BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF008O20

Length=789
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDO99410.1|  unnamed protein product                                362   8e-120   Coffea canephora [robusta coffee]
gb|ACV70033.1|  3-ketoacyl CoA thiolase 2                               362   1e-119   Petunia x hybrida [garden petunia]
ref|XP_006360332.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    360   4e-119   Solanum tuberosum [potatoes]
dbj|BAD95031.1|  3-ketoacyl-CoA thiolase                                355   1e-118   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009619812.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    359   2e-118   Nicotiana tomentosiformis
ref|XP_009784398.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    358   3e-118   Nicotiana sylvestris
ref|XP_010696158.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    358   5e-118   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004247828.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    358   6e-118   
gb|AGC59769.1|  3-ketoacyl-CoA thiolase 1                               356   3e-117   Rehmannia glutinosa [Chinese foxglove]
ref|XP_006294172.1|  hypothetical protein CARUB_v10023167mg             356   3e-117   Capsella rubella
pdb|2WU9|A  Chain A, Crystal Structure Of Peroxisomal Kat2 From A...    355   4e-117   Arabidopsis thaliana [mouse-ear cress]
ref|NP_180873.1|  3-ketoacyl-CoA thiolase 2                             355   4e-117   Arabidopsis thaliana [mouse-ear cress]
emb|CDY37750.1|  BnaA04g19180D                                          355   5e-117   Brassica napus [oilseed rape]
ref|XP_009141289.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    355   5e-117   Brassica rapa
ref|XP_010556945.1|  PREDICTED: LOW QUALITY PROTEIN: 3-ketoacyl-C...    355   8e-117   Tarenaya hassleriana [spider flower]
ref|XP_006410451.1|  hypothetical protein EUTSA_v10016622mg             354   1e-116   Eutrema salsugineum [saltwater cress]
emb|CDY23766.1|  BnaC04g43560D                                          354   2e-116   Brassica napus [oilseed rape]
ref|XP_010413914.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    353   2e-116   Camelina sativa [gold-of-pleasure]
gb|AGC24176.1|  3-ketoacyl-CoA thiolase 2                               353   2e-116   Rehmannia glutinosa [Chinese foxglove]
gb|KJB72150.1|  hypothetical protein B456_011G161700                    353   3e-116   Gossypium raimondii
ref|XP_010509924.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    353   3e-116   Camelina sativa [gold-of-pleasure]
ref|XP_011091395.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    353   3e-116   Sesamum indicum [beniseed]
gb|EYU32624.1|  hypothetical protein MIMGU_mgv1a005944mg                353   4e-116   Erythranthe guttata [common monkey flower]
ref|XP_010469514.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    353   4e-116   Camelina sativa [gold-of-pleasure]
emb|CDY19452.1|  BnaC04g11470D                                          353   5e-116   Brassica napus [oilseed rape]
ref|XP_009143894.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    352   6e-116   Brassica rapa
emb|CAA63598.1|  glyoxysomal beta-ketoacyl-thiolase                     352   6e-116   Brassica napus [oilseed rape]
ref|XP_002881265.1|  hypothetical protein ARALYDRAFT_482251             352   9e-116   
ref|XP_009132912.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    352   1e-115   Brassica rapa
emb|CDX84701.1|  BnaA03g15290D                                          351   2e-115   
ref|XP_007034450.1|  Peroxisomal 3-ketoacyl-CoA thiolase 3 isoform 2    345   1e-114   
gb|KDO43605.1|  hypothetical protein CISIN_1g012506mg                   345   1e-114   Citrus sinensis [apfelsine]
gb|KHG05724.1|  3-ketoacyl-CoA thiolase 2, peroxisomal -like protein    349   1e-114   Gossypium arboreum [tree cotton]
ref|XP_011073762.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    349   1e-114   Sesamum indicum [beniseed]
emb|CDX79511.1|  BnaC03g18470D                                          349   1e-114   
ref|XP_010069076.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    349   2e-114   Eucalyptus grandis [rose gum]
ref|XP_008457258.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    348   2e-114   Cucumis melo [Oriental melon]
ref|XP_007225741.1|  hypothetical protein PRUPE_ppa005421mg             347   2e-114   
emb|CAN81585.1|  hypothetical protein VITISV_023191                     348   3e-114   Vitis vinifera
ref|XP_002285653.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    348   3e-114   Vitis vinifera
ref|XP_002518136.1|  3-ketoacyl-CoA thiolase B, putative                348   3e-114   
gb|KDO43604.1|  hypothetical protein CISIN_1g012506mg                   345   3e-114   Citrus sinensis [apfelsine]
gb|KDP20330.1|  hypothetical protein JCGZ_06416                         348   3e-114   Jatropha curcas
ref|XP_004138952.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    348   3e-114   Cucumis sativus [cucumbers]
gb|EPS68937.1|  hypothetical protein M569_05826                         348   4e-114   Genlisea aurea
ref|XP_004296638.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    348   4e-114   Fragaria vesca subsp. vesca
ref|XP_007225742.1|  hypothetical protein PRUPE_ppa005421mg             347   7e-114   Prunus persica
gb|KDO43600.1|  hypothetical protein CISIN_1g012506mg                   346   7e-114   Citrus sinensis [apfelsine]
ref|XP_007034449.1|  Peroxisomal 3-ketoacyl-CoA thiolase 3 isoform 1    347   1e-113   
ref|XP_008224585.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    347   1e-113   Prunus mume [ume]
gb|KDO43599.1|  hypothetical protein CISIN_1g012506mg                   346   1e-113   Citrus sinensis [apfelsine]
ref|XP_006420604.1|  hypothetical protein CICLE_v10004931mg             346   2e-113   Citrus clementina [clementine]
ref|XP_010522426.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    346   2e-113   Tarenaya hassleriana [spider flower]
ref|XP_004164123.1|  PREDICTED: LOW QUALITY PROTEIN: 3-ketoacyl-C...    346   2e-113   
gb|AFK34605.1|  unknown                                                 340   2e-113   Lotus japonicus
ref|XP_009376354.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    346   2e-113   Pyrus x bretschneideri [bai li]
ref|XP_008380600.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    344   8e-113   Malus domestica [apple tree]
pir||S72532  acetyl-CoA C-acyltransferase (EC 2.3.1.16) precursor...    344   1e-112
ref|XP_004497755.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    344   1e-112   Cicer arietinum [garbanzo]
gb|ABK94786.1|  unknown                                                 340   2e-112   Populus trichocarpa [western balsam poplar]
ref|XP_006443651.1|  hypothetical protein CICLE_v10020068mg             343   2e-112   Citrus clementina [clementine]
ref|XP_011002175.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    342   1e-111   Populus euphratica
ref|XP_010243983.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    341   2e-111   Nelumbo nucifera [Indian lotus]
ref|XP_002299284.2|  hypothetical protein POPTR_0001s14280g             340   3e-111   Populus trichocarpa [western balsam poplar]
ref|XP_006854408.1|  hypothetical protein AMTR_s00039p00196630          338   3e-110   Amborella trichopoda
gb|AFW68655.1|  hypothetical protein ZEAMMB73_512974                    329   4e-110   
ref|NP_001267690.1|  3-ketoacyl-CoA thiolase 2, peroxisomal-like        337   5e-110   Cucumis sativus [cucumbers]
ref|NP_001142099.1|  uncharacterized protein LOC100274263               328   1e-109   
gb|AFW68656.1|  hypothetical protein ZEAMMB73_512974                    330   2e-109   
ref|XP_007145410.1|  hypothetical protein PHAVU_007G236600g             335   2e-109   Phaseolus vulgaris [French bean]
ref|XP_010099126.1|  3-ketoacyl-CoA thiolase 2                          335   3e-109   
gb|AFW68657.1|  hypothetical protein ZEAMMB73_512974                    330   7e-109   
ref|NP_001238475.1|  peroxisomal 3-ketoacyl-CoA thiolase                334   1e-108   Glycine max [soybeans]
ref|XP_006662414.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    333   2e-108   Oryza brachyantha
ref|XP_011034453.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    333   2e-108   Populus euphratica
ref|XP_006368897.1|  hypothetical protein POPTR_0001s14290g             333   2e-108   
pdb|2WUA|A  Chain A, Structure Of The Peroxisomal 3-Ketoacyl-Coa ...    332   2e-108   Helianthus annuus
gb|ABB45810.1|  acetoacetyl-CoA thiolase                                322   3e-108   Salvia miltiorrhiza [Chinese salvia]
gb|ACV70032.1|  3-ketoacyl CoA thiolase 1                               332   4e-108   Petunia x hybrida [garden petunia]
ref|XP_011002176.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    332   4e-108   Populus euphratica
gb|KEH41248.1|  3-ketoacyl-CoA thiolase 2, peroxisomal-like protein     332   4e-108   Medicago truncatula
gb|ACN39947.1|  unknown                                                 332   5e-108   Picea sitchensis
gb|AAQ77242.1|  acetoacetyl CoA thiolase                                332   6e-108   Helianthus annuus
ref|XP_003555712.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    332   8e-108   Glycine max [soybeans]
ref|XP_004954382.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    331   1e-107   Setaria italica
ref|XP_008235516.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    331   1e-107   Prunus mume [ume]
ref|XP_011020688.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    331   1e-107   Populus euphratica
ref|XP_010918893.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    331   2e-107   Elaeis guineensis
ref|XP_011020687.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    331   2e-107   Populus euphratica
ref|XP_007201004.1|  hypothetical protein PRUPE_ppa005303mg             330   2e-107   Prunus persica
gb|ACN29136.1|  unknown                                                 330   4e-107   Zea mays [maize]
ref|XP_009796305.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    330   4e-107   Nicotiana sylvestris
dbj|BAI66423.1|  3-ketoacyl-CoA thiolase-like protein                   329   5e-107   Triticum aestivum [Canadian hard winter wheat]
ref|XP_009796304.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    330   6e-107   Nicotiana sylvestris
ref|NP_001131193.1|  acetyl-CoA C-acyltransferase-like protein          329   7e-107   Zea mays [maize]
gb|EMT31542.1|  3-ketoacyl-CoA thiolase 2, peroxisomal                  329   9e-107   
ref|XP_009629663.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    330   9e-107   Nicotiana tomentosiformis
ref|XP_008349047.1|  PREDICTED: LOW QUALITY PROTEIN: 3-ketoacyl-C...    323   1e-106   
gb|EYU17978.1|  hypothetical protein MIMGU_mgv1a005895mg                328   1e-106   Erythranthe guttata [common monkey flower]
ref|NP_001241698.1|  3-ketoacyl-CoA thiolase 2, peroxisomal precu...    328   2e-106   
dbj|BAJ87577.1|  predicted protein                                      328   2e-106   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KHG11493.1|  3-ketoacyl-CoA thiolase 2, peroxisomal -like protein    328   2e-106   Gossypium arboreum [tree cotton]
ref|XP_009400955.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    328   2e-106   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002467133.1|  hypothetical protein SORBIDRAFT_01g020150          328   3e-106   Sorghum bicolor [broomcorn]
ref|XP_006350308.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    327   3e-106   Solanum tuberosum [potatoes]
gb|EEC67095.1|  hypothetical protein OsI_33888                          327   4e-106   Oryza sativa Indica Group [Indian rice]
ref|XP_002521123.1|  3-ketoacyl-CoA thiolase B, putative                327   4e-106   Ricinus communis
ref|NP_001064764.1|  Os10g0457600                                       327   5e-106   
ref|XP_010038353.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    327   6e-106   Eucalyptus grandis [rose gum]
ref|XP_004247103.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    327   6e-106   
ref|XP_007049825.1|  Peroxisomal 3-ketoacyl-CoA thiolase 3 isoform 1    327   7e-106   
gb|KJB10128.1|  hypothetical protein B456_001G185200                    327   7e-106   Gossypium raimondii
ref|XP_011006998.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    326   1e-105   Populus euphratica
ref|XP_011083116.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    326   2e-105   Sesamum indicum [beniseed]
