BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF009A23

Length=745
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|EYU36892.1|  hypothetical protein MIMGU_mgv1a0177021mg               253   1e-80   Erythranthe guttata [common monkey flower]
ref|XP_006358156.1|  PREDICTED: probable inactive receptor kinase...    258   8e-78   Solanum tuberosum [potatoes]
ref|XP_009607538.1|  PREDICTED: probable inactive receptor kinase...    259   1e-77   Nicotiana tomentosiformis
emb|CDP04037.1|  unnamed protein product                                246   3e-77   Coffea canephora [robusta coffee]
emb|CDP13882.1|  unnamed protein product                                256   4e-77   Coffea canephora [robusta coffee]
ref|XP_011084790.1|  PREDICTED: probable inactive receptor kinase...    256   4e-77   Sesamum indicum [beniseed]
ref|XP_004235218.1|  PREDICTED: probable inactive receptor kinase...    255   1e-76   Solanum lycopersicum
gb|ABK93951.1|  unknown                                                 246   3e-76   Populus trichocarpa [western balsam poplar]
ref|XP_009760496.1|  PREDICTED: probable inactive receptor kinase...    254   5e-76   Nicotiana sylvestris
ref|XP_009760490.1|  PREDICTED: probable inactive receptor kinase...    254   1e-75   Nicotiana sylvestris
gb|KHN40997.1|  Putative inactive receptor kinase                       241   1e-75   Glycine soja [wild soybean]
gb|KHN24722.1|  Putative inactive receptor kinase                       244   1e-75   Glycine soja [wild soybean]
ref|XP_011041763.1|  PREDICTED: probable inactive receptor kinase...    248   7e-75   Populus euphratica
ref|XP_010252005.1|  PREDICTED: probable inactive receptor kinase...    251   1e-74   Nelumbo nucifera [Indian lotus]
gb|KHN30614.1|  Putative inactive receptor kinase                       239   1e-74   Glycine soja [wild soybean]
ref|XP_004294716.1|  PREDICTED: probable inactive receptor kinase...    249   2e-74   Fragaria vesca subsp. vesca
ref|XP_007208318.1|  hypothetical protein PRUPE_ppa002781mg             249   3e-74   
ref|XP_008239856.1|  PREDICTED: probable inactive receptor kinase...    249   3e-74   Prunus mume [ume]
ref|XP_010999642.1|  PREDICTED: probable inactive receptor kinase...    248   5e-74   Populus euphratica
ref|XP_009374410.1|  PREDICTED: probable inactive receptor kinase...    248   9e-74   Pyrus x bretschneideri [bai li]
ref|XP_010999639.1|  PREDICTED: probable inactive receptor kinase...    248   1e-73   Populus euphratica
ref|XP_002325632.1|  putative plant disease resistance family pro...    247   1e-73   Populus trichocarpa [western balsam poplar]
ref|XP_010999638.1|  PREDICTED: probable inactive receptor kinase...    248   1e-73   Populus euphratica
ref|XP_011041759.1|  PREDICTED: probable inactive receptor kinase...    247   1e-73   Populus euphratica
ref|XP_010098027.1|  putative inactive receptor kinase                  248   2e-73   
ref|XP_006371315.1|  putative plant disease resistance family pro...    246   2e-73   
ref|XP_008384658.1|  PREDICTED: probable inactive receptor kinase...    246   3e-73   
ref|XP_011089538.1|  PREDICTED: probable inactive receptor kinase...    246   3e-73   
ref|XP_006371316.1|  hypothetical protein POPTR_0019s09010g             246   4e-73   
ref|XP_011089537.1|  PREDICTED: probable inactive receptor kinase...    246   6e-73   Sesamum indicum [beniseed]
emb|CBI15804.3|  unnamed protein product                                246   6e-73   Vitis vinifera
ref|XP_009370892.1|  PREDICTED: probable inactive receptor kinase...    245   7e-73   Pyrus x bretschneideri [bai li]
gb|KJB29842.1|  hypothetical protein B456_005G120900                    246   7e-73   Gossypium raimondii
ref|XP_002276162.3|  PREDICTED: probable inactive receptor kinase...    246   7e-73   Vitis vinifera
gb|KHN18649.1|  Putative inactive receptor kinase                       243   2e-72   Glycine soja [wild soybean]
ref|XP_010094441.1|  putative inactive receptor kinase                  244   2e-72   Morus notabilis
ref|XP_002533837.1|  Nodulation receptor kinase precursor, putative     244   2e-72   
ref|XP_006602052.1|  PREDICTED: probable inactive receptor kinase...    244   3e-72   Glycine max [soybeans]
ref|XP_003537367.2|  PREDICTED: probable inactive receptor kinase...    244   4e-72   
ref|XP_006602049.1|  PREDICTED: probable inactive receptor kinase...    244   4e-72   Glycine max [soybeans]
ref|XP_006602050.1|  PREDICTED: probable inactive receptor kinase...    244   4e-72   Glycine max [soybeans]
ref|XP_003553192.2|  PREDICTED: probable inactive receptor kinase...    244   4e-72   Glycine max [soybeans]
ref|XP_006591269.1|  PREDICTED: probable inactive receptor kinase...    244   4e-72   Glycine max [soybeans]
gb|KDP21623.1|  hypothetical protein JCGZ_03294                         243   4e-72   Jatropha curcas
gb|KDP45679.1|  hypothetical protein JCGZ_17286                         243   5e-72   Jatropha curcas
ref|XP_007033487.1|  Leucine-rich repeat protein kinase family pr...    243   5e-72   
gb|KHG17391.1|  hypothetical protein F383_22576                         243   6e-72   Gossypium arboreum [tree cotton]
ref|XP_007146903.1|  hypothetical protein PHAVU_006G080200g             243   6e-72   Phaseolus vulgaris [French bean]
ref|XP_010244554.1|  PREDICTED: probable inactive receptor kinase...    243   6e-72   Nelumbo nucifera [Indian lotus]
ref|XP_003519295.1|  PREDICTED: probable inactive receptor kinase...    243   6e-72   Glycine max [soybeans]
ref|XP_007207849.1|  hypothetical protein PRUPE_ppa022997mg             242   9e-72   
ref|XP_010922781.1|  PREDICTED: probable inactive receptor kinase...    242   1e-71   
ref|XP_009355011.1|  PREDICTED: probable inactive receptor kinase...    241   1e-71   
gb|KDO67579.1|  hypothetical protein CISIN_1g006886mg                   241   2e-71   Citrus sinensis [apfelsine]
ref|XP_006435961.1|  hypothetical protein CICLE_v10030941mg             241   2e-71   Citrus clementina [clementine]
ref|XP_007017100.1|  Leucine-rich repeat protein kinase family pr...    242   2e-71   
ref|XP_008803002.1|  PREDICTED: probable inactive receptor kinase...    241   2e-71   Phoenix dactylifera
ref|XP_006435960.1|  hypothetical protein CICLE_v10030941mg             241   2e-71   Citrus clementina [clementine]
ref|XP_003616055.1|  Leucine-rich repeat receptor-like protein ki...    241   2e-71   Medicago truncatula
ref|XP_007142022.1|  hypothetical protein PHAVU_008G245900g             241   2e-71   Phaseolus vulgaris [French bean]
ref|XP_006429632.1|  hypothetical protein CICLE_v10011280mg             241   3e-71   Citrus clementina [clementine]
gb|KDO64166.1|  hypothetical protein CISIN_1g006747mg                   241   3e-71   Citrus sinensis [apfelsine]
ref|XP_008463277.1|  PREDICTED: probable inactive receptor kinase...    241   4e-71   Cucumis melo [Oriental melon]
ref|XP_003544939.1|  PREDICTED: probable inactive receptor kinase...    241   5e-71   
ref|XP_004500388.1|  PREDICTED: probable inactive receptor kinase...    240   5e-71   
ref|XP_006842562.1|  hypothetical protein AMTR_s00077p00144570          228   6e-71   
ref|XP_008244615.1|  PREDICTED: probable inactive receptor kinase...    238   7e-71   Prunus mume [ume]
ref|XP_006374053.1|  leucine-rich repeat transmembrane protein ki...    239   1e-70   
ref|XP_011011771.1|  PREDICTED: probable inactive receptor kinase...    239   1e-70   Populus euphratica
ref|XP_010322111.1|  PREDICTED: probable inactive receptor kinase...    238   1e-70   Solanum lycopersicum
ref|XP_004241083.1|  PREDICTED: probable inactive receptor kinase...    238   1e-70   
ref|XP_011080640.1|  PREDICTED: probable inactive receptor kinase...    239   1e-70   Sesamum indicum [beniseed]
ref|XP_002319979.1|  putative plant disease resistance family pro...    239   1e-70   Populus trichocarpa [western balsam poplar]
gb|ABR17070.1|  unknown                                                 231   2e-70   Picea sitchensis
ref|XP_003600547.1|  Leucine-rich repeat receptor-like protein ki...    239   2e-70   
gb|KEH34523.1|  LRR receptor-like kinase                                239   2e-70   Medicago truncatula
ref|XP_004172749.1|  PREDICTED: LOW QUALITY PROTEIN: probable ina...    239   2e-70   
ref|XP_004142674.1|  PREDICTED: probable inactive receptor kinase...    238   3e-70   Cucumis sativus [cucumbers]
ref|XP_008244579.1|  PREDICTED: probable inactive receptor kinase...    238   3e-70   
ref|XP_010931391.1|  PREDICTED: probable inactive receptor kinase...    238   4e-70   Elaeis guineensis
ref|XP_008355739.1|  PREDICTED: probable inactive receptor kinase...    238   4e-70   
gb|KDO54914.1|  hypothetical protein CISIN_1g005693mg                   238   5e-70   Citrus sinensis [apfelsine]
ref|XP_006432052.1|  hypothetical protein CICLE_v10000513mg             237   7e-70   Citrus clementina [clementine]
gb|KHF99691.1|  hypothetical protein F383_18108                         236   9e-70   Gossypium arboreum [tree cotton]
gb|KDO54912.1|  hypothetical protein CISIN_1g005693mg                   238   1e-69   Citrus sinensis [apfelsine]
ref|XP_006432053.1|  hypothetical protein CICLE_v10000513mg             238   1e-69   Citrus clementina [clementine]
gb|KJB20517.1|  hypothetical protein B456_003G153000                    237   1e-69   Gossypium raimondii
gb|KJB67957.1|  hypothetical protein B456_010G219700                    236   1e-69   Gossypium raimondii
ref|XP_009592168.1|  PREDICTED: probable inactive receptor kinase...    237   2e-69   Nicotiana tomentosiformis
ref|XP_011001675.1|  PREDICTED: probable inactive receptor kinase...    235   2e-69   Populus euphratica
ref|XP_009758202.1|  PREDICTED: probable inactive receptor kinase...    237   2e-69   Nicotiana sylvestris
gb|KHG05843.1|  hypothetical protein F383_32232                         237   2e-69   Gossypium arboreum [tree cotton]
gb|KDO54913.1|  hypothetical protein CISIN_1g005693mg                   237   2e-69   Citrus sinensis [apfelsine]
ref|XP_011001671.1|  PREDICTED: probable inactive receptor kinase...    236   3e-69   Populus euphratica
ref|XP_011001674.1|  PREDICTED: probable inactive receptor kinase...    236   3e-69   Populus euphratica
ref|XP_004490727.1|  PREDICTED: probable inactive receptor kinase...    236   4e-69   Cicer arietinum [garbanzo]
ref|XP_006357316.1|  PREDICTED: probable inactive receptor kinase...    234   8e-69   Solanum tuberosum [potatoes]
ref|XP_009384331.1|  PREDICTED: probable inactive receptor kinase...    234   1e-68   Musa acuminata subsp. malaccensis [pisang utan]
gb|KCW50324.1|  hypothetical protein EUGRSUZ_J00100                     234   2e-68   Eucalyptus grandis [rose gum]
ref|XP_008788112.1|  PREDICTED: probable inactive receptor kinase...    234   2e-68   Phoenix dactylifera
ref|XP_008456255.1|  PREDICTED: probable inactive receptor kinase...    233   2e-68   
ref|XP_010031063.1|  PREDICTED: probable inactive receptor kinase...    233   2e-68   
ref|XP_010653700.1|  PREDICTED: probable inactive receptor kinase...    233   3e-68   
emb|CAN80590.1|  hypothetical protein VITISV_040789                     233   3e-68   Vitis vinifera
ref|XP_004139930.1|  PREDICTED: probable inactive receptor kinase...    233   3e-68   Cucumis sativus [cucumbers]
ref|XP_010653698.1|  PREDICTED: probable inactive receptor kinase...    233   5e-68   
ref|XP_004302522.1|  PREDICTED: probable inactive receptor kinase...    232   6e-68   Fragaria vesca subsp. vesca
gb|KHN40012.1|  Putative inactive receptor kinase                       219   2e-67   Glycine soja [wild soybean]
ref|XP_010683449.1|  PREDICTED: probable inactive receptor kinase...    230   3e-67   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010683445.1|  PREDICTED: probable inactive receptor kinase...    230   3e-67   Beta vulgaris subsp. vulgaris [field beet]
gb|KDP21848.1|  hypothetical protein JCGZ_00635                         231   3e-67   Jatropha curcas
ref|XP_010323112.1|  PREDICTED: probable inactive receptor kinase...    229   6e-67   
gb|KJB71491.1|  hypothetical protein B456_011G125200                    229   7e-67   Gossypium raimondii
ref|XP_002528709.1|  Nodulation receptor kinase precursor, putative     229   7e-67   Ricinus communis
ref|XP_009410507.1|  PREDICTED: probable inactive receptor kinase...    229   8e-67   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHN48152.1|  Putative inactive receptor kinase                       218   1e-66   Glycine soja [wild soybean]
gb|KHN25793.1|  Putative inactive receptor kinase                       229   1e-66   Glycine soja [wild soybean]
ref|XP_007011392.1|  Leucine-rich repeat protein kinase family pr...    229   1e-66   Theobroma cacao [chocolate]
ref|XP_007011393.1|  Leucine-rich repeat protein kinase family pr...    228   1e-66   
gb|EYU35188.1|  hypothetical protein MIMGU_mgv1a002709mg                228   2e-66   Erythranthe guttata [common monkey flower]
ref|XP_006280146.1|  hypothetical protein CARUB_v10026045mg             228   3e-66   
gb|KEH35517.1|  receptor-like kinase                                    227   5e-66   Medicago truncatula
ref|XP_010483401.1|  PREDICTED: probable inactive receptor kinase...    228   5e-66   
ref|XP_003526789.1|  PREDICTED: probable inactive receptor kinase...    227   6e-66   
ref|XP_004502808.1|  PREDICTED: probable inactive receptor kinase...    227   7e-66   Cicer arietinum [garbanzo]
ref|XP_010443551.1|  PREDICTED: probable inactive receptor kinase...    226   1e-65   Camelina sativa [gold-of-pleasure]
ref|XP_008813233.1|  PREDICTED: probable inactive receptor kinase...    226   1e-65   Phoenix dactylifera
ref|XP_010453493.1|  PREDICTED: probable inactive receptor kinase...    226   1e-65   Camelina sativa [gold-of-pleasure]
ref|XP_009772876.1|  PREDICTED: probable inactive receptor kinase...    226   2e-65   Nicotiana sylvestris
ref|XP_002864562.1|  predicted protein                                  226   2e-65   Arabidopsis lyrata subsp. lyrata
ref|NP_200638.1|  leucine-rich repeat protein kinase family protein     226   3e-65   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006401105.1|  hypothetical protein EUTSA_v10012925mg             225   3e-65   Eutrema salsugineum [saltwater cress]
emb|CDY58565.1|  BnaC03g12450D                                          225   4e-65   Brassica napus [oilseed rape]
ref|XP_008366817.1|  PREDICTED: probable inactive receptor kinase...    225   4e-65   
ref|XP_010541472.1|  PREDICTED: probable inactive receptor kinase...    224   4e-65   Tarenaya hassleriana [spider flower]
ref|XP_010921194.1|  PREDICTED: probable inactive receptor kinase...    218   4e-65   Elaeis guineensis
ref|XP_009590190.1|  PREDICTED: probable inactive receptor kinase...    224   5e-65   Nicotiana tomentosiformis
ref|XP_007136405.1|  hypothetical protein PHAVU_009G042300g             224   5e-65   Phaseolus vulgaris [French bean]
ref|XP_009798129.1|  PREDICTED: probable inactive receptor kinase...    224   6e-65   Nicotiana sylvestris
ref|XP_007220535.1|  hypothetical protein PRUPE_ppa002812mg             224   6e-65   Prunus persica
ref|XP_009132067.1|  PREDICTED: probable inactive receptor kinase...    224   6e-65   Brassica rapa
ref|XP_009337799.1|  PREDICTED: probable inactive receptor kinase...    224   6e-65   
ref|XP_010541471.1|  PREDICTED: probable inactive receptor kinase...    224   7e-65   
ref|XP_006356869.1|  PREDICTED: probable inactive receptor kinase...    224   8e-65   Solanum tuberosum [potatoes]
ref|XP_008234182.1|  PREDICTED: probable inactive receptor kinase...    223   8e-65   Prunus mume [ume]
ref|XP_011095165.1|  PREDICTED: probable inactive receptor kinase...    223   2e-64   Sesamum indicum [beniseed]
ref|XP_009406050.1|  PREDICTED: probable inactive receptor kinase...    223   2e-64   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009386109.1|  PREDICTED: probable inactive receptor kinase...    222   3e-64   Musa acuminata subsp. malaccensis [pisang utan]
gb|ACA61611.1|  hypothetical protein AP2_E06.2                          222   5e-64   Arabidopsis lyrata subsp. petraea
emb|CDY02808.1|  BnaC02g10810D                                          217   5e-64   
ref|XP_010938046.1|  PREDICTED: probable inactive receptor kinase...    221   7e-64   Elaeis guineensis
gb|KEH23299.1|  LRR receptor-like kinase                                220   1e-63   Medicago truncatula
ref|XP_003523287.1|  PREDICTED: probable inactive receptor kinase...    221   2e-63   Glycine max [soybeans]
ref|XP_004246956.1|  PREDICTED: probable inactive receptor kinase...    220   2e-63   Solanum lycopersicum
ref|XP_010938045.1|  PREDICTED: probable inactive receptor kinase...    221   2e-63   Elaeis guineensis
ref|XP_010670041.1|  PREDICTED: probable inactive receptor kinase...    219   3e-63   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006587908.1|  PREDICTED: probable inactive receptor kinase...    219   4e-63   Glycine max [soybeans]
dbj|BAH57151.1|  AT3G08680                                              209   5e-63   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006602721.1|  PREDICTED: probable inactive receptor kinase...    218   8e-63   Glycine max [soybeans]
ref|XP_009607078.1|  PREDICTED: probable inactive receptor kinase...    218   9e-63   
ref|XP_003518282.1|  PREDICTED: probable inactive receptor kinase...    219   9e-63   Glycine max [soybeans]
ref|XP_003544853.1|  PREDICTED: probable inactive receptor kinase...    218   1e-62   Glycine max [soybeans]
ref|NP_001169737.1|  uncharacterized LOC100383618 precursor             218   1e-62   Zea mays [maize]
gb|KHN40609.1|  Putative inactive receptor kinase                       217   2e-62   Glycine soja [wild soybean]
ref|XP_010921193.1|  PREDICTED: probable inactive receptor kinase...    217   3e-62   Elaeis guineensis
ref|XP_008810859.1|  PREDICTED: probable inactive receptor kinase...    217   3e-62   Phoenix dactylifera
ref|XP_010109178.1|  putative inactive receptor kinase                  217   4e-62   
ref|XP_007140053.1|  hypothetical protein PHAVU_008G080500g             216   4e-62   Phaseolus vulgaris [French bean]
ref|XP_004958707.1|  PREDICTED: probable inactive receptor kinase...    216   4e-62   Setaria italica
ref|XP_007141331.1|  hypothetical protein PHAVU_008G186900g             217   4e-62   Phaseolus vulgaris [French bean]
emb|CDY32713.1|  BnaA02g07750D                                          216   6e-62   Brassica napus [oilseed rape]
ref|XP_008810858.1|  PREDICTED: probable inactive receptor kinase...    217   7e-62   Phoenix dactylifera
ref|XP_002463400.1|  hypothetical protein SORBIDRAFT_02g043090          216   9e-62   Sorghum bicolor [broomcorn]
ref|XP_009126766.1|  PREDICTED: probable inactive receptor kinase...    215   1e-61   Brassica rapa
ref|XP_006658137.1|  PREDICTED: probable inactive receptor kinase...    215   2e-61   Oryza brachyantha
ref|XP_009391668.1|  PREDICTED: probable inactive receptor kinase...    215   2e-61   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009363779.1|  PREDICTED: probable inactive receptor kinase...    214   2e-61   Pyrus x bretschneideri [bai li]
ref|XP_004308997.1|  PREDICTED: probable inactive receptor kinase...    215   2e-61   Fragaria vesca subsp. vesca
gb|EAZ05160.1|  hypothetical protein OsI_27356                          214   3e-61   Oryza sativa Indica Group [Indian rice]
ref|NP_001060650.1|  Os07g0681100                                       214   3e-61   
emb|CDY03526.1|  BnaC01g15560D                                          204   4e-61   
gb|EEC75189.1|  hypothetical protein OsI_11426                          210   1e-60   Oryza sativa Indica Group [Indian rice]
gb|ACN57540.1|  At2g26730-like protein                                  200   2e-60   Capsella grandiflora
ref|XP_008388375.1|  PREDICTED: probable inactive receptor kinase...    212   2e-60   
gb|ACN57533.1|  At2g26730-like protein                                  200   3e-60   Capsella grandiflora
ref|XP_004492584.1|  PREDICTED: probable inactive receptor kinase...    211   3e-60   Cicer arietinum [garbanzo]
ref|XP_008376328.1|  PREDICTED: probable inactive receptor kinase...    211   3e-60   Malus domestica [apple tree]
emb|CDX88667.1|  BnaA03g09820D                                          211   4e-60   
gb|ACN57520.1|  At2g26730-like protein                                  199   5e-60   Capsella rubella
ref|XP_010463311.1|  PREDICTED: LOW QUALITY PROTEIN: probable ina...    211   6e-60   Camelina sativa [gold-of-pleasure]
ref|XP_010043603.1|  PREDICTED: probable inactive receptor kinase...    210   6e-60   Eucalyptus grandis [rose gum]
ref|XP_002882579.1|  hypothetical protein ARALYDRAFT_478170             211   8e-60   
gb|EPS74415.1|  hypothetical protein M569_00340                         210   8e-60   Genlisea aurea
gb|KEH21182.1|  LRR receptor-like kinase                                210   9e-60   Medicago truncatula
ref|XP_010543666.1|  PREDICTED: probable leucine-rich repeat rece...    211   1e-59   Tarenaya hassleriana [spider flower]
ref|XP_003562443.1|  PREDICTED: probable inactive receptor kinase...    210   1e-59   Brachypodium distachyon [annual false brome]
ref|NP_001050019.1|  Os03g0332900                                       210   1e-59   
ref|XP_009146990.1|  PREDICTED: probable inactive receptor kinase...    210   1e-59   Brassica rapa
ref|XP_010543665.1|  PREDICTED: probable leucine-rich repeat rece...    211   1e-59   
gb|KHN25658.1|  Putative inactive receptor kinase                       205   1e-59   Glycine soja [wild soybean]
emb|CDY35996.1|  BnaA05g29540D                                          210   1e-59   Brassica napus [oilseed rape]
gb|EYU42048.1|  hypothetical protein MIMGU_mgv1a003031mg                209   2e-59   Erythranthe guttata [common monkey flower]
ref|XP_006297193.1|  hypothetical protein CARUB_v10013201mg             209   2e-59   Capsella rubella
ref|XP_002960794.1|  hypothetical protein SELMODRAFT_74002              209   2e-59   
gb|EMT09037.1|  Putative inactive receptor kinase                       209   2e-59   
ref|NP_187480.1|  leucine-rich repeat protein kinase family protein     209   2e-59   Arabidopsis thaliana [mouse-ear cress]
gb|ACN57547.1|  At2g26730-like protein                                  197   2e-59   Capsella grandiflora
ref|XP_009362808.1|  PREDICTED: LOW QUALITY PROTEIN: probable ina...    207   2e-59   
gb|KDP25339.1|  hypothetical protein JCGZ_20495                         209   3e-59   Jatropha curcas
ref|XP_006407752.1|  hypothetical protein EUTSA_v10020278mg             209   3e-59   Eutrema salsugineum [saltwater cress]
ref|XP_010464477.1|  PREDICTED: probable inactive receptor kinase...    209   3e-59   Camelina sativa [gold-of-pleasure]
ref|XP_009362770.1|  PREDICTED: probable inactive receptor kinase...    209   4e-59   
ref|NP_196135.1|  putative leucine-rich repeat receptor-like prot...    208   8e-59   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006650037.1|  PREDICTED: probable inactive receptor kinase...    207   8e-59   
ref|XP_002871141.1|  hypothetical protein ARALYDRAFT_325150             207   9e-59   Arabidopsis lyrata subsp. lyrata
gb|KHN16761.1|  Putative inactive receptor kinase                       201   1e-58   Glycine soja [wild soybean]
emb|CDY27986.1|  BnaC05g43880D                                          207   1e-58   Brassica napus [oilseed rape]
gb|ACN57550.1|  At2g26730-like protein                                  196   1e-58   Capsella grandiflora
ref|XP_009122125.1|  PREDICTED: probable leucine-rich repeat rece...    207   1e-58   Brassica rapa
gb|AES98409.2|  LRR receptor-like kinase                                207   1e-58   Medicago truncatula
gb|EEE55588.1|  hypothetical protein OsJ_03884                          197   2e-58   Oryza sativa Japonica Group [Japonica rice]
emb|CDX98821.1|  BnaC09g50140D                                          207   2e-58   
ref|XP_002509916.1|  ATP binding protein, putative                      205   2e-58   
ref|XP_003615451.1|  Leucine-rich repeat receptor-like protein ki...    207   3e-58   
emb|CDY22164.1|  BnaC01g39370D                                          205   3e-58   Brassica napus [oilseed rape]
dbj|BAK07296.1|  predicted protein                                      206   3e-58   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002303623.1|  leucine-rich repeat transmembrane protein ki...    206   3e-58   Populus trichocarpa [western balsam poplar]
gb|KFK24939.1|  hypothetical protein AALP_AA8G045400                    206   3e-58   Arabis alpina [alpine rockcress]
dbj|BAJ93317.1|  predicted protein                                      206   4e-58   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006398978.1|  hypothetical protein EUTSA_v10012946mg             206   4e-58   Eutrema salsugineum [saltwater cress]
ref|XP_006590496.1|  PREDICTED: probable inactive receptor kinase...    205   5e-58   Glycine max [soybeans]
ref|XP_009399835.1|  PREDICTED: probable inactive receptor kinase...    206   5e-58   Musa acuminata subsp. malaccensis [pisang utan]
gb|KEH35437.1|  receptor-like kinase                                    199   6e-58   Medicago truncatula
gb|EMT12910.1|  Putative inactive receptor kinase                       205   7e-58   
ref|XP_009399834.1|  PREDICTED: probable inactive receptor kinase...    206   7e-58   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001168214.1|  uncharacterized protein LOC100381972               196   8e-58   
ref|XP_007040424.1|  Leucine-rich repeat protein kinase family pr...    205   8e-58   
ref|XP_009137362.1|  PREDICTED: probable inactive receptor kinase...    205   8e-58   Brassica rapa
ref|XP_003516715.2|  PREDICTED: probable inactive receptor kinase...    205   9e-58   Glycine max [soybeans]
ref|XP_009123870.1|  PREDICTED: probable inactive receptor kinase...    204   1e-57   Brassica rapa
emb|CDY47625.1|  BnaA01g13400D                                          205   1e-57   Brassica napus [oilseed rape]
ref|XP_006413522.1|  hypothetical protein EUTSA_v10024674mg             204   1e-57   Eutrema salsugineum [saltwater cress]
ref|XP_002299495.1|  leucine-rich repeat transmembrane protein ki...    204   1e-57   Populus trichocarpa [western balsam poplar]
ref|XP_010491047.1|  PREDICTED: probable leucine-rich repeat rece...    204   2e-57   Camelina sativa [gold-of-pleasure]
ref|XP_008437363.1|  PREDICTED: probable inactive receptor kinase...    204   2e-57   
ref|XP_010047774.1|  PREDICTED: probable inactive receptor kinase...    204   2e-57   Eucalyptus grandis [rose gum]
ref|XP_004167870.1|  PREDICTED: LOW QUALITY PROTEIN: probable ina...    204   2e-57   
ref|XP_011022559.1|  PREDICTED: probable inactive receptor kinase...    204   2e-57   Populus euphratica
ref|XP_004143879.1|  PREDICTED: probable inactive receptor kinase...    204   2e-57   Cucumis sativus [cucumbers]
gb|KJB27114.1|  hypothetical protein B456_004G278900                    204   2e-57   Gossypium raimondii
ref|XP_004511532.1|  PREDICTED: probable inactive receptor kinase...    197   2e-57   Cicer arietinum [garbanzo]
ref|XP_010423497.1|  PREDICTED: probable leucine-rich repeat rece...    204   2e-57   Camelina sativa [gold-of-pleasure]
ref|XP_010688116.1|  PREDICTED: probable inactive receptor kinase...    204   2e-57   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004149854.1|  PREDICTED: probable inactive receptor kinase...    204   3e-57   Cucumis sativus [cucumbers]
ref|XP_006475765.1|  PREDICTED: probable inactive receptor kinase...    204   3e-57   Citrus sinensis [apfelsine]
ref|XP_010915719.1|  PREDICTED: probable inactive receptor kinase...    204   3e-57   
ref|XP_002456542.1|  hypothetical protein SORBIDRAFT_03g038110          204   3e-57   Sorghum bicolor [broomcorn]
ref|XP_006289209.1|  hypothetical protein CARUB_v10002657mg             204   3e-57   Capsella rubella
ref|XP_010557581.1|  PREDICTED: probable inactive receptor kinase...    204   3e-57   Tarenaya hassleriana [spider flower]
ref|XP_004167125.1|  PREDICTED: LOW QUALITY PROTEIN: probable ina...    204   3e-57   
ref|XP_002281635.1|  PREDICTED: probable inactive receptor kinase...    204   4e-57   Vitis vinifera
ref|XP_008463343.1|  PREDICTED: probable inactive receptor kinase...    204   4e-57   Cucumis melo [Oriental melon]
gb|KDO76442.1|  hypothetical protein CISIN_1g006922mg                   203   4e-57   Citrus sinensis [apfelsine]
ref|XP_006439412.1|  hypothetical protein CICLE_v10019314mg             203   4e-57   Citrus clementina [clementine]
ref|XP_008439323.1|  PREDICTED: probable inactive receptor kinase...    203   4e-57   Cucumis melo [Oriental melon]
ref|XP_006476438.1|  PREDICTED: probable inactive receptor kinase...    203   4e-57   Citrus sinensis [apfelsine]
ref|XP_004503646.1|  PREDICTED: probable inactive receptor kinase...    203   5e-57   Cicer arietinum [garbanzo]
ref|XP_006451034.1|  hypothetical protein CICLE_v10007694mg             203   5e-57   
ref|XP_002991819.1|  hypothetical protein SELMODRAFT_42017              202   5e-57   
gb|KHN00038.1|  Putative inactive receptor kinase                       193   5e-57   Glycine soja [wild soybean]
ref|XP_004970381.1|  PREDICTED: probable inactive receptor kinase...    202   8e-57   Setaria italica
ref|XP_010658906.1|  PREDICTED: probable inactive receptor kinase...    202   1e-56   Vitis vinifera
gb|KJB54134.1|  hypothetical protein B456_009G022300                    202   1e-56   Gossypium raimondii
ref|XP_006580544.1|  PREDICTED: probable inactive receptor kinase...    202   1e-56   Glycine max [soybeans]
ref|XP_003611028.1|  Probably inactive receptor-like protein kinase     201   1e-56   Medicago truncatula
gb|KHG24076.1|  hypothetical protein F383_10304                         202   1e-56   Gossypium arboreum [tree cotton]
ref|XP_004149452.1|  PREDICTED: probable inactive receptor kinase...    201   2e-56   
ref|NP_194105.1|  Leucine-rich repeat protein kinase family protein     201   2e-56   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002324958.1|  leucine-rich repeat transmembrane protein ki...    201   2e-56   
ref|XP_011009200.1|  PREDICTED: probable inactive receptor kinase...    201   2e-56   
ref|XP_004490516.1|  PREDICTED: probable inactive receptor kinase...    201   2e-56   
ref|XP_010452417.1|  PREDICTED: probable leucine-rich repeat rece...    201   2e-56   
ref|XP_002992978.1|  hypothetical protein SELMODRAFT_270002             201   2e-56   
ref|XP_004287382.1|  PREDICTED: probable inactive receptor kinase...    201   2e-56   
ref|XP_007158557.1|  hypothetical protein PHAVU_002G162400g             200   3e-56   
ref|XP_004502606.1|  PREDICTED: probable inactive receptor kinase...    200   3e-56   
ref|XP_008388374.1|  PREDICTED: probable inactive receptor kinase...    201   3e-56   
gb|AFK45382.1|  unknown                                                 200   3e-56   
ref|XP_008793541.1|  PREDICTED: probable inactive receptor kinase...    200   4e-56   
gb|KHN37771.1|  Putative inactive receptor kinase                       193   4e-56   
ref|XP_008793397.1|  PREDICTED: probable inactive receptor kinase...    201   4e-56   
ref|XP_009137388.1|  PREDICTED: probable inactive receptor kinase...    200   4e-56   
gb|ACC91242.1|  leucine-rich repeat transmembrane protein kinase        200   4e-56   
ref|XP_006584744.1|  PREDICTED: probable inactive receptor kinase...    201   4e-56   
ref|XP_004502605.1|  PREDICTED: probable inactive receptor kinase...    200   4e-56   
ref|XP_010538821.1|  PREDICTED: probable inactive receptor kinase...    200   4e-56   
emb|CDP03386.1|  unnamed protein product                                201   4e-56   
ref|XP_007013302.1|  Leucine-rich repeat protein kinase family pr...    201   5e-56   
emb|CDX94213.1|  BnaC07g38470D                                          200   5e-56   
ref|XP_010417819.1|  PREDICTED: probable inactive receptor kinase...    200   5e-56   
ref|XP_010473057.1|  PREDICTED: probable inactive receptor kinase...    200   5e-56   
ref|XP_010448663.1|  PREDICTED: probable inactive receptor kinase...    200   6e-56   
ref|XP_001774015.1|  predicted protein                                  199   6e-56   
gb|AET05610.2|  LRR receptor-like kinase                                200   6e-56   
ref|XP_008794990.1|  PREDICTED: probable inactive receptor kinase...    200   7e-56   
ref|XP_002529343.1|  Nodulation receptor kinase precursor, putative     200   7e-56   
ref|XP_010433865.1|  PREDICTED: probable inactive receptor kinase...    200   8e-56   
ref|XP_003631134.1|  Atypical receptor-like kinase MARK                 201   8e-56   
ref|XP_003557981.1|  PREDICTED: probable inactive receptor kinase...    199   8e-56   
ref|XP_007160136.1|  hypothetical protein PHAVU_002G295600g             199   9e-56   
ref|XP_009796898.1|  PREDICTED: probable inactive receptor kinase...    199   9e-56   
gb|AFK38063.1|  unknown                                                 187   9e-56   
emb|CDY04464.1|  BnaA07g12900D                                          199   9e-56   
ref|XP_004139332.1|  PREDICTED: probable inactive receptor kinase...    199   1e-55   
ref|XP_004236305.1|  PREDICTED: probable inactive receptor kinase...    199   1e-55   
ref|XP_002879005.1|  hypothetical protein ARALYDRAFT_481544             199   1e-55   
ref|XP_008343962.1|  PREDICTED: probable inactive receptor kinase...    199   1e-55   
ref|XP_008386031.1|  PREDICTED: probable inactive receptor kinase...    199   1e-55   
ref|XP_011076041.1|  PREDICTED: probable inactive receptor kinase...    199   1e-55   
ref|XP_004300851.1|  PREDICTED: probable inactive receptor kinase...    199   1e-55   
ref|XP_004167200.1|  PREDICTED: LOW QUALITY PROTEIN: probable ina...    199   1e-55   
gb|ACZ98536.1|  protein kinase                                          199   1e-55   
ref|XP_008239079.1|  PREDICTED: probable inactive receptor kinase...    199   1e-55   
ref|XP_011026938.1|  PREDICTED: probable inactive receptor kinase...    199   1e-55   
ref|XP_009140749.1|  PREDICTED: probable inactive receptor kinase...    199   2e-55   
ref|XP_006397367.1|  hypothetical protein EUTSA_v10022498mg             199   2e-55   
ref|XP_006293818.1|  hypothetical protein CARUB_v10022800mg             199   2e-55   
ref|XP_006283316.1|  hypothetical protein CARUB_v10004355mg             198   2e-55   
gb|EYU23030.1|  hypothetical protein MIMGU_mgv1a002522mg                199   2e-55   
ref|XP_008458016.1|  PREDICTED: probable inactive receptor kinase...    199   2e-55   
emb|CDX71488.1|  BnaC04g17230D                                          200   2e-55   
ref|NP_180241.1|  leucine-rich repeat protein kinase family protein     199   2e-55   
ref|XP_009597502.1|  PREDICTED: probable inactive receptor kinase...    199   2e-55   
ref|XP_011026937.1|  PREDICTED: probable inactive receptor kinase...    199   2e-55   
gb|EAY91619.1|  hypothetical protein OsI_13254                          189   2e-55   
gb|AAK92807.1|  putative receptor protein kinase                        199   2e-55   
gb|KHG18372.1|  hypothetical protein F383_03411                         199   2e-55   
ref|XP_009103556.1|  PREDICTED: LOW QUALITY PROTEIN: probable ina...    199   2e-55   
ref|XP_010098956.1|  putative inactive receptor kinase                  199   2e-55   
gb|EMT17815.1|  Putative inactive receptor kinase                       198   2e-55   
gb|KJB64834.1|  hypothetical protein B456_010G067400                    199   2e-55   
gb|KDP32336.1|  hypothetical protein JCGZ_13261                         199   2e-55   
gb|KJB19053.1|  hypothetical protein B456_003G082600                    198   2e-55   
ref|NP_001051064.1|  Os03g0712400                                       188   3e-55   
ref|XP_006283317.1|  hypothetical protein CARUB_v10004355mg             198   3e-55   
ref|XP_006579204.1|  PREDICTED: probable inactive receptor kinase...    194   3e-55   
ref|XP_007204237.1|  hypothetical protein PRUPE_ppa002548mg             199   3e-55   
ref|XP_009782917.1|  PREDICTED: probable inactive receptor kinase...    198   3e-55   
ref|XP_010925785.1|  PREDICTED: probable inactive receptor kinase...    198   3e-55   
ref|XP_002317741.1|  hypothetical protein POPTR_0012s01230g             198   3e-55   
ref|XP_009374078.1|  PREDICTED: probable inactive receptor kinase...    197   3e-55   
ref|XP_007210296.1|  hypothetical protein PRUPE_ppa002579mg             198   3e-55   
ref|XP_009336254.1|  PREDICTED: probable inactive receptor kinase...    198   4e-55   
ref|XP_009371417.1|  PREDICTED: probable inactive receptor kinase...    198   4e-55   
ref|XP_004511531.1|  PREDICTED: probable inactive receptor kinase...    197   4e-55   
ref|XP_006351444.1|  PREDICTED: probable inactive receptor kinase...    198   4e-55   
ref|XP_011084477.1|  PREDICTED: LOW QUALITY PROTEIN: probable ina...    197   6e-55   
ref|XP_009628885.1|  PREDICTED: probable inactive receptor kinase...    197   6e-55   
ref|XP_010251541.1|  PREDICTED: probable inactive receptor kinase...    197   6e-55   
ref|XP_009380537.1|  PREDICTED: probable inactive receptor kinase...    197   6e-55   
gb|EYU23390.1|  hypothetical protein MIMGU_mgv1a003016mg                197   6e-55   
dbj|BAB62593.1|  putative receptor-like protein kinase                  197   7e-55   
ref|XP_008242698.1|  PREDICTED: probable inactive receptor kinase...    197   7e-55   
ref|XP_003564492.1|  PREDICTED: probable inactive receptor kinase...    197   7e-55   
emb|CDY48185.1|  BnaA04g15490D                                          197   8e-55   
ref|XP_010533192.1|  PREDICTED: probable inactive receptor kinase...    197   1e-54   
ref|XP_008381374.1|  PREDICTED: probable inactive receptor kinase...    187   1e-54   
ref|XP_010541406.1|  PREDICTED: probable inactive receptor kinase...    196   1e-54   
gb|KJB07168.1|  hypothetical protein B456_001G003200                    196   1e-54   
ref|XP_010104998.1|  putative inactive receptor kinase                  196   1e-54   
gb|KHN09234.1|  Putative inactive receptor kinase                       191   2e-54   
ref|XP_001778286.1|  predicted protein                                  196   2e-54   
ref|XP_010662595.1|  PREDICTED: probable inactive receptor kinase...    196   2e-54   
ref|XP_009409433.1|  PREDICTED: probable inactive receptor kinase...    196   2e-54   
ref|XP_009614171.1|  PREDICTED: probable inactive receptor kinase...    196   2e-54   
ref|XP_004245544.1|  PREDICTED: probable inactive receptor kinase...    196   2e-54   
tpg|DAA57078.1|  TPA: putative leucine-rich repeat receptor-like ...    196   2e-54   
gb|KHN00136.1|  Putative inactive receptor kinase                       195   2e-54   
gb|ACU19868.1|  unknown                                                 187   2e-54   
ref|XP_011001931.1|  PREDICTED: probable inactive receptor kinase...    196   2e-54   
gb|KHN10529.1|  Putative inactive receptor kinase                       193   3e-54   
ref|XP_011080874.1|  PREDICTED: probable inactive receptor kinase...    195   3e-54   
ref|XP_011001936.1|  PREDICTED: probable inactive receptor kinase...    195   3e-54   
ref|XP_002869766.1|  hypothetical protein ARALYDRAFT_914223             195   3e-54   
ref|XP_004503256.1|  PREDICTED: probable inactive receptor kinase...    196   4e-54   
ref|XP_006350601.1|  PREDICTED: probable inactive receptor kinase...    195   4e-54   
ref|XP_006343895.1|  PREDICTED: probable inactive receptor kinase...    195   5e-54   
ref|XP_003530966.1|  PREDICTED: probable inactive receptor kinase...    195   5e-54   
emb|CBI22555.3|  unnamed protein product                                195   5e-54   
emb|CDP12117.1|  unnamed protein product                                195   5e-54   
ref|XP_009629119.1|  PREDICTED: probable inactive receptor kinase...    195   5e-54   
ref|XP_003568238.1|  PREDICTED: probable inactive receptor kinase...    194   6e-54   
ref|XP_009767272.1|  PREDICTED: probable inactive receptor kinase...    194   7e-54   
ref|XP_003602176.1|  Leucine-rich repeat receptor-like protein ki...    197   8e-54   
ref|XP_007160555.1|  hypothetical protein PHAVU_002G331400g             194   8e-54   
ref|XP_010053173.1|  PREDICTED: probable inactive receptor kinase...    194   8e-54   
ref|XP_011084098.1|  PREDICTED: probable inactive receptor kinase...    194   8e-54   
ref|XP_009799943.1|  PREDICTED: probable inactive receptor kinase...    194   9e-54   
ref|XP_002441272.1|  hypothetical protein SORBIDRAFT_09g023570          194   9e-54   
ref|NP_001168611.1|  uncharacterized LOC100382395 precursor             194   9e-54   
ref|XP_002513601.1|  ATP binding protein, putative                      194   1e-53   
gb|KFK32479.1|  hypothetical protein AALP_AA6G247800                    194   1e-53   
ref|XP_010249925.1|  PREDICTED: probable inactive receptor kinase...    194   1e-53   
ref|XP_003527143.1|  PREDICTED: probable inactive receptor kinase...    194   2e-53   
ref|NP_001130388.1|  uncharacterized LOC100191484 precursor             193   2e-53   
gb|AES72427.2|  LRR receptor-like kinase                                193   2e-53   
ref|XP_007032119.1|  Receptor-like kinase 1                             193   2e-53   
ref|XP_010055829.1|  PREDICTED: probable inactive receptor kinase...    193   2e-53   
ref|XP_010271320.1|  PREDICTED: probable inactive receptor kinase...    193   2e-53   
ref|XP_010254253.1|  PREDICTED: probable inactive receptor kinase...    193   3e-53   
gb|EEE59802.1|  hypothetical protein OsJ_12326                          187   3e-53   
ref|XP_004961732.1|  PREDICTED: probable inactive receptor kinase...    192   3e-53   
ref|XP_007154939.1|  hypothetical protein PHAVU_003G159700g             192   3e-53   
ref|XP_007038934.1|  Leucine-rich repeat protein kinase family pr...    192   3e-53   
ref|NP_001042446.1|  Os01g0223600                                       190   4e-53   
ref|XP_008813619.1|  PREDICTED: probable inactive receptor kinase...    188   5e-53   
ref|XP_003525182.1|  PREDICTED: probable inactive receptor kinase...    192   5e-53   
ref|XP_011073578.1|  PREDICTED: probable inactive receptor kinase...    192   6e-53   
gb|EMT08914.1|  Putative inactive receptor kinase                       188   6e-53   
ref|XP_008649769.1|  PREDICTED: probable inactive receptor kinase...    192   6e-53   
emb|CBI33513.3|  unnamed protein product                                191   6e-53   
ref|XP_002276147.1|  PREDICTED: probable inactive receptor kinase...    192   7e-53   
ref|XP_001752184.1|  predicted protein                                  192   8e-53   
ref|XP_006644911.1|  PREDICTED: probable inactive receptor kinase...    191   8e-53   
gb|KHN43642.1|  Putative inactive receptor kinase                       188   8e-53   
ref|XP_006654545.1|  PREDICTED: probable inactive receptor kinase...    191   9e-53   
ref|XP_010268752.1|  PREDICTED: probable inactive receptor kinase...    192   9e-53   
gb|EYU25187.1|  hypothetical protein MIMGU_mgv1a002923mg                191   9e-53   
tpg|DAA37428.1|  TPA: putative leucine-rich repeat receptor-like ...    191   1e-52   
ref|XP_002987022.1|  hypothetical protein SELMODRAFT_41782              191   1e-52   
ref|XP_009390354.1|  PREDICTED: probable inactive receptor kinase...    191   1e-52   
ref|XP_010059849.1|  PREDICTED: probable inactive receptor kinase...    191   1e-52   
ref|XP_010916205.1|  PREDICTED: probable inactive receptor kinase...    191   1e-52   
ref|XP_007220432.1|  hypothetical protein PRUPE_ppa002831mg             191   2e-52   
emb|CDP05105.1|  unnamed protein product                                191   2e-52   
ref|XP_008669312.1|  PREDICTED: probable inactive receptor kinase...    191   2e-52   
ref|XP_004308019.1|  PREDICTED: probable inactive receptor kinase...    191   2e-52   
gb|KHN08297.1|  Putative inactive receptor kinase                       190   2e-52   
ref|XP_002972265.1|  hypothetical protein SELMODRAFT_267563             190   2e-52   
ref|XP_008669311.1|  PREDICTED: probable inactive receptor kinase...    191   2e-52   
gb|KDP22183.1|  hypothetical protein JCGZ_26014                         190   2e-52   
ref|XP_002985547.1|  hypothetical protein SELMODRAFT_234818             191   2e-52   
ref|XP_001778285.1|  predicted protein                                  191   2e-52   
ref|XP_006596280.1|  PREDICTED: probable inactive receptor kinase...    190   2e-52   
ref|XP_003609204.1|  hypothetical protein MTR_4g113100                  191   2e-52   
ref|XP_010916177.1|  PREDICTED: probable inactive receptor kinase...    190   2e-52   
gb|EEE64112.1|  hypothetical protein OsJ_18944                          190   3e-52   
ref|NP_001055854.1|  Os05g0480400                                       190   3e-52   
ref|XP_002984179.1|  hypothetical protein SELMODRAFT_156455             189   3e-52   
gb|KHN23405.1|  Putative inactive receptor kinase                       190   3e-52   
ref|XP_008466324.1|  PREDICTED: probable inactive receptor kinase...    190   3e-52   
ref|XP_009352353.1|  PREDICTED: probable inactive receptor kinase...    190   3e-52   
gb|ACL52878.1|  unknown                                                 181   3e-52   
ref|XP_011007941.1|  PREDICTED: probable inactive receptor kinase...    189   4e-52   
ref|XP_008234792.1|  PREDICTED: probable inactive receptor kinase...    189   4e-52   
ref|XP_010097875.1|  putative inactive receptor kinase                  189   4e-52   
gb|KDO56147.1|  hypothetical protein CISIN_1g007167mg                   189   4e-52   
ref|XP_004145847.1|  PREDICTED: probable inactive receptor kinase...    189   5e-52   
gb|KJB43131.1|  hypothetical protein B456_007G186000                    189   5e-52   
gb|KJB52632.1|  hypothetical protein B456_008G271600                    189   5e-52   
gb|KJB10488.1|  hypothetical protein B456_001G203900                    189   5e-52   
gb|EPS63924.1|  hypothetical protein M569_10855                         189   5e-52   
ref|XP_002454913.1|  hypothetical protein SORBIDRAFT_03g001310          188   5e-52   
ref|XP_010676354.1|  PREDICTED: probable inactive receptor kinase...    189   5e-52   
gb|KHG20222.1|  putative inactive receptor kinase -like protein         189   6e-52   
dbj|BAJ89083.1|  predicted protein                                      189   6e-52   
ref|XP_004508557.1|  PREDICTED: probable inactive receptor kinase...    189   6e-52   
ref|XP_004137511.1|  PREDICTED: probable inactive receptor kinase...    189   6e-52   
ref|XP_008775508.1|  PREDICTED: LOW QUALITY PROTEIN: probable ina...    189   7e-52   
ref|XP_009381014.1|  PREDICTED: probable inactive receptor kinase...    189   7e-52   
ref|XP_003526687.1|  PREDICTED: probable inactive receptor kinase...    189   7e-52   
dbj|BAA94519.1|  putative receptor-like kinase                          189   8e-52   
gb|KHG20593.1|  putative inactive receptor kinase -like protein         188   9e-52   
ref|XP_006374322.1|  hypothetical protein POPTR_0015s06040g             189   9e-52   
ref|XP_010925124.1|  PREDICTED: probable inactive receptor kinase...    189   9e-52   
emb|CAN82203.1|  hypothetical protein VITISV_018964                     189   9e-52   
ref|XP_004163815.1|  PREDICTED: probable inactive receptor kinase...    189   1e-51   
gb|EMT10528.1|  Putative inactive receptor kinase                       189   1e-51   
gb|ACR38562.1|  unknown                                                 181   1e-51   
ref|XP_004299514.1|  PREDICTED: probable inactive receptor kinase...    189   1e-51   
gb|KHN45250.1|  Putative inactive receptor kinase                       186   1e-51   
ref|XP_002447974.1|  hypothetical protein SORBIDRAFT_06g019120          189   1e-51   
ref|XP_007036910.1|  Receptor-like kinase 1                             189   1e-51   
ref|XP_010558411.1|  PREDICTED: probable inactive receptor kinase...    188   1e-51   
gb|AGT16967.1|  hypothetical protein SHCRBa_121_P14_R_290               189   1e-51   
gb|KHG27491.1|  hypothetical protein F383_14041                         188   1e-51   
ref|XP_009759771.1|  PREDICTED: probable inactive receptor kinase...    188   1e-51   
ref|XP_007137558.1|  hypothetical protein PHAVU_009G136800g             188   1e-51   
ref|XP_006651742.1|  PREDICTED: probable inactive receptor kinase...    187   2e-51   
dbj|BAJ94608.1|  predicted protein                                      187   2e-51   
ref|XP_006490586.1|  PREDICTED: probable inactive receptor kinase...    187   2e-51   
ref|XP_007141021.1|  hypothetical protein PHAVU_008G160700g             187   2e-51   
gb|AEW08175.1|  hypothetical protein 2_2125_01                          176   2e-51   
ref|XP_008457025.1|  PREDICTED: probable inactive receptor kinase...    187   2e-51   
ref|XP_003565740.1|  PREDICTED: probable inactive receptor kinase...    187   2e-51   
gb|EYU24506.1|  hypothetical protein MIMGU_mgv1a0087053mg               181   2e-51   
gb|KDO50809.1|  hypothetical protein CISIN_1g037905mg                   187   2e-51   
ref|XP_006645650.1|  PREDICTED: probable inactive receptor kinase...    187   3e-51   
ref|XP_006826909.1|  hypothetical protein AMTR_s00010p00158940          187   3e-51   
ref|XP_009403541.1|  PREDICTED: probable inactive receptor kinase...    187   3e-51   



