-43   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004157460.1|  PREDICTED: heparanase-like protein 1-like          165   1e-43   
ref|XP_004137422.1|  PREDICTED: heparanase-like protein 1-like          165   1e-43   
ref|XP_006581996.1|  PREDICTED: heparanase-like protein 1-like is...    164   1e-43   
emb|CDP00405.1|  unnamed protein product                                165   2e-43   
ref|NP_200933.2|  glucuronidase 1                                       165   2e-43   
gb|KHN48723.1|  Heparanase-like protein 2                               163   2e-43   
ref|XP_009394623.1|  PREDICTED: heparanase-like protein 2               164   2e-43   
ref|XP_010457069.1|  PREDICTED: heparanase-like protein 2               164   3e-43   
ref|XP_010923582.1|  PREDICTED: heparanase-like protein 2 isoform X1    164   3e-43   
gb|KHN04137.1|  Heparanase-like protein 1                               164   3e-43   
ref|XP_003527099.1|  PREDICTED: heparanase-like protein 1-like is...    164   3e-43   
gb|KGN63705.1|  hypothetical protein Csa_1G011570                       164   4e-43   
ref|XP_004138183.1|  PREDICTED: heparanase-like protein 1-like          164   4e-43   
ref|XP_007155261.1|  hypothetical protein PHAVU_003G186600g             163   6e-43   
ref|XP_010483789.1|  PREDICTED: heparanase-like protein 2               163   7e-43   
gb|KJB33257.1|  hypothetical protein B456_006G004300                    163   7e-43   
ref|XP_004508702.1|  PREDICTED: heparanase-like protein 2-like is...    161   7e-43   
ref|XP_009136454.1|  PREDICTED: heparanase-like protein 2               163   8e-43   
ref|XP_010452749.1|  PREDICTED: heparanase-like protein 1               163   8e-43   
ref|XP_003525455.1|  PREDICTED: heparanase-like protein 1-like is...    163   8e-43   
gb|KEH33104.1|  glycoside hydrolase family 79 amino-terminal doma...    162   1e-42   
ref|XP_002871291.1|  hypothetical protein ARALYDRAFT_350042             162   1e-42   
emb|CAB62595.1|  putative protein                                       162   1e-42   
gb|KJB84293.1|  hypothetical protein B456_N016700                       162   2e-42   
ref|NP_196400.2|  glucuronidase 2                                       162   2e-42   
ref|XP_010491400.1|  PREDICTED: heparanase-like protein 1               162   2e-42   
gb|KJB74088.1|  hypothetical protein B456_011G271100                    162   2e-42   
ref|XP_010106651.1|  Heparanase-like protein 1                          161   2e-42   
gb|KHN02016.1|  Heparanase-like protein 2                               161   3e-42   
gb|KJB33258.1|  hypothetical protein B456_006G004400                    161   3e-42   
ref|XP_004508698.1|  PREDICTED: heparanase-like protein 2-like is...    162   3e-42   
emb|CDP17495.1|  unnamed protein product                                161   3e-42   
ref|XP_004508697.1|  PREDICTED: heparanase-like protein 2-like is...    161   4e-42   
ref|XP_010037191.1|  PREDICTED: heparanase-like protein 2               161   4e-42   
ref|XP_006578556.1|  PREDICTED: heparanase-like protein 1-like is...    161   4e-42   
ref|XP_006399265.1|  hypothetical protein EUTSA_v10013186mg             160   5e-42   
ref|XP_006574932.1|  PREDICTED: heparanase-like protein 2-like          160   6e-42   
ref|XP_002976895.1|  hypothetical protein SELMODRAFT_105931             159   9e-42   
gb|KHN36951.1|  Heparanase-like protein 1                               160   9e-42   
ref|XP_006289223.1|  hypothetical protein CARUB_v10002679mg             159   1e-41   
ref|XP_006394524.1|  hypothetical protein EUTSA_v10003960mg             159   2e-41   
emb|CBI27258.3|  unnamed protein product                                159   2e-41   
ref|XP_010423168.1|  PREDICTED: heparanase-like protein 1 isoform X4    159   2e-41   
ref|XP_002274743.1|  PREDICTED: heparanase-like protein 2               159   2e-41   
ref|XP_010423167.1|  PREDICTED: heparanase-like protein 1 isoform X3    159   2e-41   
sp|Q9LRC8.1|BAGLU_SCUBA  RecName: Full=Baicalin-beta-D-glucuronid...    159   2e-41   
ref|XP_009122405.1|  PREDICTED: heparanase-like protein 1 isoform X1    159   2e-41   
ref|XP_010423164.1|  PREDICTED: heparanase-like protein 1 isoform X1    159   2e-41   
gb|KJB60459.1|  hypothetical protein B456_009G305800                    159   2e-41   
ref|XP_010423166.1|  PREDICTED: heparanase-like protein 1 isoform X2    159   2e-41   
gb|KJB33259.1|  hypothetical protein B456_006G004500                    157   3e-41   
ref|XP_010546171.1|  PREDICTED: heparanase-like protein 1 isoform X1    158   4e-41   
gb|KEH31991.1|  glycoside hydrolase family 79 amino-terminal doma...    156   4e-41   
gb|KEH33103.1|  glycoside hydrolase family 79 amino-terminal doma...    157   7e-41   
ref|XP_006600562.1|  PREDICTED: heparanase-like protein 1-like is...    156   1e-40   
emb|CDX69989.1|  BnaA10g23380D                                          157   1e-40   
gb|EAZ04591.1|  hypothetical protein OsI_26741                          157   1e-40   
gb|EYU43518.1|  hypothetical protein MIMGU_mgv1a004063mg                157   1e-40   
ref|XP_010904949.1|  PREDICTED: heparanase-like protein 1               156   2e-40   
emb|CDX99032.1|  BnaC09g48030D                                          156   2e-40   
ref|XP_003549557.1|  PREDICTED: heparanase-like protein 1-like is...    156   2e-40   
gb|KEH33102.1|  glycoside hydrolase family 79 amino-terminal doma...    154   2e-40   
gb|EEE53489.1|  hypothetical protein OsJ_36644                          156   3e-40   
gb|KEH31990.1|  glycoside hydrolase family 79 amino-terminal doma...    155   3e-40   
gb|KEH31989.1|  glycoside hydrolase family 79 amino-terminal doma...    155   4e-40   
ref|NP_001060182.1|  Os07g0598400                                       155   6e-40   
ref|XP_010552799.1|  PREDICTED: heparanase-like protein 2               154   7e-40   
gb|KEH33101.1|  glycoside hydrolase family 79 amino-terminal doma...    154   8e-40   
gb|KJB84191.1|  hypothetical protein B456_N009200                       154   1e-39   
gb|EEC69565.1|  hypothetical protein OsI_38868                          157   2e-39   
ref|XP_001769830.1|  predicted protein                                  154   2e-39   
ref|XP_001770123.1|  predicted protein                                  153   3e-39   
ref|XP_003614012.1|  Heparanase-like protein                            152   5e-39   
gb|AES96970.2|  glycoside hydrolase family 79 amino-terminal doma...    152   6e-39   
ref|XP_008453728.1|  PREDICTED: heparanase-like protein 1               143   3e-38   
ref|XP_001774747.1|  predicted protein                                  150   3e-38   
gb|KJB84192.1|  hypothetical protein B456_N009300                       150   3e-38   
ref|XP_002991174.1|  hypothetical protein SELMODRAFT_133100             150   4e-38   
ref|XP_002991234.1|  hypothetical protein SELMODRAFT_133227             150   4e-38   
gb|KHN18337.1|  Heparanase-like protein 1                               149   6e-38   
tpg|DAA57913.1|  TPA: hypothetical protein ZEAMMB73_865151              145   4e-37   
ref|XP_001767170.1|  predicted protein                                  145   1e-36   
ref|NP_001183276.1|  uncharacterized protein LOC100501670 precursor     145   1e-36   
ref|XP_007045929.1|  Heparanase, putative                               145   2e-36   
gb|KFK32018.1|  hypothetical protein AALP_AA6G189500                    144   4e-36   
ref|XP_008438923.1|  PREDICTED: heparanase-like protein 2               143   1e-35   
ref|XP_004134497.1|  PREDICTED: heparanase-like protein 2-like          143   1e-35   
ref|XP_004163115.1|  PREDICTED: heparanase-like protein 1-like          142   1e-35   
ref|XP_004140375.1|  PREDICTED: heparanase-like protein 1-like          142   1e-35   
gb|KGN51001.1|  hypothetical protein Csa_5G390000                       142   2e-35   
gb|EAY89013.1|  hypothetical protein OsI_10495                          142   2e-35   
gb|KEH31988.1|  glycoside hydrolase family 79 amino-terminal doma...    142   2e-35   
gb|EMS65630.1|  Heparanase-like protein 3                               139   2e-34   
ref|XP_006658769.1|  PREDICTED: heparanase-like protein 1-like          138   5e-34   
ref|XP_003609471.1|  Heparanase-like protein                            135   7e-34   
ref|XP_004146543.1|  PREDICTED: heparanase-like protein 1-like          137   1e-33   
gb|KGN53270.1|  hypothetical protein Csa_4G043860                       136   2e-33   
gb|KJB64651.1|  hypothetical protein B456_010G059600                    135   4e-33   
gb|KJB84190.1|  hypothetical protein B456_N009100                       133   8e-33   
emb|CDY02161.1|  BnaA03g40060D                                          134   1e-32   
emb|CDY23075.1|  BnaC07g31120D                                          133   3e-32   
ref|XP_008681323.1|  PREDICTED: uncharacterized protein LOC100217...    124   7e-31   
gb|KCW81361.1|  hypothetical protein EUGRSUZ_C02742                     128   1e-30   
ref|XP_002980613.1|  hypothetical protein SELMODRAFT_52894              120   5e-28   
gb|KCW83013.1|  hypothetical protein EUGRSUZ_C04395                     119   2e-27   
gb|KDP41275.1|  hypothetical protein JCGZ_15682                         118   4e-27   
gb|EYU40129.1|  hypothetical protein MIMGU_mgv1a025097mg                115   5e-27   
gb|EPS63505.1|  heparanase-like protein 1                               118   5e-27   
emb|CDP16528.1|  unnamed protein product                                110   7e-27   
gb|EMT08055.1|  Heparanase-like protein 1                               117   7e-27   
gb|KDO54583.1|  hypothetical protein CISIN_1g008834mg                   117   8e-27   
ref|XP_002976894.1|  hypothetical protein SELMODRAFT_32458              115   5e-26   
gb|KDO54582.1|  hypothetical protein CISIN_1g008834mg                   114   8e-26   
emb|CDP14477.1|  unnamed protein product                                107   9e-26   
ref|XP_002512115.1|  conserved hypothetical protein                     109   3e-25   
ref|XP_006483407.1|  PREDICTED: heparanase-like protein 3-like is...    108   1e-23   
gb|KJB74093.1|  hypothetical protein B456_011G271700                    105   2e-23   
ref|XP_004155378.1|  PREDICTED: probable S-acyltransferase At1g69...    108   8e-23   
tpg|DAA47199.1|  TPA: hypothetical protein ZEAMMB73_798346              107   1e-22   
gb|KHG13978.1|  hypothetical protein F383_01956                         105   2e-22   
ref|XP_010546175.1|  PREDICTED: heparanase-like protein 1 isoform X2  99.8    1e-20   
gb|KHN02017.1|  Heparanase-like protein 2                             94.4    3e-20   
gb|EEE67528.1|  hypothetical protein OsJ_24994                        98.2    7e-20   
ref|XP_006590142.1|  PREDICTED: heparanase-like protein 1-like        89.7    9e-19   
ref|XP_006596849.1|  PREDICTED: uncharacterized protein LOC102669243  90.5    6e-18   
ref|XP_006601533.1|  PREDICTED: heparanase-like protein 1-like        89.7    6e-18   
ref|XP_003630110.1|  Heparanase-like protein                          90.1    2e-17   
gb|KDP41274.1|  hypothetical protein JCGZ_15681                       90.9    2e-17   
ref|XP_006582719.1|  PREDICTED: heparanase-like protein 1-like        87.0    3e-17   
emb|CAN63833.1|  hypothetical protein VITISV_009131                   90.9    5e-17   
gb|EWM24999.1|  heparanase-like protein 3                             87.0    8e-16   
gb|AFK39031.1|  unknown                                               81.3    2e-15   
ref|WP_043978178.1|  hypothetical protein                             84.7    3e-15   
ref|WP_035663184.1|  hypothetical protein                             84.7    3e-15   
ref|XP_001742736.1|  hypothetical protein                             80.9    4e-15   
gb|KJB33611.1|  hypothetical protein B456_006G021700                  83.6    4e-15   
gb|KDR18877.1|  Heparanase                                            83.6    9e-15   
gb|KJB33253.1|  hypothetical protein B456_006G004200                  82.4    1e-14   
ref|WP_035215244.1|  hypothetical protein                             81.3    5e-14   
ref|WP_035177679.1|  hypothetical protein                             80.5    9e-14   
gb|KJB84361.1|  hypothetical protein B456_N0210001                    79.3    1e-13   
ref|WP_027535911.1|  hypothetical protein                             79.0    3e-13   
ref|XP_002309644.2|  hypothetical protein POPTR_0006s27360g           73.9    4e-13   
ref|WP_036048072.1|  hypothetical protein                             78.2    4e-13   
ref|WP_033317620.1|  hypothetical protein                             77.8    5e-13   
ref|WP_035729267.1|  MULTISPECIES: hypothetical protein               77.4    8e-13   
ref|WP_011686731.1|  hypothetical protein                             76.3    2e-12   
ref|XP_004998289.1|  hypothetical protein PTSG_00821                  76.3    2e-12   
ref|XP_006604018.1|  PREDICTED: heparanase-like protein 1-like is...  69.7    4e-12   
ref|XP_791715.3|  PREDICTED: heparanase-like                          74.7    5e-12   
ref|WP_038956998.1|  hypothetical protein                             74.7    6e-12   
ref|WP_035959084.1|  hypothetical protein                             74.7    6e-12   
ref|WP_006954143.1|  hypothetical protein                             74.7    7e-12   
gb|AHY53931.1|  hypothetical protein BJS_01312                        74.3    7e-12   
ref|WP_039157801.1|  hypothetical protein                             74.3    7e-12   
ref|XP_002166563.2|  PREDICTED: heparanase-like                       71.6    8e-12   
ref|WP_028174514.1|  MULTISPECIES: hypothetical protein               74.3    8e-12   
gb|KHG12946.1|  hypothetical protein F383_07365                       74.3    9e-12   
ref|XP_011298477.1|  PREDICTED: heparanase-like                       73.9    1e-11   
gb|KJC38324.1|  hypothetical protein UB31_31870                       73.9    1e-11   
ref|WP_038934864.1|  hypothetical protein                             73.6    2e-11   
ref|WP_036007187.1|  hypothetical protein                             73.2    2e-11   
ref|XP_006563435.1|  PREDICTED: heparanase-like isoform X3            72.8    2e-11   
ref|WP_012069349.1|  glycoside hydrolase                              72.8    2e-11   
ref|XP_006563434.1|  PREDICTED: heparanase-like isoform X2            72.8    2e-11   
ref|XP_006563433.1|  PREDICTED: heparanase-like isoform X1            72.8    3e-11   
tpg|DAA55153.1|  TPA: hypothetical protein ZEAMMB73_112407            72.0    4e-11   
gb|ENN73698.1|  hypothetical protein YQE_09695                        72.0    4e-11   
ref|WP_028160701.1|  hypothetical protein                             72.0    4e-11   
ref|XP_001634849.1|  predicted protein                                71.6    5e-11   
ref|WP_036027390.1|  hypothetical protein                             71.6    6e-11   
ref|WP_020719399.1|  hypothetical protein                             71.6    7e-11   
ref|XP_002167980.1|  PREDICTED: heparanase-like                       71.6    7e-11   
ref|WP_029078282.1|  hypothetical protein                             71.2    7e-11   
ref|XP_006617152.1|  PREDICTED: heparanase-like                       71.2    7e-11   
ref|WP_013662017.1|  glycoside hydrolase                              71.2    1e-10   
ref|WP_036042402.1|  hypothetical protein                             70.9    1e-10   
ref|XP_002154393.2|  PREDICTED: heparanase-like                       70.5    1e-10   
ref|WP_038941822.1|  hypothetical protein                             70.5    1e-10   
ref|WP_028147103.1|  hypothetical protein                             70.5    1e-10   
ref|WP_027583103.1|  hypothetical protein                             70.5    2e-10   
ref|WP_035688244.1|  hypothetical protein                             70.5    2e-10   
ref|WP_029582693.1|  hypothetical protein                             70.1    2e-10   
ref|XP_002170740.2|  PREDICTED: heparanase-like                       69.7    2e-10   
ref|WP_018415804.1|  glycoside hydrolase                              69.7    2e-10   
ref|WP_029879028.1|  hypothetical protein                             69.7    2e-10   
ref|WP_043855506.1|  hypothetical protein                             69.7    2e-10   
ref|XP_011438298.1|  PREDICTED: heparanase-like                       69.7    2e-10   
gb|EKC37951.1|  Heparanase                                            69.7    2e-10   
ref|XP_002162074.2|  PREDICTED: heparanase-like                       69.7    2e-10   
ref|WP_028885873.1|  glycoside hydrolase                              69.7    3e-10   
ref|WP_019604221.1|  glycoside hydrolase                              69.7    3e-10   
ref|WP_018275967.1|  glycoside hydrolase                              69.7    3e-10   
gb|KJB50981.1|  hypothetical protein B456_008G196400                  69.3    3e-10   
emb|CBY12659.1|  unnamed protein product                              69.3    3e-10   
ref|WP_024024806.1|  glycoside hydrolase                              69.7    3e-10   
gb|KJB84362.1|  hypothetical protein B456_N0210002                    65.5    3e-10   
ref|WP_035347617.1|  hypothetical protein                             69.7    3e-10   
ref|WP_014492743.1|  hypothetical protein                             69.7    3e-10   
ref|XP_009037281.1|  hypothetical protein AURANDRAFT_64495            69.3    3e-10   
ref|WP_028170627.1|  hypothetical protein                             69.3    3e-10   
ref|XP_003383078.1|  PREDICTED: heparanase-like                       69.3    4e-10   
ref|NP_198344.2|  glucuronidase 3                                     68.9    4e-10   
ref|WP_027572739.1|  hypothetical protein                             69.3    4e-10   
emb|CBY33808.1|  unnamed protein product                              68.9    4e-10   
ref|WP_028670294.1|  hypothetical protein                             68.9    4e-10   
ref|WP_035714031.1|  hypothetical protein                             66.2    5e-10   
ref|XP_003696083.1|  PREDICTED: heparanase-like                       68.9    5e-10   
ref|WP_024019241.1|  hypothetical protein                             68.9    6e-10   
ref|XP_006817513.1|  PREDICTED: heparanase-like                       68.6    6e-10   
ref|WP_028876470.1|  glycoside hydrolase                              68.6    6e-10   
ref|WP_018014255.1|  glycoside hydrolase                              68.6    7e-10   
ref|WP_015819393.1|  glycoside hydrolase                              68.6    7e-10   
ref|WP_027541887.1|  hypothetical protein                             68.2    8e-10   
ref|WP_024512363.1|  hypothetical protein                             68.2    9e-10   
ref|XP_008666379.1|  PREDICTED: uncharacterized protein LOC103645024  68.2    1e-09   
gb|KJC60860.1|  hypothetical protein UP10_10895                       67.8    1e-09   
gb|AET04586.2|  glycoside hydrolase family 79 amino-terminal doma...  66.6    1e-09   
ref|WP_044587466.1|  hypothetical protein                             67.8    1e-09   
ref|WP_021077476.1|  UMF1 family MFS transporter                      67.8    1e-09   
gb|KJC46841.1|  hypothetical protein UP09_11915                       67.4    1e-09   



>ref|XP_006359499.1| PREDICTED: heparanase-like protein 3-like [Solanum tuberosum]
Length=536

 Score =   281 bits (719),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 147/198 (74%), Positives = 159/198 (80%), Gaps = 7/198 (4%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            MSA+YDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRN L+TSFSGTKKIR
Sbjct  345  MSAAYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNVLATSFSGTKKIR  404

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
            AYAHCAKQS GITLLLINLD NTT+ A V +NG+ +H RKH  H NH             
Sbjct  405  AYAHCAKQSQGITLLLINLDGNTTIHARVDFNGTMLHRRKHRHHHNHRKSSIKL------  458

Query  391  SPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITV  212
             PRS K  + TREEYHLTAK G+L SQTMLLNGN L VDSSG+IP  +P Y+NS+E ITV
Sbjct  459  -PRSSKIASNTREEYHLTAKDGNLQSQTMLLNGNALIVDSSGNIPTFEPIYVNSTEAITV  517

Query  211  APFSIVFAHIPYVFLPAC  158
            APFSIVF HIPYV LPAC
Sbjct  518  APFSIVFVHIPYVLLPAC  535



>ref|XP_009625836.1| PREDICTED: heparanase-like protein 3 [Nicotiana tomentosiformis]
Length=538

 Score =   278 bits (712),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 140/198 (71%), Positives = 162/198 (82%), Gaps = 7/198 (4%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            MSA+YDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRN LSTSFSG+KKIR
Sbjct  347  MSAAYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNVLSTSFSGSKKIR  406

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
            AY HCAKQS GITLLLINLD NTT+ AN+A+NG+ +HHRKH  H +              
Sbjct  407  AYTHCAKQSQGITLLLINLDGNTTIRANIAFNGTLLHHRKHRHHSHRKSSSIRL------  460

Query  391  SPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITV  212
             P+S+K  + TR+EYHLTAK GDL SQTMLLNG  L++DS G+IP ++P ++NS+EP+TV
Sbjct  461  -PKSRKIASNTRQEYHLTAKDGDLQSQTMLLNGKPLTIDSFGNIPSLEPIFVNSTEPLTV  519

Query  211  APFSIVFAHIPYVFLPAC  158
            APFSI+F HIPYV LPAC
Sbjct  520  APFSILFVHIPYVILPAC  537



>ref|XP_009757548.1| PREDICTED: heparanase-like protein 3 [Nicotiana sylvestris]
Length=538

 Score =   278 bits (711),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 140/198 (71%), Positives = 161/198 (81%), Gaps = 7/198 (4%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            MSA+YDTK YCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRN LST+FSG+KKIR
Sbjct  347  MSAAYDTKAYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNVLSTTFSGSKKIR  406

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
            AYAHCAKQS GITLLLINLD NTT+ ANVA+NG+ +H RKH  H +              
Sbjct  407  AYAHCAKQSRGITLLLINLDGNTTMSANVAFNGTMLHQRKHRHHSHRKSSSIRL------  460

Query  391  SPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITV  212
             P+S+K  + TR+EYHLTAK GDL SQTMLLNG  L++DS G+IP ++P ++NS+EP+TV
Sbjct  461  -PKSRKIASNTRQEYHLTAKDGDLQSQTMLLNGKPLTIDSFGNIPSLEPIFVNSTEPLTV  519

Query  211  APFSIVFAHIPYVFLPAC  158
            APFSIVF HIPYV LPAC
Sbjct  520  APFSIVFVHIPYVILPAC  537



>ref|XP_004242732.1| PREDICTED: heparanase-like protein 3 [Solanum lycopersicum]
Length=536

 Score =   271 bits (692),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 141/198 (71%), Positives = 155/198 (78%), Gaps = 7/198 (4%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            MSA+YDTKTYCRQTLIGGNYGLLNTTTF PNPDYYSALLWHRLMGRN L+TSFSGTKK+R
Sbjct  345  MSAAYDTKTYCRQTLIGGNYGLLNTTTFEPNPDYYSALLWHRLMGRNVLATSFSGTKKLR  404

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
            AYAHCAKQS GITLLLINLD NTT+   V +NG+ +H +KH  H NH             
Sbjct  405  AYAHCAKQSQGITLLLINLDGNTTIHPRVDFNGTMLHQQKHRHHHNHRKSSIKL------  458

Query  391  SPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITV  212
             PRS K  + TREEYHLTAK G+L SQTMLLNG  L VDSSG+IP  +P Y+NS+E ITV
Sbjct  459  -PRSNKVASNTREEYHLTAKDGNLQSQTMLLNGKALIVDSSGNIPTFEPIYVNSTEAITV  517

Query  211  APFSIVFAHIPYVFLPAC  158
            AP SIVF HIPYV LPAC
Sbjct  518  APLSIVFVHIPYVLLPAC  535



>emb|CBI25561.3| unnamed protein product [Vitis vinifera]
Length=533

 Score =   268 bits (685),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 136/199 (68%), Positives = 152/199 (76%), Gaps = 11/199 (6%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            M+++YDTKTYCRQTLIGGNYGLLNT TFVPNPDYYSALLWHRLMGRN LSTSFSG KKIR
Sbjct  346  MASAYDTKTYCRQTLIGGNYGLLNTNTFVPNPDYYSALLWHRLMGRNVLSTSFSGPKKIR  405

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
            AYAHCAKQS GITLLLINLD++TTVEA VA+NG+     KH  H                
Sbjct  406  AYAHCAKQSQGITLLLINLDNSTTVEAKVAFNGTSTLQHKHKLHRTKVIWF---------  456

Query  391  SPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITV  212
                 K   M REEYHLTAK G+LHSQTMLLNGN L+V++SG IP ++P  +NSS PIT+
Sbjct  457  --EGSKTSEMEREEYHLTAKDGNLHSQTMLLNGNILTVNASGDIPPLEPLNVNSSSPITI  514

Query  211  APFSIVFAHIPYVFLPACR  155
            APFSIVF H+P V LPACR
Sbjct  515  APFSIVFVHMPSVVLPACR  533



>ref|XP_010100865.1| Heparanase-like protein 3 [Morus notabilis]
 gb|EXB85444.1| Heparanase-like protein 3 [Morus notabilis]
Length=534

 Score =   266 bits (681),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 140/199 (70%), Positives = 163/199 (82%), Gaps = 3/199 (2%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            MSA++DTKTYCRQ+LIGGNYGLL+TT   PNPDYYSALLWHRLMGRNALSTSFSGTKKIR
Sbjct  339  MSAAFDTKTYCRQSLIGGNYGLLDTTNLAPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  398

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
            AYAHCAKQS GIT+LLINLD++TTV   VA+NG++    +  +  +H HHHHH H     
Sbjct  399  AYAHCAKQSKGITVLLINLDNSTTVLGKVAFNGTW--SLEQKQTHHHRHHHHHHHRSRTS  456

Query  391  SPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITV  212
             PRS K  T  REEYHL+AK GDLHS+TMLLNGN LS+DSS +IP ++P Y+NSS+PI V
Sbjct  457  IPRSLKSET-AREEYHLSAKDGDLHSRTMLLNGNILSIDSSSNIPTLQPVYINSSKPIVV  515

Query  211  APFSIVFAHIPYVFLPACR  155
             PFSIVFAHIPYV +PAC+
Sbjct  516  RPFSIVFAHIPYVVVPACQ  534



>ref|XP_002263173.1| PREDICTED: heparanase-like protein 3 [Vitis vinifera]
Length=559

 Score =   264 bits (675),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 138/203 (68%), Positives = 156/203 (77%), Gaps = 4/203 (2%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            M+++YDTKTYCRQTLIGGNYGLLNT TFVPNPDYYSALLWHRLMGRN LSTSFSG KKIR
Sbjct  357  MASAYDTKTYCRQTLIGGNYGLLNTNTFVPNPDYYSALLWHRLMGRNVLSTSFSGPKKIR  416

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
            AYAHCAKQS GITLLLINLD++TTVEA VA+NG+     KH  H  H  H +        
Sbjct  417  AYAHCAKQSQGITLLLINLDNSTTVEAKVAFNGTSTLQHKHKLHRLHRLHKYRHRHRIHR  476

Query  391  SP----RSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSE  224
            +        K   M REEYHLTAK G+LHSQTMLLNGN L+V++SG IP ++P  +NSS 
Sbjct  477  TKVIWFEGSKTSEMEREEYHLTAKDGNLHSQTMLLNGNILTVNASGDIPPLEPLNVNSSS  536

Query  223  PITVAPFSIVFAHIPYVFLPACR  155
            PIT+APFSIVF H+P V LPACR
Sbjct  537  PITIAPFSIVFVHMPSVVLPACR  559



>ref|XP_010687865.1| PREDICTED: heparanase-like protein 3 [Beta vulgaris subsp. vulgaris]
Length=546

 Score =   263 bits (673),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 131/199 (66%), Positives = 151/199 (76%), Gaps = 5/199 (3%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            M+A YDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWH+LMGRN LSTSFSGTKK+R
Sbjct  353  MAAKYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHKLMGRNVLSTSFSGTKKVR  412

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
            AYAHC+K S GIT+LLINLD N+TVEANVA+NG++           H +       H K 
Sbjct  413  AYAHCSKLSQGITMLLINLDGNSTVEANVAFNGTWSLLHTRHHIHKHKNRARAIKWHQKK  472

Query  391  SPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITV  212
            +     RG     EYHLTAK GDL SQ MLLNG  LSV+SSG IP++ P ++NSSEPI +
Sbjct  473  AADGGVRG-----EYHLTAKNGDLQSQIMLLNGEALSVNSSGEIPDLTPLHVNSSEPIVL  527

Query  211  APFSIVFAHIPYVFLPACR  155
             PFSIVF H+PY+ LPAC+
Sbjct  528  GPFSIVFVHMPYILLPACK  546



>ref|XP_010250274.1| PREDICTED: heparanase-like protein 3 [Nelumbo nucifera]
Length=551

 Score =   263 bits (673),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 135/199 (68%), Positives = 158/199 (79%), Gaps = 0/199 (0%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            MSA+YDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGR  LST+F+GTKKIR
Sbjct  353  MSATYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRTVLSTNFTGTKKIR  412

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
            AY+HCAKQS GITLLLINLD NTTV+ +V    + ++    +RH + HH H    +    
Sbjct  413  AYSHCAKQSPGITLLLINLDGNTTVQVHVTTQHAALYKTSTLRHKHRHHKHRSHKTRFTQ  472

Query  391  SPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITV  212
             PR  K   +TREEYHLTAK G+LHSQT+ LNGN L+V+SSG IP ++P  +N S+PITV
Sbjct  473  MPRDHKNSRITREEYHLTAKDGNLHSQTVHLNGNILTVNSSGDIPPLEPISVNRSDPITV  532

Query  211  APFSIVFAHIPYVFLPACR  155
            APFSIVFAHIP + +PACR
Sbjct  533  APFSIVFAHIPDIDVPACR  551



>emb|CDP10485.1| unnamed protein product [Coffea canephora]
Length=543

 Score =   263 bits (672),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 131/198 (66%), Positives = 158/198 (80%), Gaps = 8/198 (4%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            M+++YDTK YCRQ+LIGGNYGLL+TTTFVPNPDYYSALLWH+LMGRN L+T+F GTKKIR
Sbjct  353  MASAYDTKAYCRQSLIGGNYGLLDTTTFVPNPDYYSALLWHQLMGRNVLATNFRGTKKIR  412

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
            AYAHCAKQS GITLLLINLD + +V+  VAYNG+ +H  KH  H +   +          
Sbjct  413  AYAHCAKQSKGITLLLINLDGSNSVQVKVAYNGTILHGHKHGHHHSSPKYIQL-------  465

Query  391  SPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITV  212
             P+ +K G+ TREEYHLTAKGGDLHS+TMLLNGNEL+V +SG IP++KP+   +SEPI V
Sbjct  466  -PQPRKIGSATREEYHLTAKGGDLHSRTMLLNGNELTVGNSGEIPQLKPQIFPASEPINV  524

Query  211  APFSIVFAHIPYVFLPAC  158
            AP+SIVFAHI Y+ L AC
Sbjct  525  APYSIVFAHIEYLNLQAC  542



>emb|CAN81917.1| hypothetical protein VITISV_038549 [Vitis vinifera]
Length=636

 Score =   265 bits (676),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 138/203 (68%), Positives = 156/203 (77%), Gaps = 4/203 (2%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            M+++YDTKTYCRQTLIGGNYGLLNT TFVPNPDYYSALLWHRLMGRN LSTSFSG KKIR
Sbjct  353  MASAYDTKTYCRQTLIGGNYGLLNTNTFVPNPDYYSALLWHRLMGRNVLSTSFSGPKKIR  412

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
            AYAHCAKQS GITLLLINLD++TTVEA VA+NG+     KH  H  H  H +        
Sbjct  413  AYAHCAKQSQGITLLLINLDNSTTVEAKVAFNGTSTLQHKHKLHRLHRLHKYRHRHRIHR  472

Query  391  SP----RSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSE  224
            +        K   M REEYHLTAK G+LHSQTMLLNGN L+V++SG IP ++P  +NSS 
Sbjct  473  TKVIWFEGSKTSEMEREEYHLTAKDGNLHSQTMLLNGNILTVNASGDIPPLEPLNVNSSS  532

Query  223  PITVAPFSIVFAHIPYVFLPACR  155
            PIT+APFSIVF H+P V LPACR
Sbjct  533  PITIAPFSIVFVHMPSVVLPACR  555



>ref|XP_006381083.1| hypothetical protein POPTR_0006s06100g [Populus trichocarpa]
 gb|ERP58880.1| hypothetical protein POPTR_0006s06100g [Populus trichocarpa]
Length=562

 Score =   262 bits (670),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 141/205 (69%), Positives = 164/205 (80%), Gaps = 8/205 (4%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            M+++YDTKTYCRQ+LIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRN LSTSFSGTKKIR
Sbjct  358  MASAYDTKTYCRQSLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNVLSTSFSGTKKIR  417

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
            AY HCAKQS GITLLLINLD++TTVE  V +N ++  H+KH  H +H  H  H       
Sbjct  418  AYTHCAKQSKGITLLLINLDNSTTVEVTVTFNSTWRLHQKHKPHRSHKLHKPHRSHRSHK  477

Query  391  SPRSQ-----KRGT--MTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLN  233
            S +S+     +R T  +TREEYHLTAK GDLHSQTMLLNGN L+V+SSG IP ++P ++N
Sbjct  478  SHKSKVIQQPQRSTSGITREEYHLTAKDGDLHSQTMLLNGNILTVNSSGDIPSLEPLHVN  537

Query  232  SSEPITVAPFSIVFAHIPYVFLPAC  158
            SS+PI VAPFSIVF  +PYV LPAC
Sbjct  538  SSKPIMVAPFSIVFVQMPYV-LPAC  561



>ref|XP_006381082.1| hypothetical protein POPTR_0006s06100g [Populus trichocarpa]
 gb|ERP58879.1| hypothetical protein POPTR_0006s06100g [Populus trichocarpa]
Length=554

 Score =   262 bits (670),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 141/205 (69%), Positives = 164/205 (80%), Gaps = 8/205 (4%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            M+++YDTKTYCRQ+LIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRN LSTSFSGTKKIR
Sbjct  350  MASAYDTKTYCRQSLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNVLSTSFSGTKKIR  409

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
            AY HCAKQS GITLLLINLD++TTVE  V +N ++  H+KH  H +H  H  H       
Sbjct  410  AYTHCAKQSKGITLLLINLDNSTTVEVTVTFNSTWRLHQKHKPHRSHKLHKPHRSHRSHK  469

Query  391  SPRSQ-----KRGT--MTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLN  233
            S +S+     +R T  +TREEYHLTAK GDLHSQTMLLNGN L+V+SSG IP ++P ++N
Sbjct  470  SHKSKVIQQPQRSTSGITREEYHLTAKDGDLHSQTMLLNGNILTVNSSGDIPSLEPLHVN  529

Query  232  SSEPITVAPFSIVFAHIPYVFLPAC  158
            SS+PI VAPFSIVF  +PYV LPAC
Sbjct  530  SSKPIMVAPFSIVFVQMPYV-LPAC  553



>gb|KDO73428.1| hypothetical protein CISIN_1g008762mg [Citrus sinensis]
Length=547

 Score =   261 bits (666),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 130/198 (66%), Positives = 153/198 (77%), Gaps = 11/198 (6%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            M+A++DTKTYCRQ+LIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR
Sbjct  360  MAAAHDTKTYCRQSLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  419

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
            +YAHCAKQS G+ LLLINLD++TTV A+VA+NG+     KH                   
Sbjct  420  SYAHCAKQSKGLVLLLINLDNSTTVHASVAFNGTLTSRHKHKSLKMKIIKL---------  470

Query  391  SPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITV  212
             P++   G   REEYHLTAK GDLHSQTMLLNGN LSV+S G IP ++P  + S++P++V
Sbjct  471  -PQASVGGN-EREEYHLTAKDGDLHSQTMLLNGNILSVNSIGDIPTLEPLRVKSTQPVSV  528

Query  211  APFSIVFAHIPYVFLPAC  158
             PFSIVF H+P+V LPAC
Sbjct  529  GPFSIVFVHMPHVILPAC  546



>ref|XP_007203617.1| hypothetical protein PRUPE_ppa003883mg [Prunus persica]
 gb|EMJ04816.1| hypothetical protein PRUPE_ppa003883mg [Prunus persica]
Length=542

 Score =   260 bits (665),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 135/205 (66%), Positives = 149/205 (73%), Gaps = 21/205 (10%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            MSA+YDTKTYCRQTLIGGNYGLLNTTT+ PNPDYYSALLWHRLMGRN L+TSFSG KKIR
Sbjct  353  MSAAYDTKTYCRQTLIGGNYGLLNTTTYEPNPDYYSALLWHRLMGRNVLATSFSGPKKIR  412

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
            AYAHCAKQS GIT+LLINL + TTVEA VA+N S+                         
Sbjct  413  AYAHCAKQSKGITVLLINLQNTTTVEARVAFNTSWT---------------LRHKHKSHK  457

Query  391  SPRSQ------KRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNS  230
            S R+Q       R    REEYHLTAK G+L SQTMLLNGN L+++SSG IP + P Y+NS
Sbjct  458  SHRAQLKFHQGLRSETVREEYHLTAKDGNLQSQTMLLNGNALTLNSSGIIPNLDPVYVNS  517

Query  229  SEPITVAPFSIVFAHIPYVFLPACR  155
            SEPI V P SIVFAHIPYV LPACR
Sbjct  518  SEPILVGPSSIVFAHIPYVVLPACR  542



>ref|XP_006453123.1| hypothetical protein CICLE_v10007919mg [Citrus clementina]
 ref|XP_006474380.1| PREDICTED: heparanase-like protein 3-like [Citrus sinensis]
 gb|ESR66363.1| hypothetical protein CICLE_v10007919mg [Citrus clementina]
Length=547

 Score =   260 bits (665),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 130/198 (66%), Positives = 153/198 (77%), Gaps = 11/198 (6%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            M+A++DTKTYCRQ+LIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR
Sbjct  360  MAAAHDTKTYCRQSLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  419

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
            +YAHCAKQS G+ LLLINLD++TTV A+VA+NG+     KH                   
Sbjct  420  SYAHCAKQSKGLVLLLINLDNSTTVHASVAFNGTLTSRHKHKSLKMKIIKL---------  470

Query  391  SPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITV  212
             P++   G   REEYHLTAK GDLHSQTMLLNGN LSV+S G IP ++P  + S++P++V
Sbjct  471  -PQASVGGN-EREEYHLTAKDGDLHSQTMLLNGNILSVNSIGDIPTLEPLRVKSTQPVSV  528

Query  211  APFSIVFAHIPYVFLPAC  158
             PFSIVF H+P+V LPAC
Sbjct  529  GPFSIVFVHMPHVILPAC  546



>gb|KDO73427.1| hypothetical protein CISIN_1g008762mg [Citrus sinensis]
Length=554

 Score =   260 bits (665),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 130/198 (66%), Positives = 153/198 (77%), Gaps = 11/198 (6%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            M+A++DTKTYCRQ+LIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR
Sbjct  367  MAAAHDTKTYCRQSLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  426

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
            +YAHCAKQS G+ LLLINLD++TTV A+VA+NG+     KH                   
Sbjct  427  SYAHCAKQSKGLVLLLINLDNSTTVHASVAFNGTLTSRHKHKSLKMKIIKL---------  477

Query  391  SPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITV  212
             P++   G   REEYHLTAK GDLHSQTMLLNGN LSV+S G IP ++P  + S++P++V
Sbjct  478  -PQASVGGN-EREEYHLTAKDGDLHSQTMLLNGNILSVNSIGDIPTLEPLRVKSTQPVSV  535

Query  211  APFSIVFAHIPYVFLPAC  158
             PFSIVF H+P+V LPAC
Sbjct  536  GPFSIVFVHMPHVILPAC  553



>ref|XP_008242878.1| PREDICTED: heparanase-like protein 3 [Prunus mume]
Length=542

 Score =   259 bits (663),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 135/205 (66%), Positives = 149/205 (73%), Gaps = 21/205 (10%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            MSA+YDTKTYCRQTLIGGNYGLLNTTT+ PNPDYYSALLWHRLMGRN L+TSFSG KKIR
Sbjct  353  MSAAYDTKTYCRQTLIGGNYGLLNTTTYEPNPDYYSALLWHRLMGRNVLATSFSGPKKIR  412

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
            AYAHCAKQS GIT+LLINL + TTVEA VA+N S+                         
Sbjct  413  AYAHCAKQSKGITVLLINLQNTTTVEARVAFNTSWT---------------LRHKHKSHR  457

Query  391  SPRSQ------KRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNS  230
            S R+Q       R    REEYHLTAK G+L SQTMLLNGN L+++SSG IP + P Y+NS
Sbjct  458  SHRAQLKFHQGLRSETVREEYHLTAKDGNLQSQTMLLNGNALTLNSSGIIPNLDPVYVNS  517

Query  229  SEPITVAPFSIVFAHIPYVFLPACR  155
            SEPI V P SIVFAHIPYV LPACR
Sbjct  518  SEPILVGPSSIVFAHIPYVVLPACR  542



>ref|XP_009358543.1| PREDICTED: heparanase-like protein 3 [Pyrus x bretschneideri]
Length=542

 Score =   259 bits (661),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 133/199 (67%), Positives = 149/199 (75%), Gaps = 8/199 (4%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            MSA+YDT+TYCRQTLIGGNYGLLNTTTF PNPDYYSALLWHRLMGRN L+TSFSG KKIR
Sbjct  352  MSATYDTRTYCRQTLIGGNYGLLNTTTFEPNPDYYSALLWHRLMGRNVLATSFSGPKKIR  411

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
            AYAHCAKQS GIT+LLINL + T +EA VA+N ++    KH  H  H             
Sbjct  412  AYAHCAKQSKGITVLLINLHNTTAIEARVAFNTTWTLRHKHKSHKLHRSQVAKL------  465

Query  391  SPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITV  212
              R   R +  REEYHLTAK G++ SQTMLLNGN L VDSSG+IP + P Y+N+SEPI V
Sbjct  466  --RQGLRSSTEREEYHLTAKDGNIQSQTMLLNGNALRVDSSGTIPSLNPVYVNASEPILV  523