ref|XP_010940650.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    325   2e-105   Elaeis guineensis
pdb|2C7Y|A  Chain A, Plant Enzyme                                       323   4e-105   Arabidopsis thaliana [mouse-ear cress]
emb|CDP03848.1|  unnamed protein product                                325   5e-105   Coffea canephora [robusta coffee]
ref|XP_002963753.1|  hypothetical protein SELMODRAFT_450889             324   9e-105   Selaginella moellendorffii
ref|XP_003570403.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    323   1e-104   Brachypodium distachyon [annual false brome]
ref|XP_010933143.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    323   1e-104   Elaeis guineensis
gb|EMS60447.1|  3-ketoacyl-CoA thiolase 2, peroxisomal                  322   2e-104   Triticum urartu
gb|ABR16781.1|  unknown                                                 322   3e-104   Picea sitchensis
gb|KJB42403.1|  hypothetical protein B456_007G152600                    319   3e-104   Gossypium raimondii
ref|XP_009371217.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    322   3e-104   Pyrus x bretschneideri [bai li]
ref|XP_002974835.1|  hypothetical protein SELMODRAFT_101898             322   4e-104   
ref|XP_008800565.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    322   4e-104   Phoenix dactylifera
ref|XP_002889522.1|  hypothetical protein ARALYDRAFT_470458             320   5e-104   
ref|XP_010457531.1|  PREDICTED: 3-ketoacyl-CoA thiolase 1, peroxi...    321   7e-104   Camelina sativa [gold-of-pleasure]
ref|XP_010109695.1|  3-ketoacyl-CoA thiolase 2                          321   9e-104   Morus notabilis
ref|XP_006307517.1|  hypothetical protein CARUB_v10009140mg             320   1e-103   Capsella rubella
ref|XP_008372446.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    320   1e-103   
ref|XP_009411367.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    320   1e-103   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008804452.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    320   2e-103   Phoenix dactylifera
ref|XP_009385864.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    320   2e-103   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010547052.1|  PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxi...    319   2e-103   Tarenaya hassleriana [spider flower]
ref|XP_010935683.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    320   2e-103   Elaeis guineensis
ref|XP_008804745.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    320   3e-103   Phoenix dactylifera
ref|XP_010484155.1|  PREDICTED: 3-ketoacyl-CoA thiolase 1, peroxi...    319   4e-103   Camelina sativa [gold-of-pleasure]
ref|XP_010547051.1|  PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxi...    320   4e-103   Tarenaya hassleriana [spider flower]
gb|KJB42405.1|  hypothetical protein B456_007G152600                    319   5e-103   Gossypium raimondii
gb|KHG13200.1|  3-ketoacyl-CoA thiolase 2, peroxisomal -like protein    319   5e-103   Gossypium arboreum [tree cotton]
ref|XP_004982961.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    319   6e-103   Setaria italica
emb|CDX86611.1|  BnaC08g00920D                                          319   6e-103   
ref|XP_008438387.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    319   6e-103   Cucumis melo [Oriental melon]
ref|NP_171965.1|  3-ketoacyl-CoA thiolase 1                             318   6e-103   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010547050.1|  PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxi...    319   6e-103   Tarenaya hassleriana [spider flower]
ref|XP_010475137.1|  PREDICTED: 3-ketoacyl-CoA thiolase 1, peroxi...    318   1e-102   Camelina sativa [gold-of-pleasure]
ref|XP_003574006.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    317   2e-102   Brachypodium distachyon [annual false brome]
ref|XP_009111084.1|  PREDICTED: 3-ketoacyl-CoA thiolase 1, peroxi...    317   3e-102   Brassica rapa
ref|XP_004290230.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    317   5e-102   Fragaria vesca subsp. vesca
gb|AAM61609.1|  putative acetyl-CoA acyltransferase                     316   7e-102   Arabidopsis thaliana [mouse-ear cress]
gb|ABR17647.1|  unknown                                                 316   8e-102   Picea sitchensis
gb|KDP26413.1|  hypothetical protein JCGZ_17571                         315   1e-101   Jatropha curcas
emb|CDY15520.1|  BnaA08g28040D                                          314   4e-101   Brassica napus [oilseed rape]
dbj|BAD94007.1|  peroxisomal-3-keto-acyl-CoA thiolase 1                 305   1e-100   Arabidopsis thaliana [mouse-ear cress]
ref|XP_001762605.1|  predicted protein                                  313   1e-100   
ref|XP_010484150.1|  PREDICTED: 3-ketoacyl-CoA thiolase 1, peroxi...    312   2e-100   Camelina sativa [gold-of-pleasure]
gb|KJB42404.1|  hypothetical protein B456_007G152600                    312   2e-100   Gossypium raimondii
ref|XP_001764272.1|  predicted protein                                  312   4e-100   
gb|ACU19231.1|  unknown                                                 302   8e-100   Glycine max [soybeans]
gb|AAB80634.1|  Strong similarity to Cucumis acetyl-CoA acyltrans...    311   1e-99    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010684942.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    310   2e-99    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009336051.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    310   2e-99    
ref|XP_002865685.1|  KAT5/PKT1/PKT2 peroxisomal 3-keto-acyl-CoA t...    309   5e-99    Arabidopsis lyrata subsp. lyrata
ref|XP_010439770.1|  PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxi...    306   1e-98    Camelina sativa [gold-of-pleasure]
ref|XP_006649171.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    307   1e-98    Oryza brachyantha
ref|NP_001048523.1|  Os02g0817700                                       307   2e-98    
ref|XP_010442338.1|  PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxi...    306   2e-98    Camelina sativa [gold-of-pleasure]
ref|XP_009129751.1|  PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxi...    306   2e-98    Brassica rapa
ref|XP_010439766.1|  PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxi...    307   3e-98    Camelina sativa [gold-of-pleasure]
dbj|BAF02017.1|  peroxisomal-3-keto-acyl-CoA thiolase 1                 305   4e-98    Arabidopsis thaliana [mouse-ear cress]
emb|CDY33940.1|  BnaA02g30470D                                          306   5e-98    Brassica napus [oilseed rape]
ref|XP_006395130.1|  hypothetical protein EUTSA_v10004174mg             305   5e-98    Eutrema salsugineum [saltwater cress]
ref|XP_009129750.1|  PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxi...    306   6e-98    Brassica rapa
ref|XP_006280441.1|  hypothetical protein CARUB_v10026373mg             306   7e-98    Capsella rubella
ref|XP_006395129.1|  hypothetical protein EUTSA_v10004174mg             306   8e-98    Eutrema salsugineum [saltwater cress]
ref|XP_010442336.1|  PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxi...    305   1e-97    Camelina sativa [gold-of-pleasure]
gb|AIB06952.1|  3-ketoacyl-CoA thiolase                                 305   1e-97    Vanda hybrid cultivar
ref|XP_007034451.1|  Peroxisomal 3-ketoacyl-CoA thiolase 3 isoform 3    301   2e-97    
ref|NP_851157.1|  3-keto-acyl-CoA thiolase 2                            303   2e-97    Arabidopsis thaliana [mouse-ear cress]
ref|NP_001237076.1|  3-ketoacyl-CoA thiolase                            304   3e-97    Glycine max [soybeans]
ref|NP_568704.2|  3-keto-acyl-CoA thiolase 2                            304   3e-97    Arabidopsis thaliana [mouse-ear cress]
emb|CDY05657.1|  BnaC02g38800D                                          304   4e-97    
ref|XP_008454505.1|  PREDICTED: 3-ketoacyl-CoA thiolase 1, peroxi...    304   4e-97    
ref|XP_002301570.1|  hypothetical protein POPTR_0002s22410g             303   8e-97    Populus trichocarpa [western balsam poplar]
ref|XP_003604976.1|  3-ketoacyl-CoA thiolase 2, peroxisomal             302   1e-96    Medicago truncatula
ref|XP_004152018.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    303   1e-96    Cucumis sativus [cucumbers]
gb|ADE77908.1|  unknown                                                 302   2e-96    Picea sitchensis
ref|XP_008454504.1|  PREDICTED: 3-ketoacyl-CoA thiolase 1, peroxi...    304   2e-96    
gb|AFK40880.1|  unknown                                                 301   4e-96    Medicago truncatula
ref|XP_007153157.1|  hypothetical protein PHAVU_003G011600g             300   1e-95    Phaseolus vulgaris [French bean]
gb|KHN15993.1|  3-ketoacyl-CoA thiolase 2, peroxisomal                  300   1e-95    Glycine soja [wild soybean]
gb|KJB72152.1|  hypothetical protein B456_011G161700                    300   1e-95    Gossypium raimondii
ref|XP_004506669.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    299   2e-95    Cicer arietinum [garbanzo]
ref|NP_001242568.1|  uncharacterized protein LOC100789930               298   4e-95    
emb|CAA53078.1|  3-ketoacyl-CoA thiolase B                              297   6e-95    Mangifera indica
ref|XP_008382649.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    288   1e-94    
ref|XP_010482155.1|  PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxi...    296   2e-94    Camelina sativa [gold-of-pleasure]
ref|XP_004506590.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    296   2e-94    Cicer arietinum [garbanzo]
gb|KDO43601.1|  hypothetical protein CISIN_1g012506mg                   296   3e-94    Citrus sinensis [apfelsine]
ref|XP_009336047.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    295   8e-94    
ref|XP_010482154.1|  PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxi...    295   9e-94    Camelina sativa [gold-of-pleasure]
gb|EMS48058.1|  3-ketoacyl-CoA thiolase 2, peroxisomal                  293   7e-93    Triticum urartu
gb|KFK42814.1|  hypothetical protein AALP_AA1G042000                    292   1e-92    Arabis alpina [alpine rockcress]
ref|XP_009384048.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    290   1e-91    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003632434.2|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    288   4e-91    
ref|XP_005646163.1|  thiolase                                           287   2e-90    Coccomyxa subellipsoidea C-169
gb|AFK47277.1|  unknown                                                 275   5e-90    Medicago truncatula
ref|XP_008365692.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    274   2e-89    
ref|XP_002989683.1|  hypothetical protein SELMODRAFT_447769             281   6e-89    
ref|XP_007049826.1|  Peroxisomal 3-ketoacyl-CoA thiolase 3 isoform 2    280   1e-87    
gb|KCW50166.1|  hypothetical protein EUGRSUZ_K03601                     277   2e-86    Eucalyptus grandis [rose gum]
ref|XP_010473862.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    264   2e-85    Camelina sativa [gold-of-pleasure]
ref|XP_002991797.1|  hypothetical protein SELMODRAFT_236388             271   4e-85    
gb|ABR25554.1|  peroxisomal 3-ketoacyl-coa thiolase 2 precursor         252   1e-79    Oryza sativa Indica Group [Indian rice]
ref|XP_002946078.1|  hypothetical protein VOLCADRAFT_102696             256   3e-78    Volvox carteri f. nagariensis
ref|XP_008678417.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    247   6e-78    
gb|AFK39397.1|  unknown                                                 237   2e-75    Lotus japonicus
ref|XP_008355236.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    236   1e-74    
gb|AAK76732.1|  3-ketoacyl-CoA thiolase                                 235   1e-74    Gossypium hirsutum [American cotton]
ref|XP_010172441.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    240   2e-74    Antrostomus carolinensis
ref|XP_002500295.1|  acetyl-coa acyltransferase                         244   4e-74    Micromonas commoda
ref|XP_011400620.1|  3-ketoacyl-CoA thiolase 2, peroxisomal             244   5e-74    Auxenochlorella protothecoides
ref|XP_009505170.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    237   2e-73    Phalacrocorax carbo [common cormorant]
gb|KJB72151.1|  hypothetical protein B456_011G161700                    241   2e-73    Gossypium raimondii
ref|XP_003061899.1|  predicted protein                                  239   3e-73    Micromonas pusilla CCMP1545