>gb|EYU36892.1| hypothetical protein MIMGU_mgv1a0177021mg, partial [Erythranthe 
guttata]
Length=208

 Score =   253 bits (645),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 123/172 (72%), Positives = 144/172 (84%), Gaps = 5/172 (3%)
 Frame = -3

Query  686  GGAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRVT  507
            GGAKFTHGNIKSSNVLL   ++GC+SD GL PLMN+ ATTS R  GYRAPEV VETR+ T
Sbjct  32   GGAKFTHGNIKSSNVLLNQDLEGCVSDFGLAPLMNHPATTS-RSAGYRAPEV-VETRKHT  89

Query  506  QKSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQNI  327
             KSDVYSFGV++LEMLTGK        DD++DLPRWV+SVVREEWTAEVFDVELM++QNI
Sbjct  90   HKSDVYSFGVILLEMLTGKQPTSSPARDDIIDLPRWVQSVVREEWTAEVFDVELMRFQNI  149

Query  326  EEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEPQPSSDDN  171
            EEEMVQMLQIA++CVAKAPDMRP M EVVR IE +R   ++++E +PSSD+N
Sbjct  150  EEEMVQMLQIAMACVAKAPDMRPNMDEVVRMIEEVR---QSDSENRPSSDEN  198



>ref|XP_006358156.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X1 [Solanum tuberosum]
 ref|XP_006358157.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X2 [Solanum tuberosum]
Length=635

 Score =   258 bits (660),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 132/182 (73%), Positives = 146/182 (80%), Gaps = 6/182 (3%)
 Frame = -3

Query  689  KGGAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRV  510
            +GG KFTHGNIKSSNVLLT  +DGCISD GL PLMN  +    R  GYRAPEV +ETR+ 
Sbjct  457  EGGVKFTHGNIKSSNVLLTRDLDGCISDFGLTPLMNYISYKY-RCAGYRAPEV-IETRKG  514

Query  509  TQKSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQN  330
            TQKSDVYSFGV++LEMLTGKS +P++G D+VVDLPRWVRSVVREEWTAEVFDVEL+KYQN
Sbjct  515  TQKSDVYSFGVLLLEMLTGKSPLPLSGQDEVVDLPRWVRSVVREEWTAEVFDVELLKYQN  574

Query  329  IEEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEPQPS---SDDNNGGT  159
            IEEEMVQMLQI L+CVAK PDMRP M EVVR IE IR P E ET P      S D+N  T
Sbjct  575  IEEEMVQMLQIGLACVAKVPDMRPAMGEVVRMIEEIRQP-EGETRPSSEDSRSKDSNAQT  633

Query  158  PE  153
            PE
Sbjct  634  PE  635



>ref|XP_009607538.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nicotiana 
tomentosiformis]
 ref|XP_009607539.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nicotiana 
tomentosiformis]
 ref|XP_009607540.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nicotiana 
tomentosiformis]
 ref|XP_009607541.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nicotiana 
tomentosiformis]
Length=690

 Score =   259 bits (662),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 131/184 (71%), Positives = 147/184 (80%), Gaps = 10/184 (5%)
 Frame = -3

Query  689  KGGAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRV  510
            +GG KFTHGNIKSSN+LLT   DGCISD GL PLMN       R  GYRAPEV +ETR+ 
Sbjct  507  EGGVKFTHGNIKSSNILLTRDQDGCISDFGLTPLMNYIPFKY-RCAGYRAPEV-IETRKG  564

Query  509  TQKSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQN  330
            TQKSDVYSFGV++LEMLT KS +P++GHD+VVDLPRWVRSVVREEWTAEVFDVEL+KYQN
Sbjct  565  TQKSDVYSFGVLLLEMLTAKSPIPLSGHDEVVDLPRWVRSVVREEWTAEVFDVELLKYQN  624

Query  329  IEEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEPQPSSDDN-----NG  165
            IEEEMVQMLQI L+CVAK PDMRP+M EVVR IE IR P   E E +PSS+DN     N 
Sbjct  625  IEEEMVQMLQIGLACVAKVPDMRPSMGEVVRMIEDIRQP---EGETRPSSEDNRSKDSNA  681

Query  164  GTPE  153
             TP+
Sbjct  682  QTPD  685



>emb|CDP04037.1| unnamed protein product [Coffea canephora]
Length=252

 Score =   246 bits (627),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 120/172 (70%), Positives = 144/172 (84%), Gaps = 5/172 (3%)
 Frame = -3

Query  686  GGAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRVT  507
            GG KFTHGN+KSSNVLL   +DGC+SD+GL PLMN  AT S R+ GYRAPEV +ETR+ T
Sbjct  76   GGPKFTHGNVKSSNVLLNQDLDGCVSDLGLAPLMNFPATRS-RQAGYRAPEV-METRKHT  133

Query  506  QKSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQNI  327
             KSDVYSFGV++LEMLTGK  +   G DD+VDLPRWV+SVVREEWTAEVFDVELM++QNI
Sbjct  134  HKSDVYSFGVLLLEMLTGKQPIQSPGRDDMVDLPRWVQSVVREEWTAEVFDVELMRFQNI  193

Query  326  EEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEPQPSSDDN  171
            EEEMVQMLQIA++CVAK PDMRP M EVVR IE +R   ++++E +PSS++N
Sbjct  194  EEEMVQMLQIAMACVAKVPDMRPNMDEVVRMIEEVR---QSDSENRPSSEEN  242



>emb|CDP13882.1| unnamed protein product [Coffea canephora]
Length=639

 Score =   256 bits (655),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 125/172 (73%), Positives = 145/172 (84%), Gaps = 5/172 (3%)
 Frame = -3

Query  686  GGAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRVT  507
            GGA+F+HGNIKSSNVLL    DGCI+D GL P+MN+    + R  GY APEV +ETR+ T
Sbjct  463  GGARFSHGNIKSSNVLLNKEQDGCITDFGLNPVMNSLGVKT-RGIGYHAPEV-IETRKAT  520

Query  506  QKSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQNI  327
            QKSDVYSFGV++LEMLTGKS +  +GHDDV+DLPRWVRSVVREEWTAEVFDVELMKYQN+
Sbjct  521  QKSDVYSFGVLLLEMLTGKSPIHSSGHDDVIDLPRWVRSVVREEWTAEVFDVELMKYQNV  580

Query  326  EEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEPQPSSDDN  171
            EEEMVQMLQIALSCVAKAPDMRP+M EVVR +E IR   ++E E +PSS+DN
Sbjct  581  EEEMVQMLQIALSCVAKAPDMRPSMDEVVRLMEDIR---QSELENRPSSEDN  629



>ref|XP_011084790.1| PREDICTED: probable inactive receptor kinase At5g58300 [Sesamum 
indicum]
 ref|XP_011084791.1| PREDICTED: probable inactive receptor kinase At5g58300 [Sesamum 
indicum]
 ref|XP_011084792.1| PREDICTED: probable inactive receptor kinase At5g58300 [Sesamum 
indicum]
 ref|XP_011084793.1| PREDICTED: probable inactive receptor kinase At5g58300 [Sesamum 
indicum]
 ref|XP_011084794.1| PREDICTED: probable inactive receptor kinase At5g58300 [Sesamum 
indicum]
 ref|XP_011084795.1| PREDICTED: probable inactive receptor kinase At5g58300 [Sesamum 
indicum]
 ref|XP_011084796.1| PREDICTED: probable inactive receptor kinase At5g58300 [Sesamum 
indicum]
 ref|XP_011084797.1| PREDICTED: probable inactive receptor kinase At5g58300 [Sesamum 
indicum]
 ref|XP_011084800.1| PREDICTED: probable inactive receptor kinase At5g58300 [Sesamum 
indicum]
Length=635

 Score =   256 bits (655),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 127/173 (73%), Positives = 145/173 (84%), Gaps = 5/173 (3%)
 Frame = -3

Query  689  KGGAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRV  510
            +GGAK THGNIKSSN+LL  S+DGC+SD GL P+MN       R  GYRAPEV +ETR+V
Sbjct  458  EGGAKHTHGNIKSSNILLNASLDGCVSDFGLSPMMNYIPIKY-RVAGYRAPEV-IETRKV  515

Query  509  TQKSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQN  330
            +QK+DVYSFGVV+LEMLTGKS +   G+DDVVDLPRWVRSVVREEWTAEVFDVELMKYQN
Sbjct  516  SQKADVYSFGVVLLEMLTGKSPIQYTGYDDVVDLPRWVRSVVREEWTAEVFDVELMKYQN  575

Query  329  IEEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEPQPSSDDN  171
            IEEEMVQMLQIAL+CVAK PDMRP+M EVVR IE IR   ++E E +PSS+DN
Sbjct  576  IEEEMVQMLQIALACVAKVPDMRPSMDEVVRMIEDIR---QSELENRPSSEDN  625



>ref|XP_004235218.1| PREDICTED: probable inactive receptor kinase At5g58300 [Solanum 
lycopersicum]
 ref|XP_010318222.1| PREDICTED: probable inactive receptor kinase At5g58300 [Solanum 
lycopersicum]
 ref|XP_010318223.1| PREDICTED: probable inactive receptor kinase At5g58300 [Solanum 
lycopersicum]
 ref|XP_010318224.1| PREDICTED: probable inactive receptor kinase At5g58300 [Solanum 
lycopersicum]
Length=635

 Score =   255 bits (651),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 130/182 (71%), Positives = 145/182 (80%), Gaps = 6/182 (3%)
 Frame = -3

Query  689  KGGAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRV  510
            +GG KFTHGNIKSSNVLLT  +DGCISD GL P+MN  +    R  GYRAPEV +ETR+ 
Sbjct  457  EGGVKFTHGNIKSSNVLLTRDLDGCISDFGLTPMMNYISFKY-RCAGYRAPEV-IETRKG  514

Query  509  TQKSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQN  330
            TQKSDVYSFGV++LEMLTGKS +P+ G D+VVDLPRWVRSVVREEWTAEVFDVEL+KYQN
Sbjct  515  TQKSDVYSFGVLLLEMLTGKSPLPLPGQDEVVDLPRWVRSVVREEWTAEVFDVELLKYQN  574

Query  329  IEEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEPQPS---SDDNNGGT  159
            IEEEMVQMLQI L+CVAK PDMRP M EVVR IE IR P + ET P      S D+N  T
Sbjct  575  IEEEMVQMLQIGLACVAKVPDMRPAMGEVVRMIEEIRQP-QGETRPSSEDSRSKDSNAQT  633

Query  158  PE  153
            PE
Sbjct  634  PE  635



>gb|ABK93951.1| unknown [Populus trichocarpa]
Length=351

 Score =   246 bits (628),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 126/179 (70%), Positives = 149/179 (83%), Gaps = 6/179 (3%)
 Frame = -3

Query  689  KGGAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRV  510
            +GGAKF HGNIK+SNVLLT  +DGCISD+GL PLMN   TT  R  GYRAPEV +ETR+ 
Sbjct  178  EGGAKFFHGNIKASNVLLTPDLDGCISDVGLAPLMN-FPTTMYRTIGYRAPEV-IETRKA  235

Query  509  TQKSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQN  330
            +QKSDVYSFGV++LEMLTGK+ + V GHD VVDLPRWVRSVVREEWTAEVFDVEL+++QN
Sbjct  236  SQKSDVYSFGVLLLEMLTGKAPLQVPGHDSVVDLPRWVRSVVREEWTAEVFDVELVRHQN  295

Query  329  IEEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEPQPSSD-DNNGGTP  156
            IEEEMVQMLQIAL+CVAKAPDMRP M EVVR IE I+    ++++ + SSD ++N  TP
Sbjct  296  IEEEMVQMLQIALACVAKAPDMRPKMDEVVRMIEEIQ---HSDSKNRSSSDAESNVQTP  351



>ref|XP_009760496.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X2 [Nicotiana sylvestris]
 ref|XP_009760502.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X2 [Nicotiana sylvestris]
 ref|XP_009760506.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X2 [Nicotiana sylvestris]
Length=646

 Score =   254 bits (648),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 126/173 (73%), Positives = 143/173 (83%), Gaps = 5/173 (3%)
 Frame = -3

Query  689  KGGAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRV  510
            +GG KFTHGNIKSSNVLLT   DGCISD GL PLMN       R  GYRAPEV +ETR+ 
Sbjct  470  EGGVKFTHGNIKSSNVLLTRDQDGCISDFGLTPLMNYIPFKY-RCAGYRAPEV-IETRKG  527

Query  509  TQKSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQN  330
            TQKSDVYSFGV++LEMLT KS +P++GHD+VVDLPRWVRSVVREEWTAEVFDVEL+KYQN
Sbjct  528  TQKSDVYSFGVLLLEMLTAKSPIPLSGHDEVVDLPRWVRSVVREEWTAEVFDVELLKYQN  587

Query  329  IEEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEPQPSSDDN  171
            IEEEMVQMLQI L+CVAK PDMRP+M +VVR IE IR P   + E +PSS+D+
Sbjct  588  IEEEMVQMLQIGLACVAKVPDMRPSMGQVVRMIEEIRQP---QGETRPSSEDS  637



>ref|XP_009760490.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X1 [Nicotiana sylvestris]
Length=717

 Score =   254 bits (649),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 126/173 (73%), Positives = 143/173 (83%), Gaps = 5/173 (3%)
 Frame = -3

Query  689  KGGAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRV  510
            +GG KFTHGNIKSSNVLLT   DGCISD GL PLMN       R  GYRAPEV +ETR+ 
Sbjct  541  EGGVKFTHGNIKSSNVLLTRDQDGCISDFGLTPLMNYIPFKY-RCAGYRAPEV-IETRKG  598

Query  509  TQKSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQN  330
            TQKSDVYSFGV++LEMLT KS +P++GHD+VVDLPRWVRSVVREEWTAEVFDVEL+KYQN
Sbjct  599  TQKSDVYSFGVLLLEMLTAKSPIPLSGHDEVVDLPRWVRSVVREEWTAEVFDVELLKYQN  658

Query  329  IEEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEPQPSSDDN  171
            IEEEMVQMLQI L+CVAK PDMRP+M +VVR IE IR P   + E +PSS+D+
Sbjct  659  IEEEMVQMLQIGLACVAKVPDMRPSMGQVVRMIEEIRQP---QGETRPSSEDS  708



>gb|KHN40997.1| Putative inactive receptor kinase [Glycine soja]
Length=253

 Score =   241 bits (616),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 122/172 (71%), Positives = 141/172 (82%), Gaps = 5/172 (3%)
 Frame = -3

Query  686  GGAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRVT  507
            GG KFTHGN+KSSNVLL    DGCISD GL PLMN  AT S R  GYRAPEV +ETR+ T
Sbjct  76   GGPKFTHGNVKSSNVLLNHDNDGCISDFGLTPLMNVPATPS-RAAGYRAPEV-IETRKHT  133

Query  506  QKSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQNI  327
             KSDVYSFG+++LEMLTGK+     G DD+VDLPRWV+SVVREEWTAEVFDVELM+YQNI
Sbjct  134  HKSDVYSFGILLLEMLTGKAPQQSPGRDDMVDLPRWVQSVVREEWTAEVFDVELMRYQNI  193

Query  326  EEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEPQPSSDDN  171
            EEEMVQMLQIA++CVAK PDMRP+M EVVR IE IR    +++E +PSS++N
Sbjct  194  EEEMVQMLQIAMACVAKVPDMRPSMDEVVRMIEEIR---LSDSENRPSSEEN  242



>gb|KHN24722.1| Putative inactive receptor kinase, partial [Glycine soja]
Length=327

 Score =   244 bits (622),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 122/172 (71%), Positives = 142/172 (83%), Gaps = 5/172 (3%)
 Frame = -3

Query  686  GGAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRVT  507
            GG KFTHGNIKSSNVLL    DGCISD GL PLMN  AT S R  GYRAPEV +ETR+ +
Sbjct  151  GGPKFTHGNIKSSNVLLNQDNDGCISDFGLAPLMNVPATPS-RAAGYRAPEV-IETRKHS  208

Query  506  QKSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQNI  327
             KSDVYSFGV++LEMLTGK+ +   G DD+VDLPRWV+SVVREEWTAEVFDVELM+YQNI
Sbjct  209  HKSDVYSFGVLLLEMLTGKAPLQSPGRDDMVDLPRWVQSVVREEWTAEVFDVELMRYQNI  268

Query  326  EEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEPQPSSDDN  171
            EEEMVQMLQIA++CVAK PDMRP+M E VR IE IR   ++++E +PSS++N
Sbjct  269  EEEMVQMLQIAMACVAKMPDMRPSMDEAVRMIEEIR---QSDSENRPSSEEN  317



>ref|XP_011041763.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X2 [Populus euphratica]
Length=510

 Score =   248 bits (632),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 123/172 (72%), Positives = 143/172 (83%), Gaps = 5/172 (3%)
 Frame = -3

Query  686  GGAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRVT  507
            GG KFTHGNIKS+NVLL+   DGCISD GL PLMN  AT+S R  GYRAPEV +ETR+ T
Sbjct  334  GGPKFTHGNIKSTNVLLSQDHDGCISDFGLTPLMNVPATSS-RSAGYRAPEV-IETRKHT  391

Query  506  QKSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQNI  327
             KSDVYSFGVV+LEMLTGK+ +   G DD+VDLPRWV+SVVREEWTAEVFDVELM+YQNI
Sbjct  392  HKSDVYSFGVVLLEMLTGKAPIQSPGRDDMVDLPRWVQSVVREEWTAEVFDVELMRYQNI  451

Query  326  EEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEPQPSSDDN  171
            EEEMVQMLQI ++CVAK PDMRP M EVVR IE IR   ++++E +PSS++N
Sbjct  452  EEEMVQMLQIGMTCVAKVPDMRPNMEEVVRMIEEIR---QSDSENRPSSEEN  500



>ref|XP_010252005.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nelumbo 
nucifera]
 ref|XP_010252006.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nelumbo 
nucifera]
 ref|XP_010252007.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nelumbo 
nucifera]
 ref|XP_010252008.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nelumbo 
nucifera]
 ref|XP_010252009.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nelumbo 
nucifera]
 ref|XP_010252010.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nelumbo 
nucifera]
 ref|XP_010252011.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nelumbo 
nucifera]
Length=676

 Score =   251 bits (641),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 125/173 (72%), Positives = 144/173 (83%), Gaps = 5/173 (3%)
 Frame = -3

Query  689  KGGAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRV  510
            +GG KFTHGNIKSSNVLL    DGCISD GL PLMN   T S R  GYRAPEV +ETR+ 
Sbjct  499  EGGGKFTHGNIKSSNVLLNQDQDGCISDFGLVPLMNFPVTPS-RSVGYRAPEV-IETRKP  556

Query  509  TQKSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQN  330
            TQKSDVYSFGV++LE+LTGK+ +   GHDDVVDLPRWV+SVVREEWTAEVFDVELM+YQN
Sbjct  557  TQKSDVYSFGVLLLELLTGKAPLQSPGHDDVVDLPRWVQSVVREEWTAEVFDVELMRYQN  616

Query  329  IEEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEPQPSSDDN  171
            IEEEMVQMLQIA++CVAK PDMRP M EVVR IE IR   ++++E +PSS++N
Sbjct  617  IEEEMVQMLQIAMACVAKVPDMRPKMEEVVRMIEEIR---QSDSENRPSSEEN  666



>gb|KHN30614.1| Putative inactive receptor kinase [Glycine soja]
Length=253

 Score =   239 bits (610),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 121/172 (70%), Positives = 140/172 (81%), Gaps = 5/172 (3%)
 Frame = -3

Query  686  GGAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRVT  507
            GG KF HGN+KSSNVLL    DGCISD GL PLMN  +T S R  GYRAPEV +ETR+ T
Sbjct  76   GGPKFAHGNVKSSNVLLNQDNDGCISDFGLTPLMNVPSTPS-RAAGYRAPEV-IETRKHT  133

Query  506  QKSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQNI  327
             KSDVYSFGV++LEMLTGK+     G DD+VDLPRWV+SVVREEWTAEVFDVELM+YQNI
Sbjct  134  HKSDVYSFGVLLLEMLTGKAPQQSPGRDDMVDLPRWVQSVVREEWTAEVFDVELMRYQNI  193

Query  326  EEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEPQPSSDDN  171
            EEEMVQMLQIA++CVAK PDMRP+M EVVR IE IR    +++E +PSS++N
Sbjct  194  EEEMVQMLQIAMACVAKVPDMRPSMEEVVRMIEEIR---LSDSENRPSSEEN  242



>ref|XP_004294716.1| PREDICTED: probable inactive receptor kinase At5g58300 [Fragaria 
vesca subsp. vesca]
Length=630

 Score =   249 bits (636),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 126/180 (70%), Positives = 149/180 (83%), Gaps = 8/180 (4%)
 Frame = -3

Query  686  GGAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRVT  507
            GG KFTHGNIKS+NVLL+  +DGCISD+GL PLMN  AT+  R  GYRAPEV +ETR+ +
Sbjct  456  GGPKFTHGNIKSTNVLLSQDLDGCISDVGLTPLMNVPATS--RSAGYRAPEV-IETRKHS  512

Query  506  QKSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQNI  327
             KSDVYSFGVV+LEMLTGK+ +   G DD+VDLPRWV+SVVREEWTAEVFDVELM+YQNI
Sbjct  513  HKSDVYSFGVVLLEMLTGKAPLQSPGRDDMVDLPRWVQSVVREEWTAEVFDVELMRYQNI  572

Query  326  EEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEPQPSSDDN--NGGTPE  153
            EEEMVQMLQIA++CVAK PDMRP M EVVR IE IR   ++++E +PSS+DN  N  TP+
Sbjct  573  EEEMVQMLQIAMACVAKVPDMRPNMEEVVRMIEDIR---QSDSENRPSSEDNKSNVQTPD  629



>ref|XP_007208318.1| hypothetical protein PRUPE_ppa002781mg [Prunus persica]
 gb|EMJ09517.1| hypothetical protein PRUPE_ppa002781mg [Prunus persica]
Length=634

 Score =   249 bits (635),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 123/172 (72%), Positives = 145/172 (84%), Gaps = 6/172 (3%)
 Frame = -3

Query  686  GGAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRVT  507
            GG KFTHGNIKS+NVLL+  +DGCISD+GL PLMN  ATT  R  GYRAPEV +ETR+ +
Sbjct  459  GGPKFTHGNIKSTNVLLSQDLDGCISDVGLTPLMNVPATT--RSAGYRAPEV-IETRKHS  515

Query  506  QKSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQNI  327
             KSDVYSFGVV+LEMLTGK+ +   G DD+VDLPRWV+SVVREEWTAEVFDVELM+YQNI
Sbjct  516  HKSDVYSFGVVLLEMLTGKAPLQSPGRDDMVDLPRWVQSVVREEWTAEVFDVELMRYQNI  575

Query  326  EEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEPQPSSDDN  171
            EEEMVQMLQIA++CVAK PDMRP M EVVR IE IR   ++++E +PSS++N
Sbjct  576  EEEMVQMLQIAMACVAKVPDMRPNMEEVVRMIEEIR---QSDSENRPSSEEN  624



>ref|XP_008239856.1| PREDICTED: probable inactive receptor kinase At5g58300 [Prunus 
mume]
Length=634

 Score =   249 bits (635),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 123/172 (72%), Positives = 145/172 (84%), Gaps = 6/172 (3%)
 Frame = -3

Query  686  GGAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRVT  507
            GG KFTHGNIKS+NVLL+  +DGCISD+GL PLMN  ATT  R  GYRAPEV +ETR+ +
Sbjct  459  GGPKFTHGNIKSTNVLLSQDLDGCISDVGLTPLMNVPATT--RSAGYRAPEV-IETRKHS  515

Query  506  QKSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQNI  327
             KSDVYSFGVV+LEMLTGK+ +   G DD+VDLPRWV+SVVREEWTAEVFDVELM+YQNI
Sbjct  516  HKSDVYSFGVVLLEMLTGKAPLQSPGRDDMVDLPRWVQSVVREEWTAEVFDVELMRYQNI  575

Query  326  EEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEPQPSSDDN  171
            EEEMVQMLQIA++CVAK PDMRP M EVVR IE IR   ++++E +PSS++N
Sbjct  576  EEEMVQMLQIAMACVAKVPDMRPNMEEVVRMIEEIR---QSDSENRPSSEEN  624



>ref|XP_010999642.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X3 [Populus euphratica]
Length=630

 Score =   248 bits (633),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 126/179 (70%), Positives = 150/179 (84%), Gaps = 6/179 (3%)
 Frame = -3

Query  689  KGGAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRV  510
            +GGAKF HGNIKSSNV+LT+ +DGCISD+GL PLMN   TT  R  GYRAPEV +ETR+ 
Sbjct  457  EGGAKFFHGNIKSSNVILTSDLDGCISDVGLAPLMN-FPTTMYRTIGYRAPEV-IETRKA  514

Query  509  TQKSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQN  330
            +QKSDVYSFGV++LEMLTGK+ + V GHD VVDLPRWVRSVVREEWTAEVFDVEL+++QN
Sbjct  515  SQKSDVYSFGVLLLEMLTGKAPLQVPGHDSVVDLPRWVRSVVREEWTAEVFDVELVRHQN  574

Query  329  IEEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEPQPSSD-DNNGGTP  156
            IEEEMVQMLQIAL+CVAKAPDMRP M EVVR IE I+    ++++ + SSD ++N  TP
Sbjct  575  IEEEMVQMLQIALACVAKAPDMRPKMDEVVRMIEEIQ---HSDSKNRSSSDAESNIQTP  630



>ref|XP_009374410.1| PREDICTED: probable inactive receptor kinase At5g58300 [Pyrus 
x bretschneideri]
Length=634

 Score =   248 bits (632),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 122/172 (71%), Positives = 146/172 (85%), Gaps = 6/172 (3%)
 Frame = -3

Query  686  GGAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRVT  507
            GG KFTHGNIKS+NVLL+  ++GCISD+GL PLMN +AT   R  GYRAPEV +ETRR +
Sbjct  459  GGLKFTHGNIKSTNVLLSQDLNGCISDVGLTPLMNVSATA--RSAGYRAPEV-IETRRHS  515

Query  506  QKSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQNI  327
             KSDVYSFGVV+LEMLTGK+ +   G DD+VDLPRWV+SVVREEWTAEVFDVELM+YQNI
Sbjct  516  HKSDVYSFGVVLLEMLTGKAPLQSPGRDDMVDLPRWVQSVVREEWTAEVFDVELMRYQNI  575

Query  326  EEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEPQPSSDDN  171
            EEEMVQMLQIA++CVAK PDMRP+M EVVR IE IR   ++++E +PSS++N
Sbjct  576  EEEMVQMLQIAMACVAKVPDMRPSMEEVVRMIEEIR---QSDSENRPSSEEN  624



>ref|XP_010999639.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X2 [Populus euphratica]
 ref|XP_010999640.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X2 [Populus euphratica]
 ref|XP_010999641.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X2 [Populus euphratica]
Length=655

 Score =   248 bits (632),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 126/179 (70%), Positives = 150/179 (84%), Gaps = 6/179 (3%)
 Frame = -3

Query  689  KGGAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRV  510
            +GGAKF HGNIKSSNV+LT+ +DGCISD+GL PLMN   TT  R  GYRAPEV +ETR+ 
Sbjct  482  EGGAKFFHGNIKSSNVILTSDLDGCISDVGLAPLMN-FPTTMYRTIGYRAPEV-IETRKA  539

Query  509  TQKSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQN  330
            +QKSDVYSFGV++LEMLTGK+ + V GHD VVDLPRWVRSVVREEWTAEVFDVEL+++QN
Sbjct  540  SQKSDVYSFGVLLLEMLTGKAPLQVPGHDSVVDLPRWVRSVVREEWTAEVFDVELVRHQN  599

Query  329  IEEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEPQPSSD-DNNGGTP  156
            IEEEMVQMLQIAL+CVAKAPDMRP M EVVR IE I+    ++++ + SSD ++N  TP
Sbjct  600  IEEEMVQMLQIALACVAKAPDMRPKMDEVVRMIEEIQ---HSDSKNRSSSDAESNIQTP  655



>ref|XP_002325632.1| putative plant disease resistance family protein [Populus trichocarpa]
 gb|EEF00014.1| putative plant disease resistance family protein [Populus trichocarpa]
Length=636

 Score =   247 bits (631),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 123/172 (72%), Positives = 143/172 (83%), Gaps = 5/172 (3%)
 Frame = -3

Query  686  GGAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRVT  507
            GG KFTHGNIKS+NVLL+   DGCISD GL PLMN  AT+S R  GYRAPEV +ETR+ T
Sbjct  460  GGPKFTHGNIKSTNVLLSQDHDGCISDFGLTPLMNVPATSS-RSAGYRAPEV-IETRKHT  517

Query  506  QKSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQNI  327
             KSDVYSFGVV+LEMLTGK+ +   G DD+VDLPRWV+SVVREEWTAEVFDVELM+YQNI
Sbjct  518  HKSDVYSFGVVLLEMLTGKAPIQSPGRDDMVDLPRWVQSVVREEWTAEVFDVELMRYQNI  577

Query  326  EEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEPQPSSDDN  171
            EEEMVQMLQI ++CVAK PDMRP M EVVR IE IR   ++++E +PSS++N
Sbjct  578  EEEMVQMLQIGMTCVAKVPDMRPNMEEVVRMIEEIR---QSDSENRPSSEEN  626



>ref|XP_010999638.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X1 [Populus euphratica]
Length=656

 Score =   248 bits (632),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 126/179 (70%), Positives = 150/179 (84%), Gaps = 6/179 (3%)
 Frame = -3

Query  689  KGGAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRV  510
            +GGAKF HGNIKSSNV+LT+ +DGCISD+GL PLMN   TT  R  GYRAPEV +ETR+ 
Sbjct  483  EGGAKFFHGNIKSSNVILTSDLDGCISDVGLAPLMN-FPTTMYRTIGYRAPEV-IETRKA  540

Query  509  TQKSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQN  330
            +QKSDVYSFGV++LEMLTGK+ + V GHD VVDLPRWVRSVVREEWTAEVFDVEL+++QN
Sbjct  541  SQKSDVYSFGVLLLEMLTGKAPLQVPGHDSVVDLPRWVRSVVREEWTAEVFDVELVRHQN  600

Query  329  IEEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEPQPSSD-DNNGGTP  156
            IEEEMVQMLQIAL+CVAKAPDMRP M EVVR IE I+    ++++ + SSD ++N  TP
Sbjct  601  IEEEMVQMLQIALACVAKAPDMRPKMDEVVRMIEEIQ---HSDSKNRSSSDAESNIQTP  656



>ref|XP_011041759.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X1 [Populus euphratica]
 ref|XP_011041760.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X1 [Populus euphratica]
 ref|XP_011041761.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X1 [Populus euphratica]
 ref|XP_011041762.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X1 [Populus euphratica]
Length=636

 Score =   247 bits (631),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 123/172 (72%), Positives = 143/172 (83%), Gaps = 5/172 (3%)
 Frame = -3

Query  686  GGAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRVT  507
            GG KFTHGNIKS+NVLL+   DGCISD GL PLMN  AT+S R  GYRAPEV +ETR+ T
Sbjct  460  GGPKFTHGNIKSTNVLLSQDHDGCISDFGLTPLMNVPATSS-RSAGYRAPEV-IETRKHT  517

Query  506  QKSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQNI  327
             KSDVYSFGVV+LEMLTGK+ +   G DD+VDLPRWV+SVVREEWTAEVFDVELM+YQNI
Sbjct  518  HKSDVYSFGVVLLEMLTGKAPIQSPGRDDMVDLPRWVQSVVREEWTAEVFDVELMRYQNI  577

Query  326  EEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEPQPSSDDN  171
            EEEMVQMLQI ++CVAK PDMRP M EVVR IE IR   ++++E +PSS++N
Sbjct  578  EEEMVQMLQIGMTCVAKVPDMRPNMEEVVRMIEEIR---QSDSENRPSSEEN  626



>ref|XP_010098027.1| putative inactive receptor kinase [Morus notabilis]
 gb|EXB74410.1| putative inactive receptor kinase [Morus notabilis]
Length=711

 Score =   248 bits (634),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 125/178 (70%), Positives = 142/178 (80%), Gaps = 5/178 (3%)
 Frame = -3

Query  686  GGAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRVT  507
             G KF HGNIKSSNVLL+  + GCISD GL PLMN  A  S R  GYRAPEV +ETR+ +
Sbjct  535  AGGKFVHGNIKSSNVLLSQDLSGCISDFGLAPLMNFPAIPS-RSIGYRAPEV-IETRKFS  592

Query  506  QKSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQNI  327
            QKSDVYSFGV++LEMLTGK+ V   G DDV DLPRWV+SVVREEWTAEVFDVELMKYQNI
Sbjct  593  QKSDVYSFGVILLEMLTGKAPVQSPGRDDVADLPRWVQSVVREEWTAEVFDVELMKYQNI  652

Query  326  EEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEPQPSSDDNNGGTPE  153
            EEE+VQMLQIA++CVAK PDMRPTM EVVR IE IR P+++E+ P P  +DN    PE
Sbjct  653  EEELVQMLQIAMACVAKVPDMRPTMEEVVRMIEEIR-PSDSESRPSP--EDNKSKGPE  707



>ref|XP_006371315.1| putative plant disease resistance family protein [Populus trichocarpa]
 gb|ERP49112.1| putative plant disease resistance family protein [Populus trichocarpa]
Length=630

 Score =   246 bits (629),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 126/179 (70%), Positives = 149/179 (83%), Gaps = 6/179 (3%)
 Frame = -3

Query  689  KGGAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRV  510
            +GGAKF HGNIK+SNVLLT  +DGCISD+GL PLMN   TT  R  GYRAPEV +ETR+ 
Sbjct  457  EGGAKFFHGNIKASNVLLTPDLDGCISDVGLAPLMN-FPTTMYRTIGYRAPEV-IETRKA  514

Query  509  TQKSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQN  330
            +QKSDVYSFGV++LEMLTGK+ + V GHD VVDLPRWVRSVVREEWTAEVFDVEL+++QN
Sbjct  515  SQKSDVYSFGVLLLEMLTGKAPLQVPGHDSVVDLPRWVRSVVREEWTAEVFDVELVRHQN  574

Query  329  IEEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEPQPSSD-DNNGGTP  156
            IEEEMVQMLQIAL+CVAKAPDMRP M EVVR IE I+    ++++ + SSD ++N  TP
Sbjct  575  IEEEMVQMLQIALACVAKAPDMRPKMDEVVRMIEEIQ---HSDSKNRSSSDAESNVQTP  630



>ref|XP_008384658.1| PREDICTED: probable inactive receptor kinase At5g58300 [Malus 
domestica]
Length=634

 Score =   246 bits (628),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 122/172 (71%), Positives = 145/172 (84%), Gaps = 6/172 (3%)
 Frame = -3

Query  686  GGAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRVT  507
            GG KFTHGNIKS+NVLL+  ++GCISD+GL PLMN  AT   R  GYRAPEV +ETRR +
Sbjct  459  GGPKFTHGNIKSTNVLLSQDLNGCISDVGLTPLMNVPATA--RSAGYRAPEV-IETRRHS  515

Query  506  QKSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQNI  327
             KSDVYSFGVV+LEMLTGK+ +   G DD+VDLPRWV+SVVREEWTAEVFDVELM+YQNI
Sbjct  516  HKSDVYSFGVVLLEMLTGKAPLQSPGRDDMVDLPRWVQSVVREEWTAEVFDVELMRYQNI  575

Query  326  EEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEPQPSSDDN  171
            EEEMVQMLQIA++CVAK PDMRP+M EVVR IE IR   ++++E +PSS++N
Sbjct  576  EEEMVQMLQIAMACVAKVPDMRPSMEEVVRMIEEIR---QSDSENRPSSEEN  624



>ref|XP_011089538.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X2 [Sesamum indicum]
 ref|XP_011089539.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X2 [Sesamum indicum]
Length=636

 Score =   246 bits (628),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 119/172 (69%), Positives = 145/172 (84%), Gaps = 5/172 (3%)
 Frame = -3

Query  686  GGAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRVT  507
            GGAKFTHGNIKSSNVLL   +DGC+SD GL PLMN+ +T+S R  GYRAPEV +ETR+ T
Sbjct  460  GGAKFTHGNIKSSNVLLNQDLDGCVSDFGLAPLMNHPSTSS-RHAGYRAPEV-METRKHT  517

Query  506  QKSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQNI  327
             KSDVYSFGV++LEMLTGK  +     +D+VDLPRWV+SVVREEWTAEVFDVELM++QNI
Sbjct  518  HKSDVYSFGVILLEMLTGKQPIQSPSREDIVDLPRWVQSVVREEWTAEVFDVELMRFQNI  577

Query  326  EEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEPQPSSDDN  171
            EEEMVQMLQIA++CVAK PDMRP++ EVVR IE +R   ++++E +PSSD+N
Sbjct  578  EEEMVQMLQIAMACVAKVPDMRPSIDEVVRMIEEVR---QSDSENRPSSDEN  626



>ref|XP_006371316.1| hypothetical protein POPTR_0019s09010g [Populus trichocarpa]
 gb|ERP49113.1| hypothetical protein POPTR_0019s09010g [Populus trichocarpa]
Length=655

 Score =   246 bits (629),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 126/179 (70%), Positives = 149/179 (83%), Gaps = 6/179 (3%)
 Frame = -3

Query  689  KGGAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRV  510
            +GGAKF HGNIK+SNVLLT  +DGCISD+GL PLMN   TT  R  GYRAPEV +ETR+ 
Sbjct  482  EGGAKFFHGNIKASNVLLTPDLDGCISDVGLAPLMN-FPTTMYRTIGYRAPEV-IETRKA  539

Query  509  TQKSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQN  330
            +QKSDVYSFGV++LEMLTGK+ + V GHD VVDLPRWVRSVVREEWTAEVFDVEL+++QN
Sbjct  540  SQKSDVYSFGVLLLEMLTGKAPLQVPGHDSVVDLPRWVRSVVREEWTAEVFDVELVRHQN  599

Query  329  IEEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEPQPSSD-DNNGGTP  156
            IEEEMVQMLQIAL+CVAKAPDMRP M EVVR IE I+    ++++ + SSD ++N  TP
Sbjct  600  IEEEMVQMLQIALACVAKAPDMRPKMDEVVRMIEEIQ---HSDSKNRSSSDAESNVQTP  655



>ref|XP_011089537.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X1 [Sesamum indicum]
Length=655

 Score =   246 bits (628),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 119/172 (69%), Positives = 145/172 (84%), Gaps = 5/172 (3%)
 Frame = -3

Query  686  GGAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRVT  507
            GGAKFTHGNIKSSNVLL   +DGC+SD GL PLMN+ +T+S R  GYRAPEV +ETR+ T
Sbjct  479  GGAKFTHGNIKSSNVLLNQDLDGCVSDFGLAPLMNHPSTSS-RHAGYRAPEV-METRKHT  536

Query  506  QKSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQNI  327
             KSDVYSFGV++LEMLTGK  +     +D+VDLPRWV+SVVREEWTAEVFDVELM++QNI
Sbjct  537  HKSDVYSFGVILLEMLTGKQPIQSPSREDIVDLPRWVQSVVREEWTAEVFDVELMRFQNI  596

Query  326  EEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEPQPSSDDN  171
            EEEMVQMLQIA++CVAK PDMRP++ EVVR IE +R   ++++E +PSSD+N
Sbjct  597  EEEMVQMLQIAMACVAKVPDMRPSIDEVVRMIEEVR---QSDSENRPSSDEN  645



>emb|CBI15804.3| unnamed protein product [Vitis vinifera]
Length=656

 Score =   246 bits (627),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 120/172 (70%), Positives = 144/172 (84%), Gaps = 5/172 (3%)
 Frame = -3

Query  686  GGAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRVT  507
            GG KFTHGNIKSSNVLL    +GCISD GL PLMN  AT+S R  GYRAPEV +E+R+ T
Sbjct  480  GGGKFTHGNIKSSNVLLNQDFEGCISDFGLTPLMNFPATSS-RNAGYRAPEV-IESRKHT  537

Query  506  QKSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQNI  327
             KSDVYSFGV++LEMLTGK+ +   G DD+VDLPRWV+SVVREEWTAEVFD+ELM+YQNI
Sbjct  538  HKSDVYSFGVLLLEMLTGKAPLQSPGRDDMVDLPRWVQSVVREEWTAEVFDIELMRYQNI  597

Query  326  EEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEPQPSSDDN  171
            EEEMVQMLQ+A++CVAK PDMRP+M EVVR IE IR   ++++E +PSS++N
Sbjct  598  EEEMVQMLQLAMACVAKVPDMRPSMDEVVRMIEEIR---QSDSENRPSSEEN  646



>ref|XP_009370892.1| PREDICTED: probable inactive receptor kinase At5g58300 [Pyrus 
x bretschneideri]
 ref|XP_009370912.1| PREDICTED: probable inactive receptor kinase At5g58300 [Pyrus 
x bretschneideri]
Length=639

 Score =   245 bits (626),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 125/172 (73%), Positives = 142/172 (83%), Gaps = 7/172 (4%)
 Frame = -3

Query  683  GAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRP-GYRAPEVFVETRRVT  507
            G KF HGNIKSSNVLLT  ++G +SD GL PLMN   TT P R  GYRAPEV +ET++  
Sbjct  455  GGKFIHGNIKSSNVLLTQDLNGSMSDFGLAPLMN--LTTIPSRSVGYRAPEV-IETKKSF  511

Query  506  QKSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQNI  327
            QKSDVYSFGV++LEMLTGK+ V   GHDDVVDLPRWV+SVVREEWTAEVFDVELMKYQNI
Sbjct  512  QKSDVYSFGVMLLEMLTGKAPVQTPGHDDVVDLPRWVQSVVREEWTAEVFDVELMKYQNI  571

Query  326  EEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEPQPSSDDN  171
            EEE+VQMLQIA++CVA+ PDMRPTM EVVR IE IR P   ++E +PSSDDN
Sbjct  572  EEELVQMLQIAMTCVARVPDMRPTMEEVVRMIEEIRPP---DSENRPSSDDN  620



>gb|KJB29842.1| hypothetical protein B456_005G120900 [Gossypium raimondii]
 gb|KJB29843.1| hypothetical protein B456_005G120900 [Gossypium raimondii]
Length=660

 Score =   246 bits (627),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 124/176 (70%), Positives = 142/176 (81%), Gaps = 13/176 (7%)
 Frame = -3