Query  211  APFSIVFAHIPYVFLPACR  155
             P SIVFAHIPYV  PACR
Sbjct  524  GPSSIVFAHIPYVVPPACR  542



>ref|XP_009338385.1| PREDICTED: heparanase-like protein 3 [Pyrus x bretschneideri]
Length=542

 Score =   259 bits (661),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 133/199 (67%), Positives = 149/199 (75%), Gaps = 8/199 (4%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            MSA+YDT+TYCRQTLIGGNYGLLNTTTF PNPDYYSALLWHRLMGRN L+TSFSG KKIR
Sbjct  352  MSATYDTRTYCRQTLIGGNYGLLNTTTFEPNPDYYSALLWHRLMGRNVLATSFSGPKKIR  411

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
            AYAHCAKQS GIT+LLINL + T +EA VA+N ++    KH  H  H             
Sbjct  412  AYAHCAKQSKGITVLLINLHNTTAIEARVAFNTTWTLRHKHKSHKLHRSQVAKL------  465

Query  391  SPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITV  212
              R   R +  REEYHLTAK G++ SQTMLLNGN L VDSSG+IP + P Y+N+SEPI V
Sbjct  466  --RQGLRSSTEREEYHLTAKDGNIQSQTMLLNGNALRVDSSGTIPSLNPVYVNASEPILV  523

Query  211  APFSIVFAHIPYVFLPACR  155
             P SIVFAHIPYV  PACR
Sbjct  524  GPSSIVFAHIPYVVPPACR  542



>ref|XP_008457259.1| PREDICTED: LOW QUALITY PROTEIN: heparanase-like protein 3 [Cucumis 
melo]
Length=538

 Score =   258 bits (660),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 134/200 (67%), Positives = 154/200 (77%), Gaps = 10/200 (5%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            M+A+YDTKTYCRQTLIGGNYGLLNTTTF PNPDYYSALLWHRLMGRN L+  F+GT+KIR
Sbjct  348  MAAAYDTKTYCRQTLIGGNYGLLNTTTFEPNPDYYSALLWHRLMGRNVLTAGFNGTEKIR  407

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
            AYAHC+KQS GITLLL+NLD NTTV A +A+N +            HH H  H H     
Sbjct  408  AYAHCSKQSKGITLLLLNLDGNTTVHAEIAFNRA---------RGLHHKHRSHKHKSNAR  458

Query  391  SPRSQK-RGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPIT  215
             PR     G   REEYHLTAK G+LHSQT+LLNGN LSV+SSG+IP ++P+++NSSEPI 
Sbjct  459  IPRPHGLEGEAFREEYHLTAKDGNLHSQTVLLNGNILSVNSSGNIPPLEPQHVNSSEPIM  518

Query  214  VAPFSIVFAHIPYVFLPACR  155
            VAPFSIVF HIP + LPACR
Sbjct  519  VAPFSIVFIHIPNIVLPACR  538



>ref|XP_008336960.1| PREDICTED: heparanase-like protein 3 [Malus domestica]
Length=542

 Score =   258 bits (658),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 134/199 (67%), Positives = 148/199 (74%), Gaps = 8/199 (4%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            MSA+YDTKTYCRQTLIGGNYGLLNTTTF PNPDYYSALLWHRLMGRN L+TSFSG KKIR
Sbjct  352  MSATYDTKTYCRQTLIGGNYGLLNTTTFEPNPDYYSALLWHRLMGRNVLATSFSGPKKIR  411

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
            AYAHCAKQS GIT+LLINL + T +EA VA+N ++    KH  H  H  H          
Sbjct  412  AYAHCAKQSKGITVLLINLHNTTAIEARVAFNATWTLRHKHKSHKLHRSHVAKL------  465

Query  391  SPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITV  212
              R     +  REEYHLTAK G + SQTMLLNGN L VDSSG+IP + P Y+N+SEPI V
Sbjct  466  --RQGLESSTEREEYHLTAKDGXIQSQTMLLNGNALRVDSSGTIPSLNPVYVNASEPIVV  523

Query  211  APFSIVFAHIPYVFLPACR  155
             P SIVFAHIPYV  PACR
Sbjct  524  GPSSIVFAHIPYVVPPACR  542



>ref|XP_009363939.1| PREDICTED: heparanase-like protein 3 [Pyrus x bretschneideri]
Length=542

 Score =   257 bits (656),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 134/199 (67%), Positives = 148/199 (74%), Gaps = 8/199 (4%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            MSASYDTKTYCRQTLIGGNYGLLNTTTF PNPDYYSALLWHRLMGRN L+TSFSG KKIR
Sbjct  352  MSASYDTKTYCRQTLIGGNYGLLNTTTFEPNPDYYSALLWHRLMGRNVLATSFSGPKKIR  411

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
            AYAHCAKQS GIT+LLINL + TT EA VA+N ++            H  H    +  + 
Sbjct  412  AYAHCAKQSKGITVLLINLHNTTTAEARVAFNTTWT----LRHKHKSHKPHRSHVTKLQQ  467

Query  391  SPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITV  212
             PRS    +  REEYHLT K G++ SQTMLLNGN L VDSSG IP + P Y+N+SEPI V
Sbjct  468  GPRS----STEREEYHLTPKDGNIQSQTMLLNGNALRVDSSGIIPSLNPVYVNASEPILV  523

Query  211  APFSIVFAHIPYVFLPACR  155
             P SIVFAHIPYV  PACR
Sbjct  524  GPSSIVFAHIPYVVPPACR  542



>gb|AFK44771.1| unknown [Medicago truncatula]
Length=186

 Score =   243 bits (621),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 123/198 (62%), Positives = 144/198 (73%), Gaps = 13/198 (7%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            MSASYDTKTYCRQ+LIGGNYGLLNTT F+PNPDYYSALLWHRLMGR  LST+FSGT KIR
Sbjct  1    MSASYDTKTYCRQSLIGGNYGLLNTTNFLPNPDYYSALLWHRLMGRGVLSTTFSGTNKIR  60

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
            AYAHCAKQS GIT+LLINLD++TTVEA  +   S +H +                     
Sbjct  61   AYAHCAKQSKGITILLINLDNSTTVEATFSDGKSSLHRKMPYYSRMMKLPL---------  111

Query  391  SPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITV  212
                Q     +REEYHLT +GG++HSQ MLLNGN LSV+S G IP +KP Y++SS+PI +
Sbjct  112  ----QSSIEKSREEYHLTPQGGNIHSQVMLLNGNVLSVNSDGDIPPLKPLYVSSSKPIRI  167

Query  211  APFSIVFAHIPYVFLPAC  158
            APFSIVF+HIP   + AC
Sbjct  168  APFSIVFSHIPDAVVSAC  185



>ref|XP_002533671.1| heparanase, putative [Ricinus communis]
 gb|EEF28717.1| heparanase, putative [Ricinus communis]
Length=551

 Score =   254 bits (650),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 135/208 (65%), Positives = 152/208 (73%), Gaps = 20/208 (10%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            MSA YDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRN LST+FSG KKIR
Sbjct  355  MSAVYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNVLSTNFSGMKKIR  414

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
            AYAHCAK+S G+TLLLINLD++TTV+ +V  N               H  + H       
Sbjct  415  AYAHCAKESKGVTLLLINLDNSTTVQVHVTLN----------TTATLHDKYRHHSHRSFK  464

Query  391  SPRSQKRGTM---------TREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRY  239
            S RS +  T+         TREEYHLTAK G+LHSQTMLLNGN L V+SSG IP ++P  
Sbjct  465  SHRSHRTRTILLPKGSADSTREEYHLTAKDGNLHSQTMLLNGNILDVNSSGDIPTLEPLR  524

Query  238  LNSSEPITVAPFSIVFAHIPYVFLPACR  155
            +NSS+PITV PFSIVF H+PY  LPACR
Sbjct  525  VNSSQPITVTPFSIVFVHLPYD-LPACR  551



>ref|XP_011457618.1| PREDICTED: heparanase-like protein 3 [Fragaria vesca subsp. vesca]
Length=559

 Score =   254 bits (650),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 128/199 (64%), Positives = 151/199 (76%), Gaps = 2/199 (1%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            MSA YDTKTYCRQTL+GGNYGLLNTTTFVPNPDYYSALLWHRLMGRN L+T F G KKIR
Sbjct  363  MSAVYDTKTYCRQTLVGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNVLATRFGGPKKIR  422

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
            AY HCAKQS GI +LLINL + T V+A VA+N ++    +H  H ++  H    +     
Sbjct  423  AYTHCAKQSKGIVVLLINLHNTTVVQARVAFNSTWSLRHRHKSHKSYRSHMKELNGLRSR  482

Query  391  SPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITV  212
            + R   RG   REEYHLT K G++ SQTMLLNGN L++DSSG+IP ++P ++NSS+PI V
Sbjct  483  AERV--RGDREREEYHLTPKDGNIQSQTMLLNGNALNLDSSGNIPTLEPVFVNSSQPIIV  540

Query  211  APFSIVFAHIPYVFLPACR  155
            APFSIVF HIPYV  PACR
Sbjct  541  APFSIVFVHIPYVVPPACR  559



>ref|XP_006389405.1| hypothetical protein POPTR_0025s00410g [Populus trichocarpa]
 gb|ERP48319.1| hypothetical protein POPTR_0025s00410g [Populus trichocarpa]
Length=547

 Score =   254 bits (649),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 135/198 (68%), Positives = 151/198 (76%), Gaps = 9/198 (5%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            M++SYDTKTYCRQ+LIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRN LSTSFSGTKKIR
Sbjct  358  MASSYDTKTYCRQSLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNVLSTSFSGTKKIR  417

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
            AY HCAKQS GITLLLINLDS+TTV+ NV +N +   HRKH  H +H             
Sbjct  418  AYTHCAKQSKGITLLLINLDSSTTVDVNVKFNSTLGLHRKHKTHRSHETKVIRLLEGSTS  477

Query  391  SPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITV  212
                     +TREEYHLTAK GDLHS+ MLLNGN L+V+SSG IP  +P  +NSS+PI V
Sbjct  478  E--------ITREEYHLTAKDGDLHSRIMLLNGNILTVNSSGDIPSFEPLLVNSSKPIMV  529

Query  211  APFSIVFAHIPYVFLPAC  158
            APFSIVF  + YV LPAC
Sbjct  530  APFSIVFVQMSYV-LPAC  546



>ref|XP_011020240.1| PREDICTED: heparanase-like protein 3 [Populus euphratica]
Length=559

 Score =   253 bits (647),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 139/203 (68%), Positives = 160/203 (79%), Gaps = 7/203 (3%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            M+++YDTKTYCRQ+LIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRN LSTSFSGTKKIR
Sbjct  358  MASAYDTKTYCRQSLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNVLSTSFSGTKKIR  417

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
            AY HCAKQS GITLLLINLD+ TTVE +V +N ++  H+KH  H +H  H HH       
Sbjct  418  AYTHCAKQSKGITLLLINLDNITTVEVSVTFNSTWRLHQKHKPHRSHKLHKHHRSHKSHK  477

Query  391  S-----PRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSS  227
            S     P+    G +TREEYHLTAK GDLHSQTMLLNGN L+V+SSG IP ++P ++NSS
Sbjct  478  SKVTHLPQRSTSG-ITREEYHLTAKDGDLHSQTMLLNGNILTVNSSGDIPYLEPLHVNSS  536

Query  226  EPITVAPFSIVFAHIPYVFLPAC  158
            +PI VAPFSIVF  +PY   PAC
Sbjct  537  KPIMVAPFSIVFVQMPYD-SPAC  558



>gb|AFK40288.1| unknown [Lotus japonicus]
Length=529

 Score =   251 bits (642),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 130/199 (65%), Positives = 149/199 (75%), Gaps = 13/199 (7%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            MSASYDTKTYCRQTLIGGNYGLLNTTTF+PNPDYYSALLWHRLMGR+ LST+FSGTKKIR
Sbjct  342  MSASYDTKTYCRQTLIGGNYGLLNTTTFLPNPDYYSALLWHRLMGRSVLSTTFSGTKKIR  401

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAY-NGSFVhhrkhirhinhhhhhhhshshgk  395
            AYAHCAKQS GI +LLINLDS+T +EA V   +  F+ HRK   +               
Sbjct  402  AYAHCAKQSKGIIILLINLDSSTAIEAEVTLSDNKFLRHRKMADNSKLTEL---------  452

Query  394  GSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPIT  215
              P     GT  REEYHLT  GGD+HSQ M+LNGN L+V+S+G IP ++P ++NSS PIT
Sbjct  453  --PLRGASGT-AREEYHLTPGGGDIHSQIMVLNGNALTVNSAGDIPALEPLFVNSSMPIT  509

Query  214  VAPFSIVFAHIPYVFLPAC  158
            VAPFSIVFAHIP   + AC
Sbjct  510  VAPFSIVFAHIPDAVVAAC  528



>ref|XP_008385022.1| PREDICTED: heparanase-like protein 3 [Malus domestica]
Length=542

 Score =   251 bits (641),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 131/199 (66%), Positives = 145/199 (73%), Gaps = 8/199 (4%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            MSASYDTKTYCRQTLIGGNYGLLNT TF PNPDYYSALLWHRLMGRN L+TSFSG KKIR
Sbjct  352  MSASYDTKTYCRQTLIGGNYGLLNTXTFEPNPDYYSALLWHRLMGRNVLATSFSGPKKIR  411

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
            AYAHCAKQS GIT+LLINL + TT E  VA+N ++            H  H    +  + 
Sbjct  412  AYAHCAKQSKGITVLLINLHNTTTAEVRVAFNTTWT----LRHKHKSHKPHRSHVTKLQQ  467

Query  391  SPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITV  212
             PRS    +  REEYHLT K G++ SQTMLLNGN L VDSSG IP + P Y+N+SEPI  
Sbjct  468  GPRS----STEREEYHLTPKDGNIQSQTMLLNGNALRVDSSGIIPSLNPVYVNASEPILX  523

Query  211  APFSIVFAHIPYVFLPACR  155
             P SIVFAHIPYV  PACR
Sbjct  524  GPSSIVFAHIPYVVPPACR  542



>ref|XP_003533856.1| PREDICTED: heparanase-like protein 3-like [Glycine max]
 gb|KHN48130.1| Heparanase-like protein 3 [Glycine soja]
Length=538

 Score =   248 bits (633),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 128/198 (65%), Positives = 147/198 (74%), Gaps = 12/198 (6%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            MSA+YDTKTYCRQTLIGGNYGLLNTT F+PNPDYYSALLWHRLMGR+ LST+FSGT KIR
Sbjct  352  MSAAYDTKTYCRQTLIGGNYGLLNTTNFLPNPDYYSALLWHRLMGRHVLSTTFSGTNKIR  411

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
            AYAHCAKQS GIT+LLINLDSNTTVEA V +N +           +  H    +HS    
Sbjct  412  AYAHCAKQSKGITVLLINLDSNTTVEAEVTFNNA---------AKSLRHRKMSTHSKVME  462

Query  391  SPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITV  212
             P + +     REEYHLT + GD+HSQ M+LNGN LSV S G IP ++P  +NSSEPI V
Sbjct  463  LPLASE---TAREEYHLTPQDGDIHSQIMVLNGNPLSVSSDGDIPPLEPINVNSSEPIRV  519

Query  211  APFSIVFAHIPYVFLPAC  158
            APFSIVFAH+P   + AC
Sbjct  520  APFSIVFAHLPDAVVSAC  537



>ref|XP_008219534.1| PREDICTED: heparanase-like protein 3 isoform X1 [Prunus mume]
Length=535

 Score =   248 bits (632),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 123/199 (62%), Positives = 140/199 (70%), Gaps = 17/199 (9%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            MSASYDTKTYCRQTLIGGNYGLL+T TFVPNPDYYSALLWHRLMG   LSTSF GTKK+R
Sbjct  354  MSASYDTKTYCRQTLIGGNYGLLDTNTFVPNPDYYSALLWHRLMGNKVLSTSFPGTKKLR  413

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
            AYAHC+K++ GIT+LLINLDSNT V+  V+                              
Sbjct  414  AYAHCSKKTQGITVLLINLDSNTKVQVRVS-----------------TESPGRLSYLNFQ  456

Query  391  SPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITV  212
              R  K     REEYHLTAK GDLHS+ MLLNG  LSVDSSG+IP ++P  + SS+PITV
Sbjct  457  GLRGSKGSQNVREEYHLTAKDGDLHSKVMLLNGKALSVDSSGNIPALEPITVGSSDPITV  516

Query  211  APFSIVFAHIPYVFLPACR  155
            APFSIVF HIP + +PAC+
Sbjct  517  APFSIVFVHIPSIIVPACK  535



>ref|XP_003546578.1| PREDICTED: heparanase-like protein 3-like [Glycine max]
 gb|KHN37477.1| Heparanase-like protein 3 [Glycine soja]
Length=538

 Score =   246 bits (629),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 128/198 (65%), Positives = 148/198 (75%), Gaps = 12/198 (6%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            MSA+YDTKTYCRQ+LIGGNYGLLNTT F+PNPDYYSALLWHRLMGR+ LST+FSGT KIR
Sbjct  352  MSAAYDTKTYCRQSLIGGNYGLLNTTNFLPNPDYYSALLWHRLMGRHVLSTTFSGTNKIR  411

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
            AYAHCAKQS GIT+LLINLDSNTTVEA V +N +           +  H    SHS    
Sbjct  412  AYAHCAKQSKGITVLLINLDSNTTVEAEVTFNNN---------AESLRHRKMSSHSKRME  462

Query  391  SPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITV  212
             P + +     REEYHLT + GD+HSQTM+LNG  LSV+S G IP ++P Y+NSSEPI V
Sbjct  463  LPLASETA---REEYHLTPQDGDIHSQTMVLNGKALSVNSDGDIPPLEPIYVNSSEPIRV  519

Query  211  APFSIVFAHIPYVFLPAC  158
            A FSIVFAH+P   + AC
Sbjct  520  AAFSIVFAHLPDAVVSAC  537



>gb|AAC62794.1| T2L5.6 gene product [Arabidopsis thaliana]
Length=190

 Score =   236 bits (601),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 115/198 (58%), Positives = 139/198 (70%), Gaps = 9/198 (5%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            M++ YDTKTYCRQ+LIGGNYGLLNTT F PNPDYYSAL+W +LMGR AL T+FSGTKKIR
Sbjct  1    MASLYDTKTYCRQSLIGGNYGLLNTTNFTPNPDYYSALIWRQLMGRKALFTTFSGTKKIR  60

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
            +Y HCA+QS GIT+LL+NLD+ TTV A V  N SF                         
Sbjct  61   SYTHCARQSKGITVLLMNLDNTTTVVAKVELNNSFSLRHTKHMKSYKRASSQLF------  114

Query  391  SPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITV  212
                   G + REEYHLTAK G+LHSQTMLLNGN L V+S G +P ++P ++NS+EPIT+
Sbjct  115  ---GGPNGVIQREEYHLTAKDGNLHSQTMLLNGNALQVNSMGDLPPIEPIHINSTEPITI  171

Query  211  APFSIVFAHIPYVFLPAC  158
            AP+SIVF H+  V +PAC
Sbjct  172  APYSIVFVHMRNVVVPAC  189



>ref|XP_007013614.1| Glucuronidase 3 isoform 2 [Theobroma cacao]
 gb|EOY31233.1| Glucuronidase 3 isoform 2 [Theobroma cacao]
Length=554

 Score =   247 bits (630),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 128/199 (64%), Positives = 152/199 (76%), Gaps = 2/199 (1%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            M++ YDTKTYCRQ+LIGGNYGLLNT  FVPNPDYYSALLWH+LMGRN LSTSF+GTKKIR
Sbjct  357  MASKYDTKTYCRQSLIGGNYGLLNTANFVPNPDYYSALLWHQLMGRNVLSTSFAGTKKIR  416

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
            +Y HCAKQS GITLLLINLD++TTV+A +A+N +     KH     HH H  H  S  + 
Sbjct  417  SYTHCAKQSKGITLLLINLDNSTTVQAKLAFNSTMTLQHKHRSRTLHHKHRSHKKSIIQL  476

Query  391  SPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITV  212
               +     + REEYHLTAK G+LHSQTMLLNGN LSV+SSG IP ++P  +NS +PI V
Sbjct  477  PQGTDAE--IRREEYHLTAKDGNLHSQTMLLNGNILSVNSSGIIPPLEPLLVNSPKPIMV  534

Query  211  APFSIVFAHIPYVFLPACR  155
            AP SIVF H+P V +PAC+
Sbjct  535  APLSIVFIHMPDVIVPACK  553



>ref|XP_010533116.1| PREDICTED: heparanase-like protein 3 [Tarenaya hassleriana]
Length=547

 Score =   246 bits (627),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 121/199 (61%), Positives = 146/199 (73%), Gaps = 4/199 (2%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            MS+ YDTKTYCRQ+L+GGNYGLLNTT F PNPDYYSALLWHRLMGRNAL TSFSG+KKIR
Sbjct  351  MSSLYDTKTYCRQSLVGGNYGLLNTTNFTPNPDYYSALLWHRLMGRNALFTSFSGSKKIR  410

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
            +Y HCAKQS GIT+LL+NLD+ TTV+A V +NGS +                 +      
Sbjct  411  SYTHCAKQSKGITVLLMNLDNTTTVQARVEFNGSSILRHTVHHRHGSKSSRKRAFPGL--  468

Query  391  SPRSQ-KRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPIT  215
             PR    +G M REEYHLT K GDLHSQ++LLNGN LSV  +G +P ++PR ++S++PIT
Sbjct  469  -PRPWVSKGLMGREEYHLTPKDGDLHSQSVLLNGNVLSVSPTGEMPSLEPRSVSSTDPIT  527

Query  214  VAPFSIVFAHIPYVFLPAC  158
            V+P SIVF H+P V  PAC
Sbjct  528  VSPLSIVFVHMPNVVAPAC  546



>ref|XP_002324878.2| hypothetical protein POPTR_0018s02050g [Populus trichocarpa]
 gb|EEF03443.2| hypothetical protein POPTR_0018s02050g [Populus trichocarpa]
Length=563

 Score =   246 bits (628),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 129/204 (63%), Positives = 146/204 (72%), Gaps = 18/204 (9%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            M++SYDTKTYCRQTLIGGNYGLLNT TFVPNPDYYSALLWHRLMGRN LST+FSGT  IR
Sbjct  370  MASSYDTKTYCRQTLIGGNYGLLNTGTFVPNPDYYSALLWHRLMGRNVLSTTFSGTNNIR  429

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEA-----NVAYNGSFVhhrkhirhinhhhhhhhsh  407
            AYAHCAK S GITLLLINLD NTTVE      NV  NG+ V  +++    +         
Sbjct  430  AYAHCAKASKGITLLLINLDGNTTVEVHVSTENVTGNGTLVTQQQNQTKFSGMS------  483

Query  406  shgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSS  227
                   +       TREEYHLTA  GDLHSQT+LLNGN LSV+SSGS+P ++P   + S
Sbjct  484  -------KGSNIDVSTREEYHLTALNGDLHSQTVLLNGNILSVNSSGSVPPLEPIETSQS  536

Query  226  EPITVAPFSIVFAHIPYVFLPACR  155
            +PITVAPFSIVFAHI    +PAC 
Sbjct  537  DPITVAPFSIVFAHIANSTVPACE  560



>gb|KDP30214.1| hypothetical protein JCGZ_16996 [Jatropha curcas]
Length=555

 Score =   246 bits (627),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 131/208 (63%), Positives = 152/208 (73%), Gaps = 16/208 (8%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            M++++DTKTYCRQ+LIGGNYGLLNT TFVPNPDYYSALLWHRLMGRN L  +FSGTKKIR
Sbjct  355  MASTFDTKTYCRQSLIGGNYGLLNTATFVPNPDYYSALLWHRLMGRNVLLANFSGTKKIR  414

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
            AYAHC K+S GITLLLINLD++TTV+ NVA+NG+         H  H HH          
Sbjct  415  AYAHCTKESKGITLLLINLDNSTTVQVNVAFNGT------EKLHQKHWHHRSFRSHRSFR  468

Query  391  SPRSQK---------RGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRY  239
              RS K           + TREEYHLTAK  DLHSQTMLLNG  L+V+SSG IP ++P  
Sbjct  469  PHRSHKTRIIQMHEGSASSTREEYHLTAKDRDLHSQTMLLNGKTLTVNSSGDIPILEPIN  528

Query  238  LNSSEPITVAPFSIVFAHIPYVFLPACR  155
            +NSS PI VAPFSIVFA++PY  +PACR
Sbjct  529  VNSSTPIIVAPFSIVFANLPYD-IPACR  555



>ref|XP_011017900.1| PREDICTED: heparanase-like protein 3 isoform X1 [Populus euphratica]
 ref|XP_011017901.1| PREDICTED: heparanase-like protein 3 isoform X2 [Populus euphratica]
Length=547

 Score =   245 bits (626),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 131/198 (66%), Positives = 148/198 (75%), Gaps = 9/198 (5%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            M++SYDTKTYCRQ+LIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRN LST  SGTKKIR
Sbjct  358  MASSYDTKTYCRQSLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNVLSTRSSGTKKIR  417

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
            AY HCAKQS GITLLLINLDS+TTV+ NV +N +   HRKH  H +H             
Sbjct  418  AYTHCAKQSKGITLLLINLDSSTTVDVNVKFNSTLGLHRKHKTHRSHETKVIRLLEGSTS  477

Query  391  SPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITV  212
                     +TREEYHLTAK GDLHS+ MLLNGN L+V+SSG IP  +P  +NSS+PI V
Sbjct  478  E--------ITREEYHLTAKDGDLHSRIMLLNGNILTVNSSGDIPSFEPLLVNSSKPIVV  529

Query  211  APFSIVFAHIPYVFLPAC  158
             P+SIVF  + YV LPAC
Sbjct  530  GPYSIVFVQMSYV-LPAC  546



>ref|XP_007013613.1| Glucuronidase 3 isoform 1 [Theobroma cacao]
 gb|EOY31232.1| Glucuronidase 3 isoform 1 [Theobroma cacao]
Length=615

 Score =   247 bits (630),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 128/199 (64%), Positives = 152/199 (76%), Gaps = 2/199 (1%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            M++ YDTKTYCRQ+LIGGNYGLLNT  FVPNPDYYSALLWH+LMGRN LSTSF+GTKKIR
Sbjct  357  MASKYDTKTYCRQSLIGGNYGLLNTANFVPNPDYYSALLWHQLMGRNVLSTSFAGTKKIR  416

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
            +Y HCAKQS GITLLLINLD++TTV+A +A+N +     KH     HH H  H  S  + 
Sbjct  417  SYTHCAKQSKGITLLLINLDNSTTVQAKLAFNSTMTLQHKHRSRTLHHKHRSHKKSIIQL  476

Query  391  SPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITV  212
               +     + REEYHLTAK G+LHSQTMLLNGN LSV+SSG IP ++P  +NS +PI V
Sbjct  477  PQGTDAE--IRREEYHLTAKDGNLHSQTMLLNGNILSVNSSGIIPPLEPLLVNSPKPIMV  534

Query  211  APFSIVFAHIPYVFLPACR  155
            AP SIVF H+P V +PAC+
Sbjct  535  APLSIVFIHMPDVIVPACK  553



>ref|XP_009409980.1| PREDICTED: heparanase-like protein 3 [Musa acuminata subsp. malaccensis]
Length=549

 Score =   245 bits (625),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 125/204 (61%), Positives = 147/204 (72%), Gaps = 15/204 (7%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            MS++YDTKTYCRQ+LIGGNYGLLNTTTF PNPDYYSALLWHRLMGR  LST+ +GT KIR
Sbjct  356  MSSTYDTKTYCRQSLIGGNYGLLNTTTFHPNPDYYSALLWHRLMGRRVLSTNITGTNKIR  415

Query  571  AYAHCAKQSGGITLLLINLDSNTT-----VEANVAYNGSFVhhrkhirhinhhhhhhhsh  407
            AYAHCA++S GITLLLINL  N +     V     Y+ +             H  H    
Sbjct  416  AYAHCARESPGITLLLINLSGNNSTTPVFVTTQTVYSAAL----------KQHRRHGAHR  465

Query  406  shgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSS  227
            +     PR  K    TREEYHLTAK GD+HSQT+LLNGN L+VDSSG+IPE++P  + ++
Sbjct  466  TRFNHIPRLGKTSEFTREEYHLTAKDGDIHSQTVLLNGNILAVDSSGNIPELEPVKVEAT  525

Query  226  EPITVAPFSIVFAHIPYVFLPACR  155
            +PITVAPFSIVFAHIPY + PACR
Sbjct  526  QPITVAPFSIVFAHIPYFYAPACR  549



>ref|XP_010435392.1| PREDICTED: heparanase-like protein 3, partial [Camelina sativa]
Length=315

 Score =   238 bits (606),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 117/198 (59%), Positives = 139/198 (70%), Gaps = 9/198 (5%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            MS+ YDTKTYCRQ+LIGGNYGLLNTT F PNPDYYSAL+W +LMGR AL TSFSGTKKIR
Sbjct  126  MSSVYDTKTYCRQSLIGGNYGLLNTTNFTPNPDYYSALIWRQLMGRKALFTSFSGTKKIR  185

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
            +Y HCA+QS GIT+LL+NLD+ TTV A V  N +F                         
Sbjct  186  SYTHCARQSKGITVLLMNLDNTTTVVAKVELNNTFSLRHTKHMKSYKRETSQLP------  239

Query  391  SPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITV  212
               S   G + REEYHLTAK G+LHSQTMLLNGN L V+S G +P ++P ++NS+EPIT+
Sbjct  240  ---SDSNGEIQREEYHLTAKDGNLHSQTMLLNGNALQVNSMGDLPPIEPIHINSTEPITI  296

Query  211  APFSIVFAHIPYVFLPAC  158
            AP SIVF H+  V +PAC
Sbjct  297  APHSIVFVHMRSVVVPAC  314



>ref|XP_007138475.1| hypothetical protein PHAVU_009G212400g [Phaseolus vulgaris]
 gb|ESW10469.1| hypothetical protein PHAVU_009G212400g [Phaseolus vulgaris]
Length=536

 Score =   244 bits (623),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 123/198 (62%), Positives = 148/198 (75%), Gaps = 14/198 (7%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            MSA+Y+TKTYCRQ+LIGGNYGLLNTT F+PNPDYYSALLWHRLMGRN LST+FSGTK IR
Sbjct  352  MSAAYNTKTYCRQSLIGGNYGLLNTTNFLPNPDYYSALLWHRLMGRNVLSTTFSGTKMIR  411

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
            AYAHCAKQS GIT+LLINLD NT+VEA+V ++ +                   SHS+   
Sbjct  412  AYAHCAKQSKGITVLLINLDGNTSVEADVTFDNN-----------AKSLRKMFSHSNMME  460

Query  391  SPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITV  212
             P + +     REEYHLT + G++HSQ M+LNG  L V+S+G IP + P Y+NSSEPI V
Sbjct  461  LPLASET---AREEYHLTPQDGNIHSQIMVLNGKPLRVNSAGDIPPLDPIYVNSSEPINV  517

Query  211  APFSIVFAHIPYVFLPAC  158
            APFSIVFAH+P+V + AC
Sbjct  518  APFSIVFAHLPHVVVTAC  535



>ref|XP_008219535.1| PREDICTED: heparanase-like protein 3 isoform X2 [Prunus mume]
Length=534

 Score =   244 bits (622),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 123/199 (62%), Positives = 140/199 (70%), Gaps = 18/199 (9%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            MSASYDTKTYCRQTLIGGNYGLL+T TFVPNPDYYSALLWHRLMG   LSTSF GTKK+R
Sbjct  354  MSASYDTKTYCRQTLIGGNYGLLDTNTFVPNPDYYSALLWHRLMGNKVLSTSFPGTKKLR  413

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
            AYAHC+K++ GIT+LLINLDSNT V+  V+                              
Sbjct  414  AYAHCSKKT-GITVLLINLDSNTKVQVRVS-----------------TESPGRLSYLNFQ  455

Query  391  SPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITV  212
              R  K     REEYHLTAK GDLHS+ MLLNG  LSVDSSG+IP ++P  + SS+PITV
Sbjct  456  GLRGSKGSQNVREEYHLTAKDGDLHSKVMLLNGKALSVDSSGNIPALEPITVGSSDPITV  515

Query  211  APFSIVFAHIPYVFLPACR  155
            APFSIVF HIP + +PAC+
Sbjct  516  APFSIVFVHIPSIIVPACK  534



>gb|ACJ85694.1| unknown [Medicago truncatula]
Length=176

 Score =   232 bits (592),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 118/189 (62%), Positives = 137/189 (72%), Gaps = 13/189 (7%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            MSASYDTKTYCRQ+LIGGNYGLLNTT F+PNPDYYSALLWHRLMGR  LST+FSGT KIR
Sbjct  1    MSASYDTKTYCRQSLIGGNYGLLNTTNFLPNPDYYSALLWHRLMGRGVLSTTFSGTNKIR  60

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
            AYAHCAKQS GIT+LLINLD++TTVEA  +   S +H +                     
Sbjct  61   AYAHCAKQSKGITILLINLDNSTTVEATFSDGKSSLHRKMPYYSRMMKLPL---------  111

Query  391  SPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITV  212
                Q     +REEYHLT +GG++HSQ MLLNGN LSV+S G IP +KP Y++SS+PI +
Sbjct  112  ----QSSIEKSREEYHLTPQGGNIHSQVMLLNGNVLSVNSDGDIPPLKPLYVSSSKPIRI  167

Query  211  APFSIVFAH  185
             PFSIVF H
Sbjct  168  VPFSIVFFH  176



>gb|KHG18442.1| hypothetical protein F383_07597 [Gossypium arboreum]
Length=545

 Score =   243 bits (621),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 119/199 (60%), Positives = 144/199 (72%), Gaps = 2/199 (1%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            M++ YDTKTYCRQ+LIGGNYGLL+T+TFVPNPDYYSALLWH+LMGRN LSTSF GTKKIR
Sbjct  348  MASKYDTKTYCRQSLIGGNYGLLDTSTFVPNPDYYSALLWHQLMGRNVLSTSFDGTKKIR  407

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
            +Y+HCAKQS GI +L INLD +TTV+A +A+N +      H                 + 
Sbjct  408  SYSHCAKQSEGIVVLFINLDKSTTVQAKLAFNSTMTLRHNHESRTLRIQRMSSKKMIIEL  467

Query  391  SPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITV  212
                     + REEYHLTAK G+L S+TMLLNGN L VDSSG+IP +KP Y+NS++PITV
Sbjct  468  PQMVDAE--IRREEYHLTAKDGNLQSRTMLLNGNILGVDSSGNIPPLKPLYVNSAKPITV  525

Query  211  APFSIVFAHIPYVFLPACR  155
             P SIVF H+  V LPAC+
Sbjct  526  EPLSIVFIHLSDVILPACK  544



>ref|XP_008801894.1| PREDICTED: heparanase-like protein 3 isoform X2 [Phoenix dactylifera]
Length=499

 Score =   241 bits (616),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 123/199 (62%), Positives = 145/199 (73%), Gaps = 10/199 (5%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            MS++YDTK+YCRQ+L+GGNYGLLNTTTF PNPDYYSALLWHRLMG   L T+F+GTK IR
Sbjct  311  MSSTYDTKSYCRQSLVGGNYGLLNTTTFHPNPDYYSALLWHRLMGSKVLPTNFTGTKNIR  370

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
            AYAHCA++S GITLLLINL SNTT    V    +F          +    H+   +    
Sbjct  371  AYAHCARESQGITLLLINLSSNTTTRVFVTTASAF----------SMASKHYIPRTRFNH  420

Query  391  SPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITV  212
             P  Q++    REEYHLTA  G+LHSQTMLLNGN LSVDS G+IP +KP  +++S PITV
Sbjct  421  VPGLQRKLGFIREEYHLTANKGNLHSQTMLLNGNILSVDSEGNIPTLKPIEVDASLPITV  480

Query  211  APFSIVFAHIPYVFLPACR  155
            APFSIVFAHIPY + PACR
Sbjct  481  APFSIVFAHIPYFYAPACR  499



>ref|XP_007224283.1| hypothetical protein PRUPE_ppa019445mg, partial [Prunus persica]
 gb|EMJ25482.1| hypothetical protein PRUPE_ppa019445mg, partial [Prunus persica]
Length=511

 Score =   241 bits (616),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 121/199 (61%), Positives = 137/199 (69%), Gaps = 17/199 (9%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            MSASYDTKTYCRQTLIGGNYGLL+T TFVPNPDYYSALLWHRLMG   LSTSF GTKK+R
Sbjct  330  MSASYDTKTYCRQTLIGGNYGLLDTNTFVPNPDYYSALLWHRLMGNKVLSTSFPGTKKLR  389

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
            AYAHC+K++ GIT+LLINLDSNT V+  V+                              
Sbjct  390  AYAHCSKKTQGITVLLINLDSNTKVQVRVS-----------------TESPGKLSYLNFQ  432

Query  391  SPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITV  212
              R  K     REEYHLTAK GDLHS+ MLLNG  LSVDSSG+IP ++P  + SS P TV
Sbjct  433  GLRGSKASQNVREEYHLTAKDGDLHSKVMLLNGKALSVDSSGNIPALEPITVGSSNPTTV  492

Query  211  APFSIVFAHIPYVFLPACR  155
            AP SIVF HIP + +PAC+
Sbjct  493  APLSIVFVHIPGITVPACK  511



>gb|KJB64649.1| hypothetical protein B456_010G059600 [Gossypium raimondii]
Length=545

 Score =   242 bits (617),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 119/199 (60%), Positives = 143/199 (72%), Gaps = 2/199 (1%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            M++ YDTKTYCRQ+LIGGNYGLL+T+TFVPNPDYYSALLWHRLMGRN LSTSF GTKKIR
Sbjct  348  MASKYDTKTYCRQSLIGGNYGLLDTSTFVPNPDYYSALLWHRLMGRNVLSTSFDGTKKIR  407

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
            +Y HCAKQS GI +L INLD +TTV+A +A+N +      H                 + 
Sbjct  408  SYTHCAKQSEGIMVLFINLDKSTTVQAKLAFNSTMTLRHNHESRTLRIQRMSSKKMIIEL  467

Query  391  SPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITV  212
                     + REEYHL AK G+L S+TMLLNGN LSVDSSG+IP ++P Y+NS++PITV
Sbjct  468  PQMVDAE--IRREEYHLRAKDGNLQSRTMLLNGNILSVDSSGNIPPLEPLYVNSAKPITV  525

Query  211  APFSIVFAHIPYVFLPACR  155
             P SIVF H+  V LPAC+
Sbjct  526  EPLSIVFIHLSDVILPACK  544



>ref|XP_006283483.1| hypothetical protein CARUB_v10004531mg [Capsella rubella]
 gb|EOA16381.1| hypothetical protein CARUB_v10004531mg [Capsella rubella]
Length=544

 Score =   242 bits (617),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 119/198 (60%), Positives = 142/198 (72%), Gaps = 9/198 (5%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            M++ YDTKTYCRQ+LIGGNYGLLNTT F PNPDYYSAL+W +LMGR AL TSFSGTKKIR
Sbjct  355  MASVYDTKTYCRQSLIGGNYGLLNTTNFTPNPDYYSALIWRKLMGRKALFTSFSGTKKIR  414

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
            +YAHCA+QS GIT+LL+NLD+ TTV A V  N +F                  S      
Sbjct  415  SYAHCARQSKGITVLLMNLDNTTTVLAKVELNNTFSLRHTKHVKSYKRATSQLSW-----  469

Query  391  SPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITV  212
                   G + REEYHLTAK G+LHSQTMLLNGN L V+S G IP ++P ++NS+EPIT+
Sbjct  470  ----DSDGEVQREEYHLTAKDGNLHSQTMLLNGNALQVNSMGDIPPIEPIHINSTEPITI  525

Query  211  APFSIVFAHIPYVFLPAC  158
            AP+SIVF H+P V +PAC
Sbjct  526  APYSIVFVHMPSVVVPAC  543



>gb|KEH37925.1| glycoside hydrolase family 79 amino-terminal domain protein [Medicago 
truncatula]
Length=537

 Score =   241 bits (616),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 123/198 (62%), Positives = 144/198 (73%), Gaps = 13/198 (7%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            MSASYDTKTYCRQ+LIGGNYGLLNTT F+PNPDYYSALLWHRLMGR  LST+FSGT KIR
Sbjct  352  MSASYDTKTYCRQSLIGGNYGLLNTTNFLPNPDYYSALLWHRLMGRGVLSTTFSGTNKIR  411

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
            AYAHCAKQS GIT+LLINLD++TTVEA  +   S +H +                     
Sbjct  412  AYAHCAKQSKGITILLINLDNSTTVEATFSDGKSSLHRKMPYYSRMMKLPL---------  462

Query  391  SPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITV  212
                Q     +REEYHLT +GG++HSQ MLLNGN LSV+S G IP +KP Y++SS+PI +
Sbjct  463  ----QSSIEKSREEYHLTPQGGNIHSQVMLLNGNVLSVNSDGDIPPLKPLYVSSSKPIRI  518

Query  211  APFSIVFAHIPYVFLPAC  158
            APFSIVF+HIP   + AC
Sbjct  519  APFSIVFSHIPDAVVSAC  536



>ref|XP_004159389.1| PREDICTED: LOW QUALITY PROTEIN: heparanase-like protein 3-like 
[Cucumis sativus]
Length=539

 Score =   241 bits (616),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 134/199 (67%), Positives = 156/199 (78%), Gaps = 7/199 (4%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            M+A+YDTKTYCRQTLIGGNYGLLNTTTF PNPDYYSALLWHRLMGRN LST F+GT+KIR
Sbjct  348  MAAAYDTKTYCRQTLIGGNYGLLNTTTFEPNPDYYSALLWHRLMGRNVLSTGFNGTEKIR  407

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
            AYAHC+KQS GITLLL+NLD N TV A +A+N +         H  H  + H S+     
Sbjct  408  AYAHCSKQSKGITLLLLNLDGNNTVHAGIAFNRT------TALHHKHRSNKHKSNIVRIP  461

Query  391  SPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITV  212
             PR  + G   REEYHLTAK G+LHSQT+LLNGN LSV+SSG+IP ++P+++NSSEPI V
Sbjct  462  RPRGLE-GEAFREEYHLTAKDGNLHSQTVLLNGNILSVNSSGNIPPLEPQHVNSSEPIMV  520

Query  211  APFSIVFAHIPYVFLPACR  155
            APFSIVF HIP + LPACR
Sbjct  521  APFSIVFIHIPNIILPACR  539



>ref|XP_004139281.1| PREDICTED: heparanase-like protein 3-like [Cucumis sativus]
Length=539