gb|KDD73648.1|  beta-ketoacyl-ACP synthase                              241   6e-73    Helicosporidium sp. ATCC 50920
gb|KFW92214.1|  3-ketoacyl-CoA thiolase A, peroxisomal                  236   8e-73    Phalacrocorax carbo [common cormorant]
gb|KFV08282.1|  3-ketoacyl-CoA thiolase B, peroxisomal                  239   8e-73    Tauraco erythrolophus
gb|KDO43602.1|  hypothetical protein CISIN_1g012506mg                   239   1e-72    Citrus sinensis [apfelsine]
gb|ELU09588.1|  hypothetical protein CAPTEDRAFT_229355                  240   1e-72    Capitella teleta
ref|XP_004339798.1|  acetylCoA acyltransferase, putative                240   1e-72    Acanthamoeba castellanii str. Neff
gb|KFQ33519.1|  3-ketoacyl-CoA thiolase B, peroxisomal                  238   1e-72    Merops nubicus
gb|KFW09333.1|  3-ketoacyl-CoA thiolase A, peroxisomal                  238   2e-72    Fulmarus glacialis
ref|XP_009941382.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    237   2e-72    Opisthocomus hoazin [hoatzin]
gb|EMC83181.1|  3-ketoacyl-CoA thiolase B, peroxisomal                  238   2e-72    
ref|XP_010075883.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    237   2e-72    Pterocles gutturalis
ref|XP_008942616.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    238   2e-72    Merops nubicus
gb|KFW01783.1|  3-ketoacyl-CoA thiolase B, peroxisomal                  236   3e-72    Eurypyga helias
gb|KFR17430.1|  3-ketoacyl-CoA thiolase B, peroxisomal                  237   3e-72    Opisthocomus hoazin [hoatzin]
ref|XP_002199792.2|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    238   3e-72    
ref|XP_009963091.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    236   4e-72    Tyto alba [Schleiereule]
ref|XP_005424411.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    238   4e-72    
ref|XP_010146289.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    236   4e-72    Eurypyga helias
ref|XP_009580990.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    238   4e-72    Fulmarus glacialis
ref|XP_009975644.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    238   4e-72    Tauraco erythrolophus
ref|XP_009556582.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    236   5e-72    Cuculus canorus
ref|XP_005509181.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    237   5e-72    Columba livia [carrier pigeon]
gb|KFP47895.1|  3-ketoacyl-CoA thiolase B, peroxisomal                  236   5e-72    Cathartes aura
gb|KFV42249.1|  3-ketoacyl-CoA thiolase B, peroxisomal                  236   5e-72    Tyto alba [Schleiereule]
ref|XP_009707186.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    236   6e-72    Cariama cristata
ref|XP_008929499.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    236   6e-72    
ref|XP_003781848.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    238   7e-72    
gb|KFW87055.1|  3-ketoacyl-CoA thiolase B, peroxisomal                  236   7e-72    Manacus vitellinus
gb|KFO74220.1|  3-ketoacyl-CoA thiolase B, peroxisomal                  236   8e-72    Cuculus canorus
ref|XP_005527826.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    236   8e-72    
gb|EDL76925.1|  rCG25918, isoform CRA_d                                 229   8e-72    Rattus norvegicus [brown rat]
gb|KFR09032.1|  3-ketoacyl-CoA thiolase A, peroxisomal                  236   8e-72    Nipponia nippon
gb|KDO65879.1|  hypothetical protein CISIN_1g0125222mg                  235   8e-72    Citrus sinensis [apfelsine]
ref|XP_009473628.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    236   8e-72    Nipponia nippon
gb|KFW73684.1|  3-ketoacyl-CoA thiolase A, peroxisomal                  236   8e-72    Pygoscelis adeliae
ref|XP_006713186.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    233   9e-72    Homo sapiens [man]
ref|XP_009484735.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    235   1e-71    Pelecanus crispus
gb|EOA95880.1|  3-ketoacyl-CoA thiolase B, peroxisomal                  236   1e-71    Anas platyrhynchos [duck]
gb|AAH26669.1|  Acaa1a protein                                          229   1e-71    Mus musculus [mouse]
ref|XP_010190011.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    236   1e-71    Mesitornis unicolor
ref|XP_005241038.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    236   1e-71    
ref|XP_002193705.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    238   1e-71    Taeniopygia guttata
gb|KFM05271.1|  3-ketoacyl-CoA thiolase A, peroxisomal                  236   1e-71    Aptenodytes forsteri
ref|XP_009820505.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    235   1e-71    Gavia stellata
ref|XP_005442450.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    236   1e-71    
ref|XP_010114568.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    235   1e-71    Chlamydotis macqueenii
gb|KFP39992.1|  3-ketoacyl-CoA thiolase A, peroxisomal                  235   1e-71    Chlamydotis macqueenii
gb|KFQ63006.1|  3-ketoacyl-CoA thiolase B, peroxisomal                  235   2e-71    Pelecanus crispus
gb|KFV40730.1|  3-ketoacyl-CoA thiolase A, peroxisomal                  235   2e-71    Gavia stellata
ref|XP_005027361.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    236   2e-71    
gb|KFO66172.1|  3-ketoacyl-CoA thiolase B, peroxisomal                  235   2e-71    Corvus brachyrhynchos
gb|KGL97637.1|  3-ketoacyl-CoA thiolase A, peroxisomal                  235   2e-71    Charadrius vociferus
gb|KDO65875.1|  hypothetical protein CISIN_1g0125222mg                  236   2e-71    Citrus sinensis [apfelsine]
ref|XP_010311931.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    234   2e-71    
ref|XP_008641380.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    235   2e-71    
gb|KFP07326.1|  3-ketoacyl-CoA thiolase B, peroxisomal                  236   3e-71    
gb|KFQ13333.1|  3-ketoacyl-CoA thiolase B, peroxisomal                  234   3e-71    
gb|KFO08431.1|  3-ketoacyl-CoA thiolase A, peroxisomal                  234   3e-71    
gb|KFP20301.1|  3-ketoacyl-CoA thiolase B, peroxisomal                  234   3e-71    
ref|XP_010293422.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    234   3e-71    
ref|NP_001184217.1|  acetyl-Coenzyme A acyltransferase 1 (peroxis...    236   3e-71    
emb|CAA35825.1|  3-oxoacyl-CoA thiolase                                 233   4e-71    
gb|EDL76924.1|  rCG25918, isoform CRA_c                                 231   4e-71    
ref|XP_009888784.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    234   5e-71    
gb|EGW00823.1|  3-ketoacyl-CoA thiolase B, peroxisomal                  231   5e-71    
gb|ACA58356.1|  3-ketoacyl-CoA thiolase                                 226   6e-71    
gb|EDL09222.1|  mCG20972, isoform CRA_b                                 230   6e-71    
ref|XP_009923469.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    234   7e-71    
ref|XP_003283381.1|  acetyl-CoA C-acyltransferase                       235   7e-71    
ref|XP_010710649.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    236   7e-71    
ref|XP_005040594.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    235   7e-71    
ref|XP_006749538.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    233   7e-71    
ref|XP_005491482.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    235   7e-71    
ref|XP_006512177.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    230   8e-71    
ref|XP_008522879.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    235   8e-71    
ref|XP_010016183.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    233   8e-71    
ref|XP_009084024.1|  PREDICTED: LOW QUALITY PROTEIN: 3-ketoacyl-C...    235   8e-71    
ref|XP_009897418.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    233   8e-71    
gb|KFQ52653.1|  3-ketoacyl-CoA thiolase B, peroxisomal                  233   9e-71    
ref|XP_009642386.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    234   9e-71    
ref|XP_009078375.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    234   1e-70    
ref|XP_006511987.1|  PREDICTED: 3-ketoacyl-CoA thiolase A, peroxi...    230   1e-70    
gb|KFV66334.1|  3-ketoacyl-CoA thiolase B, peroxisomal                  233   1e-70    
ref|XP_006120630.1|  PREDICTED: 3-ketoacyl-CoA thiolase A, peroxi...    234   1e-70    
ref|XP_004759760.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    234   1e-70    
ref|XP_007437964.1|  PREDICTED: 3-ketoacyl-CoA thiolase A, peroxi...    229   1e-70    
gb|ELK29226.1|  3-ketoacyl-CoA thiolase, peroxisomal                    233   1e-70    
gb|EPQ17921.1|  3-ketoacyl-CoA thiolase, peroxisomal                    233   1e-70    
ref|XP_010393120.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    234   1e-70    
ref|XP_011217239.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    233   2e-70    
ref|XP_008949804.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    232   2e-70    
ref|XP_005150078.1|  PREDICTED: 3-ketoacyl-CoA thiolase A, peroxi...    234   2e-70    
dbj|BAG57147.1|  unnamed protein product                                232   2e-70    
dbj|BAC32386.1|  unnamed protein product                                230   2e-70    
gb|KCW50169.1|  hypothetical protein EUGRSUZ_K03601                     234   2e-70    
ref|XP_008844714.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    234   2e-70    
ref|XP_007615644.1|  PREDICTED: LOW QUALITY PROTEIN: 3-ketoacyl-C...    232   2e-70    
ref|XP_006605730.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    234   2e-70    
ref|XP_004676369.1|  PREDICTED: 3-ketoacyl-CoA thiolase A, peroxi...    234   2e-70    
gb|KCW50170.1|  hypothetical protein EUGRSUZ_K03601                     233   2e-70    
ref|XP_008500452.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    235   2e-70    
ref|XP_004823725.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    234   2e-70    
ref|XP_010144408.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    232   2e-70    
ref|XP_006109905.1|  PREDICTED: LOW QUALITY PROTEIN: acetyl-CoA a...    233   3e-70    
ref|XP_001488609.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    234   3e-70    
ref|XP_004419563.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    234   3e-70    
ref|XP_003221941.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    233   4e-70    
gb|KFV86553.1|  3-ketoacyl-CoA thiolase B, peroxisomal                  232   5e-70    
ref|XP_010559421.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    233   5e-70    
ref|XP_009274247.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    234   5e-70    
ref|XP_006765161.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    233   6e-70    
ref|XP_005297193.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    232   6e-70    
gb|EGW00828.1|  3-ketoacyl-CoA thiolase B, peroxisomal                  231   6e-70    
ref|XP_009952311.1|  PREDICTED: LOW QUALITY PROTEIN: 3-ketoacyl-C...    235   7e-70    
pdb|2IIK|A  Chain A, Crystal Structure Of Human Peroxisomal Acety...    233   7e-70    
ref|XP_002914680.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    233   7e-70    
ref|XP_009443455.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    232   7e-70    
ref|XP_004662051.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    231   7e-70    
ref|XP_003464147.2|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    233   8e-70    
ref|XP_004315495.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    230   9e-70    
ref|XP_007081088.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    232   9e-70    
ref|XP_011217238.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    232   9e-70    
ref|XP_008153138.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    233   9e-70    
ref|XP_003992303.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    233   9e-70    
ref|XP_005317428.1|  PREDICTED: 3-ketoacyl-CoA thiolase A, peroxi...    232   9e-70    
ref|XP_003930949.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    232   1e-69    
ref|XP_003132151.1|  PREDICTED: 3-ketoacyl-CoA thiolase A, peroxi...    232   1e-69    
gb|EMP29415.1|  3-ketoacyl-CoA thiolase B, peroxisomal                  231   1e-69    
ref|XP_003256905.2|  PREDICTED: LOW QUALITY PROTEIN: 3-ketoacyl-C...    232   1e-69    
ref|XP_011241272.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    230   1e-69    
ref|XP_007910458.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    230   1e-69    
ref|NP_001598.1|  3-ketoacyl-CoA thiolase, peroxisomal isoform a        232   1e-69    