Query  686  GGAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRP----GYRAPEVFVET  519
            GG KF HGNIKSSNVLLT  + GCISD GL PLM     TSP+ P    GYRAPEV +E+
Sbjct  484  GGGKFIHGNIKSSNVLLTKDLHGCISDFGLTPLM-----TSPKVPSRSAGYRAPEV-IES  537

Query  518  RRVTQKSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMK  339
            R+ TQKSDVYSFGV++LEMLTGK+A   +GH DVVDLPRWV+SVVREEWTAEVFDVELMK
Sbjct  538  RKFTQKSDVYSFGVLLLEMLTGKAATQSSGHKDVVDLPRWVQSVVREEWTAEVFDVELMK  597

Query  338  YQNIEEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEPQPSSDDN  171
            YQNIEEE+VQMLQIA++CVA+ PDMRPTM EV R IE IR    + +E +PSS+DN
Sbjct  598  YQNIEEELVQMLQIAMTCVARLPDMRPTMEEVTRMIEEIR---PSVSENRPSSEDN  650



>ref|XP_002276162.3| PREDICTED: probable inactive receptor kinase At5g58300 [Vitis 
vinifera]
Length=666

 Score =   246 bits (628),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 120/172 (70%), Positives = 144/172 (84%), Gaps = 5/172 (3%)
 Frame = -3

Query  686  GGAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRVT  507
            GG KFTHGNIKSSNVLL    +GCISD GL PLMN  AT+S R  GYRAPEV +E+R+ T
Sbjct  490  GGGKFTHGNIKSSNVLLNQDFEGCISDFGLTPLMNFPATSS-RNAGYRAPEV-IESRKHT  547

Query  506  QKSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQNI  327
             KSDVYSFGV++LEMLTGK+ +   G DD+VDLPRWV+SVVREEWTAEVFD+ELM+YQNI
Sbjct  548  HKSDVYSFGVLLLEMLTGKAPLQSPGRDDMVDLPRWVQSVVREEWTAEVFDIELMRYQNI  607

Query  326  EEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEPQPSSDDN  171
            EEEMVQMLQ+A++CVAK PDMRP+M EVVR IE IR   ++++E +PSS++N
Sbjct  608  EEEMVQMLQLAMACVAKVPDMRPSMDEVVRMIEEIR---QSDSENRPSSEEN  656



>gb|KHN18649.1| Putative inactive receptor kinase [Glycine soja]
Length=585

 Score =   243 bits (620),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 122/172 (71%), Positives = 142/172 (83%), Gaps = 5/172 (3%)
 Frame = -3

Query  686  GGAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRVT  507
            GG KFTHGNIKSSNVLL    DGCISD GL PLMN  AT S R  GYRAPEV +E R+ +
Sbjct  412  GGPKFTHGNIKSSNVLLNQDNDGCISDFGLAPLMNVPATPS-RTAGYRAPEV-IEARKHS  469

Query  506  QKSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQNI  327
             KSDVYSFGV++LEMLTGK+ +   G DD+VDLPRWV+SVVREEWTAEVFDVELM+YQNI
Sbjct  470  HKSDVYSFGVLLLEMLTGKAPLQSPGRDDMVDLPRWVQSVVREEWTAEVFDVELMRYQNI  529

Query  326  EEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEPQPSSDDN  171
            EEEMVQMLQIA++CVAK PDMRP+M EVVR IE IR   ++++E +PSS++N
Sbjct  530  EEEMVQMLQIAMACVAKMPDMRPSMDEVVRMIEEIR---QSDSENRPSSEEN  578



>ref|XP_010094441.1| putative inactive receptor kinase [Morus notabilis]
 gb|EXB56022.1| putative inactive receptor kinase [Morus notabilis]
Length=634

 Score =   244 bits (622),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 119/172 (69%), Positives = 142/172 (83%), Gaps = 5/172 (3%)
 Frame = -3

Query  686  GGAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRVT  507
            GG KFTHGN+K+SNVLL   +DGCISD GL PLMN  AT S R  GYRAPEV +ETR+ T
Sbjct  458  GGPKFTHGNVKASNVLLNQDLDGCISDFGLTPLMNAHATPS-RSVGYRAPEV-IETRKYT  515

Query  506  QKSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQNI  327
             KSDVYSFGV++LEMLTGK+ +   G DD+VDLPRWV SVVREEWTAEVFD+ELM+YQNI
Sbjct  516  HKSDVYSFGVLLLEMLTGKAPLQSPGRDDMVDLPRWVHSVVREEWTAEVFDIELMRYQNI  575

Query  326  EEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEPQPSSDDN  171
            EEEMVQMLQIA++CV K PDMRP+M +VVR IE IR   ++++E +PSS++N
Sbjct  576  EEEMVQMLQIAMACVTKVPDMRPSMEQVVRMIEEIR---QSDSENRPSSEEN  624



>ref|XP_002533837.1| Nodulation receptor kinase precursor, putative [Ricinus communis]
 gb|EEF28551.1| Nodulation receptor kinase precursor, putative [Ricinus communis]
Length=635

 Score =   244 bits (622),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 122/172 (71%), Positives = 140/172 (81%), Gaps = 5/172 (3%)
 Frame = -3

Query  686  GGAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRVT  507
            GG KFTHGNIKSSNVLL    DGCISD GL PLMN  AT S R  GYRAPEV +ETR+ T
Sbjct  459  GGPKFTHGNIKSSNVLLNQDHDGCISDFGLTPLMNVPATPS-RSAGYRAPEV-IETRKHT  516

Query  506  QKSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQNI  327
             KSDVYSFGV++LEMLTGK+ +     DD+VDLPRWV+SVVREEWTAEVFDVELM+YQNI
Sbjct  517  HKSDVYSFGVLLLEMLTGKAPLQSPSRDDMVDLPRWVQSVVREEWTAEVFDVELMRYQNI  576

Query  326  EEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEPQPSSDDN  171
            EEEMVQMLQI ++CVAK PDMRP M EVVR IE IR   ++++E +PSS++N
Sbjct  577  EEEMVQMLQIGMACVAKVPDMRPNMDEVVRMIEEIR---QSDSENRPSSEEN  625



>ref|XP_006602052.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X5 [Glycine max]
Length=640

 Score =   244 bits (622),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 122/172 (71%), Positives = 142/172 (83%), Gaps = 5/172 (3%)
 Frame = -3

Query  686  GGAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRVT  507
            GG KFTHGNIKSSNVLL    DGCISD GL PLMN  AT S R  GYRAPEV +E R+ +
Sbjct  467  GGPKFTHGNIKSSNVLLNQDNDGCISDFGLAPLMNVPATPS-RTAGYRAPEV-IEARKHS  524

Query  506  QKSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQNI  327
             KSDVYSFGV++LEMLTGK+ +   G DD+VDLPRWV+SVVREEWTAEVFDVELM+YQNI
Sbjct  525  HKSDVYSFGVLLLEMLTGKAPLQSPGRDDMVDLPRWVQSVVREEWTAEVFDVELMRYQNI  584

Query  326  EEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEPQPSSDDN  171
            EEEMVQMLQIA++CVAK PDMRP+M EVVR IE IR   ++++E +PSS++N
Sbjct  585  EEEMVQMLQIAMACVAKMPDMRPSMDEVVRMIEEIR---QSDSENRPSSEEN  633



>ref|XP_003537367.2| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X1 [Glycine max]
 ref|XP_006591268.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X2 [Glycine max]
Length=671

 Score =   244 bits (623),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 122/172 (71%), Positives = 142/172 (83%), Gaps = 5/172 (3%)
 Frame = -3

Query  686  GGAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRVT  507
            GG KFTHGNIKSSNVLL    DGCISD GL PLMN  AT S R  GYRAPEV +ETR+ +
Sbjct  495  GGPKFTHGNIKSSNVLLNQDNDGCISDFGLAPLMNVPATPS-RAAGYRAPEV-IETRKHS  552

Query  506  QKSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQNI  327
             KSDVYSFGV++LEMLTGK+ +   G DD+VDLPRWV+SVVREEWTAEVFDVELM+YQNI
Sbjct  553  HKSDVYSFGVLLLEMLTGKAPLQSPGRDDMVDLPRWVQSVVREEWTAEVFDVELMRYQNI  612

Query  326  EEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEPQPSSDDN  171
            EEEMVQMLQIA++CVAK PDMRP+M E VR IE IR   ++++E +PSS++N
Sbjct  613  EEEMVQMLQIAMACVAKMPDMRPSMDEAVRMIEEIR---QSDSENRPSSEEN  661



>ref|XP_006602049.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X2 [Glycine max]
Length=668

 Score =   244 bits (623),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 122/172 (71%), Positives = 142/172 (83%), Gaps = 5/172 (3%)
 Frame = -3

Query  686  GGAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRVT  507
            GG KFTHGNIKSSNVLL    DGCISD GL PLMN  AT S R  GYRAPEV +E R+ +
Sbjct  495  GGPKFTHGNIKSSNVLLNQDNDGCISDFGLAPLMNVPATPS-RTAGYRAPEV-IEARKHS  552

Query  506  QKSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQNI  327
             KSDVYSFGV++LEMLTGK+ +   G DD+VDLPRWV+SVVREEWTAEVFDVELM+YQNI
Sbjct  553  HKSDVYSFGVLLLEMLTGKAPLQSPGRDDMVDLPRWVQSVVREEWTAEVFDVELMRYQNI  612

Query  326  EEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEPQPSSDDN  171
            EEEMVQMLQIA++CVAK PDMRP+M EVVR IE IR   ++++E +PSS++N
Sbjct  613  EEEMVQMLQIAMACVAKMPDMRPSMDEVVRMIEEIR---QSDSENRPSSEEN  661



>ref|XP_006602050.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X3 [Glycine max]
Length=667

 Score =   244 bits (623),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 122/172 (71%), Positives = 142/172 (83%), Gaps = 5/172 (3%)
 Frame = -3

Query  686  GGAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRVT  507
            GG KFTHGNIKSSNVLL    DGCISD GL PLMN  AT S R  GYRAPEV +E R+ +
Sbjct  494  GGPKFTHGNIKSSNVLLNQDNDGCISDFGLAPLMNVPATPS-RTAGYRAPEV-IEARKHS  551

Query  506  QKSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQNI  327
             KSDVYSFGV++LEMLTGK+ +   G DD+VDLPRWV+SVVREEWTAEVFDVELM+YQNI
Sbjct  552  HKSDVYSFGVLLLEMLTGKAPLQSPGRDDMVDLPRWVQSVVREEWTAEVFDVELMRYQNI  611

Query  326  EEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEPQPSSDDN  171
            EEEMVQMLQIA++CVAK PDMRP+M EVVR IE IR   ++++E +PSS++N
Sbjct  612  EEEMVQMLQIAMACVAKMPDMRPSMDEVVRMIEEIR---QSDSENRPSSEEN  660



>ref|XP_003553192.2| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X1 [Glycine max]
 ref|XP_006602051.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X4 [Glycine max]
Length=654

 Score =   244 bits (622),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 122/172 (71%), Positives = 142/172 (83%), Gaps = 5/172 (3%)
 Frame = -3

Query  686  GGAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRVT  507
            GG KFTHGNIKSSNVLL    DGCISD GL PLMN  AT S R  GYRAPEV +E R+ +
Sbjct  481  GGPKFTHGNIKSSNVLLNQDNDGCISDFGLAPLMNVPATPS-RTAGYRAPEV-IEARKHS  538

Query  506  QKSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQNI  327
             KSDVYSFGV++LEMLTGK+ +   G DD+VDLPRWV+SVVREEWTAEVFDVELM+YQNI
Sbjct  539  HKSDVYSFGVLLLEMLTGKAPLQSPGRDDMVDLPRWVQSVVREEWTAEVFDVELMRYQNI  598

Query  326  EEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEPQPSSDDN  171
            EEEMVQMLQIA++CVAK PDMRP+M EVVR IE IR   ++++E +PSS++N
Sbjct  599  EEEMVQMLQIAMACVAKMPDMRPSMDEVVRMIEEIR---QSDSENRPSSEEN  647



>ref|XP_006591269.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X3 [Glycine max]
Length=670

 Score =   244 bits (623),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 122/172 (71%), Positives = 142/172 (83%), Gaps = 5/172 (3%)
 Frame = -3

Query  686  GGAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRVT  507
            GG KFTHGNIKSSNVLL    DGCISD GL PLMN  AT S R  GYRAPEV +ETR+ +
Sbjct  494  GGPKFTHGNIKSSNVLLNQDNDGCISDFGLAPLMNVPATPS-RAAGYRAPEV-IETRKHS  551

Query  506  QKSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQNI  327
             KSDVYSFGV++LEMLTGK+ +   G DD+VDLPRWV+SVVREEWTAEVFDVELM+YQNI
Sbjct  552  HKSDVYSFGVLLLEMLTGKAPLQSPGRDDMVDLPRWVQSVVREEWTAEVFDVELMRYQNI  611

Query  326  EEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEPQPSSDDN  171
            EEEMVQMLQIA++CVAK PDMRP+M E VR IE IR   ++++E +PSS++N
Sbjct  612  EEEMVQMLQIAMACVAKMPDMRPSMDEAVRMIEEIR---QSDSENRPSSEEN  660



>gb|KDP21623.1| hypothetical protein JCGZ_03294 [Jatropha curcas]
Length=632

 Score =   243 bits (620),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 124/178 (70%), Positives = 147/178 (83%), Gaps = 6/178 (3%)
 Frame = -3

Query  686  GGAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRVT  507
            GG K  HGN+K+SNVLLT  +DG +SD+GL PLMN  AT S R  GYRAPEV +ET+++ 
Sbjct  460  GGVKCVHGNVKASNVLLTPDLDGLMSDVGLTPLMNFPATIS-RTIGYRAPEV-IETQKLN  517

Query  506  QKSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQNI  327
            QKSDV+SFGVV+LEMLTGK+ +   G DDVVDLPRWVRSVVREEWTAEVFDVELMKYQNI
Sbjct  518  QKSDVFSFGVVLLEMLTGKAPLQAPGRDDVVDLPRWVRSVVREEWTAEVFDVELMKYQNI  577

Query  326  EEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEPQPSSD-DNNGGTP  156
            E+EMVQMLQIAL+CVAKAPDMRPTM EVVR +EGI+    +E++  PSS+ ++N  TP
Sbjct  578  EDEMVQMLQIALACVAKAPDMRPTMDEVVRMMEGIQ---HSESKNLPSSEAESNAQTP  632



>gb|KDP45679.1| hypothetical protein JCGZ_17286 [Jatropha curcas]
Length=634

 Score =   243 bits (620),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 122/172 (71%), Positives = 140/172 (81%), Gaps = 5/172 (3%)
 Frame = -3

Query  686  GGAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRVT  507
            GG KFTHGNIKSSNVLL    DGCISD GL PLMN  AT S R  GYRAPEV +ETR+ T
Sbjct  458  GGPKFTHGNIKSSNVLLNQEHDGCISDFGLTPLMNVPATPS-RSAGYRAPEV-IETRKHT  515

Query  506  QKSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQNI  327
             KSDVYSFGV++LEMLTGK+ +     DD+VDLPRWV+SVVREEWTAEVFDVELM+YQNI
Sbjct  516  HKSDVYSFGVLLLEMLTGKAPLQSPARDDMVDLPRWVQSVVREEWTAEVFDVELMRYQNI  575

Query  326  EEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEPQPSSDDN  171
            EEEMVQMLQI ++CVAK PDMRP M EVVR IE IR   ++++E +PSS++N
Sbjct  576  EEEMVQMLQIGMACVAKVPDMRPNMDEVVRMIEEIR---QSDSENRPSSEEN  624



>ref|XP_007033487.1| Leucine-rich repeat protein kinase family protein isoform 1 [Theobroma 
cacao]
 ref|XP_007033488.1| Leucine-rich repeat protein kinase family protein isoform 1 [Theobroma 
cacao]
 gb|EOY04413.1| Leucine-rich repeat protein kinase family protein isoform 1 [Theobroma 
cacao]
 gb|EOY04414.1| Leucine-rich repeat protein kinase family protein isoform 1 [Theobroma 
cacao]
Length=639

 Score =   243 bits (620),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 121/171 (71%), Positives = 143/171 (84%), Gaps = 5/171 (3%)
 Frame = -3

Query  683  GAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRVTQ  504
            G KF+HGNIKSSNVLL   + GCISD GL  LM+  A  S R  GYRAPEV +ETR+ TQ
Sbjct  464  GGKFSHGNIKSSNVLLNQDLHGCISDFGLTSLMSFPAVPS-RSAGYRAPEV-IETRKFTQ  521

Query  503  KSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQNIE  324
            KSDVYSFGV++LEMLTGKS V ++GH+DVVDLPRWV+SVVREEWTAEVFDVELMKYQN+E
Sbjct  522  KSDVYSFGVLLLEMLTGKSPVQLSGHEDVVDLPRWVQSVVREEWTAEVFDVELMKYQNVE  581

Query  323  EEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEPQPSSDDN  171
            EE+VQMLQIA++CVA+ PDMRPTM EV R +E IR P+++E   +PSS+DN
Sbjct  582  EELVQMLQIAMTCVARLPDMRPTMEEVTRMMEEIR-PSDSEN--RPSSEDN  629



>gb|KHG17391.1| hypothetical protein F383_22576 [Gossypium arboreum]
Length=661

 Score =   243 bits (621),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 123/176 (70%), Positives = 142/176 (81%), Gaps = 13/176 (7%)
 Frame = -3

Query  686  GGAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRP----GYRAPEVFVET  519
            GG KF HGNIKSSNVLLT  + GCISD GL PLM     TSP+ P    GYRAPEV +E+
Sbjct  485  GGGKFIHGNIKSSNVLLTEDLHGCISDFGLTPLM-----TSPKVPSRSAGYRAPEV-IES  538

Query  518  RRVTQKSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMK  339
            R+ TQKSDVYSFGV++LEMLTGK+A   +GH DVVDLPRWV+SVVREEWTAEVFDVELMK
Sbjct  539  RKFTQKSDVYSFGVLLLEMLTGKAATQSSGHADVVDLPRWVQSVVREEWTAEVFDVELMK  598

Query  338  YQNIEEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEPQPSSDDN  171
            YQNIEEE+VQMLQIA++CVA+ PDMRP+M EV R IE IR    + +E +PSS+DN
Sbjct  599  YQNIEEELVQMLQIAMTCVARLPDMRPSMEEVTRMIEEIR---PSVSENRPSSEDN  651



>ref|XP_007146903.1| hypothetical protein PHAVU_006G080200g [Phaseolus vulgaris]
 gb|ESW18897.1| hypothetical protein PHAVU_006G080200g [Phaseolus vulgaris]
Length=657

 Score =   243 bits (621),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 123/172 (72%), Positives = 143/172 (83%), Gaps = 5/172 (3%)
 Frame = -3

Query  686  GGAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRVT  507
            GG+KFTHGNIKSSNVLL    DGCISD GL  LMN  AT S R  GYRAPEV VETR+ +
Sbjct  481  GGSKFTHGNIKSSNVLLNQDNDGCISDFGLASLMNVPATPS-RAAGYRAPEV-VETRKHS  538

Query  506  QKSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQNI  327
             KSDVYSFGV++LEMLTGK+ +   G DD+VDLPRWV+SVVREEWTAEVFDVELM+YQNI
Sbjct  539  HKSDVYSFGVLLLEMLTGKAPLQSPGRDDMVDLPRWVQSVVREEWTAEVFDVELMRYQNI  598

Query  326  EEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEPQPSSDDN  171
            EEEMVQMLQIA++CVAK PDMRP+M EVVR IE IR   ++++E +PSS++N
Sbjct  599  EEEMVQMLQIAMACVAKMPDMRPSMDEVVRLIEEIR---QSDSENRPSSEEN  647



>ref|XP_010244554.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nelumbo 
nucifera]
 ref|XP_010244555.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nelumbo 
nucifera]
 ref|XP_010244556.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nelumbo 
nucifera]
 ref|XP_010244557.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nelumbo 
nucifera]
 ref|XP_010244558.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nelumbo 
nucifera]
Length=642

 Score =   243 bits (620),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 122/173 (71%), Positives = 142/173 (82%), Gaps = 5/173 (3%)
 Frame = -3

Query  689  KGGAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRV  510
            +GG KF HGNIKSSNVLLT   DGCISD GL  LMN     S R  GYRAPEV +ETR+ 
Sbjct  465  EGGGKFIHGNIKSSNVLLTQDQDGCISDFGLASLMNFPVIPS-RSVGYRAPEV-IETRKP  522

Query  509  TQKSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQN  330
            TQKSDVYSFGV++LE+LTGK+ +   GHDDVVDLPRWV+SVVREEWTAEVFDVELM+YQN
Sbjct  523  TQKSDVYSFGVLLLELLTGKAPLQSPGHDDVVDLPRWVQSVVREEWTAEVFDVELMRYQN  582

Query  329  IEEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEPQPSSDDN  171
            IEEEMVQMLQIA++CVAK PD+RP M EVVR IE IR   ++++E +PSS++N
Sbjct  583  IEEEMVQMLQIAMACVAKVPDVRPKMEEVVRMIEEIR---QSDSENRPSSEEN  632



>ref|XP_003519295.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X1 [Glycine max]
 ref|XP_006575457.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X2 [Glycine max]
 ref|XP_006575458.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X3 [Glycine max]
Length=654

 Score =   243 bits (621),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 122/172 (71%), Positives = 141/172 (82%), Gaps = 5/172 (3%)
 Frame = -3

Query  686  GGAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRVT  507
            GG KFTHGN+KSSNVLL    DGCISD GL PLMN  AT S R  GYRAPEV +ETR+ T
Sbjct  477  GGPKFTHGNVKSSNVLLNHDNDGCISDFGLTPLMNVPATPS-RAAGYRAPEV-IETRKHT  534

Query  506  QKSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQNI  327
             KSDVYSFG+++LEMLTGK+     G DD+VDLPRWV+SVVREEWTAEVFDVELM+YQNI
Sbjct  535  HKSDVYSFGILLLEMLTGKAPQQSPGRDDMVDLPRWVQSVVREEWTAEVFDVELMRYQNI  594

Query  326  EEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEPQPSSDDN  171
            EEEMVQMLQIA++CVAK PDMRP+M EVVR IE IR    +++E +PSS++N
Sbjct  595  EEEMVQMLQIAMACVAKVPDMRPSMDEVVRMIEEIR---LSDSENRPSSEEN  643



>ref|XP_007207849.1| hypothetical protein PRUPE_ppa022997mg, partial [Prunus persica]
 gb|EMJ09048.1| hypothetical protein PRUPE_ppa022997mg, partial [Prunus persica]
Length=623

 Score =   242 bits (618),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 122/171 (71%), Positives = 141/171 (82%), Gaps = 5/171 (3%)
 Frame = -3

Query  683  GAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRVTQ  504
            G KFTHGNIKSSNVLLT  ++G ISD GL PLMN  AT   R  GYRAPEV +ET++  Q
Sbjct  448  GGKFTHGNIKSSNVLLTQDLNGSISDFGLAPLMN-FATIPSRSVGYRAPEV-IETKKSFQ  505

Query  503  KSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQNIE  324
            KSDVYSFGV++LEMLTGK+ V   G DDVVDLPRWV+SVVREEWTAEVFDVELM+YQNIE
Sbjct  506  KSDVYSFGVLLLEMLTGKAPVQSPGRDDVVDLPRWVQSVVREEWTAEVFDVELMRYQNIE  565

Query  323  EEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEPQPSSDDN  171
            EE+VQMLQIA++CVA+ PDMRPTM EVVR IE IR P   +++ +PSS+DN
Sbjct  566  EELVQMLQIAMACVARVPDMRPTMEEVVRMIEEIRPP---DSDNRPSSEDN  613



>ref|XP_010922781.1| PREDICTED: probable inactive receptor kinase At5g58300 [Elaeis 
guineensis]
 ref|XP_010922782.1| PREDICTED: probable inactive receptor kinase At5g58300 [Elaeis 
guineensis]
 ref|XP_010922783.1| PREDICTED: probable inactive receptor kinase At5g58300 [Elaeis 
guineensis]
 ref|XP_010922784.1| PREDICTED: probable inactive receptor kinase At5g58300 [Elaeis 
guineensis]
 ref|XP_010922785.1| PREDICTED: probable inactive receptor kinase At5g58300 [Elaeis 
guineensis]
 ref|XP_010922786.1| PREDICTED: probable inactive receptor kinase At5g58300 [Elaeis 
guineensis]
Length=635

 Score =   242 bits (618),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 121/181 (67%), Positives = 146/181 (81%), Gaps = 7/181 (4%)
 Frame = -3

Query  689  KGGAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRV  510
            +GG KFTHGNIK+SNVLLT  ++ C+SD GL PLMN  AT S    GYRAPEV +ETR+ 
Sbjct  459  EGGGKFTHGNIKASNVLLTQDLEACVSDFGLAPLMNIHATPSRVVVGYRAPEV-IETRKS  517

Query  509  TQKSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQN  330
            TQKSDVYSFGV++LEMLTGK+ +   G DDVVDLPRWV+SVVREEWTAEVFDVELM+YQN
Sbjct  518  TQKSDVYSFGVLLLEMLTGKAPLQSPGRDDVVDLPRWVQSVVREEWTAEVFDVELMRYQN  577

Query  329  IEEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEPQPSSD---DNNGGT  159
            IEEEMVQMLQIA++CVA+APD RP M +V+R IE +R    +++E +PSS+   D+N  T
Sbjct  578  IEEEMVQMLQIAMACVARAPDQRPIMEDVIRMIEEVR---HSDSENRPSSEKSKDSNAQT  634

Query  158  P  156
            P
Sbjct  635  P  635



>ref|XP_009355011.1| PREDICTED: probable inactive receptor kinase At5g58300 [Pyrus 
x bretschneideri]
 ref|XP_009355020.1| PREDICTED: probable inactive receptor kinase At5g58300 [Pyrus 
x bretschneideri]
Length=623

 Score =   241 bits (616),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 121/170 (71%), Positives = 142/170 (84%), Gaps = 6/170 (4%)
 Frame = -3

Query  686  GGAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRVT  507
            GG KFTHGNIKS+NVLL+  +DGCISD+GL PLMN  AT   R  GYRAPEV +ETR+ +
Sbjct  458  GGPKFTHGNIKSTNVLLSQDLDGCISDVGLTPLMNVPATA--RSAGYRAPEV-IETRKHS  514

Query  506  QKSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQNI  327
             KSDVYSFGVV+LEMLTGK+ +   G DD+VDLPRWV+SVVREEWTAEVFDVELM+YQNI
Sbjct  515  HKSDVYSFGVVLLEMLTGKAPLQSPGRDDMVDLPRWVQSVVREEWTAEVFDVELMRYQNI  574

Query  326  EEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEPQPSSD  177
            EEEMVQMLQIA++CVAK PDMRPTM EVVR IE IR   ++++E + SS+
Sbjct  575  EEEMVQMLQIAMACVAKVPDMRPTMEEVVRMIEEIR---QSDSENRQSSE  621



>gb|KDO67579.1| hypothetical protein CISIN_1g006886mg [Citrus sinensis]
 gb|KDO67580.1| hypothetical protein CISIN_1g006886mg [Citrus sinensis]
Length=627

 Score =   241 bits (616),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 120/163 (74%), Positives = 138/163 (85%), Gaps = 3/163 (2%)
 Frame = -3

Query  698  FIQ-KGGAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVE  522
            FI  +GGAKFTHGNIKSSNVLLT  ++GCISD+GL  L+N   TT+ R  GYRAPEV  E
Sbjct  450  FIHSEGGAKFTHGNIKSSNVLLTQDLNGCISDVGLAHLIN-FPTTATRTIGYRAPEV-TE  507

Query  521  TRRVTQKSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELM  342
            TR+ +QKSDVYSFGV++LEMLTGK+ +  +GHDDVVDLPRWVRSVVREEWTAEVFDVEL+
Sbjct  508  TRKASQKSDVYSFGVLLLEMLTGKAPLQHSGHDDVVDLPRWVRSVVREEWTAEVFDVELL  567

Query  341  KYQNIEEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGP  213
            KYQ++EEEMVQMLQIALSCVAK PD RP M +VVR IE I+ P
Sbjct  568  KYQDVEEEMVQMLQIALSCVAKVPDSRPKMDDVVRMIEQIQQP  610



>ref|XP_006435961.1| hypothetical protein CICLE_v10030941mg [Citrus clementina]
 ref|XP_006486131.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X2 [Citrus sinensis]
 ref|XP_006486132.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X3 [Citrus sinensis]
 gb|ESR49201.1| hypothetical protein CICLE_v10030941mg [Citrus clementina]
Length=627

 Score =   241 bits (616),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 120/163 (74%), Positives = 138/163 (85%), Gaps = 3/163 (2%)
 Frame = -3

Query  698  FIQ-KGGAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVE  522
            FI  +GGAKFTHGNIKSSNVLLT  ++GCISD+GL  L+N   TT+ R  GYRAPEV  E
Sbjct  450  FIHSEGGAKFTHGNIKSSNVLLTQDLNGCISDVGLAHLIN-FPTTATRTIGYRAPEV-TE  507

Query  521  TRRVTQKSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELM  342
            TR+ +QKSDVYSFGV++LEMLTGK+ +  +GHDDVVDLPRWVRSVVREEWTAEVFDVEL+
Sbjct  508  TRKASQKSDVYSFGVLLLEMLTGKAPLQHSGHDDVVDLPRWVRSVVREEWTAEVFDVELL  567

Query  341  KYQNIEEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGP  213
            KYQ++EEEMVQMLQIALSCVAK PD RP M +VVR IE I+ P
Sbjct  568  KYQDVEEEMVQMLQIALSCVAKVPDSRPKMDDVVRMIEQIQQP  610



>ref|XP_007017100.1| Leucine-rich repeat protein kinase family protein [Theobroma 
cacao]
 gb|EOY34719.1| Leucine-rich repeat protein kinase family protein [Theobroma 
cacao]
Length=671

 Score =   242 bits (618),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 120/172 (70%), Positives = 142/172 (83%), Gaps = 5/172 (3%)
 Frame = -3

Query  686  GGAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRVT  507
            GG KFTHGN+KSSNVLL    DGCISD+GL PLMN   T S R  GYRAPEV +ETR+ T
Sbjct  495  GGPKFTHGNVKSSNVLLNQDHDGCISDLGLTPLMNVPVTPS-RTAGYRAPEV-IETRKHT  552

Query  506  QKSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQNI  327
             KSDVYSFGV++LEMLTGK+ +   G DD+VDLPRWV+SVVREEWTAEVFDVELM++QNI
Sbjct  553  HKSDVYSFGVLLLEMLTGKAPLQSPGRDDMVDLPRWVQSVVREEWTAEVFDVELMRFQNI  612

Query  326  EEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEPQPSSDDN  171
            EEEMVQMLQIA++CVAK PDMRP M EVVR IE +R   ++++E +PSS++N
Sbjct  613  EEEMVQMLQIAMACVAKVPDMRPNMDEVVRMIEEVR---QSDSENRPSSEEN  661



>ref|XP_008803002.1| PREDICTED: probable inactive receptor kinase At5g58300 [Phoenix 
dactylifera]
 ref|XP_008803003.1| PREDICTED: probable inactive receptor kinase At5g58300 [Phoenix 
dactylifera]
 ref|XP_008803004.1| PREDICTED: probable inactive receptor kinase At5g58300 [Phoenix 
dactylifera]
 ref|XP_008803005.1| PREDICTED: probable inactive receptor kinase At5g58300 [Phoenix 
dactylifera]
 ref|XP_008803006.1| PREDICTED: probable inactive receptor kinase At5g58300 [Phoenix 
dactylifera]
Length=635

 Score =   241 bits (616),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 119/178 (67%), Positives = 138/178 (78%), Gaps = 1/178 (1%)
 Frame = -3

Query  689  KGGAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRV  510
            +GG KFTHGNIK+SNVLLT  ++ C+SD GL PLMN  AT S    GYRAPEV +ETR+ 
Sbjct  459  EGGGKFTHGNIKASNVLLTQDLEACVSDFGLAPLMNTHATPSRIVVGYRAPEV-IETRKS  517

Query  509  TQKSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQN  330
            TQKSDVYSFGV++LEMLTGK+ +   G DDVVDLPRWV+SVVREEWTAEVFDVELM+YQN
Sbjct  518  TQKSDVYSFGVLLLEMLTGKAPLQSPGRDDVVDLPRWVQSVVREEWTAEVFDVELMRYQN  577

Query  329  IEEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEPQPSSDDNNGGTP  156
            IEEEMVQMLQIA++CVA+APD RP M EV+R IE +R            S D+N  TP
Sbjct  578  IEEEMVQMLQIAMACVARAPDQRPRMEEVIRMIEEVRHSDSGNRPSSEKSKDSNAQTP  635



>ref|XP_006435960.1| hypothetical protein CICLE_v10030941mg [Citrus clementina]
 ref|XP_006486130.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X1 [Citrus sinensis]
 gb|ESR49200.1| hypothetical protein CICLE_v10030941mg [Citrus clementina]
Length=638

 Score =   241 bits (616),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 120/163 (74%), Positives = 138/163 (85%), Gaps = 3/163 (2%)
 Frame = -3

Query  698  FIQ-KGGAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVE  522
            FI  +GGAKFTHGNIKSSNVLLT  ++GCISD+GL  L+N   TT+ R  GYRAPEV  E
Sbjct  461  FIHSEGGAKFTHGNIKSSNVLLTQDLNGCISDVGLAHLIN-FPTTATRTIGYRAPEV-TE  518

Query  521  TRRVTQKSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELM  342
            TR+ +QKSDVYSFGV++LEMLTGK+ +  +GHDDVVDLPRWVRSVVREEWTAEVFDVEL+
Sbjct  519  TRKASQKSDVYSFGVLLLEMLTGKAPLQHSGHDDVVDLPRWVRSVVREEWTAEVFDVELL  578

Query  341  KYQNIEEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGP  213
            KYQ++EEEMVQMLQIALSCVAK PD RP M +VVR IE I+ P
Sbjct  579  KYQDVEEEMVQMLQIALSCVAKVPDSRPKMDDVVRMIEQIQQP  621



>ref|XP_003616055.1| Leucine-rich repeat receptor-like protein kinase [Medicago truncatula]
 gb|AES99013.1| receptor-like kinase [Medicago truncatula]
Length=651

 Score =   241 bits (616),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 122/172 (71%), Positives = 139/172 (81%), Gaps = 5/172 (3%)
 Frame = -3

Query  686  GGAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRVT  507
            GG +FTHGN+KSSNVLL    DGCISD GL PLMN  AT S R  GYRAPEV +ETR+ T
Sbjct  475  GGPRFTHGNVKSSNVLLNQDNDGCISDFGLTPLMNIPATPS-RTMGYRAPEV-IETRKHT  532

Query  506  QKSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQNI  327
             KSDVYSFGV++LEMLTGK+       DD+VDLPRWVRSVVREEWTAEVFDVELM+YQNI
Sbjct  533  HKSDVYSFGVLLLEMLTGKAPQQSPVRDDMVDLPRWVRSVVREEWTAEVFDVELMRYQNI  592

Query  326  EEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEPQPSSDDN  171
            EEEMVQMLQI ++CVAK PDMRP M EVVR IE IR   +++++ +PSSDDN
Sbjct  593  EEEMVQMLQIGMTCVAKVPDMRPNMEEVVRMIEEIR---QSDSDNRPSSDDN  641



>ref|XP_007142022.1| hypothetical protein PHAVU_008G245900g [Phaseolus vulgaris]
 ref|XP_007142023.1| hypothetical protein PHAVU_008G245900g [Phaseolus vulgaris]
 gb|ESW14016.1| hypothetical protein PHAVU_008G245900g [Phaseolus vulgaris]
 gb|ESW14017.1| hypothetical protein PHAVU_008G245900g [Phaseolus vulgaris]
Length=655

 Score =   241 bits (616),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 122/172 (71%), Positives = 140/172 (81%), Gaps = 5/172 (3%)
 Frame = -3

Query  686  GGAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRVT  507
            GG KFTHGN+KSSNVLL    DGCISD GL PLMN  AT S R  GYRAPEV +ETR+ +
Sbjct  478  GGPKFTHGNVKSSNVLLNQDNDGCISDFGLTPLMNVPATPS-RAAGYRAPEV-IETRKHS  535

Query  506  QKSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQNI  327
             KSDVYSFGV++LEMLTGK+     G DD+VDLPRWV+SVVREEWTAEVFDVELM+YQNI
Sbjct  536  HKSDVYSFGVLLLEMLTGKAPQQSPGRDDMVDLPRWVQSVVREEWTAEVFDVELMRYQNI  595

Query  326  EEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEPQPSSDDN  171
            EEEMVQMLQIA++CVAK PDMRPTM EV R IE IR    +++E +PSS++N
Sbjct  596  EEEMVQMLQIAMACVAKVPDMRPTMEEVARMIEEIR---LSDSENRPSSEEN  644



>ref|XP_006429632.1| hypothetical protein CICLE_v10011280mg [Citrus clementina]
 ref|XP_006481232.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X1 [Citrus sinensis]
 ref|XP_006481233.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X2 [Citrus sinensis]
 ref|XP_006481234.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X3 [Citrus sinensis]
 gb|ESR42872.1| hypothetical protein CICLE_v10011280mg [Citrus clementina]
Length=632

 Score =   241 bits (615),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 120/170 (71%), Positives = 139/170 (82%), Gaps = 5/170 (3%)
 Frame = -3

Query  683  GAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRVTQ  504
            G KF  GNIKSSNVLL+  + GCISD GL PLMN   T   R  GYRAPEV +ET++ TQ
Sbjct  458  GGKFILGNIKSSNVLLSQDLQGCISDFGLTPLMN-TPTVPSRSAGYRAPEV-IETKKPTQ  515

Query  503  KSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQNIE  324
            KSDVYSFGV++LEMLTGK+ +   GH+DVVDLPRWV+SVVREEWT+EVFDVELM+Y+NIE
Sbjct  516  KSDVYSFGVLLLEMLTGKAPIQAPGHEDVVDLPRWVQSVVREEWTSEVFDVELMRYENIE  575

Query  323  EEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEPQPSSDD  174
            EEMVQMLQIA+SCVAK PDMRPTM EVVR IE IR    +++E QPSS+D
Sbjct  576  EEMVQMLQIAMSCVAKVPDMRPTMEEVVRMIEDIR---PSDSENQPSSED  622



>gb|KDO64166.1| hypothetical protein CISIN_1g006747mg [Citrus sinensis]
Length=632

 Score =   241 bits (615),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 120/170 (71%), Positives = 139/170 (82%), Gaps = 5/170 (3%)
 Frame = -3

Query  683  GAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRVTQ  504
            G KF  GNIKSSNVLL+  + GCISD GL PLMN   T   R  GYRAPEV +ET++ TQ
Sbjct  458  GGKFILGNIKSSNVLLSQDLQGCISDFGLTPLMN-TPTVPSRSAGYRAPEV-IETKKPTQ  515

Query  503  KSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQNIE  324
            KSDVYSFGV++LEMLTGK+ +   GH+DVVDLPRWV+SVVREEWT+EVFDVELM+Y+NIE
Sbjct  516  KSDVYSFGVLLLEMLTGKAPIQAPGHEDVVDLPRWVQSVVREEWTSEVFDVELMRYENIE  575

Query  323  EEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEPQPSSDD  174
            EEMVQMLQIA+SCVAK PDMRPTM EVVR IE IR    +++E QPSS+D
Sbjct  576  EEMVQMLQIAMSCVAKVPDMRPTMEEVVRMIEDIR---PSDSENQPSSED  622



>ref|XP_008463277.1| PREDICTED: probable inactive receptor kinase At5g58300 [Cucumis 
melo]
 ref|XP_008463278.1| PREDICTED: probable inactive receptor kinase At5g58300 [Cucumis 
melo]
 ref|XP_008463279.1| PREDICTED: probable inactive receptor kinase At5g58300 [Cucumis 
melo]
 ref|XP_008463281.1| PREDICTED: probable inactive receptor kinase At5g58300 [Cucumis 
melo]
 ref|XP_008463282.1| PREDICTED: probable inactive receptor kinase At5g58300 [Cucumis 
melo]
 ref|XP_008463283.1| PREDICTED: probable inactive receptor kinase At5g58300 [Cucumis 
melo]
Length=640

 Score =   241 bits (614),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 121/174 (70%), Positives = 139/174 (80%), Gaps = 5/174 (3%)
 Frame = -3

Query  683  GAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRVTQ  504
            G KF HGNIKSSN+LLT   +GCISD GL PLMN+ A  S R  GYRAPEV +ETR+ TQ
Sbjct  455  GGKFIHGNIKSSNILLTQDPNGCISDFGLTPLMNSPAIPS-RSVGYRAPEV-IETRKSTQ  512

Query  503  KSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQNIE  324
            KSDVYSFGVV+LEMLTGK+     G DDV+DLPRWV+SVVREEWT+EVFDVELMKYQNIE
Sbjct  513  KSDVYSFGVVLLEMLTGKAPSQSPGRDDVIDLPRWVQSVVREEWTSEVFDVELMKYQNIE  572

Query  323  EEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEPQPSSDDNNGG  162
            EE+VQMLQIA++CV++ PDMRPTM EVVR IE IR      +  +PSS+DN  G
Sbjct  573  EELVQMLQIAMACVSRVPDMRPTMDEVVRMIEEIR---SLHSGTRPSSEDNKAG  623



>ref|XP_003544939.1| PREDICTED: probable inactive receptor kinase At5g58300-like [Glycine 
max]
Length=656

 Score =   241 bits (614),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 121/172 (70%), Positives = 140/172 (81%), Gaps = 5/172 (3%)
 Frame = -3

Query  686  GGAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRVT  507
            GG KF HGN+KSSNVLL    DGCISD GL PLMN  +T S R  GYRAPEV +ETR+ T
Sbjct  479  GGPKFAHGNVKSSNVLLNQDNDGCISDFGLTPLMNVPSTPS-RAAGYRAPEV-IETRKHT  536

Query  506  QKSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQNI  327
             KSDVYSFGV++LEMLTGK+     G DD+VDLPRWV+SVVREEWTAEVFDVELM+YQNI
Sbjct  537  HKSDVYSFGVLLLEMLTGKAPQQSPGRDDMVDLPRWVQSVVREEWTAEVFDVELMRYQNI  596

Query  326  EEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEPQPSSDDN  171
            EEEMVQMLQIA++CVAK PDMRP+M EVVR IE IR    +++E +PSS++N
Sbjct  597  EEEMVQMLQIAMACVAKVPDMRPSMEEVVRMIEEIR---LSDSENRPSSEEN  645



>ref|XP_004500388.1| PREDICTED: probable inactive receptor kinase At5g58300-like [Cicer 
arietinum]
Length=647

 Score =   240 bits (613),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 122/172 (71%), Positives = 141/172 (82%), Gaps = 5/172 (3%)
 Frame = -3

Query  686  GGAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRVT  507
            GG KFTHGNIKSSNVLL    DGCISD GL  LMN  AT S R  GYRAPEV +ETR+ +
Sbjct  471  GGPKFTHGNIKSSNVLLNQDNDGCISDFGLAALMNVPATPS-RAAGYRAPEV-IETRKHS  528

Query  506  QKSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQNI  327
             KSDVYSFGV++LEMLTGK+ +   G DD+VDLPRWV+SVVREEWTAEVFDVELM+YQNI
Sbjct  529  HKSDVYSFGVLLLEMLTGKAPLQSPGRDDMVDLPRWVQSVVREEWTAEVFDVELMRYQNI  588

Query  326  EEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEPQPSSDDN  171
            EEEMVQMLQIA++CVAK PDMRP+M EVVR IE IR    +++E +PSS++N
Sbjct  589  EEEMVQMLQIAMACVAKMPDMRPSMDEVVRMIEEIR---LSDSENRPSSEEN  637



>ref|XP_006842562.1| hypothetical protein AMTR_s00077p00144570 [Amborella trichopoda]
 gb|ERN04237.1| hypothetical protein AMTR_s00077p00144570 [Amborella trichopoda]
Length=219

 Score =   228 bits (582),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 112/178 (63%), Positives = 140/178 (79%), Gaps = 10/178 (6%)
 Frame = -3

Query  686  GGAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAAT-TSPRRPGYRAPEVFVETRRV  510
            GG KFTHGNIKSSN+LLT  ++  +SD GL PLM+  A    PR PGYRAPE   ETRR 
Sbjct  36   GGGKFTHGNIKSSNILLTPELEPLVSDFGLAPLMSPPAPGPHPRAPGYRAPETL-ETRRA  94

Query  509  TQKSDVYSFGVVVLEMLTGKS-----AVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVEL  345
            TQKSDVYSFGV++LE+LTGKS          G +D+ DLPRWV+SVVREEWTAEVFDVEL
Sbjct  95   TQKSDVYSFGVLLLELLTGKSPAQAHQAQAQGSEDIADLPRWVQSVVREEWTAEVFDVEL  154

Query  344  MKYQNIEEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEPQPSSDDN  171
            M+YQNIEEEMVQMLQ+A++CVA+ PD+RP M+EVV+ +E ++   ++++E +PSS+DN
Sbjct  155  MRYQNIEEEMVQMLQVAMACVARVPDLRPKMSEVVKMVEDVK---QSDSENRPSSEDN  209



>ref|XP_008244615.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X2 [Prunus mume]
Length=554

 Score =   238 bits (607),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 120/171 (70%), Positives = 139/171 (81%), Gaps = 5/171 (3%)
 Frame = -3

Query  683  GAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRVTQ  504
            G KF HGNIKSSN LLT  ++G ISD GL PLMN  AT   R  GYRAPEV +ET++  Q
Sbjct  379  GGKFIHGNIKSSNALLTQDLNGSISDFGLAPLMN-FATIPSRSVGYRAPEV-IETKKSFQ  436

Query  503  KSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQNIE  324
            KSDVYSFGV++LEMLTGK+ V   G DDVVDLPRWV+SVVREEWTAEVFDVELM+YQNIE
Sbjct  437  KSDVYSFGVLLLEMLTGKAPVQSPGRDDVVDLPRWVQSVVREEWTAEVFDVELMRYQNIE  496

Query  323  EEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEPQPSSDDN  171
            EE+VQMLQIA++CVA+ PDMRPTM EVVR IE IR P   +++ +PSS+DN
Sbjct  497  EELVQMLQIAMACVARVPDMRPTMEEVVRMIEEIRPP---DSDNRPSSEDN  544



>ref|XP_006374053.1| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
 gb|ERP51850.1| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
Length=626

 Score =   239 bits (610),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 120/173 (69%), Positives = 141/173 (82%), Gaps = 5/173 (3%)
 Frame = -3

Query  683  GAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRVTQ  504
            G KF HGNIKSSNVLL   + GCISD GL PL++  +  S R  GYRAPEV ++TR+ TQ
Sbjct  456  GGKFIHGNIKSSNVLLMQDLHGCISDFGLTPLLSYPSVPS-RSAGYRAPEV-IDTRKSTQ  513

Query  503  KSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQNIE  324
            KSDVYSFGVV+LEMLTGK+ V   GHDDV+DLPRWV+SVVREEWTAEVFD ELM+YQNIE
Sbjct  514  KSDVYSFGVVLLEMLTGKAPVQSPGHDDVIDLPRWVQSVVREEWTAEVFDEELMRYQNIE  573

Query  323  EEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEPQPSSDDNNG  165
            EEMV+MLQIA++CVA  PDMRPTM EVVR IE + GP+E+E   +PSS++N G
Sbjct  574  EEMVEMLQIAMACVAVVPDMRPTMEEVVRMIEEV-GPSESEN--RPSSEENKG  623