 Score =   241 bits (615),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 134/199 (67%), Positives = 156/199 (78%), Gaps = 7/199 (4%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            M+A+YDTKTYCRQTLIGGNYGLLNTTTF PNPDYYSALLWHRLMGRN LST F+GT+KIR
Sbjct  348  MAAAYDTKTYCRQTLIGGNYGLLNTTTFEPNPDYYSALLWHRLMGRNVLSTGFNGTEKIR  407

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
            AYAHC+KQS GITLLL+NLD N TV A +A+N +         H  H  + H S+     
Sbjct  408  AYAHCSKQSKGITLLLLNLDGNNTVHAGIAFNRT------TALHHKHRSNKHKSNIVRIP  461

Query  391  SPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITV  212
             PR  + G   REEYHLTAK G+LHSQT+LLNGN LSV+SSG+IP ++P+++NSSEPI V
Sbjct  462  RPRGLE-GEAFREEYHLTAKDGNLHSQTVLLNGNILSVNSSGNIPPLEPQHVNSSEPIMV  520

Query  211  APFSIVFAHIPYVFLPACR  155
            APFSIVF HIP + LPACR
Sbjct  521  APFSIVFIHIPNIILPACR  539



>ref|XP_008801893.1| PREDICTED: heparanase-like protein 3 isoform X1 [Phoenix dactylifera]
Length=548

 Score =   241 bits (615),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 123/199 (62%), Positives = 145/199 (73%), Gaps = 10/199 (5%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            MS++YDTK+YCRQ+L+GGNYGLLNTTTF PNPDYYSALLWHRLMG   L T+F+GTK IR
Sbjct  360  MSSTYDTKSYCRQSLVGGNYGLLNTTTFHPNPDYYSALLWHRLMGSKVLPTNFTGTKNIR  419

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
            AYAHCA++S GITLLLINL SNTT    V    +F          +    H+   +    
Sbjct  420  AYAHCARESQGITLLLINLSSNTTTRVFVTTASAF----------SMASKHYIPRTRFNH  469

Query  391  SPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITV  212
             P  Q++    REEYHLTA  G+LHSQTMLLNGN LSVDS G+IP +KP  +++S PITV
Sbjct  470  VPGLQRKLGFIREEYHLTANKGNLHSQTMLLNGNILSVDSEGNIPTLKPIEVDASLPITV  529

Query  211  APFSIVFAHIPYVFLPACR  155
            APFSIVFAHIPY + PACR
Sbjct  530  APFSIVFAHIPYFYAPACR  548



>ref|XP_011081531.1| PREDICTED: heparanase-like protein 3 [Sesamum indicum]
Length=549

 Score =   241 bits (614),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 122/199 (61%), Positives = 143/199 (72%), Gaps = 15/199 (8%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            MS+SYDTKTYCRQ+LIGGNYGLLNTTT+VPNPDYYSALLWHRLMGR  LSTSF GT KIR
Sbjct  366  MSSSYDTKTYCRQSLIGGNYGLLNTTTYVPNPDYYSALLWHRLMGRKVLSTSFVGTNKIR  425

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
            AYAHCAK S G+TLLLINLD++T V+  ++        RK      +             
Sbjct  426  AYAHCAKNSPGVTLLLINLDNSTAVQVGLSVENIVQQTRKTKFTSIY-------------  472

Query  391  SPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITV  212
              +      M REEYHLT K GDLHSQTMLLNG  ++V+SSG IP ++PR ++ SEPITV
Sbjct  473  --KHHTEFEMMREEYHLTPKDGDLHSQTMLLNGEIITVNSSGMIPPLEPRRVDLSEPITV  530

Query  211  APFSIVFAHIPYVFLPACR  155
            APFSI+FA IP + LPAC+
Sbjct  531  APFSILFARIPSIQLPACK  549



>gb|KHG18266.1| hypothetical protein F383_21213 [Gossypium arboreum]
Length=519

 Score =   239 bits (611),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 123/199 (62%), Positives = 152/199 (76%), Gaps = 2/199 (1%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            M++ YDTKTYCRQ+L+GGNYGLLNTT F PNPDYYSALLWHRLMGRN LSTSF+GT KIR
Sbjct  320  MASKYDTKTYCRQSLVGGNYGLLNTTNFEPNPDYYSALLWHRLMGRNVLSTSFTGTDKIR  379

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
            +Y HCAKQS GITLLLINL+++TTV A +A+N S +  +   R    HH H    +    
Sbjct  380  SYTHCAKQSKGITLLLINLNNSTTVRAKLAFN-STMSLQHKHRSRISHHKHKIHKTTIIK  438

Query  391  SPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITV  212
             P+    G + REEYHLTAKGG+L SQ++LLNGN LSV+SSG IP ++P ++ S++PI V
Sbjct  439  LPQGID-GKIRREEYHLTAKGGNLQSQSILLNGNILSVNSSGFIPHLEPLHVKSAKPIMV  497

Query  211  APFSIVFAHIPYVFLPACR  155
            AP SIVF H+P V +PAC+
Sbjct  498  APLSIVFTHMPDVTVPACK  516



>ref|XP_011036604.1| PREDICTED: heparanase-like protein 3 isoform X2 [Populus euphratica]
Length=520

 Score =   239 bits (611),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 126/204 (62%), Positives = 144/204 (71%), Gaps = 18/204 (9%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            M++SYDTKTYCRQTLIGGNYGLLNT TFVPNPDYYSALLWHRLMGRN LST+FSGT  IR
Sbjct  327  MASSYDTKTYCRQTLIGGNYGLLNTGTFVPNPDYYSALLWHRLMGRNVLSTTFSGTNNIR  386

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEA-----NVAYNGSFVhhrkhirhinhhhhhhhsh  407
            AYAHCAK S GITLLLINLD NTTV+      NV  NG+ V  +++    +         
Sbjct  387  AYAHCAKASKGITLLLINLDGNTTVKVHVANENVTSNGTLVTQQQNQTTFSGMS------  440

Query  406  shgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSS  227
                   R       TREEYHLTA  GDLH QT+LLNGN LSV+SSGS+P ++P   + S
Sbjct  441  -------RGSNIDVSTREEYHLTALNGDLHCQTVLLNGNILSVNSSGSVPPLEPIETSQS  493

Query  226  EPITVAPFSIVFAHIPYVFLPACR  155
            +PIT APFSIVFAH+    +PAC 
Sbjct  494  DPITGAPFSIVFAHLANSTVPACE  517



>ref|XP_002283260.2| PREDICTED: heparanase-like protein 3 [Vitis vinifera]
Length=532

 Score =   239 bits (610),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 121/199 (61%), Positives = 142/199 (71%), Gaps = 6/199 (3%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            M++SYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRN LSTSF GT+KIR
Sbjct  338  MASSYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNVLSTSFYGTRKIR  397

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
            AYAHC+KQS GITLLLINLD NTTV+  V+   +        R            S+   
Sbjct  398  AYAHCSKQSPGITLLLINLDGNTTVQVQVSTENA------GNRTSTLQDTDKTQRSNFSR  451

Query  391  SPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITV  212
              R  K     REEYHLTAK GDLHSQT+LLNG  L+++SS  +P ++P  ++S +P+ V
Sbjct  452  MRRVSKIDASVREEYHLTAKDGDLHSQTLLLNGKVLTINSSRIVPPLEPIRVSSMDPVIV  511

Query  211  APFSIVFAHIPYVFLPACR  155
            APFSIVF   P +  PAC+
Sbjct  512  APFSIVFVRFPNINYPACK  530



>gb|EYU34947.1| hypothetical protein MIMGU_mgv1a004017mg [Erythranthe guttata]
Length=549

 Score =   239 bits (611),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 127/200 (64%), Positives = 150/200 (75%), Gaps = 3/200 (2%)
 Frame = -1

Query  748  SASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIRA  569
            S++YDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMG++ LSTSF+G++KIRA
Sbjct  349  SSTYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGKSVLSTSFTGSRKIRA  408

Query  568  YAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkGS  389
            YAHCAK+S GITLLLIN+D NTTV A V  +G  V  + H     HHH   H H   KG+
Sbjct  409  YAHCAKKSQGITLLLINIDGNTTVNAKVDIHGRVVRMQNHSNIHPHHHMPRHHHRRSKGT  468

Query  388  P---RSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPI  218
            P     Q      REEYHLT  GGD+HSQT+LLNG +L+VDSSG IP + P  ++S EP+
Sbjct  469  PLHHNKQVSANNVREEYHLTPLGGDIHSQTVLLNGKKLTVDSSGVIPALDPVTVDSLEPL  528

Query  217  TVAPFSIVFAHIPYVFLPAC  158
             VAP+SIVF H+P   + AC
Sbjct  529  IVAPYSIVFVHMPNFDVSAC  548



>ref|XP_010906003.1| PREDICTED: heparanase-like protein 3 [Elaeis guineensis]
Length=545

 Score =   239 bits (611),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 124/199 (62%), Positives = 142/199 (71%), Gaps = 10/199 (5%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            MS++YDTK+YCRQ+L+GGNYGLLNTTTF PNPDYYSALLWHRLMG   LST+F+GTK IR
Sbjct  357  MSSTYDTKSYCRQSLVGGNYGLLNTTTFHPNPDYYSALLWHRLMGSKVLSTNFTGTKNIR  416

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
            AYAHCA++S GITLLLINL  NTT E  V    +F    KH       +H          
Sbjct  417  AYAHCARESQGITLLLINLSGNTTTEVFVTTASAFAIASKHYIPRTRFNHV---------  467

Query  391  SPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITV  212
             P  Q+     REEYHLTA  G+LHSQTMLLNGN L VDS G IP +KP  +++S PITV
Sbjct  468  -PGFQRTLAFMREEYHLTAGDGNLHSQTMLLNGNILHVDSEGKIPTLKPIEVDASLPITV  526

Query  211  APFSIVFAHIPYVFLPACR  155
             PFSIVFAHIPY + PACR
Sbjct  527  TPFSIVFAHIPYFYAPACR  545



>ref|XP_009355782.1| PREDICTED: heparanase-like protein 3 [Pyrus x bretschneideri]
Length=533

 Score =   239 bits (609),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 121/198 (61%), Positives = 140/198 (71%), Gaps = 19/198 (10%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            ++ASYDTKTYCRQTLIGGNYGLL+T TF PNPDYYSALLWHRLMG  ALSTSFSGTKKIR
Sbjct  354  LAASYDTKTYCRQTLIGGNYGLLDTNTFQPNPDYYSALLWHRLMGNKALSTSFSGTKKIR  413

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
            AYAHC+K++ GIT+LLINLDSNTTV+  V+ + +                          
Sbjct  414  AYAHCSKKTKGITVLLINLDSNTTVQVRVSTDST-------------------GRPVSSE  454

Query  391  SPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITV  212
            S +S K     REEYHLTA+ GDL S+ MLLNG  LSVDSSG IP ++P  +  S+P TV
Sbjct  455  SLQSSKDSDDVREEYHLTAQDGDLQSKVMLLNGKALSVDSSGDIPPLEPITVRLSDPTTV  514

Query  211  APFSIVFAHIPYVFLPAC  158
            APFSIVF HIP   +PAC
Sbjct  515  APFSIVFVHIPNTTVPAC  532



>ref|XP_011036603.1| PREDICTED: heparanase-like protein 3 isoform X1 [Populus euphratica]
Length=563

 Score =   239 bits (611),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 126/204 (62%), Positives = 144/204 (71%), Gaps = 18/204 (9%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            M++SYDTKTYCRQTLIGGNYGLLNT TFVPNPDYYSALLWHRLMGRN LST+FSGT  IR
Sbjct  370  MASSYDTKTYCRQTLIGGNYGLLNTGTFVPNPDYYSALLWHRLMGRNVLSTTFSGTNNIR  429

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEA-----NVAYNGSFVhhrkhirhinhhhhhhhsh  407
            AYAHCAK S GITLLLINLD NTTV+      NV  NG+ V  +++    +         
Sbjct  430  AYAHCAKASKGITLLLINLDGNTTVKVHVANENVTSNGTLVTQQQNQTTFSGMS------  483

Query  406  shgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSS  227
                   R       TREEYHLTA  GDLH QT+LLNGN LSV+SSGS+P ++P   + S
Sbjct  484  -------RGSNIDVSTREEYHLTALNGDLHCQTVLLNGNILSVNSSGSVPPLEPIETSQS  536

Query  226  EPITVAPFSIVFAHIPYVFLPACR  155
            +PIT APFSIVFAH+    +PAC 
Sbjct  537  DPITGAPFSIVFAHLANSTVPACE  560



>ref|NP_851092.1| glucuronidase 3 [Arabidopsis thaliana]
 gb|AED93922.1| glucuronidase 3 [Arabidopsis thaliana]
Length=401

 Score =   235 bits (600),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 121/198 (61%), Positives = 148/198 (75%), Gaps = 9/198 (5%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            M++ YDTKTYCRQ+LIGGNYGLLNTT F PNPDYYSAL+W +LMGR AL T+FSGTKKIR
Sbjct  212  MASLYDTKTYCRQSLIGGNYGLLNTTNFTPNPDYYSALIWRQLMGRKALFTTFSGTKKIR  271

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
            +Y HCA+QS GIT+LL+NLD+ TTV A V  N SF      +RH  H   +  + S   G
Sbjct  272  SYTHCARQSKGITVLLMNLDNTTTVVAKVELNNSF-----SLRHTKHMKSYKRASSQLFG  326

Query  391  SPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITV  212
             P     G + REEYHLTAK G+LHSQTMLLNGN L V+S G +P ++P ++NS+EPIT+
Sbjct  327  GP----NGVIQREEYHLTAKDGNLHSQTMLLNGNALQVNSMGDLPPIEPIHINSTEPITI  382

Query  211  APFSIVFAHIPYVFLPAC  158
            AP+SIVF H+  V +PAC
Sbjct  383  APYSIVFVHMRNVVVPAC  400



>ref|XP_010440690.1| PREDICTED: heparanase-like protein 3 [Camelina sativa]
Length=536

 Score =   238 bits (607),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 117/198 (59%), Positives = 141/198 (71%), Gaps = 9/198 (5%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            MS+ YDTKTYCRQ+LIGGNYGLLNTT F PNPDYYSAL+W +LMGR AL TSFSGTKKIR
Sbjct  347  MSSVYDTKTYCRQSLIGGNYGLLNTTNFTPNPDYYSALIWRQLMGRKALFTSFSGTKKIR  406

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
            +Y HCA+QS GIT+LL+NLD+ TTV A V  N +F          +              
Sbjct  407  SYTHCARQSKGITVLLMNLDNTTTVVAKVELNNTFSLRHTKHMKSSKRATSQLP------  460

Query  391  SPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITV  212
               S   G + REEYHLTAK G+LHSQTMLLNGN L V+S G +P ++P ++NS+EPIT+
Sbjct  461  ---SDSNGEIQREEYHLTAKDGNLHSQTMLLNGNPLQVNSMGDLPPIEPIHINSTEPITI  517

Query  211  APFSIVFAHIPYVFLPAC  158
            AP+SIVF H+  V +PAC
Sbjct  518  APYSIVFVHMRSVVVPAC  535



>ref|XP_004488517.1| PREDICTED: heparanase-like protein 3-like [Cicer arietinum]
Length=536

 Score =   238 bits (607),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 118/198 (60%), Positives = 140/198 (71%), Gaps = 13/198 (7%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            MSA+YDTKTYCRQ+LIGGNYGLLNTT F+PNPDYYSALLWHRLMGR+ LST+FSGT KIR
Sbjct  351  MSAAYDTKTYCRQSLIGGNYGLLNTTNFLPNPDYYSALLWHRLMGRHVLSTTFSGTNKIR  410

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
            AYAHCAKQS GIT+LLINLD++T  E   +   S  H +                     
Sbjct  411  AYAHCAKQSKGITILLINLDNSTNFEVTYSNTKSLWHRKMSDNSKIMKLPL---------  461

Query  391  SPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITV  212
                       REEYHLT + G++HSQ M+LNGN LS++S G IP ++P Y+NSS+PITV
Sbjct  462  ----HSSSVTAREEYHLTPQDGNIHSQIMVLNGNVLSINSDGDIPPLEPLYVNSSKPITV  517

Query  211  APFSIVFAHIPYVFLPAC  158
            APFSIVF+HIP   +PAC
Sbjct  518  APFSIVFSHIPDAVVPAC  535



>gb|EYU20239.1| hypothetical protein MIMGU_mgv1a026019mg [Erythranthe guttata]
Length=544

 Score =   238 bits (607),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 124/203 (61%), Positives = 146/203 (72%), Gaps = 10/203 (5%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            MS+SYD+KTYCRQ+LIGGNYGLL+T T++PNPDYYSALLWHRLMGRN LSTSF GTKKIR
Sbjct  348  MSSSYDSKTYCRQSLIGGNYGLLDTNTYLPNPDYYSALLWHRLMGRNVLSTSFEGTKKIR  407

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
            AYAHC+K S GITL+LINLD  TTVE  V+   +F+                    +   
Sbjct  408  AYAHCSKNSIGITLVLINLDKATTVEVGVSIE-NFI-----SNKTLTVEQIVEQTRNTNP  461

Query  391  SPRSQKRG---TMTREEYHLTAKGGDLHSQTMLLNGNELSVD-SSGSIPEMKPRYLNSSE  224
            + R +  G    M REEYHLTAK GDLHSQTMLLNG  + V+ SSG IP + PR + SSE
Sbjct  462  TSRYKHNGENEMMMREEYHLTAKDGDLHSQTMLLNGEIVKVNTSSGIIPPLVPRRVISSE  521

Query  223  PITVAPFSIVFAHIPYVFLPACR  155
            PITVAPFSI+FA IP + +PAC+
Sbjct  522  PITVAPFSILFAQIPSIQVPACK  544



>gb|KJB23649.1| hypothetical protein B456_004G108900 [Gossypium raimondii]
Length=554

 Score =   238 bits (607),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 123/199 (62%), Positives = 151/199 (76%), Gaps = 2/199 (1%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            M++ YDTKTYCRQ+L+GGNYGLLNTT F PNPDYYSALLWHRLMGRN LSTSF+GT KIR
Sbjct  347  MASKYDTKTYCRQSLVGGNYGLLNTTNFEPNPDYYSALLWHRLMGRNVLSTSFTGTDKIR  406

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
            +Y HCAKQS GITLLLINL+++TTV+A +A+N S +  R   R    H+ H    +    
Sbjct  407  SYTHCAKQSKGITLLLINLNNSTTVQAKLAFN-STMSLRHKHRSRISHNKHRIHKTTIIK  465

Query  391  SPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITV  212
             P+    G + REEYHLTAK G+L SQ+MLLNGN LSV SSG IP ++P ++ S++PI V
Sbjct  466  LPQGID-GKIRREEYHLTAKDGNLQSQSMLLNGNILSVSSSGIIPHLEPLHVKSAKPIMV  524

Query  211  APFSIVFAHIPYVFLPACR  155
            AP SIVF H+P V +PAC+
Sbjct  525  APLSIVFTHMPDVTVPACK  543



>emb|CDY12398.1| BnaC08g08070D [Brassica napus]
Length=536

 Score =   238 bits (606),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 116/198 (59%), Positives = 141/198 (71%), Gaps = 10/198 (5%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            M++ YDTKTYCRQ+LIGGNYGLLNTT F PNPDYYSAL+W RLMGR AL TSFSGTKKIR
Sbjct  348  MASVYDTKTYCRQSLIGGNYGLLNTTNFTPNPDYYSALIWRRLMGRKALFTSFSGTKKIR  407

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
            +Y HCA+QS GIT+LL+NLD+ TTV ANV  N ++    +                    
Sbjct  408  SYTHCARQSKGITVLLMNLDNTTTVVANVELNNTYKLRHRKTSQKIARTSQMPWV-----  462

Query  391  SPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITV  212
                   G   REEYHLTAK G+LHSQTMLLNG+ L V+S G IP ++P ++NS++PIT+
Sbjct  463  -----SDGETQREEYHLTAKDGNLHSQTMLLNGHALQVNSIGDIPPLEPIHVNSTDPITI  517

Query  211  APFSIVFAHIPYVFLPAC  158
            AP+SIVF H+P V +PAC
Sbjct  518  APYSIVFVHMPNVVVPAC  535



>gb|KJB23650.1| hypothetical protein B456_004G108900 [Gossypium raimondii]
Length=546

 Score =   238 bits (607),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 123/199 (62%), Positives = 151/199 (76%), Gaps = 2/199 (1%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            M++ YDTKTYCRQ+L+GGNYGLLNTT F PNPDYYSALLWHRLMGRN LSTSF+GT KIR
Sbjct  347  MASKYDTKTYCRQSLVGGNYGLLNTTNFEPNPDYYSALLWHRLMGRNVLSTSFTGTDKIR  406

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
            +Y HCAKQS GITLLLINL+++TTV+A +A+N S +  R   R    H+ H    +    
Sbjct  407  SYTHCAKQSKGITLLLINLNNSTTVQAKLAFN-STMSLRHKHRSRISHNKHRIHKTTIIK  465

Query  391  SPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITV  212
             P+    G + REEYHLTAK G+L SQ+MLLNGN LSV SSG IP ++P ++ S++PI V
Sbjct  466  LPQGID-GKIRREEYHLTAKDGNLQSQSMLLNGNILSVSSSGIIPHLEPLHVKSAKPIMV  524

Query  211  APFSIVFAHIPYVFLPACR  155
            AP SIVF H+P V +PAC+
Sbjct  525  APLSIVFTHMPDVTVPACK  543



>emb|CDY47561.1| BnaA08g07260D [Brassica napus]
Length=536

 Score =   237 bits (605),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 115/198 (58%), Positives = 141/198 (71%), Gaps = 10/198 (5%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            M++ YDTKTYCRQ+LIGGNYGLLNTT F PNPDYYSAL+W RLMGRNAL T+FSGTKKIR
Sbjct  348  MASVYDTKTYCRQSLIGGNYGLLNTTNFTPNPDYYSALIWRRLMGRNALFTTFSGTKKIR  407

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
            +Y HCA+QS GIT+LL+NLD+ TTV ANV  N ++    +                    
Sbjct  408  SYTHCARQSKGITVLLMNLDNTTTVVANVELNNTYKLRHRKTSQKIARTSQMPWV-----  462

Query  391  SPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITV  212
                   G   REEYHLTAK  +LHSQTMLLNG+ L V+S G IP ++P ++NS++PIT+
Sbjct  463  -----SNGETQREEYHLTAKDANLHSQTMLLNGHALQVNSIGDIPPLEPIHVNSTDPITI  517

Query  211  APFSIVFAHIPYVFLPAC  158
            AP+SIVF H+P V +PAC
Sbjct  518  APYSIVFVHMPNVVVPAC  535



>ref|XP_009108062.1| PREDICTED: heparanase-like protein 3 [Brassica rapa]
Length=536

 Score =   237 bits (605),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 115/198 (58%), Positives = 141/198 (71%), Gaps = 10/198 (5%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            M++ YDTKTYCRQ+LIGGNYGLLNTT F PNPDYYSAL+W RLMGRNAL T+FSGTKKIR
Sbjct  348  MASVYDTKTYCRQSLIGGNYGLLNTTNFTPNPDYYSALIWRRLMGRNALFTTFSGTKKIR  407

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
            +Y HCA+QS GIT+LL+NLD+ TTV ANV  N ++    +                    
Sbjct  408  SYTHCARQSKGITVLLMNLDNTTTVVANVELNNTYKLRHRKTSQKIARTSQMPWV-----  462

Query  391  SPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITV  212
                   G   REEYHLTAK  +LHSQTMLLNG+ L V+S G IP ++P ++NS++PIT+
Sbjct  463  -----SNGETQREEYHLTAKDANLHSQTMLLNGHALQVNSIGDIPPLEPIHVNSTDPITI  517

Query  211  APFSIVFAHIPYVFLPAC  158
            AP+SIVF H+P V +PAC
Sbjct  518  APYSIVFVHMPNVVVPAC  535



>ref|XP_010648741.1| PREDICTED: heparanase-like protein 3 [Vitis vinifera]
Length=567

 Score =   238 bits (606),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 123/200 (62%), Positives = 145/200 (73%), Gaps = 19/200 (10%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            M++SY  KTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRN LSTSF+GTKKIR
Sbjct  354  MASSYGNKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNVLSTSFNGTKKIR  413

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
            AY+HC+KQS GITLLLINLD NTT+   V+                   +  ++ +    
Sbjct  414  AYSHCSKQSPGITLLLINLDGNTTLRVQVS-----------------TENDGNNRTSTLQ  456

Query  391  SPRSQKRGTM--TREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPI  218
            S    +R     TREEYHLTAK G+LHSQT+LLNG  L+V+SSGSIP ++P  ++S +PI
Sbjct  457  SKNQTQRSNFASTREEYHLTAKDGNLHSQTLLLNGKVLTVNSSGSIPPLEPISVSSLDPI  516

Query  217  TVAPFSIVFAHIPYVFLPAC  158
            TVAPFS+VFA  P V  PAC
Sbjct  517  TVAPFSVVFARFPDVNYPAC  536



>ref|XP_006852836.1| hypothetical protein AMTR_s00033p00188330 [Amborella trichopoda]
 gb|ERN14303.1| hypothetical protein AMTR_s00033p00188330 [Amborella trichopoda]
Length=544

 Score =   237 bits (605),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 119/198 (60%), Positives = 143/198 (72%), Gaps = 8/198 (4%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            M+++++TKTYCRQ+LIGGNYGLLNTTT+ PNPDYYSALLWHRLMG   LST+F+   KIR
Sbjct  354  MASNFNTKTYCRQSLIGGNYGLLNTTTYEPNPDYYSALLWHRLMGTRVLSTNFTAKSKIR  413

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
            AYAHCAK++ GITLLLINLD NTTV A V  + + ++  KH     H + +         
Sbjct  414  AYAHCAKRTKGITLLLINLDGNTTVNARVTMDSAIINSSKHQNMFPHTNFNRM-------  466

Query  391  SPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITV  212
             PR Q+   + REEYHLTAK GDLHSQTMLLNG  L V+  G IP M+P  +NSSEPI V
Sbjct  467  -PRKQRATEIIREEYHLTAKDGDLHSQTMLLNGKILGVNQQGKIPRMEPIRVNSSEPIVV  525

Query  211  APFSIVFAHIPYVFLPAC  158
            APFSIVF H+P +  P C
Sbjct  526  APFSIVFVHMPLIHAPVC  543



>ref|XP_009393723.1| PREDICTED: heparanase-like protein 3 [Musa acuminata subsp. malaccensis]
Length=548

 Score =   235 bits (600),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 117/199 (59%), Positives = 139/199 (70%), Gaps = 27/199 (14%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            MS++Y+TKTYCRQ+L+GGNYGLLNTTTF PNPDYYSALLWHRLMG+  L T+F+G++  R
Sbjct  377  MSSTYNTKTYCRQSLVGGNYGLLNTTTFHPNPDYYSALLWHRLMGKQVLRTNFTGSRMTR  436

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
            AY+HCAK+S GITLLLINL  NTT E  V    ++                         
Sbjct  437  AYSHCAKESQGITLLLINLSGNTTTEVFVTTKTAY-------------------------  471

Query  391  SPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITV  212
               + K    TREEYHLTAK GD+HSQTMLLNG+ L+VDS G IPE++P  + +SEPITV
Sbjct  472  --SALKTAESTREEYHLTAKDGDIHSQTMLLNGHILAVDSDGHIPELEPVKVAASEPITV  529

Query  211  APFSIVFAHIPYVFLPACR  155
             PFSIVFAHIPY   PACR
Sbjct  530  DPFSIVFAHIPYFHAPACR  548



>ref|XP_008394121.1| PREDICTED: heparanase-like protein 3 isoform X2 [Malus domestica]
Length=533

 Score =   235 bits (599),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 118/198 (60%), Positives = 138/198 (70%), Gaps = 19/198 (10%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            ++ASYDTKTYCRQTLIGGNYGLL+T TF PNPDYYSALLWHRLMG  ALSTSFSGTKKIR
Sbjct  354  LAASYDTKTYCRQTLIGGNYGLLDTNTFQPNPDYYSALLWHRLMGNKALSTSFSGTKKIR  413

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
            AYAHC+K++ GIT+LLINLD NTTV+  V+ + +                          
Sbjct  414  AYAHCSKKTKGITVLLINLDGNTTVQVRVSTDST-------------------GRPVSSE  454

Query  391  SPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITV  212
            S +S K     REEYHLTA+ GDL S+ MLLNG  L VDSSG IP ++P  +  S+P TV
Sbjct  455  SLQSSKDSDDVREEYHLTAQDGDLQSKVMLLNGKALIVDSSGDIPPLEPITVRLSDPTTV  514

Query  211  APFSIVFAHIPYVFLPAC  158
            APFSIVF H+P   +PAC
Sbjct  515  APFSIVFVHVPNTTVPAC  532



>ref|XP_002870409.1| glycosyl hydrolase family 79 N-terminal domain-containing protein 
[Arabidopsis lyrata subsp. lyrata]
 gb|EFH46668.1| glycosyl hydrolase family 79 N-terminal domain-containing protein 
[Arabidopsis lyrata subsp. lyrata]
Length=536

 Score =   234 bits (598),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 117/198 (59%), Positives = 145/198 (73%), Gaps = 9/198 (5%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            M++ YDTKTYCRQ+LIGGNYGLLNTT F PNPDYYSAL+W +LMGR AL T+FSGTKKIR
Sbjct  347  MASLYDTKTYCRQSLIGGNYGLLNTTNFTPNPDYYSALIWRQLMGRKALFTTFSGTKKIR  406

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
            +Y HCA+QS GIT+LL+NLD+ TTV A V  N +F         + H  H          
Sbjct  407  SYTHCARQSKGITVLLMNLDNTTTVVAKVELNKTF--------SLRHTKHMKSYKRATSQ  458

Query  391  SPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITV  212
             P+    G + REEYHLTAK G+LHSQTMLLNGN L V+S+G +P ++P ++NS+EPIT+
Sbjct  459  LPQ-DPNGEIQREEYHLTAKDGNLHSQTMLLNGNALQVNSTGDLPPIEPIHINSTEPITI  517

Query  211  APFSIVFAHIPYVFLPAC  158
            AP+SIVF H+  V +PAC
Sbjct  518  APYSIVFVHMRSVVVPAC  535



>ref|NP_851093.1| glucuronidase 3 [Arabidopsis thaliana]
 sp|Q9FZP1.2|HPSE3_ARATH RecName: Full=Heparanase-like protein 3; Flags: Precursor [Arabidopsis 
thaliana]
 dbj|BAF01139.1| hypothetical protein [Arabidopsis thaliana]
 gb|AED93923.1| glucuronidase 3 [Arabidopsis thaliana]
Length=536

 Score =   234 bits (597),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 115/198 (58%), Positives = 139/198 (70%), Gaps = 9/198 (5%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            M++ YDTKTYCRQ+LIGGNYGLLNTT F PNPDYYSAL+W +LMGR AL T+FSGTKKIR
Sbjct  347  MASLYDTKTYCRQSLIGGNYGLLNTTNFTPNPDYYSALIWRQLMGRKALFTTFSGTKKIR  406

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
            +Y HCA+QS GIT+LL+NLD+ TTV A V  N SF                         
Sbjct  407  SYTHCARQSKGITVLLMNLDNTTTVVAKVELNNSFSLRHTKHMKSYKRASSQLF------  460

Query  391  SPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITV  212
                   G + REEYHLTAK G+LHSQTMLLNGN L V+S G +P ++P ++NS+EPIT+
Sbjct  461  ---GGPNGVIQREEYHLTAKDGNLHSQTMLLNGNALQVNSMGDLPPIEPIHINSTEPITI  517

Query  211  APFSIVFAHIPYVFLPAC  158
            AP+SIVF H+  V +PAC
Sbjct  518  APYSIVFVHMRNVVVPAC  535



>ref|XP_007011804.1| Glucuronidase 3 isoform 2 [Theobroma cacao]
 gb|EOY29423.1| Glucuronidase 3 isoform 2 [Theobroma cacao]
Length=513

 Score =   233 bits (595),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 120/204 (59%), Positives = 142/204 (70%), Gaps = 15/204 (7%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            M++SYDTKTYCRQTLIGGNYGLL+T TFVP+PDYYSALLWHRLMG N LSTSFSGT+ +R
Sbjct  318  MASSYDTKTYCRQTLIGGNYGLLDTATFVPHPDYYSALLWHRLMGSNVLSTSFSGTRNLR  377

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANV-----AYNGSFVhhrkhirhinhhhhhhhsh  407
            AYAHC+KQS GI LLLINL +NTTV+  V     A NG                      
Sbjct  378  AYAHCSKQSQGIALLLINLSANTTVQVRVSTESPASNGDV----------RLQQEDQTPR  427

Query  406  shgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSS  227
             +    PR+ K    TREEYHLTAK G+LHS+ +LLNG  LS++SSG IP M P   +  
Sbjct  428  INFATMPRNSKSNGNTREEYHLTAKDGNLHSKIVLLNGKVLSLNSSGGIPSMDPVNRSML  487

Query  226  EPITVAPFSIVFAHIPYVFLPACR  155
             PITVAPFS+VF+HIP + +PAC+
Sbjct  488  APITVAPFSVVFSHIPSIRIPACK  511



>dbj|BAB10787.1| unnamed protein product [Arabidopsis thaliana]
Length=536

 Score =   234 bits (597),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 115/198 (58%), Positives = 139/198 (70%), Gaps = 9/198 (5%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            M++ YDTKTYCRQ+LIGGNYGLLNTT F PNPDYYSAL+W +LMGR AL T+FSGTKKIR
Sbjct  347  MASLYDTKTYCRQSLIGGNYGLLNTTNFTPNPDYYSALIWRQLMGRKALFTTFSGTKKIR  406

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
            +Y HCA+QS GIT+LL+NLD+ TTV A V  N SF                         
Sbjct  407  SYTHCARQSKGITVLLMNLDNTTTVVAKVELNNSFSLRHTKHMKSYKRASSQLF------  460

Query  391  SPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITV  212
                   G + REEYHLTAK G+LHSQTMLLNGN L V+S G +P ++P ++NS+EPIT+
Sbjct  461  ---GGPNGVIQREEYHLTAKDGNLHSQTMLLNGNALQVNSMGDLPPIEPIHINSTEPITI  517

Query  211  APFSIVFAHIPYVFLPAC  158
            AP+SIVF H+  V +PAC
Sbjct  518  APYSIVFVHMRNVVVPAC  535



>ref|XP_003609474.1| Heparanase-like protein [Medicago truncatula]
 gb|AES91671.1| glycoside hydrolase family 79 amino-terminal domain protein [Medicago 
truncatula]
Length=529

 Score =   234 bits (596),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 118/198 (60%), Positives = 137/198 (69%), Gaps = 25/198 (13%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            MSA+Y T+TYCRQTLIGGNYGLLNTTTF+PNPDYYSALLWHRLMG   LST+F GTKKIR
Sbjct  356  MSATYGTRTYCRQTLIGGNYGLLNTTTFMPNPDYYSALLWHRLMGGRVLSTTFYGTKKIR  415

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
             YAHCAK+S GIT+L +NLD++TTV+A VA N                            
Sbjct  416  TYAHCAKESKGITILFLNLDNSTTVQARVALN-------------------------FAK  450

Query  391  SPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITV  212
             P     G   R EYHLTAK G+LHSQTM+LNGN LS +S+G IP + P Y++SS+PITV
Sbjct  451  KPSPHNVGESQRREYHLTAKDGNLHSQTMVLNGNILSGNSAGDIPSLNPIYVDSSKPITV  510

Query  211  APFSIVFAHIPYVFLPAC  158
             P SIVFAHIP   + AC
Sbjct  511  RPLSIVFAHIPDAAVKAC  528



>ref|XP_008394120.1| PREDICTED: heparanase-like protein 3 isoform X1 [Malus domestica]
Length=563

 Score =   234 bits (598),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 118/198 (60%), Positives = 138/198 (70%), Gaps = 19/198 (10%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            ++ASYDTKTYCRQTLIGGNYGLL+T TF PNPDYYSALLWHRLMG  ALSTSFSGTKKIR
Sbjct  384  LAASYDTKTYCRQTLIGGNYGLLDTNTFQPNPDYYSALLWHRLMGNKALSTSFSGTKKIR  443

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
            AYAHC+K++ GIT+LLINLD NTTV+  V+ + +                          
Sbjct  444  AYAHCSKKTKGITVLLINLDGNTTVQVRVSTDST-------------------GRPVSSE  484

Query  391  SPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITV  212
            S +S K     REEYHLTA+ GDL S+ MLLNG  L VDSSG IP ++P  +  S+P TV
Sbjct  485  SLQSSKDSDDVREEYHLTAQDGDLQSKVMLLNGKALIVDSSGDIPPLEPITVRLSDPTTV  544

Query  211  APFSIVFAHIPYVFLPAC  158
            APFSIVF H+P   +PAC
Sbjct  545  APFSIVFVHVPNTTVPAC  562



>ref|XP_010450341.1| PREDICTED: heparanase-like protein 3 [Camelina sativa]
Length=536

 Score =   234 bits (596),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 118/198 (60%), Positives = 142/198 (72%), Gaps = 9/198 (5%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            MS+ YDTKTYCRQ+LIGGNYGLLNTT F PNPDYYSAL+W +LMGR AL TSFSGTKKIR
Sbjct  347  MSSVYDTKTYCRQSLIGGNYGLLNTTNFTPNPDYYSALIWRQLMGRKALFTSFSGTKKIR  406

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
            +Y HCA+QS GIT+LLINLD+ TT+   V  N +F            H  H  S+     
Sbjct  407  SYTHCARQSKGITVLLINLDNTTTIVTKVELNNTF---------SLRHTKHMKSYKRATY  457

Query  391  SPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITV  212
               S   G + REEYHLTAK G+LHSQTM LNGN L V+S G +P ++P ++NS+EPIT+
Sbjct  458  QLPSDSNGEIQREEYHLTAKDGNLHSQTMQLNGNALQVNSMGDLPPIEPIHINSTEPITI  517

Query  211  APFSIVFAHIPYVFLPAC  158
            AP+SIVF H+  V +PAC
Sbjct  518  APYSIVFVHMRTVVVPAC  535



>ref|XP_007011803.1| Glucuronidase 3 isoform 1 [Theobroma cacao]
 gb|EOY29422.1| Glucuronidase 3 isoform 1 [Theobroma cacao]
Length=549

 Score =   233 bits (595),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 117/199 (59%), Positives = 141/199 (71%), Gaps = 5/199 (3%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            M++SYDTKTYCRQTLIGGNYGLL+T TFVP+PDYYSALLWHRLMG N LSTSFSGT+ +R
Sbjct  354  MASSYDTKTYCRQTLIGGNYGLLDTATFVPHPDYYSALLWHRLMGSNVLSTSFSGTRNLR  413

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
            AYAHC+KQS GI LLLINL +NTTV+  V+              +           +   
Sbjct  414  AYAHCSKQSQGIALLLINLSANTTVQVRVS-----TESPASNGDVRLQQEDQTPRINFAT  468

Query  391  SPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITV  212
             PR+ K    TREEYHLTAK G+LHS+ +LLNG  LS++SSG IP M P   +   PITV
Sbjct  469  MPRNSKSNGNTREEYHLTAKDGNLHSKIVLLNGKVLSLNSSGGIPSMDPVNRSMLAPITV  528

Query  211  APFSIVFAHIPYVFLPACR  155
            APFS+VF+HIP + +PAC+
Sbjct  529  APFSVVFSHIPSIRIPACK  547



>ref|XP_006403100.1| hypothetical protein EUTSA_v10003449mg [Eutrema salsugineum]
 gb|ESQ44553.1| hypothetical protein EUTSA_v10003449mg [Eutrema salsugineum]
Length=529

 Score =   232 bits (591),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 120/208 (58%), Positives = 143/208 (69%), Gaps = 28/208 (13%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            M++ YDTKTYCRQ+LIGGNYGLLNTT F PNPDYYSAL+W  LMGR AL TSFSG KKIR
Sbjct  339  MASIYDTKTYCRQSLIGGNYGLLNTTNFTPNPDYYSALIWRTLMGRKALFTSFSGIKKIR  398

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
            +Y HCA+QS GIT+LL+NLD+ TTV A V  N +F                  S  H K 
Sbjct  399  SYTHCARQSKGITVLLMNLDNTTTVVATVELNNTF------------------SLRHAKH  440

Query  391  SPRSQKR----------GTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPR  242
               SQKR          G + REEYHLTA  G+LHSQTMLLNGN L + S+G IP ++P 
Sbjct  441  RKSSQKREISQLPWVSNGEIQREEYHLTAMDGNLHSQTMLLNGNALQISSTGDIPPLEPI  500

Query  241  YLNSSEPITVAPFSIVFAHIPYVFLPAC  158
            ++NS+EPIT+AP+SIVF H+  V +PAC
Sbjct  501  HVNSTEPITIAPYSIVFVHMRTVVVPAC  528



>emb|CDP13545.1| unnamed protein product [Coffea canephora]
Length=514

 Score =   230 bits (586),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 112/199 (56%), Positives = 141/199 (71%), Gaps = 31/199 (16%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            M++SYDTK YCRQTL+GGNYGLLNTTTFVPNPDYYSALLWHRLMGRN L+T+ +  K +R
Sbjct  347  MASSYDTKAYCRQTLVGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNVLATNLTAIKNLR  406

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
            AYAHC+K S GIT+LLINLD+  TV+  +++                             
Sbjct  407  AYAHCSKLSHGITVLLINLDAYATVQVGLSFT----------------------------  438

Query  391  SPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITV  212
              R+    +M R+EYHLTAK G++HSQ +LLNG  LSVDSSG+IP ++PR +N S+PIT+
Sbjct  439  --RNNLDSSM-RKEYHLTAKHGNIHSQIVLLNGKILSVDSSGTIPPLEPRTVNPSDPITI  495

Query  211  APFSIVFAHIPYVFLPACR  155
            APFSIVFA IP + +PAC+
Sbjct  496  APFSIVFADIPNILVPACK  514



>gb|KFK22707.1| hypothetical protein AALP_AAs49083U000200 [Arabis alpina]
Length=535

 Score =   231 bits (588),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 116/198 (59%), Positives = 140/198 (71%), Gaps = 8/198 (4%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            M++ YDTKTYCRQ+LIGGNYGLLNTT F PNPDYYSAL+W +LMGR AL TSFSGTKKIR
Sbjct  345  MASIYDTKTYCRQSLIGGNYGLLNTTNFTPNPDYYSALIWRQLMGRKALFTSFSGTKKIR  404