ref|XP_002813979.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    232   1e-69    
ref|XP_005634306.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    230   1e-69    
ref|XP_004033892.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    232   1e-69    
ref|XP_004642271.1|  PREDICTED: 3-ketoacyl-CoA thiolase A, peroxi...    232   1e-69    
ref|XP_006023013.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    229   1e-69    
ref|XP_005882731.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    232   2e-69    
ref|XP_005348140.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    231   2e-69    
ref|XP_002759778.2|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    231   2e-69    
ref|XP_003505982.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    231   2e-69    
ref|XP_009537056.1|  hypothetical protein PHYSODRAFT_340572             231   2e-69    
ref|XP_007066606.1|  PREDICTED: 3-ketoacyl-CoA thiolase A, peroxi...    230   2e-69    
ref|NP_001035108.1|  3-ketoacyl-CoA thiolase B, peroxisomal precu...    231   2e-69    
ref|XP_008161239.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    231   2e-69    
ref|XP_001697225.1|  acetyl-CoA acyltransferase                         232   2e-69    
sp|P07871.2|THIKB_RAT  RecName: Full=3-ketoacyl-CoA thiolase B, p...    231   3e-69    
ref|XP_008066531.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    231   3e-69    
ref|XP_007127846.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    230   3e-69    
ref|XP_005348137.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    231   3e-69    
ref|XP_010004292.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    231   3e-69    
dbj|BAE35878.1|  unnamed protein product                                231   3e-69    
gb|EDL76915.1|  rCG25819, isoform CRA_a                                 231   3e-69    
ref|XP_005297192.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    231   3e-69    
ref|XP_004906796.1|  PREDICTED: LOW QUALITY PROTEIN: 3-ketoacyl-C...    231   3e-69    
dbj|BAA14106.1|  peroxisomal 3-ketoacyl-CoA thiolase A                  231   3e-69    
ref|XP_008584769.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    229   3e-69    
sp|P21775.2|THIKA_RAT  RecName: Full=3-ketoacyl-CoA thiolase A, p...    231   4e-69    
ref|XP_009683500.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    231   4e-69    
ref|NP_570934.1|  3-ketoacyl-CoA thiolase A, peroxisomal precursor      231   4e-69    
gb|EHB16856.1|  3-ketoacyl-CoA thiolase B, peroxisomal                  231   4e-69    
ref|XP_008710007.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    232   4e-69    
ref|XP_002802920.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    229   4e-69    
ref|XP_004835307.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    231   4e-69    
ref|XP_007644623.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    231   4e-69    
ref|XP_006869210.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    231   4e-69    
ref|XP_006265991.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    231   5e-69    
ref|XP_005386652.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    231   5e-69    
ref|NP_666342.1|  3-ketoacyl-CoA thiolase B, peroxisomal precursor      231   5e-69    
gb|ELV10533.1|  3-ketoacyl-CoA thiolase, peroxisomal                    229   5e-69    
ref|XP_007462753.1|  PREDICTED: 3-ketoacyl-CoA thiolase A, peroxi...    231   5e-69    
ref|XP_003415748.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    230   5e-69    
ref|XP_007127844.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    230   6e-69    
ref|XP_009066824.1|  hypothetical protein LOTGIDRAFT_134529             231   6e-69    
ref|XP_007517129.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    230   6e-69    
ref|XP_005317422.1|  PREDICTED: 3-ketoacyl-CoA thiolase A, peroxi...    230   7e-69    
ref|XP_005994280.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    230   7e-69    
ref|XP_006173724.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    228   7e-69    
gb|KFO38323.1|  3-ketoacyl-CoA thiolase B, peroxisomal                  229   7e-69    
ref|XP_004277954.1|  PREDICTED: 3-ketoacyl-CoA thiolase A, peroxi...    230   7e-69    
ref|XP_005849380.1|  hypothetical protein CHLNCDRAFT_143854             231   8e-69    
dbj|BAA14107.1|  peroxisomal 3-ketoacyl-CoA thiolase B                  230   8e-69    
ref|NP_036621.1|  3-ketoacyl-CoA thiolase A, peroxisomal                230   9e-69    
ref|XP_010944140.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    228   1e-68    
ref|XP_534222.2|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal...    229   1e-68    
ref|XP_001418570.1|  predicted protein                                  229   1e-68    
ref|XP_003456538.2|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    231   1e-68    
ref|XP_004018276.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    227   1e-68    
ref|XP_010616927.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    229   1e-68    
ref|XP_004704131.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    229   1e-68    
ref|XP_006169029.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    229   1e-68    
ref|XP_004412369.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    229   2e-68    
ref|XP_010980336.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    228   2e-68    
ref|XP_004588416.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    228   3e-68    
ref|XP_010355558.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    228   3e-68    
dbj|BAE25296.1|  unnamed protein product                                228   4e-68    
dbj|BAE72965.1|  hypothetical protein                                   228   4e-68    
ref|XP_006890653.1|  PREDICTED: 3-ketoacyl-CoA thiolase A, peroxi...    228   4e-68    
ref|XP_007191535.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    228   5e-68    
gb|ETI53494.1|  hypothetical protein F443_03599                         228   5e-68    
gb|ETK93319.1|  hypothetical protein L915_03492                         227   6e-68    
ref|XP_008900800.1|  hypothetical protein PPTG_08457                    227   6e-68    
ref|XP_007943891.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    226   7e-68    
gb|EPZ32623.1|  3-ketoacyl-CoA thiolase A, peroxisomal                  227   7e-68    
ref|XP_005695607.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    225   7e-68    
ref|XP_007969955.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    228   9e-68    
ref|XP_005975939.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    227   1e-67    
ref|XP_005546711.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    228   1e-67    
ref|XP_003894723.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    228   1e-67    
ref|XP_001088834.2|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    228   1e-67    
ref|XP_007513169.1|  unknown                                            228   1e-67    
ref|NP_001080604.1|  3-ketoacyl-CoA thiolase, peroxisomal               227   1e-67    
ref|XP_006200711.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    227   1e-67    
ref|XP_006806602.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    228   1e-67    
ref|XP_004614628.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    226   2e-67    
ref|NP_001029491.1|  3-ketoacyl-CoA thiolase, peroxisomal               226   2e-67    
emb|CEF98532.1|  Thiolase-like, subgroup                                226   2e-67    
ref|XP_004538713.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    226   3e-67    
ref|XP_011480271.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    224   3e-67    
ref|XP_004377453.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    226   4e-67    
ref|XP_007943890.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    226   4e-67    
ref|XP_005383786.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    225   5e-67    
gb|KGL84935.1|  3-ketoacyl-CoA thiolase B, peroxisomal                  224   5e-67    
ref|WP_012281246.1|  acetyl-CoA acetyltransferase                       224   5e-67    
ref|XP_006077082.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    225   5e-67    
ref|XP_005940527.1|  PREDICTED: 3-ketoacyl-CoA thiolase A, peroxi...    226   6e-67    
ref|XP_005748614.1|  PREDICTED: 3-ketoacyl-CoA thiolase A, peroxi...    226   6e-67    
ref|XP_009876634.1|  PREDICTED: LOW QUALITY PROTEIN: 3-ketoacyl-C...    223   7e-67    
ref|XP_010833811.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    225   7e-67    
ref|XP_005901200.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    225   7e-67    
ref|XP_004338982.1|  acetylCoA C-acetyltransferase subfamily protein    229   8e-67    
emb|CCA20150.1|  3ketoacylCoA thiolase A putative                       224   1e-66    
ref|XP_002180190.1|  beta-ketoacyl-coa thiolase                         223   2e-66    
ref|XP_008853327.1|  PREDICTED: LOW QUALITY PROTEIN: 3-ketoacyl-C...    224   2e-66    
ref|XP_007578554.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    223   2e-66    
ref|XP_002904159.1|  3-ketoacyl-CoA thiolase A                          223   3e-66    
ref|XP_010224152.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    224   3e-66    
ref|XP_004635291.1|  PREDICTED: 3-ketoacyl-CoA thiolase A, peroxi...    223   4e-66    
ref|XP_002742159.1|  PREDICTED: 3-ketoacyl-CoA thiolase A, peroxi...    223   5e-66    
gb|EJK62852.1|  hypothetical protein THAOC_16519                        225   5e-66    
ref|NP_001187475.1|  peroxisomal 3-ketoacyl-CoA thiolase A              223   5e-66    
ref|XP_010739674.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    223   7e-66    
gb|ACO51137.1|  acetyl-coenzyme A acyltransferase 1                     219   7e-66    
ref|XP_004360305.1|  acetyl-CoA C-acyltransferase                       232   1e-65    
gb|EJY88018.1|  Acetyl-CoA acyltransferases family protein              221   1e-65    
ref|XP_003080093.1|  Dynein 1-alpha heavy chain, flagellar inner ...    234   1e-65    
ref|XP_002591918.1|  hypothetical protein BRAFLDRAFT_284464             222   1e-65    
ref|XP_007253620.1|  PREDICTED: 3-ketoacyl-CoA thiolase A, peroxi...    221   2e-65    
ref|XP_006910841.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    221   2e-65    
ref|XP_008276561.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    221   2e-65    
ref|XP_004349337.1|  peroxisomal 3-ketoacyl-CoA thiolase B              221   2e-65    
emb|CBJ49265.1|  3-ketoacyl-CoA thiolase                                220   2e-65    
dbj|BAJ85217.1|  predicted protein                                      220   3e-65    
gb|KDO30583.1|  hypothetical protein SPRG_04484                         220   3e-65    
ref|XP_005096572.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    220   4e-65    
ref|XP_008314704.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    220   5e-65    
ref|XP_009833031.1|  hypothetical protein, variant 2                    217   6e-65    
ref|NP_001072686.1|  3-ketoacyl-CoA thiolase, peroxisomal               220   6e-65    
ref|XP_010785602.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    220   7e-65    
ref|XP_011363629.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    220   7e-65    
ref|XP_008877314.1|  hypothetical protein H310_12126                    219   1e-64    
ref|XP_004880487.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    219   1e-64    
ref|XP_004854313.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    219   1e-64    
gb|EPY89211.1|  acetyl-CoA acyltransferase 1                            218   1e-64    
ref|XP_004854312.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    219   1e-64    
ref|XP_004880486.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    219   1e-64    
ref|XP_002111185.1|  expressed hypothetical protein                     219   2e-64    
ref|WP_013075085.1|  acetyl-CoA acetyltransferase                       218   2e-64    
emb|CCI45800.1|  unnamed protein product                                218   2e-64    
ref|XP_003724378.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    219   2e-64    
ref|XP_003762905.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    219   3e-64    
ref|XP_008616222.1|  acetyl-CoA acyltransferase 1                       217   4e-64    
ref|XP_009833029.1|  hypothetical protein H257_08703                    217   5e-64    
ref|NP_001002207.1|  3-ketoacyl-CoA thiolase, peroxisomal               217   7e-64    