>ref|XP_011011771.1| PREDICTED: probable inactive receptor kinase At5g58300 [Populus 
euphratica]
 ref|XP_011011772.1| PREDICTED: probable inactive receptor kinase At5g58300 [Populus 
euphratica]
 ref|XP_011011773.1| PREDICTED: probable inactive receptor kinase At5g58300 [Populus 
euphratica]
 ref|XP_011011774.1| PREDICTED: probable inactive receptor kinase At5g58300 [Populus 
euphratica]
 ref|XP_011011775.1| PREDICTED: probable inactive receptor kinase At5g58300 [Populus 
euphratica]
Length=635

 Score =   239 bits (610),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 119/172 (69%), Positives = 140/172 (81%), Gaps = 5/172 (3%)
 Frame = -3

Query  686  GGAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRVT  507
            GG KFTHGNIKSSNVLL+   DGCISD GL PLMN  A++S R  GYRAPEV +ET + +
Sbjct  459  GGPKFTHGNIKSSNVLLSQDHDGCISDFGLTPLMNVPASSS-RSAGYRAPEV-IETSKHS  516

Query  506  QKSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQNI  327
             KSDVYSFGV++LEMLTGK+ +     DD+VDLPRWV+SVVREEWTAEVFDVELM+YQNI
Sbjct  517  HKSDVYSFGVILLEMLTGKAPIQSPRRDDMVDLPRWVQSVVREEWTAEVFDVELMRYQNI  576

Query  326  EEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEPQPSSDDN  171
            EEEMVQMLQI ++CVAK PDMRP M EVVR IE IR   ++++E +PSS+ N
Sbjct  577  EEEMVQMLQIGMTCVAKVPDMRPNMEEVVRMIEEIR---QSDSENRPSSEGN  625



>ref|XP_010322111.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X1 [Solanum lycopersicum]
Length=594

 Score =   238 bits (608),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 109/158 (69%), Positives = 132/158 (84%), Gaps = 1/158 (1%)
 Frame = -3

Query  692  QKGGAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRR  513
             +GG KFTHGNIK+SN+LLT  +DGCISD GL PLMN+ +  + +  GY APEV +ETR+
Sbjct  436  SEGGTKFTHGNIKASNILLTRDLDGCISDFGLSPLMNHTSIKNNKAVGYHAPEV-IETRK  494

Query  512  VTQKSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQ  333
             TQKSDVYSFGV+VLE+LTGKS +P+ GH+DVV+LPRWVR+VV+EEWTAEVFD  LMKY 
Sbjct  495  GTQKSDVYSFGVLVLELLTGKSPLPLPGHEDVVNLPRWVRAVVKEEWTAEVFDAVLMKYH  554

Query  332  NIEEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIR  219
            NI+EEMV MLQIAL CVAK PDMRP+M EV++ IE I+
Sbjct  555  NIQEEMVHMLQIALLCVAKVPDMRPSMGEVIKMIEQIK  592



>ref|XP_004241083.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X2 [Solanum lycopersicum]
Length=593

 Score =   238 bits (608),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 109/158 (69%), Positives = 132/158 (84%), Gaps = 1/158 (1%)
 Frame = -3

Query  692  QKGGAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRR  513
             +GG KFTHGNIK+SN+LLT  +DGCISD GL PLMN+ +  + +  GY APEV +ETR+
Sbjct  435  SEGGTKFTHGNIKASNILLTRDLDGCISDFGLSPLMNHTSIKNNKAVGYHAPEV-IETRK  493

Query  512  VTQKSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQ  333
             TQKSDVYSFGV+VLE+LTGKS +P+ GH+DVV+LPRWVR+VV+EEWTAEVFD  LMKY 
Sbjct  494  GTQKSDVYSFGVLVLELLTGKSPLPLPGHEDVVNLPRWVRAVVKEEWTAEVFDAVLMKYH  553

Query  332  NIEEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIR  219
            NI+EEMV MLQIAL CVAK PDMRP+M EV++ IE I+
Sbjct  554  NIQEEMVHMLQIALLCVAKVPDMRPSMGEVIKMIEQIK  591



>ref|XP_011080640.1| PREDICTED: probable inactive receptor kinase At5g58300 [Sesamum 
indicum]
Length=640

 Score =   239 bits (610),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 116/172 (67%), Positives = 142/172 (83%), Gaps = 5/172 (3%)
 Frame = -3

Query  686  GGAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRVT  507
            GGA+FTHGNIKSSNVLL   ++ C+SD GL PLMN+ A++S R  GYRAPEV +ETR+ T
Sbjct  470  GGARFTHGNIKSSNVLLNQDVEACVSDFGLAPLMNSPASSS-RHTGYRAPEV-IETRKHT  527

Query  506  QKSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQNI  327
             KSDVYSFGV++LEMLTGK  +   G DD+VDLPRWV+SVVREEWTAEVFD+ELM++QNI
Sbjct  528  HKSDVYSFGVMLLEMLTGKQPIQSPGRDDIVDLPRWVQSVVREEWTAEVFDIELMRFQNI  587

Query  326  EEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEPQPSSDDN  171
            EEEMVQMLQIA++CVAK PD RP M EVVR IE +R    +++E +PSS++N
Sbjct  588  EEEMVQMLQIAMACVAKVPDARPNMDEVVRMIEEVR---PSDSENRPSSEEN  636



>ref|XP_002319979.1| putative plant disease resistance family protein [Populus trichocarpa]
 gb|EEE95902.1| putative plant disease resistance family protein [Populus trichocarpa]
Length=635

 Score =   239 bits (610),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 119/172 (69%), Positives = 140/172 (81%), Gaps = 5/172 (3%)
 Frame = -3

Query  686  GGAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRVT  507
            GG KFTHGNIKSSNVLL+   DGCISD GL PLMN  A++S R  GYRAPEV +ET + +
Sbjct  459  GGPKFTHGNIKSSNVLLSQDHDGCISDFGLTPLMNVPASSS-RSAGYRAPEV-IETSKHS  516

Query  506  QKSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQNI  327
             KSDVYSFGV++LEMLTGK+ +     DD+VDLPRWV+SVVREEWTAEVFDVELM+YQNI
Sbjct  517  HKSDVYSFGVILLEMLTGKAPIQSPRRDDMVDLPRWVQSVVREEWTAEVFDVELMRYQNI  576

Query  326  EEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEPQPSSDDN  171
            EEEMVQMLQI ++CVAK PDMRP M EVVR IE IR   ++++E +PSS+ N
Sbjct  577  EEEMVQMLQIGMTCVAKVPDMRPNMEEVVRMIEEIR---QSDSENRPSSEGN  625



>gb|ABR17070.1| unknown [Picea sitchensis]
Length=340

 Score =   231 bits (589),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 119/183 (65%), Positives = 146/183 (80%), Gaps = 7/183 (4%)
 Frame = -3

Query  692  QKGGAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRR  513
            ++GG KFTHGNIKSSNVLLTT +DGC+SD GL PL + AA  + R  GYRAPEV +ETR+
Sbjct  145  EEGGGKFTHGNIKSSNVLLTTDLDGCVSDFGLVPLFSAAAAAN-RIAGYRAPEV-IETRK  202

Query  512  VTQKSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQ  333
            VTQKSDVYSFGV++LE+LTGK+    + +D+ +DLPRWV+SVVREEWTAEVFDVELM+YQ
Sbjct  203  VTQKSDVYSFGVLLLELLTGKAPNQASLNDEGIDLPRWVQSVVREEWTAEVFDVELMRYQ  262

Query  332  NIEEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEPQPSSDD----NNG  165
            NIEEEMVQ+LQIA++CVA  PD RP M +VV+ IE +R   ET+   + SSDD    +NG
Sbjct  263  NIEEEMVQLLQIAMACVAAVPDQRPRMQDVVKMIEDMR-QFETDDGNRQSSDDKSKESNG  321

Query  164  GTP  156
             TP
Sbjct  322  QTP  324



>ref|XP_003600547.1| Leucine-rich repeat receptor-like protein kinase [Medicago truncatula]
 gb|AES70798.1| LRR receptor-like kinase [Medicago truncatula]
Length=660

 Score =   239 bits (610),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 120/172 (70%), Positives = 140/172 (81%), Gaps = 5/172 (3%)
 Frame = -3

Query  686  GGAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRVT  507
            GG KFTHGNIKSSNVLL    DGCISD GL  LMN  A  S R  GYRAPEV +ETR+ +
Sbjct  484  GGPKFTHGNIKSSNVLLNQDNDGCISDFGLASLMNVPANPS-RAAGYRAPEV-IETRKHS  541

Query  506  QKSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQNI  327
             KSDVYSFGV++LEMLTGK+ +   G DD+VDLPRWV+SVVREEWTAEVFDVELM+YQNI
Sbjct  542  HKSDVYSFGVLLLEMLTGKAPLQSPGRDDMVDLPRWVQSVVREEWTAEVFDVELMRYQNI  601

Query  326  EEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEPQPSSDDN  171
            EEEMVQMLQIA++CVAK PDMRP M EVV+ IE IR   ++++E +PSS++N
Sbjct  602  EEEMVQMLQIAMACVAKMPDMRPNMDEVVKMIEEIR---QSDSENRPSSEEN  650



>gb|KEH34523.1| LRR receptor-like kinase [Medicago truncatula]
Length=650

 Score =   239 bits (609),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 120/172 (70%), Positives = 140/172 (81%), Gaps = 5/172 (3%)
 Frame = -3

Query  686  GGAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRVT  507
            GG KFTHGNIKSSNVLL    DGCISD GL  LMN  A  S R  GYRAPEV +ETR+ +
Sbjct  474  GGPKFTHGNIKSSNVLLNQDNDGCISDFGLASLMNVPANPS-RAAGYRAPEV-IETRKHS  531

Query  506  QKSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQNI  327
             KSDVYSFGV++LEMLTGK+ +   G DD+VDLPRWV+SVVREEWTAEVFDVELM+YQNI
Sbjct  532  HKSDVYSFGVLLLEMLTGKAPLQSPGRDDMVDLPRWVQSVVREEWTAEVFDVELMRYQNI  591

Query  326  EEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEPQPSSDDN  171
            EEEMVQMLQIA++CVAK PDMRP M EVV+ IE IR   ++++E +PSS++N
Sbjct  592  EEEMVQMLQIAMACVAKMPDMRPNMDEVVKMIEEIR---QSDSENRPSSEEN  640



>ref|XP_004172749.1| PREDICTED: LOW QUALITY PROTEIN: probable inactive receptor kinase 
At5g58300-like [Cucumis sativus]
Length=638

 Score =   239 bits (609),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 118/171 (69%), Positives = 140/171 (82%), Gaps = 5/171 (3%)
 Frame = -3

Query  683  GAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRVTQ  504
            G KF HGNIKSSN+LLT  ++GCISD GL PLMN+ A  S R  GYRAPEV +ETR+ TQ
Sbjct  455  GGKFIHGNIKSSNILLTQDLNGCISDFGLTPLMNSPAIPS-RSVGYRAPEV-IETRKSTQ  512

Query  503  KSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQNIE  324
            KSDVYSFGV++LEMLTGK+     G DDV+DLPRWV+SVVREEWT+EVFDVELMKYQNIE
Sbjct  513  KSDVYSFGVILLEMLTGKAPSQSPGRDDVMDLPRWVQSVVREEWTSEVFDVELMKYQNIE  572

Query  323  EEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEPQPSSDDN  171
            EE+VQMLQIA++CV++ PDMRPTM +VVR IE IR     ++  +PSS+DN
Sbjct  573  EELVQMLQIAMACVSRVPDMRPTMDDVVRMIEEIR---SLDSGTRPSSEDN  620



>ref|XP_004142674.1| PREDICTED: probable inactive receptor kinase At5g58300-like [Cucumis 
sativus]
 gb|KGN54462.1| hypothetical protein Csa_4G334730 [Cucumis sativus]
Length=638

 Score =   238 bits (608),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 118/171 (69%), Positives = 140/171 (82%), Gaps = 5/171 (3%)
 Frame = -3

Query  683  GAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRVTQ  504
            G KF HGNIKSSN+LLT  ++GCISD GL PLMN+ A  S R  GYRAPEV +ETR+ TQ
Sbjct  455  GGKFIHGNIKSSNILLTQDLNGCISDFGLTPLMNSPAIPS-RSVGYRAPEV-IETRKSTQ  512

Query  503  KSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQNIE  324
            KSDVYSFGV++LEMLTGK+     G DDV+DLPRWV+SVVREEWT+EVFDVELMKYQNIE
Sbjct  513  KSDVYSFGVILLEMLTGKAPSQSPGRDDVMDLPRWVQSVVREEWTSEVFDVELMKYQNIE  572

Query  323  EEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEPQPSSDDN  171
            EE+VQMLQIA++CV++ PDMRPTM +VVR IE IR     ++  +PSS+DN
Sbjct  573  EELVQMLQIAMACVSRVPDMRPTMDDVVRMIEEIR---SLDSGTRPSSEDN  620



>ref|XP_008244579.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X1 [Prunus mume]
 ref|XP_008244587.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X1 [Prunus mume]
 ref|XP_008244595.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X1 [Prunus mume]
 ref|XP_008244604.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X1 [Prunus mume]
 ref|XP_008244609.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X1 [Prunus mume]
Length=633

 Score =   238 bits (607),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 120/171 (70%), Positives = 139/171 (81%), Gaps = 5/171 (3%)
 Frame = -3

Query  683  GAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRVTQ  504
            G KF HGNIKSSN LLT  ++G ISD GL PLMN  AT   R  GYRAPEV +ET++  Q
Sbjct  458  GGKFIHGNIKSSNALLTQDLNGSISDFGLAPLMN-FATIPSRSVGYRAPEV-IETKKSFQ  515

Query  503  KSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQNIE  324
            KSDVYSFGV++LEMLTGK+ V   G DDVVDLPRWV+SVVREEWTAEVFDVELM+YQNIE
Sbjct  516  KSDVYSFGVLLLEMLTGKAPVQSPGRDDVVDLPRWVQSVVREEWTAEVFDVELMRYQNIE  575

Query  323  EEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEPQPSSDDN  171
            EE+VQMLQIA++CVA+ PDMRPTM EVVR IE IR P   +++ +PSS+DN
Sbjct  576  EELVQMLQIAMACVARVPDMRPTMEEVVRMIEEIRPP---DSDNRPSSEDN  623



>ref|XP_010931391.1| PREDICTED: probable inactive receptor kinase At5g58300 [Elaeis 
guineensis]
 ref|XP_010931392.1| PREDICTED: probable inactive receptor kinase At5g58300 [Elaeis 
guineensis]
 ref|XP_010931393.1| PREDICTED: probable inactive receptor kinase At5g58300 [Elaeis 
guineensis]
Length=636

 Score =   238 bits (607),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 118/178 (66%), Positives = 140/178 (79%), Gaps = 2/178 (1%)
 Frame = -3

Query  686  GGAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRVT  507
            GG KFTHGNIK+SNVLLT  ++ C+SD GL PLMN  AT S    GYRAPEV +ETR+ T
Sbjct  460  GGGKFTHGNIKASNVLLTQDLEACVSDFGLAPLMNTHATPSRVVVGYRAPEV-IETRKST  518

Query  506  QKSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQNI  327
            Q+SDVYSFGV++LEMLTGK+ +   G DDVVDLPRWV+SVVREEWTAEVFDVELM+YQNI
Sbjct  519  QRSDVYSFGVLLLEMLTGKAPLQSPGRDDVVDLPRWVQSVVREEWTAEVFDVELMRYQNI  578

Query  326  EEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIR-GPAETETEPQPSSDDNNGGTP  156
            EEEMVQMLQIA++CVA+APD RP M EV+R IE +R   +E     +  + D+N  TP
Sbjct  579  EEEMVQMLQIAMACVARAPDQRPRMEEVIRMIEEVRHSDSENRQSSEEKARDSNVPTP  636



>ref|XP_008355739.1| PREDICTED: probable inactive receptor kinase At5g58300 [Malus 
domestica]
Length=639

 Score =   238 bits (607),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 124/172 (72%), Positives = 140/172 (81%), Gaps = 7/172 (4%)
 Frame = -3

Query  683  GAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRP-GYRAPEVFVETRRVT  507
            G KF HGNIKSSNVLLT  + G ISD GL  LMN   TT P R  GYRAPEV +ET++  
Sbjct  455  GGKFIHGNIKSSNVLLTQDLYGSISDFGLALLMN--LTTIPSRSVGYRAPEV-IETKKSF  511

Query  506  QKSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQNI  327
            QKSDVYSFGV++LEMLTGK+ V  +G DDVVDLPRWV+SVVREEWTAEVFDVELMKYQNI
Sbjct  512  QKSDVYSFGVMLLEMLTGKAPVQSSGRDDVVDLPRWVQSVVREEWTAEVFDVELMKYQNI  571

Query  326  EEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEPQPSSDDN  171
            EEE+VQMLQIA++CVA+ PDMRPTM EVVR IE IR P   ++E +PSSDDN
Sbjct  572  EEELVQMLQIAMTCVARVPDMRPTMEEVVRMIEEIRPP---DSENRPSSDDN  620



>gb|KDO54914.1| hypothetical protein CISIN_1g005693mg [Citrus sinensis]
 gb|KDO54915.1| hypothetical protein CISIN_1g005693mg [Citrus sinensis]
Length=635

 Score =   238 bits (606),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 117/172 (68%), Positives = 141/172 (82%), Gaps = 5/172 (3%)
 Frame = -3

Query  686  GGAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRVT  507
            GG KFTHGNIK+SNVL+   +DGCISD GL PLMN  AT S R  GYRAPEV +ETR+ +
Sbjct  459  GGPKFTHGNIKASNVLINQDLDGCISDFGLTPLMNVPATPS-RSAGYRAPEV-IETRKHS  516

Query  506  QKSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQNI  327
             KSDVYSFGV++LEMLTGK+ +     DD+VDLPRWV+SVVREEWTAEVFDVELM++QNI
Sbjct  517  HKSDVYSFGVLLLEMLTGKAPLQSPTRDDMVDLPRWVQSVVREEWTAEVFDVELMRFQNI  576

Query  326  EEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEPQPSSDDN  171
            EEEMVQMLQI ++CVAK PDMRP M EVVR IE +R   ++++E +PSS++N
Sbjct  577  EEEMVQMLQIGMACVAKVPDMRPNMDEVVRMIEEVR---QSDSENRPSSEEN  625



>ref|XP_006432052.1| hypothetical protein CICLE_v10000513mg [Citrus clementina]
 ref|XP_006464957.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X2 [Citrus sinensis]
 ref|XP_006464958.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X3 [Citrus sinensis]
 gb|ESR45292.1| hypothetical protein CICLE_v10000513mg [Citrus clementina]
Length=635

 Score =   237 bits (605),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 117/172 (68%), Positives = 141/172 (82%), Gaps = 5/172 (3%)
 Frame = -3

Query  686  GGAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRVT  507
            GG KFTHGNIK+SNVL+   +DGCISD GL PLMN  AT S R  GYRAPEV +ETR+ +
Sbjct  459  GGPKFTHGNIKASNVLINQDLDGCISDFGLTPLMNVPATPS-RSAGYRAPEV-IETRKHS  516

Query  506  QKSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQNI  327
             KSDVYSFGV++LEMLTGK+ +     DD+VDLPRWV+SVVREEWTAEVFDVELM++QNI
Sbjct  517  HKSDVYSFGVLLLEMLTGKAPLQSPTRDDMVDLPRWVQSVVREEWTAEVFDVELMRFQNI  576

Query  326  EEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEPQPSSDDN  171
            EEEMVQMLQI ++CVAK PDMRP M EVVR IE +R   ++++E +PSS++N
Sbjct  577  EEEMVQMLQIGMACVAKVPDMRPNMDEVVRMIEEVR---QSDSENRPSSEEN  625



>gb|KHF99691.1| hypothetical protein F383_18108 [Gossypium arboreum]
Length=609

 Score =   236 bits (603),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 117/179 (65%), Positives = 147/179 (82%), Gaps = 6/179 (3%)
 Frame = -3

Query  689  KGGAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRV  510
            +GG KFTHGNIKSSNVLL+  ++ C+SD+GL PLMN   +TS R  GYRAPEV +ETR++
Sbjct  436  EGGGKFTHGNIKSSNVLLSDELEACVSDVGLTPLMNAPLSTS-RIVGYRAPEV-IETRKI  493

Query  509  TQKSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQN  330
            TQKSDVYSFGV++LEMLT K+ +  +G DDVVDLPRWVRSVVREEWTAEVFDVEL+++Q 
Sbjct  494  TQKSDVYSFGVLLLEMLTAKAPLQPSGQDDVVDLPRWVRSVVREEWTAEVFDVELLRFQT  553

Query  329  IEEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEPQPSSD-DNNGGTP  156
             +EEMVQMLQIAL+CVAK PDMRPTM E +R IE +R   ++E++ + SS+ ++N  TP
Sbjct  554  FQEEMVQMLQIALTCVAKTPDMRPTMDEAIRMIEDVR---QSESKNRTSSEAESNIQTP  609



>gb|KDO54912.1| hypothetical protein CISIN_1g005693mg [Citrus sinensis]
Length=672

 Score =   238 bits (606),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 117/172 (68%), Positives = 141/172 (82%), Gaps = 5/172 (3%)
 Frame = -3

Query  686  GGAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRVT  507
            GG KFTHGNIK+SNVL+   +DGCISD GL PLMN  AT S R  GYRAPEV +ETR+ +
Sbjct  496  GGPKFTHGNIKASNVLINQDLDGCISDFGLTPLMNVPATPS-RSAGYRAPEV-IETRKHS  553

Query  506  QKSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQNI  327
             KSDVYSFGV++LEMLTGK+ +     DD+VDLPRWV+SVVREEWTAEVFDVELM++QNI
Sbjct  554  HKSDVYSFGVLLLEMLTGKAPLQSPTRDDMVDLPRWVQSVVREEWTAEVFDVELMRFQNI  613

Query  326  EEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEPQPSSDDN  171
            EEEMVQMLQI ++CVAK PDMRP M EVVR IE +R   ++++E +PSS++N
Sbjct  614  EEEMVQMLQIGMACVAKVPDMRPNMDEVVRMIEEVR---QSDSENRPSSEEN  662



>ref|XP_006432053.1| hypothetical protein CICLE_v10000513mg [Citrus clementina]
 ref|XP_006464956.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X1 [Citrus sinensis]
 gb|ESR45293.1| hypothetical protein CICLE_v10000513mg [Citrus clementina]
Length=672

 Score =   238 bits (606),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 117/172 (68%), Positives = 141/172 (82%), Gaps = 5/172 (3%)
 Frame = -3

Query  686  GGAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRVT  507
            GG KFTHGNIK+SNVL+   +DGCISD GL PLMN  AT S R  GYRAPEV +ETR+ +
Sbjct  496  GGPKFTHGNIKASNVLINQDLDGCISDFGLTPLMNVPATPS-RSAGYRAPEV-IETRKHS  553

Query  506  QKSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQNI  327
             KSDVYSFGV++LEMLTGK+ +     DD+VDLPRWV+SVVREEWTAEVFDVELM++QNI
Sbjct  554  HKSDVYSFGVLLLEMLTGKAPLQSPTRDDMVDLPRWVQSVVREEWTAEVFDVELMRFQNI  613

Query  326  EEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEPQPSSDDN  171
            EEEMVQMLQI ++CVAK PDMRP M EVVR IE +R   ++++E +PSS++N
Sbjct  614  EEEMVQMLQIGMACVAKVPDMRPNMDEVVRMIEEVR---QSDSENRPSSEEN  662



>gb|KJB20517.1| hypothetical protein B456_003G153000 [Gossypium raimondii]
 gb|KJB20518.1| hypothetical protein B456_003G153000 [Gossypium raimondii]
 gb|KJB20520.1| hypothetical protein B456_003G153000 [Gossypium raimondii]
 gb|KJB20521.1| hypothetical protein B456_003G153000 [Gossypium raimondii]
Length=657

 Score =   237 bits (604),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 119/172 (69%), Positives = 141/172 (82%), Gaps = 5/172 (3%)
 Frame = -3

Query  686  GGAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRVT  507
            GG KFTHGNIKSSNVL+    DGCISD+GL PLMN  AT S R  GYRAPEV +ETR+ T
Sbjct  481  GGPKFTHGNIKSSNVLINQEHDGCISDLGLTPLMNVPATPS-RSVGYRAPEV-IETRKHT  538

Query  506  QKSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQNI  327
             KSDVYSFGV++LEMLTGK+ +     DD+VDLPRWV+SVVREEWTAEVFDVELM++QNI
Sbjct  539  HKSDVYSFGVLLLEMLTGKAPLQSPRRDDMVDLPRWVQSVVREEWTAEVFDVELMRFQNI  598

Query  326  EEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEPQPSSDDN  171
            EEEMVQMLQIA++CVAK  DMRP M EVVR IE +R   ++++E +PSS++N
Sbjct  599  EEEMVQMLQIAMACVAKVADMRPNMDEVVRMIEEVR---QSDSENRPSSEEN  647



>gb|KJB67957.1| hypothetical protein B456_010G219700 [Gossypium raimondii]
 gb|KJB67958.1| hypothetical protein B456_010G219700 [Gossypium raimondii]
 gb|KJB67959.1| hypothetical protein B456_010G219700 [Gossypium raimondii]
Length=609

 Score =   236 bits (602),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 118/179 (66%), Positives = 146/179 (82%), Gaps = 6/179 (3%)
 Frame = -3

Query  689  KGGAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRV  510
            +GG KFTHGNIKSSNVLL+  ++ C+SD GL PLMN   TTS R  GYRAPEV +ETR++
Sbjct  436  EGGGKFTHGNIKSSNVLLSDELEACVSDAGLTPLMNAPLTTS-RIVGYRAPEV-IETRKI  493

Query  509  TQKSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQN  330
            TQKSDVYSFGV++LEMLT K+ +  +G DDVVDLPRWVRSVVREEWTAEVFDVEL+++Q 
Sbjct  494  TQKSDVYSFGVLLLEMLTAKAPLQPSGQDDVVDLPRWVRSVVREEWTAEVFDVELLRFQT  553

Query  329  IEEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEPQPSSD-DNNGGTP  156
             +EEMVQMLQIAL+CVAK PDMRPTM E +R IE +R   ++E++ + SS+ ++N  TP
Sbjct  554  FQEEMVQMLQIALTCVAKTPDMRPTMDEAIRMIEDVR---QSESKNRTSSEAESNIQTP  609



>ref|XP_009592168.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nicotiana 
tomentosiformis]
Length=652

 Score =   237 bits (604),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 116/172 (67%), Positives = 140/172 (81%), Gaps = 5/172 (3%)
 Frame = -3

Query  686  GGAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRVT  507
            GG K THGNIKSSNVLL   M+ C+SD GL P+MN  A  S R PGYRAPEV +ETR+ T
Sbjct  476  GGPKVTHGNIKSSNVLLNQDMEACVSDFGLAPVMNFPAAPS-RHPGYRAPEV-IETRKHT  533

Query  506  QKSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQNI  327
             KSDVYSFGV++LEMLTGK  +   G DD+VDLPRWV+SVVREEWTAEVFDVELM++QNI
Sbjct  534  HKSDVYSFGVLMLEMLTGKQPIQSPGRDDMVDLPRWVQSVVREEWTAEVFDVELMRFQNI  593

Query  326  EEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEPQPSSDDN  171
            EEEMVQMLQIA++CV + PDMRPTM EVVR IE +R   +++++ +PSS++N
Sbjct  594  EEEMVQMLQIAMACVGRVPDMRPTMDEVVRMIEEVR---QSDSDNRPSSEEN  642



>ref|XP_011001675.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X3 [Populus euphratica]
Length=586

 Score =   235 bits (600),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 118/173 (68%), Positives = 140/173 (81%), Gaps = 5/173 (3%)
 Frame = -3

Query  683  GAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRVTQ  504
            G  F HGNIKSSNVLL   + GCISD GL PL++  +  S R  GYRAPEV ++TR+ TQ
Sbjct  416  GGNFIHGNIKSSNVLLMQDLHGCISDFGLTPLLSYPSVPS-RSVGYRAPEV-IDTRKSTQ  473

Query  503  KSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQNIE  324
            KSDVYSFGVV+LEMLTGK+ V   GHDD++DLPRWV+SVVREEWTAEVFD ELM+YQNIE
Sbjct  474  KSDVYSFGVVLLEMLTGKAPVQSPGHDDLIDLPRWVQSVVREEWTAEVFDEELMRYQNIE  533

Query  323  EEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEPQPSSDDNNG  165
            EEMV+MLQIA++CVA  PDMRPTM EVVR IE + GP+E+E   +PSS++N G
Sbjct  534  EEMVEMLQIAMACVAVVPDMRPTMEEVVRMIEEV-GPSESEN--RPSSEENKG  583



>ref|XP_009758202.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nicotiana 
sylvestris]
Length=652

 Score =   237 bits (604),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 116/172 (67%), Positives = 140/172 (81%), Gaps = 5/172 (3%)
 Frame = -3

Query  686  GGAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRVT  507
            GG K THGNIKSSNVLL   M+ C+SD GL P+MN  A  S R PGYRAPEV +ETR+ T
Sbjct  476  GGPKVTHGNIKSSNVLLNQDMEACVSDFGLAPVMNFPAAPS-RHPGYRAPEV-IETRKHT  533

Query  506  QKSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQNI  327
             KSDVYSFGV++LEMLTGK  +   G DD+VDLPRWV+SVVREEWTAEVFDVELM++QNI
Sbjct  534  HKSDVYSFGVLMLEMLTGKQPIQSPGRDDMVDLPRWVQSVVREEWTAEVFDVELMRFQNI  593

Query  326  EEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEPQPSSDDN  171
            EEEMVQMLQIA++CV + PDMRPTM EVVR IE +R   +++++ +PSS++N
Sbjct  594  EEEMVQMLQIAMACVGRVPDMRPTMDEVVRMIEEVR---QSDSDNRPSSEEN  642



>gb|KHG05843.1| hypothetical protein F383_32232 [Gossypium arboreum]
Length=659

 Score =   237 bits (604),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 119/172 (69%), Positives = 141/172 (82%), Gaps = 5/172 (3%)
 Frame = -3

Query  686  GGAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRVT  507
            GG KFTHGNIKSSNVL+    DGCISD+GL PLMN  AT S R  GYRAPEV +ETR+ T
Sbjct  483  GGPKFTHGNIKSSNVLINQEHDGCISDLGLTPLMNVPATPS-RTVGYRAPEV-IETRKHT  540

Query  506  QKSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQNI  327
             KSDVYSFGV++LEMLTGK+ +     DD+VDLPRWV+SVVREEWTAEVFDVELM++QNI
Sbjct  541  HKSDVYSFGVLLLEMLTGKAPLQSPRRDDMVDLPRWVQSVVREEWTAEVFDVELMRFQNI  600

Query  326  EEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEPQPSSDDN  171
            EEEMVQMLQIA++CVAK  DMRP M EVVR IE +R   ++++E +PSS++N
Sbjct  601  EEEMVQMLQIAMACVAKVADMRPNMDEVVRMIEEVR---QSDSENRPSSEEN  649



>gb|KDO54913.1| hypothetical protein CISIN_1g005693mg [Citrus sinensis]
Length=682

 Score =   237 bits (605),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 117/172 (68%), Positives = 141/172 (82%), Gaps = 5/172 (3%)
 Frame = -3

Query  686  GGAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRVT  507
            GG KFTHGNIK+SNVL+   +DGCISD GL PLMN  AT S R  GYRAPEV +ETR+ +
Sbjct  506  GGPKFTHGNIKASNVLINQDLDGCISDFGLTPLMNVPATPS-RSAGYRAPEV-IETRKHS  563

Query  506  QKSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQNI  327
             KSDVYSFGV++LEMLTGK+ +     DD+VDLPRWV+SVVREEWTAEVFDVELM++QNI
Sbjct  564  HKSDVYSFGVLLLEMLTGKAPLQSPTRDDMVDLPRWVQSVVREEWTAEVFDVELMRFQNI  623

Query  326  EEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEPQPSSDDN  171
            EEEMVQMLQI ++CVAK PDMRP M EVVR IE +R   ++++E +PSS++N
Sbjct  624  EEEMVQMLQIGMACVAKVPDMRPNMDEVVRMIEEVR---QSDSENRPSSEEN  672



>ref|XP_011001671.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X1 [Populus euphratica]
 ref|XP_011001672.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X1 [Populus euphratica]
Length=632

 Score =   236 bits (601),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 118/173 (68%), Positives = 140/173 (81%), Gaps = 5/173 (3%)
 Frame = -3

Query  683  GAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRVTQ  504
            G  F HGNIKSSNVLL   + GCISD GL PL++  +  S R  GYRAPEV ++TR+ TQ
Sbjct  462  GGNFIHGNIKSSNVLLMQDLHGCISDFGLTPLLSYPSVPS-RSVGYRAPEV-IDTRKSTQ  519

Query  503  KSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQNIE  324
            KSDVYSFGVV+LEMLTGK+ V   GHDD++DLPRWV+SVVREEWTAEVFD ELM+YQNIE
Sbjct  520  KSDVYSFGVVLLEMLTGKAPVQSPGHDDLIDLPRWVQSVVREEWTAEVFDEELMRYQNIE  579

Query  323  EEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEPQPSSDDNNG  165
            EEMV+MLQIA++CVA  PDMRPTM EVVR IE + GP+E+E   +PSS++N G
Sbjct  580  EEMVEMLQIAMACVAVVPDMRPTMEEVVRMIEEV-GPSESEN--RPSSEENKG  629



>ref|XP_011001674.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X2 [Populus euphratica]
Length=631

 Score =   236 bits (601),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 118/173 (68%), Positives = 140/173 (81%), Gaps = 5/173 (3%)
 Frame = -3

Query  683  GAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRVTQ  504
            G  F HGNIKSSNVLL   + GCISD GL PL++  +  S R  GYRAPEV ++TR+ TQ
Sbjct  461  GGNFIHGNIKSSNVLLMQDLHGCISDFGLTPLLSYPSVPS-RSVGYRAPEV-IDTRKSTQ  518

Query  503  KSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQNIE  324
            KSDVYSFGVV+LEMLTGK+ V   GHDD++DLPRWV+SVVREEWTAEVFD ELM+YQNIE
Sbjct  519  KSDVYSFGVVLLEMLTGKAPVQSPGHDDLIDLPRWVQSVVREEWTAEVFDEELMRYQNIE  578

Query  323  EEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEPQPSSDDNNG  165
            EEMV+MLQIA++CVA  PDMRPTM EVVR IE + GP+E+E   +PSS++N G
Sbjct  579  EEMVEMLQIAMACVAVVPDMRPTMEEVVRMIEEV-GPSESEN--RPSSEENKG  628



>ref|XP_004490727.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X1 [Cicer arietinum]
 ref|XP_004490728.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X2 [Cicer arietinum]
Length=653

 Score =   236 bits (601),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 119/172 (69%), Positives = 137/172 (80%), Gaps = 5/172 (3%)
 Frame = -3

Query  686  GGAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRVT  507
            GG KFTHGN+KSSNVLL    D CISD GL P MN  AT S R  GYRAPEV +ETR+ T
Sbjct  477  GGPKFTHGNVKSSNVLLNQDNDSCISDFGLTPFMNVPATPS-RAIGYRAPEV-IETRKHT  534

Query  506  QKSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQNI  327
             KSDVYSFGV++LEMLTGK+       DD+VDLPRWV+SVVREEWTAEVFDVELM+YQNI
Sbjct  535  HKSDVYSFGVLLLEMLTGKAPQQSPVRDDMVDLPRWVQSVVREEWTAEVFDVELMRYQNI  594

Query  326  EEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEPQPSSDDN  171
            EEEMVQMLQI ++CVAK PDMRP M EVVR IE IR   +++++ +PSSD+N
Sbjct  595  EEEMVQMLQIGMACVAKVPDMRPNMEEVVRMIEEIR---QSDSDNRPSSDEN  643



>ref|XP_006357316.1| PREDICTED: probable inactive receptor kinase At5g58300-like [Solanum 
tuberosum]
Length=592

 Score =   234 bits (596),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 110/158 (70%), Positives = 131/158 (83%), Gaps = 2/158 (1%)
 Frame = -3

Query  692  QKGGAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRR  513
             +GG KFTHGNIK+SN+LLT  +DGCISD GL PLMN  A  + +  GY APEV +ETR+
Sbjct  435  SEGGVKFTHGNIKASNILLTRDLDGCISDFGLSPLMNYTAIKN-KAAGYHAPEV-IETRK  492

Query  512  VTQKSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQ  333
             TQKSDVYSFGV+VLE+LTGKS +P+  H+DVV+LPRWVR+VV+EEWTAEVFD ELMKY 
Sbjct  493  GTQKSDVYSFGVLVLELLTGKSPLPLPRHEDVVNLPRWVRAVVKEEWTAEVFDAELMKYH  552

Query  332  NIEEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIR  219
            NI+EEMV MLQIAL CVAK PDMRP+M EV++ IE I+
Sbjct  553  NIQEEMVHMLQIALLCVAKVPDMRPSMDEVIKMIEQIK  590



>ref|XP_009384331.1| PREDICTED: probable inactive receptor kinase At5g58300 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009384332.1| PREDICTED: probable inactive receptor kinase At5g58300 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009384333.1| PREDICTED: probable inactive receptor kinase At5g58300 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009384334.1| PREDICTED: probable inactive receptor kinase At5g58300 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009384335.1| PREDICTED: probable inactive receptor kinase At5g58300 [Musa 
acuminata subsp. malaccensis]
Length=642

 Score =   234 bits (597),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 118/190 (62%), Positives = 148/190 (78%), Gaps = 7/190 (4%)
 Frame = -3

Query  689  KGGAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRV  510
            +GG KF HG+IKS+NVLLT  +D C++D GL P M++A T+S    GYRAPEV +ETR+ 
Sbjct  457  EGGGKFIHGDIKSNNVLLTQELDACVADYGLAPFMSSATTSSRIVVGYRAPEV-IETRKY  515

Query  509  TQKSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQN  330
            TQKSDVYSFGV++LEMLTGK+ +   G DDVVDLPRWV+SVVREEWTAEVFDVELM++Q+
Sbjct  516  TQKSDVYSFGVLLLEMLTGKAPLQSPGRDDVVDLPRWVQSVVREEWTAEVFDVELMRHQH  575

Query  329  IEEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEPQPSSD---DNNGGT  159
            IEEEMVQMLQIA++CVAK+PD RP M E++R IE IR    +++E +PSS+   D    T
Sbjct  576  IEEEMVQMLQIAMACVAKSPDQRPKMEELIRMIEDIR---HSDSENRPSSEKSKDEKVET  632

Query  158  PE*ICHESAM  129
            P+    ES M
Sbjct  633  PQAADTESTM  642



>gb|KCW50324.1| hypothetical protein EUGRSUZ_J00100 [Eucalyptus grandis]
 gb|KCW50325.1| hypothetical protein EUGRSUZ_J00100 [Eucalyptus grandis]
Length=630

 Score =   234 bits (596),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 119/177 (67%), Positives = 140/177 (79%), Gaps = 6/177 (3%)
 Frame = -3

Query  683  GAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRVTQ  504
            GAK  HGNIKS NV LT   DGC+SD+GL PLMN +A T PR  GY APEV +E+R+VTQ
Sbjct  459  GAKCVHGNIKSLNVFLTQDHDGCVSDVGLTPLMNLSAIT-PRVIGYYAPEV-IESRKVTQ  516

Query  503  KSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQNIE  324
            KSDVYSFGV++LEMLTGK+ +   G DDV+DLPRWVRSVVREEWTAEVFDVEL+KY+N+E
Sbjct  517  KSDVYSFGVLLLEMLTGKTPLKHPGLDDVIDLPRWVRSVVREEWTAEVFDVELLKYENVE  576

Query  323  EEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEPQPSSD-DNNGGTP  156
            EEMVQMLQIAL+CV K PDMRP M EV R I+ +R P   E + +PSS  ++N  TP
Sbjct  577  EEMVQMLQIALTCVTKVPDMRPKMDEVARLIDEVREP---EAKDRPSSGAESNAQTP  630



>ref|XP_008788112.1| PREDICTED: probable inactive receptor kinase At5g58300 [Phoenix 
dactylifera]
Length=636

 Score =   234 bits (596),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 114/172 (66%), Positives = 139/172 (81%), Gaps = 4/172 (2%)
 Frame = -3

Query  689  KGGAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRV  510
            +GG KF HGNIK+SNVLLT  ++ CISD GL PLMN  AT S    GYRAPEV +ETR+ 
Sbjct  459  EGGGKFAHGNIKASNVLLTQDLEACISDFGLAPLMNTHATPSRVVVGYRAPEV-IETRKY  517

Query  509  TQKSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQN  330
            TQKSDVYSFGV++LEMLTGK+ +   G DDV DLPRWV+SVVREEWTAEVFDVELM+Y+N
Sbjct  518  TQKSDVYSFGVLLLEMLTGKAPLQSPGRDDVADLPRWVQSVVREEWTAEVFDVELMRYRN  577

Query  329  IEEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEPQPSSDD  174
            IEEEMVQMLQIA++CVA+APD RP M EV+R I+ +R    +++E + SS++
Sbjct  578  IEEEMVQMLQIAMACVARAPDQRPRMEEVIRMIDEVR---HSDSENRASSEE  626



>ref|XP_008456255.1| PREDICTED: probable inactive receptor kinase At5g58300 [Cucumis 
melo]
 ref|XP_008456256.1| PREDICTED: probable inactive receptor kinase At5g58300 [Cucumis 
melo]
Length=630

 Score =   233 bits (595),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 115/172 (67%), Positives = 139/172 (81%), Gaps = 7/172 (4%)
 Frame = -3

Query  686  GGAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRVT  507
            GG KFTHGNIK+SNVLL   ++ C+SD GL PLMN     + R  GYRAPEV +E R+ T
Sbjct  456  GGPKFTHGNIKASNVLLIQEINACVSDFGLTPLMN---VPTSRTAGYRAPEV-IEARKHT  511

Query  506  QKSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQNI  327
             KSDVYSFGV++LEMLTGK+ +   G D++VDLPRWV+SVVREEWTAEVFDVELM+YQNI
Sbjct  512  HKSDVYSFGVLLLEMLTGKAPLQSPGRDEMVDLPRWVQSVVREEWTAEVFDVELMRYQNI  571

Query  326  EEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEPQPSSDDN  171
            EEEMVQMLQIA++CVAK PDMRP M EVVR IE IR   ++++E +PSS++N
Sbjct  572  EEEMVQMLQIAMTCVAKLPDMRPNMDEVVRMIEEIR---QSDSENRPSSEEN  620



>ref|XP_010031063.1| PREDICTED: probable inactive receptor kinase At5g58300 [Eucalyptus 
grandis]
 ref|XP_010031064.1| PREDICTED: probable inactive receptor kinase At5g58300 [Eucalyptus 
grandis]
 ref|XP_010031065.1| PREDICTED: probable inactive receptor kinase At5g58300 [Eucalyptus 
grandis]
 ref|XP_010031066.1| PREDICTED: probable inactive receptor kinase At5g58300 [Eucalyptus 
grandis]
 gb|KCW50323.1| hypothetical protein EUGRSUZ_J00100 [Eucalyptus grandis]
Length=633

 Score =   233 bits (595),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 119/177 (67%), Positives = 140/177 (79%), Gaps = 6/177 (3%)
 Frame = -3

Query  683  GAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRVTQ  504
            GAK  HGNIKS NV LT   DGC+SD+GL PLMN +A T PR  GY APEV +E+R+VTQ
Sbjct  462  GAKCVHGNIKSLNVFLTQDHDGCVSDVGLTPLMNLSAIT-PRVIGYYAPEV-IESRKVTQ  519

Query  503  KSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQNIE  324
            KSDVYSFGV++LEMLTGK+ +   G DDV+DLPRWVRSVVREEWTAEVFDVEL+KY+N+E
Sbjct  520  KSDVYSFGVLLLEMLTGKTPLKHPGLDDVIDLPRWVRSVVREEWTAEVFDVELLKYENVE  579

Query  323  EEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEPQPSSD-DNNGGTP  156
            EEMVQMLQIAL+CV K PDMRP M EV R I+ +R P   E + +PSS  ++N  TP
Sbjct  580  EEMVQMLQIALTCVTKVPDMRPKMDEVARLIDEVREP---EAKDRPSSGAESNAQTP  633



>ref|XP_010653700.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X2 [Vitis vinifera]
 emb|CBI32886.3| unnamed protein product [Vitis vinifera]
Length=634

 Score =   233 bits (594),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 122/175 (70%), Positives = 141/175 (81%), Gaps = 5/175 (3%)
 Frame = -3

Query  683  GAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRVTQ  504
            G KFTHGNIKSSNVLLT  +DG ISD GL  LMN    TS R  GYRAPEV +ETR+ TQ
Sbjct  460  GGKFTHGNIKSSNVLLTQDVDGQISDFGLTSLMNYPLVTS-RSLGYRAPEV-IETRKSTQ  517

Query  503  KSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQNIE  324
            KSDVYS+GV++LEMLTGK+ V   G DDVVDLPRWV+SVVREEWTAEVFDVELMK Q+ E
Sbjct  518  KSDVYSYGVLLLEMLTGKAPVQSPGRDDVVDLPRWVQSVVREEWTAEVFDVELMKDQSYE  577

Query  323  EEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEPQPSSDDNNGGT  159
            EEMVQMLQIA++CVAK PDMRP M EVVR +E IR P+++E   +PSSD+ + G+
Sbjct  578  EEMVQMLQIAMACVAKMPDMRPKMEEVVRLMEEIR-PSDSEN--RPSSDNQSKGS  629



>emb|CAN80590.1| hypothetical protein VITISV_040789 [Vitis vinifera]
Length=625

 Score =   233 bits (594),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 122/175 (70%), Positives = 141/175 (81%), Gaps = 5/175 (3%)
 Frame = -3

Query  683  GAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRVTQ  504
            G KFTHGNIKSSNVLLT  +DG ISD GL  LMN    TS R  GYRAPEV +ETR+ TQ
Sbjct  451  GGKFTHGNIKSSNVLLTQDVDGQISDFGLTSLMNYPLVTS-RSLGYRAPEV-IETRKSTQ  508

Query  503  KSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQNIE  324
            KSDVYS+GV++LEMLTGK+ V   G DDVVDLPRWV+SVVREEWTAEVFDVELMK Q+ E
Sbjct  509  KSDVYSYGVLLLEMLTGKAPVQSPGRDDVVDLPRWVQSVVREEWTAEVFDVELMKDQSYE  568

Query  323  EEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEPQPSSDDNNGGT  159
            EEMVQMLQIA++CVAK PDMRP M EVVR +E IR P+++E   +PSSD+ + G+
Sbjct  569  EEMVQMLQIAMACVAKMPDMRPKMEEVVRLMEEIR-PSDSEN--RPSSDNQSKGS  620



>ref|XP_004139930.1| PREDICTED: probable inactive receptor kinase At5g58300-like [Cucumis 
sativus]
 ref|XP_004154555.1| PREDICTED: probable inactive receptor kinase At5g58300-like [Cucumis 
sativus]
 gb|KGN46766.1| hypothetical protein Csa_6G133750 [Cucumis sativus]
Length=630

 Score =   233 bits (593),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 115/172 (67%), Positives = 139/172 (81%), Gaps = 7/172 (4%)
 Frame = -3

Query  686  GGAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRVT  507
            GG KFTHGNIK+SNVLL   ++ C+SD GL PLMN     + R  GYRAPEV +E R+ T
Sbjct  456  GGPKFTHGNIKASNVLLIQDVNACVSDFGLTPLMN---VPTSRTAGYRAPEV-IEARKHT  511