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
            +Y HCA+QS GIT+LL+NLDS TTV+ NV  N S    R      +              
Sbjct  405  SYTHCARQSKGITVLLMNLDSTTTVKVNVELNSSTFSLRHTKHRKSRKTVISQLPWV---  461

Query  391  SPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITV  212
                   G + REEYHLTAK G+LHSQ+MLLN   L V+S+G IP ++P ++NS+EPITV
Sbjct  462  -----SNGEIQREEYHLTAKDGNLHSQSMLLNEYILHVNSAGDIPPLEPIFVNSTEPITV  516

Query  211  APFSIVFAHIPYVFLPAC  158
            AP+SIVF H+  V +PAC
Sbjct  517  APYSIVFVHMRSVVVPAC  534



>ref|XP_006483406.1| PREDICTED: heparanase-like protein 3-like isoform X1 [Citrus 
sinensis]
Length=561

 Score =   230 bits (587),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 123/205 (60%), Positives = 139/205 (68%), Gaps = 17/205 (8%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            M++ Y TKTYCRQTLIGGNYGLLNT TFVPNPDYYSALLWHRLMG N LSTS SGT KIR
Sbjct  364  MASIYGTKTYCRQTLIGGNYGLLNTNTFVPNPDYYSALLWHRLMGSNVLSTSLSGTTKIR  423

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEA-------NVAYNGSFVhhrkhirhinhhhhhhh  413
            AYAHC+KQS G TLLLINLD NT           N+A NG+ V               + 
Sbjct  424  AYAHCSKQSQGTTLLLINLDGNTAARVRVTISRENLAGNGALV---------VQQEQQNQ  474

Query  412  shshgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLN  233
                 K S  ++  G M REEYHLTA+ GDLHSQTMLLNG  L+V+SS   P ++P Y++
Sbjct  475  RKRFAKISQDTKTNGKM-REEYHLTARDGDLHSQTMLLNGEILAVNSSEDFPPLEPIYVS  533

Query  232  SSEPITVAPFSIVFAHIPYVFLPAC  158
             + PI VAPFSIVFA IP   LPAC
Sbjct  534  ETAPIIVAPFSIVFAEIPSSVLPAC  558



>ref|XP_011078541.1| PREDICTED: heparanase-like protein 3 [Sesamum indicum]
Length=537

 Score =   229 bits (585),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 117/199 (59%), Positives = 144/199 (72%), Gaps = 8/199 (4%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            ++++YDTKTYCRQTLIGGNYGLLNTTTF PNPDYYSALLWHRLMG   LST+F+G + IR
Sbjct  347  LASTYDTKTYCRQTLIGGNYGLLNTTTFAPNPDYYSALLWHRLMGTYVLSTNFTGNRTIR  406

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
            AYAHCAKQS G+TLLLIN+D NTTV A V +NG+    RKH  H +              
Sbjct  407  AYAHCAKQSQGVTLLLINIDGNTTVHAKVDFNGTLTRLRKHRHHRHRSTATPLH------  460

Query  391  SPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITV  212
               +++     REEYHLT   G++ S+T+LLNG  L+V+SSG IP ++P  +NSSEPI V
Sbjct  461  --HNKQVSGKVREEYHLTPADGNIQSRTILLNGKALTVNSSGLIPVLEPVRVNSSEPIMV  518

Query  211  APFSIVFAHIPYVFLPACR  155
            AP+SIVF H+P   +PACR
Sbjct  519  APYSIVFVHMPNAAVPACR  537



>ref|XP_008793957.1| PREDICTED: heparanase-like protein 3 [Phoenix dactylifera]
Length=411

 Score =   226 bits (575),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 117/198 (59%), Positives = 138/198 (70%), Gaps = 10/198 (5%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            MS++Y+TK+YCRQ+L+GGNYGLLNT TF PNPDYYSALLWHRLMG   LST+F+GTK IR
Sbjct  223  MSSTYNTKSYCRQSLVGGNYGLLNTATFHPNPDYYSALLWHRLMGSKVLSTNFTGTKSIR  282

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
            AYAHCA++S GITLLLINL   TT +  V    +F    KH       +H          
Sbjct  283  AYAHCARESLGITLLLINLSGKTTSQVFVTTASAFTLALKHHIPRTRFNHIT--------  334

Query  391  SPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITV  212
              R  +     REEYHLTAK G+LHSQ MLLNGN LSVDS G+ P +KP  +++S PITV
Sbjct  335  --RLGRTLAFMREEYHLTAKDGNLHSQAMLLNGNILSVDSEGNFPTLKPMEVDASLPITV  392

Query  211  APFSIVFAHIPYVFLPAC  158
            APFSIVF HIP+   PAC
Sbjct  393  APFSIVFVHIPHFHAPAC  410



>ref|XP_002452991.1| hypothetical protein SORBIDRAFT_04g036200 [Sorghum bicolor]
 gb|EES05967.1| hypothetical protein SORBIDRAFT_04g036200 [Sorghum bicolor]
Length=540

 Score =   228 bits (582),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 112/198 (57%), Positives = 133/198 (67%), Gaps = 12/198 (6%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            M++ YDTKTYCRQT +GGNYGLLNTTTF PNPDYYSALLWHRLMG   LST+F+GT KIR
Sbjct  354  MASKYDTKTYCRQTFVGGNYGLLNTTTFEPNPDYYSALLWHRLMGTKVLSTTFNGTNKIR  413

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
            AYAHCAK S GITLLLINLD N T    V   G+                          
Sbjct  414  AYAHCAKNSEGITLLLINLDGNNTNHICVTSQGA------------QTQSARKESRMSYQ  461

Query  391  SPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITV  212
             P   +   +TR+EYHLT KGG+L SQ MLLNGN L+ D++G IP+++P  +  ++PITV
Sbjct  462  IPGLGEAAELTRQEYHLTPKGGNLQSQQMLLNGNVLATDANGDIPKLEPVQVEGTQPITV  521

Query  211  APFSIVFAHIPYVFLPAC  158
             P+SIVFAHIP  + PAC
Sbjct  522  GPYSIVFAHIPSFYAPAC  539



>ref|XP_010927354.1| PREDICTED: heparanase-like protein 3 isoform X2 [Elaeis guineensis]
Length=463

 Score =   226 bits (577),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 117/199 (59%), Positives = 139/199 (70%), Gaps = 10/199 (5%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            MS++Y+TK+YCRQ+L+GGNYGLLN  TF PNPDYYSALLWHRLMG   LS  F+GT+ IR
Sbjct  275  MSSTYNTKSYCRQSLVGGNYGLLNRMTFQPNPDYYSALLWHRLMGSKVLSAKFTGTESIR  334

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
            AYAHCA++S GITLLLINL  NTT +A V    ++    KH       +H          
Sbjct  335  AYAHCARESQGITLLLINLSGNTTSQAFVTTASNYTIGLKHHIPRTRFNHIT--------  386

Query  391  SPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITV  212
              R +K  T  REEYHLTAK G+LHSQ MLLNGN LS+DS G+IP  +P  L++S PITV
Sbjct  387  --RLRKTATFMREEYHLTAKDGNLHSQVMLLNGNILSLDSEGNIPTFEPMELDASLPITV  444

Query  211  APFSIVFAHIPYVFLPACR  155
             PFSIVF HIP+   PACR
Sbjct  445  TPFSIVFVHIPHFDAPACR  463



>ref|NP_001241969.1| uncharacterized protein LOC100792087 precursor [Glycine max]
 gb|ACU20377.1| unknown [Glycine max]
Length=525

 Score =   228 bits (581),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 116/198 (59%), Positives = 138/198 (70%), Gaps = 26/198 (13%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            MSA YDT+TYCRQ+LIGGNYGLLNT+TF+PNPDYYSALLWHRLMG   LST+F GTKKIR
Sbjct  353  MSAVYDTRTYCRQSLIGGNYGLLNTSTFMPNPDYYSALLWHRLMGGRVLSTTFYGTKKIR  412

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
             YAHCAKQS GIT+L+++LD++TTVE NVA   + + +                      
Sbjct  413  TYAHCAKQSKGITILVLSLDNSTTVEVNVALKFNKLPY----------------------  450

Query  391  SPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITV  212
                ++ G   R EYHLTA   +LHSQTMLLNG  LSV+S+G IP + P Y+NS +PI V
Sbjct  451  ----RRVGEPARREYHLTAPDRNLHSQTMLLNGKILSVNSAGEIPPLDPLYVNSRKPIIV  506

Query  211  APFSIVFAHIPYVFLPAC  158
             P SIVFAHIP V L AC
Sbjct  507  GPLSIVFAHIPNVLLSAC  524



>gb|EMT25528.1| Heparanase-like protein 3 [Aegilops tauschii]
Length=481

 Score =   226 bits (577),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 116/199 (58%), Positives = 139/199 (70%), Gaps = 11/199 (6%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            MSA YDTK+YCRQTL+GGNYGLLNTTTF PNPDYYSALLWHRLMG   LST+F+GT KIR
Sbjct  294  MSAKYDTKSYCRQTLVGGNYGLLNTTTFEPNPDYYSALLWHRLMGTKVLSTTFNGTNKIR  353

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
            AY HCAK S GITLLLINL  N T    V   G+               H H +  H + 
Sbjct  354  AYTHCAKDSQGITLLLINLSGNNTNHIYVTSEGA-----------QEVTHPHVAKEHTRS  402

Query  391  SPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITV  212
             P+  +   + R+EYHLTAK G+L SQ MLLNGN L+  ++G+IP+++P  +  +EPITV
Sbjct  403  IPKLGETAGLARQEYHLTAKDGNLQSQHMLLNGNVLATGANGAIPKLEPVQVEGTEPITV  462

Query  211  APFSIVFAHIPYVFLPACR  155
            AP+SIVFAHIP  + PACR
Sbjct  463  APYSIVFAHIPGFYAPACR  481



>ref|XP_002515478.1| heparanase, putative [Ricinus communis]
 gb|EEF46927.1| heparanase, putative [Ricinus communis]
Length=527

 Score =   228 bits (580),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 119/209 (57%), Positives = 146/209 (70%), Gaps = 26/209 (12%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            M++S++TKTYCRQTLIGGNYGLLNT TFVPNPDYYSALLWHRLMG NAL+TSFSGTKK+R
Sbjct  329  MASSFNTKTYCRQTLIGGNYGLLNTNTFVPNPDYYSALLWHRLMGTNALATSFSGTKKMR  388

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
            AYAHC+K + GITLLLINLD NT+ E  ++                 +   + + +    
Sbjct  389  AYAHCSKATQGITLLLINLDGNTSFEVRIS---------------TENVGSNVTWTMQDH  433

Query  391  SPRSQK-----RGT------MTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKP  245
            S R +K     RG+      +TR+EYHLTAK GDLHSQT+LLNG  L+ DSSG+IP ++P
Sbjct  434  SNRGEKFARMSRGSVSKLYEITRDEYHLTAKDGDLHSQTVLLNGKILTPDSSGAIPSLEP  493

Query  244  RYLNSSEPITVAPFSIVFAHIPYVFLPAC  158
               +   PI VAPFSIVFA I  + +PAC
Sbjct  494  IKASLLNPIAVAPFSIVFAQIANITVPAC  522



>ref|XP_004249602.1| PREDICTED: heparanase-like protein 3 [Solanum lycopersicum]
Length=542

 Score =   228 bits (581),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 112/198 (57%), Positives = 138/198 (70%), Gaps = 15/198 (8%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            MSA++DTKTYCRQTL+GGNYGLLNTTTF PNPDYY ALLWHRLMGRN LST F G KK+R
Sbjct  352  MSATFDTKTYCRQTLVGGNYGLLNTTTFHPNPDYYGALLWHRLMGRNVLSTQFQGMKKLR  411

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
            +YAHC+K S GI L+LIN+ S+ TV  +++                   + + S    + 
Sbjct  412  SYAHCSKSSEGIALMLINMHSSITVNISLS---------------VTVANTNESPMLLQV  456

Query  391  SPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITV  212
            +     R  + REEYHLTAK GDLHSQT+LLNGNEL+VD  G IP ++P  +N S PI++
Sbjct  457  TNDQNARHEIEREEYHLTAKDGDLHSQTVLLNGNELNVDHFGRIPLLEPVRVNPSHPISI  516

Query  211  APFSIVFAHIPYVFLPAC  158
            AP SIVF HIP + +PAC
Sbjct  517  APLSIVFVHIPSIQVPAC  534



>ref|XP_003542659.1| PREDICTED: heparanase-like protein 3-like [Glycine max]
 gb|KHN47116.1| Heparanase-like protein 3 [Glycine soja]
Length=524

 Score =   227 bits (579),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 115/198 (58%), Positives = 138/198 (70%), Gaps = 26/198 (13%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            MSA YDT+TYCRQ+LIGGNYGLLNT+TFVPNPDYYSALLWHRLMG   L T+F GTKKIR
Sbjct  352  MSAVYDTRTYCRQSLIGGNYGLLNTSTFVPNPDYYSALLWHRLMGGRVLLTTFYGTKKIR  411

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
             YAHCAK+S GIT+L++NLD++TTV+ NVA   + + +                      
Sbjct  412  TYAHCAKESKGITILVLNLDNSTTVQVNVALKFNKLPY----------------------  449

Query  391  SPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITV  212
                ++ G   R EYHLTA   +LHSQTMLLNG  LSV+S+G IP ++P Y+NS +PI V
Sbjct  450  ----RRVGEPARREYHLTAPDRNLHSQTMLLNGKMLSVNSAGEIPPLEPLYVNSRKPIIV  505

Query  211  APFSIVFAHIPYVFLPAC  158
             P SIVFAHIP V L AC
Sbjct  506  GPLSIVFAHIPNVLLSAC  523



>ref|XP_006450373.1| hypothetical protein CICLE_v10010401mg [Citrus clementina]
 gb|ESR63613.1| hypothetical protein CICLE_v10010401mg [Citrus clementina]
Length=551

 Score =   228 bits (581),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 121/205 (59%), Positives = 139/205 (68%), Gaps = 17/205 (8%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            M++ Y TKTYCRQTLIGGNYGLLNT TFVPNPDYYSALLWH LMG N LSTS +GT KIR
Sbjct  354  MASIYGTKTYCRQTLIGGNYGLLNTNTFVPNPDYYSALLWHWLMGSNVLSTSLAGTTKIR  413

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEA-------NVAYNGSFVhhrkhirhinhhhhhhh  413
            AYAHC+KQS G TLLLINLD NTT          N+A NG+ V               + 
Sbjct  414  AYAHCSKQSQGTTLLLINLDGNTTARVRVTISRENLAGNGALV---------VQQEQQNQ  464

Query  412  shshgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLN  233
                 K    ++  G M REEYHLTA+ GDLHSQT+LLNG  L+V+SSG  P ++P Y++
Sbjct  465  RKRFAKICQDTKTNGKM-REEYHLTARDGDLHSQTVLLNGEILAVNSSGDFPPLEPIYVS  523

Query  232  SSEPITVAPFSIVFAHIPYVFLPAC  158
             + PI VAPFSIVFA IP   LPAC
Sbjct  524  ETAPIIVAPFSIVFAEIPSSVLPAC  548



>gb|EPS66918.1| hypothetical protein M569_07858, partial [Genlisea aurea]
Length=523

 Score =   227 bits (578),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 110/198 (56%), Positives = 137/198 (69%), Gaps = 15/198 (8%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            M++ YDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGR  LSTSF+GTKKIR
Sbjct  341  MASLYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRQVLSTSFTGTKKIR  400

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
             Y HC+K +GGIT+LL+NLD+ T V+ +++                       S +  + 
Sbjct  401  VYTHCSKSTGGITVLLMNLDNTTAVDVDLSVGNGVA---------------DQSFAQLRI  445

Query  391  SPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITV  212
                     + REEYHL+AK GDLHSQT++LNG E+ V +S  IP +KP+ +   +P+TV
Sbjct  446  RESDATENKLMREEYHLSAKDGDLHSQTVILNGEEIHVINSSEIPHLKPKLVEPWDPLTV  505

Query  211  APFSIVFAHIPYVFLPAC  158
            AP SIVFA IP + +PAC
Sbjct  506  APLSIVFAQIPTIKVPAC  523



>ref|XP_006338978.1| PREDICTED: heparanase-like protein 3-like [Solanum tuberosum]
Length=541

 Score =   227 bits (579),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 112/198 (57%), Positives = 137/198 (69%), Gaps = 15/198 (8%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            MSA++DTK YCRQTL+GGNYGLLNTTTF PNPDYY ALLWHRLMGRN LST F G KK+R
Sbjct  351  MSATFDTKKYCRQTLVGGNYGLLNTTTFHPNPDYYGALLWHRLMGRNVLSTQFQGMKKLR  410

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
            +YAHC+K S GITL+LIN+  + TV  N++                   + + S    + 
Sbjct  411  SYAHCSKSSEGITLMLINMHGSKTVNINLS---------------VTLANTNESSMLLQV  455

Query  391  SPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITV  212
            +     R  + REEYHLTAK GDLHSQT+LLNG EL+VD  G IP +KP  +N S+PI++
Sbjct  456  TNDQNPRHGIEREEYHLTAKDGDLHSQTVLLNGKELNVDHFGRIPLLKPIRVNPSDPISI  515

Query  211  APFSIVFAHIPYVFLPAC  158
            AP SIVF HIP + +PAC
Sbjct  516  APLSIVFVHIPTIQVPAC  533



>ref|XP_009792772.1| PREDICTED: heparanase-like protein 3 isoform X2 [Nicotiana sylvestris]
Length=546

 Score =   227 bits (579),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 114/198 (58%), Positives = 136/198 (69%), Gaps = 15/198 (8%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            MSA++DTKTYCRQTL+GGNYGLLNT TF PNPDYY ALLWHRLMGR+ LST F GTKK+R
Sbjct  356  MSATFDTKTYCRQTLVGGNYGLLNTITFHPNPDYYGALLWHRLMGRSVLSTQFKGTKKLR  415

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
            AY HC+K S GITLLLIN+D   TV  +V+           +   N +            
Sbjct  416  AYTHCSKSSDGITLLLINMDGGATVNVSVS-----------VTLANANKVSLLLRDINDQ  464

Query  391  SPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITV  212
            +PR +    + REEYHLTAK G+LHSQT+LLN  ELSVD  G IP ++P  + SSEP+ +
Sbjct  465  NPRHE----IWREEYHLTAKDGELHSQTVLLNEKELSVDHFGRIPHLEPLRVKSSEPLAI  520

Query  211  APFSIVFAHIPYVFLPAC  158
            APFSIVF  IP V +PAC
Sbjct  521  APFSIVFVDIPIVQVPAC  538



>ref|XP_009623092.1| PREDICTED: heparanase-like protein 3 [Nicotiana tomentosiformis]
Length=537

 Score =   227 bits (578),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 115/198 (58%), Positives = 137/198 (69%), Gaps = 15/198 (8%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            MSA +DTKTYCRQTL+GGNYGLLN  TF PNPDYY ALLWHRLMGR+ LST F GTKK+R
Sbjct  347  MSAMFDTKTYCRQTLVGGNYGLLNARTFRPNPDYYGALLWHRLMGRSVLSTQFQGTKKLR  406

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
            AYAHC+K S GITLLLIN+D + TV  NV+ + +  +  K    +   +           
Sbjct  407  AYAHCSKSSDGITLLLINMDGDATV--NVSLSVTLANANKAPLLLQVING----------  454

Query  391  SPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITV  212
                  R  + REEYHLTAK G+LHSQT+LLNG ELSVD  G IP ++P  + SSEP+ +
Sbjct  455  ---QNSRHEIWREEYHLTAKDGELHSQTLLLNGKELSVDHFGRIPHLEPIRVKSSEPLAI  511

Query  211  APFSIVFAHIPYVFLPAC  158
            APFSIVF  IP V +PAC
Sbjct  512  APFSIVFVDIPTVQVPAC  529



>ref|XP_009792771.1| PREDICTED: heparanase-like protein 3 isoform X1 [Nicotiana sylvestris]
Length=550

 Score =   227 bits (578),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 114/198 (58%), Positives = 136/198 (69%), Gaps = 15/198 (8%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            MSA++DTKTYCRQTL+GGNYGLLNT TF PNPDYY ALLWHRLMGR+ LST F GTKK+R
Sbjct  360  MSATFDTKTYCRQTLVGGNYGLLNTITFHPNPDYYGALLWHRLMGRSVLSTQFKGTKKLR  419

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
            AY HC+K S GITLLLIN+D   TV  +V+           +   N +            
Sbjct  420  AYTHCSKSSDGITLLLINMDGGATVNVSVS-----------VTLANANKVSLLLRDINDQ  468

Query  391  SPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITV  212
            +PR +    + REEYHLTAK G+LHSQT+LLN  ELSVD  G IP ++P  + SSEP+ +
Sbjct  469  NPRHE----IWREEYHLTAKDGELHSQTVLLNEKELSVDHFGRIPHLEPLRVKSSEPLAI  524

Query  211  APFSIVFAHIPYVFLPAC  158
            APFSIVF  IP V +PAC
Sbjct  525  APFSIVFVDIPIVQVPAC  542



>gb|KHN15030.1| Heparanase-like protein 3 [Glycine soja]
Length=525

 Score =   226 bits (575),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 116/198 (59%), Positives = 137/198 (69%), Gaps = 26/198 (13%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            MSA YDT+TYCRQ+LIGGNYGLLNT+TF+PNPDYYSALLWHRLMG   LST+F GTKKIR
Sbjct  353  MSAVYDTRTYCRQSLIGGNYGLLNTSTFMPNPDYYSALLWHRLMGGRVLSTTFYGTKKIR  412

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
             YAHCAKQS GIT+L++NLD++TTVE NVA   + + +                      
Sbjct  413  TYAHCAKQSKGITILVLNLDNSTTVEVNVALKFNKLPY----------------------  450

Query  391  SPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITV  212
                ++ G   R EYHLTA   +LHSQTMLLNG  LSV+S+G IP + P Y+NS +PI V
Sbjct  451  ----RRVGEPARREYHLTAPDRNLHSQTMLLNGKILSVNSAGEIPPLDPLYVNSRKPIIV  506

Query  211  APFSIVFAHIPYVFLPAC  158
               SIVFAHIP V L AC
Sbjct  507  GLLSIVFAHIPNVLLSAC  524



>ref|XP_010927353.1| PREDICTED: heparanase-like protein 3 isoform X1 [Elaeis guineensis]
Length=543

 Score =   225 bits (574),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 117/199 (59%), Positives = 139/199 (70%), Gaps = 10/199 (5%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            MS++Y+TK+YCRQ+L+GGNYGLLN  TF PNPDYYSALLWHRLMG   LS  F+GT+ IR
Sbjct  355  MSSTYNTKSYCRQSLVGGNYGLLNRMTFQPNPDYYSALLWHRLMGSKVLSAKFTGTESIR  414

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
            AYAHCA++S GITLLLINL  NTT +A V    ++    KH       +H          
Sbjct  415  AYAHCARESQGITLLLINLSGNTTSQAFVTTASNYTIGLKHHIPRTRFNHIT--------  466

Query  391  SPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITV  212
              R +K  T  REEYHLTAK G+LHSQ MLLNGN LS+DS G+IP  +P  L++S PITV
Sbjct  467  --RLRKTATFMREEYHLTAKDGNLHSQVMLLNGNILSLDSEGNIPTFEPMELDASLPITV  524

Query  211  APFSIVFAHIPYVFLPACR  155
             PFSIVF HIP+   PACR
Sbjct  525  TPFSIVFVHIPHFDAPACR  543



>ref|XP_007155083.1| hypothetical protein PHAVU_003G171800g [Phaseolus vulgaris]
 gb|ESW27077.1| hypothetical protein PHAVU_003G171800g [Phaseolus vulgaris]
Length=512

 Score =   224 bits (571),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 113/199 (57%), Positives = 135/199 (68%), Gaps = 26/199 (13%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            MSA YDT TYCRQTLIGGNYGLLNT+TF+PNPDYYSALLWHRLMG   LST+F GTKKIR
Sbjct  340  MSAVYDTTTYCRQTLIGGNYGLLNTSTFMPNPDYYSALLWHRLMGGRVLSTTFYGTKKIR  399

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
            +YAHCAK+S GIT+LL+NLD++T+V+ NV                               
Sbjct  400  SYAHCAKESKGITILLLNLDNSTSVQVNV--------------------------DLTFN  433

Query  391  SPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITV  212
                 +     R EYHLTA   ++HSQ MLLNG  LSV+S+G IP ++P Y++S++PITV
Sbjct  434  KLPHHRVDEPARREYHLTAPDRNIHSQIMLLNGKALSVNSAGEIPPLEPVYVDSTKPITV  493

Query  211  APFSIVFAHIPYVFLPACR  155
             P SIVFAHIP V L ACR
Sbjct  494  GPLSIVFAHIPNVLLSACR  512



>ref|XP_007155084.1| hypothetical protein PHAVU_003G171800g [Phaseolus vulgaris]
 gb|ESW27078.1| hypothetical protein PHAVU_003G171800g [Phaseolus vulgaris]
Length=524

 Score =   224 bits (571),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 113/199 (57%), Positives = 135/199 (68%), Gaps = 26/199 (13%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            MSA YDT TYCRQTLIGGNYGLLNT+TF+PNPDYYSALLWHRLMG   LST+F GTKKIR
Sbjct  352  MSAVYDTTTYCRQTLIGGNYGLLNTSTFMPNPDYYSALLWHRLMGGRVLSTTFYGTKKIR  411

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
            +YAHCAK+S GIT+LL+NLD++T+V+ NV                               
Sbjct  412  SYAHCAKESKGITILLLNLDNSTSVQVNV--------------------------DLTFN  445

Query  391  SPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITV  212
                 +     R EYHLTA   ++HSQ MLLNG  LSV+S+G IP ++P Y++S++PITV
Sbjct  446  KLPHHRVDEPARREYHLTAPDRNIHSQIMLLNGKALSVNSAGEIPPLEPVYVDSTKPITV  505

Query  211  APFSIVFAHIPYVFLPACR  155
             P SIVFAHIP V L ACR
Sbjct  506  GPLSIVFAHIPNVLLSACR  524



>ref|XP_004508419.1| PREDICTED: heparanase-like protein 3-like [Cicer arietinum]
Length=527

 Score =   224 bits (570),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 115/198 (58%), Positives = 135/198 (68%), Gaps = 26/198 (13%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            MSA+Y T++YCRQTLIGGNYGLLNTTTF+PNPDYYSALLWHRLMG   LST+F  TKKIR
Sbjct  355  MSATYGTESYCRQTLIGGNYGLLNTTTFMPNPDYYSALLWHRLMGGRVLSTTFYETKKIR  414

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
             YAHCAK+S GIT+L +NLD++TTV   VA N                            
Sbjct  415  TYAHCAKESTGITILFLNLDNSTTVNTQVALN-------------------------FAK  449

Query  391  SPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITV  212
             P S   G   R EYHLTAK G++HSQTMLLNGN LSV+S G+IP++ P Y++SS+PI V
Sbjct  450  KPVSH-VGKSLRREYHLTAKDGNIHSQTMLLNGNILSVNSDGAIPQLNPIYVDSSKPIIV  508

Query  211  APFSIVFAHIPYVFLPAC  158
             P SIVF HIP   + AC
Sbjct  509  GPLSIVFVHIPDAAVLAC  526



>ref|XP_010099859.1| Heparanase-like protein 3 [Morus notabilis]
 gb|EXB80736.1| Heparanase-like protein 3 [Morus notabilis]
Length=536

 Score =   224 bits (570),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 118/203 (58%), Positives = 142/203 (70%), Gaps = 18/203 (9%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            M+ASYDTKTYCRQTLIGGNYGLLNT TFVPNPDYYSALLWHRLMG N +ST+FSGT K+R
Sbjct  346  MAASYDTKTYCRQTLIGGNYGLLNTNTFVPNPDYYSALLWHRLMGNNVISTNFSGTTKMR  405

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
            AYAHC+K++ GITLLLINL+ +TTV   V+                       +  H + 
Sbjct  406  AYAHCSKKTRGITLLLINLEKDTTVNVRVS-------------TETDASSKTLNTEHRRT  452

Query  391  SPRSQKRGTM-----TREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSS  227
            +P +  +G++     TREEYHLTAK G+L SQ + LNG  L+VDSSG IP + P   + S
Sbjct  453  TPSTMSQGSISSENITREEYHLTAKNGNLESQNVHLNGKILNVDSSGVIPPLDPINKSVS  512

Query  226  EPITVAPFSIVFAHIPYVFLPAC  158
            EPITVAPFSIVFA I  + +PAC
Sbjct  513  EPITVAPFSIVFALILNIDVPAC  535



>gb|EMS60649.1| Heparanase-like protein 3 [Triticum urartu]
Length=588

 Score =   224 bits (572),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 116/199 (58%), Positives = 140/199 (70%), Gaps = 11/199 (6%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            MSA YDTK+YCRQTL+GGNYGLLNTTTF PNPDYYSALLWHRLMG   LST+F+GT KIR
Sbjct  385  MSAKYDTKSYCRQTLVGGNYGLLNTTTFEPNPDYYSALLWHRLMGTKVLSTTFNGTNKIR  444

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
            AY HC+K S GITLLLINL  N T    V   G+               H H +  H + 
Sbjct  445  AYTHCSKDSEGITLLLINLSGNNTNHIYVNSEGA-----------QEFAHPHGAKEHRRS  493

Query  391  SPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITV  212
             P+  +   +TR+EYHLTAK G+L SQ MLLNGN L+  ++G+IP+++P  +  +EPITV
Sbjct  494  IPKLGETAGLTRQEYHLTAKDGNLQSQHMLLNGNVLATGANGAIPKLEPVQVEGTEPITV  553

Query  211  APFSIVFAHIPYVFLPACR  155
            AP+SIVFAHIP  + PACR
Sbjct  554  APYSIVFAHIPGFYAPACR  572



>gb|KDO61807.1| hypothetical protein CISIN_1g037212mg [Citrus sinensis]
Length=551

 Score =   224 bits (570),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 121/205 (59%), Positives = 137/205 (67%), Gaps = 17/205 (8%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            M++ Y TKTYCRQTLIGGNYGLLNT TFVPNP YYSALLWHRLMG   LSTS S T KIR
Sbjct  354  MASIYGTKTYCRQTLIGGNYGLLNTNTFVPNPGYYSALLWHRLMGSTVLSTSLSETTKIR  413

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEA-------NVAYNGSFVhhrkhirhinhhhhhhh  413
            AYAHC+KQS G TLLLINLD NTT          N+A NG+ V               + 
Sbjct  414  AYAHCSKQSQGTTLLLINLDGNTTARVRVTISRENLAGNGALV---------VQQEQQNQ  464

Query  412  shshgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLN  233
                 K S  ++  G M REEYHLTA+ GDLHSQTMLLNG  L+V+SS   P ++P Y++
Sbjct  465  RKRFAKISQDTKTNGKM-REEYHLTARDGDLHSQTMLLNGEILAVNSSEDFPPLEPIYVS  523

Query  232  SSEPITVAPFSIVFAHIPYVFLPAC  158
             + PI VAPFSIVFA IP   LPAC
Sbjct  524  ETAPIIVAPFSIVFAEIPSSVLPAC  548



>ref|XP_011459847.1| PREDICTED: heparanase-like protein 3 [Fragaria vesca subsp. vesca]
Length=412

 Score =   220 bits (560),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 114/200 (57%), Positives = 141/200 (71%), Gaps = 18/200 (9%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            MSASYDTKTYCRQTLIGGNYGLL+  TF PNPDYYSALLW RLMG N LSTSFSGTKK+R
Sbjct  230  MSASYDTKTYCRQTLIGGNYGLLDINTFKPNPDYYSALLWQRLMGNNVLSTSFSGTKKLR  289

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVA-YNGSFVhhrkhirhinhhhhhhhshshgk  395
             YAHC+K++ GIT+LLINL  NTTV+ +V+  NG                    + +  +
Sbjct  290  TYAHCSKKTQGITVLLINL-GNTTVQVDVSTKNGG----------------SRSTLNFKE  332

Query  394  GSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPIT  215
            G   S+      REEYH+TAK GDL S+ +LLNG EL+V+S+G IP ++P  +  S+P +
Sbjct  333  GLKDSKATKNDVREEYHITAKDGDLLSRVILLNGKELTVNSAGQIPSLEPMIVEISDPTS  392

Query  214  VAPFSIVFAHIPYVFLPACR  155
            VAPFSIVF HIP + +PAC+
Sbjct  393  VAPFSIVFVHIPNITVPACK  412



>gb|KDP33563.1| hypothetical protein JCGZ_07134 [Jatropha curcas]
Length=539

 Score =   223 bits (568),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 116/198 (59%), Positives = 141/198 (71%), Gaps = 7/198 (4%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            M++SY+TKTYCRQ+LIGGNYGLLNT T+VPNPDYYSALLWHRLMGRNALSTSFSGT KIR
Sbjct  348  MASSYNTKTYCRQSLIGGNYGLLNTDTYVPNPDYYSALLWHRLMGRNALSTSFSGTNKIR  407

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
            AYAHC+K + GITLLLINLD N TV+  V+             +     + +   S    
Sbjct  408  AYAHCSKATQGITLLLINLDGNNTVQVRVS-------TETVAANGIMPEYQNGGRSKFSR  460

Query  391  SPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITV  212
               S K    TR+EYHLTA+ G+LHSQT+LLNG  L+++ SG+IP ++P   + S PITV
Sbjct  461  MSGSTKVDKHTRDEYHLTAEDGNLHSQTVLLNGKILALNLSGAIPPLEPIKASLSSPITV  520

Query  211  APFSIVFAHIPYVFLPAC  158
            APFSIVFA I  + +P C
Sbjct  521  APFSIVFARIANITVPVC  538



>emb|CBI21126.3| unnamed protein product [Vitis vinifera]
Length=887

 Score =   227 bits (579),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 116/199 (58%), Positives = 135/199 (68%), Gaps = 30/199 (15%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            M++SYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRN LSTSF GT+KIR
Sbjct  717  MASSYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNVLSTSFYGTRKIR  776

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
            AYAHC+KQS GITLLLINLD  T   +N +                              
Sbjct  777  AYAHCSKQSPGITLLLINLDDKTQ-RSNFS-----------------------------R  806

Query  391  SPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITV  212
              R  K     REEYHLTAK GDLHSQT+LLNG  L+++SS  +P ++P  ++S +P+ V
Sbjct  807  MRRVSKIDASVREEYHLTAKDGDLHSQTLLLNGKVLTINSSRIVPPLEPIRVSSMDPVIV  866

Query  211  APFSIVFAHIPYVFLPACR  155
            APFSIVF   P +  PAC+
Sbjct  867  APFSIVFVRFPNINYPACK  885


 Score =   161 bits (408),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 75/90 (83%), Positives = 82/90 (91%), Gaps = 0/90 (0%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            M++SY  KTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRN LSTSF+GTKKIR
Sbjct  338  MASSYGNKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNVLSTSFNGTKKIR  397

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVA  482
            AY+HC+KQS GITLLLINLD NTT+   V+
Sbjct  398  AYSHCSKQSPGITLLLINLDGNTTLRVQVS  427



>ref|XP_003561019.1| PREDICTED: heparanase-like protein 3 [Brachypodium distachyon]
Length=538

 Score =   221 bits (564),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 114/198 (58%), Positives = 139/198 (70%), Gaps = 16/198 (8%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            MSA YDTKTYCRQT IGGNYG+LNT+TF PNPDYYSALLWHRLMG   L+T FSGT KIR
Sbjct  356  MSAKYDTKTYCRQTFIGGNYGMLNTSTFEPNPDYYSALLWHRLMGTKVLATKFSGTNKIR  415

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
            AYAHC K+S GITLLLINL  NTT   +V   G+   H + +RH+               
Sbjct  416  AYAHCTKRSPGITLLLINLGGNTTNHVSVTSEGAATKHGRKVRHVVGF------------  463

Query  391  SPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITV  212
               +Q  G M REEYHLT KGG++ SQ M+LNG EL+ D++G+IP ++P  +++++ I V
Sbjct  464  ---AQGAGAM-REEYHLTPKGGNIQSQVMVLNGKELATDAAGNIPRLEPVKVDAAQHIAV  519

Query  211  APFSIVFAHIPYVFLPAC  158
            AP SIVFAHIP+   PAC
Sbjct  520  APHSIVFAHIPHFHAPAC  537



>gb|KJB27355.1| hypothetical protein B456_004G293000 [Gossypium raimondii]
Length=505

 Score =   221 bits (562),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 111/198 (56%), Positives = 135/198 (68%), Gaps = 26/198 (13%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            M++SYDTKTYCRQTLIGGNYGLL+T TFVPNPDYY ALLWHRLMG N LSTSFSGT  +R
Sbjct  332  MASSYDTKTYCRQTLIGGNYGLLDTATFVPNPDYYGALLWHRLMGSNVLSTSFSGTTGVR  391

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
            AYAHC+KQS GI+LLLIN ++N +V   V  +G                           
Sbjct  392  AYAHCSKQSQGISLLLINFNANISVNVRVVTDGE-------------------------Q  426

Query  391  SPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITV  212
            +PR  K G  +REEYH TAK  +LHSQ ++LNG  L+++SSG IP M+P   + ++PI V
Sbjct  427  APRV-KLGNTSREEYHFTAKDENLHSQKVVLNGKILALNSSGGIPPMEPVNRSMTDPIIV  485

Query  211  APFSIVFAHIPYVFLPAC  158
            APFS VF+HI  + LPAC
Sbjct  486  APFSYVFSHISSIILPAC  503



>gb|KJB27356.1| hypothetical protein B456_004G293000 [Gossypium raimondii]
Length=532

 Score =   221 bits (563),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 111/198 (56%), Positives = 135/198 (68%), Gaps = 26/198 (13%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            M++SYDTKTYCRQTLIGGNYGLL+T TFVPNPDYY ALLWHRLMG N LSTSFSGT  +R
Sbjct  359  MASSYDTKTYCRQTLIGGNYGLLDTATFVPNPDYYGALLWHRLMGSNVLSTSFSGTTGVR  418

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
            AYAHC+KQS GI+LLLIN ++N +V   V  +G                           
Sbjct  419  AYAHCSKQSQGISLLLINFNANISVNVRVVTDGE-------------------------Q  453

Query  391  SPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITV  212
            +PR  K G  +REEYH TAK  +LHSQ ++LNG  L+++SSG IP M+P   + ++PI V
Sbjct  454  APRV-KLGNTSREEYHFTAKDENLHSQKVVLNGKILALNSSGGIPPMEPVNRSMTDPIIV  512

Query  211  APFSIVFAHIPYVFLPAC  158
            APFS VF+HI  + LPAC
Sbjct  513  APFSYVFSHISSIILPAC  530



>ref|XP_010048938.1| PREDICTED: heparanase-like protein 3 isoform X2 [Eucalyptus grandis]
Length=506

 Score =   220 bits (561),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 115/198 (58%), Positives = 139/198 (70%), Gaps = 5/198 (3%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            M+A+YDTKTYCRQTLIGGNYGLLNT TF+PNPDYYSALLWH+LMG   L TSFSGT KIR
Sbjct  313  MAATYDTKTYCRQTLIGGNYGLLNTQTFLPNPDYYSALLWHKLMGSEVLLTSFSGTDKIR  372

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
            AYAHC+K   GITLLLINLD  TTV+ +V+   +             H   +H       
Sbjct  373  AYAHCSKNPPGITLLLINLDGKTTVQVHVSTENA----TSKGTVTLKHESQNHRTRFASM  428

Query  391  SPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITV  212
            S  S   G + REEYHLTAK G++ SQ +LLN   L++DSSG+IP + P Y++ S+PITV
Sbjct  429  SRGSSNDGNI-REEYHLTAKEGNIQSQVLLLNRKVLNIDSSGNIPSLDPIYVSHSDPITV  487

Query  211  APFSIVFAHIPYVFLPAC  158
            APFS+VFA IP + + AC
Sbjct  488  APFSVVFARIPSMNVSAC  505



>ref|XP_006648064.1| PREDICTED: heparanase-like protein 3-like [Oryza brachyantha]
Length=549

 Score =   221 bits (562),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 114/199 (57%), Positives = 136/199 (68%), Gaps = 1/199 (1%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            MS+ YDTKTYCRQTLIGGNYGLLNTTTF PNPDYYSALLWHRLMG N LST+F+   KIR
Sbjct  352  MSSKYDTKTYCRQTLIGGNYGLLNTTTFEPNPDYYSALLWHRLMGTNVLSTTFNSMNKIR  411

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
            AYAHCA++S GITLLLINL  N T    V   G+        R     +        G  
Sbjct  412  AYAHCARESKGITLLLINLSGNNTNHIYVTSEGTGAQPYSTKREGRRPYRTKGGRRFGHI  471

Query  391  SPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITV  212
             P   +   + REEYHLT K G+L SQ +LLNGN L+ D++G IP+++P  +  ++PITV
Sbjct  472  -PGLGEEAQLIREEYHLTPKDGNLQSQHVLLNGNVLAPDANGDIPKLEPVKVEGTQPITV  530

Query  211  APFSIVFAHIPYVFLPACR  155
            AP+SIVFAHIP  + PACR
Sbjct  531  APYSIVFAHIPSFYAPACR  549



>ref|XP_010048937.1| PREDICTED: heparanase-like protein 3 isoform X1 [Eucalyptus grandis]
 gb|KCW81360.1| hypothetical protein EUGRSUZ_C02742 [Eucalyptus grandis]
Length=543

 Score =   219 bits (559),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 115/198 (58%), Positives = 139/198 (70%), Gaps = 5/198 (3%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            M+A+YDTKTYCRQTLIGGNYGLLNT TF+PNPDYYSALLWH+LMG   L TSFSGT KIR
Sbjct  350  MAATYDTKTYCRQTLIGGNYGLLNTQTFLPNPDYYSALLWHKLMGSEVLLTSFSGTDKIR  409

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
            AYAHC+K   GITLLLINLD  TTV+ +V+   +             H   +H       
Sbjct  410  AYAHCSKNPPGITLLLINLDGKTTVQVHVSTENA----TSKGTVTLKHESQNHRTRFASM  465

Query  391  SPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITV  212
            S  S   G + REEYHLTAK G++ SQ +LLN   L++DSSG+IP + P Y++ S+PITV
Sbjct  466  SRGSSNDGNI-REEYHLTAKEGNIQSQVLLLNRKVLNIDSSGNIPSLDPIYVSHSDPITV  524

Query  211  APFSIVFAHIPYVFLPAC  158
            APFS+VFA IP + + AC
Sbjct  525  APFSVVFARIPSMNVSAC  542



>dbj|BAJ89245.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=549

 Score =   219 bits (559),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 113/199 (57%), Positives = 138/199 (69%), Gaps = 11/199 (6%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            MSA YDTK+YCRQTL+GGNYGLLNTTTF PNPDYYSALLWHRLMG   LST+F+GT KIR
Sbjct  362  MSAKYDTKSYCRQTLVGGNYGLLNTTTFEPNPDYYSALLWHRLMGTKVLSTTFNGTNKIR  421