>emb|CDO99410.1| unnamed protein product [Coffea canephora]
Length=461

 Score =   362 bits (930),  Expect = 8e-120, Method: Compositional matrix adjust.
 Identities = 172/191 (90%), Positives = 186/191 (97%), Gaps = 0/191 (0%)
 Frame = -3

Query  769  DLAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPA  590
            DLAKLKPVFKKDG+TTAGNSSQV+DGAGAVLLMKRSLA+QKGLPILGVFRTFAAVGVDPA
Sbjct  271  DLAKLKPVFKKDGSTTAGNSSQVSDGAGAVLLMKRSLAMQKGLPILGVFRTFAAVGVDPA  330

Query  589  VMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAI  410
            +MG+GPAVAIPAAVKSAGLEL+DIDLFEINEAFASQ++YC++KLGLDPEKINVNGGAMAI
Sbjct  331  IMGVGPAVAIPAAVKSAGLELEDIDLFEINEAFASQFVYCREKLGLDPEKINVNGGAMAI  390

Query  409  GHPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKV  230
            GHPLGATGARCVATLLHEMKRRGKDCR+GVVSMCIGTGMGAA VFERGD+CDEL NARK+
Sbjct  391  GHPLGATGARCVATLLHEMKRRGKDCRFGVVSMCIGTGMGAAAVFERGDSCDELCNARKI  450

Query  229  ETHGYLSKDAR  197
            E +  LSKDAR
Sbjct  451  EANNLLSKDAR  461



>gb|ACV70033.1| 3-ketoacyl CoA thiolase 2 [Petunia x hybrida]
Length=463

 Score =   362 bits (929),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 172/190 (91%), Positives = 184/190 (97%), Gaps = 0/190 (0%)
 Frame = -3

Query  769  DLAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPA  590
            DLAKL+PVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLA+QKGLPILGVFRTFAAVGVDPA
Sbjct  273  DLAKLRPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAMQKGLPILGVFRTFAAVGVDPA  332

Query  589  VMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAI  410
            +MGIGPAVAIPAAVKSAGLEL+DIDLFEINEAFASQY+YC+KKL LDPEKINVNG AMA+
Sbjct  333  IMGIGPAVAIPAAVKSAGLELEDIDLFEINEAFASQYVYCRKKLELDPEKINVNGSAMAL  392

Query  409  GHPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKV  230
            GHPLGATGARCVATLLHEMKRRGKDCR+GVVSMCIGTGMGAA VFERGD+CDEL NARK+
Sbjct  393  GHPLGATGARCVATLLHEMKRRGKDCRFGVVSMCIGTGMGAAAVFERGDSCDELRNARKI  452

Query  229  ETHGYLSKDA  200
            ++H  LSKDA
Sbjct  453  DSHNLLSKDA  462



>ref|XP_006360332.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Solanum 
tuberosum]
Length=465

 Score =   360 bits (925),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 173/191 (91%), Positives = 186/191 (97%), Gaps = 1/191 (1%)
 Frame = -3

Query  769  DLAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPA  590
            DLAKLKPVFKK GTTTAGNSSQVTDGAGAVLLMKRS+A+QKGLPILGVFRTFAAVGVDPA
Sbjct  274  DLAKLKPVFKKSGTTTAGNSSQVTDGAGAVLLMKRSIAMQKGLPILGVFRTFAAVGVDPA  333

Query  589  VMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAI  410
            +MGIGPAVAIPAAVKSAGLEL+DIDLFEINEAFASQ++YC+KKLGLDPEKINVNGGAMAI
Sbjct  334  IMGIGPAVAIPAAVKSAGLELEDIDLFEINEAFASQFVYCRKKLGLDPEKINVNGGAMAI  393

Query  409  GHPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKV  230
            GHPLGATGARCVATLLHEMKRRGKDCR+GVVSMCIGTGMGAA VFERGD+CDEL NARK+
Sbjct  394  GHPLGATGARCVATLLHEMKRRGKDCRFGVVSMCIGTGMGAAAVFERGDSCDELRNARKI  453

Query  229  ETHGY-LSKDA  200
            ++H + LSKDA
Sbjct  454  DSHNHLLSKDA  464



>dbj|BAD95031.1| 3-ketoacyl-CoA thiolase [Arabidopsis thaliana]
Length=343

 Score =   355 bits (911),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 171/190 (90%), Positives = 181/190 (95%), Gaps = 0/190 (0%)
 Frame = -3

Query  766  LAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAV  587
            L KLKPVFKKDGTTTAGNSSQV+DGAGAVLLMKRS+A+QKGLP+LGVFRTFAAVGVDPA+
Sbjct  154  LGKLKPVFKKDGTTTAGNSSQVSDGAGAVLLMKRSVAMQKGLPVLGVFRTFAAVGVDPAI  213

Query  586  MGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIG  407
            MGIGPAVAIPAAVK+AGLELDDIDLFEINEAFASQ++YC+ KLGLDPEKINVNGGAMAIG
Sbjct  214  MGIGPAVAIPAAVKAAGLELDDIDLFEINEAFASQFVYCRNKLGLDPEKINVNGGAMAIG  273

Query  406  HPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVE  227
            HPLGATGARCVATLLHEMKRRGKDCR+GVVSMCIGTGMGAA VFERGD  DEL NARKVE
Sbjct  274  HPLGATGARCVATLLHEMKRRGKDCRFGVVSMCIGTGMGAAAVFERGDGVDELRNARKVE  333

Query  226  THGYLSKDAR  197
              G LSKDAR
Sbjct  334  AQGLLSKDAR  343



>ref|XP_009619812.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Nicotiana 
tomentosiformis]
Length=464

 Score =   359 bits (921),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 173/190 (91%), Positives = 183/190 (96%), Gaps = 0/190 (0%)
 Frame = -3

Query  769  DLAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPA  590
            DLAKLKPVFKK GTTTAGNSSQVTDGAGAVLLMKRSLA+QKGLPILGVFRTFAAVGVDPA
Sbjct  274  DLAKLKPVFKKSGTTTAGNSSQVTDGAGAVLLMKRSLAMQKGLPILGVFRTFAAVGVDPA  333