Query  506  QKSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQNI  327
             KSDVYSFGV++LEMLTGK+ +   G D++VDLPRWV+SVVREEWTAEVFDVELM+YQNI
Sbjct  512  HKSDVYSFGVLLLEMLTGKAPLQSPGRDEMVDLPRWVQSVVREEWTAEVFDVELMRYQNI  571

Query  326  EEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEPQPSSDDN  171
            EEEMVQMLQIA++CVAK PDMRP M EVVR IE IR   ++++E +PSS++N
Sbjct  572  EEEMVQMLQIAMTCVAKLPDMRPNMDEVVRMIEEIR---QSDSENRPSSEEN  620



>ref|XP_010653698.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X1 [Vitis vinifera]
 ref|XP_010653699.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X1 [Vitis vinifera]
Length=667

 Score =   233 bits (594),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 122/175 (70%), Positives = 141/175 (81%), Gaps = 5/175 (3%)
 Frame = -3

Query  683  GAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRVTQ  504
            G KFTHGNIKSSNVLLT  +DG ISD GL  LMN    TS R  GYRAPEV +ETR+ TQ
Sbjct  493  GGKFTHGNIKSSNVLLTQDVDGQISDFGLTSLMNYPLVTS-RSLGYRAPEV-IETRKSTQ  550

Query  503  KSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQNIE  324
            KSDVYS+GV++LEMLTGK+ V   G DDVVDLPRWV+SVVREEWTAEVFDVELMK Q+ E
Sbjct  551  KSDVYSYGVLLLEMLTGKAPVQSPGRDDVVDLPRWVQSVVREEWTAEVFDVELMKDQSYE  610

Query  323  EEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEPQPSSDDNNGGT  159
            EEMVQMLQIA++CVAK PDMRP M EVVR +E IR P+++E   +PSSD+ + G+
Sbjct  611  EEMVQMLQIAMACVAKMPDMRPKMEEVVRLMEEIR-PSDSEN--RPSSDNQSKGS  662



>ref|XP_004302522.1| PREDICTED: probable inactive receptor kinase At5g58300 [Fragaria 
vesca subsp. vesca]
 ref|XP_011466403.1| PREDICTED: probable inactive receptor kinase At5g58300 [Fragaria 
vesca subsp. vesca]
 ref|XP_011466404.1| PREDICTED: probable inactive receptor kinase At5g58300 [Fragaria 
vesca subsp. vesca]
 ref|XP_011466405.1| PREDICTED: probable inactive receptor kinase At5g58300 [Fragaria 
vesca subsp. vesca]
 ref|XP_011466406.1| PREDICTED: probable inactive receptor kinase At5g58300 [Fragaria 
vesca subsp. vesca]
Length=633

 Score =   232 bits (592),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 114/165 (69%), Positives = 133/165 (81%), Gaps = 3/165 (2%)
 Frame = -3

Query  686  GGAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRVT  507
            GG KF HGNIKSSN+L+T  ++GCISD GL PLMN  AT   R  GYRAPEV +E R+  
Sbjct  457  GGGKFIHGNIKSSNILITQDLNGCISDFGLTPLMN-FATIPSRSVGYRAPEV-IEARKSF  514

Query  506  QKSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQNI  327
            QKSDVYSFGV++LEMLTGK+ V   G DDVVDLPRWV+SVVREEWTAEVFDVELM++QNI
Sbjct  515  QKSDVYSFGVLLLEMLTGKAPVQSPGRDDVVDLPRWVQSVVREEWTAEVFDVELMRFQNI  574

Query  326  EEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEP  192
            EEE+VQMLQIA++CV   PD+RPTM EVV+ IE IR P ++E  P
Sbjct  575  EEELVQMLQIAMACVQNVPDLRPTMEEVVKMIEDIR-PPDSENRP  618



>gb|KHN40012.1| Putative inactive receptor kinase [Glycine soja]
Length=203

 Score =   219 bits (557),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 113/175 (65%), Positives = 134/175 (77%), Gaps = 3/175 (2%)
 Frame = -3

Query  680  AKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRVTQK  501
            +K THGNIKSSNVL+T   DGCI+D+GL P+M+  +T S R  GYRAPEV  E RR+TQK
Sbjct  32   SKLTHGNIKSSNVLITQQHDGCITDVGLTPMMSTQSTMS-RANGYRAPEV-TEYRRITQK  89

Query  500  SDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQNIEE  321
            SDVYSFGV++LE+LTGK+ +   G++D+VDLPRWVRSVVREEWTAEVFD EL++ Q  EE
Sbjct  90   SDVYSFGVLLLELLTGKAPLGYPGYEDMVDLPRWVRSVVREEWTAEVFDEELLRGQYFEE  149

Query  320  EMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEPQPSSDDNNGGTP  156
            EMVQMLQIAL+CVAK  D RPTM E VR IE IR P E +     S  D+N  TP
Sbjct  150  EMVQMLQIALACVAKLADNRPTMDETVRNIEEIRLP-ELKNPNTSSESDSNLQTP  203



>ref|XP_010683449.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X2 [Beta vulgaris subsp. vulgaris]
Length=641

 Score =   230 bits (587),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 113/177 (64%), Positives = 138/177 (78%), Gaps = 3/177 (2%)
 Frame = -3

Query  683  GAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRVTQ  504
            G +FTHGNIKSSNV L+  ++GCISD GL PLM+  A   PR  GYRAPE  VETR++TQ
Sbjct  464  GGRFTHGNIKSSNVFLSEDVNGCISDFGLAPLMSFPAVP-PRTAGYRAPET-VETRKITQ  521

Query  503  KSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQNIE  324
            KSDVYSFGV++LE+LTGK+ V   G DDVVDLPRWV+SVVREEWTAEVFD ELM+ QNIE
Sbjct  522  KSDVYSFGVLLLELLTGKTPVQSPGRDDVVDLPRWVQSVVREEWTAEVFDTELMRNQNIE  581

Query  323  EEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEPQPSSDDNNGGTPE  153
            EE+VQMLQIA++CV+K PD+RP M EVVR IE  R  +++ + P P ++ +    PE
Sbjct  582  EELVQMLQIAMACVSKVPDLRPDMGEVVRMIEETR-QSDSSSRPSPEAEGSKSKAPE  637



>ref|XP_010683445.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X1 [Beta vulgaris subsp. vulgaris]
 ref|XP_010683446.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X1 [Beta vulgaris subsp. vulgaris]
 ref|XP_010683447.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X1 [Beta vulgaris subsp. vulgaris]
 ref|XP_010683448.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X1 [Beta vulgaris subsp. vulgaris]
Length=643

 Score =   230 bits (587),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 113/177 (64%), Positives = 138/177 (78%), Gaps = 3/177 (2%)
 Frame = -3

Query  683  GAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRVTQ  504
            G +FTHGNIKSSNV L+  ++GCISD GL PLM+  A   PR  GYRAPE  VETR++TQ
Sbjct  466  GGRFTHGNIKSSNVFLSEDVNGCISDFGLAPLMSFPAVP-PRTAGYRAPET-VETRKITQ  523

Query  503  KSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQNIE  324
            KSDVYSFGV++LE+LTGK+ V   G DDVVDLPRWV+SVVREEWTAEVFD ELM+ QNIE
Sbjct  524  KSDVYSFGVLLLELLTGKTPVQSPGRDDVVDLPRWVQSVVREEWTAEVFDTELMRNQNIE  583

Query  323  EEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEPQPSSDDNNGGTPE  153
            EE+VQMLQIA++CV+K PD+RP M EVVR IE  R  +++ + P P ++ +    PE
Sbjct  584  EELVQMLQIAMACVSKVPDLRPDMGEVVRMIEETR-QSDSSSRPSPEAEGSKSKAPE  639



>gb|KDP21848.1| hypothetical protein JCGZ_00635 [Jatropha curcas]
Length=657

 Score =   231 bits (588),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 117/177 (66%), Positives = 138/177 (78%), Gaps = 3/177 (2%)
 Frame = -3

Query  686  GGAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRVT  507
            GG KF HGNIKSSN+LLT  + G ISD GL P+M+  +  + R  GYRAPEV +ETR+ T
Sbjct  484  GGGKFIHGNIKSSNLLLTQDLRGRISDFGLTPIMSYPSVPA-RSAGYRAPEV-IETRKST  541

Query  506  QKSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQNI  327
            QKSDVYSFGV++LEMLTGK+ V   G D+VVDLPRWV+SVVREEWTAEVFDVELM+YQNI
Sbjct  542  QKSDVYSFGVLLLEMLTGKAPVQSTGQDEVVDLPRWVQSVVREEWTAEVFDVELMRYQNI  601

Query  326  EEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEPQPSSDDNNGGTP  156
            EEEMVQMLQIA+SCVA+ PD RPTM EVVR IE IR P ++       + ++N  TP
Sbjct  602  EEEMVQMLQIAMSCVARVPDTRPTMNEVVRMIEEIR-PTDSVNHTSEENTESNTQTP  657



>ref|XP_010323112.1| PREDICTED: probable inactive receptor kinase At5g58300 [Solanum 
lycopersicum]
Length=627

 Score =   229 bits (584),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 113/170 (66%), Positives = 136/170 (80%), Gaps = 5/170 (3%)
 Frame = -3

Query  686  GGAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRVT  507
            GG KFTHGNIKSSNVLL   M+ CISD GL P+MN  A  S R PGYRAPEV +E+R+ +
Sbjct  461  GGPKFTHGNIKSSNVLLKQDMEACISDFGLAPIMNFPAAPS-RYPGYRAPEV-IESRKHS  518

Query  506  QKSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQNI  327
             KSDVYSFGV++LEMLTGK  +   G DD+VDLPRWV+SVVREEWT+EVFDV+LM++QNI
Sbjct  519  HKSDVYSFGVLLLEMLTGKQPMQSPGRDDMVDLPRWVQSVVREEWTSEVFDVDLMRFQNI  578

Query  326  EEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEPQPSSD  177
            EEEMVQMLQIA++CV K PDMRP M EVVR IE +R   ++ +E + SS+
Sbjct  579  EEEMVQMLQIAMACVVKVPDMRPNMEEVVRMIEDVR---QSNSENRHSSE  625



>gb|KJB71491.1| hypothetical protein B456_011G125200 [Gossypium raimondii]
Length=628

 Score =   229 bits (584),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 115/171 (67%), Positives = 138/171 (81%), Gaps = 6/171 (4%)
 Frame = -3

Query  686  GGAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRVT  507
            GG KF HGNIK SNVLLT  + GCISD GL  LM+ + T   R  GYRAPE  +ETR+ T
Sbjct  459  GGGKFVHGNIKPSNVLLTQDLHGCISDFGLTSLMS-SPTVPSRAVGYRAPEA-IETRKFT  516

Query  506  QKSDVYSFGVVVLEMLTGKSAV-PVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQN  330
            QKSDVYSFGV++LEMLTGK+AV   +GH+DVVDLPRWV+SVVREEWTAEVFD+ELMKY +
Sbjct  517  QKSDVYSFGVLLLEMLTGKAAVVQTSGHEDVVDLPRWVQSVVREEWTAEVFDIELMKYND  576

Query  329  IEEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEPQPSSD  177
            IEEE+VQMLQIA++CVA+ PD+RP+M EV R IE IR    +++E +PSSD
Sbjct  577  IEEELVQMLQIAMACVARLPDVRPSMEEVTRTIEEIR---SSDSENRPSSD  624



>ref|XP_002528709.1| Nodulation receptor kinase precursor, putative [Ricinus communis]
 gb|EEF33698.1| Nodulation receptor kinase precursor, putative [Ricinus communis]
Length=633

 Score =   229 bits (584),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 116/174 (67%), Positives = 137/174 (79%), Gaps = 5/174 (3%)
 Frame = -3

Query  686  GGAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRVT  507
             G +F H NIKSSNVL+T  + G +SD GL P+M+  A  S R  GYRAPEV +ETR+ T
Sbjct  459  AGGRFIHANIKSSNVLITQDLCGSVSDFGLTPIMSYPAVPS-RTAGYRAPEV-IETRKPT  516

Query  506  QKSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQNI  327
            QKSDVYSFGV++LEMLTGK+ V   G DDVVDLPRWV+SVVREEWTAEVFD+EL+KYQNI
Sbjct  517  QKSDVYSFGVLLLEMLTGKAPVQSTGQDDVVDLPRWVQSVVREEWTAEVFDLELLKYQNI  576

Query  326  EEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEPQPSSDDNNG  165
            EEEMVQMLQIA++CVA+ PDMRPTM EVVR IE IR P   ++   PSS++  G
Sbjct  577  EEEMVQMLQIAMACVARVPDMRPTMDEVVRMIEEIRVP---DSLNHPSSEEYKG  627



>ref|XP_009410507.1| PREDICTED: probable inactive receptor kinase At5g58300 [Musa 
acuminata subsp. malaccensis]
Length=627

 Score =   229 bits (584),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 112/170 (66%), Positives = 137/170 (81%), Gaps = 4/170 (2%)
 Frame = -3

Query  686  GGAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRVT  507
            G  KF HG+IKS+N+LLT  +D C+ D GL PLMN+AAT S    GYRAPEV +ETR+ T
Sbjct  459  GSGKFIHGDIKSNNILLTQELDACVCDYGLAPLMNSAATPSRIVVGYRAPEV-IETRKYT  517

Query  506  QKSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQNI  327
            QKSDVYSFGV++LEMLTGK+ +   G DDV DLPRWV+SVVREEWTAEVFDVELM+Y +I
Sbjct  518  QKSDVYSFGVLLLEMLTGKAPLQSPGRDDVADLPRWVQSVVREEWTAEVFDVELMRYPHI  577

Query  326  EEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEPQPSSD  177
            EEEMVQMLQIA++CV+KAPD RP M EV+R IE I+    +++E +PSS+
Sbjct  578  EEEMVQMLQIAMACVSKAPDQRPKMEEVIRMIEDIQ---HSDSENRPSSE  624



>gb|KHN48152.1| Putative inactive receptor kinase [Glycine soja]
Length=250

 Score =   218 bits (556),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 112/175 (64%), Positives = 133/175 (76%), Gaps = 3/175 (2%)
 Frame = -3

Query  680  AKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRVTQK  501
            +K THGNIKSSNVL+    DGCI+D+GL P+M+  +T S R  GYRAPEV  E RR+TQK
Sbjct  79   SKLTHGNIKSSNVLINQQHDGCITDVGLTPMMSTQSTMS-RANGYRAPEV-TEYRRITQK  136

Query  500  SDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQNIEE  321
            SDVYSFGV++LE+LTGK+ +   G++D+VDLPRWVRSVVREEWTAEVFD EL++ Q  EE
Sbjct  137  SDVYSFGVLLLELLTGKAPLGYPGYEDMVDLPRWVRSVVREEWTAEVFDEELLRGQYFEE  196

Query  320  EMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEPQPSSDDNNGGTP  156
            EMVQMLQIAL+CVAK  D RPTM E VR IE IR P E +     S  D+N  TP
Sbjct  197  EMVQMLQIALACVAKVSDNRPTMDETVRNIEEIRLP-ELKNRNTSSESDSNVQTP  250



>gb|KHN25793.1| Putative inactive receptor kinase [Glycine soja]
Length=642

 Score =   229 bits (583),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 115/182 (63%), Positives = 140/182 (77%), Gaps = 3/182 (2%)
 Frame = -3

Query  698  FIQ-KGGAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVE  522
            FI  +GG KF HGNIKS+NVL+T  +DGCISD+GL PLMN  AT S R  GYRAPEV  +
Sbjct  461  FIHSEGGPKFAHGNIKSTNVLITQELDGCISDVGLPPLMNTPATMS-RANGYRAPEV-TD  518

Query  521  TRRVTQKSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELM  342
            ++++T KSDVYSFGV++LEMLTGK+ +   G++DVVDLPRWVRSVVREEWTAEVFD EL+
Sbjct  519  SKKITHKSDVYSFGVLLLEMLTGKTPLRYPGYEDVVDLPRWVRSVVREEWTAEVFDEELL  578

Query  341  KYQNIEEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEPQPSSDDNNGG  162
            + Q +EEEMVQMLQIAL+CVAK PD RP M +VVR +E I+ P       Q S  ++N  
Sbjct  579  RGQYVEEEMVQMLQIALACVAKGPDQRPRMDQVVRMLEEIKHPELKNYHRQSSESESNVQ  638

Query  161  TP  156
            TP
Sbjct  639  TP  640



>ref|XP_007011392.1| Leucine-rich repeat protein kinase family protein isoform 1 [Theobroma 
cacao]
 gb|EOY20202.1| Leucine-rich repeat protein kinase family protein isoform 1 [Theobroma 
cacao]
Length=639

 Score =   229 bits (583),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 115/179 (64%), Positives = 145/179 (81%), Gaps = 6/179 (3%)
 Frame = -3

Query  689  KGGAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRV  510
            +GG K THGNIKSSN+LL+  ++GC+SD+GL PLMN A  T  R  GYRAPEV ++TR+V
Sbjct  466  EGGGKCTHGNIKSSNILLSDELEGCVSDVGLAPLMN-APVTMSRIMGYRAPEV-IQTRKV  523

Query  509  TQKSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQN  330
            TQKSDVYSFGV++LEMLT K+ +  +GHD+VVDLPRWVRSVVREEWTAEVFDVEL+++Q+
Sbjct  524  TQKSDVYSFGVLLLEMLTAKAPLQPSGHDEVVDLPRWVRSVVREEWTAEVFDVELLRFQH  583

Query  329  IEEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEPQPSSD-DNNGGTP  156
             +EEMVQMLQIAL+CVAK  + RP M E+VR IE IR P   E++ + SS+ ++N  TP
Sbjct  584  FQEEMVQMLQIALACVAKTTETRPKMDEIVRMIEDIRQP---ESKNRTSSEAESNIQTP  639



>ref|XP_007011393.1| Leucine-rich repeat protein kinase family protein isoform 2 [Theobroma 
cacao]
 gb|EOY20203.1| Leucine-rich repeat protein kinase family protein isoform 2 [Theobroma 
cacao]
Length=634

 Score =   228 bits (582),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 115/179 (64%), Positives = 145/179 (81%), Gaps = 6/179 (3%)
 Frame = -3

Query  689  KGGAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRV  510
            +GG K THGNIKSSN+LL+  ++GC+SD+GL PLMN A  T  R  GYRAPEV ++TR+V
Sbjct  461  EGGGKCTHGNIKSSNILLSDELEGCVSDVGLAPLMN-APVTMSRIMGYRAPEV-IQTRKV  518

Query  509  TQKSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQN  330
            TQKSDVYSFGV++LEMLT K+ +  +GHD+VVDLPRWVRSVVREEWTAEVFDVEL+++Q+
Sbjct  519  TQKSDVYSFGVLLLEMLTAKAPLQPSGHDEVVDLPRWVRSVVREEWTAEVFDVELLRFQH  578

Query  329  IEEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEPQPSSD-DNNGGTP  156
             +EEMVQMLQIAL+CVAK  + RP M E+VR IE IR P   E++ + SS+ ++N  TP
Sbjct  579  FQEEMVQMLQIALACVAKTTETRPKMDEIVRMIEDIRQP---ESKNRTSSEAESNIQTP  634



>gb|EYU35188.1| hypothetical protein MIMGU_mgv1a002709mg [Erythranthe guttata]
Length=645

 Score =   228 bits (582),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 121/185 (65%), Positives = 135/185 (73%), Gaps = 11/185 (6%)
 Frame = -3

Query  686  GGAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSP----RRPGYRAPEVFVET  519
            GGAK THGNIKSSN+LL  S+D CISD GL  L N   TT+P    R  GYRAPEV  E+
Sbjct  464  GGAKHTHGNIKSSNILLNESLDACISDFGLNSLSN---TTAPAVKYRVAGYRAPEVIAES  520

Query  518  R---RVTQKSDVYSFGVVVLEMLTGKSAVPVAGHDDVV-DLPRWVRSVVREEWTAEVFDV  351
            R     TQKSDVYSFGVV+LEMLTGKS +   G+D+VV DLPRWVRSVVREEWTAEVFDV
Sbjct  521  RVKASATQKSDVYSFGVVLLEMLTGKSPIQYLGYDEVVVDLPRWVRSVVREEWTAEVFDV  580

Query  350  ELMKYQNIEEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEPQPSSDDN  171
            ELM+Y+NIEEEMVQ+LQI LSCVAKA D RP+M EVVR IE IR      +     S D+
Sbjct  581  ELMQYRNIEEEMVQLLQIGLSCVAKAADARPSMDEVVRMIEDIRADKYRTSSEDNRSKDS  640

Query  170  NGGTP  156
               TP
Sbjct  641  TAPTP  645



>ref|XP_006280146.1| hypothetical protein CARUB_v10026045mg [Capsella rubella]
 gb|EOA13044.1| hypothetical protein CARUB_v10026045mg [Capsella rubella]
Length=658

 Score =   228 bits (581),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 116/174 (67%), Positives = 142/174 (82%), Gaps = 6/174 (3%)
 Frame = -3

Query  686  GGAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRR-PGYRAPEVFVETRRV  510
            GG KF+HGNIKSSNV++    DGCISD GL PLM  A   +P R  GYRAPEV +ETR+ 
Sbjct  477  GGPKFSHGNIKSSNVIMKQDSDGCISDFGLSPLM--AVPIAPMRGAGYRAPEV-IETRKH  533

Query  509  TQKSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQN  330
            T KSD+YSFGV++LEMLTGKS V     DD+VDLPRWV+SVVREEWT+EVFDVELM++QN
Sbjct  534  THKSDIYSFGVLILEMLTGKSPVQSPSRDDMVDLPRWVQSVVREEWTSEVFDVELMRFQN  593

Query  329  IEEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEPQPSSDDNN  168
            IEEEMVQMLQIA++CVA+ P++RPTM ++VR IE IR  +++ET  +PSSDDN+
Sbjct  594  IEEEMVQMLQIAMACVAQMPEVRPTMDDIVRMIEEIR-VSDSETT-RPSSDDNS  645



>gb|KEH35517.1| receptor-like kinase [Medicago truncatula]
Length=635

 Score =   227 bits (579),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 117/182 (64%), Positives = 140/182 (77%), Gaps = 4/182 (2%)
 Frame = -3

Query  698  FIQ-KGGAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVE  522
            FI  +GG KFTHGNIKS+NVL+T   D CISD+GL PLMN  AT S R  GYRAPEV  +
Sbjct  457  FIHTEGGQKFTHGNIKSTNVLITEEFDSCISDVGLPPLMNAPATMS-RTNGYRAPEV-TD  514

Query  521  TRRVTQKSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELM  342
            ++++TQKSDVYSFGV++LE+LTGK  +   G++DVVDLPRWVRSVVREEWTAEVFD EL+
Sbjct  515  SKKITQKSDVYSFGVLLLELLTGKVPMRYPGYEDVVDLPRWVRSVVREEWTAEVFDEELL  574

Query  341  KYQNIEEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEPQPSSDDNNGG  162
            + Q +EEEMVQMLQIAL+CVAK PDMRP M E VR IE I+ P E +      S+ +N  
Sbjct  575  RGQYVEEEMVQMLQIALACVAKTPDMRPRMDEAVRMIEEIKNP-EFKNRTSSESEYSNVQ  633

Query  161  TP  156
            TP
Sbjct  634  TP  635



>ref|XP_010483401.1| PREDICTED: probable inactive receptor kinase At5g58300 [Camelina 
sativa]
 ref|XP_010483402.1| PREDICTED: probable inactive receptor kinase At5g58300 [Camelina 
sativa]
 ref|XP_010483403.1| PREDICTED: probable inactive receptor kinase At5g58300 [Camelina 
sativa]
 ref|XP_010483404.1| PREDICTED: probable inactive receptor kinase At5g58300 [Camelina 
sativa]
 ref|XP_010483406.1| PREDICTED: probable inactive receptor kinase At5g58300 [Camelina 
sativa]
 ref|XP_010483407.1| PREDICTED: probable inactive receptor kinase At5g58300 [Camelina 
sativa]
 ref|XP_010483408.1| PREDICTED: probable inactive receptor kinase At5g58300 [Camelina 
sativa]
Length=656

 Score =   228 bits (580),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 116/174 (67%), Positives = 141/174 (81%), Gaps = 6/174 (3%)
 Frame = -3

Query  686  GGAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRR-PGYRAPEVFVETRRV  510
            GG KF+HGNIKSSNV++    D CISD GL PLM  A   +P R  GYRAPEV +ETR+ 
Sbjct  475  GGPKFSHGNIKSSNVIMKQETDACISDFGLTPLM--AVPIAPMRGAGYRAPEV-IETRKH  531

Query  509  TQKSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQN  330
            T K+DVYSFGV++LEMLTGKS +     DD+VDLPRWV+SVVREEWT+EVFDVELM++QN
Sbjct  532  THKTDVYSFGVLILEMLTGKSPIQSPSRDDMVDLPRWVQSVVREEWTSEVFDVELMRFQN  591

Query  329  IEEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEPQPSSDDNN  168
            IEEEMVQMLQIA++CVA+ PD+RPTM +VVR IE IR  +++ET  +PSSDDN+
Sbjct  592  IEEEMVQMLQIAMACVAQMPDVRPTMDDVVRMIEEIR-VSDSETT-RPSSDDNS  643



>ref|XP_003526789.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoformX1 
[Glycine max]
 ref|XP_003526790.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoformX2 
[Glycine max]
 ref|XP_006581706.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X3 [Glycine max]
Length=642

 Score =   227 bits (579),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 114/182 (63%), Positives = 139/182 (76%), Gaps = 3/182 (2%)
 Frame = -3

Query  698  FIQ-KGGAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVE  522
            FI  +GG KF HGNIKS+NVL+   +DGCISD+GL PLMN  AT S R  GYRAPEV  +
Sbjct  461  FIHSEGGPKFAHGNIKSTNVLINQELDGCISDVGLPPLMNTPATMS-RANGYRAPEV-TD  518

Query  521  TRRVTQKSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELM  342
            ++++T KSDVYSFGV++LEMLTGK+ +   G++DVVDLPRWVRSVVREEWTAEVFD EL+
Sbjct  519  SKKITHKSDVYSFGVLLLEMLTGKTPLRYPGYEDVVDLPRWVRSVVREEWTAEVFDEELL  578

Query  341  KYQNIEEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEPQPSSDDNNGG  162
            + Q +EEEMVQMLQIAL+CVAK PD RP M +VVR +E I+ P       Q S  ++N  
Sbjct  579  RGQYVEEEMVQMLQIALACVAKGPDQRPRMDQVVRMLEEIKHPELKNYHRQSSESESNVQ  638

Query  161  TP  156
            TP
Sbjct  639  TP  640



>ref|XP_004502808.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X1 [Cicer arietinum]
 ref|XP_004502809.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X2 [Cicer arietinum]
 ref|XP_004502810.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X3 [Cicer arietinum]
Length=644

 Score =   227 bits (578),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 117/182 (64%), Positives = 139/182 (76%), Gaps = 4/182 (2%)
 Frame = -3

Query  698  FIQ-KGGAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVE  522
            FI  +GG KFTHGNIKS+NVL+T  +D CISD+GL PLMN  AT S R  GYRAPEV  +
Sbjct  466  FIHSEGGPKFTHGNIKSTNVLITQELDSCISDVGLPPLMNTPATMS-RANGYRAPEV-TD  523

Query  521  TRRVTQKSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELM  342
            +R++TQKSDVYSFGV++LEMLTGK  +   G++D VDLPRWVRSVVREEWTAEVFD E++
Sbjct  524  SRKITQKSDVYSFGVLLLEMLTGKVPMRYPGYEDFVDLPRWVRSVVREEWTAEVFDEEVL  583

Query  341  KYQNIEEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEPQPSSDDNNGG  162
            + Q +EEEMVQMLQI L+CVAK PDMRP M E VR IE I+ P E +      SD +N  
Sbjct  584  RGQYVEEEMVQMLQIGLACVAKTPDMRPRMDEAVRMIEEIKHP-EFKNRTSSESDYSNLQ  642

Query  161  TP  156
            TP
Sbjct  643  TP  644



>ref|XP_010443551.1| PREDICTED: probable inactive receptor kinase At5g58300 [Camelina 
sativa]
 ref|XP_010443552.1| PREDICTED: probable inactive receptor kinase At5g58300 [Camelina 
sativa]
 ref|XP_010443553.1| PREDICTED: probable inactive receptor kinase At5g58300 [Camelina 
sativa]
Length=661

 Score =   226 bits (577),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 116/174 (67%), Positives = 141/174 (81%), Gaps = 6/174 (3%)
 Frame = -3

Query  686  GGAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRR-PGYRAPEVFVETRRV  510
            GG KF+HGNIKSSNV++    D CISD GL PLM  A   +P R  GYRAPEV +ETR+ 
Sbjct  480  GGPKFSHGNIKSSNVIMKQETDACISDFGLTPLM--AVPIAPMRGAGYRAPEV-IETRKH  536

Query  509  TQKSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQN  330
            T KSDVYSFGV++LEMLTGKS +     DD+VDLPRWV+SVVREEWT+EVFDVELM++QN
Sbjct  537  THKSDVYSFGVLILEMLTGKSPIQSPSRDDMVDLPRWVQSVVREEWTSEVFDVELMRFQN  596

Query  329  IEEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEPQPSSDDNN  168
            IEEEMVQMLQIA++CVA+ P++RPTM +VVR IE IR  +++ET  +PSSDDN+
Sbjct  597  IEEEMVQMLQIAMACVAQMPEVRPTMDDVVRMIEEIR-VSDSETT-RPSSDDNS  648



>ref|XP_008813233.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X2 [Phoenix dactylifera]
Length=636

 Score =   226 bits (576),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 112/173 (65%), Positives = 135/173 (78%), Gaps = 2/173 (1%)
 Frame = -3

Query  689  KGGAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRV  510
            +GG KF HGNIKSSN+LL+  ++  +SD GL PLMN  AT S    GYRAPE  VETR+V
Sbjct  462  EGGPKFVHGNIKSSNILLSQDLNPFVSDYGLSPLMNPPATLSQVVVGYRAPET-VETRKV  520

Query  509  TQKSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQN  330
            TQKSDVYSFGV++LEMLTGK+ +   GHDDV DLPRWV+SVVREEWTAEVFDVELM+YQN
Sbjct  521  TQKSDVYSFGVLLLEMLTGKAPLQSQGHDDVADLPRWVQSVVREEWTAEVFDVELMRYQN  580

Query  329  IEEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEPQPSSDDN  171
            IEEE+V+ML IA+SCVA+ P+ RP M +V+R IE IR  + +E+ P    D N
Sbjct  581  IEEELVRMLHIAMSCVARTPEQRPRMEDVIRMIEEIR-KSGSESRPSLPGDSN  632



>ref|XP_010453493.1| PREDICTED: probable inactive receptor kinase At5g58300 [Camelina 
sativa]
 ref|XP_010453499.1| PREDICTED: probable inactive receptor kinase At5g58300 [Camelina 
sativa]
 ref|XP_010453507.1| PREDICTED: probable inactive receptor kinase At5g58300 [Camelina 
sativa]
 ref|XP_010453515.1| PREDICTED: probable inactive receptor kinase At5g58300 [Camelina 
sativa]
Length=656

 Score =   226 bits (577),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 116/174 (67%), Positives = 141/174 (81%), Gaps = 6/174 (3%)
 Frame = -3

Query  686  GGAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRR-PGYRAPEVFVETRRV  510
            GG KF+HGNIKSSNV++    D CISD GL PLM  A   +P R  GYRAPEV +ETR+ 
Sbjct  475  GGPKFSHGNIKSSNVIMKQESDACISDFGLTPLM--AVPIAPMRGAGYRAPEV-IETRKH  531

Query  509  TQKSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQN  330
            T KSDVYSFGV++LEMLTGKS +     +D+VDLPRWV+SVVREEWT+EVFDVELM++QN
Sbjct  532  THKSDVYSFGVLILEMLTGKSPIQSPSREDMVDLPRWVQSVVREEWTSEVFDVELMRFQN  591

Query  329  IEEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEPQPSSDDNN  168
            IEEEMVQMLQIA++CVA+ PD+RPTM +VVR IE IR  +++ET  +PSSDDN+
Sbjct  592  IEEEMVQMLQIAIACVAQMPDVRPTMDDVVRMIEEIR-VSDSETT-RPSSDDNS  643



>ref|XP_009772876.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nicotiana 
sylvestris]
Length=648

 Score =   226 bits (575),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 112/176 (64%), Positives = 139/176 (79%), Gaps = 5/176 (3%)
 Frame = -3

Query  683  GAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRVTQ  504
            G K  HGNI+SSNVLLT    GCISD+GL PLM  + T   R  GYRAPEV +ETR+ TQ
Sbjct  473  GGKLIHGNIRSSNVLLTHDNSGCISDVGLTPLMG-SPTIPSRSAGYRAPEV-IETRKCTQ  530

Query  503  KSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQNIE  324
            KSDVYSFGV++LE+LTGK+ V   GHD+VVDLPRWV+SVVREEWTAEVFD EL+K+QNIE
Sbjct  531  KSDVYSFGVLLLELLTGKAPVQPPGHDEVVDLPRWVQSVVREEWTAEVFDAELIKFQNIE  590

Query  323  EEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEPQPSSDDNNGGTP  156
            +EMVQMLQIA++CVAK P+ RP M +VV+ IE I+   ++++  +PSS+DN   +P
Sbjct  591  DEMVQMLQIAMTCVAKVPETRPDMNQVVQMIEDIQ---QSDSGNRPSSEDNKSRSP  643



>ref|XP_002864562.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH40821.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=658

 Score =   226 bits (575),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 117/174 (67%), Positives = 141/174 (81%), Gaps = 6/174 (3%)
 Frame = -3

Query  686  GGAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRR-PGYRAPEVFVETRRV  510
            GG KF+HGNIKSSNV++    D CISD GL PLM  A   +P R  GYRAPEV +ETR+ 
Sbjct  477  GGPKFSHGNIKSSNVIMKQESDACISDFGLTPLM--AVPIAPMRGAGYRAPEV-METRKH  533

Query  509  TQKSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQN  330
            T KSDVYSFGV++LEMLTGKS V     DD+VDLPRWV+SVVREEWT+EVFDVELM++QN
Sbjct  534  THKSDVYSFGVLILEMLTGKSPVQSPSRDDMVDLPRWVQSVVREEWTSEVFDVELMRFQN  593

Query  329  IEEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEPQPSSDDNN  168
            IEEEMVQMLQIA++CVA+ P++RPTM +VVR IE IR  +++ET  +PSSDDN+
Sbjct  594  IEEEMVQMLQIAMACVAQMPEVRPTMDDVVRMIEEIRV-SDSETT-RPSSDDNS  645



>ref|NP_200638.1| leucine-rich repeat protein kinase family protein [Arabidopsis 
thaliana]
 ref|NP_001119458.1| leucine-rich repeat protein kinase family protein [Arabidopsis 
thaliana]
 sp|Q9LVM0.1|Y5830_ARATH RecName: Full=Probable inactive receptor kinase At5g58300; Flags: 
Precursor [Arabidopsis thaliana]
 dbj|BAA96921.1| receptor-like protein kinase [Arabidopsis thaliana]
 gb|AAL57654.1| unknown protein [Arabidopsis thaliana]
 gb|AAN64529.1| At5g58299/At5g58299 [Arabidopsis thaliana]
 gb|ACN59396.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AED97030.1| leucine-rich repeat protein kinase family protein [Arabidopsis 
thaliana]
 gb|AED97031.1| leucine-rich repeat protein kinase family protein [Arabidopsis 
thaliana]
Length=654

 Score =   226 bits (575),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 116/174 (67%), Positives = 141/174 (81%), Gaps = 6/174 (3%)
 Frame = -3

Query  686  GGAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRR-PGYRAPEVFVETRRV  510
            GG KF+HGNIKSSNV++    D CISD GL PLM  A   +P R  GYRAPEV +ETR+ 
Sbjct  477  GGPKFSHGNIKSSNVIMKQESDACISDFGLTPLM--AVPIAPMRGAGYRAPEV-METRKH  533

Query  509  TQKSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQN  330
            T KSDVYSFGV++LEMLTGKS V     DD+VDLPRWV+SVVREEWT+EVFD+ELM++QN
Sbjct  534  THKSDVYSFGVLILEMLTGKSPVQSPSRDDMVDLPRWVQSVVREEWTSEVFDIELMRFQN  593

Query  329  IEEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEPQPSSDDNN  168
            IEEEMVQMLQIA++CVA+ P++RPTM +VVR IE IR  +++ET  +PSSDDN+
Sbjct  594  IEEEMVQMLQIAMACVAQVPEVRPTMDDVVRMIEEIRV-SDSETT-RPSSDDNS  645



>ref|XP_006401105.1| hypothetical protein EUTSA_v10012925mg [Eutrema salsugineum]
 gb|ESQ42558.1| hypothetical protein EUTSA_v10012925mg [Eutrema salsugineum]
Length=650

 Score =   225 bits (574),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 115/175 (66%), Positives = 141/175 (81%), Gaps = 8/175 (5%)
 Frame = -3

Query  686  GGAKFTHGNIKSSNVLLTT-SMDGCISDIGLCPLMNNAATTSPRR-PGYRAPEVFVETRR  513
            GG KF+HGNIKSSNV++   S D CISD GL PLM  A   +P R  GYRAPEV +ETR+
Sbjct  471  GGPKFSHGNIKSSNVIMKQESSDVCISDFGLAPLM--AVPVAPMRGAGYRAPEV-IETRK  527

Query  512  VTQKSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQ  333
             T KSD+YSFGV++LEMLTGKS V     +D+VDLPRWV+SVVREEWT+EVFDVELM++Q
Sbjct  528  HTHKSDIYSFGVLILEMLTGKSPVQSPSREDMVDLPRWVQSVVREEWTSEVFDVELMRFQ  587

Query  332  NIEEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEPQPSSDDNN  168
            NIEEEMVQMLQ+A++CVA+ P++RPTM EVVR IE IR    +++E +PSSDDN+
Sbjct  588  NIEEEMVQMLQVAMACVAQMPEVRPTMDEVVRMIEEIRA---SDSETRPSSDDNS  639



>emb|CDY58565.1| BnaC03g12450D [Brassica napus]
Length=653

 Score =   225 bits (573),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 115/174 (66%), Positives = 138/174 (79%), Gaps = 6/174 (3%)
 Frame = -3

Query  686  GGAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRR-PGYRAPEVFVETRRV  510
            GG KF+HGNIK+SNV++    D C+SD GL PLM  +   +P R  GYRAPEV V TR+ 
Sbjct  474  GGPKFSHGNIKASNVIMKQENDVCVSDFGLSPLM--SVPIAPMRGAGYRAPEVIV-TRKH  530

Query  509  TQKSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQN  330
            T KSDVYSFGV++LEMLTGKS V  A  +D+VDLPRWV+SVVREEWT+EVFDVELMK+QN
Sbjct  531  THKSDVYSFGVLILEMLTGKSPVQSASREDMVDLPRWVQSVVREEWTSEVFDVELMKFQN  590

Query  329  IEEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEPQPSSDDNN  168
            IEEEMVQMLQIA++CVA  P++RP+M EVVR IE IR    +ET  +PSSDDN+
Sbjct  591  IEEEMVQMLQIAMACVAHVPEVRPSMDEVVRMIEEIRVSDSSET--RPSSDDNS  642



>ref|XP_008366817.1| PREDICTED: probable inactive receptor kinase At5g58300 [Malus 
domestica]
 ref|XP_008366818.1| PREDICTED: probable inactive receptor kinase At5g58300 [Malus 
domestica]
Length=636

 Score =   225 bits (573),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 113/163 (69%), Positives = 130/163 (80%), Gaps = 3/163 (2%)
 Frame = -3

Query  680  AKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRVTQK  501
             KF HGN+KSSNVLL   + G ISD GL PLMN  A  S R  GYRAPEV +ET++  QK
Sbjct  453  GKFIHGNVKSSNVLLMQDLTGSISDFGLAPLMNFXAIPS-RSVGYRAPEV-IETKKSFQK  510

Query  500  SDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQNIEE  321
            SDVYSFGV++LEMLTGK+ V   G DD+VDLPRWV+SVVREEWTAEVFDVELM+Y+NIEE
Sbjct  511  SDVYSFGVMLLEMLTGKAPVQSPGRDDIVDLPRWVQSVVREEWTAEVFDVELMRYENIEE  570

Query  320  EMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEP  192
            E+VQMLQIA++CVA  PDMRPTM EVVR IE IR P ++E  P
Sbjct  571  ELVQMLQIAMTCVATVPDMRPTMEEVVRMIEEIR-PPDSENRP  612



>ref|XP_010541472.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X2 [Tarenaya hassleriana]
 ref|XP_010541473.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X2 [Tarenaya hassleriana]
Length=628

 Score =   224 bits (572),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 113/173 (65%), Positives = 136/173 (79%), Gaps = 7/173 (4%)
 Frame = -3

Query  686  GGAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRVT  507
            GG KF HGNIKSSNVL+    DGCISD GL  LM   A  + R  GYRAPEV  ETR+ T
Sbjct  457  GGPKFAHGNIKSSNVLINQETDGCISDSGLTSLM---AMPTTRAAGYRAPEV-TETRKQT  512

Query  506  QKSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQNI  327
             KSDVYSFGV++LEMLTGK+ +     DD+VDLPRWV+SVVREEWT+EVFDVELM++QNI
Sbjct  513  HKSDVYSFGVLLLEMLTGKAPIQSPSRDDMVDLPRWVQSVVREEWTSEVFDVELMRFQNI  572

Query  326  EEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEPQPSSDDNN  168
            EEEMVQMLQ+A++CVA+ PDMRP M +VVR IE IR    ++++ +PSS+DNN
Sbjct  573  EEEMVQMLQVAMACVARLPDMRPDMDQVVRMIEEIR---LSDSDNRPSSEDNN  622



>ref|XP_010921194.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X2 [Elaeis guineensis]
Length=349

 Score =   218 bits (554),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 109/171 (64%), Positives = 132/171 (77%), Gaps = 2/171 (1%)
 Frame = -3

Query  689  KGGAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRV  510
            +GG KF HGNIKSSN+LL   ++  +SD GL PLMN  AT S    GYRAPE  +ETR++
Sbjct  176  EGGPKFVHGNIKSSNILLGQDLNPLVSDYGLSPLMNPPATLSQLMVGYRAPET-METRKI  234

Query  509  TQKSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQN  330
            TQKSDVYSFGVV+LEMLTGK+ +   GHDDV DLPRWV+SVVREEWTAEVFDVELM   N
Sbjct  235  TQKSDVYSFGVVLLEMLTGKAPLQSQGHDDVADLPRWVQSVVREEWTAEVFDVELMMDHN  294

Query  329  IEEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAET-ETEPQPSS  180
             EEE+V+MLQIA+SCVA+ P+ RP M +VVR IE IR    + E++P+ S+
Sbjct  295  NEEELVRMLQIAMSCVARTPEQRPRMEDVVRMIEEIRKSGSSLESKPKDST  345



>ref|XP_009590190.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nicotiana 
tomentosiformis]
 ref|XP_009590191.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nicotiana 
tomentosiformis]
Length=645

 Score =   224 bits (572),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 111/176 (63%), Positives = 139/176 (79%), Gaps = 5/176 (3%)
 Frame = -3

Query  683  GAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRVTQ  504
            G K  HGNI+SSNVLLT    GCISD+GL PLM  + T   R  GYRAPEV +ETR+ TQ
Sbjct  470  GGKLIHGNIRSSNVLLTHDNSGCISDVGLTPLMG-SPTIPSRSAGYRAPEV-IETRKCTQ  527

Query  503  KSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQNIE  324
            KSDVYSFGV++LE+LTGK+ V   GHD+VVDLPRWV+SVVREEWTAEVFD EL+K+QNI+
Sbjct  528  KSDVYSFGVLLLELLTGKAPVQPPGHDEVVDLPRWVQSVVREEWTAEVFDAELIKFQNIQ  587

Query  323  EEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEPQPSSDDNNGGTP  156
            +EMVQMLQIA++CVAK P+ RP M +VV+ IE I+   ++++  +PSS+DN   +P
Sbjct  588  DEMVQMLQIAMACVAKVPETRPDMNQVVQMIEDIQ---QSDSGNRPSSEDNKSRSP  640



>ref|XP_007136405.1| hypothetical protein PHAVU_009G042300g [Phaseolus vulgaris]
 ref|XP_007136406.1| hypothetical protein PHAVU_009G042300g [Phaseolus vulgaris]
 gb|ESW08399.1| hypothetical protein PHAVU_009G042300g [Phaseolus vulgaris]
 gb|ESW08400.1| hypothetical protein PHAVU_009G042300g [Phaseolus vulgaris]
Length=640

 Score =   224 bits (572),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 114/177 (64%), Positives = 139/177 (79%), Gaps = 4/177 (2%)
 Frame = -3

Query  698  FIQ-KGGAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVE  522
            FI  +GG KFTHGNIKS+NVL++  ++GCISD+GL PLMN  AT S R  GYRAPEV  +
Sbjct  463  FIHSEGGPKFTHGNIKSNNVLISQELEGCISDVGLPPLMNTPATMS-RSNGYRAPEV-TD  520

Query  521  TRRVTQKSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELM  342
            ++++TQKSDVYSFGVV+LEMLTGK+ +   G++DVVDLPRWVRSVVREEWTAEVFD EL+
Sbjct  521  SKKITQKSDVYSFGVVLLEMLTGKTPLRYPGYEDVVDLPRWVRSVVREEWTAEVFDEELL  580

Query  341  KYQNIEEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEPQPSSDDN  171
            + Q +EEEMVQMLQIAL+CVAK  + RP M EV R IE I+ P E +  P   S+ N
Sbjct  581  RGQYVEEEMVQMLQIALACVAKGSENRPRMDEVARMIEEIKHP-ELKNRPSSESESN  636



>ref|XP_009798129.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nicotiana 
sylvestris]
 ref|XP_009798130.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nicotiana 
sylvestris]
 ref|XP_009798131.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nicotiana 
sylvestris]
Length=625

 Score =   224 bits (571),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 108/170 (64%), Positives = 137/170 (81%), Gaps = 5/170 (3%)
 Frame = -3

Query  686  GGAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRVT  507
            GG KF HGNIKSSNVLL   ++ C+SD GL P+MN  A  + R PGYRAPEV +ETR+ +
Sbjct  459  GGPKFAHGNIKSSNVLLKQDLEACVSDFGLAPIMNFPAAPT-RYPGYRAPEV-IETRKHS  516

Query  506  QKSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQNI  327
             KSDVYSFGV++LEMLTGK  +   G DD+VDLPRWV+SV++EEWT+EVFDV+LM++QNI
Sbjct  517  HKSDVYSFGVLLLEMLTGKQPMQSPGRDDMVDLPRWVQSVLKEEWTSEVFDVDLMRFQNI  576

Query  326  EEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEPQPSSD  177
            EEEMVQMLQIA++CVAK PDMRP M EVV+ IE +R   ++++E + SS+
Sbjct  577  EEEMVQMLQIAMACVAKVPDMRPNMEEVVKMIEEVR---QSDSENRQSSE  623



>ref|XP_007220535.1| hypothetical protein PRUPE_ppa002812mg [Prunus persica]
 gb|EMJ21734.1| hypothetical protein PRUPE_ppa002812mg [Prunus persica]
Length=631

 Score =   224 bits (571),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 109/173 (63%), Positives = 139/173 (80%), Gaps = 5/173 (3%)
 Frame = -3

Query  695  IQKGGAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETR  516
            I   GAK +HGNIKS+NVLLT  ++ CI+D+GL PLMN  AT S R  GYRAPE   + R
Sbjct  456  IHSEGAKCSHGNIKSTNVLLTQDLEACITDVGLSPLMNFPATMS-RATGYRAPEA-TDMR  513