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
            AY HC K S GITLLLINL  N T    V   G+               H H +  H + 
Sbjct  422  AYTHCTKDSEGITLLLINLSGNNTNHIYVTSEGA-----------QEGAHPHGAKEHTRS  470

Query  391  SPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITV  212
             P+  +   +TR+EYHLTAK G+L SQ MLLNGN L+  ++G+IP+++P  ++ ++PIT+
Sbjct  471  IPKLGETAGLTRQEYHLTAKDGNLQSQHMLLNGNVLATGANGAIPKLEPVQVDGTQPITL  530

Query  211  APFSIVFAHIPYVFLPACR  155
             P+SIVFAHIP    PACR
Sbjct  531  GPYSIVFAHIPDFNAPACR  549



>ref|XP_004954253.1| PREDICTED: heparanase-like protein 3-like [Setaria italica]
Length=538

 Score =   219 bits (557),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 109/198 (55%), Positives = 132/198 (67%), Gaps = 12/198 (6%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            MS+ YDTK+YCRQTL+GGNYGLLN TTF PNPDYYSALLWHRLMG   LST+F+GT KIR
Sbjct  352  MSSKYDTKSYCRQTLVGGNYGLLNKTTFEPNPDYYSALLWHRLMGTKVLSTTFNGTNKIR  411

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
             YAHCA+ S GITLLLINL  N T    VA  G+                    +     
Sbjct  412  TYAHCARNSEGITLLLINLSGNNTNHIYVASEGA------------RTQSARKENRRFGH  459

Query  391  SPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITV  212
             P   +   +TREEYHLT K G+L SQ +LLNGN L+ D++G IP+++P  +  ++PITV
Sbjct  460  IPGLGEAAELTREEYHLTPKDGNLQSQQVLLNGNVLATDANGDIPKLEPVQVEGTQPITV  519

Query  211  APFSIVFAHIPYVFLPAC  158
             P+SIVFAHIP  + PAC
Sbjct  520  GPYSIVFAHIPSFYAPAC  537



>gb|AFW77131.1| hypothetical protein ZEAMMB73_462319 [Zea mays]
Length=303

 Score =   212 bits (539),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 107/198 (54%), Positives = 131/198 (66%), Gaps = 3/198 (2%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            MSA YDTK+YCRQ+LIGGNYGLLNTTTF PNPDYYSALLWHRLMG   L+T+FSGT KIR
Sbjct  108  MSAKYDTKSYCRQSLIGGNYGLLNTTTFQPNPDYYSALLWHRLMGTKVLATTFSGTNKIR  167

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
            AYAHCA+ S GITLLLINL  NTT + +V+                   H          
Sbjct  168  AYAHCARDSPGITLLLINLSGNTTTQVSVSVT---TQGAVAAHKHGARKHVGGRKFRHVH  224

Query  391  SPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITV  212
             P   +     R+EYHLT K G+L SQ MLLNG  L+ D++G+IP ++   +++++PI V
Sbjct  225  VPSFDEAAGGVRDEYHLTPKDGNLRSQIMLLNGRALATDTAGNIPALEAVKMDAAQPIAV  284

Query  211  APFSIVFAHIPYVFLPAC  158
            AP+SIVFA I +   PAC
Sbjct  285  APYSIVFARISHFNAPAC  302



>ref|XP_004964694.1| PREDICTED: heparanase-like protein 3-like [Setaria italica]
Length=572

 Score =   218 bits (556),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 113/221 (51%), Positives = 136/221 (62%), Gaps = 22/221 (10%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            MSA YDTK+YCRQ+LIGGNYGLLNTTTF PNPDYYSALLWHRLMG   L+T+F+GT KIR
Sbjct  351  MSAKYDTKSYCRQSLIGGNYGLLNTTTFQPNPDYYSALLWHRLMGTKVLATTFTGTNKIR  410

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
            AYAHCA+ S GITLLLINL  NT  + +V    +      +      +     S +    
Sbjct  411  AYAHCARDSPGITLLLINLSGNTKTQVSVTQTAAVAGGAHNHGARRSNTTTQVSVTTQAA  470

Query  391  SPRSQKRG----------------------TMTREEYHLTAKGGDLHSQTMLLNGNELSV  278
            +    K G                        TR+EYHLT KGGDL SQ MLLNG  L+ 
Sbjct  471  AAGEHKHGWRRHGRKFGHSHAPGLAAAAAAGATRDEYHLTPKGGDLRSQVMLLNGRALAT  530

Query  277  DSSGSIPEMKPRYLNSSEPITVAPFSIVFAHIPYVFLPACR  155
             + GSIP ++P  + ++EPI VAP+SIVFA IP+   PACR
Sbjct  531  GADGSIPRLEPVKVGAAEPIAVAPYSIVFARIPHFNAPACR  571



>ref|XP_003570329.1| PREDICTED: heparanase-like protein 3 [Brachypodium distachyon]
Length=541

 Score =   218 bits (554),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 111/198 (56%), Positives = 133/198 (67%), Gaps = 12/198 (6%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            MSA YDTK+YCRQTL+GGNYGLLNTTTF PNPDYYSALLWHRLMG   LST+F+GT KIR
Sbjct  355  MSAKYDTKSYCRQTLVGGNYGLLNTTTFEPNPDYYSALLWHRLMGTKVLSTTFNGTNKIR  414

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
            AY HCA+ + GITLLLINL  N T    V   G+ ++  K       H            
Sbjct  415  AYTHCARDTEGITLLLINLSGNDTNHIYVTSEGAHLYSAKKENRRFAHV-----------  463

Query  391  SPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITV  212
             P   +     R+EYHLT K G+L SQ MLLNGN L+ D++G IP+++P  +  S+PITV
Sbjct  464  -PGLGEVAEFKRQEYHLTPKDGNLQSQHMLLNGNLLATDANGDIPKLEPVQVEGSQPITV  522

Query  211  APFSIVFAHIPYVFLPAC  158
             P+SIVFAHIP  + PAC
Sbjct  523  GPYSIVFAHIPSFYAPAC  540



>gb|AFW73900.1| hypothetical protein ZEAMMB73_176333 [Zea mays]
Length=540

 Score =   218 bits (554),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 107/198 (54%), Positives = 131/198 (66%), Gaps = 15/198 (8%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            MS+ YDTK+YCRQTL+GGNYGLLNT+TF PNPDYYSALLWHRLMG   LST+F+GT KIR
Sbjct  357  MSSKYDTKSYCRQTLVGGNYGLLNTSTFEPNPDYYSALLWHRLMGTKVLSTAFNGTNKIR  416

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
             YAHCAK S GITLLLINLD ++T    V   G+     +                    
Sbjct  417  GYAHCAKNSEGITLLLINLDGSSTNRIYVTSQGAHAQSGRKKGSEGL-------------  463

Query  391  SPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITV  212
                     +TR+EYHLT K G+L SQ +LLNGN L+ D+ G IPE++P  +  ++PITV
Sbjct  464  --GEAAAAALTRQEYHLTPKDGNLQSQQVLLNGNALATDADGEIPELEPVQVEGTQPITV  521

Query  211  APFSIVFAHIPYVFLPAC  158
             P+SIVFAH+P  + PAC
Sbjct  522  GPYSIVFAHVPSFYAPAC  539



>ref|NP_001048420.1| Os02g0802200 [Oryza sativa Japonica Group]
 dbj|BAD36026.1| putative beta-glucuronidase precursor [Oryza sativa Japonica 
Group]
 dbj|BAD36734.1| putative beta-glucuronidase precursor [Oryza sativa Japonica 
Group]
 dbj|BAF10334.1| Os02g0802200 [Oryza sativa Japonica Group]
 gb|EAZ24974.1| hypothetical protein OsJ_08752 [Oryza sativa Japonica Group]
 dbj|BAG98079.1| unnamed protein product [Oryza sativa Japonica Group]
Length=541

 Score =   217 bits (553),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 111/199 (56%), Positives = 132/199 (66%), Gaps = 11/199 (6%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            MS+ YDTKTYCRQTLIGGNYGLLNTTTF PNPDYYSALLW+RLMG   LS +F+GT KIR
Sbjct  354  MSSKYDTKTYCRQTLIGGNYGLLNTTTFEPNPDYYSALLWNRLMGTKVLSATFNGTNKIR  413

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
            AYAHCA+ S GITLLLINL  N T    V   G           +  +            
Sbjct  414  AYAHCARDSRGITLLLINLSGNNTNHIYVTSEG-----------VQPYSTKKEGRRRFGR  462

Query  391  SPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITV  212
             P   +   + REEYHLT K G L SQ +LLNGN L+ D++G IP+++P  +  ++PITV
Sbjct  463  IPGLGEEAQLIREEYHLTPKDGSLQSQHVLLNGNVLAPDANGEIPKLEPVQVEGTQPITV  522

Query  211  APFSIVFAHIPYVFLPACR  155
            AP+SIVFAHIP  + PACR
Sbjct  523  APYSIVFAHIPRFYAPACR  541



>ref|XP_006655848.1| PREDICTED: heparanase-like protein 3-like [Oryza brachyantha]
Length=409

 Score =   214 bits (544),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 112/198 (57%), Positives = 131/198 (66%), Gaps = 12/198 (6%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            MSA YDTK+YCRQ+LIGGNYGLLN  TF PNPDYYSALLWHRLMG   LST+FSGT  IR
Sbjct  223  MSAKYDTKSYCRQSLIGGNYGLLNKETFQPNPDYYSALLWHRLMGTKVLSTTFSGTNMIR  282

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
            AYAHCA+ S GITLLLINL  N+T +  V   G   +  K       H   +        
Sbjct  283  AYAHCARDSPGITLLLINLSGNSTNQVTVTSEGVHANAVKKHSRKTKHLPGYV-------  335

Query  391  SPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITV  212
                Q  G+M REEYHLT K G L SQ MLLNG  L  D++G IP ++P  +++++PI V
Sbjct  336  ----QAAGSM-REEYHLTPKDGSLQSQVMLLNGRALVTDANGGIPRLEPVKVDAAQPIAV  390

Query  211  APFSIVFAHIPYVFLPAC  158
            AP+SIVFAHIP    PAC
Sbjct  391  APYSIVFAHIPNFSAPAC  408



>ref|XP_010048935.1| PREDICTED: heparanase-like protein 3 [Eucalyptus grandis]
Length=551

 Score =   217 bits (552),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 112/199 (56%), Positives = 139/199 (70%), Gaps = 5/199 (3%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            M+A+Y+TKTYCRQTLIGGNYGLLNT  F+PNPDYYSALLWH+LMG   L TSF GT KIR
Sbjct  358  MAATYNTKTYCRQTLIGGNYGLLNTQNFLPNPDYYSALLWHKLMGSKVLLTSFLGTDKIR  417

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
            AYAHC+K S G+TLLLINLD NTTV+ +V+   +      +          +H     + 
Sbjct  418  AYAHCSKNSPGVTLLLINLDGNTTVQVHVSTENA----TSNGTLTLKQESQNHRTKFARM  473

Query  391  SPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITV  212
            S  S   G + REEYHLTAK G++ SQ +LLNG  L+ DSSG+IP   P  ++ S+PITV
Sbjct  474  SRGSSNDGNI-REEYHLTAKEGNIQSQVLLLNGKVLNTDSSGNIPSFDPINVSHSDPITV  532

Query  211  APFSIVFAHIPYVFLPACR  155
            APFS+VFA IP + + AC+
Sbjct  533  APFSVVFAQIPNMNVTACK  551



>gb|EAY87898.1| hypothetical protein OsI_09318 [Oryza sativa Indica Group]
 gb|ACR10239.1| heparanase [Oryza sativa Indica Group]
Length=541

 Score =   216 bits (550),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 110/199 (55%), Positives = 132/199 (66%), Gaps = 11/199 (6%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            MS+ YDTKTYCRQTLIGGNYGLLNTTTF PNPDYYSALLW+RLMG   LS +F+GT KIR
Sbjct  354  MSSKYDTKTYCRQTLIGGNYGLLNTTTFEPNPDYYSALLWNRLMGTKVLSATFNGTNKIR  413

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
            AYAHCA+ S GITLLLINL  N T    +   G           +  +            
Sbjct  414  AYAHCARDSRGITLLLINLSGNNTNHIYMTSEG-----------VQPYSTKKEGRRRFGR  462

Query  391  SPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITV  212
             P   +   + REEYHLT K G L SQ +LLNGN L+ D++G IP+++P  +  ++PITV
Sbjct  463  IPGLGEEAQLIREEYHLTPKDGSLQSQHVLLNGNVLAPDANGEIPKLEPVQVEGTQPITV  522

Query  211  APFSIVFAHIPYVFLPACR  155
            AP+SIVFAHIP  + PACR
Sbjct  523  APYSIVFAHIPRFYAPACR  541



>ref|XP_008647415.1| PREDICTED: uncharacterized protein LOC100193781 isoform X2 [Zea 
mays]
Length=401

 Score =   210 bits (535),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 107/198 (54%), Positives = 131/198 (66%), Gaps = 3/198 (2%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            MSA YDTK+YCRQ+LIGGNYGLLNTTTF PNPDYYSALLWHRLMG   L+T+FSGT KIR
Sbjct  206  MSAKYDTKSYCRQSLIGGNYGLLNTTTFQPNPDYYSALLWHRLMGTKVLATTFSGTNKIR  265

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
            AYAHCA+ S GITLLLINL  NTT + +V+                   H          
Sbjct  266  AYAHCARDSPGITLLLINLSGNTTTQVSVSVT---TQGAVAAHKHGARKHVGGRKFRHVH  322

Query  391  SPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITV  212
             P   +     R+EYHLT K G+L SQ MLLNG  L+ D++G+IP ++   +++++PI V
Sbjct  323  VPSFDEAAGGVRDEYHLTPKDGNLRSQIMLLNGRALATDTAGNIPALEAVKMDAAQPIAV  382

Query  211  APFSIVFAHIPYVFLPAC  158
            AP+SIVFA I +   PAC
Sbjct  383  APYSIVFARISHFNAPAC  400



>ref|XP_008647414.1| PREDICTED: uncharacterized protein LOC100193781 isoform X1 [Zea 
mays]
Length=494

 Score =   211 bits (537),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 107/198 (54%), Positives = 131/198 (66%), Gaps = 3/198 (2%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            MSA YDTK+YCRQ+LIGGNYGLLNTTTF PNPDYYSALLWHRLMG   L+T+FSGT KIR
Sbjct  299  MSAKYDTKSYCRQSLIGGNYGLLNTTTFQPNPDYYSALLWHRLMGTKVLATTFSGTNKIR  358

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
            AYAHCA+ S GITLLLINL  NTT + +V+                   H          
Sbjct  359  AYAHCARDSPGITLLLINLSGNTTTQVSVSVT---TQGAVAAHKHGARKHVGGRKFRHVH  415

Query  391  SPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITV  212
             P   +     R+EYHLT K G+L SQ MLLNG  L+ D++G+IP ++   +++++PI V
Sbjct  416  VPSFDEAAGGVRDEYHLTPKDGNLRSQIMLLNGRALATDTAGNIPALEAVKMDAAQPIAV  475

Query  211  APFSIVFAHIPYVFLPAC  158
            AP+SIVFA I +   PAC
Sbjct  476  APYSIVFARISHFNAPAC  493



>ref|XP_010048934.1| PREDICTED: heparanase-like protein 3 isoform X2 [Eucalyptus grandis]
Length=444

 Score =   210 bits (534),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 109/204 (53%), Positives = 134/204 (66%), Gaps = 15/204 (7%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            M+A+Y+TKTYCRQTLIGG YGLLN++TF PNPDYYSALLWHRLMG N L T+F+GT K+R
Sbjct  251  MAATYNTKTYCRQTLIGGGYGLLNSSTFQPNPDYYSALLWHRLMGNNVLFTNFTGTNKLR  310

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANV-----AYNGSFVhhrkhirhinhhhhhhhsh  407
            AY+HC+K S G+TLLLINLD NTT + +V     A NG+ +   +     +         
Sbjct  311  AYSHCSKNSTGVTLLLINLDGNTTAQVHVSAEDGAGNGTLILQPQIRSRKSKFSRIS---  367

Query  406  shgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSS  227
                   +        REEYHLTAK  DLHSQ  LLNG  LSVDSSG+IP + P  +  S
Sbjct  368  -------KGLIFDANIREEYHLTAKDRDLHSQVTLLNGKILSVDSSGNIPALNPIQVRMS  420

Query  226  EPITVAPFSIVFAHIPYVFLPACR  155
            +PI VA FS+ FA  P + + ACR
Sbjct  421  DPILVASFSVAFARFPSMNVTACR  444



>ref|NP_001132339.1| uncharacterized protein LOC100193781 precursor [Zea mays]
 gb|ACG29680.1| heparanase-like protein 3 precursor [Zea mays]
Length=543

 Score =   211 bits (536),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 107/198 (54%), Positives = 131/198 (66%), Gaps = 3/198 (2%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            MSA YDTK+YCRQ+LIGGNYGLLNTTTF PNPDYYSALLWHRLMG   L+T+FSGT KIR
Sbjct  348  MSAKYDTKSYCRQSLIGGNYGLLNTTTFQPNPDYYSALLWHRLMGTKVLATTFSGTNKIR  407

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
            AYAHCA+ S GITLLLINL  NTT + +V+                   H          
Sbjct  408  AYAHCARDSPGITLLLINLSGNTTTQVSVSVT---TQGAVAAHKHGARKHVGGRKFRHVH  464

Query  391  SPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITV  212
             P   +     R+EYHLT K G+L SQ MLLNG  L+ D++G+IP ++   +++++PI V
Sbjct  465  VPSFDEAAGGVRDEYHLTPKDGNLRSQIMLLNGRALATDTAGNIPALEAVKMDAAQPIAV  524

Query  211  APFSIVFAHIPYVFLPAC  158
            AP+SIVFA I +   PAC
Sbjct  525  APYSIVFARISHFNAPAC  542



>gb|EYU34948.1| hypothetical protein MIMGU_mgv1a004017mg [Erythranthe guttata]
Length=540

 Score =   211 bits (536),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 118/200 (59%), Positives = 141/200 (71%), Gaps = 12/200 (6%)
 Frame = -1

Query  748  SASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIRA  569
            S++YDTKTYCRQTLIGGNYGLLNTTT         ALLWHRLMG++ LSTSF+G++KIRA
Sbjct  349  SSTYDTKTYCRQTLIGGNYGLLNTTT---------ALLWHRLMGKSVLSTSFTGSRKIRA  399

Query  568  YAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkGS  389
            YAHCAK+S GITLLLIN+D NTTV A V  +G  V  + H     HHH   H H   KG+
Sbjct  400  YAHCAKKSQGITLLLINIDGNTTVNAKVDIHGRVVRMQNHSNIHPHHHMPRHHHRRSKGT  459

Query  388  P---RSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPI  218
            P     Q      REEYHLT  GGD+HSQT+LLNG +L+VDSSG IP + P  ++S EP+
Sbjct  460  PLHHNKQVSANNVREEYHLTPLGGDIHSQTVLLNGKKLTVDSSGVIPALDPVTVDSLEPL  519

Query  217  TVAPFSIVFAHIPYVFLPAC  158
             VAP+SIVF H+P   + AC
Sbjct  520  IVAPYSIVFVHMPNFDVSAC  539



>gb|ACF81144.1| unknown [Zea mays]
 gb|AFW77132.1| heparanase-like protein 3 [Zea mays]
Length=543

 Score =   211 bits (536),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 107/198 (54%), Positives = 131/198 (66%), Gaps = 3/198 (2%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            MSA YDTK+YCRQ+LIGGNYGLLNTTTF PNPDYYSALLWHRLMG   L+T+FSGT KIR
Sbjct  348  MSAKYDTKSYCRQSLIGGNYGLLNTTTFQPNPDYYSALLWHRLMGTKVLATTFSGTNKIR  407

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
            AYAHCA+ S GITLLLINL  NTT + +V+                   H          
Sbjct  408  AYAHCARDSPGITLLLINLSGNTTTQVSVSVT---TQGAVAAHKHGARKHVGGRKFRHVH  464

Query  391  SPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITV  212
             P   +     R+EYHLT K G+L SQ MLLNG  L+ D++G+IP ++   +++++PI V
Sbjct  465  VPSFDEAAGGVRDEYHLTPKDGNLRSQIMLLNGRALATDTAGNIPALEAVKMDAAQPIAV  524

Query  211  APFSIVFAHIPYVFLPAC  158
            AP+SIVFA I +   PAC
Sbjct  525  APYSIVFARISHFNAPAC  542



>ref|NP_001056967.1| Os06g0179000 [Oryza sativa Japonica Group]
 dbj|BAD72300.1| putative beta-glucuronidase precursor [Oryza sativa Japonica 
Group]
 dbj|BAF18881.1| Os06g0179000 [Oryza sativa Japonica Group]
 dbj|BAG89440.1| unnamed protein product [Oryza sativa Japonica Group]
Length=526

 Score =   209 bits (533),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 110/198 (56%), Positives = 128/198 (65%), Gaps = 17/198 (9%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            MSA YDTK+YCRQ+LIGGNYGLLN  TF PNPDYYSALLWHRLMG   LS +F+GT  IR
Sbjct  345  MSAKYDTKSYCRQSLIGGNYGLLNKETFQPNPDYYSALLWHRLMGTKVLSATFNGTNMIR  404

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
             YAHCAK S GITLLLINL  NTT + +V   G+  +  K                    
Sbjct  405  TYAHCAKDSPGITLLLINLSGNTTSQVSVTSEGAHANTVKKHSRKT--------------  450

Query  391  SPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITV  212
              R    G+M REEYHLTAK G L SQ MLLNG  L  D +G IP ++P  +++++PI V
Sbjct  451  --RHLAAGSM-REEYHLTAKDGSLQSQVMLLNGRALVADENGEIPRLEPVKVDAAQPIAV  507

Query  211  APFSIVFAHIPYVFLPAC  158
            AP+SIVFAHI     PAC
Sbjct  508  APYSIVFAHIHNFPAPAC  525



>gb|EAY99897.1| hypothetical protein OsI_21892 [Oryza sativa Indica Group]
 gb|ACR10238.1| heparanase [Oryza sativa Indica Group]
Length=525

 Score =   209 bits (533),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 110/198 (56%), Positives = 128/198 (65%), Gaps = 17/198 (9%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            MSA YDTK+YCRQ+LIGGNYGLLN  TF PNPDYYSALLWHRLMG   LS +F+GT  IR
Sbjct  344  MSAKYDTKSYCRQSLIGGNYGLLNKETFQPNPDYYSALLWHRLMGTKVLSATFNGTNMIR  403

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
             YAHCAK S GITLLLINL  NTT + +V   G+  +  K                    
Sbjct  404  TYAHCAKDSPGITLLLINLSGNTTSQVSVTSEGAHANTVKKHSRKT--------------  449

Query  391  SPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITV  212
              R    G+M REEYHLTAK G L SQ MLLNG  L  D +G IP ++P  +++++PI V
Sbjct  450  --RHLAAGSM-REEYHLTAKDGSLQSQVMLLNGRALVADENGEIPRLEPVKVDAAQPIAV  506

Query  211  APFSIVFAHIPYVFLPAC  158
            AP+SIVFAHI     PAC
Sbjct  507  APYSIVFAHIHNFPAPAC  524



>gb|EAZ36024.1| hypothetical protein OsJ_20330 [Oryza sativa Japonica Group]
Length=525

 Score =   209 bits (533),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 110/198 (56%), Positives = 128/198 (65%), Gaps = 17/198 (9%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            MSA YDTK+YCRQ+LIGGNYGLLN  TF PNPDYYSALLWHRLMG   LS +F+GT  IR
Sbjct  344  MSAKYDTKSYCRQSLIGGNYGLLNKETFQPNPDYYSALLWHRLMGTKVLSATFNGTNMIR  403

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
             YAHCAK S GITLLLINL  NTT + +V   G+  +  K                    
Sbjct  404  TYAHCAKDSPGITLLLINLSGNTTSQVSVTSEGAHANTVKKHSRKT--------------  449

Query  391  SPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITV  212
              R    G+M REEYHLTAK G L SQ MLLNG  L  D +G IP ++P  +++++PI V
Sbjct  450  --RHLAAGSM-REEYHLTAKDGSLQSQVMLLNGRALVADENGEIPRLEPVKVDAAQPIAV  506

Query  211  APFSIVFAHIPYVFLPAC  158
            AP+SIVFAHI     PAC
Sbjct  507  APYSIVFAHIHNFPAPAC  524



>ref|XP_010665516.1| PREDICTED: heparanase-like protein 3 isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=543

 Score =   209 bits (533),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 111/207 (54%), Positives = 135/207 (65%), Gaps = 27/207 (13%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            M+A+Y TKTYCRQTLIGGNYGLL+T++FVPNPDYYSALLW+RLMG+  LSTS SGT  +R
Sbjct  356  MAATYGTKTYCRQTLIGGNYGLLDTSSFVPNPDYYSALLWNRLMGKQVLSTSISGTNNLR  415

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
            AY HC+KQS GITLLLINLD+  T++ N++     +                        
Sbjct  416  AYTHCSKQSQGITLLLINLDALMTLQVNISTETDSI-------------------LAADK  456

Query  391  SP--RSQKRGTM------TREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYL  236
            SP  R  K   M      TREEYHLTA   DL S+ +LLNG  L+VDSSG IP MKP  +
Sbjct  457  SPFARKSKFEQMPIISQNTREEYHLTAPNRDLISKKVLLNGRILTVDSSGGIPPMKPAVV  516

Query  235  NSSEPITVAPFSIVFAHIPYVFLPACR  155
            + S+PI+VAP SIVF HIP +    C+
Sbjct  517  HLSDPISVAPLSIVFVHIPSIVSYTCK  543



>ref|XP_010048933.1| PREDICTED: heparanase-like protein 3 isoform X1 [Eucalyptus grandis]
Length=544

 Score =   209 bits (532),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 109/204 (53%), Positives = 134/204 (66%), Gaps = 15/204 (7%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            M+A+Y+TKTYCRQTLIGG YGLLN++TF PNPDYYSALLWHRLMG N L T+F+GT K+R
Sbjct  351  MAATYNTKTYCRQTLIGGGYGLLNSSTFQPNPDYYSALLWHRLMGNNVLFTNFTGTNKLR  410

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANV-----AYNGSFVhhrkhirhinhhhhhhhsh  407
            AY+HC+K S G+TLLLINLD NTT + +V     A NG+ +   +     +         
Sbjct  411  AYSHCSKNSTGVTLLLINLDGNTTAQVHVSAEDGAGNGTLILQPQIRSRKSKFSRIS---  467

Query  406  shgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSS  227
                   +        REEYHLTAK  DLHSQ  LLNG  LSVDSSG+IP + P  +  S
Sbjct  468  -------KGLIFDANIREEYHLTAKDRDLHSQVTLLNGKILSVDSSGNIPALNPIQVRMS  520

Query  226  EPITVAPFSIVFAHIPYVFLPACR  155
            +PI VA FS+ FA  P + + ACR
Sbjct  521  DPILVASFSVAFARFPSMNVTACR  544



>ref|XP_010665510.1| PREDICTED: heparanase-like protein 3 isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=604

 Score =   209 bits (532),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 111/207 (54%), Positives = 135/207 (65%), Gaps = 27/207 (13%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            M+A+Y TKTYCRQTLIGGNYGLL+T++FVPNPDYYSALLW+RLMG+  LSTS SGT  +R
Sbjct  417  MAATYGTKTYCRQTLIGGNYGLLDTSSFVPNPDYYSALLWNRLMGKQVLSTSISGTNNLR  476

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
            AY HC+KQS GITLLLINLD+  T++ N++     +                        
Sbjct  477  AYTHCSKQSQGITLLLINLDALMTLQVNISTETDSI-------------------LAADK  517

Query  391  SP--RSQKRGTM------TREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYL  236
            SP  R  K   M      TREEYHLTA   DL S+ +LLNG  L+VDSSG IP MKP  +
Sbjct  518  SPFARKSKFEQMPIISQNTREEYHLTAPNRDLISKKVLLNGRILTVDSSGGIPPMKPAVV  577

Query  235  NSSEPITVAPFSIVFAHIPYVFLPACR  155
            + S+PI+VAP SIVF HIP +    C+
Sbjct  578  HLSDPISVAPLSIVFVHIPSIVSYTCK  604



>dbj|BAJ90636.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=524

 Score =   207 bits (527),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 103/198 (52%), Positives = 125/198 (63%), Gaps = 17/198 (9%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            MSA +DTK+YCRQ+ IGGNYGLLNTTTF PNPDYYSALLWHRLMG   L   F+GT  +R
Sbjct  343  MSAKFDTKSYCRQSFIGGNYGLLNTTTFQPNPDYYSALLWHRLMGTKVLEARFTGTNMVR  402

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
            AYAHCAK + GITLLLINL  N T    VA +G                   H  +  + 
Sbjct  403  AYAHCAKHAPGITLLLINLHRNATNHVTVASSGG-----------------AHGGAARRH  445

Query  391  SPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITV  212
             PR  +     REEYHLT +GGD+ SQ M+LNG  L   + GSIP M+P  ++++  + V
Sbjct  446  GPRFGQAAGAAREEYHLTPEGGDIQSQVMMLNGRALVTGADGSIPRMEPVKVDAARHVAV  505

Query  211  APFSIVFAHIPYVFLPAC  158
            AP SIVF H+P+   PAC
Sbjct  506  APRSIVFVHMPHFHAPAC  523



>ref|XP_010050122.1| PREDICTED: heparanase-like protein 3 [Eucalyptus grandis]
 gb|KCW83012.1| hypothetical protein EUGRSUZ_C04395 [Eucalyptus grandis]
Length=542

 Score =   206 bits (525),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 105/198 (53%), Positives = 131/198 (66%), Gaps = 11/198 (6%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            M++++DTKTYCRQ  IGGNYGLL+ T+F+PNPDYYSALLWHRLMGR  L  S S + KIR
Sbjct  355  MASTFDTKTYCRQAFIGGNYGLLDATSFIPNPDYYSALLWHRLMGRKVLGASLSRSDKIR  414

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
            AYAHCAK S G+ LL INLD N+T E  V  NG+ + + +H                   
Sbjct  415  AYAHCAKASKGVMLLFINLDGNSTAEVTVVNNGTPIRNHRHYNFGKGFIQF---------  465

Query  391  SPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITV  212
             P+      + REEYHLT K GD  S+T++LNGN L+V +SG IP + P+ +NSS  I V
Sbjct  466  -PQDSNDENV-REEYHLTPKDGDPLSRTVMLNGNILAVSTSGEIPALNPKNVNSSSSIVV  523

Query  211  APFSIVFAHIPYVFLPAC  158
            AP SIVFAH+PY  +P C
Sbjct  524  APQSIVFAHMPYYAIPDC  541



>gb|EPS67583.1| hypothetical protein M569_07189, partial [Genlisea aurea]
Length=534

 Score =   205 bits (522),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 103/198 (52%), Positives = 132/198 (67%), Gaps = 7/198 (4%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            +++ YD K YCRQTLIGGNYGLLNTTTF PNPD+YSALLWHRLMG   LS +F+ T K+R
Sbjct  344  LASYYDHKVYCRQTLIGGNYGLLNTTTFAPNPDFYSALLWHRLMGPRVLSATFNVTNKVR  403

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
            AYAHCAK+S GI+LLL+N+D N + +  V ++             N   H     +    
Sbjct  404  AYAHCAKRSLGISLLLVNIDGNNSYDLRVEHD-------LTTPRRNSRKHIRLHRAPKWS  456

Query  391  SPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITV  212
              + Q+ G + REEYHLT   G++ S+ +LLNG EL VDSS  IP ++P  +NSS+PI V
Sbjct  457  HVKQQQLGEVPREEYHLTPLDGNIQSRVVLLNGKELIVDSSNQIPVLEPVQVNSSDPIKV  516

Query  211  APFSIVFAHIPYVFLPAC  158
             P+SIVF H P + LPAC
Sbjct  517  DPYSIVFVHFPSMDLPAC  534



>gb|EYU38304.1| hypothetical protein MIMGU_mgv1a011158mg [Erythranthe guttata]
Length=290

 Score =   197 bits (500),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 102/199 (51%), Positives = 123/199 (62%), Gaps = 28/199 (14%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            M+A+YDTK +CRQTL+GG Y LL+TTTFVPNPDYY ALLWHRLMG++ L T F G+ KIR
Sbjct  113  MAAAYDTKLFCRQTLVGGYYSLLDTTTFVPNPDYYGALLWHRLMGKHVLLTRFEGSSKIR  172

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
            AYAHCAK S G+ +LLINLD NTT EA ++                              
Sbjct  173  AYAHCAKNSPGVVVLLINLDGNTTAEAKLS----------------------------LF  204

Query  391  SPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITV  212
                 +R    R+EYHLT   G++ S+T+LLNG  L VDSSG+IP M+P  +  S PITV
Sbjct  205  ENDDGERLFDFRQEYHLTPLEGNIQSKTVLLNGKPLIVDSSGAIPIMEPVEVIGSRPITV  264

Query  211  APFSIVFAHIPYVFLPACR  155
             P SIVF HI      ACR
Sbjct  265  NPHSIVFVHISNFAFKACR  283



>ref|XP_008658727.1| PREDICTED: heparanase-like protein 3 isoform X1 [Zea mays]
Length=555

 Score =   202 bits (515),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 104/202 (51%), Positives = 131/202 (65%), Gaps = 3/202 (1%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            M+A +DTK+YCRQ+L+GGNYGLLNTTTF PNPDYYSALLWHRLMG   L+ +FSGT KIR
Sbjct  351  MAARFDTKSYCRQSLVGGNYGLLNTTTFQPNPDYYSALLWHRLMGTKVLAVTFSGTNKIR  410

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhh---hhhhshsh  401
            AYAHCA+ S GITLLLINL  N T   +V   G+   H    RH    H           
Sbjct  411  AYAHCARDSPGITLLLINLSGNATARVSVTAQGAAAAHAHRHRHDARKHGGGRKFRHVHV  470

Query  400  gkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEP  221
               +   +      R EYHLT K GDL SQ ++LNG  L+ D++G+IP ++   ++++ P
Sbjct  471  PGFAGGGEAAAGAVRHEYHLTPKDGDLTSQVVMLNGRALATDAAGNIPALEAVEVDAARP  530

Query  220  ITVAPFSIVFAHIPYVFLPACR  155
            I V P+SIVFA +P+   PACR
Sbjct  531  IAVTPYSIVFARVPHFSAPACR  552



>ref|NP_001152083.1| heparanase-like protein 3 precursor [Zea mays]
 gb|ACG45701.1| heparanase-like protein 3 precursor [Zea mays]
Length=552

 Score =   201 bits (512),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 102/200 (51%), Positives = 131/200 (66%), Gaps = 1/200 (1%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            M+A +DTK+YCRQ+L+GGNYGLLNTTTF PNPDYYSALLWHRLMG   L+ +FSGT KIR
Sbjct  350  MAARFDTKSYCRQSLVGGNYGLLNTTTFQPNPDYYSALLWHRLMGTEVLAVTFSGTNKIR  409

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANV-AYNGSFVhhrkhirhinhhhhhhhshshgk  395
            AYAHCA+ S GITLLLINL  N T   +V A   +  H  +H    +             
Sbjct  410  AYAHCARDSPGITLLLINLSGNATARVSVTAQGAAAAHAHRHGARKHGGGRKFRHVHVPG  469

Query  394  GSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPIT  215
             +   +      R EYHLT K GDL SQ ++LNG  L+ D++G+IP ++   ++++ PI 
Sbjct  470  FAGAGEAAAGAVRHEYHLTPKDGDLTSQVVMLNGRALATDAAGNIPALEAVEVDAARPIA  529

Query  214  VAPFSIVFAHIPYVFLPACR  155
            V P+SIVFA +P+   PACR
Sbjct  530  VTPYSIVFARVPHFSAPACR  549



>ref|XP_002437942.1| hypothetical protein SORBIDRAFT_10g005260 [Sorghum bicolor]
 gb|EER89309.1| hypothetical protein SORBIDRAFT_10g005260 [Sorghum bicolor]
Length=554

 Score =   200 bits (509),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 107/202 (53%), Positives = 132/202 (65%), Gaps = 5/202 (2%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            MSA YDTK+YCRQ+LIGGNYGLLNTTTF PNPDYYSALLWHRLMG   L+T+F+GT KIR
Sbjct  353  MSAKYDTKSYCRQSLIGGNYGLLNTTTFQPNPDYYSALLWHRLMGTKVLATTFNGTNKIR  412

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
            AYAHCA+ S GITLLLINL  NTT + +V    +               H          
Sbjct  413  AYAHCARDSPGITLLLINLSGNTTTQVSVTVT-TQGQGAVAAHKHGARKHVGGRKFGHVH  471

Query  391  SPR----SQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSE  224
             PR     +      R+EYHLT K G+L SQ MLLNG  L+ D++G+IP ++   +++++
Sbjct  472  GPRFTGVDEAAAGAVRDEYHLTPKDGNLRSQVMLLNGKALATDAAGNIPALEAVKVDAAQ  531

Query  223  PITVAPFSIVFAHIPYVFLPAC  158
            PI VAP+SIVFA I +   PAC
Sbjct  532  PIAVAPYSIVFARISHFNAPAC  553



>gb|ABR16706.1| unknown [Picea sitchensis]
Length=381

 Score =   193 bits (491),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 100/198 (51%), Positives = 127/198 (64%), Gaps = 30/198 (15%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            M++++ TK++CRQ+LIGGNYGLLNTTTF+PNPDYYSALLWHRLMG   L+T+ +GT+ +R
Sbjct  213  MASAFSTKSFCRQSLIGGNYGLLNTTTFLPNPDYYSALLWHRLMGTRVLATNSTGTEYLR  272

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
            AYAHC K S G+TLLLINL  +T +   V+                             G
Sbjct  273  AYAHCTKSSRGVTLLLINLSRDTGISVQVS----------------------------TG  304

Query  391  SPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITV  212
            S  S  R   +R EYHLTAK GDLHSQT+LLNGN L++   G IP +    + ++ PI V
Sbjct  305  SGTSTDRN--SRLEYHLTAKDGDLHSQTVLLNGNILNITPDGEIPSLSAVTVPANRPILV  362

Query  211  APFSIVFAHIPYVFLPAC  158
            AP SI F ++PYV  PAC
Sbjct  363  APLSIAFVNLPYVQFPAC  380



>gb|KCW81359.1| hypothetical protein EUGRSUZ_C02741 [Eucalyptus grandis]
Length=490

 Score =   187 bits (476),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 100/199 (50%), Positives = 125/199 (63%), Gaps = 21/199 (11%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            M+A+Y+TKTYCRQTLIGGNYGLLNT  F+PNPDYYSALLWH+LMG   L TSF GT KIR
Sbjct  313  MAATYNTKTYCRQTLIGGNYGLLNTQNFLPNPDYYSALLWHKLMGSKVLLTSFLGTDKIR  372

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
            AYAHC+K S      +I++ +      N   NG+    ++   H                
Sbjct  373  AYAHCSKNS------VIHVSTE-----NATSNGTLTLKQESQNHRTKFARMS--------  413

Query  391  SPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITV  212
              R        REEYHLTAK G++ SQ +LLNG  L+ DSSG+IP   P  ++ S+PITV
Sbjct  414  --RGSSNDGNIREEYHLTAKEGNIQSQVLLLNGKVLNTDSSGNIPSFDPINVSHSDPITV  471

Query  211  APFSIVFAHIPYVFLPACR  155
            APFS+VFA IP + + AC+
Sbjct  472  APFSVVFAQIPNMNVTACK  490



>gb|ACN26863.1| unknown [Zea mays]
 tpg|DAA44038.1| TPA: hypothetical protein ZEAMMB73_735117 [Zea mays]
Length=431

 Score =   183 bits (464),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 100/198 (51%), Positives = 117/198 (59%), Gaps = 1/198 (1%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            M++ Y+TK +CRQTLIGGNYGLL+T TF+PNPDYYSALLWHRLMG   LS   +  ++IR
Sbjct  234  MASKYNTKVFCRQTLIGGNYGLLDTQTFLPNPDYYSALLWHRLMGNGVLSVDINAPRQIR  293

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
            AYAHC KQ  GIT+LLINL SNTT       N   V   K           H        
Sbjct  294  AYAHCRKQQQGITILLINL-SNTTGYNVTLQNDINVSLGKRPDLEKRSSFTHRLRKAVSW  352

Query  391  SPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITV  212
              R     T  REEYHLTAK GDL S+TMLLNG  L +  +GSIP M P  +    P+ +
Sbjct  353  LGRKPASNTRRREEYHLTAKDGDLQSKTMLLNGAPLELGDAGSIPAMDPVLVAVDLPVQL  412

Query  211  APFSIVFAHIPYVFLPAC  158
            AP SI F  +P     AC
Sbjct  413  APTSIAFVVLPKFEAKAC  430



>ref|XP_010936349.1| PREDICTED: heparanase-like protein 1 isoform X2 [Elaeis guineensis]
Length=576

 Score =   185 bits (469),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 97/198 (49%), Positives = 119/198 (60%), Gaps = 1/198 (1%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            M++ Y+TK YCRQTLIGGNYGLL+T  FVPNPDYYSALLWH+LMGR  LS    G+  +R
Sbjct  379  MASKYNTKVYCRQTLIGGNYGLLDTEKFVPNPDYYSALLWHQLMGRGVLSVDIDGSPSLR  438

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
             YAHCAKQ  G+++LLINL SNTT       N   V+  +        +  H        
Sbjct  439  VYAHCAKQEAGVSVLLINL-SNTTKSIVTVQNDINVNLGEKDGIQKDSYFVHGLKKTVSW  497

Query  391  SPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITV  212
              R    G+  REEYHLTAK G+  SQTMLLNG+ L +   G IP + P Y++ + PI +
Sbjct  498  LGRKPLDGSQKREEYHLTAKDGNHQSQTMLLNGSPLELTEDGGIPALNPAYVSVNSPIKM  557

Query  211  APFSIVFAHIPYVFLPAC  158
            AP SI F   P     AC
Sbjct  558  APMSIAFVVFPNFEARAC  575



>ref|XP_010936348.1| PREDICTED: heparanase-like protein 1 isoform X1 [Elaeis guineensis]
Length=601

 Score =   184 bits (468),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 97/198 (49%), Positives = 119/198 (60%), Gaps = 1/198 (1%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            M++ Y+TK YCRQTLIGGNYGLL+T  FVPNPDYYSALLWH+LMGR  LS    G+  +R
Sbjct  404  MASKYNTKVYCRQTLIGGNYGLLDTEKFVPNPDYYSALLWHQLMGRGVLSVDIDGSPSLR  463