Query  589  VMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAI  410
            +MGIGPAVAIPAAVKSAGLEL+DIDLFEINEAFASQY+YC+KKL LDPEKINVNGGAMA+
Sbjct  334  IMGIGPAVAIPAAVKSAGLELEDIDLFEINEAFASQYVYCRKKLELDPEKINVNGGAMAL  393

Query  409  GHPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKV  230
            GHPLGATGARCVATLLHEMKRRGKDCR+GVVSMCIGTGMGAA VFERGD+CDEL NARK+
Sbjct  394  GHPLGATGARCVATLLHEMKRRGKDCRFGVVSMCIGTGMGAAAVFERGDSCDELCNARKI  453

Query  229  ETHGYLSKDA  200
             +H  LSKDA
Sbjct  454  GSHNLLSKDA  463



>ref|XP_009784398.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Nicotiana 
sylvestris]
Length=464

 Score =   358 bits (919),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 172/190 (91%), Positives = 183/190 (96%), Gaps = 0/190 (0%)
 Frame = -3

Query  769  DLAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPA  590
            DLAKLKPVFKK GTTTAGNSSQVTDGAGAVLLMKRS+A+QKGLPILGVFRTFAAVGVDPA
Sbjct  274  DLAKLKPVFKKSGTTTAGNSSQVTDGAGAVLLMKRSIAMQKGLPILGVFRTFAAVGVDPA  333

Query  589  VMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAI  410
            +MGIGPAVAIPAAVKSAGLEL+DIDLFEINEAFASQY+YC+KKL LDPEKINVNGGAMA+
Sbjct  334  IMGIGPAVAIPAAVKSAGLELEDIDLFEINEAFASQYVYCRKKLELDPEKINVNGGAMAL  393

Query  409  GHPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKV  230
            GHPLGATGARCVATLLHEMKRRGKDCR+GVVSMCIGTGMGAA VFERGD+CDEL NARK+
Sbjct  394  GHPLGATGARCVATLLHEMKRRGKDCRFGVVSMCIGTGMGAAAVFERGDSCDELCNARKI  453

Query  229  ETHGYLSKDA  200
             +H  LSKDA
Sbjct  454  GSHNLLSKDA  463



>ref|XP_010696158.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Beta vulgaris 
subsp. vulgaris]
Length=462

 Score =   358 bits (918),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 173/191 (91%), Positives = 184/191 (96%), Gaps = 0/191 (0%)
 Frame = -3

Query  769  DLAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPA  590
            DLAKLKPVFKK GTTTAGNSSQVTDGAGAVLLMKRS+A+ KGLPILGVFRTFAAVGVDPA
Sbjct  272  DLAKLKPVFKKSGTTTAGNSSQVTDGAGAVLLMKRSVAMSKGLPILGVFRTFAAVGVDPA  331

Query  589  VMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAI  410
            +MGIGPAVAIPAAVK+AGLELDDIDLFEINEAFASQ+LYC+KKL LDPEKINVNGGAMAI
Sbjct  332  IMGIGPAVAIPAAVKAAGLELDDIDLFEINEAFASQFLYCRKKLDLDPEKINVNGGAMAI  391

Query  409  GHPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKV  230
            GHPLGATGARCVATLLHEMKRRGKDCR+GV+SMCIGTGMGAA VFERGDA D+L NARKV
Sbjct  392  GHPLGATGARCVATLLHEMKRRGKDCRFGVISMCIGTGMGAAAVFERGDAADDLCNARKV  451

Query  229  ETHGYLSKDAR  197
            E+HG LSKDA+
Sbjct  452  ESHGLLSKDAK  462



>ref|XP_004247828.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Solanum lycopersicum]
Length=465

 Score =   358 bits (918),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 172/191 (90%), Positives = 185/191 (97%), Gaps = 1/191 (1%)
 Frame = -3

Query  769  DLAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPA  590
            DLAKLKPVFKK GTTTAGNSSQVTDGAGAVLLMKRS+A+QKGLPILGVFRTFAAVGVDPA
Sbjct  274  DLAKLKPVFKKSGTTTAGNSSQVTDGAGAVLLMKRSIAMQKGLPILGVFRTFAAVGVDPA  333

Query  589  VMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAI  410
            +MGIGPAVAIPAAVKSAGLEL+DIDLFEINEAFASQ++YC+KKL LDPEKINVNGGAMAI
Sbjct  334  IMGIGPAVAIPAAVKSAGLELEDIDLFEINEAFASQFVYCRKKLELDPEKINVNGGAMAI  393

Query  409  GHPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKV  230
            GHPLGATGARCVATLLHEMKRRGKDCR+GVVSMCIGTGMGAA VFERGD+CDEL NARK+
Sbjct  394  GHPLGATGARCVATLLHEMKRRGKDCRFGVVSMCIGTGMGAAAVFERGDSCDELRNARKI  453

Query  229  ETHGY-LSKDA  200
            ++H + LSKDA
Sbjct  454  DSHNHLLSKDA  464



>gb|AGC59769.1| 3-ketoacyl-CoA thiolase 1 [Rehmannia glutinosa]
Length=464

 Score =   356 bits (913),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 169/191 (88%), Positives = 183/191 (96%), Gaps = 0/191 (0%)
 Frame = -3

Query  769  DLAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPA  590
            DL KLKPVFKKDG+TTAGNSSQV+DGAGAVLLMKRS+A+QKGLPILGVFR+FAAVGVDPA
Sbjct  274  DLGKLKPVFKKDGSTTAGNSSQVSDGAGAVLLMKRSVAMQKGLPILGVFRSFAAVGVDPA  333

Query  589  VMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAI  410
            +MG+GPAVAIPAAVKSAGLEL DIDLFE+NEAFASQ++YC+KKL LDPEKINVNGGAMAI
Sbjct  334  IMGVGPAVAIPAAVKSAGLELGDIDLFEVNEAFASQFVYCRKKLELDPEKINVNGGAMAI  393

Query  409  GHPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKV  230
            GHPLG TGARCVATLLHEMKRRGKDCR+GVVSMCIGTGMGAA VFERGD+CDELSNAR V
Sbjct  394  GHPLGVTGARCVATLLHEMKRRGKDCRFGVVSMCIGTGMGAAAVFERGDSCDELSNARTV  453

Query  229  ETHGYLSKDAR  197
             TH +LSKDAR
Sbjct  454  GTHNFLSKDAR  464



>ref|XP_006294172.1| hypothetical protein CARUB_v10023167mg [Capsella rubella]
 gb|EOA27070.1| hypothetical protein CARUB_v10023167mg [Capsella rubella]
Length=462

 Score =   356 bits (913),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 171/190 (90%), Positives = 182/190 (96%), Gaps = 0/190 (0%)
 Frame = -3

Query  766  LAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAV  587
            L KLKPVFKKDGTTTAGNSSQV+DGAGAVLLMKRS+A+QKGLP+LGVFRTFAAVGVDPA+
Sbjct  273  LGKLKPVFKKDGTTTAGNSSQVSDGAGAVLLMKRSVAMQKGLPVLGVFRTFAAVGVDPAI  332

Query  586  MGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIG  407
            MGIGPAVAIPAAVK+AGLELDDIDLFEINEAFASQ++YC+ KLGLDPEKINVNGGA+AIG
Sbjct  333  MGIGPAVAIPAAVKAAGLELDDIDLFEINEAFASQFVYCRNKLGLDPEKINVNGGALAIG  392

Query  406  HPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVE  227
            HPLGATGARCVATLLHEMKRRGKDCR+GVVSMCIGTGMGAA VFERGD  DEL NARKVE
Sbjct  393  HPLGATGARCVATLLHEMKRRGKDCRFGVVSMCIGTGMGAAAVFERGDGVDELRNARKVE  452

Query  226  THGYLSKDAR  197
            T G LSKDAR
Sbjct  453  TQGLLSKDAR  462



>pdb|2WU9|A Chain A, Crystal Structure Of Peroxisomal Kat2 From Arabidopsis 
Thaliana
 pdb|2WU9|B Chain B, Crystal Structure Of Peroxisomal Kat2 From Arabidopsis 
Thaliana
Length=442

 Score =   355 bits (910),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 171/190 (90%), Positives = 181/190 (95%), Gaps = 0/190 (0%)
 Frame = -3

Query  766  LAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAV  587
            L KLKPVFKKDGTTTAGNSSQV+DGAGAVLLMKRS+A+QKGLP+LGVFRTFAAVGVDPA+
Sbjct  253  LGKLKPVFKKDGTTTAGNSSQVSDGAGAVLLMKRSVAMQKGLPVLGVFRTFAAVGVDPAI  312

Query  586  MGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIG  407
            MGIGPAVAIPAAVK+AGLELDDIDLFEINEAFASQ++YC+ KLGLDPEKINVNGGAMAIG
Sbjct  313  MGIGPAVAIPAAVKAAGLELDDIDLFEINEAFASQFVYCRNKLGLDPEKINVNGGAMAIG  372

Query  406  HPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVE  227
            HPLGATGARCVATLLHEMKRRGKDCR+GVVSMCIGTGMGAA VFERGD  DEL NARKVE
Sbjct  373  HPLGATGARCVATLLHEMKRRGKDCRFGVVSMCIGTGMGAAAVFERGDGVDELRNARKVE  432

Query  226  THGYLSKDAR  197
              G LSKDAR
Sbjct  433  AQGLLSKDAR  442



>ref|NP_180873.1| 3-ketoacyl-CoA thiolase 2 [Arabidopsis thaliana]
 sp|Q56WD9.2|THIK2_ARATH RecName: Full=3-ketoacyl-CoA thiolase 2, peroxisomal; AltName: 
Full=Acetyl-CoA acyltransferase 2; AltName: Full=Beta-ketothiolase 
2; AltName: Full=Peroxisomal 3-oxoacyl-CoA thiolase 
2; AltName: Full=Peroxisome defective protein 1; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAG42910.1|AF327529_1 putative 3-ketoacyl-CoA thiolase [Arabidopsis thaliana]
 gb|AAK15577.1|AF349530_1 putative 3-ketoacyl-CoA thiolase [Arabidopsis thaliana]
 gb|AAC04908.1| 3-ketoacyl-CoA thiolase [Arabidopsis thaliana]
 dbj|BAA25248.1| 3-ketoacyl-CoA thiolase [Arabidopsis thaliana]
 dbj|BAA25249.1| 3-ketoacyl-CoA thiolase [Arabidopsis thaliana]
 gb|AAK96606.1| At2g33150/F25I18.11 [Arabidopsis thaliana]
 gb|AAL36070.1| At2g33150/F25I18.11 [Arabidopsis thaliana]
 gb|AAM65085.1| 3-ketoacyl-CoA thiolase [Arabidopsis thaliana]
 gb|AEC08791.1| 3-ketoacyl-CoA thiolase 2 [Arabidopsis thaliana]
Length=462