Query  515  RVTQKSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKY  336
            +++ KSDVYSFGV++LEMLTGK+ +   GHD V+DLPRWV+SVVREEWTAEVFD+EL++ 
Sbjct  514  KISHKSDVYSFGVLLLEMLTGKTTLQYPGHDSVIDLPRWVKSVVREEWTAEVFDLELLRQ  573

Query  335  QNIEEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEPQPSSD  177
            Q+IEEEMVQMLQIAL+CV+K P+ RP+M EVVR IE IR   +++T+ +PSS+
Sbjct  574  QHIEEEMVQMLQIALACVSKLPEARPSMDEVVRMIEEIR---QSDTKTRPSSE  623



>ref|XP_009132067.1| PREDICTED: probable inactive receptor kinase At5g58300 [Brassica 
rapa]
Length=650

 Score =   224 bits (572),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 115/174 (66%), Positives = 138/174 (79%), Gaps = 6/174 (3%)
 Frame = -3

Query  686  GGAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRR-PGYRAPEVFVETRRV  510
            GG+KF+HGNIKSSNV++    D C+SD GL PLM  +   +P R  GYRAPEV V TR+ 
Sbjct  471  GGSKFSHGNIKSSNVIMKQENDVCVSDFGLSPLM--SVPIAPMRGAGYRAPEVIV-TRKH  527

Query  509  TQKSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQN  330
            T KSDVYSFGV++LEMLTGKS V     +D+VDLPRWV+SVVREEWT+EVFDVELMK+QN
Sbjct  528  THKSDVYSFGVLILEMLTGKSPVQSPSREDMVDLPRWVQSVVREEWTSEVFDVELMKFQN  587

Query  329  IEEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEPQPSSDDNN  168
            IEEEMVQMLQIA++CVA  P++RP+M EVVR IE IR    +ET  +PSSDDN+
Sbjct  588  IEEEMVQMLQIAMACVAHVPEVRPSMDEVVRMIEEIRVSDSSET--RPSSDDNS  639



>ref|XP_009337799.1| PREDICTED: probable inactive receptor kinase At5g58300 [Pyrus 
x bretschneideri]
Length=636

 Score =   224 bits (571),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 115/172 (67%), Positives = 135/172 (78%), Gaps = 5/172 (3%)
 Frame = -3

Query  683  GAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRVTQ  504
            G KF HGN+KSSNVLL   + G ISD GL PLMN  A  S R  GYRAPEV +ET++  Q
Sbjct  452  GGKFIHGNVKSSNVLLMQDLTGSISDFGLAPLMNFTAIPS-RSVGYRAPEV-IETKKSFQ  509

Query  503  KSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQNIE  324
            KSDVYSFGV++LEMLTGK+ +   G DDVVDLPRWV+SVVREEWTAEVFDVELM+ +NIE
Sbjct  510  KSDVYSFGVMLLEMLTGKAPLQSPGRDDVVDLPRWVQSVVREEWTAEVFDVELMRCENIE  569

Query  323  EEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEPQPSSDDNN  168
            EE+VQMLQIA++CVA  PDMRPTM EVVR IE IR P   ++E + SS+D +
Sbjct  570  EELVQMLQIAMTCVATVPDMRPTMEEVVRMIEDIRPP---DSENRSSSEDKS  618



>ref|XP_010541471.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X1 [Tarenaya hassleriana]
Length=652

 Score =   224 bits (572),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 113/173 (65%), Positives = 136/173 (79%), Gaps = 7/173 (4%)
 Frame = -3

Query  686  GGAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRVT  507
            GG KF HGNIKSSNVL+    DGCISD GL  LM   A  + R  GYRAPEV  ETR+ T
Sbjct  481  GGPKFAHGNIKSSNVLINQETDGCISDSGLTSLM---AMPTTRAAGYRAPEV-TETRKQT  536

Query  506  QKSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQNI  327
             KSDVYSFGV++LEMLTGK+ +     DD+VDLPRWV+SVVREEWT+EVFDVELM++QNI
Sbjct  537  HKSDVYSFGVLLLEMLTGKAPIQSPSRDDMVDLPRWVQSVVREEWTSEVFDVELMRFQNI  596

Query  326  EEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEPQPSSDDNN  168
            EEEMVQMLQ+A++CVA+ PDMRP M +VVR IE IR    ++++ +PSS+DNN
Sbjct  597  EEEMVQMLQVAMACVARLPDMRPDMDQVVRMIEEIR---LSDSDNRPSSEDNN  646



>ref|XP_006356869.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X1 [Solanum tuberosum]
 ref|XP_006356870.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X2 [Solanum tuberosum]
Length=653

 Score =   224 bits (571),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 111/176 (63%), Positives = 139/176 (79%), Gaps = 5/176 (3%)
 Frame = -3

Query  683  GAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRVTQ  504
            G K  HGNIKSSNVLLT   +GCISD+GL PLM    T   +  GYRAPEV +ET++ TQ
Sbjct  478  GGKLIHGNIKSSNVLLTHDNNGCISDVGLTPLMG-FPTIPSKSAGYRAPEV-IETKKCTQ  535

Query  503  KSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQNIE  324
            KSDVYSFGV++LE+LTGK+ V   GHD+VVDLPRWV+SVVREEWTAEVFDVEL+K+QNIE
Sbjct  536  KSDVYSFGVLLLELLTGKAPVQPPGHDEVVDLPRWVQSVVREEWTAEVFDVELIKFQNIE  595

Query  323  EEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEPQPSSDDNNGGTP  156
            +EMVQMLQIA++CVA  P+ RP M++VV+ IE I+   + ++  +PSS+DN   +P
Sbjct  596  DEMVQMLQIAMTCVANVPETRPDMSQVVQMIEDIQ---QIDSGNRPSSEDNKSRSP  648



>ref|XP_008234182.1| PREDICTED: probable inactive receptor kinase At5g58300 [Prunus 
mume]
Length=601

 Score =   223 bits (569),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 109/173 (63%), Positives = 138/173 (80%), Gaps = 5/173 (3%)
 Frame = -3

Query  695  IQKGGAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETR  516
            I   GAK +HGNIKS+NVLLT  ++ CI+D+GL PLMN  AT S R  GYRAPE   + R
Sbjct  426  IHSEGAKCSHGNIKSTNVLLTQDLEACITDVGLSPLMNFPATMS-RATGYRAPEA-TDMR  483

Query  515  RVTQKSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKY  336
            +++ KSDVYSFGV++LEMLTGK+ +   GHD V+DLPRWV+SVVREEWTAEVFD+EL++ 
Sbjct  484  KISHKSDVYSFGVLLLEMLTGKTTLQYPGHDSVIDLPRWVKSVVREEWTAEVFDLELLRQ  543

Query  335  QNIEEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEPQPSSD  177
            Q+IEEEMVQMLQIAL+CV+K P+ RP M EVVR IE IR   +++T+ +PSS+
Sbjct  544  QHIEEEMVQMLQIALACVSKLPEARPRMDEVVRMIEEIR---QSDTKTRPSSE  593



>ref|XP_011095165.1| PREDICTED: probable inactive receptor kinase At5g58300 [Sesamum 
indicum]
 ref|XP_011095166.1| PREDICTED: probable inactive receptor kinase At5g58300 [Sesamum 
indicum]
Length=643

 Score =   223 bits (568),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 109/164 (66%), Positives = 129/164 (79%), Gaps = 2/164 (1%)
 Frame = -3

Query  686  GGAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRVT  507
             G K THGNIKSSNVLLT   +GCI+D GL PLM    T   R  GYRAPEV  ETR+ T
Sbjct  469  AGGKQTHGNIKSSNVLLTQDFNGCITDFGLTPLMGIIPTIPSRSAGYRAPEV-TETRKST  527

Query  506  QKSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQNI  327
            QKSDVYSFGV++LE+LTGK+   + G D+VVDLPRWV+SVVREEWTAEVFD +L+KYQNI
Sbjct  528  QKSDVYSFGVLLLELLTGKAPTKLVGQDEVVDLPRWVQSVVREEWTAEVFDADLVKYQNI  587

Query  326  EEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETE  195
            EEEMVQMLQIA++CVA+ PD RP M EVV+ I  IR P+++E +
Sbjct  588  EEEMVQMLQIAMNCVAQVPDARPAMDEVVKMIGKIR-PSDSENQ  630



>ref|XP_009406050.1| PREDICTED: probable inactive receptor kinase At5g58300 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009406051.1| PREDICTED: probable inactive receptor kinase At5g58300 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009406052.1| PREDICTED: probable inactive receptor kinase At5g58300 [Musa 
acuminata subsp. malaccensis]
Length=631

 Score =   223 bits (567),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 111/174 (64%), Positives = 136/174 (78%), Gaps = 5/174 (3%)
 Frame = -3

Query  689  KGGAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRV  510
            +GG KF HGNIKSSNVLLT  +D C+S+ GL PLM++AAT S R  GYRAPEV +E R+ 
Sbjct  455  QGGGKFIHGNIKSSNVLLTQELDACVSEFGLAPLMSSAATPS-RVVGYRAPEV-IEHRKS  512

Query  509  TQKSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQN  330
            TQKSDVYSFGV +LE+LTGKS     G DDVVDLPRWV+SVVREEWTAEVFDVELM+Y N
Sbjct  513  TQKSDVYSFGVFLLELLTGKSPFQSPGRDDVVDLPRWVQSVVREEWTAEVFDVELMRYPN  572

Query  329  IEEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEPQPSSDDNN  168
            IEE+MVQMLQ+A+ CV +  + RP M +VVR IE ++    + +E +PSS+D +
Sbjct  573  IEEDMVQMLQVAMQCVVRVAEQRPKMEDVVRMIEDVQ---RSNSENRPSSEDKS  623



>ref|XP_009386109.1| PREDICTED: probable inactive receptor kinase At5g58300 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009386110.1| PREDICTED: probable inactive receptor kinase At5g58300 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009386111.1| PREDICTED: probable inactive receptor kinase At5g58300 [Musa 
acuminata subsp. malaccensis]
Length=633

 Score =   222 bits (566),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 115/183 (63%), Positives = 139/183 (76%), Gaps = 10/183 (5%)
 Frame = -3

Query  689  KGGAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRV  510
            +GG K  HGNIKS+NVLLT  +  C+S+ GL  LMN AAT S R  GYRAPEV +E ++ 
Sbjct  456  QGGGKLIHGNIKSANVLLTQELSACVSEFGLALLMNCAATPS-RIMGYRAPEV-LEQQKS  513

Query  509  TQKSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQN  330
            T+KSDVYSFGV +LE+LTGKS V   GHD+VVDLPRWV+SVVREEWTAEVFDVELMKY N
Sbjct  514  TEKSDVYSFGVFLLELLTGKSPVQTPGHDEVVDLPRWVQSVVREEWTAEVFDVELMKYPN  573

Query  329  IEEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEPQPSSD-----DNNG  165
            IEE+MVQML +A+ CVA+ PD RPTM +VVR IE +R    + +E +PSS+     D+N 
Sbjct  574  IEEDMVQMLHVAMQCVARVPDRRPTMEDVVRMIEDVR---HSNSESRPSSEEGKAKDDNV  630

Query  164  GTP  156
             TP
Sbjct  631  LTP  633



>gb|ACA61611.1| hypothetical protein AP2_E06.2 [Arabidopsis lyrata subsp. petraea]
Length=658

 Score =   222 bits (566),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 116/174 (67%), Positives = 140/174 (80%), Gaps = 6/174 (3%)
 Frame = -3

Query  686  GGAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRR-PGYRAPEVFVETRRV  510
            GG KF+HGNIKSSNV++    D CISD GL PLM  A   +P R  GYRAPEV +ETR+ 
Sbjct  477  GGPKFSHGNIKSSNVIMKQESDACISDFGLTPLM--AVPIAPMRGAGYRAPEV-METRKH  533

Query  509  TQKSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQN  330
            T KSDVYSFGV++LEMLTGKS V     DD+VDLPRWV+SVVREEWT+EVFDVELM++QN
Sbjct  534  THKSDVYSFGVLILEMLTGKSPVQSPSRDDMVDLPRWVQSVVREEWTSEVFDVELMRFQN  593

Query  329  IEEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEPQPSSDDNN  168
            IEEEMVQMLQIA++CVA+  ++RPTM +VVR IE IR  +++ET  +PSSDDN+
Sbjct  594  IEEEMVQMLQIAMACVAQMHEVRPTMDDVVRMIEEIRV-SDSETT-RPSSDDNS  645



>emb|CDY02808.1| BnaC02g10810D [Brassica napus]
Length=421

 Score =   217 bits (552),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 113/176 (64%), Positives = 137/176 (78%), Gaps = 6/176 (3%)
 Frame = -3

Query  692  QKGGAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRR-PGYRAPEVFVETR  516
            Q GG KF+HGNIKSSN+++    D C+SD GL  LM  A   +P R  GYRAPEV +ETR
Sbjct  240  QVGGPKFSHGNIKSSNMIMKQESDVCVSDYGLTSLM--AVPVTPMRGAGYRAPEV-IETR  296

Query  515  RVTQKSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKY  336
            + T KSDVYSFGV++LEMLTGKS V     +D+VDLPRWV+SVVREEWT+EVFDVELMK 
Sbjct  297  KHTHKSDVYSFGVLILEMLTGKSPVQSPSREDMVDLPRWVQSVVREEWTSEVFDVELMKV  356

Query  335  QNIEEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEPQPSSDDNN  168
            QNIEEEMVQMLQIA++CVA+  ++RP+M +VVR IE IR    +ET  +PSSDDN+
Sbjct  357  QNIEEEMVQMLQIAMACVAQVAEVRPSMDDVVRMIEEIRVSDSSET--RPSSDDNS  410



>ref|XP_010938046.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X2 [Elaeis guineensis]
Length=641

 Score =   221 bits (564),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 107/157 (68%), Positives = 126/157 (80%), Gaps = 1/157 (1%)
 Frame = -3

Query  689  KGGAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRV  510
            KGG KF HGNIKSSN+LL    +  +SD GL PLMN  A  S    GYRAPE  +ETR++
Sbjct  464  KGGPKFVHGNIKSSNILLNQDRNPFVSDYGLSPLMNPPANLSRVVVGYRAPET-METRKI  522

Query  509  TQKSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQN  330
            TQKSDVYSFGV++LEMLTGK+ +   GHDDV DLPRWV+SVVREEWTAEVFDVELM+YQN
Sbjct  523  TQKSDVYSFGVLLLEMLTGKAPLQCQGHDDVADLPRWVQSVVREEWTAEVFDVELMRYQN  582

Query  329  IEEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIR  219
            IEE++VQMLQIA+SCVA+ P+ RP M EV+R IE I+
Sbjct  583  IEEQLVQMLQIAMSCVARTPEQRPGMEEVIRMIEEIQ  619



>gb|KEH23299.1| LRR receptor-like kinase [Medicago truncatula]
Length=611

 Score =   220 bits (561),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 107/157 (68%), Positives = 128/157 (82%), Gaps = 4/157 (3%)
 Frame = -3

Query  683  GAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRP-GYRAPEVFVETRRVT  507
            G K  HGNIKSSNVLLT  + GCISD GL PL   +   SP+ P GYRAPEV  E+R+ T
Sbjct  455  GRKHVHGNIKSSNVLLTIDLQGCISDFGLTPL--TSLCVSPKSPPGYRAPEV-NESRKYT  511

Query  506  QKSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQNI  327
            QKSDVYSFGV++LEMLTGK+ V  +GHDDVVDLP+WV+SVVREEWTAEVFD++LM+Y NI
Sbjct  512  QKSDVYSFGVLLLEMLTGKTPVQYSGHDDVVDLPKWVQSVVREEWTAEVFDLDLMRYSNI  571

Query  326  EEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRG  216
            EE++VQMLQ+A++CVA+ PD RP+M EVVR IE IR 
Sbjct  572  EEDLVQMLQLAMACVAEMPDTRPSMEEVVRMIEDIRA  608



>ref|XP_003523287.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X1 [Glycine max]
 ref|XP_006578848.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X2 [Glycine max]
 ref|XP_006578849.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X3 [Glycine max]
 ref|XP_006578850.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X4 [Glycine max]
 ref|XP_006578851.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X5 [Glycine max]
Length=640

 Score =   221 bits (562),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 113/183 (62%), Positives = 139/183 (76%), Gaps = 4/183 (2%)
 Frame = -3

Query  698  FIQ-KGGAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVE  522
            FI  +GG KF+HGNIKS+NVL+T  +DGCISD+GL PLMN  AT S R  GYRAPE   +
Sbjct  458  FIHSEGGPKFSHGNIKSTNVLITQELDGCISDVGLPPLMNTPATMS-RANGYRAPEA-TD  515

Query  521  TRRVTQKSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELM  342
            +++++ KSDVY FGV++LEMLTGK+ +   G++DVVDLPRWVRSVVREEWTAEVFD EL+
Sbjct  516  SKKISHKSDVYGFGVLLLEMLTGKTPLRYPGYEDVVDLPRWVRSVVREEWTAEVFDEELL  575

Query  341  KYQNIEEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEPQPSSD-DNNG  165
            + Q +EEEMVQMLQIAL+CVAK  D RP M EVVR +E I+ P       Q S + D+N 
Sbjct  576  RGQYVEEEMVQMLQIALACVAKGSDNRPRMDEVVRMLEEIKHPELKNHHRQSSHESDSNV  635

Query  164  GTP  156
             TP
Sbjct  636  QTP  638



>ref|XP_004246956.1| PREDICTED: probable inactive receptor kinase At5g58300 [Solanum 
lycopersicum]
Length=633

 Score =   220 bits (561),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 109/176 (62%), Positives = 136/176 (77%), Gaps = 5/176 (3%)
 Frame = -3

Query  683  GAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRVTQ  504
            G K  HGNIKSSNVLLT    GCISD+GL PLM    T   R  GYRAPEV +ET++ TQ
Sbjct  458  GGKLIHGNIKSSNVLLTQDNSGCISDVGLTPLMG-FPTIPSRSAGYRAPEV-IETKKCTQ  515

Query  503  KSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQNIE  324
            KSDVYSFGV++LE+LTGK+ V   GHD+VVDLPRWV+SVVREEWTAEVFD EL+K+QN E
Sbjct  516  KSDVYSFGVLLLELLTGKAPVQPPGHDEVVDLPRWVQSVVREEWTAEVFDTELIKFQNNE  575

Query  323  EEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEPQPSSDDNNGGTP  156
            +EMVQMLQIA++CVA  P+ RP M+++V+ IE I+   + ++  +PSS+DN   +P
Sbjct  576  DEMVQMLQIAMACVANVPETRPGMSQIVQMIEDIQ---QIDSGNRPSSEDNKSRSP  628



>ref|XP_010938045.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X1 [Elaeis guineensis]
Length=682

 Score =   221 bits (563),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 107/157 (68%), Positives = 126/157 (80%), Gaps = 1/157 (1%)
 Frame = -3

Query  689  KGGAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRV  510
            KGG KF HGNIKSSN+LL    +  +SD GL PLMN  A  S    GYRAPE  +ETR++
Sbjct  505  KGGPKFVHGNIKSSNILLNQDRNPFVSDYGLSPLMNPPANLSRVVVGYRAPET-METRKI  563

Query  509  TQKSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQN  330
            TQKSDVYSFGV++LEMLTGK+ +   GHDDV DLPRWV+SVVREEWTAEVFDVELM+YQN
Sbjct  564  TQKSDVYSFGVLLLEMLTGKAPLQCQGHDDVADLPRWVQSVVREEWTAEVFDVELMRYQN  623

Query  329  IEEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIR  219
            IEE++VQMLQIA+SCVA+ P+ RP M EV+R IE I+
Sbjct  624  IEEQLVQMLQIAMSCVARTPEQRPGMEEVIRMIEEIQ  660



>ref|XP_010670041.1| PREDICTED: probable inactive receptor kinase At5g58300 [Beta 
vulgaris subsp. vulgaris]
Length=635

 Score =   219 bits (559),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 114/184 (62%), Positives = 139/184 (76%), Gaps = 11/184 (6%)
 Frame = -3

Query  689  KGGAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRV  510
            + G KF HGNIKSSNVLL+   +GCISD GL  LMN    TS R  GY APEV +E R+ 
Sbjct  455  EAGGKFIHGNIKSSNVLLSQDYEGCISDFGLPLLMNFQGITS-RSIGYHAPEV-IEVRKA  512

Query  509  TQKSDVYSFGVVVLEMLTGKSAVPVA-GHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQ  333
            +QKSDVYSFGV++LE+LTGK+ +  + GH+DV+DLPRWV+SVVREEWT+EVFD EL++  
Sbjct  513  SQKSDVYSFGVLLLEILTGKAPLKTSHGHNDVIDLPRWVQSVVREEWTSEVFDAELLRCP  572

Query  332  NIEEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEPQPSSDDN-----N  168
            N EEEMV MLQIAL+CVA+ PDMRP M +VVR IE IR    +E+E +PSSD+N     N
Sbjct  573  NAEEEMVHMLQIALACVARVPDMRPKMDDVVRMIEEIR---PSESEERPSSDENKSKDSN  629

Query  167  GGTP  156
             GTP
Sbjct  630  AGTP  633



>ref|XP_006587908.1| PREDICTED: probable inactive receptor kinase At5g58300-like [Glycine 
max]
 gb|KHN29485.1| Putative inactive receptor kinase [Glycine soja]
Length=607

 Score =   219 bits (557),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 103/155 (66%), Positives = 128/155 (83%), Gaps = 3/155 (2%)
 Frame = -3

Query  683  GAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRVTQ  504
            G K  HGNIKSSNV+L+  + GCISD GL PL N  A++  R PGY APEV +E+R+ T+
Sbjct  452  GRKLVHGNIKSSNVILSIDLQGCISDFGLTPLTNFCASS--RSPGYGAPEV-IESRKSTK  508

Query  503  KSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQNIE  324
            KSDVYSFGV++LEMLTGK+ V  +GHD+VVDLP+WV+SVVREEWTAEVFD+ELM+Y NIE
Sbjct  509  KSDVYSFGVLLLEMLTGKTPVQYSGHDEVVDLPKWVQSVVREEWTAEVFDLELMRYPNIE  568

Query  323  EEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIR  219
            +E+VQMLQ+A++CVA  PD RP+M EVV+ IE IR
Sbjct  569  DELVQMLQLAMACVAAMPDTRPSMEEVVKTIEEIR  603



>dbj|BAH57151.1| AT3G08680 [Arabidopsis thaliana]
Length=256

 Score =   209 bits (532),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 102/156 (65%), Positives = 123/156 (79%), Gaps = 2/156 (1%)
 Frame = -3

Query  683  GAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRVTQ  504
            GAK  HGNIKS NVLLT  +  C+SD G+ PLM++      R  GYRAPE  +ETR+ TQ
Sbjct  77   GAKLLHGNIKSPNVLLTQELHVCVSDFGIAPLMSHHTLIPSRSLGYRAPEA-IETRKHTQ  135

Query  503  KSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQ-NI  327
            KSDVYSFGV++LEMLTGK+A    GH++VVDLP+WV+SVVREEWT EVFDVEL+K Q N+
Sbjct  136  KSDVYSFGVLLLEMLTGKAAGKTTGHEEVVDLPKWVQSVVREEWTGEVFDVELIKQQHNV  195

Query  326  EEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIR  219
            EEEMVQMLQIA++CV+K PD RP+M EVV  +E IR
Sbjct  196  EEEMVQMLQIAMACVSKHPDSRPSMEEVVNMMEEIR  231



>ref|XP_006602721.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X2 [Glycine max]
 ref|XP_003551618.2| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X1 [Glycine max]
Length=607

 Score =   218 bits (555),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 102/155 (66%), Positives = 128/155 (83%), Gaps = 3/155 (2%)
 Frame = -3

Query  683  GAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRVTQ  504
            G K  HGNIKSSNV+L+  + GCISD GL PL N   ++  R PGY +PEV +E+R+ TQ
Sbjct  452  GKKLVHGNIKSSNVILSIDLQGCISDFGLTPLTNFCGSS--RSPGYGSPEV-IESRKSTQ  508

Query  503  KSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQNIE  324
            KSDVYSFGV++LEMLTGK+ V  +GHD+VVDLP+WV+SVVREEWTAEVFD+ELM+Y NIE
Sbjct  509  KSDVYSFGVLLLEMLTGKTPVQYSGHDEVVDLPKWVQSVVREEWTAEVFDLELMRYPNIE  568

Query  323  EEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIR  219
            +E+VQMLQ+A++CVA  PD+RP+M EVVR IE +R
Sbjct  569  DELVQMLQLAMACVAVMPDVRPSMEEVVRTIEELR  603



>ref|XP_009607078.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nicotiana 
tomentosiformis]
Length=625

 Score =   218 bits (556),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 106/170 (62%), Positives = 135/170 (79%), Gaps = 5/170 (3%)
 Frame = -3

Query  686  GGAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRVT  507
            GG KF HGNIKSSNVLL   ++ CISD GL P+MN     + R PGYRAPEV +ETR+ +
Sbjct  459  GGPKFAHGNIKSSNVLLKQDLEACISDFGLAPIMNFPVAPT-RYPGYRAPEV-IETRKHS  516

Query  506  QKSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQNI  327
             KSDVYSFGV++LEMLTGK  +   G DD+VDLPRWV+SV++EEWT+EVFDV+LM++QNI
Sbjct  517  HKSDVYSFGVLLLEMLTGKQPMQSPGRDDMVDLPRWVQSVLKEEWTSEVFDVDLMRFQNI  576

Query  326  EEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEPQPSSD  177
            EEEMVQMLQIA++CVAK  DMRP M EVV+ I+ +R   ++++E + SS+
Sbjct  577  EEEMVQMLQIAMACVAKVADMRPNMEEVVKMIKEVR---QSDSENRQSSE  623



>ref|XP_003518282.1| PREDICTED: probable inactive receptor kinase At5g58300-like [Glycine 
max]
Length=648

 Score =   219 bits (557),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 112/175 (64%), Positives = 133/175 (76%), Gaps = 3/175 (2%)
 Frame = -3

Query  680  AKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRVTQK  501
            +K THGNIKSSNVL+    DGCI+D+GL P+M+  +T S R  GYRAPEV  E RR+TQK
Sbjct  477  SKLTHGNIKSSNVLINQQHDGCITDVGLTPMMSTQSTMS-RANGYRAPEV-TEYRRITQK  534

Query  500  SDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQNIEE  321
            SDVYSFGV++LE+LTGK+ +   G++D+VDLPRWVRSVVREEWTAEVFD EL++ Q  EE
Sbjct  535  SDVYSFGVLLLELLTGKAPLGYPGYEDMVDLPRWVRSVVREEWTAEVFDEELLRGQYFEE  594

Query  320  EMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEPQPSSDDNNGGTP  156
            EMVQMLQIAL+CVAK  D RPTM E VR IE IR P E +     S  D+N  TP
Sbjct  595  EMVQMLQIALACVAKVSDNRPTMDETVRNIEEIRLP-ELKNRNTSSESDSNVQTP  648



>ref|XP_003544853.1| PREDICTED: probable inactive receptor kinase At5g58300-like [Glycine 
max]
Length=650

 Score =   218 bits (556),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 112/175 (64%), Positives = 134/175 (77%), Gaps = 3/175 (2%)
 Frame = -3

Query  680  AKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRVTQK  501
            +K THGNIKSSNVL+T   DGCI+D+GL P+M+  +T S R  GYRAPEV  E RR+TQK
Sbjct  479  SKLTHGNIKSSNVLITQQHDGCITDVGLTPMMSTQSTMS-RANGYRAPEV-TEYRRITQK  536

Query  500  SDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQNIEE  321
            SDVYSFGV++LE+LTGK+ +   G++D+VDLPRWVRSVVREEWTAEVFD EL++ Q  EE
Sbjct  537  SDVYSFGVLLLELLTGKAPLGYPGYEDMVDLPRWVRSVVREEWTAEVFDEELLRGQYFEE  596

Query  320  EMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEPQPSSDDNNGGTP  156
            EMVQMLQIAL+CVAK  D RPTM E VR I+ IR P E +     S  D+N  TP
Sbjct  597  EMVQMLQIALACVAKLADNRPTMDETVRNIQEIRLP-ELKNPNTSSESDSNLQTP  650



>ref|NP_001169737.1| uncharacterized LOC100383618 precursor [Zea mays]
 gb|ACN34721.1| unknown [Zea mays]
 tpg|DAA64145.1| TPA: putative leucine-rich repeat receptor-like protein kinase 
family protein [Zea mays]
Length=636

 Score =   218 bits (555),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 107/174 (61%), Positives = 135/174 (78%), Gaps = 4/174 (2%)
 Frame = -3

Query  689  KGGAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRV  510
            +GGAK THGN+KS+NVL+    +  +SD GL  L +     S    GYRAPE+ VE R++
Sbjct  459  EGGAKLTHGNVKSTNVLVDQDHNPSVSDYGLSALTSVPVNASRVVVGYRAPEI-VENRKI  517

Query  509  TQKSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQN  330
            TQKSDVYSFGV+++EMLTGK+ +   G+DDVVDLPRWV SVVREEWTAEVFDVELMK+QN
Sbjct  518  TQKSDVYSFGVLLMEMLTGKAPLQTQGNDDVVDLPRWVHSVVREEWTAEVFDVELMKHQN  577

Query  329  IEEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEPQPSSDDNN  168
            IEEE+VQMLQIA+ C AK+PD RPTM EV+R IEG+R   ++ +E + SSD+ +
Sbjct  578  IEEELVQMLQIAMVCTAKSPDRRPTMEEVIRMIEGLR---QSTSESRASSDEKS  628



>gb|KHN40609.1| Putative inactive receptor kinase [Glycine soja]
Length=607

 Score =   217 bits (553),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 102/155 (66%), Positives = 127/155 (82%), Gaps = 3/155 (2%)
 Frame = -3

Query  683  GAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRVTQ  504
            G K  HGNIKSSNV+L+  + GCISD GL PL N   ++  R PGY +PEV +E+R+ TQ
Sbjct  452  GKKLVHGNIKSSNVILSIDLQGCISDFGLTPLTNFCGSS--RSPGYGSPEV-IESRKSTQ  508

Query  503  KSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQNIE  324
            KSDVYSFGV++LEMLTGK+ V  +GHD+VVDLP+WV+SVVREEWTAEVFD+ELM+Y NIE
Sbjct  509  KSDVYSFGVLLLEMLTGKTPVQYSGHDEVVDLPKWVQSVVREEWTAEVFDLELMRYPNIE  568

Query  323  EEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIR  219
            +E+VQMLQ+A++CVA  PD RP+M EVVR IE +R
Sbjct  569  DELVQMLQLAMACVAVMPDARPSMEEVVRTIEELR  603



>ref|XP_010921193.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X1 [Elaeis guineensis]
Length=634

 Score =   217 bits (553),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 109/171 (64%), Positives = 132/171 (77%), Gaps = 2/171 (1%)
 Frame = -3

Query  689  KGGAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRV  510
            +GG KF HGNIKSSN+LL   ++  +SD GL PLMN  AT S    GYRAPE  +ETR++
Sbjct  461  EGGPKFVHGNIKSSNILLGQDLNPLVSDYGLSPLMNPPATLSQLMVGYRAPET-METRKI  519

Query  509  TQKSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQN  330
            TQKSDVYSFGVV+LEMLTGK+ +   GHDDV DLPRWV+SVVREEWTAEVFDVELM   N
Sbjct  520  TQKSDVYSFGVVLLEMLTGKAPLQSQGHDDVADLPRWVQSVVREEWTAEVFDVELMMDHN  579

Query  329  IEEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAET-ETEPQPSS  180
             EEE+V+MLQIA+SCVA+ P+ RP M +VVR IE IR    + E++P+ S+
Sbjct  580  NEEELVRMLQIAMSCVARTPEQRPRMEDVVRMIEEIRKSGSSLESKPKDST  630



>ref|XP_008810859.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X2 [Phoenix dactylifera]
Length=644

 Score =   217 bits (553),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 109/174 (63%), Positives = 131/174 (75%), Gaps = 6/174 (3%)
 Frame = -3

Query  689  KGGAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRV  510
            +GG KF HGNIKSSNVLL   ++  +SD GL PLMN  A  S    GYRAPE  +ETR++
Sbjct  467  EGGPKFVHGNIKSSNVLLNHDLNPFVSDYGLSPLMNPPANLSRVVVGYRAPET-IETRKI  525

Query  509  TQKSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQN  330
            TQKSDVYSFGV++LEMLTGK+ +   GHDDV DLPRWV+SVVREEWTAEVFDVEL++YQN
Sbjct  526  TQKSDVYSFGVLLLEMLTGKAPLQGQGHDDVADLPRWVQSVVREEWTAEVFDVELLRYQN  585

Query  329  IEEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIE-----GIRGPAETETEPQPS  183
            IEE++VQMLQIA+SCVA+ P+ RP M EV+  I      G +G    E EP+ S
Sbjct  586  IEEQLVQMLQIAMSCVARTPEQRPRMEEVITMIGEIQQFGSKGRPSLEGEPEDS  639



>ref|XP_010109178.1| putative inactive receptor kinase [Morus notabilis]
 gb|EXC21107.1| putative inactive receptor kinase [Morus notabilis]
Length=635

 Score =   217 bits (552),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 108/178 (61%), Positives = 136/178 (76%), Gaps = 3/178 (2%)
 Frame = -3

Query  689  KGGAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRV  510
            +GG K  HGNIKSSNVLL+  ++ CI+D GL  ++N     S R  GYRAPE  ++TR++
Sbjct  461  EGGPKCIHGNIKSSNVLLSQDLEACITDFGLAQIVNFPPIIS-RILGYRAPEA-IDTRKL  518

Query  509  TQKSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQN  330
            TQKSDVYSFGV++LEMLTGK  +   GH++VVDLPRWVRSVVREEWT+EVFDVE+++   
Sbjct  519  TQKSDVYSFGVLLLEMLTGKIPIRYPGHNEVVDLPRWVRSVVREEWTSEVFDVEILRQTY  578

Query  329  IEEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEPQPSSDDNNGGTP  156
            +EEEMVQMLQIAL+CV+K PD RP M EVV+ IE +R P +T+T P   SD +N  TP
Sbjct  579  VEEEMVQMLQIALACVSKVPDSRPNMEEVVKMIEDVR-PPQTKTRPSSESDYSNVQTP  635



>ref|XP_007140053.1| hypothetical protein PHAVU_008G080500g [Phaseolus vulgaris]
 gb|ESW12047.1| hypothetical protein PHAVU_008G080500g [Phaseolus vulgaris]
Length=607

 Score =   216 bits (550),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 104/154 (68%), Positives = 126/154 (82%), Gaps = 3/154 (2%)
 Frame = -3

Query  683  GAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRVTQ  504
            G K  HGNIKSSNV+LT  + GCISD GL PL N  A++  R PGY APEV +ETR+ TQ
Sbjct  452  GRKLVHGNIKSSNVILTIDLQGCISDFGLTPLTNFCASS--RSPGYGAPEV-IETRKSTQ  508

Query  503  KSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQNIE  324
            KSDVYSFGV++LEMLTGK+ V  +GHD+ VDLP+WV+SVVREEWTAEVFD+ELM+Y NIE
Sbjct  509  KSDVYSFGVLLLEMLTGKTPVQYSGHDEEVDLPKWVQSVVREEWTAEVFDLELMRYPNIE  568

Query  323  EEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGI  222
            +E+VQMLQ+A++CVA  PD RP+M EVV+ IE I
Sbjct  569  DELVQMLQLAMACVAVMPDSRPSMVEVVKTIEEI  602



>ref|XP_004958707.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X1 [Setaria italica]
 ref|XP_004958708.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X2 [Setaria italica]
 ref|XP_004958709.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X3 [Setaria italica]
Length=639

 Score =   216 bits (551),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 106/172 (62%), Positives = 134/172 (78%), Gaps = 4/172 (2%)
 Frame = -3

Query  689  KGGAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRV  510
            +GG K THGN+KS+NVL+  + +  +SD GL  LM+     S    GYRAPE  VE R++
Sbjct  462  EGGTKLTHGNVKSTNVLVDKNHNPSVSDYGLSALMSVPVNASRVVVGYRAPET-VENRKI  520

Query  509  TQKSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQN  330
            TQKSDVYSFGV+++EMLTGK+ +   G+DDVVDLPRWV SVVREEWTAEVFDVELMK QN
Sbjct  521  TQKSDVYSFGVLLMEMLTGKAPLQTQGNDDVVDLPRWVHSVVREEWTAEVFDVELMKEQN  580

Query  329  IEEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEPQPSSDD  174
            IEEE+VQMLQIA++C A++PD RPTM E++R IEG+R   ++ TE + SSD+
Sbjct  581  IEEELVQMLQIAMACTARSPDRRPTMEELIRMIEGLR---QSATESRASSDE  629



>ref|XP_007141331.1| hypothetical protein PHAVU_008G186900g [Phaseolus vulgaris]
 ref|XP_007141332.1| hypothetical protein PHAVU_008G186900g [Phaseolus vulgaris]
 gb|ESW13325.1| hypothetical protein PHAVU_008G186900g [Phaseolus vulgaris]
 gb|ESW13326.1| hypothetical protein PHAVU_008G186900g [Phaseolus vulgaris]
Length=644

 Score =   217 bits (552),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 109/170 (64%), Positives = 129/170 (76%), Gaps = 2/170 (1%)
 Frame = -3

Query  680  AKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRVTQK  501
            +K THGNIKSSNVL+T   DGCI+D+GL P+M   +T S +  GYRAPEV  E RR+TQK
Sbjct  473  SKLTHGNIKSSNVLITQEHDGCITDVGLTPVMTTQSTMS-KTNGYRAPEV-TEYRRITQK  530

Query  500  SDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQNIEE  321
            SDVYSFGV++LEMLTGK+ +  +G++D+VDLPRWVRSVVREEWTAEVFD EL++ Q  EE
Sbjct  531  SDVYSFGVLLLEMLTGKAPMGYSGYEDMVDLPRWVRSVVREEWTAEVFDEELLRGQYFEE  590

Query  320  EMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEPQPSSDDN  171
            EMVQMLQIAL+CVAK  D RPTM E VR IE IR P          S+ N
Sbjct  591  EMVQMLQIALACVAKVADNRPTMDETVRNIEEIRLPDLNNRNTSSESESN  640



>emb|CDY32713.1| BnaA02g07750D [Brassica napus]
Length=651

 Score =   216 bits (551),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 113/176 (64%), Positives = 137/176 (78%), Gaps = 6/176 (3%)
 Frame = -3

Query  692  QKGGAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRR-PGYRAPEVFVETR  516
            Q GG KF+HGNIKSSN+++    D C+SD GL  LM  A   +P R  GYRAPEV +ETR
Sbjct  470  QVGGPKFSHGNIKSSNMIMKQESDVCVSDYGLTSLM--AVPVTPMRGAGYRAPEV-IETR  526

Query  515  RVTQKSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKY  336
            + T KSDVYSFGV++LEMLTGKS V     +D+VDLPRWV+SVVREEWT+EVFDVELMK 
Sbjct  527  KHTHKSDVYSFGVLILEMLTGKSPVQSPSREDMVDLPRWVQSVVREEWTSEVFDVELMKV  586

Query  335  QNIEEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEPQPSSDDNN  168
            QNIEEEMVQMLQIA++CVA+  ++RP+M +VVR IE IR    +ET  +PSSDDN+
Sbjct  587  QNIEEEMVQMLQIAMACVAQVAEVRPSMDDVVRMIEEIRVSDSSET--RPSSDDNS  640



>ref|XP_008810858.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X1 [Phoenix dactylifera]
Length=685

 Score =   217 bits (552),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 109/174 (63%), Positives = 131/174 (75%), Gaps = 6/174 (3%)
 Frame = -3

Query  689  KGGAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRV  510
            +GG KF HGNIKSSNVLL   ++  +SD GL PLMN  A  S    GYRAPE  +ETR++
Sbjct  508  EGGPKFVHGNIKSSNVLLNHDLNPFVSDYGLSPLMNPPANLSRVVVGYRAPET-IETRKI  566

Query  509  TQKSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQN  330
            TQKSDVYSFGV++LEMLTGK+ +   GHDDV DLPRWV+SVVREEWTAEVFDVEL++YQN
Sbjct  567  TQKSDVYSFGVLLLEMLTGKAPLQGQGHDDVADLPRWVQSVVREEWTAEVFDVELLRYQN  626

Query  329  IEEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIE-----GIRGPAETETEPQPS  183
            IEE++VQMLQIA+SCVA+ P+ RP M EV+  I      G +G    E EP+ S
Sbjct  627  IEEQLVQMLQIAMSCVARTPEQRPRMEEVITMIGEIQQFGSKGRPSLEGEPEDS  680



>ref|XP_002463400.1| hypothetical protein SORBIDRAFT_02g043090 [Sorghum bicolor]
 gb|EER99921.1| hypothetical protein SORBIDRAFT_02g043090 [Sorghum bicolor]
Length=639

 Score =   216 bits (549),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 106/174 (61%), Positives = 134/174 (77%), Gaps = 4/174 (2%)
 Frame = -3

Query  689  KGGAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRV  510
            +GG K THGN+KS+NVL+    +  +SD GL  LM+     S    GYRAPE  VE+R++
Sbjct  462  EGGVKLTHGNVKSTNVLVDQDHNPSVSDYGLSALMSVPVNASRVVVGYRAPET-VESRKI  520

Query  509  TQKSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQN  330
            TQKSDVYSFGV+++EMLTGK+ +   G+DDVVDLPRWV SVVREEWTAEVFDVELMK+QN
Sbjct  521  TQKSDVYSFGVLLMEMLTGKAPLQTQGNDDVVDLPRWVHSVVREEWTAEVFDVELMKHQN  580

Query  329  IEEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEPQPSSDDNN  168
            IEEE+VQMLQIA+ C AK+PD RP M EV+R IEG+R   ++ +E + SSD+ +
Sbjct  581  IEEELVQMLQIAMVCTAKSPDRRPAMEEVIRMIEGLR---QSTSESRASSDEKS  631



>ref|XP_009126766.1| PREDICTED: probable inactive receptor kinase At5g58300 [Brassica 
rapa]
Length=651

 Score =   215 bits (548),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 112/175 (64%), Positives = 135/175 (77%), Gaps = 4/175 (2%)
 Frame = -3

Query  692  QKGGAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRR  513
            Q GG KF+HGNIKSSN+++    D C+SD GL  LM     T  R  GYRAPEV +ETR+
Sbjct  470  QVGGPKFSHGNIKSSNMIMKQENDVCVSDYGLTSLMV-VPVTPMRGAGYRAPEV-IETRK  527

Query  512  VTQKSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQ  333
             T KSDVYSFGV++LEMLTGKS V     +D+VDLPRWV+SVVREEWT+EVFDVELMK Q
Sbjct  528  HTHKSDVYSFGVLILEMLTGKSPVQSPSREDMVDLPRWVQSVVREEWTSEVFDVELMKVQ  587

Query  332  NIEEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEPQPSSDDNN  168
            NIEEEMVQMLQIA++CVA+  ++RP+M +VVR IE IR    +ET  +PSSDDN+
Sbjct  588  NIEEEMVQMLQIAMACVAQVAEVRPSMDDVVRMIEEIRVSDSSET--RPSSDDNS  640



>ref|XP_006658137.1| PREDICTED: probable inactive receptor kinase At5g58300-like [Oryza 
brachyantha]
Length=642

 Score =   215 bits (547),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 105/172 (61%), Positives = 133/172 (77%), Gaps = 4/172 (2%)
 Frame = -3

Query  689  KGGAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRV  510
            +GGAK +HGNIKS+N+LL       +SD GL  LM+  A  S    GYRAPE  +E R++
Sbjct  465  EGGAKLSHGNIKSTNILLDQDYSSYVSDYGLSALMSVPANASRVVVGYRAPET-IENRKI  523

Query  509  TQKSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQN  330
            TQKSD+YSFGV+++EMLTGK+ +   G+DDVVDLPRWV SVVREEWTAEVFDVEL+K QN
Sbjct  524  TQKSDIYSFGVLLMEMLTGKAPLQSQGNDDVVDLPRWVHSVVREEWTAEVFDVELIKQQN  583

Query  329  IEEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEPQPSSDD  174
            IEEE+VQMLQIA+SC +++PD RPTM +V+R IEG+R  A   +E + SSD+
Sbjct  584  IEEELVQMLQIAMSCTSRSPDRRPTMEDVIRMIEGLRHSA---SESRASSDE  632



>ref|XP_009391668.1| PREDICTED: probable inactive receptor kinase At5g58300 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009391669.1| PREDICTED: probable inactive receptor kinase At5g58300 [Musa 
acuminata subsp. malaccensis]
Length=652

 Score =   215 bits (548),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 108/174 (62%), Positives = 132/174 (76%), Gaps = 4/174 (2%)
 Frame = -3

Query  689  KGGAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRV  510
            KGGAK  HGNIKSSN+LL   +   +SD GL  LMN  A  S    GYRAPE  +E R++
Sbjct  475  KGGAKLAHGNIKSSNILLNQDLKPVVSDYGLMVLMNLPAKPSRIVVGYRAPET-IEARKI  533

Query  509  TQKSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQN  330
            TQKSD+YSFGV++LEMLTGK+ +   GHDDVVDLPRWV+SVVREEWTAEVFD ELM  QN
Sbjct  534  TQKSDIYSFGVLLLEMLTGKAPLQSQGHDDVVDLPRWVQSVVREEWTAEVFDRELMGSQN  593

Query  329  IEEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEPQPSSDDNN  168
             EEEMVQMLQIA++CVA+ PD RP + EV++ IE IR   ++ +E +PSS+D +
Sbjct  594  TEEEMVQMLQIAMACVARVPDRRPRIEEVIQRIEEIR---QSGSESRPSSEDRH  644



>ref|XP_009363779.1| PREDICTED: probable inactive receptor kinase At5g58300 [Pyrus 
x bretschneideri]
Length=635

 Score =   214 bits (546),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 107/173 (62%), Positives = 135/173 (78%), Gaps = 5/173 (3%)
 Frame = -3

Query  695  IQKGGAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETR  516
            I   GAK +HGNIKS+N+LLT  ++ CISD+GL PLM+     S R  GYRAPE  V+ R
Sbjct  460  IHSVGAKCSHGNIKSTNILLTQELEACISDVGLSPLMSFPPAMS-RAIGYRAPEA-VDMR  517

Query  515  RVTQKSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKY  336
            + T KSDVYSFGV++LEMLTGK+ +   GHD VVDLPRWV+SVVREEWTAEVFD+EL+K+
Sbjct  518  KTTHKSDVYSFGVLLLEMLTGKATLEYLGHDCVVDLPRWVKSVVREEWTAEVFDLELLKH  577

Query  335  QNIEEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEPQPSSD  177
             +IEEEMVQ+LQIAL+CV K P+ RP M EVVR IE +R   +++T+ +PSS+
Sbjct  578  HHIEEEMVQVLQIALACVTKLPETRPNMDEVVRMIEELR---QSDTKTRPSSE  627



>ref|XP_004308997.1| PREDICTED: probable inactive receptor kinase At5g58300 [Fragaria 
vesca subsp. vesca]
 ref|XP_011470006.1| PREDICTED: probable inactive receptor kinase At5g58300 [Fragaria 
vesca subsp. vesca]
Length=643

 Score =   215 bits (547),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 109/176 (62%), Positives = 137/176 (78%), Gaps = 8/176 (5%)
 Frame = -3

Query  692  QKGGAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNN--AATTSPRRPGYRAPEVFVET  519
             +GG K  HGNIKS+NVLLT  ++ CISD+GL PLMN   A + S R  GYRAPE  ++ 
Sbjct  466  SEGGVKCIHGNIKSTNVLLTEELEACISDVGLTPLMNFPVATSMSRRATGYRAPEA-IDM  524