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
             YAHCAKQ  G+++LLINL SNTT       N   V+  +        +  H        
Sbjct  464  VYAHCAKQEAGVSVLLINL-SNTTKSIVTVQNDINVNLGEKDGIQKDSYFVHGLKKTVSW  522

Query  391  SPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITV  212
              R    G+  REEYHLTAK G+  SQTMLLNG+ L +   G IP + P Y++ + PI +
Sbjct  523  LGRKPLDGSQKREEYHLTAKDGNHQSQTMLLNGSPLELTEDGGIPALNPAYVSVNSPIKM  582

Query  211  APFSIVFAHIPYVFLPAC  158
            AP SI F   P     AC
Sbjct  583  APMSIAFVVFPNFEARAC  600



>ref|XP_011070961.1| PREDICTED: heparanase-like protein 1 isoform X2 [Sesamum indicum]
Length=489

 Score =   182 bits (461),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 93/198 (47%), Positives = 122/198 (62%), Gaps = 26/198 (13%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            M++ ++ K +CRQ+LIGGNYGLLNTTTFVPNPDYY ALLWHRLMG N LS S +G+  +R
Sbjct  317  MTSRFNHKVFCRQSLIGGNYGLLNTTTFVPNPDYYGALLWHRLMGTNVLSASHNGSPYLR  376

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
             Y+HC+K++ GI+LLLIN+ ++TT E +VA +                            
Sbjct  377  VYSHCSKKTAGISLLLINMSNSTTFEVSVADD--------------------------TN  410

Query  391  SPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITV  212
            S   Q R T  REEYHLT + G++ S  +LLNG  L +  S  IP M P+ +++  PI V
Sbjct  411  SYHQQYRDTNKREEYHLTPEDGNILSDVLLLNGTPLKLTESSDIPAMNPQLVDARLPIKV  470

Query  211  APFSIVFAHIPYVFLPAC  158
             P SIVFA +P    PAC
Sbjct  471  TPDSIVFATLPGFKAPAC  488



>gb|ACG44916.1| heparanase-like protein 2 precursor [Zea mays]
 gb|ACN28738.1| unknown [Zea mays]
 tpg|DAA44037.1| TPA: heparanase-like protein 2 [Zea mays]
Length=541

 Score =   183 bits (464),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 100/198 (51%), Positives = 117/198 (59%), Gaps = 1/198 (1%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            M++ Y+TK +CRQTLIGGNYGLL+T TF+PNPDYYSALLWHRLMG   LS   +  ++IR
Sbjct  344  MASKYNTKVFCRQTLIGGNYGLLDTQTFLPNPDYYSALLWHRLMGNGVLSVDINAPRQIR  403

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
            AYAHC KQ  GIT+LLINL SNTT       N   V   K           H        
Sbjct  404  AYAHCRKQQQGITILLINL-SNTTGYNVTLQNDINVSLGKRPDLEKRSSFTHRLRKAVSW  462

Query  391  SPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITV  212
              R     T  REEYHLTAK GDL S+TMLLNG  L +  +GSIP M P  +    P+ +
Sbjct  463  LGRKPASNTRRREEYHLTAKDGDLQSKTMLLNGAPLELGDAGSIPAMDPVLVAVDLPVQL  522

Query  211  APFSIVFAHIPYVFLPAC  158
            AP SI F  +P     AC
Sbjct  523  APTSIAFVVLPKFEAKAC  540



>gb|EAZ26032.1| hypothetical protein OsJ_09885 [Oryza sativa Japonica Group]
Length=497

 Score =   182 bits (461),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 99/198 (50%), Positives = 118/198 (60%), Gaps = 1/198 (1%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            M++ Y+TK +CRQTLIGG+YGLL+T TF+PNPDYYSALLWHRLMGR  LS   +  +K+R
Sbjct  300  MASKYNTKIFCRQTLIGGHYGLLDTQTFLPNPDYYSALLWHRLMGREVLSVDINAPRKLR  359

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
            AYAHC KQ  GITLLLINL SNTT       N   V   K      H+   H        
Sbjct  360  AYAHCRKQQQGITLLLINL-SNTTGYNVTLQNDINVSLDKTASLHKHNSFSHSLRRAVSW  418

Query  391  SPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITV  212
              R        REEYHLTAK GDL S+TMLLNG  L +   G +P M P  +  + P+ +
Sbjct  419  LGRKPSSDVARREEYHLTAKDGDLQSKTMLLNGAPLELSDDGGVPAMSPALVAVNSPVYL  478

Query  211  APFSIVFAHIPYVFLPAC  158
            AP SI F  +P     AC
Sbjct  479  APTSIAFVVLPMFEAKAC  496



>dbj|BAJ97884.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=537

 Score =   182 bits (463),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 100/197 (51%), Positives = 112/197 (57%), Gaps = 1/197 (1%)
 Frame = -1

Query  748  SASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIRA  569
            SA YDTK YCRQTLIGGNYGLL+T T+VPNPDYYSALLWHRLMG   LS  F GT  +RA
Sbjct  342  SAKYDTKVYCRQTLIGGNYGLLDTDTYVPNPDYYSALLWHRLMGNGVLSIDFGGTSYLRA  401

Query  568  YAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkGS  389
            YAHC KQ GGI LLLINL  N      V  N   V   +           H         
Sbjct  402  YAHCGKQKGGIALLLINLSQNMGSMVTVR-NDLNVGIAQGQGITRDSSFVHGLKRTVSWV  460

Query  388  PRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITVA  209
                  G   REEYHLTA+ G+  ++TMLLNG  L +   G IP M P  +++S PI VA
Sbjct  461  GSKASDGLEKREEYHLTAQDGNPLARTMLLNGVPLELTEDGDIPPMYPVQVSASSPIYVA  520

Query  208  PFSIVFAHIPYVFLPAC  158
            P SI F   P     AC
Sbjct  521  PLSIAFVVFPDFEADAC  537



>dbj|BAJ96463.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=537

 Score =   182 bits (463),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 100/197 (51%), Positives = 112/197 (57%), Gaps = 1/197 (1%)
 Frame = -1

Query  748  SASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIRA  569
            SA YDTK YCRQTLIGGNYGLL+T T+VPNPDYYSALLWHRLMG   LS  F GT  +RA
Sbjct  342  SAKYDTKVYCRQTLIGGNYGLLDTDTYVPNPDYYSALLWHRLMGNGVLSIDFGGTSYLRA  401

Query  568  YAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkGS  389
            YAHC KQ GGI LLLINL  N      V  N   V   +           H         
Sbjct  402  YAHCGKQKGGIALLLINLSQNMGSMVTVR-NDLNVGIAQGQGITRDSSFVHGLKRTVSWV  460

Query  388  PRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITVA  209
                  G   REEYHLTA+ G+  ++TMLLNG  L +   G IP M P  +++S PI VA
Sbjct  461  GSKASDGLEKREEYHLTAQDGNPLARTMLLNGVPLELTEDGDIPPMYPVQVSASSPIYVA  520

Query  208  PFSIVFAHIPYVFLPAC  158
            P SI F   P     AC
Sbjct  521  PLSIAFVVFPDFEADAC  537



>dbj|BAJ84826.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=537

 Score =   182 bits (462),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 100/197 (51%), Positives = 112/197 (57%), Gaps = 1/197 (1%)
 Frame = -1

Query  748  SASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIRA  569
            SA YDTK YCRQTLIGGNYGLL+T T+VPNPDYYSALLWHRLMG   LS  F GT  +RA
Sbjct  342  SAKYDTKVYCRQTLIGGNYGLLDTDTYVPNPDYYSALLWHRLMGNGVLSIDFGGTSYLRA  401

Query  568  YAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkGS  389
            YAHC KQ GGI LLLINL  N      V  N   V   +           H         
Sbjct  402  YAHCGKQKGGIALLLINLSQNMGSMVTVR-NDLNVGIAQGQGITRDSSFVHGLKRTVSWV  460

Query  388  PRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITVA  209
                  G   REEYHLTA+ G+  ++TMLLNG  L +   G IP M P  +++S PI VA
Sbjct  461  GSKASDGLEKREEYHLTAQDGNPLARTMLLNGVPLELTEDGDIPPMYPVQVSASSPIYVA  520

Query  208  PFSIVFAHIPYVFLPAC  158
            P SI F   P     AC
Sbjct  521  PLSIAFVVFPDFEADAC  537



>ref|XP_011070960.1| PREDICTED: heparanase-like protein 2 isoform X1 [Sesamum indicum]
Length=514

 Score =   182 bits (461),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 93/198 (47%), Positives = 122/198 (62%), Gaps = 26/198 (13%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            M++ ++ K +CRQ+LIGGNYGLLNTTTFVPNPDYY ALLWHRLMG N LS S +G+  +R
Sbjct  342  MTSRFNHKVFCRQSLIGGNYGLLNTTTFVPNPDYYGALLWHRLMGTNVLSASHNGSPYLR  401

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
             Y+HC+K++ GI+LLLIN+ ++TT E +VA +                            
Sbjct  402  VYSHCSKKTAGISLLLINMSNSTTFEVSVADD--------------------------TN  435

Query  391  SPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITV  212
            S   Q R T  REEYHLT + G++ S  +LLNG  L +  S  IP M P+ +++  PI V
Sbjct  436  SYHQQYRDTNKREEYHLTPEDGNILSDVLLLNGTPLKLTESSDIPAMNPQLVDARLPIKV  495

Query  211  APFSIVFAHIPYVFLPAC  158
             P SIVFA +P    PAC
Sbjct  496  TPDSIVFATLPGFKAPAC  513



>ref|XP_002468296.1| hypothetical protein SORBIDRAFT_01g043180 [Sorghum bicolor]
 gb|EER95294.1| hypothetical protein SORBIDRAFT_01g043180 [Sorghum bicolor]
Length=543

 Score =   182 bits (462),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 100/198 (51%), Positives = 117/198 (59%), Gaps = 1/198 (1%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            M++ Y+TK +CRQTLIGGNYGLL+T TF+PNPDYYSALLWHRLMG   LS   +  ++IR
Sbjct  346  MASKYNTKVFCRQTLIGGNYGLLDTETFLPNPDYYSALLWHRLMGNGVLSVDINAPRQIR  405

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
            AYAHC +Q  GITLLLINL SNTT       N   V   K           H        
Sbjct  406  AYAHCRRQQQGITLLLINL-SNTTGYNVTLQNDINVSLGKRPDLEKRSSFTHRLKKAVSW  464

Query  391  SPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITV  212
              R     T  REEYHLTAK GDL S+TMLLNG  L +  +GSIP M P  +    P+ +
Sbjct  465  LGRKPTSDTKRREEYHLTAKDGDLQSKTMLLNGVPLELGDAGSIPAMDPVLVAVDSPVHL  524

Query  211  APFSIVFAHIPYVFLPAC  158
            AP SI F  +P     AC
Sbjct  525  APTSIAFVVLPKFEAKAC  542



>gb|KCW81358.1| hypothetical protein EUGRSUZ_C02740 [Eucalyptus grandis]
Length=488

 Score =   181 bits (458),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 97/199 (49%), Positives = 119/199 (60%), Gaps = 27/199 (14%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            M+A+Y+TKTYCRQTLIGG YGLLN++TF PNPDYYSALLWHRLMG N L T+F+GT K+R
Sbjct  317  MAATYNTKTYCRQTLIGGGYGLLNSSTFQPNPDYYSALLWHRLMGNNVLFTNFTGTNKLR  376

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
            AY+HC+K S                  N A NG+ +   +     +              
Sbjct  377  AYSHCSKNS-----------------VNGAGNGTLILQPQIRSRKSKFSRIS--------  411

Query  391  SPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITV  212
              +        REEYHLTAK  DLHSQ  LLNG  LSVDSSG+IP + P  +  S+PI V
Sbjct  412  --KGLIFDANIREEYHLTAKDRDLHSQVTLLNGKILSVDSSGNIPALNPIQVRMSDPILV  469

Query  211  APFSIVFAHIPYVFLPACR  155
            A FS+ FA  P + + ACR
Sbjct  470  ASFSVAFARFPSMNVTACR  488



>ref|NP_001049350.1| Os03g0211700 [Oryza sativa Japonica Group]
 gb|ABF94603.1| Heparanase-like protein 2 precursor, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF11264.1| Os03g0211700 [Oryza sativa Japonica Group]
Length=541

 Score =   182 bits (461),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 99/198 (50%), Positives = 118/198 (60%), Gaps = 1/198 (1%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            M++ Y+TK +CRQTLIGG+YGLL+T TF+PNPDYYSALLWHRLMGR  LS   +  +K+R
Sbjct  344  MASKYNTKIFCRQTLIGGHYGLLDTQTFLPNPDYYSALLWHRLMGREVLSVDINAPRKLR  403

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
            AYAHC KQ  GITLLLINL SNTT       N   V   K      H+   H        
Sbjct  404  AYAHCRKQQQGITLLLINL-SNTTGYNVTLQNDINVSLDKTASLHKHNSFSHSLRRAVSW  462

Query  391  SPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITV  212
              R        REEYHLTAK GDL S+TMLLNG  L +   G +P M P  +  + P+ +
Sbjct  463  LGRKPSSDVARREEYHLTAKDGDLQSKTMLLNGAPLELSDDGGVPAMSPALVAVNSPVYL  522

Query  211  APFSIVFAHIPYVFLPAC  158
            AP SI F  +P     AC
Sbjct  523  APTSIAFVVLPMFEAKAC  540



>ref|XP_008393204.1| PREDICTED: heparanase-like protein 1 [Malus domestica]
Length=546

 Score =   182 bits (461),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 91/198 (46%), Positives = 116/198 (59%), Gaps = 0/198 (0%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            MSA ++T+ YCRQ+L+GGNYGLLN T+FVPNPDYYSALLWHRLMG+  LS   +G+  +R
Sbjct  348  MSAKHNTRVYCRQSLVGGNYGLLNKTSFVPNPDYYSALLWHRLMGQGVLSAHNNGSADLR  407

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
             YAHC +   GITLLLINL + T    NV                   +           
Sbjct  408  TYAHCTRGRAGITLLLINLSNETNFXTNVENILDADLGAHARNISKESYFKRGLKRTVSW  467

Query  391  SPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITV  212
              R      + REEYHLT K GDL S+TM+LNG  L +   G+IPE++P  ++   P+T+
Sbjct  468  VGRKALDEAICREEYHLTPKDGDLRSKTMVLNGAPLEITKDGNIPELEPARVDMKAPLTI  527

Query  211  APFSIVFAHIPYVFLPAC  158
            AP SI F  +PY    AC
Sbjct  528  APLSIKFVVLPYFDAQAC  545



>ref|NP_001145968.1| uncharacterized protein LOC100279495 precursor [Zea mays]
 gb|ACL52953.1| unknown [Zea mays]
Length=541

 Score =   181 bits (459),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 99/198 (50%), Positives = 116/198 (59%), Gaps = 1/198 (1%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            M++ Y+TK +CRQTLIGGNYGLL+T TF+PNPDYYSALLWHRLMG   LS   +  ++IR
Sbjct  344  MASKYNTKVFCRQTLIGGNYGLLDTQTFLPNPDYYSALLWHRLMGNGVLSVDINAPRQIR  403

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
            AYAHC KQ  GIT+LLINL SNTT       N   V   K           H        
Sbjct  404  AYAHCRKQQQGITILLINL-SNTTGYNVTLQNDINVSLGKRPDLEKRSSFTHRLRKAVSW  462

Query  391  SPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITV  212
              R     T  REEYHLT K GDL S+TMLLNG  L +  +GSIP M P  +    P+ +
Sbjct  463  LGRKPASNTRRREEYHLTTKDGDLQSKTMLLNGAPLELGDAGSIPAMDPVLVAVDLPVQL  522

Query  211  APFSIVFAHIPYVFLPAC  158
            AP SI F  +P     AC
Sbjct  523  APTSIAFVVLPKFEAKAC  540



>ref|XP_009338656.1| PREDICTED: heparanase-like protein 1 isoform X1 [Pyrus x bretschneideri]
 ref|XP_009338663.1| PREDICTED: heparanase-like protein 1 isoform X2 [Pyrus x bretschneideri]
Length=546

 Score =   181 bits (459),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 91/198 (46%), Positives = 116/198 (59%), Gaps = 0/198 (0%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            MSA ++T+ YCRQ+L+GGNYGLLN T+FVPNPDYYSALLWHRLMG+  LS   +G+  +R
Sbjct  348  MSAKHNTRVYCRQSLVGGNYGLLNKTSFVPNPDYYSALLWHRLMGQGVLSAHNNGSXXLR  407

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
             YAHC +   GITLLLINL + T    NV                   +           
Sbjct  408  TYAHCTRGRAGITLLLINLSNETNFITNVENILDTDLGAHARNISKESYFKRGLKRTVSW  467

Query  391  SPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITV  212
              R      + REEYHLT K GDL S+TM+LNG  L +   G+IPE++P  ++   P+T+
Sbjct  468  VGRKALDEAICREEYHLTPKDGDLRSKTMILNGAPLEITKDGNIPELEPARVDMKAPLTI  527

Query  211  APFSIVFAHIPYVFLPAC  158
            AP SI F  +PY    AC
Sbjct  528  APLSIKFVVLPYFDAQAC  545



>gb|AGV40186.2| heparanase 1-like protein [Nicotiana tabacum]
Length=541

 Score =   181 bits (458),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 93/199 (47%), Positives = 117/199 (59%), Gaps = 0/199 (0%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            M+A + TK YCRQTLIGGNYGLL+T+TFVPNPDYYSALLWHRLMG+  L  S + +  +R
Sbjct  343  MAAKHHTKVYCRQTLIGGNYGLLDTSTFVPNPDYYSALLWHRLMGKEVLDVSSNASPYLR  402

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
            +YAHC K   G+TLLLINL +      N+  +          ++   +   H        
Sbjct  403  SYAHCTKDRAGVTLLLINLSNQIQYGVNIQSSAYTSLQVGEKKNHKKNAFVHGLKETVSW  462

Query  391  SPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITV  212
                    T+ REEYHLT +GGDL S+TMLLNG  L +  +G IP + P   N   PI+V
Sbjct  463  VGSKSSDVTLYREEYHLTPEGGDLQSRTMLLNGKPLQLTETGDIPSLTPVLKNIESPISV  522

Query  211  APFSIVFAHIPYVFLPACR  155
            AP SI F   P    P+CR
Sbjct  523  APLSIKFIVFPNFNSPSCR  541



>ref|XP_009631958.1| PREDICTED: heparanase-like protein 2 [Nicotiana tomentosiformis]
Length=541

 Score =   181 bits (458),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 93/199 (47%), Positives = 117/199 (59%), Gaps = 0/199 (0%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            M+A + TK YCRQTLIGGNYGLL+T+TFVPNPDYYSALLWHRLMG+  L  S + +  +R
Sbjct  343  MAAKHHTKVYCRQTLIGGNYGLLDTSTFVPNPDYYSALLWHRLMGKEVLDVSSNASPYLR  402

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
            +YAHC K   G+TLLLINL +      N+  +          ++   +   H        
Sbjct  403  SYAHCTKDRAGVTLLLINLSNQIQYGVNIQSSAYTSLQVGEKKNHKKNAFVHGLKETVSW  462

Query  391  SPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITV  212
                    T+ REEYHLT +GGDL S+TMLLNG  L +  +G IP + P   N   PI+V
Sbjct  463  VGSKSSDVTLYREEYHLTPEGGDLQSRTMLLNGKPLQLTETGDIPSLTPVLKNIESPISV  522

Query  211  APFSIVFAHIPYVFLPACR  155
            AP SI F   P    P+CR
Sbjct  523  APLSIKFIVFPNFNSPSCR  541



>ref|XP_003520103.1| PREDICTED: heparanase-like protein 2-like [Glycine max]
 ref|XP_003520107.1| PREDICTED: heparanase-like protein 2-like [Glycine max]
Length=175

 Score =   171 bits (433),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 89/199 (45%), Positives = 116/199 (58%), Gaps = 26/199 (13%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            M+++++ K YCRQ L+GGNYGLL+TTTF+PNPDYY ALLWHRLMG   LS S  G+  +R
Sbjct  1    MTSTFNHKVYCRQALVGGNYGLLDTTTFIPNPDYYGALLWHRLMGSKVLSVSHEGSPYLR  60

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
            AY HC+K+  GIT+LLIN+ ++TT E ++     +                         
Sbjct  61   AYVHCSKKESGITVLLINMSNSTTFEVSLLNENLY-------------------------  95

Query  391  SPRSQKRGTMT-REEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPIT  215
             P    R   T REEYHLT K G++ S+ +LLNG  L +  S  IPEM P+ ++ S PI 
Sbjct  96   HPEVGLRNRNTPREEYHLTPKDGNIQSKVVLLNGTPLVLTQSLHIPEMNPKLVDPSSPIK  155

Query  214  VAPFSIVFAHIPYVFLPAC  158
            V   SIVF H      PAC
Sbjct  156  VKHDSIVFVHSKSFNAPAC  174



>ref|XP_002284470.1| PREDICTED: heparanase-like protein 1 [Vitis vinifera]
 ref|XP_010663309.1| PREDICTED: heparanase-like protein 1 [Vitis vinifera]
 ref|XP_010663310.1| PREDICTED: heparanase-like protein 1 [Vitis vinifera]
Length=539

 Score =   180 bits (457),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 95/198 (48%), Positives = 117/198 (59%), Gaps = 1/198 (1%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            M++ Y TK YCRQTLIGGNYGLLNTTT VPNPDYYSALLWHRLMG+  L+   + +  +R
Sbjct  342  MASKYHTKVYCRQTLIGGNYGLLNTTTLVPNPDYYSALLWHRLMGKGVLAVDSTASPFLR  401

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
            +YAHC+K   GITLLLINL + TT + NV  N   ++       +               
Sbjct  402  SYAHCSKGKAGITLLLINLSNQTTFQINVE-NSMNLNLFVKKTTMYRGSAFMRGLKKSAS  460

Query  391  SPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITV  212
               S+    + REEYHLT K G L SQTM+LNG  L +   G+IP + P  LN + PI +
Sbjct  461  WIGSKADEQLFREEYHLTPKDGYLRSQTMVLNGMPLELTDDGNIPSLNPVRLNLNAPIFI  520

Query  211  APFSIVFAHIPYVFLPAC  158
             P SI F   P    PAC
Sbjct  521  NPLSIAFIAFPNFDAPAC  538



>ref|XP_003578591.1| PREDICTED: heparanase-like protein 1 [Brachypodium distachyon]
Length=538

 Score =   180 bits (456),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 97/198 (49%), Positives = 116/198 (59%), Gaps = 1/198 (1%)
 Frame = -1

Query  748  SASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIRA  569
            SA YDTK YCRQTLIGGNYGLL+T TFVPNPDYYSALLWHRLMG+  LS    G+  +RA
Sbjct  342  SAKYDTKVYCRQTLIGGNYGLLDTDTFVPNPDYYSALLWHRLMGKGVLSMDIGGSSYLRA  401

Query  568  YAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkGS  389
            YAHC KQ GG+TLLLINL  N     +V  N   V   +       +   H         
Sbjct  402  YAHCGKQKGGVTLLLINLSQNMGSMVSVR-NDLNVDLAQGQGITRDNSFVHGLKRTVSWV  460

Query  388  PRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITVA  209
                  G   REEYHLTA+ GD  ++T+LLNG  L + + G IP + P  ++ S PI V+
Sbjct  461  GSKASDGLEKREEYHLTAQDGDPLTRTVLLNGVPLELTADGDIPPLYPVQVSVSSPIYVS  520

Query  208  PFSIVFAHIPYVFLPACR  155
            P SI F   P     AC+
Sbjct  521  PLSIAFVVFPDFEADACQ  538



>ref|XP_008374597.1| PREDICTED: heparanase-like protein 1 [Malus domestica]
 ref|XP_008374598.1| PREDICTED: heparanase-like protein 1 [Malus domestica]
Length=546

 Score =   180 bits (456),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 89/198 (45%), Positives = 118/198 (60%), Gaps = 0/198 (0%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            MSA Y+T+ YCRQ+L+GGNYGLLN T+FVPNPDYYSALLWHRLMG+  LS + +G+  +R
Sbjct  348  MSAKYNTRVYCRQSLVGGNYGLLNRTSFVPNPDYYSALLWHRLMGQGVLSANNNGSADLR  407

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
             YAHC +   GITLLLINL + T    N+A         +        +           
Sbjct  408  TYAHCTRGRAGITLLLINLSNETNFIVNIANVLDTDLGAQAGNVSKESYFKRGLKRTVSW  467

Query  391  SPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITV  212
              R      + REEYHLT K GD+ S+TM+LNG  L +   G+IPE++P  ++   P+ +
Sbjct  468  VGRKALDEAIYREEYHLTPKDGDVKSKTMVLNGAPLEITKDGNIPELEPTRVDMKAPLRI  527

Query  211  APFSIVFAHIPYVFLPAC  158
            AP SI F  +P+    AC
Sbjct  528  APLSIKFVVLPFFDAQAC  545



>ref|XP_010259074.1| PREDICTED: heparanase-like protein 1 [Nelumbo nucifera]
 ref|XP_010259082.1| PREDICTED: heparanase-like protein 1 [Nelumbo nucifera]
 ref|XP_010259088.1| PREDICTED: heparanase-like protein 1 [Nelumbo nucifera]
Length=539

 Score =   180 bits (456),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 94/198 (47%), Positives = 116/198 (59%), Gaps = 1/198 (1%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            M++ Y TK YCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMG+  L+     +  +R
Sbjct  342  MASKYSTKAYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGKGVLAVHSDASPFLR  401

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
            AYAHC+K   GITLLLINL + T  +  V  N   ++  +  +        H        
Sbjct  402  AYAHCSKGRAGITLLLINLSNQTDFKIMVQ-NDVNINVHEGEKITQGGSFMHGLKKTVSW  460

Query  391  SPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITV  212
              R    G   REEYHLT+  G L SQ MLLNG  L +  +G IP + P  ++   PI +
Sbjct  461  VGRKTSDGKALREEYHLTSMDGHLRSQKMLLNGTPLELTENGDIPPLDPVLVDVKSPIYI  520

Query  211  APFSIVFAHIPYVFLPAC  158
            +P SI F   P+   PAC
Sbjct  521  SPLSIAFVAFPHFEAPAC  538



>ref|XP_011012392.1| PREDICTED: heparanase-like protein 2 [Populus euphratica]
Length=520

 Score =   179 bits (455),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 90/198 (45%), Positives = 123/198 (62%), Gaps = 22/198 (11%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            M+A+++ K YCRQ LIGGNYGLLNTT+F+PNPDYY ALLWHRLMG+  L+TS  G+  +R
Sbjct  344  MTATFNHKVYCRQALIGGNYGLLNTTSFIPNPDYYGALLWHRLMGKTVLATSHFGSPYLR  403

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
             Y HC+KQ  GIT+L+IN+ ++T+++ +V  +                       +    
Sbjct  404  TYTHCSKQKPGITMLIINMSNSTSIDVSVTND----------------------ENKYPH  441

Query  391  SPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITV  212
            + R    G+  REEYHLT K G++ S  +LLNG  L + SS  IP + P+ ++SS PITV
Sbjct  442  NYRMTVNGSNQREEYHLTPKDGNIQSDVVLLNGTPLQLTSSQDIPSLSPKIVDSSSPITV  501

Query  211  APFSIVFAHIPYVFLPAC  158
            AP SIV+  I     PAC
Sbjct  502  APDSIVYVTIRDFKAPAC  519



>ref|XP_010688437.1| PREDICTED: heparanase-like protein 3 [Beta vulgaris subsp. vulgaris]
Length=459

 Score =   177 bits (450),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 91/199 (46%), Positives = 120/199 (60%), Gaps = 27/199 (14%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            M+A+++TK +CRQ LIGG+YGLLNTTTF+PNPDYY+ALLWHRLMG+  L+T   G  KIR
Sbjct  287  MAATFNTKAFCRQALIGGHYGLLNTTTFLPNPDYYNALLWHRLMGKQVLATKVIGNPKIR  346

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
            AY HC+KQS GITLL+INLD+     +    +G                           
Sbjct  347  AYTHCSKQSEGITLLIINLDNKPFKISVETQDGPIT------------------------  382

Query  391  SPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITV  212
               +  + T+T E Y LTA   DL S+T+LLNG  L + S G IP++ P+ ++    I V
Sbjct  383  ---NPSKPTITTEVYQLTAPNADLRSKTVLLNGQALLLTSLGEIPQLIPQKVSYGSTIDV  439

Query  211  APFSIVFAHIPYVFLPACR  155
            A +SIVF H P +  PAC+
Sbjct  440  AAYSIVFVHFPEISSPACK  458



>ref|XP_003558511.1| PREDICTED: heparanase-like protein 1 [Brachypodium distachyon]
Length=544

 Score =   179 bits (454),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 99/202 (49%), Positives = 124/202 (61%), Gaps = 7/202 (3%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            M++ Y+TK +CRQTLIGGNYGLL+T TF+PNPDYYSALLWHRLMG+  LS   +  +K+R
Sbjct  345  MASKYNTKVFCRQTLIGGNYGLLDTQTFIPNPDYYSALLWHRLMGKGVLSVDINAPRKVR  404

Query  571  AYAHCAKQSGGITLLLINLDS----NTTVEANVAYNGSFVhhrkhirhinhhhhhhhshs  404
            AYAHC+KQ  GITLLLINL +    N T++ ++  N S        RH +  H    + S
Sbjct  405  AYAHCSKQQQGITLLLINLSNSTGYNVTLQNDI--NVSLEKQTNLRRHSSFTHGLRRAVS  462

Query  403  hgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSE  224
                 P S +     REEYHL AK GD  S+TMLLNG  L +   GSIP + P     S 
Sbjct  463  WLGRKP-SSRDAAAKREEYHLAAKDGDHQSRTMLLNGVPLELADDGSIPALDPVTAAVSS  521

Query  223  PITVAPFSIVFAHIPYVFLPAC  158
            P+ +AP SI F  +P     AC
Sbjct  522  PVYLAPTSIAFVVLPKFEAKAC  543



>ref|XP_009783167.1| PREDICTED: heparanase-like protein 2 [Nicotiana sylvestris]
Length=516

 Score =   178 bits (451),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 91/198 (46%), Positives = 124/198 (63%), Gaps = 27/198 (14%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            M+++++ K YCRQ+LIGGNYGLLNTT+F+PNPDYY ALLWH+LMG+N LST+  G+  +R
Sbjct  345  MTSTFNHKVYCRQSLIGGNYGLLNTTSFIPNPDYYGALLWHKLMGKNVLSTTHEGSPYLR  404

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
             YAHC+K S G+T+LLIN+D +TT E +V  + +                          
Sbjct  405  TYAHCSKSS-GVTVLLINMDKSTTFEVSVVDDLNMYP-----------------------  440

Query  391  SPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITV  212
               S+      REEYHLT K G++ S  +LLNG  L + +S  IPEM P+ ++ + PI+V
Sbjct  441  ---SRIEPIHQREEYHLTPKDGNIQSDVLLLNGTPLKLTASFDIPEMNPQLVDPTLPISV  497

Query  211  APFSIVFAHIPYVFLPAC  158
            AP SIVFA +     PAC
Sbjct  498  APRSIVFATLRGFQAPAC  515



>ref|XP_004239465.2| PREDICTED: heparanase-like protein 2, partial [Solanum lycopersicum]
Length=513

 Score =   178 bits (451),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 94/199 (47%), Positives = 127/199 (64%), Gaps = 16/199 (8%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            M+++++ K YCRQ+LIGGNYGLLNTT+F+PNPDYY ALLWH+LMG+N LS +  G+  IR
Sbjct  329  MTSTFNHKVYCRQSLIGGNYGLLNTTSFIPNPDYYGALLWHKLMGKNVLSITHEGSPYIR  388

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
             YAHC+K S GIT+LLIN+D +TT + +V  +               + +     S    
Sbjct  389  TYAHCSKTS-GITVLLINMDKSTTFDVSVVDD--------------LNMYAEGVASVEYI  433

Query  391  SPRSQKRGTM-TREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPIT  215
            +P      +M  REEYHLT K G++ S  +LLNG  L + SS  IP MKP+ ++ + PI+
Sbjct  434  NPNPDSVDSMHPREEYHLTPKDGNIQSDVLLLNGTPLKLTSSLDIPVMKPKLVDPTLPIS  493

Query  214  VAPFSIVFAHIPYVFLPAC  158
            VAP SIVFA +     PAC
Sbjct  494  VAPQSIVFATLRGFQAPAC  512



>emb|CAD42650.1| putative heparanase [Hordeum vulgare subsp. vulgare]
Length=537

 Score =   178 bits (451),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 98/197 (50%), Positives = 111/197 (56%), Gaps = 1/197 (1%)
 Frame = -1

Query  748  SASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIRA  569
            SA YDTK YCRQTLIGGNYGLL+T T+VPNPDYYSALLWHRLMG   LS  F  T  +RA
Sbjct  342  SAKYDTKVYCRQTLIGGNYGLLDTDTYVPNPDYYSALLWHRLMGNGVLSIDFGSTSYLRA  401

Query  568  YAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkGS  389
            YAHC K+ GGI LLLINL  N      V  N   V   +           H         
Sbjct  402  YAHCGKRKGGIALLLINLSQNMGSMVTVR-NDLNVGIAQGQGDHKDSSFVHGLKRTVSWV  460

Query  388  PRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITVA  209
                  G   REEYHLTA+ G+  ++TMLLNG  L +   G IP M P  +++S PI VA
Sbjct  461  GSKASDGLEKREEYHLTAQDGNPLARTMLLNGVPLELTEDGDIPPMYPVQVSASSPIYVA  520

Query  208  PFSIVFAHIPYVFLPAC  158
            P SI F   P     AC
Sbjct  521  PLSIAFVAFPDFEADAC  537



>ref|XP_004241591.1| PREDICTED: heparanase-like protein 2 [Solanum lycopersicum]
Length=539

 Score =   178 bits (452),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 91/198 (46%), Positives = 122/198 (62%), Gaps = 1/198 (1%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            M+A+Y TK YCRQT IGGNYGLL+T+TFVPNPDYYSALLWHRLMG+  L+ S + +  +R
Sbjct  342  MAATYHTKVYCRQTFIGGNYGLLDTSTFVPNPDYYSALLWHRLMGKGVLAVSNNASSYLR  401

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
            +YAHC +   G+TLLLINL + T    N+  + S   H K   +           +    
Sbjct  402  SYAHCTRHRAGVTLLLINLSNQTHYGVNIESSVSITSHVKEKSNHKSSFVQRLKKTISWV  461

Query  391  SPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITV  212
              +S    T++REEYHLT   G+L S+TMLLNG  L +  +G+IP + P  +    PI++
Sbjct  462  GRKSSDV-TLSREEYHLTPLDGNLQSRTMLLNGKPLQLAENGNIPSLSPVLVKLKSPISI  520

Query  211  APFSIVFAHIPYVFLPAC  158
            +P SI F   PY+  P C
Sbjct  521  SPLSIKFIVFPYLSSPVC  538



>emb|CBI15157.3| unnamed protein product [Vitis vinifera]
Length=513

 Score =   177 bits (450),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 95/200 (48%), Positives = 116/200 (58%), Gaps = 31/200 (16%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            M++ Y TK YCRQTLIGGNYGLLNTTT VPNPDYYSALLWHRLMG+  L+   + +  +R
Sbjct  342  MASKYHTKVYCRQTLIGGNYGLLNTTTLVPNPDYYSALLWHRLMGKGVLAVDSTASPFLR  401

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANV--AYNGSFVhhrkhirhinhhhhhhhshshg  398
            +YAHC+K   GITLLLINL + TT + NV  + N +F                       
Sbjct  402  SYAHCSKGKAGITLLLINLSNQTTFQINVENSMNLNF-----------------------  438

Query  397  kGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPI  218
                  +    + REEYHLT K G L SQTM+LNG  L +   G+IP + P  LN + PI
Sbjct  439  ------KADEQLFREEYHLTPKDGYLRSQTMVLNGMPLELTDDGNIPSLNPVRLNLNAPI  492

Query  217  TVAPFSIVFAHIPYVFLPAC  158
             + P SI F   P    PAC
Sbjct  493  FINPLSIAFIAFPNFDAPAC  512



>ref|XP_009612848.1| PREDICTED: heparanase-like protein 2 [Nicotiana tomentosiformis]
Length=516

 Score =   177 bits (450),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 91/198 (46%), Positives = 124/198 (63%), Gaps = 27/198 (14%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            M+++++ K YCRQ+LIGGNYGLLNTT+F+PNPDYY ALLWH+LMG+N LST+  G+  +R
Sbjct  345  MTSTFNHKVYCRQSLIGGNYGLLNTTSFIPNPDYYGALLWHKLMGKNVLSTTHEGSPYLR  404

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
             YAHC+K S G+T+LLIN+D +TT E +V  + +                          
Sbjct  405  TYAHCSKTS-GVTVLLINMDKSTTFEVSVVDDLNMYP-----------------------  440

Query  391  SPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITV  212
               S+      REEYHLT K G++ S  +LLNG  L + +S  IPEM P+ ++ + PI+V
Sbjct  441  ---SRIEPIHQREEYHLTPKDGNIQSDVLLLNGTPLKLTASFDIPEMNPQLVDPTLPISV  497

Query  211  APFSIVFAHIPYVFLPAC  158
            AP SIVFA +     PAC
Sbjct  498  APRSIVFATLRGFQAPAC  515



>ref|XP_010030437.1| PREDICTED: heparanase-like protein 1 [Eucalyptus grandis]
 ref|XP_010030444.1| PREDICTED: heparanase-like protein 1 [Eucalyptus grandis]
 ref|XP_010030449.1| PREDICTED: heparanase-like protein 1 [Eucalyptus grandis]
 gb|KCW83688.1| hypothetical protein EUGRSUZ_B00567 [Eucalyptus grandis]
 gb|KCW83689.1| hypothetical protein EUGRSUZ_B00567 [Eucalyptus grandis]
Length=540

 Score =   177 bits (450),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 94/200 (47%), Positives = 121/200 (61%), Gaps = 5/200 (3%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            M++ YDTK YCRQ+L+GGNYGLLNTTT VPNPDYYSALLWHRLMG+ AL+ S      +R
Sbjct  343  MASKYDTKVYCRQSLVGGNYGLLNTTTLVPNPDYYSALLWHRLMGKRALAVSGDAPPSLR  402

Query  571  AYAHCAKQSGGITLLLINLDSNT--TVEANVAYNGSFVhhrkhirhinhhhhhhhshshg  398
             YAHC K   G+TLLLINL + T   +    +     V  +   +     H    + S  
Sbjct  403  CYAHCLKGRAGVTLLLINLRNQTKFIITTQKSVQNLHVEEQSVNKGSILIHGLKKTVSFV  462

Query  397  kGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPI  218
               P    R  + REEYHLT +GG L SQTMLLNG+ L +   G+IP +KP  +++   I
Sbjct  463  GQGP---SRAPLFREEYHLTPQGGHLQSQTMLLNGSPLELTRDGAIPPLKPNLVHADSLI  519

Query  217  TVAPFSIVFAHIPYVFLPAC  158
            +V+P SI F  +P   + AC
Sbjct  520  SVSPLSIAFIVLPNFDVQAC  539



>ref|XP_006348811.1| PREDICTED: heparanase-like protein 2-like [Solanum tuberosum]
Length=552

 Score =   177 bits (450),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 96/198 (48%), Positives = 129/198 (65%), Gaps = 14/198 (7%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            M+++++ K YCRQ+LIGGNYGLLNTT+FVPNPDYY ALLWH+LMG+N LS +  G+  IR
Sbjct  368  MTSTFNHKVYCRQSLIGGNYGLLNTTSFVPNPDYYGALLWHKLMGKNVLSITHEGSPYIR  427

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
             YAHC+K S GIT+LLIN+D +TT + +V  +            +N +     S  +   
Sbjct  428  TYAHCSKTS-GITVLLINMDKSTTFDVSVVND------------LNMYAESVASVEYINP  474

Query  391  SPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITV  212
            +P S +     REEYHLT K G++ S  +LLNG  L + SS  IP MKP+ ++ + PI+V
Sbjct  475  NPDSVES-IHPREEYHLTPKDGNIQSDVLLLNGTPLKLTSSLDIPVMKPKLVDPTLPISV  533

Query  211  APFSIVFAHIPYVFLPAC  158
            AP SIVFA +     PAC
Sbjct  534  APQSIVFATLRGFQAPAC  551



>gb|KDP31311.1| hypothetical protein JCGZ_11687 [Jatropha curcas]
Length=539

 Score =   177 bits (448),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 96/212 (45%), Positives = 120/212 (57%), Gaps = 29/212 (14%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            M++ Y+TK YCRQTLIGGNYGLLNTTTFVPNPDYYSALLWH+LMG+  L+     +  +R
Sbjct  342  MASKYNTKVYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHQLMGKGVLAVGSDASPYLR  401

Query  571  AYAHCAKQSGGITLLLINLDSNTT--------------VEANVAYNGSFVhhrkhirhin  434
            AYAHC+K+  GITLLLINL + T               VE N+    SFV   K      
Sbjct  402  AYAHCSKRRAGITLLLINLSNQTDFVISVQNSATMKLHVEKNIQRENSFVRGLKRSVSWV  461

Query  433  hhhhhhhshshgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPE  254
             +                   G + REEYHLT K G L S+TM+LNG  L +   G IP 
Sbjct  462  GNQAL---------------DGVLKREEYHLTPKDGYLRSRTMVLNGIPLQLTKDGDIPA  506

Query  253  MKPRYLNSSEPITVAPFSIVFAHIPYVFLPAC  158
            M+P + + + PI ++P SI F  +P    P C
Sbjct  507  MEPVHTDVNSPIYISPLSISFIVLPNFDAPTC  538



>gb|EYU22381.1| hypothetical protein MIMGU_mgv1a008019mg [Erythranthe guttata]
 gb|EYU22382.1| hypothetical protein MIMGU_mgv1a008019mg [Erythranthe guttata]
Length=387

 Score =   174 bits (440),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 89/203 (44%), Positives = 119/203 (59%), Gaps = 36/203 (18%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            M+++++ K +CRQ L+GGNYGLLNTTTF+PNPDYY ALLWHRLMG+N L TS  G+  +R
Sbjct  215  MTSAFNHKVFCRQALVGGNYGLLNTTTFIPNPDYYGALLWHRLMGKNVLFTSHKGSPYLR  274