 Score =   355 bits (912),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 171/190 (90%), Positives = 181/190 (95%), Gaps = 0/190 (0%)
 Frame = -3

Query  766  LAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAV  587
            L KLKPVFKKDGTTTAGNSSQV+DGAGAVLLMKRS+A+QKGLP+LGVFRTFAAVGVDPA+
Sbjct  273  LGKLKPVFKKDGTTTAGNSSQVSDGAGAVLLMKRSVAMQKGLPVLGVFRTFAAVGVDPAI  332

Query  586  MGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIG  407
            MGIGPAVAIPAAVK+AGLELDDIDLFEINEAFASQ++YC+ KLGLDPEKINVNGGAMAIG
Sbjct  333  MGIGPAVAIPAAVKAAGLELDDIDLFEINEAFASQFVYCRNKLGLDPEKINVNGGAMAIG  392

Query  406  HPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVE  227
            HPLGATGARCVATLLHEMKRRGKDCR+GVVSMCIGTGMGAA VFERGD  DEL NARKVE
Sbjct  393  HPLGATGARCVATLLHEMKRRGKDCRFGVVSMCIGTGMGAAAVFERGDGVDELRNARKVE  452

Query  226  THGYLSKDAR  197
              G LSKDAR
Sbjct  453  AQGLLSKDAR  462



>emb|CDY37750.1| BnaA04g19180D [Brassica napus]
Length=462

 Score =   355 bits (911),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 171/190 (90%), Positives = 180/190 (95%), Gaps = 0/190 (0%)
 Frame = -3

Query  766  LAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAV  587
            L KLKPVFKKDGTTTAGNSSQV+DGAGAVLLMKRSLA QKGLP+LGVFRTFAAVGVDPA+
Sbjct  273  LGKLKPVFKKDGTTTAGNSSQVSDGAGAVLLMKRSLATQKGLPVLGVFRTFAAVGVDPAI  332

Query  586  MGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIG  407
            MG+GPAVAIPAAVK+AGLELDDIDLFEINEAFASQ+LYC+ KLGLD EK+NVNGGAMAIG
Sbjct  333  MGVGPAVAIPAAVKAAGLELDDIDLFEINEAFASQFLYCRNKLGLDEEKVNVNGGAMAIG  392

Query  406  HPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVE  227
            HPLGATGARCVATLLHEMKRRGKDCR+GVVSMCIGTGMGAA VFERGD  DEL NARKVE
Sbjct  393  HPLGATGARCVATLLHEMKRRGKDCRFGVVSMCIGTGMGAAAVFERGDGVDELRNARKVE  452

Query  226  THGYLSKDAR  197
              GYLSKDAR
Sbjct  453  AQGYLSKDAR  462



>ref|XP_009141289.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Brassica rapa]
Length=462

 Score =   355 bits (911),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 171/190 (90%), Positives = 180/190 (95%), Gaps = 0/190 (0%)
 Frame = -3

Query  766  LAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAV  587
            L KLKPVFKKDGTTTAGNSSQV+DGAGAVLLMKRSLA QKGLP+LGVFRTFAAVGVDPA+
Sbjct  273  LGKLKPVFKKDGTTTAGNSSQVSDGAGAVLLMKRSLATQKGLPVLGVFRTFAAVGVDPAI  332

Query  586  MGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIG  407
            MG+GPAVAIPAAVK+AGLELDDIDLFEINEAFASQ+LYC+ KLGLD EK+NVNGGAMAIG
Sbjct  333  MGVGPAVAIPAAVKAAGLELDDIDLFEINEAFASQFLYCRNKLGLDEEKVNVNGGAMAIG  392

Query  406  HPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVE  227
            HPLGATGARCVATLLHEMKRRGKDCR+GVVSMCIGTGMGAA VFERGD  DEL NARKVE
Sbjct  393  HPLGATGARCVATLLHEMKRRGKDCRFGVVSMCIGTGMGAAAVFERGDGVDELRNARKVE  452

Query  226  THGYLSKDAR  197
              GYLSKDAR
Sbjct  453  AQGYLSKDAR  462



>ref|XP_010556945.1| PREDICTED: LOW QUALITY PROTEIN: 3-ketoacyl-CoA thiolase 2, peroxisomal-like 
[Tarenaya hassleriana]
Length=463

 Score =   355 bits (910),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 169/192 (88%), Positives = 184/192 (96%), Gaps = 1/192 (1%)
 Frame = -3

Query  769  DLAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPA  590
            DLAKLKPVFKKDGTTTAGNSSQ++DGAGAVLLMKRS+A+QKGLPILGVFRTFAAVGVDPA
Sbjct  272  DLAKLKPVFKKDGTTTAGNSSQISDGAGAVLLMKRSVAMQKGLPILGVFRTFAAVGVDPA  331

Query  589  VMGIGPAVAIPAAVK-SAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMA  413
            +MG+GPAVAIP AVK +AGLELDDIDLFEINEAFASQ++YC+ KLGLDPE+INVNGGAMA
Sbjct  332  IMGVGPAVAIPGAVKQAAGLELDDIDLFEINEAFASQFVYCRNKLGLDPERINVNGGAMA  391

Query  412  IGHPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARK  233
            IGHPLGATGARCV TLLHEMKRRG+DCRYGVVSMCIGTGMGAA VFERGD  D+LSNARK
Sbjct  392  IGHPLGATGARCVGTLLHEMKRRGRDCRYGVVSMCIGTGMGAAAVFERGDGVDDLSNARK  451

Query  232  VETHGYLSKDAR  197
            VE HG+LSKD+R
Sbjct  452  VEAHGFLSKDSR  463



>ref|XP_006410451.1| hypothetical protein EUTSA_v10016622mg [Eutrema salsugineum]
 dbj|BAJ34444.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ51904.1| hypothetical protein EUTSA_v10016622mg [Eutrema salsugineum]
Length=462

 Score =   354 bits (909),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 171/190 (90%), Positives = 181/190 (95%), Gaps = 0/190 (0%)
 Frame = -3

Query  766  LAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAV  587
            L KLKPVFKKDGTTTAGNSSQV+DGAGAVLLMKRS+A+QKGLP+LGVFRTFAAVGVDPA+
Sbjct  273  LGKLKPVFKKDGTTTAGNSSQVSDGAGAVLLMKRSVAMQKGLPVLGVFRTFAAVGVDPAI  332

Query  586  MGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIG  407
            MGIGPAVAIPAAVK+AGLELDDIDLFEINEAFASQ++YC+ KLGLD EKINVNGGAMAIG
Sbjct  333  MGIGPAVAIPAAVKAAGLELDDIDLFEINEAFASQFVYCRNKLGLDAEKINVNGGAMAIG  392

Query  406  HPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVE  227
            HPLGATGARCVATLLHEMKRRGKDCR+GVVSMCIGTGMGAA VFERGD  DEL NARKVE
Sbjct  393  HPLGATGARCVATLLHEMKRRGKDCRFGVVSMCIGTGMGAAAVFERGDGVDELRNARKVE  452

Query  226  THGYLSKDAR  197
             HG LSKDAR
Sbjct  453  AHGLLSKDAR  462



>emb|CDY23766.1| BnaC04g43560D [Brassica napus]
Length=462

 Score =   354 bits (908),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 170/190 (89%), Positives = 180/190 (95%), Gaps = 0/190 (0%)
 Frame = -3

Query  766  LAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAV  587
            L KLKPVFKKDGTTTAGNSSQV+DGAGAVLLMKRS+A QKGLP+LGVFRTFAAVGVDPA+
Sbjct  273  LGKLKPVFKKDGTTTAGNSSQVSDGAGAVLLMKRSVATQKGLPVLGVFRTFAAVGVDPAI  332

Query  586  MGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIG  407
            MG+GPAVAIPAAVK+AGLELDDIDLFEINEAFASQ+LYC+ KLGLD EK+NVNGGAMAIG
Sbjct  333  MGVGPAVAIPAAVKAAGLELDDIDLFEINEAFASQFLYCRNKLGLDAEKVNVNGGAMAIG  392

Query  406  HPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVE  227
            HPLGATGARCVATLLHEMKRRGKDCR+GVVSMCIGTGMGAA VFERGD  DEL NARKVE
Sbjct  393  HPLGATGARCVATLLHEMKRRGKDCRFGVVSMCIGTGMGAAAVFERGDGVDELRNARKVE  452

Query  226  THGYLSKDAR  197
              GYLSKDAR
Sbjct  453  AQGYLSKDAR  462



>ref|XP_010413914.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Camelina sativa]
Length=462

 Score =   353 bits (907),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 170/190 (89%), Positives = 181/190 (95%), Gaps = 0/190 (0%)
 Frame = -3

Query  766  LAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAV  587
            L KLKPVFKKDGTTTAGNSSQV+DGAGAVLLMKRS+A+QKGLP+LGVFRTFAAVGVDPA+
Sbjct  273  LGKLKPVFKKDGTTTAGNSSQVSDGAGAVLLMKRSVAMQKGLPVLGVFRTFAAVGVDPAI  332

Query  586  MGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIG  407
            MGIGPAVAIPAAVK+AGLELDDIDLFEINEAFASQ++YC+ KLGLDPEKINVNGGA+AIG
Sbjct  333  MGIGPAVAIPAAVKAAGLELDDIDLFEINEAFASQFVYCRNKLGLDPEKINVNGGALAIG  392

Query  406  HPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVE  227
            HPLGATGARCVATLLHEMKRRGKDCR+GVVSMCIGTGMGAA VFERGD  DEL NARKVE
Sbjct  393  HPLGATGARCVATLLHEMKRRGKDCRFGVVSMCIGTGMGAAAVFERGDGVDELRNARKVE  452

Query  226  THGYLSKDAR  197
              G LSKDAR
Sbjct  453  AQGLLSKDAR  462



>gb|AGC24176.1| 3-ketoacyl-CoA thiolase 2 [Rehmannia glutinosa]
Length=464

 Score =   353 bits (907),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 168/191 (88%), Positives = 181/191 (95%), Gaps = 0/191 (0%)
 Frame = -3