Query  518  RRVTQKSDVYSFGVVVLEMLTGKSAVPVAGHDD--VVDLPRWVRSVVREEWTAEVFDVEL  345
            R+++ KSDVYSFGV++LEMLTGK+ +  AGH D  VVDLPRWV+SVVREEWTAEVFD+EL
Sbjct  525  RKMSDKSDVYSFGVLLLEMLTGKTTLQNAGHYDDVVVDLPRWVKSVVREEWTAEVFDLEL  584

Query  344  MKYQNIEEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEPQPSSD  177
            +K Q IEEEMVQMLQIAL+CVAK P+ RP M +VVR +E  R   +++T+ +PSS+
Sbjct  585  LKQQGIEEEMVQMLQIALACVAKLPESRPKMDDVVRMLEEFR---QSDTKTRPSSE  637



>gb|EAZ05160.1| hypothetical protein OsI_27356 [Oryza sativa Indica Group]
Length=640

 Score =   214 bits (546),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 105/172 (61%), Positives = 133/172 (77%), Gaps = 4/172 (2%)
 Frame = -3

Query  689  KGGAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRV  510
            +GGAK THGNIKS+N+LL       +SD GL  LM+  A  S    GYRAPE  +E R++
Sbjct  463  EGGAKLTHGNIKSTNILLDQDYSSYVSDYGLSALMSVPANASRVVVGYRAPET-IENRKI  521

Query  509  TQKSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQN  330
            TQKSDVYSFGV+++EMLTGK+ +   G+DDVVDLPRWV SVVREEWTAEVFDVEL+K QN
Sbjct  522  TQKSDVYSFGVLLMEMLTGKAPLQSQGNDDVVDLPRWVHSVVREEWTAEVFDVELIKQQN  581

Query  329  IEEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEPQPSSDD  174
            IEEE+VQMLQIA++C +++PD RP+M +V+R IEG+R  A   +E + SSD+
Sbjct  582  IEEELVQMLQIAMACTSRSPDRRPSMEDVIRMIEGLRHSA---SESRASSDE  630



>ref|NP_001060650.1| Os07g0681100 [Oryza sativa Japonica Group]
 dbj|BAC80010.1| putative receptor-like protein kinase [Oryza sativa Japonica 
Group]
 dbj|BAF22564.1| Os07g0681100 [Oryza sativa Japonica Group]
 gb|EAZ41109.1| hypothetical protein OsJ_25602 [Oryza sativa Japonica Group]
Length=640

 Score =   214 bits (546),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 105/172 (61%), Positives = 133/172 (77%), Gaps = 4/172 (2%)
 Frame = -3

Query  689  KGGAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRV  510
            +GGAK THGNIKS+N+LL       +SD GL  LM+  A  S    GYRAPE  +E R++
Sbjct  463  EGGAKLTHGNIKSTNILLDQDYSSYVSDYGLTALMSVPANASRVVVGYRAPET-IENRKI  521

Query  509  TQKSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQN  330
            TQKSDVYSFGV+++EMLTGK+ +   G+DDVVDLPRWV SVVREEWTAEVFDVEL+K QN
Sbjct  522  TQKSDVYSFGVLLMEMLTGKAPLQSQGNDDVVDLPRWVHSVVREEWTAEVFDVELIKQQN  581

Query  329  IEEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEPQPSSDD  174
            IEEE+VQMLQIA++C +++PD RP+M +V+R IEG+R  A   +E + SSD+
Sbjct  582  IEEELVQMLQIAMACTSRSPDRRPSMEDVIRMIEGLRHSA---SESRASSDE  630



>emb|CDY03526.1| BnaC01g15560D [Brassica napus]
Length=256

 Score =   204 bits (519),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 98/178 (55%), Positives = 127/178 (71%), Gaps = 2/178 (1%)
 Frame = -3

Query  692  QKGGAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRR  513
            ++   K  HGNIKSSN+ L +  +GC+SD+GL  +M+  A    R+ GYRAPEV  +TR+
Sbjct  73   RENNGKLVHGNIKSSNIFLNSERNGCVSDLGLTAVMSALAPPISRQAGYRAPEV-TDTRK  131

Query  512  VTQKSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQ  333
             +Q SDVYSFGVV+LE+LTGKS +     D+++ L RWV SVVREEWTAEVFDVEL++Y 
Sbjct  132  SSQLSDVYSFGVVLLELLTGKSPIHTTAGDEIIHLVRWVHSVVREEWTAEVFDVELLRYT  191

Query  332  NIEEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEPQPSSDDNNGGT  159
            NIEEEMV+MLQIA+SCV KAPD RP M+++VR IE + G  +    P P     NG +
Sbjct  192  NIEEEMVEMLQIAMSCVVKAPDQRPKMSDLVRLIESV-GNRQASLGPDPKPKSENGAS  248



>gb|EEC75189.1| hypothetical protein OsI_11426 [Oryza sativa Indica Group]
Length=495

 Score =   210 bits (534),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 102/173 (59%), Positives = 134/173 (77%), Gaps = 4/173 (2%)
 Frame = -3

Query  689  KGGAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRV  510
            +GG+K  HGNIK++NVLL    +  +SD GL  LM+   +TS    GYRAPE F E+R+ 
Sbjct  318  EGGSKLAHGNIKATNVLLDQDHNPYVSDYGLSALMSFPISTSRVVVGYRAPETF-ESRKF  376

Query  509  TQKSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQN  330
            T KSDVYSFGV+++EMLTGK+ +   G DDVVDLPRWV SVVREEWTAEVFDVELMKY N
Sbjct  377  THKSDVYSFGVLLMEMLTGKAPLQSQGQDDVVDLPRWVHSVVREEWTAEVFDVELMKYLN  436

Query  329  IEEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEPQPSSDDN  171
            IE+E+VQMLQ+A++C +++P+ RPTMAEV+R IE +R   ++ +E + SS++N
Sbjct  437  IEDELVQMLQLAMACTSRSPERRPTMAEVIRMIEELR---QSASESRDSSNEN  486



>gb|ACN57540.1| At2g26730-like protein, partial [Capsella grandiflora]
 gb|ACN57544.1| At2g26730-like protein, partial [Capsella grandiflora]
Length=187

 Score =   200 bits (509),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 102/174 (59%), Positives = 128/174 (74%), Gaps = 2/174 (1%)
 Frame = -3

Query  680  AKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRVTQK  501
            AK  HGNIK+SN+LL  + D CISD GL  L +N++  + R  GY APEV  ETR+VT K
Sbjct  11   AKLVHGNIKASNILLXPNQDTCISDYGLNQLFSNSSPPN-RLAGYHAPEVL-ETRKVTFK  68

Query  500  SDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQNIEE  321
            SDVYSFGV++LE+LTGKS    +  ++ +DLPRWV SVVREEWTAEVFDVELM+Y NIEE
Sbjct  69   SDVYSFGVLLLELLTGKSPNQASLGEEGIDLPRWVLSVVREEWTAEVFDVELMRYHNIEE  128

Query  320  EMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEPQPSSDDNNGGT  159
            EMVQ+LQIA++CV+  PD RP M EV+R IE +     T+   + SSDD + G+
Sbjct  129  EMVQLLQIAMTCVSTVPDQRPVMQEVLRMIEDVNRSETTDDGLRQSSDDPSKGS  182



>ref|XP_008388375.1| PREDICTED: probable inactive receptor kinase At5g58300 [Malus 
domestica]
Length=635

 Score =   212 bits (539),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 111/180 (62%), Positives = 135/180 (75%), Gaps = 4/180 (2%)
 Frame = -3

Query  695  IQKGGAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETR  516
            I   GAK +HGNIKS+NVLLT  ++ CISD+GL PLMN     S R  GYRAPE   + R
Sbjct  460  IHSEGAKSSHGNIKSTNVLLTQELEACISDVGLSPLMNFPPAMS-RAMGYRAPEA-TDMR  517

Query  515  RVTQKSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKY  336
            ++T KSDVYSFGV++LEMLTGK+ +   G+D VVDLPRWV+SVVREEWTAEVFD+EL+K 
Sbjct  518  KITHKSDVYSFGVLLLEMLTGKTTLQYPGYDCVVDLPRWVKSVVREEWTAEVFDLELLKQ  577

Query  335  QNIEEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEPQPSSDDNNGGTP  156
            Q+ EEEMVQMLQIAL+CV K P+ RP M EVVR IE +R  ++T+T  Q S  + N  TP
Sbjct  578  QHSEEEMVQMLQIALACVTKLPETRPNMDEVVRMIEELR-QSDTKTR-QSSESEFNVQTP  635



>gb|ACN57533.1| At2g26730-like protein, partial [Capsella grandiflora]
 gb|ACN57535.1| At2g26730-like protein, partial [Capsella grandiflora]
 gb|ACN57537.1| At2g26730-like protein, partial [Capsella grandiflora]
 gb|ACN57538.1| At2g26730-like protein, partial [Capsella grandiflora]
 gb|ACN57541.1| At2g26730-like protein, partial [Capsella grandiflora]
 gb|ACN57542.1| At2g26730-like protein, partial [Capsella grandiflora]
 gb|ACN57543.1| At2g26730-like protein, partial [Capsella grandiflora]
 gb|ACN57545.1| At2g26730-like protein, partial [Capsella grandiflora]
 gb|ACN57546.1| At2g26730-like protein, partial [Capsella grandiflora]
 gb|ACN57548.1| At2g26730-like protein, partial [Capsella grandiflora]
Length=187

 Score =   200 bits (508),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 102/174 (59%), Positives = 128/174 (74%), Gaps = 2/174 (1%)
 Frame = -3

Query  680  AKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRVTQK  501
            AK  HGNIK+SN+LL  + D CISD GL  L +N++  + R  GY APEV  ETR+VT K
Sbjct  11   AKLVHGNIKASNILLHPNQDTCISDYGLNQLFSNSSPPN-RLAGYHAPEVL-ETRKVTFK  68

Query  500  SDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQNIEE  321
            SDVYSFGV++LE+LTGKS    +  ++ +DLPRWV SVVREEWTAEVFDVELM+Y NIEE
Sbjct  69   SDVYSFGVLLLELLTGKSPNQASLGEEGIDLPRWVLSVVREEWTAEVFDVELMRYHNIEE  128

Query  320  EMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEPQPSSDDNNGGT  159
            EMVQ+LQIA++CV+  PD RP M EV+R IE +     T+   + SSDD + G+
Sbjct  129  EMVQLLQIAMTCVSTVPDQRPVMQEVLRMIEDVNRSETTDDGLRQSSDDPSKGS  182



>ref|XP_004492584.1| PREDICTED: probable inactive receptor kinase At5g58300-like [Cicer 
arietinum]
Length=611

 Score =   211 bits (538),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 104/157 (66%), Positives = 125/157 (80%), Gaps = 4/157 (3%)
 Frame = -3

Query  683  GAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRP-GYRAPEVFVETRRVT  507
            G K  HGNIKSSNVLL+  + G ISD GL PL   +   SP+ P GY+APEV  E+R+ T
Sbjct  455  GRKLVHGNIKSSNVLLSIDLQGSISDFGLTPL--TSLCVSPKSPPGYQAPEV-NESRKST  511

Query  506  QKSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQNI  327
            QKSDVYSFGV++LEMLTGK+    +GHDDVVDLP+WV+SVVREEWTAEVFD+ELM+Y NI
Sbjct  512  QKSDVYSFGVLLLEMLTGKTPAQYSGHDDVVDLPKWVQSVVREEWTAEVFDLELMRYPNI  571

Query  326  EEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRG  216
            EEE+VQMLQ+A++CVA  PD RP+M EVV+ IE IR 
Sbjct  572  EEELVQMLQLAMACVAVMPDTRPSMEEVVKMIEDIRA  608



>ref|XP_008376328.1| PREDICTED: probable inactive receptor kinase At5g58300 [Malus 
domestica]
Length=635

 Score =   211 bits (538),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 105/172 (61%), Positives = 132/172 (77%), Gaps = 5/172 (3%)
 Frame = -3

Query  695  IQKGGAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETR  516
            I   GAK +HGNIKS+N+LLT  ++ CISD+GL PLMN     S R  GYR PE  ++ R
Sbjct  460  IHSVGAKCSHGNIKSTNILLTQELEACISDVGLSPLMNFPPAMS-RAIGYRPPEA-IDMR  517

Query  515  RVTQKSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKY  336
            + T KSDVYSFGV++LEMLTGK+ +   GHD VVDLPRWV+SVVREEWTAEVFD+EL+K+
Sbjct  518  KTTHKSDVYSFGVLLLEMLTGKATLEYLGHDCVVDLPRWVKSVVREEWTAEVFDLELLKH  577

Query  335  QNIEEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEPQPSS  180
             +IEEEMVQ+LQIAL+CV K P+ RP M EVVR I  +R   +++T+ +PSS
Sbjct  578  HHIEEEMVQVLQIALACVTKLPETRPNMDEVVRMIGELR---QSDTKTRPSS  626



>emb|CDX88667.1| BnaA03g09820D [Brassica napus]
Length=625

 Score =   211 bits (538),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 109/173 (63%), Positives = 130/173 (75%), Gaps = 17/173 (10%)
 Frame = -3

Query  686  GGAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRVT  507
            GG+KF+HGNIKSSNV++    D C+SD G                GYRAPEV V TR+ T
Sbjct  459  GGSKFSHGNIKSSNVIMKQENDVCVSDFG--------------GAGYRAPEVIV-TRKHT  503

Query  506  QKSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQNI  327
             KSDVYSFGV++LEMLTGKS V     +D+VDLPRWV+SVVREEWT+EVFDVELMK+QNI
Sbjct  504  HKSDVYSFGVLILEMLTGKSPVQSPSREDMVDLPRWVQSVVREEWTSEVFDVELMKFQNI  563

Query  326  EEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEPQPSSDDNN  168
            EEEMVQMLQIA++CVA  P++RP+M EVVR IE IR    +ET  +PSSDDN+
Sbjct  564  EEEMVQMLQIAMACVAHVPEVRPSMDEVVRMIEEIRVSDSSET--RPSSDDNS  614



>gb|ACN57520.1| At2g26730-like protein, partial [Capsella rubella]
 gb|ACN57521.1| At2g26730-like protein, partial [Capsella rubella]
 gb|ACN57522.1| At2g26730-like protein, partial [Capsella rubella]
 gb|ACN57523.1| At2g26730-like protein, partial [Capsella rubella]
 gb|ACN57524.1| At2g26730-like protein, partial [Capsella rubella]
 gb|ACN57525.1| At2g26730-like protein, partial [Capsella rubella]
 gb|ACN57526.1| At2g26730-like protein, partial [Capsella rubella]
 gb|ACN57527.1| At2g26730-like protein, partial [Capsella rubella]
 gb|ACN57528.1| At2g26730-like protein, partial [Capsella rubella]
 gb|ACN57529.1| At2g26730-like protein, partial [Capsella rubella]
 gb|ACN57530.1| At2g26730-like protein, partial [Capsella rubella]
 gb|ACN57531.1| At2g26730-like protein, partial [Capsella rubella]
 gb|ACN57532.1| At2g26730-like protein, partial [Capsella rubella]
 gb|ACN57534.1| At2g26730-like protein, partial [Capsella grandiflora]
 gb|ACN57536.1| At2g26730-like protein, partial [Capsella grandiflora]
 gb|ACN57539.1| At2g26730-like protein, partial [Capsella grandiflora]
Length=187

 Score =   199 bits (506),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 101/174 (58%), Positives = 128/174 (74%), Gaps = 2/174 (1%)
 Frame = -3

Query  680  AKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRVTQK  501
            AK  HGNIK+SN+LL  + D C+SD GL  L +N++  + R  GY APEV  ETR+VT K
Sbjct  11   AKLVHGNIKASNILLHPNQDTCVSDYGLNQLFSNSSPPN-RLAGYHAPEVL-ETRKVTFK  68

Query  500  SDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQNIEE  321
            SDVYSFGV++LE+LTGKS    +  ++ +DLPRWV SVVREEWTAEVFDVELM+Y NIEE
Sbjct  69   SDVYSFGVLLLELLTGKSPNQASLGEEGIDLPRWVLSVVREEWTAEVFDVELMRYHNIEE  128

Query  320  EMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEPQPSSDDNNGGT  159
            EMVQ+LQIA++CV+  PD RP M EV+R IE +     T+   + SSDD + G+
Sbjct  129  EMVQLLQIAMTCVSTVPDQRPVMQEVLRMIEDVNRSETTDDGLRQSSDDPSKGS  182



>ref|XP_010463311.1| PREDICTED: LOW QUALITY PROTEIN: probable inactive receptor kinase 
At3g08680 [Camelina sativa]
Length=637

 Score =   211 bits (536),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 106/171 (62%), Positives = 126/171 (74%), Gaps = 6/171 (4%)
 Frame = -3

Query  683  GAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRVTQ  504
            GAK  HGNIKS NVLLT  +  C+SD G+ PLM++      R  GYRAPE  +ETR+ TQ
Sbjct  458  GAKLLHGNIKSPNVLLTQDLHVCVSDFGIAPLMSHHTLIPSRSLGYRAPEA-IETRKHTQ  516

Query  503  KSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQ-NI  327
            KSDVYSFGV++LEMLTGK+A    GH++VVDLP+WV+SVVREEWT EVFDVEL+K Q N+
Sbjct  517  KSDVYSFGVLLLEMLTGKAAGKTTGHEEVVDLPKWVQSVVREEWTGEVFDVELIKQQHNV  576

Query  326  EEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIR----GPAETETEPQP  186
            EEEMVQMLQIA++CV+K PD RP+M EVV  IE IR    GP        P
Sbjct  577  EEEMVQMLQIAMACVSKHPDTRPSMEEVVNMIEEIRPTGSGPGSGNRASSP  627



>ref|XP_010043603.1| PREDICTED: probable inactive receptor kinase At5g58300 [Eucalyptus 
grandis]
 gb|KCW88397.1| hypothetical protein EUGRSUZ_A00785 [Eucalyptus grandis]
Length=613

 Score =   210 bits (535),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 105/165 (64%), Positives = 129/165 (78%), Gaps = 3/165 (2%)
 Frame = -3

Query  686  GGAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRVT  507
            GG +F HGNIKSSNVLLT  + GCIS+ GL PL+   A   PR  GYRAPEV ++TR+ T
Sbjct  450  GGGRFIHGNIKSSNVLLTQDLQGCISEFGLTPLIRTPAVP-PRSAGYRAPEV-MKTRKPT  507

Query  506  QKSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQNI  327
            QKSD+YSFGV++LEMLTGKS +     +DV DLPRWV+SVVREEWTAEVFD EL++  NI
Sbjct  508  QKSDIYSFGVLLLEMLTGKSPIQSPRREDVFDLPRWVQSVVREEWTAEVFDEELLRDGNI  567

Query  326  EEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEP  192
            EEE+V+ML+IAL+CV + PD RPTM EVVR IE +R P+++E  P
Sbjct  568  EEELVEMLKIALACVDRMPDGRPTMDEVVRMIEEVR-PSDSENPP  611



>ref|XP_002882579.1| hypothetical protein ARALYDRAFT_478170 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58838.1| hypothetical protein ARALYDRAFT_478170 [Arabidopsis lyrata subsp. 
lyrata]
Length=639

 Score =   211 bits (536),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 106/171 (62%), Positives = 126/171 (74%), Gaps = 6/171 (4%)
 Frame = -3

Query  683  GAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRVTQ  504
            GAK  HGNIKS NVLLT  +  C+SD G+ PLM++      R  GYRAPE  +ETR+ TQ
Sbjct  460  GAKLLHGNIKSPNVLLTQELQVCVSDFGIAPLMSHHTLIPSRSLGYRAPEA-IETRKHTQ  518

Query  503  KSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQ-NI  327
            KSDVYSFGV++LEMLTGK+A    GH++VVDLP+WV+SVVREEWT EVFDVEL+K Q N+
Sbjct  519  KSDVYSFGVLLLEMLTGKAAGKTTGHEEVVDLPKWVQSVVREEWTGEVFDVELIKQQHNV  578

Query  326  EEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIR----GPAETETEPQP  186
            EEEMVQMLQIA++CV+K PD RPTM EVV  +E IR    GP        P
Sbjct  579  EEEMVQMLQIAMACVSKHPDSRPTMEEVVNMMEEIRPSGSGPGSGNRASSP  629



>gb|EPS74415.1| hypothetical protein M569_00340 [Genlisea aurea]
Length=629

 Score =   210 bits (535),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 107/156 (69%), Positives = 128/156 (82%), Gaps = 5/156 (3%)
 Frame = -3

Query  668  HGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRVTQKSDVY  489
            HGNIKSSN+LLT ++DGC+SD GL  +++       R  GYRAPEV +ETR+V+QKSDVY
Sbjct  468  HGNIKSSNILLTLNLDGCVSDFGLSSMLSYIQVKH-RVAGYRAPEV-IETRKVSQKSDVY  525

Query  488  SFGVVVLEMLTGKSAV--PVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQNIEEEM  315
            SFGV++LEMLTGKS +      ++DVVDLPRWVRSVVREEWTAEVFD EL+K +NIEEE+
Sbjct  526  SFGVLLLEMLTGKSPLQHTTGYNNDVVDLPRWVRSVVREEWTAEVFDEELLKLKNIEEEL  585

Query  314  VQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAE  207
            VQMLQIALSCVAK P++RPTM EVVR IE IR P+E
Sbjct  586  VQMLQIALSCVAKVPEIRPTMVEVVRMIEEIR-PSE  620



>gb|KEH21182.1| LRR receptor-like kinase [Medicago truncatula]
Length=639

 Score =   210 bits (535),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 102/176 (58%), Positives = 127/176 (72%), Gaps = 4/176 (2%)
 Frame = -3

Query  689  KGGAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRV  510
            + G K  HGNIKSSN+ L T   GC+SD+GL  +  + A    R  GYRAPEV  +TR+ 
Sbjct  441  ENGGKLVHGNIKSSNIFLNTKQYGCVSDLGLATISTSLALPISRAAGYRAPEV-TDTRKA  499

Query  509  TQKSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQN  330
             Q SDVYSFGVV+LE+LTGKS +   G D+++ L RWV SVVREEWTAEVFD+ELM+Y N
Sbjct  500  AQPSDVYSFGVVLLELLTGKSPIHTTGGDEIIHLVRWVHSVVREEWTAEVFDLELMRYPN  559

Query  329  IEEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEPQPSSDDNNGG  162
            IEEEMV+MLQIA+SCV + PD RP M+EVV+ IE +R    T+T+P   S +N GG
Sbjct  560  IEEEMVEMLQIAMSCVVRMPDQRPKMSEVVKMIENVRQIDNTQTQP---SSENQGG  612



>ref|XP_010543666.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g05160 isoform X2 [Tarenaya hassleriana]
Length=675

 Score =   211 bits (536),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 105/156 (67%), Positives = 125/156 (80%), Gaps = 5/156 (3%)
 Frame = -3

Query  677  KFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRVTQKS  498
            K  HGNIKSSN+LLT  ++ C+SD  L PL N   T +PR  GY APEV +ETR+V+QKS
Sbjct  506  KCIHGNIKSSNILLTQDLEPCLSDTALVPLFN-ILTNTPRTIGYNAPEV-IETRKVSQKS  563

Query  497  DVYSFGVVVLEMLTGKSAVPVAGHDD---VVDLPRWVRSVVREEWTAEVFDVELMKYQNI  327
            DVYSFGV++LEMLTGK+ +  +G DD   VVDLPRWVRSVVREEWTAEVFDVEL+++QNI
Sbjct  564  DVYSFGVLLLEMLTGKTPLTQSGLDDEHVVVDLPRWVRSVVREEWTAEVFDVELLRFQNI  623

Query  326  EEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIR  219
            EEEMVQMLQIAL+CV+K PD RP M EV + IE +R
Sbjct  624  EEEMVQMLQIALACVSKVPDSRPQMEEVSKMIEDVR  659



>ref|XP_003562443.1| PREDICTED: probable inactive receptor kinase At5g58300 [Brachypodium 
distachyon]
 ref|XP_010233863.1| PREDICTED: probable inactive receptor kinase At5g58300 [Brachypodium 
distachyon]
 ref|XP_010233866.1| PREDICTED: probable inactive receptor kinase At5g58300 [Brachypodium 
distachyon]
 ref|XP_010233870.1| PREDICTED: probable inactive receptor kinase At5g58300 [Brachypodium 
distachyon]
Length=640

 Score =   210 bits (535),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 104/175 (59%), Positives = 130/175 (74%), Gaps = 3/175 (2%)
 Frame = -3

Query  689  KGGAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRV  510
            +GG K THGNIKS+NVL+    +  +SD GL  LMN   + S    GYRAPE  VE+R++
Sbjct  463  EGGGKLTHGNIKSTNVLIDQDHNPYVSDYGLNSLMNAPVSASRVVVGYRAPET-VESRKI  521

Query  509  TQKSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQN  330
            TQKSDVY FGV+++EMLTGK+ +   G+DDVVDLPRWV SVVREEWTAEVFDVELMK+QN
Sbjct  522  TQKSDVYCFGVLLMEMLTGKAPLQSQGNDDVVDLPRWVHSVVREEWTAEVFDVELMKHQN  581

Query  329  IEEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIR--GPAETETEPQPSSDDN  171
            IEEE+VQMLQIA++C +  P+ RP M EV+R IEG+R  GP   ++  +   D N
Sbjct  582  IEEELVQMLQIAMACTSGPPERRPAMEEVIRMIEGLRHSGPESRDSADEKLKDSN  636



>ref|NP_001050019.1| Os03g0332900 [Oryza sativa Japonica Group]
 gb|ABF95778.1| Protein kinase domain containing protein, expressed [Oryza sativa 
Japonica Group]
 gb|ABF95779.1| Protein kinase domain containing protein, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF11933.1| Os03g0332900 [Oryza sativa Japonica Group]
 dbj|BAG95872.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE59003.1| hypothetical protein OsJ_10722 [Oryza sativa Japonica Group]
Length=634

 Score =   210 bits (534),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 102/173 (59%), Positives = 134/173 (77%), Gaps = 4/173 (2%)
 Frame = -3

Query  689  KGGAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRV  510
            +GG+K  HGNIK++NVLL    +  +SD GL  LM+   +TS    GYRAPE F E+R+ 
Sbjct  457  EGGSKLAHGNIKATNVLLDQDHNPYVSDYGLSALMSFPISTSRVVVGYRAPETF-ESRKF  515

Query  509  TQKSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQN  330
            T KSDVYSFGV+++EMLTGK+ +   G DDVVDLPRWV SVVREEWTAEVFDVELMKY N
Sbjct  516  THKSDVYSFGVLLMEMLTGKAPLQSQGQDDVVDLPRWVHSVVREEWTAEVFDVELMKYLN  575

Query  329  IEEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEPQPSSDDN  171
            IE+E+VQMLQ+A++C +++P+ RPTMAEV+R IE +R   ++ +E + SS++N
Sbjct  576  IEDELVQMLQLAMACTSRSPERRPTMAEVIRMIEELR---QSASESRDSSNEN  625



>ref|XP_009146990.1| PREDICTED: probable inactive receptor kinase At3g08680 [Brassica 
rapa]
Length=635

 Score =   210 bits (534),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 100/156 (64%), Positives = 124/156 (79%), Gaps = 2/156 (1%)
 Frame = -3

Query  683  GAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRVTQ  504
            GAK  HGNIKS NVLLT  ++ C+SD G+ PLM++      R  GYRAPE  +ETR+ TQ
Sbjct  455  GAKLLHGNIKSPNVLLTQDLNACVSDYGIAPLMSHHTLLPSRSLGYRAPEA-IETRKHTQ  513

Query  503  KSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQ-NI  327
            KSDVYSFGV++LEMLTGK+A    GH++VVDLP+WV+SVVREEWT EVFDVEL+K Q N+
Sbjct  514  KSDVYSFGVLLLEMLTGKAAGKTTGHEEVVDLPKWVQSVVREEWTGEVFDVELIKQQHNV  573

Query  326  EEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIR  219
            EEEMVQMLQ+A++CV+K PD RP+M EVV  +E +R
Sbjct  574  EEEMVQMLQVAMACVSKHPDSRPSMEEVVNMMEEVR  609



>ref|XP_010543665.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g05160 isoform X1 [Tarenaya hassleriana]
Length=712

 Score =   211 bits (537),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 105/156 (67%), Positives = 125/156 (80%), Gaps = 5/156 (3%)
 Frame = -3

Query  677  KFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRVTQKS  498
            K  HGNIKSSN+LLT  ++ C+SD  L PL N   T +PR  GY APEV +ETR+V+QKS
Sbjct  543  KCIHGNIKSSNILLTQDLEPCLSDTALVPLFN-ILTNTPRTIGYNAPEV-IETRKVSQKS  600

Query  497  DVYSFGVVVLEMLTGKSAVPVAGHDD---VVDLPRWVRSVVREEWTAEVFDVELMKYQNI  327
            DVYSFGV++LEMLTGK+ +  +G DD   VVDLPRWVRSVVREEWTAEVFDVEL+++QNI
Sbjct  601  DVYSFGVLLLEMLTGKTPLTQSGLDDEHVVVDLPRWVRSVVREEWTAEVFDVELLRFQNI  660

Query  326  EEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIR  219
            EEEMVQMLQIAL+CV+K PD RP M EV + IE +R
Sbjct  661  EEEMVQMLQIALACVSKVPDSRPQMEEVSKMIEDVR  696



>gb|KHN25658.1| Putative inactive receptor kinase [Glycine soja]
Length=425

 Score =   205 bits (522),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 98/172 (57%), Positives = 125/172 (73%), Gaps = 1/172 (1%)
 Frame = -3

Query  689  KGGAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRV  510
            + G K  HGNI+SSN+ L +   GC+SD+GL  +M++ A    R  GYRAPEV  +TR+ 
Sbjct  243  ENGGKLVHGNIRSSNIFLNSKQYGCVSDLGLATIMSSVAIPISRAAGYRAPEV-TDTRKA  301

Query  509  TQKSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQN  330
            TQ SDVYSFGVV+LE+LTGKS V   G D++V L RWV SVVREEWTAEVFD+EL++Y N
Sbjct  302  TQPSDVYSFGVVLLELLTGKSPVYTTGSDEIVHLVRWVHSVVREEWTAEVFDLELIRYPN  361

Query  329  IEEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEPQPSSDD  174
            IEEEMV+MLQIA+SCV + PD RP M E+V+ IE +R       +P  SS++
Sbjct  362  IEEEMVEMLQIAMSCVVRVPDQRPKMLELVKMIENVRQIEIVVNQPSISSEN  413



>emb|CDY35996.1| BnaA05g29540D [Brassica napus]
Length=635

 Score =   210 bits (534),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 100/156 (64%), Positives = 124/156 (79%), Gaps = 2/156 (1%)
 Frame = -3

Query  683  GAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRVTQ  504
            GAK  HGNIKS NVLLT  ++ C+SD G+ PLM++      R  GYRAPE  +ETR+ TQ
Sbjct  455  GAKLLHGNIKSPNVLLTQDLNACVSDYGIAPLMSHHTLLPSRSLGYRAPEA-IETRKHTQ  513

Query  503  KSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQ-NI  327
            KSDVYSFGV++LEMLTGK+A    GH++VVDLP+WV+SVVREEWT EVFDVEL+K Q N+
Sbjct  514  KSDVYSFGVLLLEMLTGKAAGKTTGHEEVVDLPKWVQSVVREEWTGEVFDVELIKQQHNV  573

Query  326  EEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIR  219
            EEEMVQMLQ+A++CV+K PD RP+M EVV  +E +R
Sbjct  574  EEEMVQMLQVAMACVSKHPDSRPSMEEVVNMMEEVR  609



>gb|EYU42048.1| hypothetical protein MIMGU_mgv1a003031mg [Erythranthe guttata]
Length=614

 Score =   209 bits (532),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 108/177 (61%), Positives = 132/177 (75%), Gaps = 5/177 (3%)
 Frame = -3

Query  683  GAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRVTQ  504
            G K THGNIKSSNVLLT + D  I+D GL P+M        R  GYRAPE+ V+T + TQ
Sbjct  440  GGKLTHGNIKSSNVLLTQNSDARITDFGLIPVMGGIPGIPSRGAGYRAPEL-VQTGKSTQ  498

Query  503  KSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQ-NI  327
            KSD+YSFGV++LE+LTGK+ V   G D+V DLPRWV+SVVREEWTAEVFD +L+KY  NI
Sbjct  499  KSDIYSFGVLILELLTGKAPVQPMGQDEVEDLPRWVQSVVREEWTAEVFDADLIKYHNNI  558

Query  326  EEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEPQPSSDDNNGGTP  156
            EEEMVQMLQI L+CVAK P+MRP M+EVVR IE IR    T++E + SS+ +   +P
Sbjct  559  EEEMVQMLQIGLACVAKVPEMRPAMSEVVRMIEEIR---LTDSENRTSSEKSRSTSP  612



>ref|XP_006297193.1| hypothetical protein CARUB_v10013201mg [Capsella rubella]
 ref|XP_006297194.1| hypothetical protein CARUB_v10013201mg [Capsella rubella]
 gb|EOA30091.1| hypothetical protein CARUB_v10013201mg [Capsella rubella]
 gb|EOA30092.1| hypothetical protein CARUB_v10013201mg [Capsella rubella]
Length=633

 Score =   209 bits (533),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 105/171 (61%), Positives = 126/171 (74%), Gaps = 6/171 (4%)
 Frame = -3

Query  683  GAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRVTQ  504
            GAK  HGNIKS NVLLT  +  C+SD G+ PLM++      R  GYRAPE  +ETR+ TQ
Sbjct  454  GAKLLHGNIKSPNVLLTQDLHVCVSDFGIAPLMSHHTLIPSRSLGYRAPET-IETRKHTQ  512

Query  503  KSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQ-NI  327
            KSDVYSFGV++LEMLTGK+A    GH++VVDLP+WV+SVVREEWT EVFDVEL+K Q N+
Sbjct  513  KSDVYSFGVLLLEMLTGKAAGKTTGHEEVVDLPKWVQSVVREEWTGEVFDVELIKQQHNV  572

Query  326  EEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIR----GPAETETEPQP  186
            EEEMVQMLQIA++CV+K PD RP+M EVV  +E IR    GP        P
Sbjct  573  EEEMVQMLQIAMACVSKHPDTRPSMEEVVNMMEEIRPSGSGPGSGNRASSP  623



>ref|XP_002960794.1| hypothetical protein SELMODRAFT_74002 [Selaginella moellendorffii]
 ref|XP_002983874.1| hypothetical protein SELMODRAFT_119396 [Selaginella moellendorffii]
 gb|EFJ14886.1| hypothetical protein SELMODRAFT_119396 [Selaginella moellendorffii]
 gb|EFJ38333.1| hypothetical protein SELMODRAFT_74002 [Selaginella moellendorffii]
Length=649

 Score =   209 bits (533),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 99/158 (63%), Positives = 127/158 (80%), Gaps = 2/158 (1%)
 Frame = -3

Query  692  QKGGAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRR  513
            ++GG+ F HGNIKSSN+LL  + D  +SD GL  L N+++  S R  GYRAPEV  ETR+
Sbjct  440  EQGGSNFVHGNIKSSNILLKKNYDAAVSDFGLAQLFNSSSAAS-RIVGYRAPEV-AETRK  497

Query  512  VTQKSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQ  333
             TQ+SDVYSFGV++LE+LTGK+    + +D+ +DLPRWV+SVVREEWTAEVFD+ELM+YQ
Sbjct  498  STQRSDVYSFGVLLLELLTGKAPTQASLNDEGIDLPRWVQSVVREEWTAEVFDLELMRYQ  557

Query  332  NIEEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIR  219
            NIEEEMVQ+LQ+A++CVA +PD RP M +VVR IE IR
Sbjct  558  NIEEEMVQLLQVAMACVATSPDQRPKMKDVVRMIEDIR  595



>gb|EMT09037.1| Putative inactive receptor kinase [Aegilops tauschii]
Length=637

 Score =   209 bits (533),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 102/172 (59%), Positives = 130/172 (76%), Gaps = 4/172 (2%)
 Frame = -3

Query  689  KGGAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRV  510
            +GGAK THGNIKS+NVL+    +  +SD GL  LMN   + S    GYRAPE  +E R+ 
Sbjct  460  EGGAKLTHGNIKSTNVLVGQDQNAYVSDYGLSSLMNAPVSASRVVVGYRAPET-IENRKS  518

Query  509  TQKSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQN  330
            TQKSDVY FGV+++EMLTGK+ +   G+DDVVDLPRWV SVVREEWTAEVFD+ELMK+QN
Sbjct  519  TQKSDVYCFGVLLMEMLTGKAPLQSQGNDDVVDLPRWVHSVVREEWTAEVFDIELMKHQN  578

Query  329  IEEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEPQPSSDD  174
            IEEE+VQMLQ+A++C +  P+ RP M EV+R IEG+R    + +E + SSD+
Sbjct  579  IEEELVQMLQVAMACTSGPPERRPAMEEVIRMIEGLR---HSASESRASSDE  627



>ref|NP_187480.1| leucine-rich repeat protein kinase family protein [Arabidopsis 
thaliana]
 ref|NP_974257.1| leucine-rich repeat protein kinase family protein [Arabidopsis 
thaliana]
 sp|Q9C9Y8.1|Y3868_ARATH RecName: Full=Probable inactive receptor kinase At3g08680; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAG51359.1|AC012562_20 putative protein kinase; 49514-51513 [Arabidopsis thaliana]
 gb|ACN59313.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AEE74662.1| leucine-rich repeat protein kinase family protein [Arabidopsis 
thaliana]
 gb|AEE74663.1| leucine-rich repeat protein kinase family protein [Arabidopsis 
thaliana]
Length=640

 Score =   209 bits (533),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 105/171 (61%), Positives = 126/171 (74%), Gaps = 6/171 (4%)
 Frame = -3

Query  683  GAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRVTQ  504
            GAK  HGNIKS NVLLT  +  C+SD G+ PLM++      R  GYRAPE  +ETR+ TQ
Sbjct  461  GAKLLHGNIKSPNVLLTQELHVCVSDFGIAPLMSHHTLIPSRSLGYRAPEA-IETRKHTQ  519

Query  503  KSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQ-NI  327
            KSDVYSFGV++LEMLTGK+A    GH++VVDLP+WV+SVVREEWT EVFDVEL+K Q N+
Sbjct  520  KSDVYSFGVLLLEMLTGKAAGKTTGHEEVVDLPKWVQSVVREEWTGEVFDVELIKQQHNV  579

Query  326  EEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIR----GPAETETEPQP  186
            EEEMVQMLQIA++CV+K PD RP+M EVV  +E IR    GP        P
Sbjct  580  EEEMVQMLQIAMACVSKHPDSRPSMEEVVNMMEEIRPSGSGPGSGNRASSP  630



>gb|ACN57547.1| At2g26730-like protein, partial [Capsella grandiflora]
 gb|ACN57549.1| At2g26730-like protein, partial [Capsella grandiflora]
 gb|ACN57551.1| At2g26730-like protein, partial [Capsella grandiflora]
Length=187

 Score =   197 bits (502),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 101/174 (58%), Positives = 127/174 (73%), Gaps = 2/174 (1%)
 Frame = -3

Query  680  AKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRVTQK  501
            AK  HGNIK+SN+LL  + D C SD GL  L +N++  + R  GY APEV  ETR+VT K
Sbjct  11   AKLVHGNIKASNILLHPNQDTCXSDYGLNQLFSNSSPPN-RLAGYHAPEVL-ETRKVTFK  68

Query  500  SDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQNIEE  321
            SDVYSFGV++LE+LTGKS    +  ++ +DLPRWV SVVREEWTAEVFDVELM+Y NIEE
Sbjct  69   SDVYSFGVLLLELLTGKSPNQASLGEEGIDLPRWVLSVVREEWTAEVFDVELMRYHNIEE  128

Query  320  EMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEPQPSSDDNNGGT  159
            EMVQ+LQIA++CV+  PD RP M EV+R IE +     T+   + SSDD + G+
Sbjct  129  EMVQLLQIAMTCVSTVPDQRPVMQEVLRMIEDVNRSETTDDGLRQSSDDPSKGS  182



>ref|XP_009362808.1| PREDICTED: LOW QUALITY PROTEIN: probable inactive receptor kinase 
At3g08680 [Pyrus x bretschneideri]
Length=530

 Score =   207 bits (527),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 103/169 (61%), Positives = 128/169 (76%), Gaps = 2/169 (1%)
 Frame = -3

Query  695  IQKGGAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETR  516
            I   GAK +H NIKS+NVLLT  ++ CISD+GL PLMN     S R  GYRAPE  ++ R
Sbjct  362  IHSEGAKSSHDNIKSTNVLLTQELEACISDVGLSPLMNFPPAMS-RAMGYRAPEA-IDMR  419

Query  515  RVTQKSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKY  336
            ++T KSDVYSFGV++LEMLTGK+ +    +D VVDLPRWV+SVVREEWTAEVFD+EL+K 
Sbjct  420  KITHKSDVYSFGVLLLEMLTGKTTLQYPSYDCVVDLPRWVKSVVREEWTAEVFDLELLKQ  479

Query  335  QNIEEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEPQ  189
            Q+ EEEMVQM+QIAL+CV K P+ RP M  VVR IE +R  +E+E + Q
Sbjct  480  QHSEEEMVQMVQIALACVTKLPETRPNMDAVVRMIEELRQSSESEFDVQ  528



>gb|KDP25339.1| hypothetical protein JCGZ_20495 [Jatropha curcas]
Length=627

 Score =   209 bits (532),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 101/172 (59%), Positives = 127/172 (74%), Gaps = 4/172 (2%)
 Frame = -3

Query  689  KGGAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRV  510
            + G KF HGNIKSSN+ L +   GC+SD+GL  +M+  A    R  GYRAPEV  +TR+ 
Sbjct  443  ENGGKFVHGNIKSSNIFLNSRHYGCVSDLGLSAIMSQLAPPISRAAGYRAPEV-TDTRKA  501

Query  509  TQKSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQN  330
             Q SDVYSFGVV+LE+LTGKS +   G D+++ L RWV SVVREEWTAEVFDVELM++ N
Sbjct  502  AQPSDVYSFGVVLLELLTGKSPIHTTGGDEIIHLVRWVHSVVREEWTAEVFDVELMRFPN  561

Query  329  IEEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEPQPSSDD  174
            IEEEMV+MLQIALSCV + PD RP M +VV+ IE +R     +TE +PSS++
Sbjct  562  IEEEMVEMLQIALSCVVRMPDQRPKMQDVVKMIENVR---RVDTENRPSSEN  610



>ref|XP_006407752.1| hypothetical protein EUTSA_v10020278mg [Eutrema salsugineum]
 gb|ESQ49205.1| hypothetical protein EUTSA_v10020278mg [Eutrema salsugineum]
Length=639

 Score =   209 bits (532),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 105/172 (61%), Positives = 126/172 (73%), Gaps = 7/172 (4%)
 Frame = -3

Query  683  GAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRVTQ  504
            GAK  HGNIKS NVLLT  +  C+SD G+ PLM++      R  GYRAPE  +ETR+ TQ
Sbjct  459  GAKLLHGNIKSPNVLLTQDLHVCVSDFGIAPLMSHHTLLPSRSLGYRAPEA-IETRKHTQ  517

Query  503  KSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQ-NI  327
            KSDVYSFGV++LEMLTGK+A    GH++VVDLP+WV+SVVREEWT EVFDVEL+K Q N+
Sbjct  518  KSDVYSFGVLLLEMLTGKAAGKTTGHEEVVDLPKWVQSVVREEWTGEVFDVELIKQQHNV  577

Query  326  EEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIR-----GPAETETEPQP  186
            EEEMVQMLQIA++CV+K PD RP+M EVV  +E IR     GP        P
Sbjct  578  EEEMVQMLQIAMACVSKHPDSRPSMEEVVNMMEEIRPSTGSGPGSANRASSP  629



>ref|XP_010464477.1| PREDICTED: probable inactive receptor kinase At3g08680 [Camelina 
sativa]
Length=638

 Score =   209 bits (532),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 105/171 (61%), Positives = 126/171 (74%), Gaps = 6/171 (4%)
 Frame = -3

Query  683  GAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRVTQ  504
            GAK  HGNIKS NVLLT  +  C+SD G+ PLM++      R  GYRAPE  +ETR+ T+
Sbjct  459  GAKLLHGNIKSPNVLLTQDLHVCVSDFGIAPLMSHHTLIPSRSLGYRAPEA-IETRKHTK  517

Query  503  KSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQ-NI  327
            KSDVYSFGV++LEMLTGK+A    GH++VVDLP+WV+SVVREEWT EVFDVEL+K Q N+
Sbjct  518  KSDVYSFGVLLLEMLTGKAAGKTTGHEEVVDLPKWVQSVVREEWTGEVFDVELIKQQHNV  577

Query  326  EEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIR----GPAETETEPQP  186
            EEEMVQMLQIA++CV+K PD RP+M EVV  IE IR    GP        P
Sbjct  578  EEEMVQMLQIAMACVSKHPDTRPSMEEVVNMIEEIRPTGSGPGSGNRASSP  628



>ref|XP_009362770.1| PREDICTED: probable inactive receptor kinase At5g58300 [Pyrus 
x bretschneideri]
Length=654

 Score =   209 bits (532),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 109/180 (61%), Positives = 133/180 (74%), Gaps = 4/180 (2%)
 Frame = -3

Query  695  IQKGGAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETR  516
            I   GAK +HGNIKS+NVLLT  ++ CISD+GL PLMN     S R  GYRAPE  ++ R
Sbjct  479  IHSEGAKSSHGNIKSTNVLLTQELEACISDVGLSPLMNFPPAMS-RAMGYRAPEA-IDMR  536

Query  515  RVTQKSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKY  336
            ++T KSDVYSFGV++LEMLTGK  +    +D VVDLPRWV+SVVREEWTAE FD+EL+K 
Sbjct  537  KITHKSDVYSFGVLLLEMLTGKITLQYPSYDCVVDLPRWVKSVVREEWTAEAFDLELLKQ  596

Query  335  QNIEEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEPQPSSDDNNGGTP  156
            Q+ EEEMVQMLQIAL+CV K P+ RP M EVVR IE +R  ++T+T  Q S  + N  TP
Sbjct  597  QHSEEEMVQMLQIALACVTKLPETRPNMEEVVRMIEELR-QSDTKTR-QSSESEFNVQTP  654



>ref|NP_196135.1| putative leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 sp|Q9FHK7.1|Y5516_ARATH RecName: Full=Probable leucine-rich repeat receptor-like protein 
kinase At5g05160; Flags: Precursor [Arabidopsis thaliana]
 dbj|BAB09692.1| receptor-like protein kinase [Arabidopsis thaliana]
 gb|ACN59361.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AED90835.1| putative leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
Length=640

 Score =   208 bits (529),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 103/156 (66%), Positives = 124/156 (79%), Gaps = 5/156 (3%)
 Frame = -3

Query  677  KFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRVTQKS  498
            KF HG+IKSSN+LLT  ++ C+SD  L  L N   T +PR  GY APEV +ETRRV+Q+S
Sbjct  464  KFVHGDIKSSNILLTEDLEPCLSDTSLVTLFN-LPTHTPRTIGYNAPEV-IETRRVSQRS  521

Query  497  DVYSFGVVVLEMLTGKSAVPVAGHDD---VVDLPRWVRSVVREEWTAEVFDVELMKYQNI  327
            DVYSFGVV+LEMLTGK+ +   G +D   V+DLPRWVRSVVREEWTAEVFDVEL+K+QNI
Sbjct  522  DVYSFGVVILEMLTGKTPLTQPGLEDERVVIDLPRWVRSVVREEWTAEVFDVELLKFQNI  581