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVA-----YNGSFVhhrkhirhinhhhhhhhsh  407
             Y+HC+K+S GI+LL+IN+ ++TT E +V      YN  + +                  
Sbjct  275  VYSHCSKKSAGISLLMINMSNSTTFEVSVVDETNLYNQEYTNLN----------------  318

Query  406  shgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSS  227
                            REEYHLT K G++ S  +LLNG  L +  S  IP M P+ ++S 
Sbjct  319  ---------------QREEYHLTPKDGNILSDVLLLNGTPLKLTESFDIPAMNPQLVDSV  363

Query  226  EPITVAPFSIVFAHIPYVFLPAC  158
             PI V P SIVFA +     PAC
Sbjct  364  SPIKVGPDSIVFATLKGFKAPAC  386



>gb|EMS53277.1| Heparanase-like protein 1 [Triticum urartu]
Length=456

 Score =   175 bits (444),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 99/202 (49%), Positives = 111/202 (55%), Gaps = 6/202 (3%)
 Frame = -1

Query  748  SASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYS-----ALLWHRLMGRNALSTSFSGT  584
            SA YDTK YCRQTLIGGNYGLL+T T+VPNPDYY      ALLWHRLMG   LS  F GT
Sbjct  256  SAKYDTKVYCRQTLIGGNYGLLDTDTYVPNPDYYRQVSVLALLWHRLMGNGVLSIDFGGT  315

Query  583  KKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshs  404
              +RAYAHC KQ GGI LLLINL  N      V  N   V   +           H    
Sbjct  316  SYLRAYAHCGKQKGGIALLLINLSQNMGSMVTVR-NDLNVGLAQGQGITRGSSFVHGLKR  374

Query  403  hgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSE  224
                       G   REEYHLTA+ G+  ++TMLLNG  L +   G IP M P  +++S 
Sbjct  375  TVSWVGSKASDGLEKREEYHLTAQDGNRFARTMLLNGVPLELTEDGDIPPMYPVQVSASS  434

Query  223  PITVAPFSIVFAHIPYVFLPAC  158
            PI VAP SI F   P     AC
Sbjct  435  PIYVAPLSIAFVVFPDFEADAC  456



>ref|XP_002315010.1| hypothetical protein POPTR_0010s16820g [Populus trichocarpa]
 gb|EEF01181.1| hypothetical protein POPTR_0010s16820g [Populus trichocarpa]
Length=518

 Score =   176 bits (447),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 89/198 (45%), Positives = 122/198 (62%), Gaps = 22/198 (11%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            M+A+++ K YCRQTLIGGNYGLLNTT+F+PNPDYY ALLWHRLMG+  L+T+  G+  +R
Sbjct  342  MTATFNHKVYCRQTLIGGNYGLLNTTSFIPNPDYYGALLWHRLMGKTVLATNHFGSPYLR  401

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
             Y HC+KQ  GIT+L+IN+ ++T+++ +V  + +                          
Sbjct  402  TYTHCSKQKPGITMLIINMSNSTSIDVSVTNDEN----------------------KYPH  439

Query  391  SPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITV  212
            + R    G+  REEYHLT K G++ S  +LLNG  L + SS  IP + P  ++SS PI V
Sbjct  440  NYRMTVNGSNQREEYHLTPKDGNIQSDVVLLNGTPLQLTSSQDIPSLSPMIVDSSSPIRV  499

Query  211  APFSIVFAHIPYVFLPAC  158
            AP SIV+  I     PAC
Sbjct  500  APDSIVYVTIRDFKAPAC  517



>ref|XP_009339108.1| PREDICTED: heparanase-like protein 1 isoform X1 [Pyrus x bretschneideri]
 ref|XP_009339109.1| PREDICTED: heparanase-like protein 1 isoform X1 [Pyrus x bretschneideri]
 ref|XP_009339110.1| PREDICTED: heparanase-like protein 1 isoform X2 [Pyrus x bretschneideri]
Length=546

 Score =   176 bits (447),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 87/198 (44%), Positives = 115/198 (58%), Gaps = 0/198 (0%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            MSA Y+T+ YCRQ+L+GGNYGLLN T+FVPNPDYYSALLWHRLMGR  LS   +G+  +R
Sbjct  348  MSAKYNTRVYCRQSLVGGNYGLLNRTSFVPNPDYYSALLWHRLMGRGVLSADNNGSADLR  407

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
             YAHC +   GITLLLINL + T    N+          +        +           
Sbjct  408  TYAHCTRGRAGITLLLINLSNETNFIVNIENVLDTDLGAQARNAGKESNFKRGLKRTVSW  467

Query  391  SPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITV  212
              R      + REEYHLT K GD+ S+TM+ NG  L +   G+IPE++P  ++   P+ +
Sbjct  468  VGRKALDEAIYREEYHLTPKDGDVKSKTMVHNGAPLEITKDGNIPELEPSRVDRKAPLRI  527

Query  211  APFSIVFAHIPYVFLPAC  158
            +P SI F  +P+    AC
Sbjct  528  SPLSIKFVVLPFFDAQAC  545



>ref|XP_009761177.1| PREDICTED: heparanase-like protein 2 [Nicotiana sylvestris]
 ref|XP_009761178.1| PREDICTED: heparanase-like protein 2 [Nicotiana sylvestris]
Length=541

 Score =   176 bits (447),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 91/199 (46%), Positives = 115/199 (58%), Gaps = 0/199 (0%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            ++A + TK YCRQTLIGGNYGLL+T+TFVPNPDYYSALLWHRLMG+  L  S   +  +R
Sbjct  343  IAAKHHTKVYCRQTLIGGNYGLLDTSTFVPNPDYYSALLWHRLMGKEVLHISSKASPYLR  402

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
            +YAHC K   G+TLLLINL +      N+  +          ++       H        
Sbjct  403  SYAHCTKDRAGVTLLLINLSNQIQYGVNIQSSAYTSLQVGKKKNHKKSSFVHGLKETVSW  462

Query  391  SPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITV  212
                    T+ REEYHLT +GG+L S+TMLLNG  L +  +G IP + P   N   PI+V
Sbjct  463  VGSKSSDVTLYREEYHLTPEGGNLQSRTMLLNGKPLQLTETGDIPSLSPVLENIKSPISV  522

Query  211  APFSIVFAHIPYVFLPACR  155
            AP SI F   P    P+CR
Sbjct  523  APLSIKFIVFPNFNSPSCR  541



>ref|XP_010678425.1| PREDICTED: heparanase-like protein 2 [Beta vulgaris subsp. vulgaris]
 ref|XP_010678426.1| PREDICTED: heparanase-like protein 2 [Beta vulgaris subsp. vulgaris]
Length=544

 Score =   176 bits (447),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 94/201 (47%), Positives = 118/201 (59%), Gaps = 4/201 (2%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            ++A+Y+TK YCRQ LIGGNYGLLN  TFVPNPDYYSALLW+RLMG+  L      +  +R
Sbjct  345  LAATYNTKVYCRQALIGGNYGLLNKNTFVPNPDYYSALLWNRLMGKKVLPVDNVASPYLR  404

Query  571  AYAHCAKQSGGITLLLINLDSNTT--VEANVAYNGSFVhhrkhirhinhhhhhhhshshg  398
            +YAHCAK   GITLLLINL  NT+  V+     N         I   +            
Sbjct  405  SYAHCAKGRAGITLLLINLSKNTSFIVKLQNTMNKDLHISNDMIFKEDSLTRGLKKTVSW  464

Query  397  kGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPI  218
             GS  S   G + REEYHLT K G L SQTM+LNG  L +   G IP ++P ++  + P+
Sbjct  465  VGSRASD--GQLHREEYHLTPKEGHLQSQTMVLNGKPLQISEHGDIPVLEPAFVAVNSPL  522

Query  217  TVAPFSIVFAHIPYVFLPACR  155
             ++P SI F   PY   PAC+
Sbjct  523  YISPLSISFVVFPYFDAPACK  543



>ref|XP_008239880.1| PREDICTED: heparanase-like protein 1 [Prunus mume]
 ref|XP_008239881.1| PREDICTED: heparanase-like protein 1 [Prunus mume]
Length=547

 Score =   176 bits (447),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 85/192 (44%), Positives = 118/192 (61%), Gaps = 0/192 (0%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            MSA Y+T+ YCRQ+L+GGNYGLLN T+FVPNPDYYSALLWHRLMG+  L+ + + +  +R
Sbjct  348  MSAKYNTRVYCRQSLVGGNYGLLNRTSFVPNPDYYSALLWHRLMGQGVLAVNSNASADLR  407

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
             YAHCA+   GIT++LIN  ++T    NV     F             +           
Sbjct  408  TYAHCARGRAGITVVLINFSNDTDFIVNVENILDFNLGAHERNISKESYFKRSLKKTVSW  467

Query  391  SPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITV  212
              R      + REEYHLT K G+L S+TM+LNG  L +   G+IPE++P ++ ++ P+T+
Sbjct  468  VGRKALDKPVYREEYHLTPKKGNLRSKTMVLNGAPLEITKDGNIPELEPAHVLANSPLTI  527

Query  211  APFSIVFAHIPY  176
            +P SI F  +PY
Sbjct  528  SPLSIKFVVLPY  539



>gb|ACV84153.1| heparanase [Oryza sativa Indica Group]
Length=542

 Score =   176 bits (446),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 98/199 (49%), Positives = 118/199 (59%), Gaps = 2/199 (1%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG-TKKI  575
            M++ Y+TK +CRQTLIGG+YGLL+T TF+PNPDYYSALLWHRLMGR  LS   +   +K+
Sbjct  344  MASKYNTKVFCRQTLIGGHYGLLDTQTFLPNPDYYSALLWHRLMGREVLSVDINAPPRKL  403

Query  574  RAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgk  395
            RAYAHC KQ  GITLLLINL+ NTT       N   V   K      H+   H       
Sbjct  404  RAYAHCRKQQQGITLLLINLN-NTTGYNVTLQNDINVSLDKTASLHKHNSFSHSLRRAVS  462

Query  394  GSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPIT  215
               R        REEYHLTAK GDL S+TMLLNG  L +   G +P M P  +  + P+ 
Sbjct  463  WLGRKPSSDVARREEYHLTAKDGDLQSKTMLLNGAPLELSDDGGVPAMSPALVAVNSPVY  522

Query  214  VAPFSIVFAHIPYVFLPAC  158
            +AP SI F  +P     AC
Sbjct  523  LAPTSIAFVVLPMFEAKAC  541



>ref|XP_006354764.1| PREDICTED: heparanase-like protein 2-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006354765.1| PREDICTED: heparanase-like protein 2-like isoform X2 [Solanum 
tuberosum]
 ref|XP_006354766.1| PREDICTED: heparanase-like protein 2-like isoform X3 [Solanum 
tuberosum]
Length=538

 Score =   176 bits (445),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 92/198 (46%), Positives = 119/198 (60%), Gaps = 1/198 (1%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            M+A Y TK YCRQT IGGNYGLL+T+TFVPNPDYYSALLWHRLMG+  L+ S + +  +R
Sbjct  341  MAAIYHTKVYCRQTFIGGNYGLLDTSTFVPNPDYYSALLWHRLMGKGVLAVSNNASSYLR  400

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
            +YAHC +   G+TLLLINL + T    N+  + S   H K   +           +    
Sbjct  401  SYAHCTRHRAGVTLLLINLSNQTHYGVNIESSVSITSHVKEKSNHKSSFVQRLKKTISWV  460

Query  391  SPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITV  212
              +S    T++REEYHLT   G+L S+TMLLNG  L +  +G IP + P  +N   PI+V
Sbjct  461  GRKSSDV-TLSREEYHLTPLDGNLQSRTMLLNGKPLQLTENGHIPSLSPVLVNLKSPISV  519

Query  211  APFSIVFAHIPYVFLPAC  158
            +P SI F   P    P C
Sbjct  520  SPLSIKFIVFPNFSSPVC  537



>ref|XP_010936395.1| PREDICTED: heparanase-like protein 2 [Elaeis guineensis]
Length=527

 Score =   175 bits (443),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 89/198 (45%), Positives = 122/198 (62%), Gaps = 19/198 (10%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            M  +++ K +CRQ LIGGNY LLNTTTF+PNPDYYSALLWHRLMG   L T+ +G+  +R
Sbjct  346  MVTTFNHKVFCRQALIGGNYALLNTTTFIPNPDYYSALLWHRLMGPGVLHTTHNGSPYLR  405

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
            AYAHC+KQ  G+TLLLINL ++T+ + +V  + +    +      +              
Sbjct  406  AYAHCSKQKNGVTLLLINLSNSTSFDVSVVSDLNLYPPKIGRSLASV-------------  452

Query  391  SPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITV  212
                Q++G   REEYHLT +GG++ S+ MLLNG  L++  SG IPEM P   +++ P+ +
Sbjct  453  ----QEKG--QREEYHLTPQGGNIQSRVMLLNGQPLNLTCSGDIPEMYPFIADAAAPLHI  506

Query  211  APFSIVFAHIPYVFLPAC  158
            AP SI F        PAC
Sbjct  507  APQSIAFVSFQDFKSPAC  524



>ref|XP_004298393.1| PREDICTED: heparanase-like protein 2 [Fragaria vesca subsp. vesca]
Length=525

 Score =   175 bits (443),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 89/198 (45%), Positives = 120/198 (61%), Gaps = 17/198 (9%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            M+ASY  K +CRQ LIGGNY LLNTT+F+PNPDYY ALLWHRLMG + LST   G+  +R
Sbjct  342  MTASYSHKVFCRQALIGGNYALLNTTSFIPNPDYYGALLWHRLMGNSVLSTVHYGSPFLR  401

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
            AY+HC+K+  GITLLLIN+ ++TT + +V                     + H     + 
Sbjct  402  AYSHCSKKKPGITLLLINMSNSTTFDVDV-----------------LPEFNLHPWQRYEE  444

Query  391  SPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITV  212
               ++  G   REEYHLT +GG++ S  +LLNG  L +  S  IPEM+P+ ++ +  ++V
Sbjct  445  QSDTKSTGASMREEYHLTPEGGNIQSDVLLLNGTPLKLTESFDIPEMQPKLVDPTSAVSV  504

Query  211  APFSIVFAHIPYVFLPAC  158
            AP S VF  I     PAC
Sbjct  505  APDSFVFVSIKDFHAPAC  522



>gb|EYU28837.1| hypothetical protein MIMGU_mgv1a026758mg, partial [Erythranthe 
guttata]
Length=503

 Score =   174 bits (442),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 87/198 (44%), Positives = 123/198 (62%), Gaps = 18/198 (9%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            M+++++ K +CRQ LIGGNY LLNTTTF+PNPDYY ALLWHRLMG+N LS +  G+  +R
Sbjct  323  MTSTFNHKVFCRQALIGGNYALLNTTTFIPNPDYYGALLWHRLMGKNVLSATHDGSPYLR  382

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
            AY+HC+K++ GI++LLIN+ ++TT E +V  + +                     +    
Sbjct  383  AYSHCSKKTAGISVLLINMSNSTTFEVSVVEDMNLY------------------PNEETK  424

Query  391  SPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITV  212
            S       +  REEYHLT K G++ S  +LLNG  L +  S  IP M P+ ++++ PIT+
Sbjct  425  SLEDISGDSNQREEYHLTPKDGNILSDVLLLNGTPLKLTESLEIPSMNPQLVDATLPITI  484

Query  211  APFSIVFAHIPYVFLPAC  158
            AP SIVFA +     PAC
Sbjct  485  APDSIVFATLRGFKAPAC  502



>ref|XP_006664141.1| PREDICTED: heparanase-like protein 1-like isoform X1 [Oryza brachyantha]
 ref|XP_006664142.1| PREDICTED: heparanase-like protein 1-like isoform X2 [Oryza brachyantha]
Length=539

 Score =   175 bits (443),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 92/198 (46%), Positives = 116/198 (59%), Gaps = 1/198 (1%)
 Frame = -1

Query  748  SASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIRA  569
            SA YDTK YCRQTLIGGNYGLL+T TFVPNPDYYSALLWHRLMG   +S   SG+  +RA
Sbjct  342  SAKYDTKVYCRQTLIGGNYGLLDTQTFVPNPDYYSALLWHRLMGNGVISLDTSGSSYLRA  401

Query  568  YAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkGS  389
            YAHC KQ GG+ LL++NL+ N     +V  N   ++ R+           H         
Sbjct  402  YAHCGKQKGGVALLMLNLNKNMGFMVSVR-NDLNINAREMAGIRRESSFVHGLKRTVSWV  460

Query  388  PRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITVA  209
                  G   REEYHLT +GG+ +++T+LLNG  L +  +G IP + P  ++ + PI VA
Sbjct  461  GSKASDGLEKREEYHLTPQGGNPYARTVLLNGGPLQLTENGDIPSLPPVLVSVNSPIYVA  520

Query  208  PFSIVFAHIPYVFLPACR  155
            P SI F   P      C 
Sbjct  521  PLSITFVVFPDFEAEGCE  538



>ref|XP_004299326.1| PREDICTED: heparanase-like protein 1 [Fragaria vesca subsp. vesca]
Length=540

 Score =   174 bits (442),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 88/198 (44%), Positives = 117/198 (59%), Gaps = 0/198 (0%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            MSA Y++  YCRQ+L+GG+YGLLN T+FVPNPDYYSALLWHRLMG + L    +G   +R
Sbjct  342  MSAMYNSAVYCRQSLVGGHYGLLNRTSFVPNPDYYSALLWHRLMGESVLKVDRNGAPHLR  401

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
             YAHC+K S GIT+LLINL + T    NV          +           H        
Sbjct  402  VYAHCSKGSAGITVLLINLSNQTDFIVNVKNVLELDRADRSRSTGKGSKFSHGLKRTVSW  461

Query  391  SPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITV  212
                   GT+ R+EYHLT K G+L S+ M+LNG  L +   G+IPE++P  +  ++PI++
Sbjct  462  VGLKASDGTLHRKEYHLTPKDGNLRSKIMVLNGVPLEITKDGNIPELEPVIVPVNDPISI  521

Query  211  APFSIVFAHIPYVFLPAC  158
              FSI F  +P+   PAC
Sbjct  522  TSFSIKFVVLPHFEAPAC  539



>gb|KJB50982.1| hypothetical protein B456_008G196400 [Gossypium raimondii]
Length=539

 Score =   174 bits (441),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 93/199 (47%), Positives = 117/199 (59%), Gaps = 1/199 (1%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            M++ Y TK YCRQTLIGGNYGLLN TTFVPNPDYYS LLWHRLMG+  L+     +  +R
Sbjct  342  MASKYHTKVYCRQTLIGGNYGLLNATTFVPNPDYYSGLLWHRLMGKVVLNVESHASPFLR  401

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
            +YAHC+K   G+TLL+INL + T    N A N   +      ++I+     H+       
Sbjct  402  SYAHCSKGRAGVTLLVINLSNQTNFIMN-AQNSINLKLAAIEQNISRDSFTHNLKKTFSW  460

Query  391  SPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITV  212
                     + REEYHLT K G L SQTM+LNG  L +  +G IP + P  +N   PIT+
Sbjct  461  VGTKASDDALLREEYHLTPKDGYLRSQTMVLNGIPLELTRTGDIPSLNPVRVNVKSPITI  520

Query  211  APFSIVFAHIPYVFLPACR  155
            +P SI F   P    PACR
Sbjct  521  SPLSIAFIVFPNFEAPACR  539



>ref|XP_009595357.1| PREDICTED: heparanase-like protein 2 isoform X2 [Nicotiana tomentosiformis]
Length=539

 Score =   174 bits (440),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 90/199 (45%), Positives = 119/199 (60%), Gaps = 1/199 (1%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            M+A Y TK YCRQT +GGNYGLL+T+TF+PNPDYYSALLWHRLMG+  L+ S + +  +R
Sbjct  342  MAAKYLTKVYCRQTFVGGNYGLLDTSTFIPNPDYYSALLWHRLMGKGVLAVSRNSSSYLR  401

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
            +YAHC +   G+TLLLINL + T    ++  + +   H     +      H    +    
Sbjct  402  SYAHCTRDRAGVTLLLINLSNQTQYGVSIESSATTTSHANEKSNHKKSFIHGLKKTFSWV  461

Query  391  SPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITV  212
              +S    T++REEYHLT   G+LHS+ MLLNG  L +   G IP + P  +N   PI+V
Sbjct  462  GSKSSDV-TLSREEYHLTPLDGNLHSKIMLLNGLPLQLTEDGDIPSLSPVIVNIKSPISV  520

Query  211  APFSIVFAHIPYVFLPACR  155
            AP SI F   P    P CR
Sbjct  521  APLSIKFLVFPNYNSPGCR  539



>ref|XP_008221534.1| PREDICTED: heparanase-like protein 2 [Prunus mume]
Length=526

 Score =   174 bits (440),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 93/203 (46%), Positives = 122/203 (60%), Gaps = 29/203 (14%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            M+++Y+ K YCRQ LIGGNY LLNTTTF+PNPDYY ALLWHRLMG   LST+  G+  +R
Sbjct  347  MTSTYNHKVYCRQALIGGNYALLNTTTFIPNPDYYGALLWHRLMGNRVLSTTHLGSPYLR  406

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANV--AYNGSFVhhrkhirhinhhhhhhhshshg  398
            AY+HC+K   GITL+LIN+ + TT +  V   YN                          
Sbjct  407  AYSHCSKNQKGITLVLINMSNTTTFDVAVHPDYN------------------------LY  442

Query  397  kGSPRSQKRGTMT---REEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSS  227
             G  R +K G +    REEYHLT +GG++ S  +LLNGN L + +S  IP+M+P+ ++ +
Sbjct  443  LGPIRVRKHGRIVGREREEYHLTPEGGNIQSDVLLLNGNPLKLTNSSDIPKMEPKLVDPT  502

Query  226  EPITVAPFSIVFAHIPYVFLPAC  158
              I+VA  SIVF  I     PAC
Sbjct  503  SAISVAADSIVFVSIKDFHAPAC  525



>ref|XP_009595353.1| PREDICTED: heparanase-like protein 2 isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009595354.1| PREDICTED: heparanase-like protein 2 isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009595355.1| PREDICTED: heparanase-like protein 2 isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009595356.1| PREDICTED: heparanase-like protein 2 isoform X1 [Nicotiana tomentosiformis]
Length=556

 Score =   174 bits (441),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 90/199 (45%), Positives = 119/199 (60%), Gaps = 1/199 (1%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            M+A Y TK YCRQT +GGNYGLL+T+TF+PNPDYYSALLWHRLMG+  L+ S + +  +R
Sbjct  359  MAAKYLTKVYCRQTFVGGNYGLLDTSTFIPNPDYYSALLWHRLMGKGVLAVSRNSSSYLR  418

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
            +YAHC +   G+TLLLINL + T    ++  + +   H     +      H    +    
Sbjct  419  SYAHCTRDRAGVTLLLINLSNQTQYGVSIESSATTTSHANEKSNHKKSFIHGLKKTFSWV  478

Query  391  SPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITV  212
              +S    T++REEYHLT   G+LHS+ MLLNG  L +   G IP + P  +N   PI+V
Sbjct  479  GSKSSDV-TLSREEYHLTPLDGNLHSKIMLLNGLPLQLTEDGDIPSLSPVIVNIKSPISV  537

Query  211  APFSIVFAHIPYVFLPACR  155
            AP SI F   P    P CR
Sbjct  538  APLSIKFLVFPNYNSPGCR  556



>ref|XP_006574931.1| PREDICTED: heparanase-like protein 2-like isoform X2 [Glycine 
max]
Length=337

 Score =   169 bits (429),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 87/198 (44%), Positives = 116/198 (59%), Gaps = 26/198 (13%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            M+++++ K YCRQ L+GGNYGLL+TTTF+PNPDYY ALLWHRLMG   LS S  G+  +R
Sbjct  165  MTSTFNHKVYCRQALVGGNYGLLDTTTFIPNPDYYGALLWHRLMGSKVLSVSHEGSPYLR  224

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
            AY HC+K   GI +LLIN+ ++TT E ++  + +                          
Sbjct  225  AYVHCSKTESGIAVLLINMSNSTTFEVSLLNDMNLY------------------------  260

Query  391  SPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITV  212
             P    + T  REEYHLT K G++ S+ +LLNG  L +  S  IPEMKP+ ++ S P+ V
Sbjct  261  -PEVVFKNTQ-REEYHLTPKDGNIQSKVVLLNGTPLVLTQSLHIPEMKPKLVDPSSPVKV  318

Query  211  APFSIVFAHIPYVFLPAC  158
               SIVF H      PAC
Sbjct  319  KHDSIVFVHSKSFNAPAC  336



>ref|XP_002514696.1| Heparanase-2, putative [Ricinus communis]
 gb|EEF47802.1| Heparanase-2, putative [Ricinus communis]
Length=539

 Score =   174 bits (440),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 92/198 (46%), Positives = 118/198 (60%), Gaps = 1/198 (1%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            +++ Y+TK YCRQTLIGGNYGLLNTTT VPNPDYYSALLWHRLMG+  L+     +  +R
Sbjct  342  LASKYNTKAYCRQTLIGGNYGLLNTTTLVPNPDYYSALLWHRLMGKGVLAVGSDASPYLR  401

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
            AYAHC++   G+TLLLINL + T    +V  + +   H K               S    
Sbjct  402  AYAHCSRGRAGVTLLLINLSNQTDFIISVQNSMAMKLHVKENIQRESRIVRGLKRSVSWV  461

Query  391  SPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITV  212
              R+    ++TREEYHLT+K G L SQTM+LNG  L +   G IP + P + N   PI +
Sbjct  462  GNRASDE-SLTREEYHLTSKDGYLRSQTMVLNGIPLELTEDGEIPRLDPVHNNVKSPIYI  520

Query  211  APFSIVFAHIPYVFLPAC  158
            +P SI F   P    P+C
Sbjct  521  SPLSIAFIVFPNFDAPSC  538



>ref|XP_007209868.1| hypothetical protein PRUPE_ppa003813mg [Prunus persica]
 gb|EMJ11067.1| hypothetical protein PRUPE_ppa003813mg [Prunus persica]
Length=547

 Score =   174 bits (440),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 85/192 (44%), Positives = 117/192 (61%), Gaps = 0/192 (0%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            MSA Y+T+ YCRQ+L+GGNYGLLN T+FVPNPDYYSALLWHRLMG+  L+ + + +  +R
Sbjct  348  MSAKYNTRVYCRQSLVGGNYGLLNRTSFVPNPDYYSALLWHRLMGQGVLAVNSNASADLR  407

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
             YAHCA+   GIT++LINL ++T    NV     F             +           
Sbjct  408  IYAHCARGRAGITVVLINLSNDTDFIVNVENILDFNLGAHERNISKESYFKRSLKKTVSW  467

Query  391  SPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITV  212
              R      + REEYHLT K  +L S+TM+LNG  L +   G+IPE++P  + ++ P+T+
Sbjct  468  VGRKALDKPVYREEYHLTPKNRNLRSKTMVLNGAPLEITKDGNIPELEPARVFANSPLTI  527

Query  211  APFSIVFAHIPY  176
            +P SI F  +PY
Sbjct  528  SPLSIKFVVLPY  539



>ref|XP_011072824.1| PREDICTED: heparanase-like protein 1 isoform X1 [Sesamum indicum]
Length=540

 Score =   174 bits (440),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 89/199 (45%), Positives = 113/199 (57%), Gaps = 0/199 (0%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            M+A+YDTK YCRQTLIGG YGLLN TTFVPNPDYYSALLWH+LMG+  L+        IR
Sbjct  342  MAATYDTKVYCRQTLIGGFYGLLNKTTFVPNPDYYSALLWHQLMGKGVLAVESHSPPYIR  401

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
            +YAHC K+  GITLLLINL + T     V          K       +   H        
Sbjct  402  SYAHCTKERAGITLLLINLSNRTAYNVEVESRNIAELSMKDRTGTKRNSFVHGLKRSLSW  461

Query  391  SPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITV  212
                     ++REEYHLT + GDL S+ MLLNG  L +  +G IP + P   + + P+++
Sbjct  462  IGNKASDEKLSREEYHLTPENGDLQSKIMLLNGKRLQLTETGDIPSLVPVLQDVNSPLSI  521

Query  211  APFSIVFAHIPYVFLPACR  155
            +P+SI F   P    P C+
Sbjct  522  SPYSIKFVVFPNFSTPGCK  540



>ref|XP_011072825.1| PREDICTED: heparanase-like protein 1 isoform X2 [Sesamum indicum]
 ref|XP_011072826.1| PREDICTED: heparanase-like protein 1 isoform X2 [Sesamum indicum]
Length=540

 Score =   174 bits (440),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 89/199 (45%), Positives = 113/199 (57%), Gaps = 0/199 (0%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            M+A+YDTK YCRQTLIGG YGLLN TTFVPNPDYYSALLWH+LMG+  L+        IR
Sbjct  342  MAATYDTKVYCRQTLIGGFYGLLNKTTFVPNPDYYSALLWHQLMGKGVLAVESHSPPYIR  401

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
            +YAHC K+  GITLLLINL + T     V          K       +   H        
Sbjct  402  SYAHCTKERAGITLLLINLSNRTAYNVEVESRNIAELSMKDRTGTKRNSFVHGLKRSLSW  461

Query  391  SPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITV  212
                     ++REEYHLT + GDL S+ MLLNG  L +  +G IP + P   + + P+++
Sbjct  462  IGNKASDEKLSREEYHLTPENGDLQSKIMLLNGKRLQLTETGDIPSLVPVLQDVNSPLSI  521

Query  211  APFSIVFAHIPYVFLPACR  155
            +P+SI F   P    P C+
Sbjct  522  SPYSIKFVVFPNFSTPGCK  540



>ref|XP_002512114.1| Heparanase precursor, putative [Ricinus communis]
 gb|EEF50783.1| Heparanase precursor, putative [Ricinus communis]
Length=596

 Score =   174 bits (441),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 88/197 (45%), Positives = 117/197 (59%), Gaps = 20/197 (10%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            M+++Y+ K YCRQ  IGGNYGLLNTT+F+PNPDYY ALLWHRLMG+  L+TS + +  +R
Sbjct  353  MTSTYNHKVYCRQAFIGGNYGLLNTTSFIPNPDYYGALLWHRLMGKQVLATSHNASPYLR  412

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
            AY+HC+K+  GITLLLIN+ + T+   +V  + +F                         
Sbjct  413  AYSHCSKKKPGITLLLINMSNQTSYSVSVIDDDNFFASNSAN------------------  454

Query  391  SPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITV  212
              +    G   REEYHLT K G++ S  +LLNG  L +  S  IP MKP+ ++ S PITV
Sbjct  455  --QYSSAGNEQREEYHLTPKDGNIQSDVLLLNGTPLQLTDSLDIPAMKPQLVDPSSPITV  512

Query  211  APFSIVFAHIPYVFLPA  161
            AP S V+  I     PA
Sbjct  513  APDSFVYVTIKDFKAPA  529



>ref|XP_006374168.1| hypothetical protein POPTR_0015s03440g [Populus trichocarpa]
 gb|ERP51965.1| hypothetical protein POPTR_0015s03440g [Populus trichocarpa]
Length=362

 Score =   170 bits (430),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 94/212 (44%), Positives = 121/212 (57%), Gaps = 29/212 (14%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            M++ Y+TK YCRQTL+GG+YGLLNTTT VPNPDYYSALLWHRLMG+  L+   + +  +R
Sbjct  165  MASRYNTKVYCRQTLVGGHYGLLNTTTLVPNPDYYSALLWHRLMGKGVLAVGSNASPFLR  224

Query  571  AYAHCAKQSGGITLLLINLDSNT--------------TVEANVAYNGSFVhhrkhirhin  434
            +YAHC+K   GITLLLINL + T              TVE N++   SFV          
Sbjct  225  SYAHCSKGRAGITLLLINLSNQTDFIISVQNSMDMRLTVEENISGENSFV----------  274

Query  433  hhhhhhhshshgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPE  254
                     S      R+     + REEYHLTAK G+L S+TM+LNG  L +    +IP 
Sbjct  275  ----RGLKRSVSWVGSRASDE-PLYREEYHLTAKDGNLQSRTMVLNGIPLELTEDENIPS  329

Query  253  MKPRYLNSSEPITVAPFSIVFAHIPYVFLPAC  158
            + P  L+ + P+ + P SI F   P    PAC
Sbjct  330  LDPVRLDVNSPLYINPLSISFIVFPNFDAPAC  361



>ref|XP_006649618.1| PREDICTED: heparanase-like protein 2-like [Oryza brachyantha]
Length=542

 Score =   173 bits (439),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 92/198 (46%), Positives = 113/198 (57%), Gaps = 0/198 (0%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            M++ Y+TK +CRQTLIGG+YGLL+T TF+PNPDYYSALLWHRLMG   LS   + ++K+R
Sbjct  344  MASKYNTKVFCRQTLIGGHYGLLDTQTFLPNPDYYSALLWHRLMGSGVLSVDINASRKLR  403

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
            AYAHC KQ  GITLLLINL + T     +  + +    R       H    H        
Sbjct  404  AYAHCRKQQQGITLLLINLSNTTGYNVTLQNDINVSLDRTANLQRRHASFSHGLRRAVSW  463

Query  391  SPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITV  212
              R        REEYHLTAK GDL S+TMLLNG  L +   G +P M P       P+ +
Sbjct  464  LGRMPSSDVARREEYHLTAKDGDLQSRTMLLNGAPLELLDDGGVPAMNPVRAAVDSPVYL  523

Query  211  APFSIVFAHIPYVFLPAC  158
            AP SI F  +P      C
Sbjct  524  APTSIAFVVLPMFEAKTC  541



>gb|KDO83095.1| hypothetical protein CISIN_1g041499mg, partial [Citrus sinensis]
Length=512

 Score =   172 bits (437),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 85/198 (43%), Positives = 123/198 (62%), Gaps = 21/198 (11%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            M+++++ K +CRQ LIGGNY LLNTTTF+PNPDYY +LLWHRLMG+N L+T+ + +  +R
Sbjct  335  MTSTFNHKVFCRQALIGGNYALLNTTTFIPNPDYYGSLLWHRLMGKNVLATTQNASPYLR  394

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
             Y+HC+K+  GIT+LLINL ++T+ + +V  + +    ++                    
Sbjct  395  VYSHCSKEKPGITVLLINLSNSTSFDVSVINDMNLYPSQEQT------------------  436

Query  391  SPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITV  212
                  +G   REEYHLT +GG++ S  +LLNG  L + +S  IP M+P+  +   PITV
Sbjct  437  ---QDSQGEKPREEYHLTPEGGNIQSDVVLLNGTPLKLTNSLDIPSMEPKLADRYSPITV  493

Query  211  APFSIVFAHIPYVFLPAC  158
            AP SIVFA +     PAC
Sbjct  494  APHSIVFATLRDFKAPAC  511



>ref|XP_006345162.1| PREDICTED: heparanase-like protein 1-like [Solanum tuberosum]
Length=540

 Score =   173 bits (438),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 88/199 (44%), Positives = 113/199 (57%), Gaps = 0/199 (0%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            M+A + TK YCRQTLIGGNYGLL+T TFVPNPDYYSALLW+RLMG+  L    S    +R
Sbjct  342  MAAKHHTKVYCRQTLIGGNYGLLDTDTFVPNPDYYSALLWNRLMGKVVLGVFNSAAPHLR  401

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
             YAHC K   G+TLLLINL +    + N+             +        H        
Sbjct  402  TYAHCTKDRAGVTLLLINLSTQIQYKVNIHSTAETSLQVGEKKVHKKKSFAHSIKESVSW  461

Query  391  SPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITV  212
                    T++REEYHLT +GG++ S+TMLLNG  L +  +G IP + P + N + PI++
Sbjct  462  VGTKSSDVTLSREEYHLTPEGGNIKSRTMLLNGKLLRLTETGDIPSLSPVFTNLNSPISI  521

Query  211  APFSIVFAHIPYVFLPACR  155
             P SI F   P    P+CR
Sbjct  522  EPLSIKFIVFPNFNSPSCR  540



>ref|XP_009801842.1| PREDICTED: heparanase-like protein 1 isoform X2 [Nicotiana sylvestris]
Length=506

 Score =   172 bits (437),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 95/201 (47%), Positives = 120/201 (60%), Gaps = 5/201 (2%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            M+A Y TK YCRQT IGGNYGLL+T+TF+PNPDYYSALLWHRLMG+   + S + +  +R
Sbjct  309  MAAKYHTKVYCRQTFIGGNYGLLDTSTFIPNPDYYSALLWHRLMGKGVFAVSSNSSSYLR  368

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
            +YAHC +   G+TLLLINL + T    ++    S VH   H    ++H            
Sbjct  369  SYAHCTRNRAGVTLLLINLSNQTQYRVSIE---SSVHTSSHANEKSNHKKSFIHGLKKTF  425

Query  391  SPRSQKRG--TMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPI  218
            S    K    T++REEYHLT   G+LHS+TMLLNG  L +   G IP + P  +N   PI
Sbjct  426  SWVGSKSSDVTLSREEYHLTPLNGNLHSKTMLLNGLPLQLTEIGDIPSLSPVLVNIVSPI  485

Query  217  TVAPFSIVFAHIPYVFLPACR  155
            +VAP SI F   P    P CR
Sbjct  486  SVAPLSIKFIVFPNYNSPGCR  506



>ref|XP_007209866.1| hypothetical protein PRUPE_ppa003804mg [Prunus persica]
 gb|EMJ11065.1| hypothetical protein PRUPE_ppa003804mg [Prunus persica]
Length=547

 Score =   173 bits (438),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 84/192 (44%), Positives = 117/192 (61%), Gaps = 0/192 (0%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            MSA Y+T+ YCRQ+L+GGNYGLLN T+FVPNPDYYSALLWHRLMG+  L+ + + +  +R
Sbjct  348  MSAKYNTRVYCRQSLVGGNYGLLNRTSFVPNPDYYSALLWHRLMGQGVLAVNSNASADLR  407

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
             YAHCA+   G+T++LINL ++T    NV     F             +           
Sbjct  408  TYAHCARGRAGVTVVLINLSNDTDFIVNVENILDFNLGAHERNISKESYFKRSLKKTVSW  467

Query  391  SPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITV  212
              R      + REEYHLT K  +L S+TM+LNG  L +   G+IPE++P  + ++ P+T+
Sbjct  468  VGRKALDKPVYREEYHLTPKNRNLRSKTMVLNGAPLEITKDGNIPELEPARVLANSPLTI  527

Query  211  APFSIVFAHIPY  176
            +P SI F  +PY
Sbjct  528  SPLSIKFVVLPY  539



>ref|XP_009801838.1| PREDICTED: heparanase-like protein 2 isoform X1 [Nicotiana sylvestris]
 ref|XP_009801839.1| PREDICTED: heparanase-like protein 2 isoform X1 [Nicotiana sylvestris]
 ref|XP_009801840.1| PREDICTED: heparanase-like protein 2 isoform X1 [Nicotiana sylvestris]
 ref|XP_009801841.1| PREDICTED: heparanase-like protein 2 isoform X1 [Nicotiana sylvestris]
Length=539

 Score =   173 bits (438),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 95/201 (47%), Positives = 120/201 (60%), Gaps = 5/201 (2%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            M+A Y TK YCRQT IGGNYGLL+T+TF+PNPDYYSALLWHRLMG+   + S + +  +R
Sbjct  342  MAAKYHTKVYCRQTFIGGNYGLLDTSTFIPNPDYYSALLWHRLMGKGVFAVSSNSSSYLR  401

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
            +YAHC +   G+TLLLINL + T    ++    S VH   H    ++H            
Sbjct  402  SYAHCTRNRAGVTLLLINLSNQTQYRVSIE---SSVHTSSHANEKSNHKKSFIHGLKKTF  458

Query  391  SPRSQKRG--TMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPI  218
            S    K    T++REEYHLT   G+LHS+TMLLNG  L +   G IP + P  +N   PI
Sbjct  459  SWVGSKSSDVTLSREEYHLTPLNGNLHSKTMLLNGLPLQLTEIGDIPSLSPVLVNIVSPI  518

Query  217  TVAPFSIVFAHIPYVFLPACR  155
            +VAP SI F   P    P CR
Sbjct  519  SVAPLSIKFIVFPNYNSPGCR  539



>ref|XP_007226518.1| hypothetical protein PRUPE_ppa025624mg, partial [Prunus persica]
 gb|EMJ27717.1| hypothetical protein PRUPE_ppa025624mg, partial [Prunus persica]
Length=501

 Score =   172 bits (436),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 90/201 (45%), Positives = 120/201 (60%), Gaps = 25/201 (12%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            M+++Y  K YCRQ LIGGNY LLNTTTF+PNPDYY ALLWHRLMG   LST+  G+  +R
Sbjct  322  MTSTYSHKVYCRQALIGGNYALLNTTTFIPNPDYYGALLWHRLMGNRVLSTTHLGSPYLR  381

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
            AY+HC+K   GITL+LIN+ + TT +  V  + +                          
Sbjct  382  AYSHCSKNQKGITLVLINMSNTTTFDVAVLPDYNLYLGPI--------------------  421

Query  391  SPRSQKRGTMT---REEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEP  221
              R +K G +    REEYHLT +GG++ S  +LLNGN L + +S  IP+M+P+ ++ +  
Sbjct  422  --RMRKHGHIVGREREEYHLTPEGGNIQSDVVLLNGNPLKLTNSSDIPKMEPKLVDPTSA  479

Query  220  ITVAPFSIVFAHIPYVFLPAC  158
            I+VA  SIVF  I     PAC
Sbjct  480  ISVAADSIVFVSIKDFHAPAC  500



>ref|XP_006837042.1| hypothetical protein AMTR_s00110p00045590 [Amborella trichopoda]
 gb|ERM99895.1| hypothetical protein AMTR_s00110p00045590 [Amborella trichopoda]
Length=524

 Score =   172 bits (436),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 86/198 (43%), Positives = 116/198 (59%), Gaps = 16/198 (8%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            M++SY+ K YCRQ+L+GGNYGLL+TTTFVPNPD+YSALLWHRLMG+  L         +R
Sbjct  342  MTSSYNHKAYCRQSLVGGNYGLLDTTTFVPNPDFYSALLWHRLMGKRVLGVEVDNAPYLR  401

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
            AYAHCAK   G+ LL INL ++TT   ++  + +        +                 
Sbjct  402  AYAHCAKNKAGVMLLFINLSNSTTFNVSMENDMNIFTTSSSDKVAKDVV-----------  450

Query  391  SPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITV  212
                 + G+  REEYHLT K G++ S+ MLLNG+ L +  +G IP + P  ++S  PI +
Sbjct  451  ----SQTGS-KREEYHLTPKNGNIFSRVMLLNGSPLELTKAGEIPAISPLSIDSDSPILI  505