Query  326  EEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIR  219
            EEEMVQMLQ+AL+CVA+ P+ RP M EV R IE +R
Sbjct  582  EEEMVQMLQLALACVARNPESRPKMEEVARMIEDVR  617



>ref|XP_006650037.1| PREDICTED: probable inactive receptor kinase At5g58300-like [Oryza 
brachyantha]
Length=635

 Score =   207 bits (528),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 105/185 (57%), Positives = 135/185 (73%), Gaps = 11/185 (6%)
 Frame = -3

Query  689  KGGAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRV  510
            +GG+K THGNIKS+NVLL       +SD GL  LM+   +TS    GYRAPE  +E+R+ 
Sbjct  457  EGGSKLTHGNIKSTNVLLDQDHSPYVSDYGLGALMSFPVSTSRVVVGYRAPEA-IESRKF  515

Query  509  TQKSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQN  330
            T KSDVYSFGV+++EMLTGK+ +   G DDVVDLPRWV SVVREEWTAEVFDVELMKY N
Sbjct  516  THKSDVYSFGVLLMEMLTGKAPLQSQGQDDVVDLPRWVHSVVREEWTAEVFDVELMKYLN  575

Query  329  IEEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEPQPSSDDNNGGTPE*  150
            IE+E+VQMLQ+A++C +++PD RPTMA+V+  IE +R   ++  E + SS++N       
Sbjct  576  IEDELVQMLQLAMACTSRSPDRRPTMAQVISVIEELR---QSAPESRESSNENG------  626

Query  149  ICHES  135
             C ES
Sbjct  627  -CRES  630



>ref|XP_002871141.1| hypothetical protein ARALYDRAFT_325150 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47400.1| hypothetical protein ARALYDRAFT_325150 [Arabidopsis lyrata subsp. 
lyrata]
Length=638

 Score =   207 bits (528),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 103/156 (66%), Positives = 124/156 (79%), Gaps = 5/156 (3%)
 Frame = -3

Query  677  KFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRVTQKS  498
            KF HG+IKSSN+LLT  ++ C+SD  L  L N   T +PR  GY APEV +ETRRV+Q+S
Sbjct  462  KFVHGDIKSSNILLTEDLEPCLSDTSLVTLFN-LPTHTPRTIGYNAPEV-IETRRVSQRS  519

Query  497  DVYSFGVVVLEMLTGKSAVPVAGHDD---VVDLPRWVRSVVREEWTAEVFDVELMKYQNI  327
            DVYSFGVV+LEMLTGK+ +   G +D   V+DLPRWVRSVVREEWTAEVFDVEL+K+QNI
Sbjct  520  DVYSFGVVILEMLTGKTPLTQPGLEDERVVIDLPRWVRSVVREEWTAEVFDVELLKFQNI  579

Query  326  EEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIR  219
            EEEMVQMLQ+AL+CVA+ P+ RP M EV R IE +R
Sbjct  580  EEEMVQMLQLALACVARNPESRPKMEEVARMIEDVR  615



>gb|KHN16761.1| Putative inactive receptor kinase [Glycine soja]
Length=369

 Score =   201 bits (512),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 97/172 (56%), Positives = 122/172 (71%), Gaps = 6/172 (3%)
 Frame = -3

Query  683  GAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRVTQ  504
            G K  HGNIK SN+ L +   GC+SD+GL  + ++ A    R  GYRAPEV  +TR+  Q
Sbjct  177  GGKLVHGNIKCSNIFLNSKQYGCVSDLGLATISSSLALPISRAAGYRAPEV-TDTRKAAQ  235

Query  503  KSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQNIE  324
             SDVYSFGVV+LE+LTGKS +   G D+++ L RWV SVVREEWTAEVFD+ELM+Y NIE
Sbjct  236  PSDVYSFGVVLLELLTGKSPIHTTGGDEIIHLVRWVHSVVREEWTAEVFDLELMRYPNIE  295

Query  323  EEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEPQPSSDDNN  168
            EEMV+MLQIA+SCV + PD RP M+EVV+ IE +R     +T+ Q  S   N
Sbjct  296  EEMVEMLQIAMSCVVRMPDQRPKMSEVVKMIENVR-----QTDAQTHSSSGN  342



>emb|CDY27986.1| BnaC05g43880D [Brassica napus]
Length=631

 Score =   207 bits (528),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 99/156 (63%), Positives = 123/156 (79%), Gaps = 2/156 (1%)
 Frame = -3

Query  683  GAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRVTQ  504
            GAK  HGNIKS NVLL   ++ C+SD G+ PLM++      R  GYRAPE  +ETR+ TQ
Sbjct  451  GAKLLHGNIKSPNVLLMQDLNACVSDYGIAPLMSHHTLLPSRSLGYRAPEA-IETRKHTQ  509

Query  503  KSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQ-NI  327
            KSDVYSFGV++LEMLTGK+A    GH++VVDLP+WV+SVVREEWT EVFDVEL+K Q N+
Sbjct  510  KSDVYSFGVLLLEMLTGKAAGKTTGHEEVVDLPKWVQSVVREEWTGEVFDVELIKQQHNV  569

Query  326  EEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIR  219
            EEEMVQMLQ+A++CV+K PD RP+M EVV  +E +R
Sbjct  570  EEEMVQMLQVAMACVSKHPDSRPSMEEVVNMMEEVR  605



>gb|ACN57550.1| At2g26730-like protein, partial [Capsella grandiflora]
Length=187

 Score =   196 bits (497),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 100/174 (57%), Positives = 126/174 (72%), Gaps = 2/174 (1%)
 Frame = -3

Query  680  AKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRVTQK  501
            AK  HGNIK+SN+LL  + D C  D GL  L +N++  + R  GY APEV  ETR+VT K
Sbjct  11   AKLVHGNIKASNILLHPNQDTCXXDYGLNQLFSNSSPPN-RLAGYHAPEVL-ETRKVTFK  68

Query  500  SDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQNIEE  321
            SDVYSFGV++LE+LTGKS    +  ++ +DLPRWV SVVREEWTAEVFDVELM+Y NIEE
Sbjct  69   SDVYSFGVLLLELLTGKSPNQASLGEEGIDLPRWVLSVVREEWTAEVFDVELMRYHNIEE  128

Query  320  EMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEPQPSSDDNNGGT  159
            EMVQ+LQIA++CV+  PD RP M EV+R IE +     T+   + SSDD + G+
Sbjct  129  EMVQLLQIAMTCVSTVPDQRPVMQEVLRMIEDVNRSETTDDGLRQSSDDPSKGS  182



>ref|XP_009122125.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g05160 [Brassica rapa]
 emb|CDX70172.1| BnaA10g25210D [Brassica napus]
Length=624

 Score =   207 bits (527),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 103/156 (66%), Positives = 124/156 (79%), Gaps = 5/156 (3%)
 Frame = -3

Query  677  KFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRVTQKS  498
            KF HG+IKSSN+LLT  ++ C+SD  L  L N   T +PR  GY APEV +ET+RV+Q+S
Sbjct  451  KFVHGDIKSSNILLTDDLEPCLSDTCLVTLFN-LPTYTPRTIGYNAPEV-IETKRVSQRS  508

Query  497  DVYSFGVVVLEMLTGKSAVPVAGHDD---VVDLPRWVRSVVREEWTAEVFDVELMKYQNI  327
            DVYSFGVV+LEMLTGK+ +   G +D   V+DLPRWVRSVVREEWTAEVFDVEL+KYQNI
Sbjct  509  DVYSFGVVILEMLTGKTPLTQPGLEDERVVIDLPRWVRSVVREEWTAEVFDVELLKYQNI  568

Query  326  EEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIR  219
            EEEMVQMLQ+AL+CVA+ P+ RP M EV R IE +R
Sbjct  569  EEEMVQMLQLALACVARNPESRPKMDEVARMIEDVR  604



>gb|AES98409.2| LRR receptor-like kinase [Medicago truncatula]
Length=604

 Score =   207 bits (526),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 105/163 (64%), Positives = 132/163 (81%), Gaps = 5/163 (3%)
 Frame = -3

Query  692  QKGGAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRR  513
            ++GG KF HGN+KS+NVL+T  +DGCI+D+GL PLMN  +T S R  GYRAPEV +E+R+
Sbjct  430  KEGGPKFIHGNVKSTNVLVTQELDGCIADVGLTPLMNTLSTMS-RSNGYRAPEV-IESRK  487

Query  512  V-TQKSDVYSFGVVVLEMLTGKSAVPVAGHD-DVVDLPRWVRSVVREEWTAEVFDVELMK  339
            + TQKSDVYSFGV++LEMLTGK  +  +G++ D+VDLPRWVRSVV EEWTAEVFD E+++
Sbjct  488  IATQKSDVYSFGVILLEMLTGKIPLGYSGYEHDMVDLPRWVRSVVHEEWTAEVFDEEMIR  547

Query  338  -YQNIEEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGP  213
              + +EEEMVQMLQIAL+CVAK  D RPTM EVVR +  IR P
Sbjct  548  GGEYVEEEMVQMLQIALACVAKVVDNRPTMDEVVRNMAEIRHP  590



>gb|EEE55588.1| hypothetical protein OsJ_03884 [Oryza sativa Japonica Group]
Length=251

 Score =   197 bits (502),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 100/178 (56%), Positives = 131/178 (74%), Gaps = 4/178 (2%)
 Frame = -3

Query  689  KGGAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRV  510
            +GG KF HGN+KSSN+LL+ ++DGC+S+ GL  LM      + R  GYRAPEV  ET++ 
Sbjct  75   EGGGKFIHGNLKSSNILLSQNLDGCVSEFGLAQLMTIPPAPA-RLVGYRAPEVL-ETKKP  132

Query  509  TQKSDVYSFGVVVLEMLTGKSAVPVAGHDDVVD-LPRWVRSVVREEWTAEVFDVELMKYQ  333
            TQKSDVYSFGV+VLEMLTGK+ +   G +D ++ LPRWV+SVVREEWTAEVFDV+L+++ 
Sbjct  133  TQKSDVYSFGVLVLEMLTGKAPLRSPGREDSIEHLPRWVQSVVREEWTAEVFDVDLLRHP  192

Query  332  NIEEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGP-AETETEPQPSSDDNNGG  162
            NIE+EMVQMLQ+A++CVA  PD RP M EV+R I  IR   + + T P+    D +  
Sbjct  193  NIEDEMVQMLQVAMACVAAPPDQRPKMDEVIRRIVEIRNSYSGSRTPPEEKQKDESAA  250



>emb|CDX98821.1| BnaC09g50140D [Brassica napus]
Length=628

 Score =   207 bits (526),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 103/156 (66%), Positives = 124/156 (79%), Gaps = 5/156 (3%)
 Frame = -3

Query  677  KFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRVTQKS  498
            KF HG+IKSSN+LLT  ++ C+SD  L  L N   T +PR  GY APEV +ET+RV+Q+S
Sbjct  455  KFVHGDIKSSNILLTDDLEPCLSDTCLVTLFN-LPTYTPRTIGYNAPEV-IETKRVSQRS  512

Query  497  DVYSFGVVVLEMLTGKSAVPVAGHDD---VVDLPRWVRSVVREEWTAEVFDVELMKYQNI  327
            DVYSFGVV+LEMLTGK+ +   G +D   V+DLPRWVRSVVREEWTAEVFDVEL+KYQNI
Sbjct  513  DVYSFGVVILEMLTGKTPLTQPGLEDERVVIDLPRWVRSVVREEWTAEVFDVELLKYQNI  572

Query  326  EEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIR  219
            EEEMVQMLQ+AL+CVA+ P+ RP M EV R IE +R
Sbjct  573  EEEMVQMLQLALACVARNPESRPKMDEVARMIEDVR  608



>ref|XP_002509916.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF51303.1| ATP binding protein, putative [Ricinus communis]
Length=536

 Score =   205 bits (521),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 99/172 (58%), Positives = 127/172 (74%), Gaps = 4/172 (2%)
 Frame = -3

Query  689  KGGAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRV  510
            + G KF HGNIKSSN+ L +   GC+SD+GL  +M+  A    R  GYRAPEV  +TR+ 
Sbjct  351  ENGGKFVHGNIKSSNIFLNSRQYGCVSDLGLSTIMSPLAAPISRAAGYRAPEV-TDTRKA  409

Query  509  TQKSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQN  330
             Q +DVYSFGVV+LE+LTGKS +   G D+++ L RWV SVVREEWTAEVFDVELM++ N
Sbjct  410  GQPADVYSFGVVLLELLTGKSPIHTTGGDEIIHLVRWVHSVVREEWTAEVFDVELMRFPN  469

Query  329  IEEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEPQPSSDD  174
            IEEEMV+MLQIALSCV + PD RP M +VV+ IE +R     +T+ +PSS++
Sbjct  470  IEEEMVEMLQIALSCVVRIPDQRPKMPDVVKMIESVR---RIDTDNRPSSEN  518



>ref|XP_003615451.1| Leucine-rich repeat receptor-like protein kinase [Medicago truncatula]
Length=658

 Score =   207 bits (526),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 105/163 (64%), Positives = 132/163 (81%), Gaps = 5/163 (3%)
 Frame = -3

Query  692  QKGGAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRR  513
            ++GG KF HGN+KS+NVL+T  +DGCI+D+GL PLMN  +T S R  GYRAPEV +E+R+
Sbjct  484  KEGGPKFIHGNVKSTNVLVTQELDGCIADVGLTPLMNTLSTMS-RSNGYRAPEV-IESRK  541

Query  512  V-TQKSDVYSFGVVVLEMLTGKSAVPVAGHD-DVVDLPRWVRSVVREEWTAEVFDVELMK  339
            + TQKSDVYSFGV++LEMLTGK  +  +G++ D+VDLPRWVRSVV EEWTAEVFD E+++
Sbjct  542  IATQKSDVYSFGVILLEMLTGKIPLGYSGYEHDMVDLPRWVRSVVHEEWTAEVFDEEMIR  601

Query  338  -YQNIEEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGP  213
              + +EEEMVQMLQIAL+CVAK  D RPTM EVVR +  IR P
Sbjct  602  GGEYVEEEMVQMLQIALACVAKVVDNRPTMDEVVRNMAEIRHP  644



>emb|CDY22164.1| BnaC01g39370D [Brassica napus]
Length=565

 Score =   205 bits (521),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 101/156 (65%), Positives = 123/156 (79%), Gaps = 2/156 (1%)
 Frame = -3

Query  683  GAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRVTQ  504
            GAK  HGNIKS NVLLT  ++ C+SD G+ PLM++ A  S R  GY APE  +ETR+ T 
Sbjct  235  GAKLLHGNIKSPNVLLTQDLNACVSDYGIAPLMSHHAFLSSRSLGYIAPEA-IETRQHTH  293

Query  503  KSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQ-NI  327
            KSD+YSFGV++LEMLTGK+A   AGH++VVDLP+WV+SVVREEWT EVFDVEL+K Q N 
Sbjct  294  KSDMYSFGVLLLEMLTGKAAGKTAGHEEVVDLPKWVQSVVREEWTGEVFDVELIKQQHNA  353

Query  326  EEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIR  219
            EEEMVQ LQIA++CV+K PD RP+M EVV  +E IR
Sbjct  354  EEEMVQTLQIAMACVSKHPDSRPSMEEVVNMMEEIR  389



>dbj|BAK07296.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=637

 Score =   206 bits (524),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 102/172 (59%), Positives = 130/172 (76%), Gaps = 4/172 (2%)
 Frame = -3

Query  689  KGGAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRV  510
            +GGAK THGNIKS+NVL+    +  +SD GL  LM+   + S    GYRAPE  +E R+ 
Sbjct  460  EGGAKLTHGNIKSTNVLVDQDHNPYVSDYGLSSLMSPPVSASRVVVGYRAPET-IENRKS  518

Query  509  TQKSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQN  330
            TQKSDVY FGV+++EMLTGK+ +   G+DDVVDLPRWV SVVREEWTAEVFD+ELMK+QN
Sbjct  519  TQKSDVYCFGVLLMEMLTGKAPLQSQGNDDVVDLPRWVHSVVREEWTAEVFDIELMKHQN  578

Query  329  IEEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEPQPSSDD  174
            IEEE+VQMLQ+A++C +  P+ RP M EV+R IEG+R  A   +E + SSD+
Sbjct  579  IEEELVQMLQVAMACTSGPPERRPAMEEVIRMIEGLRHSA---SESRASSDE  627



>ref|XP_002303623.1| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
 gb|EEE78602.1| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
Length=626

 Score =   206 bits (524),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 102/178 (57%), Positives = 127/178 (71%), Gaps = 3/178 (2%)
 Frame = -3

Query  689  KGGAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRV  510
            + G KF HGNIKSSN+ L +   GC+SD+GL  + ++ A    R  GYRAPEV  +TR+ 
Sbjct  443  ENGGKFVHGNIKSSNIFLNSRCYGCVSDLGLVTITSSLAPPIARAAGYRAPEV-ADTRKA  501

Query  509  TQKSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQN  330
             Q SD+YSFGVV+LE+LTGKS +   G D+++ L RWV SVVREEWTAEVFDVELM+Y N
Sbjct  502  AQPSDIYSFGVVLLELLTGKSPIHTTGSDEIIHLVRWVHSVVREEWTAEVFDVELMRYPN  561

Query  329  IEEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEPQPSSDDNNGGTP  156
            IEEEMV+MLQIA+SCV + PD RP M EVV+ IE +R   +TE   QPS   +   TP
Sbjct  562  IEEEMVEMLQIAMSCVVRMPDQRPKMTEVVKMIENVR-QIDTENH-QPSESRSESSTP  617



>gb|KFK24939.1| hypothetical protein AALP_AA8G045400 [Arabis alpina]
Length=630

 Score =   206 bits (524),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 102/156 (65%), Positives = 124/156 (79%), Gaps = 5/156 (3%)
 Frame = -3

Query  677  KFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRVTQKS  498
            +F HG+IKSSN+LLT  ++ C+SD  L  L N   T +PR  GY APEV +ETRRV+Q+S
Sbjct  454  RFVHGDIKSSNILLTQDLEPCLSDTCLVTLFN-LPTHTPRTIGYNAPEV-IETRRVSQRS  511

Query  497  DVYSFGVVVLEMLTGKSAVPVAGHDD---VVDLPRWVRSVVREEWTAEVFDVELMKYQNI  327
            DVYSFGVV+LEMLTGK+ +   G +D   V+DLPRWVRSVVREEWTAEVFDVEL+KYQNI
Sbjct  512  DVYSFGVVLLEMLTGKTPLTQPGLEDESVVIDLPRWVRSVVREEWTAEVFDVELLKYQNI  571

Query  326  EEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIR  219
            EEEMVQMLQ+AL+CV++ P+ RP M EV R IE +R
Sbjct  572  EEEMVQMLQLALACVSRNPESRPKMEEVARMIEDVR  607



>dbj|BAJ93317.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=637

 Score =   206 bits (524),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 102/172 (59%), Positives = 130/172 (76%), Gaps = 4/172 (2%)
 Frame = -3

Query  689  KGGAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRV  510
            +GGAK THGNIKS+NVL+    +  +SD GL  LM+   + S    GYRAPE  +E R+ 
Sbjct  460  EGGAKLTHGNIKSTNVLVDQDHNPYVSDYGLSSLMSPPVSASRVVVGYRAPET-IENRKS  518

Query  509  TQKSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQN  330
            TQKSDVY FGV+++EMLTGK+ +   G+DDVVDLPRWV SVVREEWTAEVFD+ELMK+QN
Sbjct  519  TQKSDVYCFGVLLMEMLTGKAPLQSQGNDDVVDLPRWVHSVVREEWTAEVFDIELMKHQN  578

Query  329  IEEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEPQPSSDD  174
            IEEE+VQMLQ+A++C +  P+ RP M EV+R IEG+R  A   +E + SSD+
Sbjct  579  IEEELVQMLQVAMACTSGPPERRPAMEEVIRMIEGLRHSA---SESRASSDE  627



>ref|XP_006398978.1| hypothetical protein EUTSA_v10012946mg [Eutrema salsugineum]
 gb|ESQ40431.1| hypothetical protein EUTSA_v10012946mg [Eutrema salsugineum]
Length=639

 Score =   206 bits (524),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 103/156 (66%), Positives = 124/156 (79%), Gaps = 5/156 (3%)
 Frame = -3

Query  677  KFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRVTQKS  498
            KF HG+IKSSN+LLT  ++ C+SD  L  L N   T +PR  GY APEV +ET+RV+Q+S
Sbjct  466  KFVHGDIKSSNILLTEDLEPCLSDTCLATLFN-LPTHTPRTIGYNAPEV-IETKRVSQRS  523

Query  497  DVYSFGVVVLEMLTGKSAVPVAGHDD---VVDLPRWVRSVVREEWTAEVFDVELMKYQNI  327
            DVYSFGVV+LEMLTGK+ +   G +D   VVDLPRWVRSVVREEWTAEVFDVEL+KYQNI
Sbjct  524  DVYSFGVVILEMLTGKAPLTQPGLEDERVVVDLPRWVRSVVREEWTAEVFDVELLKYQNI  583

Query  326  EEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIR  219
            EEEMVQMLQ+AL+CVA+ P+ RP M EV R I+ +R
Sbjct  584  EEEMVQMLQLALACVARNPESRPRMEEVARMIQEVR  619



>ref|XP_006590496.1| PREDICTED: probable inactive receptor kinase At4g23740-like [Glycine 
max]
Length=589

 Score =   205 bits (521),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 98/172 (57%), Positives = 125/172 (73%), Gaps = 1/172 (1%)
 Frame = -3

Query  689  KGGAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRV  510
            + G K  HGNI+SSN+ L +   GC+SD+GL  +M++ A    R  GYRAPEV  +TR+ 
Sbjct  407  ENGGKLVHGNIRSSNIFLNSKQYGCVSDLGLATIMSSVAIPISRAAGYRAPEV-TDTRKA  465

Query  509  TQKSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQN  330
            TQ SDVYSFGVV+LE+LTGKS V   G D++V L RWV SVVREEWTAEVFD+EL++Y N
Sbjct  466  TQPSDVYSFGVVLLELLTGKSPVYTTGADEIVHLVRWVHSVVREEWTAEVFDLELIRYPN  525

Query  329  IEEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEPQPSSDD  174
            IEEEMV+MLQIA+SCV + PD RP M E+V+ IE +R       +P  SS++
Sbjct  526  IEEEMVEMLQIAMSCVVRLPDQRPKMLELVKMIESVRQIEIVVNQPSISSEN  577



>ref|XP_009399835.1| PREDICTED: probable inactive receptor kinase At4g23740 isoform 
X2 [Musa acuminata subsp. malaccensis]
 ref|XP_009399836.1| PREDICTED: probable inactive receptor kinase At4g23740 isoform 
X3 [Musa acuminata subsp. malaccensis]
Length=651

 Score =   206 bits (523),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 100/155 (65%), Positives = 122/155 (79%), Gaps = 2/155 (1%)
 Frame = -3

Query  680  AKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRVTQK  501
             K  HGNIKSSNV L     GC+SD+GL  ++N  A   PR  GYRAPEV  +T++ +Q 
Sbjct  451  GKLVHGNIKSSNVFLNNQQYGCVSDLGLPSIINPMAPLVPRTVGYRAPEV-TDTKKASQA  509

Query  500  SDVYSFGVVVLEMLTGKSAVPVAGH-DDVVDLPRWVRSVVREEWTAEVFDVELMKYQNIE  324
            SDVYSFGVV+LE+LTGKS VP+ G  D+V+ L RWV+SVVREEWTAEVFDVELM+Y NIE
Sbjct  510  SDVYSFGVVMLELLTGKSPVPIVGSGDEVIHLVRWVQSVVREEWTAEVFDVELMRYPNIE  569

Query  323  EEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIR  219
            EEMV+MLQIA++CVA+ P+ RP MA+VVR IEG+R
Sbjct  570  EEMVEMLQIAMNCVARVPERRPKMAQVVRMIEGVR  604



>gb|KEH35437.1| receptor-like kinase [Medicago truncatula]
Length=347

 Score =   199 bits (505),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 99/177 (56%), Positives = 127/177 (72%), Gaps = 5/177 (3%)
 Frame = -3

Query  701  MFIQKGGAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVE  522
            +  Q+GG K  HGNIK+SN+ L +   GC+SDIGL  LM++  +   R  GYRAPEV ++
Sbjct  170  IHTQQGG-KLVHGNIKASNIFLNSQGYGCVSDIGLVTLMSSIPSQGARATGYRAPEV-ID  227

Query  521  TRRVTQKSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELM  342
            TR+ T  SDVYSFGV++LE+LTGK  V     +  V L RWV+SVVREEWTAEVFD EL+
Sbjct  228  TRKATHSSDVYSFGVLLLELLTGKPPVYSTEGEQAVHLVRWVKSVVREEWTAEVFDTELL  287

Query  341  KYQNIEEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRG---PAETETEPQPSS  180
            +Y +IEEEMV+MLQI ++C A+ PD RP MAEVVR +EGIR    P+ TE+  Q S+
Sbjct  288  RYSSIEEEMVEMLQIGMACAARMPDQRPKMAEVVRMMEGIRHENRPSSTESGSQVST  344



>gb|EMT12910.1| Putative inactive receptor kinase [Aegilops tauschii]
Length=637

 Score =   205 bits (522),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 100/173 (58%), Positives = 130/173 (75%), Gaps = 3/173 (2%)
 Frame = -3

Query  689  KGGAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRV  510
            +GG K  HGNIKS+NVLL    +  +SD G+  LM+    TS    GYRAPE + E+R+ 
Sbjct  459  EGGPKLAHGNIKSTNVLLDQDHNPHVSDYGMSTLMSLPINTSRVVVGYRAPETY-ESRKF  517

Query  509  TQKSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQN  330
            T KSDVYSFGV+++EMLTGK+ +   G +DV+DLPRWV SVVREEWTAEVFDV LMKY N
Sbjct  518  THKSDVYSFGVLLMEMLTGKAPLQSQGQEDVIDLPRWVHSVVREEWTAEVFDVALMKYHN  577

Query  329  IEEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEPQPSSDDN  171
            IE+E+VQMLQ+A++C +++PD RPTMAEV+R IE +R    T +E + SS++N
Sbjct  578  IEDELVQMLQLAMACTSRSPDRRPTMAEVIRMIEDLR--QFTASESRASSNEN  628



>ref|XP_009399834.1| PREDICTED: probable inactive receptor kinase At4g23740 isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=666

 Score =   206 bits (523),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 100/155 (65%), Positives = 122/155 (79%), Gaps = 2/155 (1%)
 Frame = -3

Query  680  AKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRVTQK  501
             K  HGNIKSSNV L     GC+SD+GL  ++N  A   PR  GYRAPEV  +T++ +Q 
Sbjct  451  GKLVHGNIKSSNVFLNNQQYGCVSDLGLPSIINPMAPLVPRTVGYRAPEV-TDTKKASQA  509

Query  500  SDVYSFGVVVLEMLTGKSAVPVAGH-DDVVDLPRWVRSVVREEWTAEVFDVELMKYQNIE  324
            SDVYSFGVV+LE+LTGKS VP+ G  D+V+ L RWV+SVVREEWTAEVFDVELM+Y NIE
Sbjct  510  SDVYSFGVVMLELLTGKSPVPIVGSGDEVIHLVRWVQSVVREEWTAEVFDVELMRYPNIE  569

Query  323  EEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIR  219
            EEMV+MLQIA++CVA+ P+ RP MA+VVR IEG+R
Sbjct  570  EEMVEMLQIAMNCVARVPERRPKMAQVVRMIEGVR  604



>ref|NP_001168214.1| uncharacterized protein LOC100381972 [Zea mays]
 gb|ACN27473.1| unknown [Zea mays]
Length=254

 Score =   196 bits (497),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 94/158 (59%), Positives = 123/158 (78%), Gaps = 2/158 (1%)
 Frame = -3

Query  689  KGGAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRV  510
            +GG KF HGNIK+SNVLL+ ++DG +S+ GL  +M    T+ P+  GYRAPEV  ET++ 
Sbjct  75   EGGGKFIHGNIKASNVLLSQNLDGRVSEFGLAQIMTTPQTSLPQLVGYRAPEVL-ETKKT  133

Query  509  TQKSDVYSFGVVVLEMLTGKSAVPVAGHDDVVD-LPRWVRSVVREEWTAEVFDVELMKYQ  333
             QKSDVYSFGV++LEMLTGK+ +   G  D V+ LP+WVRSVVREEWTAE+FDV+L+++ 
Sbjct  134  IQKSDVYSFGVLLLEMLTGKAPLRSPGRKDSVEHLPKWVRSVVREEWTAEIFDVDLLRHP  193

Query  332  NIEEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIR  219
            N+E+EMVQMLQIA++CVA  P+ RP M EV+R I  IR
Sbjct  194  NVEDEMVQMLQIAMACVAADPEQRPRMDEVIRRITEIR  231



>ref|XP_007040424.1| Leucine-rich repeat protein kinase family protein isoform 1 [Theobroma 
cacao]
 ref|XP_007040425.1| Leucine-rich repeat protein kinase family protein isoform 1 [Theobroma 
cacao]
 ref|XP_007040426.1| Leucine-rich repeat protein kinase family protein isoform 1 [Theobroma 
cacao]
 gb|EOY24925.1| Leucine-rich repeat protein kinase family protein isoform 1 [Theobroma 
cacao]
 gb|EOY24926.1| Leucine-rich repeat protein kinase family protein isoform 1 [Theobroma 
cacao]
 gb|EOY24927.1| Leucine-rich repeat protein kinase family protein isoform 1 [Theobroma 
cacao]
Length=626

 Score =   205 bits (521),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 99/172 (58%), Positives = 126/172 (73%), Gaps = 4/172 (2%)
 Frame = -3

Query  689  KGGAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRV  510
            + G KF HGNIKSSN+ L +   GC+SD+GL  +M+  A    R  GYRAPEV  +TR+ 
Sbjct  443  ENGGKFVHGNIKSSNIFLNSEQYGCVSDLGLSTIMSPLAPPISRAAGYRAPEV-TDTRKA  501

Query  509  TQKSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQN  330
             Q SDVYSFGVV+LE+LTGKS +   G D++V L RWV SVVREEWTAEVFD+ELM+Y N
Sbjct  502  MQPSDVYSFGVVLLELLTGKSPIHTTGGDEIVHLVRWVHSVVREEWTAEVFDIELMRYPN  561

Query  329  IEEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEPQPSSDD  174
            IEEEMV+MLQIA++CV + PD RP M E+V+ +E +R     E+E +PSS +
Sbjct  562  IEEEMVEMLQIAMTCVVRMPDQRPKMPELVKMLENVR---HIESENRPSSGN  610



>ref|XP_009137362.1| PREDICTED: probable inactive receptor kinase At4g23740 [Brassica 
rapa]
Length=628

 Score =   205 bits (521),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 99/174 (57%), Positives = 128/174 (74%), Gaps = 2/174 (1%)
 Frame = -3

Query  692  QKGGAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRR  513
            Q+   K  HGNIKSSN+ L +  +GC+SD+GL  +M+  A    R+ GYRAPEV  +TR+
Sbjct  445  QENNGKLVHGNIKSSNIFLNSERNGCVSDLGLTAVMSALAPPISRQAGYRAPEV-TDTRK  503

Query  512  VTQKSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQ  333
             +Q SDVYSFGVV+LE+LTGKS +     D+++ L RWV SVVREEWTAEVFDVEL++Y 
Sbjct  504  SSQLSDVYSFGVVLLELLTGKSPIHTTAGDEIIHLVRWVHSVVREEWTAEVFDVELLRYT  563

Query  332  NIEEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRG-PAETETEPQPSSDD  174
            NIEEEMV+MLQIA+SCV KAPD RP M+++VR IE +    A    EP+P S++
Sbjct  564  NIEEEMVEMLQIAMSCVVKAPDQRPKMSDLVRLIESVGNRQASLGPEPKPKSEN  617



>ref|XP_003516715.2| PREDICTED: probable inactive receptor kinase At4g23740-like [Glycine 
max]
Length=635

 Score =   205 bits (521),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 98/172 (57%), Positives = 125/172 (73%), Gaps = 1/172 (1%)
 Frame = -3

Query  689  KGGAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRV  510
            + G K  HGNI+SSN+ L +   GC+SD+GL  +M++ A    R  GYRAPEV  +TR+ 
Sbjct  453  ENGGKLVHGNIRSSNIFLNSKQYGCVSDLGLATIMSSVAIPISRAAGYRAPEV-TDTRKA  511

Query  509  TQKSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQN  330
            TQ SDVYSFGVV+LE+LTGKS V   G D++V L RWV SVVREEWTAEVFD+EL++Y N
Sbjct  512  TQPSDVYSFGVVLLELLTGKSPVYTTGSDEIVHLVRWVHSVVREEWTAEVFDLELIRYPN  571

Query  329  IEEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEPQPSSDD  174
            IEEEMV+MLQIA+SCV + PD RP M E+V+ IE +R       +P  SS++
Sbjct  572  IEEEMVEMLQIAMSCVVRVPDQRPKMLELVKMIENVRQIEIVVNQPSISSEN  623



>ref|XP_009123870.1| PREDICTED: probable inactive receptor kinase At3g08680 [Brassica 
rapa]
 ref|XP_009123879.1| PREDICTED: probable inactive receptor kinase At3g08680 [Brassica 
rapa]
Length=618

 Score =   204 bits (520),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 105/180 (58%), Positives = 132/180 (73%), Gaps = 7/180 (4%)
 Frame = -3

Query  683  GAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRVTQ  504
            GAK  HGNIKS NVLLT  ++ C+SD  + PLM++      R  GYRAPE  +ETR+ T 
Sbjct  438  GAKLLHGNIKSPNVLLTQDLNACVSDYSIAPLMSHHTLLPSRSLGYRAPEA-IETRKHTH  496

Query  503  KSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQ-NI  327
            KSDVYSFGV++LEMLTGK+A   AGH+++VDLP+WV+SVVREEWT EVFDVEL+K Q N+
Sbjct  497  KSDVYSFGVLLLEMLTGKAAGKTAGHEELVDLPKWVQSVVREEWTGEVFDVELIKQQHNV  556

Query  326  EEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEPQPSSDDNNGGTPE*I  147
            EEEMVQ LQIA++CV++ PD RP+M EVV  +E IR  A T + P  +   N   +PE I
Sbjct  557  EEEMVQTLQIAMACVSRHPDSRPSMEEVVNMMEEIR--ASTGSGPGSA---NRASSPEMI  611



>emb|CDY47625.1| BnaA01g13400D [Brassica napus]
Length=662

 Score =   205 bits (522),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 99/174 (57%), Positives = 128/174 (74%), Gaps = 2/174 (1%)
 Frame = -3

Query  692  QKGGAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRR  513
            Q+   K  HGNIKSSN+ L +  +GC+SD+GL  +M+  A    R+ GYRAPEV  +TR+
Sbjct  479  QENNGKLVHGNIKSSNIFLNSERNGCVSDLGLTAVMSALAPPISRQAGYRAPEV-TDTRK  537

Query  512  VTQKSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQ  333
             +Q SDVYSFGVV+LE+LTGKS +     D+++ L RWV SVVREEWTAEVFDVEL++Y 
Sbjct  538  SSQLSDVYSFGVVLLELLTGKSPIHTTAGDEIIHLVRWVHSVVREEWTAEVFDVELLRYT  597

Query  332  NIEEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRG-PAETETEPQPSSDD  174
            NIEEEMV+MLQIA+SCV KAPD RP M+++VR IE +    A    EP+P S++
Sbjct  598  NIEEEMVEMLQIAMSCVVKAPDQRPKMSDLVRLIESVGNRQASLGPEPKPKSEN  651



>ref|XP_006413522.1| hypothetical protein EUTSA_v10024674mg [Eutrema salsugineum]
 gb|ESQ54975.1| hypothetical protein EUTSA_v10024674mg [Eutrema salsugineum]
Length=630

 Score =   204 bits (520),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 95/173 (55%), Positives = 127/173 (73%), Gaps = 1/173 (1%)
 Frame = -3

Query  692  QKGGAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRR  513
            ++   K  HGNIKSSN+ L +  +GC+SD+GL  +M+  A    R+ GYRAPEV  +TR+
Sbjct  447  EENNGKLVHGNIKSSNIFLNSERNGCVSDLGLTAVMSPLAPPISRQAGYRAPEV-TDTRK  505

Query  512  VTQKSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQ  333
             +Q SDVYSFGVV+LE+LTGKS +     D+++ L RWV SVVREEWTAEVFD+EL++Y 
Sbjct  506  SSQLSDVYSFGVVLLELLTGKSPIHTTAGDEIIHLVRWVHSVVREEWTAEVFDIELLRYT  565

Query  332  NIEEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEPQPSSDD  174
            NIEEEMV+MLQIA+SCV KAPD RP M+++VR +E +        EP+P S++
Sbjct  566  NIEEEMVEMLQIAMSCVVKAPDQRPRMSDLVRLMENVGNRRAASLEPKPKSEN  618



>ref|XP_002299495.1| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
 gb|EEE84300.1| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
Length=626

 Score =   204 bits (519),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 101/172 (59%), Positives = 123/172 (72%), Gaps = 2/172 (1%)
 Frame = -3

Query  689  KGGAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRV  510
            + G KF HGNIKSSN+ L +   GC+SD+GL  + +  A    R  GYRAPEV  +TR+ 
Sbjct  443  ENGGKFVHGNIKSSNIFLNSQQYGCVSDLGLATITSPLAPPIARAAGYRAPEV-ADTRKA  501

Query  509  TQKSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQN  330
             Q SDVYSFGVV+LE+LTGKS +   G D+++ L RWV SVVREEWTAEVFDVELM+Y N
Sbjct  502  AQPSDVYSFGVVLLELLTGKSPIHTTGGDEIIHLVRWVHSVVREEWTAEVFDVELMRYPN  561

Query  329  IEEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRG-PAETETEPQPSSD  177
            IEEEMV+MLQIA+SCVA+ PD RP M +VVR IE +R    E    PQ  S+
Sbjct  562  IEEEMVEMLQIAMSCVARMPDKRPKMTDVVRMIENVRQMDTENHQSPQNRSE  613



>ref|XP_010491047.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g05160 [Camelina sativa]
Length=639

 Score =   204 bits (519),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 101/155 (65%), Positives = 123/155 (79%), Gaps = 5/155 (3%)
 Frame = -3

Query  677  KFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRVTQKS  498
            KF HG+IKSSN+LLT  ++ C+SD  L  L N   T +PR  GY APEV +ET+RV+Q+S
Sbjct  463  KFVHGDIKSSNILLTEDLEPCLSDTSLVTLFN-LPTHTPRTIGYNAPEV-IETKRVSQRS  520

Query  497  DVYSFGVVVLEMLTGKSAVPVAGHDD---VVDLPRWVRSVVREEWTAEVFDVELMKYQNI  327
            DVYSFGVV+LEMLTGK+ +   G +D   V+DLPRWVRSVVREEWTAEVFDVEL+K+QNI
Sbjct  521  DVYSFGVVILEMLTGKTPLTQPGLEDERVVIDLPRWVRSVVREEWTAEVFDVELLKFQNI  580

Query  326  EEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGI  222
            EEEMVQMLQ+AL+CVA+ P+ RP M EV R IE +
Sbjct  581  EEEMVQMLQLALACVARNPESRPKMEEVARMIEDV  615



>ref|XP_008437363.1| PREDICTED: probable inactive receptor kinase At4g23740 [Cucumis 
melo]
 ref|XP_008437364.1| PREDICTED: probable inactive receptor kinase At4g23740 [Cucumis 
melo]
 ref|XP_008437365.1| PREDICTED: probable inactive receptor kinase At4g23740 [Cucumis 
melo]
 ref|XP_008437367.1| PREDICTED: probable inactive receptor kinase At4g23740 [Cucumis 
melo]
Length=628

 Score =   204 bits (519),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 98/166 (59%), Positives = 123/166 (74%), Gaps = 2/166 (1%)
 Frame = -3

Query  689  KGGAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRV  510
            + G K  HGN+KSSN+ L +   GC+SD+GL  + ++ +    R  GYRAPEV  +TR+ 
Sbjct  443  ENGGKLVHGNVKSSNIFLNSQQYGCVSDLGLATITSSLSPPISRAAGYRAPEV-TDTRKA  501

Query  509  TQKSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQN  330
            TQ SDV+SFGVV+LE+LTGKS +   G +++V L RWV SVVREEWTAEVFDVELM+Y N
Sbjct  502  TQASDVFSFGVVLLELLTGKSPIHATGGEEIVHLVRWVHSVVREEWTAEVFDVELMRYPN  561

Query  329  IEEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEP  192
            IEEEMV+MLQIALSCVA+ PD RP M E+V+ IE +R P E E  P
Sbjct  562  IEEEMVEMLQIALSCVARIPDQRPKMPEIVKMIENVR-PMEAENRP  606



>ref|XP_010047774.1| PREDICTED: probable inactive receptor kinase At2g26730 [Eucalyptus 
grandis]
 gb|KCW79754.1| hypothetical protein EUGRSUZ_C01100 [Eucalyptus grandis]
Length=663

 Score =   204 bits (520),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 112/176 (64%), Positives = 133/176 (76%), Gaps = 7/176 (4%)
 Frame = -3

Query  680  AKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRR-PGYRAPEVFVETRRVTQ  504
             K  HGNIKSSNVLL    + C+SD GL PL   A  T P R  GYRAPEV VETRRVT 
Sbjct  475  GKVVHGNIKSSNVLLRPDHNACVSDFGLNPLFGTA--TPPNRVAGYRAPEV-VETRRVTF  531

Query  503  KSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQNIE  324
            +SDVYSFGV++LE+LTGK+    +  ++ +DLPRWV+SVVREEWTAEVFDVELM+YQNIE
Sbjct  532  QSDVYSFGVLLLELLTGKAPNQASLGEEGIDLPRWVQSVVREEWTAEVFDVELMRYQNIE  591

Query  323  EEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGI-RGPAETETEPQPSSDDNNGGT  159
            EEMVQ+LQIA+SCVA APD RP M EVVR +E + RG  ET+   + SSDD + G+
Sbjct  592  EEMVQLLQIAMSCVAVAPDQRPPMVEVVRMMEEMNRG--ETDDGLRQSSDDPSKGS  645



>ref|XP_004167870.1| PREDICTED: LOW QUALITY PROTEIN: probable inactive receptor kinase 
At4g23740-like [Cucumis sativus]
Length=628

 Score =   204 bits (519),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 98/166 (59%), Positives = 123/166 (74%), Gaps = 2/166 (1%)
 Frame = -3

Query  689  KGGAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRV  510
            + G K  HGN+KSSN+ L +   GC+SD+GL  + ++ +    R  GYRAPEV  +TR+ 
Sbjct  443  ENGGKLVHGNVKSSNIFLNSQQYGCVSDLGLATITSSLSPPISRAAGYRAPEV-TDTRKA  501

Query  509  TQKSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQN  330
            TQ SDV+SFGVV+LE+LTGKS +   G +++V L RWV SVVREEWTAEVFDVELM+Y N
Sbjct  502  TQASDVFSFGVVLLELLTGKSPIHATGGEEIVHLVRWVHSVVREEWTAEVFDVELMRYPN  561

Query  329  IEEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEP  192
            IEEEMV+MLQIALSCVA+ PD RP M E+V+ IE +R P E E  P
Sbjct  562  IEEEMVEMLQIALSCVARIPDQRPKMPEIVKMIENVR-PMEAENRP  606



>ref|XP_011022559.1| PREDICTED: probable inactive receptor kinase At4g23740 [Populus 
euphratica]
Length=622

 Score =   204 bits (518),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 98/173 (57%), Positives = 124/173 (72%), Gaps = 8/173 (5%)
 Frame = -3

Query  689  KGGAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRV  510
            + G KF HGNIKSSN+ L +   GC+SD+GL  + ++ A    R  GYRAPE+  +TR+ 
Sbjct  443  ENGGKFVHGNIKSSNIFLNSQCYGCVSDLGLVTITSSLAPPIARAAGYRAPEI-ADTRKA  501

Query  509  TQKSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQN  330
             Q SD+YSFGVV+LE+LTGKS +   G D+++ L RWV SVVREEWTAEVFDVELM+Y N
Sbjct  502  AQPSDIYSFGVVLLELLTGKSPIHTTGSDEIIHLVRWVHSVVREEWTAEVFDVELMRYPN  561

Query  329  IEEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIR-------GPAETETEP  192
            IEEEMV+MLQIA+SCV + PD RP M EVV+ IE +R        P+E+ T P
Sbjct  562  IEEEMVEMLQIAMSCVVRMPDQRPKMTEVVKMIENVRQIDPENHQPSESSTPP  614



>ref|XP_004143879.1| PREDICTED: probable inactive receptor kinase At4g23740-like [Cucumis 
sativus]
 gb|KGN50039.1| hypothetical protein Csa_5G151550 [Cucumis sativus]
Length=628

 Score =   204 bits (518),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 98/166 (59%), Positives = 123/166 (74%), Gaps = 2/166 (1%)
 Frame = -3

Query  689  KGGAKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRV  510
            + G K  HGN+KSSN+ L +   GC+SD+GL  + ++ +    R  GYRAPEV  +TR+ 
Sbjct  443  ENGGKLVHGNVKSSNIFLNSQQYGCVSDLGLATITSSLSPPISRAAGYRAPEV-TDTRKA  501

Query  509  TQKSDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQN  330
            TQ SDV+SFGVV+LE+LTGKS +   G +++V L RWV SVVREEWTAEVFDVELM+Y N
Sbjct  502  TQASDVFSFGVVLLELLTGKSPIHATGGEEIVHLVRWVHSVVREEWTAEVFDVELMRYPN  561

Query  329  IEEEMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGIRGPAETETEP  192
            IEEEMV+MLQIALSCVA+ PD RP M E+V+ IE +R P E E  P
Sbjct  562  IEEEMVEMLQIALSCVARIPDQRPKMPEIVKMIENVR-PMEAENRP  606



>gb|KJB27114.1| hypothetical protein B456_004G278900 [Gossypium raimondii]
Length=637

 Score =   204 bits (518),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 108/175 (62%), Positives = 132/175 (75%), Gaps = 5/175 (3%)
 Frame = -3

Query  680  AKFTHGNIKSSNVLLTTSMDGCISDIGLCPLMNNAATTSPRRPGYRAPEVFVETRRVTQK  501
             K  HGNIKSSN+LL    + C+SD GL P+ +N A++S R  GYRAPEV VETR VT K
Sbjct  449  GKVVHGNIKSSNILLRPDHEACMSDFGLNPIFSNTASSS-RFSGYRAPEV-VETRNVTFK  506

Query  500  SDVYSFGVVVLEMLTGKSAVPVAGHDDVVDLPRWVRSVVREEWTAEVFDVELMKYQNIEE  321
            SDVYSFGVV+LE+LTGKS    +  ++ +DLPRWV+SVVREEWTAEVFDVELM+Y NIEE
Sbjct  507  SDVYSFGVVLLELLTGKSPNQTSMGEEGIDLPRWVQSVVREEWTAEVFDVELMRYHNIEE  566

Query  320  EMVQMLQIALSCVAKAPDMRPTMAEVVRAIEGI-RGPAETETEPQPSSDDNNGGT  159
            EMVQ+LQIA++CV+  PD RP M EVV  IE + RG  ET+   + SSDD + G+
Sbjct  567  EMVQLLQIAMACVSIVPDQRPIMQEVVHLIEDVYRG--ETDDGLRQSSDDPSKGS  619



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1360982043420