Query  211  APFSIVFAHIPYVFLPAC  158
            AP SI F  +P    PAC
Sbjct  506  APRSIAFVRLPDFKAPAC  523



>ref|XP_004985229.1| PREDICTED: heparanase-like protein 1-like isoform X1 [Setaria 
italica]
 ref|XP_004985230.1| PREDICTED: heparanase-like protein 1-like isoform X2 [Setaria 
italica]
Length=540

 Score =   172 bits (437),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 97/198 (49%), Positives = 118/198 (60%), Gaps = 3/198 (2%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            M++ Y+TK +CRQTLIGGNYGLL+T TF+PNPDYYSALLWHRLMG   LS      +++R
Sbjct  345  MASKYNTKVFCRQTLIGGNYGLLDTQTFLPNPDYYSALLWHRLMGNGVLSIDSIAPRRLR  404

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
            AYAHC +Q  GITLLLINL SNTT       N   +  R  +   +   H         G
Sbjct  405  AYAHCRRQQQGITLLLINL-SNTTGYNVTLQNDINIGKRPDLEKRSSFSHRLRKAVSWLG  463

Query  391  SPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITV  212
            S  S    T  REEYHLT K GD+ S+TMLLNG +L +   GS+P M P       P+ +
Sbjct  464  SKASSD--TKKREEYHLTPKDGDVQSKTMLLNGVQLELGDDGSVPAMNPVLAAVDSPVYL  521

Query  211  APFSIVFAHIPYVFLPAC  158
            AP SI F  +P     AC
Sbjct  522  APTSIAFIVLPEFEAKAC  539



>ref|XP_009395254.1| PREDICTED: heparanase-like protein 1, partial [Musa acuminata 
subsp. malaccensis]
Length=509

 Score =   172 bits (436),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 90/200 (45%), Positives = 118/200 (59%), Gaps = 26/200 (13%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            M+++Y+ K YCRQ+LIGGNY LL+TTTFVPNPD+Y ALLWH+LMG   L T+  G+  +R
Sbjct  331  MASTYNHKVYCRQSLIGGNYCLLDTTTFVPNPDFYGALLWHQLMGPGVLHTTNDGSPYLR  390

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
            AYAHC+K+  G+TLLLINL ++T  +  V  +                            
Sbjct  391  AYAHCSKKKSGVTLLLINLSNSTAFDVVVTSD------------------------LNLY  426

Query  391  SPRS--QKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPI  218
             PRS  ++     REEYHLTA+GGDL S  MLLNG  L +  S  IP M+P  +++  P+
Sbjct  427  QPRSGNEQGQHGEREEYHLTAQGGDLRSSEMLLNGKLLKLTPSFEIPHMEPSIVSAGAPL  486

Query  217  TVAPFSIVFAHIPYVFLPAC  158
            T+AP SI F        PAC
Sbjct  487  TIAPLSIAFVRFKDFQAPAC  506



>ref|XP_006477619.1| PREDICTED: heparanase-like protein 1-like isoform X1 [Citrus 
sinensis]
 ref|XP_006477620.1| PREDICTED: heparanase-like protein 1-like isoform X2 [Citrus 
sinensis]
 gb|KDO54578.1| hypothetical protein CISIN_1g008834mg [Citrus sinensis]
 gb|KDO54579.1| hypothetical protein CISIN_1g008834mg [Citrus sinensis]
 gb|KDO54580.1| hypothetical protein CISIN_1g008834mg [Citrus sinensis]
 gb|KDO54581.1| hypothetical protein CISIN_1g008834mg [Citrus sinensis]
Length=543

 Score =   172 bits (436),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 90/198 (45%), Positives = 115/198 (58%), Gaps = 0/198 (0%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            MS+ Y+TK YCRQTL+GGNYGLLN TTF+PNPDYYSALLWHRLMG+  LS +  G+  +R
Sbjct  344  MSSKYNTKVYCRQTLVGGNYGLLNATTFIPNPDYYSALLWHRLMGKGVLSVATDGSSSLR  403

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
            +YAHC+K+  GITLLLINL + T    +V  + +     K                    
Sbjct  404  SYAHCSKEREGITLLLINLSNQTDYVISVHNSMNMKLTVKGKDINGESSLSRDIKRAVSW  463

Query  391  SPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITV  212
               +   G +TREEYHLT K G L SQTM+LNG  L +     IP++ P  ++ + PI +
Sbjct  464  VGSTASDGHLTREEYHLTPKDGYLQSQTMVLNGIPLQLAEDEGIPKLDPVRVDVNSPIYI  523

Query  211  APFSIVFAHIPYVFLPAC  158
               SI F   P     AC
Sbjct  524  THLSIAFIVFPNFSARAC  541



>ref|XP_006440691.1| hypothetical protein CICLE_v10019304mg [Citrus clementina]
 gb|ESR53931.1| hypothetical protein CICLE_v10019304mg [Citrus clementina]
Length=543

 Score =   172 bits (436),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 90/198 (45%), Positives = 115/198 (58%), Gaps = 0/198 (0%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            MS+ Y+TK YCRQTL+GGNYGLLN TTF+PNPDYYSALLWHRLMG+  LS +  G+  +R
Sbjct  344  MSSKYNTKVYCRQTLVGGNYGLLNATTFIPNPDYYSALLWHRLMGKGVLSVATDGSSSLR  403

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
            +YAHC+K+  GITLLLINL + T    +V  + +     K                    
Sbjct  404  SYAHCSKEREGITLLLINLSNQTDYVISVHNSMNMKLTVKGKDINGESSLSRDIKRAVSW  463

Query  391  SPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITV  212
               +   G +TREEYHLT K G L SQTM+LNG  L +     IP++ P  ++ + PI +
Sbjct  464  VGSTASDGHLTREEYHLTPKDGYLQSQTMVLNGIPLQLAEDEGIPKLDPVRVDVNSPIYI  523

Query  211  APFSIVFAHIPYVFLPAC  158
               SI F   P     AC
Sbjct  524  THLSIAFIVFPNFSARAC  541



>gb|KDO54577.1| hypothetical protein CISIN_1g008834mg [Citrus sinensis]
Length=551

 Score =   172 bits (436),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 90/198 (45%), Positives = 115/198 (58%), Gaps = 0/198 (0%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            MS+ Y+TK YCRQTL+GGNYGLLN TTF+PNPDYYSALLWHRLMG+  LS +  G+  +R
Sbjct  352  MSSKYNTKVYCRQTLVGGNYGLLNATTFIPNPDYYSALLWHRLMGKGVLSVATDGSSSLR  411

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
            +YAHC+K+  GITLLLINL + T    +V  + +     K                    
Sbjct  412  SYAHCSKEREGITLLLINLSNQTDYVISVHNSMNMKLTVKGKDINGESSLSRDIKRAVSW  471

Query  391  SPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITV  212
               +   G +TREEYHLT K G L SQTM+LNG  L +     IP++ P  ++ + PI +
Sbjct  472  VGSTASDGHLTREEYHLTPKDGYLQSQTMVLNGIPLQLAEDEGIPKLDPVRVDVNSPIYI  531

Query  211  APFSIVFAHIPYVFLPAC  158
               SI F   P     AC
Sbjct  532  THLSIAFIVFPNFSARAC  549



>ref|XP_008672060.1| PREDICTED: uncharacterized protein LOC100192026 isoform X2 [Zea 
mays]
 gb|ACG27548.1| heparanase-like protein 2 precursor [Zea mays]
 gb|ACR37728.1| unknown [Zea mays]
 tpg|DAA55154.1| TPA: heparanase-like protein 2 [Zea mays]
Length=540

 Score =   172 bits (436),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 93/197 (47%), Positives = 113/197 (57%), Gaps = 1/197 (1%)
 Frame = -1

Query  748  SASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIRA  569
            SA YDTK YCRQTLIGGNYGLL+T TFVPNPDYYSALLWH+LMG   LS   SG+  +RA
Sbjct  343  SAKYDTKVYCRQTLIGGNYGLLDTETFVPNPDYYSALLWHQLMGTGVLSVDISGSSYLRA  402

Query  568  YAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkGS  389
            Y HCAKQ GG+TLLL+NL        +V  N   V+  +           H         
Sbjct  403  YVHCAKQKGGVTLLLLNLHRTMGFMVSVR-NDLNVNLAEGQGIRRDSAFVHGLKRTVSWV  461

Query  388  PRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITVA  209
                  G   REEYHL++K G+  ++TMLLNG  L +   G IP + P  ++ + PI VA
Sbjct  462  GSKASDGFSKREEYHLSSKDGNPFARTMLLNGAPLELTEDGGIPSLYPVEVSVNSPIYVA  521

Query  208  PFSIVFAHIPYVFLPAC  158
            P +I F   P     AC
Sbjct  522  PLTIAFVVFPDFEAEAC  538



>ref|XP_002866422.1| glycosyl hydrolase family 79 N-terminal domain-containing protein 
[Arabidopsis lyrata subsp. lyrata]
 gb|EFH42681.1| glycosyl hydrolase family 79 N-terminal domain-containing protein 
[Arabidopsis lyrata subsp. lyrata]
Length=537

 Score =   172 bits (435),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 91/198 (46%), Positives = 118/198 (60%), Gaps = 3/198 (2%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            +S+ ++TK YCRQ L+GG YGLL   TFVPNPDYYSALLWHRLMG+  L    + ++ +R
Sbjct  342  ISSKHNTKVYCRQALVGGFYGLLEKETFVPNPDYYSALLWHRLMGKGVLGVQTTASEYLR  401

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
            AY HC+K+  GIT+LLINL  NTT    V+ NG  V  +              S     G
Sbjct  402  AYVHCSKRRAGITILLINLSKNTTFTVAVS-NGVNVVLQADTMKRKSFLETLKSKVSWVG  460

Query  391  SPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITV  212
            +  S   G + REEYHL+ K GDLHS+ MLLNGN L   ++G IP+++P       P+ +
Sbjct  461  NKASD--GYLNREEYHLSPKHGDLHSKIMLLNGNPLVPTATGDIPKLEPARHGVKSPVYI  518

Query  211  APFSIVFAHIPYVFLPAC  158
             P SI F  +P    PAC
Sbjct  519  NPLSISFIVLPTFDAPAC  536



>ref|XP_010258148.1| PREDICTED: heparanase-like protein 1 isoform X3 [Nelumbo nucifera]
Length=540

 Score =   172 bits (435),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 89/198 (45%), Positives = 113/198 (57%), Gaps = 0/198 (0%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            M++ Y+T+ YCRQTLIGGNYGLLN TTFVPNPD+YSALLWHRLMG++ L+     +  +R
Sbjct  342  MASKYNTRAYCRQTLIGGNYGLLNLTTFVPNPDFYSALLWHRLMGKSVLTVDSDASPFLR  401

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
             YAHC+K   GITLLLINL + T     V  + +    R            H        
Sbjct  402  VYAHCSKGRAGITLLLINLSNQTDFRITVQNDININVRRGEQTIQRKGSFIHGLKRTVSW  461

Query  391  SPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITV  212
              R     T  REEY LT   G + SQTM+LNG  L +  +G IP + P  ++   PI+V
Sbjct  462  VGRRASDITTMREEYRLTPMDGQIRSQTMVLNGTPLELTENGDIPALDPVLVDVESPISV  521

Query  211  APFSIVFAHIPYVFLPAC  158
            AP SI F  +P+    AC
Sbjct  522  APLSIAFVALPHFEAAAC  539



>ref|XP_010258147.1| PREDICTED: heparanase-like protein 1 isoform X2 [Nelumbo nucifera]
Length=543

 Score =   172 bits (435),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 89/198 (45%), Positives = 113/198 (57%), Gaps = 0/198 (0%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            M++ Y+T+ YCRQTLIGGNYGLLN TTFVPNPD+YSALLWHRLMG++ L+     +  +R
Sbjct  345  MASKYNTRAYCRQTLIGGNYGLLNLTTFVPNPDFYSALLWHRLMGKSVLTVDSDASPFLR  404

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
             YAHC+K   GITLLLINL + T     V  + +    R            H        
Sbjct  405  VYAHCSKGRAGITLLLINLSNQTDFRITVQNDININVRRGEQTIQRKGSFIHGLKRTVSW  464

Query  391  SPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITV  212
              R     T  REEY LT   G + SQTM+LNG  L +  +G IP + P  ++   PI+V
Sbjct  465  VGRRASDITTMREEYRLTPMDGQIRSQTMVLNGTPLELTENGDIPALDPVLVDVESPISV  524

Query  211  APFSIVFAHIPYVFLPAC  158
            AP SI F  +P+    AC
Sbjct  525  APLSIAFVALPHFEAAAC  542



>ref|XP_010258146.1| PREDICTED: heparanase-like protein 1 isoform X1 [Nelumbo nucifera]
Length=544

 Score =   172 bits (435),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 89/198 (45%), Positives = 113/198 (57%), Gaps = 0/198 (0%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            M++ Y+T+ YCRQTLIGGNYGLLN TTFVPNPD+YSALLWHRLMG++ L+     +  +R
Sbjct  346  MASKYNTRAYCRQTLIGGNYGLLNLTTFVPNPDFYSALLWHRLMGKSVLTVDSDASPFLR  405

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
             YAHC+K   GITLLLINL + T     V  + +    R            H        
Sbjct  406  VYAHCSKGRAGITLLLINLSNQTDFRITVQNDININVRRGEQTIQRKGSFIHGLKRTVSW  465

Query  391  SPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITV  212
              R     T  REEY LT   G + SQTM+LNG  L +  +G IP + P  ++   PI+V
Sbjct  466  VGRRASDITTMREEYRLTPMDGQIRSQTMVLNGTPLELTENGDIPALDPVLVDVESPISV  525

Query  211  APFSIVFAHIPYVFLPAC  158
            AP SI F  +P+    AC
Sbjct  526  APLSIAFVALPHFEAAAC  543



>ref|XP_010258149.1| PREDICTED: heparanase-like protein 1 isoform X4 [Nelumbo nucifera]
Length=537

 Score =   172 bits (435),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 89/198 (45%), Positives = 113/198 (57%), Gaps = 0/198 (0%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            M++ Y+T+ YCRQTLIGGNYGLLN TTFVPNPD+YSALLWHRLMG++ L+     +  +R
Sbjct  339  MASKYNTRAYCRQTLIGGNYGLLNLTTFVPNPDFYSALLWHRLMGKSVLTVDSDASPFLR  398

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
             YAHC+K   GITLLLINL + T     V  + +    R            H        
Sbjct  399  VYAHCSKGRAGITLLLINLSNQTDFRITVQNDININVRRGEQTIQRKGSFIHGLKRTVSW  458

Query  391  SPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITV  212
              R     T  REEY LT   G + SQTM+LNG  L +  +G IP + P  ++   PI+V
Sbjct  459  VGRRASDITTMREEYRLTPMDGQIRSQTMVLNGTPLELTENGDIPALDPVLVDVESPISV  518

Query  211  APFSIVFAHIPYVFLPAC  158
            AP SI F  +P+    AC
Sbjct  519  APLSIAFVALPHFEAAAC  536



>gb|KJB38700.1| hypothetical protein B456_006G267500 [Gossypium raimondii]
 gb|KJB38701.1| hypothetical protein B456_006G267500 [Gossypium raimondii]
Length=542

 Score =   172 bits (435),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 88/201 (44%), Positives = 117/201 (58%), Gaps = 2/201 (1%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            M++ Y TK YCRQTLIGGNYGLLN TT+VPNPDYYSALLWHRLMG+  L+     +  +R
Sbjct  342  MASKYHTKVYCRQTLIGGNYGLLNATTYVPNPDYYSALLWHRLMGKVVLAVGSDASPFLR  401

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANV--AYNGSFVhhrkhirhinhhhhhhhshshg  398
            +YAHC+K   G+TLL+INL   T    +V  + N +     +              ++  
Sbjct  402  SYAHCSKGRIGVTLLVINLSDQTKFITDVQNSMNNNIRLATEQQNISRKSFSRSLKNTAS  461

Query  397  kGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPI  218
                ++       REEYHLT K G L ++TM+LNG  L + S+G+IP + P  +N   PI
Sbjct  462  GAEIKASSDEYSYREEYHLTPKNGYLQTRTMVLNGIPLELTSTGNIPRLDPVRVNVKSPI  521

Query  217  TVAPFSIVFAHIPYVFLPACR  155
            ++ P SI F   P    PACR
Sbjct  522  SITPLSIAFLVFPDFVAPACR  542



>ref|XP_008785953.1| PREDICTED: heparanase-like protein 2 isoform X2 [Phoenix dactylifera]
Length=539

 Score =   171 bits (434),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 97/212 (46%), Positives = 121/212 (57%), Gaps = 29/212 (14%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            M++ Y+T+ YCRQTLIGGNYGLL+T TF+PNPDYYSALLW+RLMG   LS   SG+  +R
Sbjct  342  MASKYNTRVYCRQTLIGGNYGLLDTKTFIPNPDYYSALLWNRLMGNGVLSIDLSGSSYLR  401

Query  571  AYAHCAKQSGGITLLLINLDSNT----TVEANVAYN----------GSFVhhrkhirhin  434
            AYAHC K+  G++LLLINL  +T    TV  ++  N          GSFVH  K      
Sbjct  402  AYAHCRKRKSGVSLLLINLSKSTEFIVTVRNDINVNLAEGGGIQRDGSFVHGLKRTVSWV  461

Query  433  hhhhhhhshshgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPE  254
                            R     + TREEYHLTAK G+  SQT+LLNG  L +   G IP 
Sbjct  462  G---------------RRASDQSETREEYHLTAKDGNHLSQTVLLNGTPLELTEDGDIPP  506

Query  253  MKPRYLNSSEPITVAPFSIVFAHIPYVFLPAC  158
            + P    ++ PI++AP SI F   P     AC
Sbjct  507  LNPVLTAANSPISIAPLSIAFVVFPKFEAQAC  538



>ref|XP_004962990.1| PREDICTED: heparanase-like protein 2-like [Setaria italica]
Length=540

 Score =   171 bits (434),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 93/197 (47%), Positives = 114/197 (58%), Gaps = 1/197 (1%)
 Frame = -1

Query  748  SASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIRA  569
            SA YDTK YCRQTLIGGNYGLL+T TFVPNPDYYSALLWHRLMG   LST  SG+  +RA
Sbjct  343  SAKYDTKVYCRQTLIGGNYGLLDTETFVPNPDYYSALLWHRLMGTGVLSTDISGSSYLRA  402

Query  568  YAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkGS  389
            Y HC KQ GG+ +LL+NL  +     +V  N   V+  +       +   H         
Sbjct  403  YVHCGKQKGGVAILLLNLHRSMGFMVSVR-NDLNVNLAEGQGIRRDNIFVHGLKRTVSWV  461

Query  388  PRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITVA  209
                  G   REEYHL+AK G+  ++TMLLNG  L +   G IP + P  ++ + PI VA
Sbjct  462  GSKASDGYSKREEYHLSAKDGNPFARTMLLNGVPLELTEDGDIPPLYPVEVSVNSPIYVA  521

Query  208  PFSIVFAHIPYVFLPAC  158
            P +I F   P     AC
Sbjct  522  PLTIAFVVFPDFEAEAC  538



>ref|XP_008672059.1| PREDICTED: uncharacterized protein LOC100192026 isoform X1 [Zea 
mays]
 gb|ACR34666.1| unknown [Zea mays]
 tpg|DAA55155.1| TPA: heparanase-like protein 2 [Zea mays]
Length=575

 Score =   172 bits (435),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 93/197 (47%), Positives = 113/197 (57%), Gaps = 1/197 (1%)
 Frame = -1

Query  748  SASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIRA  569
            SA YDTK YCRQTLIGGNYGLL+T TFVPNPDYYSALLWH+LMG   LS   SG+  +RA
Sbjct  378  SAKYDTKVYCRQTLIGGNYGLLDTETFVPNPDYYSALLWHQLMGTGVLSVDISGSSYLRA  437

Query  568  YAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkGS  389
            Y HCAKQ GG+TLLL+NL        +V  N   V+  +           H         
Sbjct  438  YVHCAKQKGGVTLLLLNLHRTMGFMVSVR-NDLNVNLAEGQGIRRDSAFVHGLKRTVSWV  496

Query  388  PRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITVA  209
                  G   REEYHL++K G+  ++TMLLNG  L +   G IP + P  ++ + PI VA
Sbjct  497  GSKASDGFSKREEYHLSSKDGNPFARTMLLNGAPLELTEDGGIPSLYPVEVSVNSPIYVA  556

Query  208  PFSIVFAHIPYVFLPAC  158
            P +I F   P     AC
Sbjct  557  PLTIAFVVFPDFEAEAC  573



>ref|NP_001130921.1| uncharacterized protein LOC100192026 precursor [Zea mays]
 gb|ACF79309.1| unknown [Zea mays]
 tpg|DAA55156.1| TPA: heparanase-like protein 2 [Zea mays]
Length=566

 Score =   172 bits (435),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 93/197 (47%), Positives = 113/197 (57%), Gaps = 1/197 (1%)
 Frame = -1

Query  748  SASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIRA  569
            SA YDTK YCRQTLIGGNYGLL+T TFVPNPDYYSALLWH+LMG   LS   SG+  +RA
Sbjct  369  SAKYDTKVYCRQTLIGGNYGLLDTETFVPNPDYYSALLWHQLMGTGVLSVDISGSSYLRA  428

Query  568  YAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkGS  389
            Y HCAKQ GG+TLLL+NL        +V  N   V+  +           H         
Sbjct  429  YVHCAKQKGGVTLLLLNLHRTMGFMVSVR-NDLNVNLAEGQGIRRDSAFVHGLKRTVSWV  487

Query  388  PRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITVA  209
                  G   REEYHL++K G+  ++TMLLNG  L +   G IP + P  ++ + PI VA
Sbjct  488  GSKASDGFSKREEYHLSSKDGNPFARTMLLNGAPLELTEDGGIPSLYPVEVSVNSPIYVA  547

Query  208  PFSIVFAHIPYVFLPAC  158
            P +I F   P     AC
Sbjct  548  PLTIAFVVFPDFEAEAC  564



>ref|NP_001067122.1| Os12g0578400 [Oryza sativa Japonica Group]
 gb|ABA99069.1| Heparanase-like protein 2 precursor, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF30141.1| Os12g0578400 [Oryza sativa Japonica Group]
 dbj|BAG93793.1| unnamed protein product [Oryza sativa Japonica Group]
Length=539

 Score =   171 bits (434),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 91/198 (46%), Positives = 115/198 (58%), Gaps = 1/198 (1%)
 Frame = -1

Query  748  SASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIRA  569
            SA YDTK YCRQTLIGGNYGLL+T TFVPNPDYYSALLWHRLMG+  +S   SG+  +RA
Sbjct  342  SAKYDTKVYCRQTLIGGNYGLLDTETFVPNPDYYSALLWHRLMGKGVISLDTSGSSYLRA  401

Query  568  YAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkGS  389
            YAHC KQ GG+ LL++NL+ N     +V  N   ++ R+       +   H         
Sbjct  402  YAHCGKQKGGVALLMLNLNKNMGFMVSVR-NDLNINFREMAGIKRDNSFVHGLKRTVSWV  460

Query  388  PRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITVA  209
                  G   REEYHLT + G+  ++T+LLNG  L +   G IP + P  ++ + PI VA
Sbjct  461  GSKASDGLEKREEYHLTPQDGNPFARTVLLNGAPLQLTGDGDIPSLPPVMVSVNSPIYVA  520

Query  208  PFSIVFAHIPYVFLPACR  155
            P SI F   P      C 
Sbjct  521  PLSIAFVVFPDFEAEGCE  538



>ref|XP_006440690.1| hypothetical protein CICLE_v10019304mg [Citrus clementina]
 gb|ESR53930.1| hypothetical protein CICLE_v10019304mg [Citrus clementina]
Length=628

 Score =   172 bits (436),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 90/198 (45%), Positives = 115/198 (58%), Gaps = 0/198 (0%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            MS+ Y+TK YCRQTL+GGNYGLLN TTF+PNPDYYSALLWHRLMG+  LS +  G+  +R
Sbjct  429  MSSKYNTKVYCRQTLVGGNYGLLNATTFIPNPDYYSALLWHRLMGKGVLSVATDGSSSLR  488

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
            +YAHC+K+  GITLLLINL + T    +V  + +     K                    
Sbjct  489  SYAHCSKEREGITLLLINLSNQTDYVISVHNSMNMKLTVKGKDINGESSLSRDIKRAVSW  548

Query  391  SPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITV  212
               +   G +TREEYHLT K G L SQTM+LNG  L +     IP++ P  ++ + PI +
Sbjct  549  VGSTASDGHLTREEYHLTPKDGYLQSQTMVLNGIPLQLAEDEGIPKLDPVRVDVNSPIYI  608

Query  211  APFSIVFAHIPYVFLPAC  158
               SI F   P     AC
Sbjct  609  THLSIAFIVFPNFSARAC  626



>ref|XP_006438800.1| hypothetical protein CICLE_v10033641mg, partial [Citrus clementina]
 gb|ESR52040.1| hypothetical protein CICLE_v10033641mg, partial [Citrus clementina]
Length=498

 Score =   171 bits (432),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 84/198 (42%), Positives = 122/198 (62%), Gaps = 21/198 (11%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            M+++++ K +CRQ LIGGNY LLNTTTF+PNPDYY +LLWHRLMG+N L+T+ + +  +R
Sbjct  321  MTSTFNHKVFCRQALIGGNYALLNTTTFIPNPDYYGSLLWHRLMGKNVLATTQNASPYLR  380

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
             Y+HC+K+  GIT+LLINL ++T+ + +V  + +    ++                    
Sbjct  381  VYSHCSKEKPGITVLLINLSNSTSFDVSVINDMNLYPSQEQT------------------  422

Query  391  SPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITV  212
                  +    REEYHLT +GG++ S  +LLNG  L + +S  IP M+P+  +   PITV
Sbjct  423  ---QDSQDEKPREEYHLTPEGGNIQSDVVLLNGTPLKLTNSLDIPSMEPKLADRYSPITV  479

Query  211  APFSIVFAHIPYVFLPAC  158
            AP SIVFA +     PAC
Sbjct  480  APHSIVFATLRDFKAPAC  497



>ref|XP_006483691.1| PREDICTED: heparanase-like protein 2-like [Citrus sinensis]
Length=521

 Score =   171 bits (432),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 84/198 (42%), Positives = 122/198 (62%), Gaps = 21/198 (11%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            M+++++ K +CRQ LIGGNY LLNTTTF+PNPDYY +LLWHRLMG+N L+T+ + +  +R
Sbjct  344  MTSTFNHKVFCRQALIGGNYALLNTTTFIPNPDYYGSLLWHRLMGKNVLATTQNASPYLR  403

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
             Y+HC+K+  GIT+LLINL ++T+ + +V  + +    ++                    
Sbjct  404  VYSHCSKEKPGITVLLINLSNSTSFDVSVINDMNLYPSQEQT------------------  445

Query  391  SPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITV  212
                  +    REEYHLT +GG++ S  +LLNG  L + +S  IP M+P+  +   PITV
Sbjct  446  ---QDSQDEKPREEYHLTPEGGNIQSDVVLLNGTPLKLTNSLDIPSMEPKLADRYSPITV  502

Query  211  APFSIVFAHIPYVFLPAC  158
            AP SIVFA +     PAC
Sbjct  503  APHSIVFATLRDFKAPAC  520



>gb|KHN02019.1| Heparanase-like protein 2 [Glycine soja]
Length=513

 Score =   171 bits (432),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 87/198 (44%), Positives = 117/198 (59%), Gaps = 26/198 (13%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            M+++++ K YCRQ L+GGNYGLL+TTTF+PNPDYY ALLWHRLMG   LS S  G+  +R
Sbjct  341  MTSTFNHKVYCRQALVGGNYGLLDTTTFIPNPDYYGALLWHRLMGSKVLSVSHEGSPYLR  400

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
            AY HC+K+  GI +LLIN+ ++TT E ++  + +                          
Sbjct  401  AYVHCSKKESGIAVLLINMSNSTTFEVSLLNDMNLY------------------------  436

Query  391  SPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITV  212
             P    + T  REEYHLT K G++ S+ +LLNG  L +  S  IPEMKP+ ++ S P+ V
Sbjct  437  -PEVVFKNTQ-REEYHLTPKDGNIQSKVVLLNGTPLVLTQSLHIPEMKPKLVDPSSPVKV  494

Query  211  APFSIVFAHIPYVFLPAC  158
               SIVF H      PAC
Sbjct  495  KHDSIVFVHSKSFNAPAC  512



>ref|XP_011075654.1| PREDICTED: heparanase-like protein 2 [Sesamum indicum]
Length=522

 Score =   171 bits (432),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 84/198 (42%), Positives = 121/198 (61%), Gaps = 19/198 (10%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            M+++++ K +CRQ LIGGNY LLNTT+F+PNPDYY ALLWHRLMG+  LS + +G+  +R
Sbjct  343  MTSTFNHKVFCRQALIGGNYALLNTTSFIPNPDYYGALLWHRLMGKQVLSATHNGSPYLR  402

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
            AY+HC+K++ GI++LLIN+ ++TT E +V  + +       +                  
Sbjct  403  AYSHCSKKTSGISVLLINMSNSTTFEVSVMDDLNLYPEDYSLSS----------------  446

Query  391  SPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITV  212
                  +    REEYHLT K G++ S  +LLNG  L +  S  IP M P+ ++++ PITV
Sbjct  447  ---GYSKYVWQREEYHLTPKDGNIQSDVVLLNGTPLKLTESSDIPAMNPQVVDAASPITV  503

Query  211  APFSIVFAHIPYVFLPAC  158
             P SIVFA +     PAC
Sbjct  504  QPDSIVFATLRGFAAPAC  521



>gb|EMT29716.1| Heparanase-like protein 3 [Aegilops tauschii]
Length=501

 Score =   170 bits (431),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 90/182 (49%), Positives = 107/182 (59%), Gaps = 18/182 (10%)
 Frame = -1

Query  703  GGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIRAYAHCAKQSGGITLLL  524
            GGNYGLLNTTTF PNPDYYSALLWHRLMG   L   F+G+  +RAYAHCAK + GITLLL
Sbjct  337  GGNYGLLNTTTFQPNPDYYSALLWHRLMGTKVLEAKFTGSNMVRAYAHCAKHAPGITLLL  396

Query  523  INLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkGSPRSQKRGTMTREEYH  344
            INL  N T   +VA                            K   R  +     REEYH
Sbjct  397  INLHVNATNHVSVAGR------------------GGAHAGGRKHGGRFAQPPGAAREEYH  438

Query  343  LTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITVAPFSIVFAHIPYVFLP  164
            LT +GG++ SQ MLLNG  L+  + G IP M+P  ++++ PI VAP SIVF H+P    P
Sbjct  439  LTPEGGNIQSQMMLLNGRALAAGADGGIPGMEPVKVDAARPIAVAPRSIVFVHMPDYHAP  498

Query  163  AC  158
            AC
Sbjct  499  AC  500



>ref|XP_008661167.1| PREDICTED: heparanase-like protein 1 [Zea mays]
Length=540

 Score =   171 bits (432),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 93/197 (47%), Positives = 114/197 (58%), Gaps = 1/197 (1%)
 Frame = -1

Query  748  SASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIRA  569
            SA YDTK YCRQTLIGGNYGLL+T TFVPNPDYYSALLWHRLMG   LS   SG+  +R 
Sbjct  343  SAKYDTKVYCRQTLIGGNYGLLDTDTFVPNPDYYSALLWHRLMGTGVLSLDISGSPYLRP  402

Query  568  YAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkGS  389
            YAHCAKQ GGI L+L+NL        +V  N   V+  +       +   H         
Sbjct  403  YAHCAKQKGGIALVLLNLHRTMGFMVSVR-NDINVNLAEGQGIRRDNAFVHGLKRTVSWV  461

Query  388  PRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITVA  209
                  G   REEYHL+A+ G+  ++TMLLNG  L +   G IP + P  ++++ PI VA
Sbjct  462  GSKASDGFSKREEYHLSAQDGNPFARTMLLNGVPLELTEDGDIPPLYPVEVSANSPIYVA  521

Query  208  PFSIVFAHIPYVFLPAC  158
            P +I F   P     AC
Sbjct  522  PLTIAFVVFPDFEAEAC  538



>ref|XP_011013080.1| PREDICTED: heparanase-like protein 1 isoform X2 [Populus euphratica]
Length=417

 Score =   168 bits (426),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 95/212 (45%), Positives = 120/212 (57%), Gaps = 29/212 (14%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            M++ Y+TK YCRQTL+GGNYGLLNTTT VPNPDYYSALLWHRLMG+  L+   + +  +R
Sbjct  220  MASRYNTKVYCRQTLVGGNYGLLNTTTLVPNPDYYSALLWHRLMGKGVLAVGSNASPFLR  279

Query  571  AYAHCAKQSGGITLLLINLDSNT--------------TVEANVAYNGSFVhhrkhirhin  434
            +YAHC+K   GITLLLINL + T              TVE N++   SF+   K      
Sbjct  280  SYAHCSKGRAGITLLLINLSNQTDFIISVQNSMDMRLTVEENISGENSFMRGLKRSVSWV  339

Query  433  hhhhhhhshshgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPE  254
             +              R+     M REEYHLTAK G L S TM+LNG  L +    +IP 
Sbjct  340  GN--------------RASDE-PMYREEYHLTAKDGYLQSPTMVLNGIPLELTEDENIPN  384

Query  253  MKPRYLNSSEPITVAPFSIVFAHIPYVFLPAC  158
            + P  L+ + P+ + P SI F   P    PAC
Sbjct  385  LDPVRLDLNSPLYINPLSISFIVFPNFDAPAC  416



>dbj|BAJ97219.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=541

 Score =   171 bits (432),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 92/198 (46%), Positives = 115/198 (58%), Gaps = 3/198 (2%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            MS+ Y+TK +CRQTLIGGNYGLL+T TF+PNPDYYSALLWHRLMG   LS   +  +K+R
Sbjct  346  MSSKYNTKVFCRQTLIGGNYGLLDTQTFLPNPDYYSALLWHRLMGNGVLSVDINAPRKLR  405

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
            AYAHC+K+  GITLLLINL ++T    NV          +       H       +    
Sbjct  406  AYAHCSKRHKGITLLLINLSNSTGY--NVTLQNDLNVSVERGSGHRRHRGGGLRRAVSWL  463

Query  391  SPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITV  212
              ++    T  R+EYHLTAK GD  S+TMLLNG  L +   G +P M P       P+ +
Sbjct  464  GSKTSSEST-KRDEYHLTAKDGDHQSRTMLLNGLPLELGDDGGVPAMNPVPAAVDSPVHL  522

Query  211  APFSIVFAHIPYVFLPAC  158
            AP SI F  +P     AC
Sbjct  523  APTSIAFVVLPRFEAKAC  540



>ref|XP_006374166.1| hypothetical protein POPTR_0015s03440g [Populus trichocarpa]
 gb|ERP51963.1| hypothetical protein POPTR_0015s03440g [Populus trichocarpa]
Length=476

 Score =   169 bits (429),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 94/212 (44%), Positives = 121/212 (57%), Gaps = 29/212 (14%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            M++ Y+TK YCRQTL+GG+YGLLNTTT VPNPDYYSALLWHRLMG+  L+   + +  +R
Sbjct  279  MASRYNTKVYCRQTLVGGHYGLLNTTTLVPNPDYYSALLWHRLMGKGVLAVGSNASPFLR  338

Query  571  AYAHCAKQSGGITLLLINLDSNT--------------TVEANVAYNGSFVhhrkhirhin  434
            +YAHC+K   GITLLLINL + T              TVE N++   SFV          
Sbjct  339  SYAHCSKGRAGITLLLINLSNQTDFIISVQNSMDMRLTVEENISGENSFV----------  388

Query  433  hhhhhhhshshgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPE  254
                     S      R+     + REEYHLTAK G+L S+TM+LNG  L +    +IP 
Sbjct  389  ----RGLKRSVSWVGSRASDE-PLYREEYHLTAKDGNLQSRTMVLNGIPLELTEDENIPS  443

Query  253  MKPRYLNSSEPITVAPFSIVFAHIPYVFLPAC  158
            + P  L+ + P+ + P SI F   P    PAC
Sbjct  444  LDPVRLDVNSPLYINPLSISFIVFPNFDAPAC  475



>gb|ACR10240.1| heparanase [Oryza sativa Indica Group]
Length=539

 Score =   170 bits (431),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 90/198 (45%), Positives = 115/198 (58%), Gaps = 1/198 (1%)
 Frame = -1

Query  748  SASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIRA  569
            SA YDTK YCRQTLIGGNYGLL+T +FVPNPDYYSALLWHRLMG+  +S   SG+  +RA
Sbjct  342  SAKYDTKVYCRQTLIGGNYGLLDTESFVPNPDYYSALLWHRLMGKGVISLDTSGSSYLRA  401

Query  568  YAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkGS  389
            YAHC KQ GG+ LL++NL+ N     +V  N   ++ R+       +   H         
Sbjct  402  YAHCGKQKGGVALLMLNLNKNMGFMVSVR-NDLNINFREMAGIKRDNSFVHGLKRTVSWV  460

Query  388  PRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITVA  209
                  G   REEYHLT + G+  ++T+LLNG  L +   G IP + P  ++ + PI VA
Sbjct  461  GSKASDGLEKREEYHLTPQDGNPFARTVLLNGAPLQLTGDGDIPSLPPVMVSVNSPIYVA  520

Query  208  PFSIVFAHIPYVFLPACR  155
            P SI F   P      C 
Sbjct  521  PLSIAFVVFPDFEAEGCE  538



>gb|KJB74275.1| hypothetical protein B456_011G2845002, partial [Gossypium raimondii]
Length=246

 Score =   163 bits (413),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 84/198 (42%), Positives = 114/198 (58%), Gaps = 22/198 (11%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            M++ Y+ K YCRQ L GGNY LL TTTFVPNPDYY ALLWHR+MG   LS +  G+  +R
Sbjct  70   MTSVYNHKVYCRQALTGGNYALLKTTTFVPNPDYYGALLWHRVMGSKVLSVTHKGSPYLR  129

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
             Y+HCAK+  G++ + INL  NT+ E N+ ++ +                         G
Sbjct  130  VYSHCAKKEPGVSFVFINLSKNTSFEINLYHDQNL----------------------NGG  167

Query  391  SPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITV  212
            SP  + +G   REEYHLT K G++ S  +LLNG  L +  S  IPE+KP+ ++  + I++
Sbjct  168  SPNFEFKGHKKREEYHLTPKDGNILSSIVLLNGTPLELSDSLEIPELKPKLVDGLKTISI  227

Query  211  APFSIVFAHIPYVFLPAC  158
            A  SI F  I     PAC
Sbjct  228  ATHSIAFVTIIDFNAPAC  245



>ref|XP_006574930.1| PREDICTED: heparanase-like protein 2-like isoform X1 [Glycine 
max]
Length=513

 Score =   169 bits (429),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 87/198 (44%), Positives = 116/198 (59%), Gaps = 26/198 (13%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            M+++++ K YCRQ L+GGNYGLL+TTTF+PNPDYY ALLWHRLMG   LS S  G+  +R
Sbjct  341  MTSTFNHKVYCRQALVGGNYGLLDTTTFIPNPDYYGALLWHRLMGSKVLSVSHEGSPYLR  400

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
            AY HC+K   GI +LLIN+ ++TT E ++  + +                          
Sbjct  401  AYVHCSKTESGIAVLLINMSNSTTFEVSLLNDMNLY------------------------  436

Query  391  SPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITV  212
             P    + T  REEYHLT K G++ S+ +LLNG  L +  S  IPEMKP+ ++ S P+ V
Sbjct  437  -PEVVFKNTQ-REEYHLTPKDGNIQSKVVLLNGTPLVLTQSLHIPEMKPKLVDPSSPVKV  494

Query  211  APFSIVFAHIPYVFLPAC  158
               SIVF H      PAC
Sbjct  495  KHDSIVFVHSKSFNAPAC  512



>gb|KCW86528.1| hypothetical protein EUGRSUZ_B03174 [Eucalyptus grandis]
Length=522

 Score =   169 bits (429),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 85/202 (42%), Positives = 122/202 (60%), Gaps = 29/202 (14%)
 Frame = -1

Query  751  MSASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIR  572
            M++ ++ K +CRQ LIGGNY LLNTTTF+PNPD+Y ALLWHRLMG+  LST+ SG+  +R
Sbjct  345  MTSRFNHKVFCRQALIGGNYALLNTTTFIPNPDFYGALLWHRLMGKEVLSTTHSGSPYLR  404

Query  571  AYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkG  392
            AYAHC++ + G+T++LIN+ ++T+ + ++  + ++                         
Sbjct  405  AYAHCSRNTPGVTVVLINMSNSTSFDVSIVDDPNW-------------------------  439

Query  391  SPRSQKR----GTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSE  224
            SP  QK+        REEYHLT K G++ S  +LLNG  L +  S  IPE+ P  ++ S+
Sbjct  440  SPSKQKKIASGSHAQREEYHLTPKDGNIRSDVLLLNGTPLKLTDSSDIPELNPTTVDPSQ  499

Query  223  PITVAPFSIVFAHIPYVFLPAC  158
            PI V   SIVFA +     PAC
Sbjct  500  PIHVVADSIVFARLQGFKAPAC  521



>ref|XP_002442385.1| hypothetical protein SORBIDRAFT_08g019250 [Sorghum bicolor]
 gb|EES16223.1| hypothetical protein SORBIDRAFT_08g019250 [Sorghum bicolor]
Length=540

 Score =   170 bits (430),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 92/197 (47%), Positives = 113/197 (57%), Gaps = 1/197 (1%)
 Frame = -1

Query  748  SASYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIRA  569
            SA YDTK YCRQTLIGGNYGLL+T TFVPNPDYYSALLWH++MG   LS   SG+  +RA
Sbjct  343  SAKYDTKVYCRQTLIGGNYGLLDTDTFVPNPDYYSALLWHQIMGTRVLSIDISGSSYLRA  402

Query  568  YAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkGS  389
            Y HCAKQ GG+ LLL+NL        +V  N   V+  +       +   H         
Sbjct  403  YVHCAKQKGGVALLLLNLHRTMGFMVSVR-NDLNVNLAEGRGIRRDNAFVHGLKRTVSWV  461

Query  388  PRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITVA  209
                  G   REEYHL+AK G+  ++TMLLNG  L +   G IP + P  ++ + PI VA
Sbjct  462  GSKASDGFSKREEYHLSAKDGNPFARTMLLNGVPLELTEDGDIPPLYPVEVSVNSPIYVA  521

Query  208  PFSIVFAHIPYVFLPAC  158
            P +I F   P     AC
Sbjct  522  PLTIAFVVFPDFEAEAC  538



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1387667965840