Query  769  DLAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPA  590
            DL KLKPVFKKDG+TTAGNSSQV+DGAGAVLLMKRS+A+QKGLPILGVFR+FAAVGVDPA
Sbjct  274  DLGKLKPVFKKDGSTTAGNSSQVSDGAGAVLLMKRSVAMQKGLPILGVFRSFAAVGVDPA  333

Query  589  VMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAI  410
            +MG+GPAVAIPAAVKSAGLEL DIDLFEINEAFASQ++YC+KKL LDPEKINVNGGAMAI
Sbjct  334  IMGVGPAVAIPAAVKSAGLELGDIDLFEINEAFASQFVYCRKKLELDPEKINVNGGAMAI  393

Query  409  GHPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKV  230
            GHPLG TGARCV TLLHEMKRRGKDCR+GVVSMCIGTGMGAA VFERGD+CDELSN R V
Sbjct  394  GHPLGVTGARCVVTLLHEMKRRGKDCRFGVVSMCIGTGMGAAAVFERGDSCDELSNTRTV  453

Query  229  ETHGYLSKDAR  197
             TH +LSKDAR
Sbjct  454  GTHNFLSKDAR  464



>gb|KJB72150.1| hypothetical protein B456_011G161700 [Gossypium raimondii]
Length=464

 Score =   353 bits (907),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 169/191 (88%), Positives = 182/191 (95%), Gaps = 0/191 (0%)
 Frame = -3

Query  769  DLAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPA  590
            DL KLKPVFKK+GTTTAGNSSQV+DGAGAVLLMKRS+A++KGLPILGVFRTFAAVGVDPA
Sbjct  274  DLGKLKPVFKKNGTTTAGNSSQVSDGAGAVLLMKRSVAMRKGLPILGVFRTFAAVGVDPA  333

Query  589  VMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAI  410
            +MG+GPAVAIPAAVKSAGLELDD+DLFEINEAFASQ++YCQKKL LDP+KINVNGGAMAI
Sbjct  334  IMGVGPAVAIPAAVKSAGLELDDVDLFEINEAFASQFVYCQKKLELDPQKINVNGGAMAI  393

Query  409  GHPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKV  230
            GHPLG TGARCVATLLHEMKRRGKDCR+GVVSMCIGTGMGAA VFERGD  DEL NARKV
Sbjct  394  GHPLGVTGARCVATLLHEMKRRGKDCRFGVVSMCIGTGMGAAAVFERGDCVDELCNARKV  453

Query  229  ETHGYLSKDAR  197
            ET+  LSKDAR
Sbjct  454  ETNSLLSKDAR  464



>ref|XP_010509924.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Camelina 
sativa]
Length=462

 Score =   353 bits (906),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 170/190 (89%), Positives = 181/190 (95%), Gaps = 0/190 (0%)
 Frame = -3

Query  766  LAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAV  587
            L KLKPVFKKDGTTTAGNSSQV+DGAGAVLLMKRS+A+QKGLP+LGVFRTFAAVGVDPA+
Sbjct  273  LGKLKPVFKKDGTTTAGNSSQVSDGAGAVLLMKRSVAMQKGLPVLGVFRTFAAVGVDPAI  332

Query  586  MGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIG  407
            MGIGPAVAIPAAVK+AGLELDDIDLFEINEAFASQ++YC+ KLGLDPEKINVNGGA+AIG
Sbjct  333  MGIGPAVAIPAAVKAAGLELDDIDLFEINEAFASQFVYCRNKLGLDPEKINVNGGALAIG  392

Query  406  HPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVE  227
            HPLGATGARCVATLLHEMKRRGKDCR+GVVSMCIGTGMGAA VFERGD  DEL NARKVE
Sbjct  393  HPLGATGARCVATLLHEMKRRGKDCRFGVVSMCIGTGMGAAAVFERGDGVDELRNARKVE  452

Query  226  THGYLSKDAR  197
              G LSKDAR
Sbjct  453  AQGLLSKDAR  462



>ref|XP_011091395.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Sesamum indicum]
Length=464

 Score =   353 bits (906),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 169/191 (88%), Positives = 183/191 (96%), Gaps = 0/191 (0%)
 Frame = -3

Query  769  DLAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPA  590
            +L KLKPVFKKDG+TTAGNSSQV+DGAGAVLLMKRS+A+QKGLPILGVFR+FAAVGVDPA
Sbjct  274  ELGKLKPVFKKDGSTTAGNSSQVSDGAGAVLLMKRSVAMQKGLPILGVFRSFAAVGVDPA  333

Query  589  VMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAI  410
            +MG+GPAVAIPAAVKSAGLEL DIDLFEINEAFASQ++YC+KKL LD EKINVNGGAMAI
Sbjct  334  IMGVGPAVAIPAAVKSAGLELGDIDLFEINEAFASQFVYCRKKLELDAEKINVNGGAMAI  393

Query  409  GHPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKV  230
            GHPLGATGARCVATLLHEMKRRGKDCR+GVVSMCIGTGMGAAGVFERGD+CDEL N RKV
Sbjct  394  GHPLGATGARCVATLLHEMKRRGKDCRFGVVSMCIGTGMGAAGVFERGDSCDELCNVRKV  453

Query  229  ETHGYLSKDAR  197
            ET  +LSKDAR
Sbjct  454  ETQNFLSKDAR  464



>gb|EYU32624.1| hypothetical protein MIMGU_mgv1a005944mg [Erythranthe guttata]
Length=464

 Score =   353 bits (906),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 168/191 (88%), Positives = 180/191 (94%), Gaps = 0/191 (0%)
 Frame = -3

Query  769  DLAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPA  590
            DL KLKPVFKKDG+TTA NSSQV+DGAGAVLLMKRS+A+QKGLPILGVFR+F AVGVDPA
Sbjct  274  DLGKLKPVFKKDGSTTAANSSQVSDGAGAVLLMKRSIAMQKGLPILGVFRSFCAVGVDPA  333

Query  589  VMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAI  410
            +MGIGPAVAIPAAVK+AGLEL DIDLFEINEAFASQ+LYCQKKL LDP KINVNGGAMAI
Sbjct  334  IMGIGPAVAIPAAVKAAGLELGDIDLFEINEAFASQFLYCQKKLELDPAKINVNGGAMAI  393

Query  409  GHPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKV  230
            GHPLGATGARCVATLLHEMKRRGKDCR+G VSMCIGTGMGAA VFERGD+CDELSNARK+
Sbjct  394  GHPLGATGARCVATLLHEMKRRGKDCRFGAVSMCIGTGMGAAAVFERGDSCDELSNARKI  453

Query  229  ETHGYLSKDAR  197
            E   +LSKDAR
Sbjct  454  EAQNFLSKDAR  464



>ref|XP_010469514.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Camelina 
sativa]
Length=462

 Score =   353 bits (906),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 170/190 (89%), Positives = 181/190 (95%), Gaps = 0/190 (0%)
 Frame = -3

Query  766  LAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAV  587
            L KLKPVFKKDGTTTAGNSSQV+DGAGAVLLMKRS+A+QKGLP+LGVFRTFAAVGVDPA+
Sbjct  273  LGKLKPVFKKDGTTTAGNSSQVSDGAGAVLLMKRSVAMQKGLPVLGVFRTFAAVGVDPAI  332

Query  586  MGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIG  407
            MGIGPAVAIPAAVK+AGLELDDIDLFEINEAFASQ++YC+ KLGLDPEKINVNGGA+AIG
Sbjct  333  MGIGPAVAIPAAVKAAGLELDDIDLFEINEAFASQFVYCRNKLGLDPEKINVNGGALAIG  392

Query  406  HPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVE  227
            HPLGATGARCVATLLHEMKRRGKDCR+GVVSMCIGTGMGAA VFERGD  DEL NARKVE
Sbjct  393  HPLGATGARCVATLLHEMKRRGKDCRFGVVSMCIGTGMGAAAVFERGDGVDELRNARKVE  452

Query  226  THGYLSKDAR  197
              G LSKDAR
Sbjct  453  AQGLLSKDAR  462



>emb|CDY19452.1| BnaC04g11470D [Brassica napus]
Length=463

 Score =   353 bits (905),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 169/190 (89%), Positives = 181/190 (95%), Gaps = 0/190 (0%)
 Frame = -3

Query  766  LAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAV  587
            L KLKPVFKKDGTTTAGNSSQV+DGAGAVLLM+RS+A QKGLP+LGVFRTFAAVGVDPA+
Sbjct  274  LGKLKPVFKKDGTTTAGNSSQVSDGAGAVLLMRRSVATQKGLPVLGVFRTFAAVGVDPAI  333

Query  586  MGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIG  407
            MG+GPAVAIPAAVK+AGLELDDIDLFEINEAFASQ++YC+ KLGLD EKINVNGGAMAIG
Sbjct  334  MGVGPAVAIPAAVKAAGLELDDIDLFEINEAFASQFVYCRNKLGLDAEKINVNGGAMAIG  393

Query  406  HPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVE  227
            HPLGATGARCVATLLHEMKRRGKDCR+GVVSMCIGTGMGAA VFERGD  DEL NARKVE
Sbjct  394  HPLGATGARCVATLLHEMKRRGKDCRFGVVSMCIGTGMGAAAVFERGDGVDELRNARKVE  453

Query  226  THGYLSKDAR  197
            +HG LSKDAR
Sbjct  454  SHGLLSKDAR  463



>ref|XP_009143894.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Brassica rapa]
 emb|CDY17140.1| BnaA05g10480D [Brassica napus]
Length=462

 Score =   352 bits (904),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 169/190 (89%), Positives = 181/190 (95%), Gaps = 0/190 (0%)
 Frame = -3

Query  766  LAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAV  587
            L KLKPVFKKDGTTTAGNSSQV+DGAGAVLLM+RS+A QKGLP+LGVFRTFAAVGVDPA+
Sbjct  273  LGKLKPVFKKDGTTTAGNSSQVSDGAGAVLLMRRSVATQKGLPVLGVFRTFAAVGVDPAI  332

Query  586  MGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIG  407
            MG+GPAVAIPAAVK+AGLELDDIDLFEINEAFASQ++YC+ KLGLD EKINVNGGAMAIG
Sbjct  333  MGVGPAVAIPAAVKAAGLELDDIDLFEINEAFASQFVYCRNKLGLDAEKINVNGGAMAIG  392

Query  406  HPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVE  227
            HPLGATGARCVATLLHEMKRRGKDCR+GVVSMCIGTGMGAA VFERGD  DEL NARKVE
Sbjct  393  HPLGATGARCVATLLHEMKRRGKDCRFGVVSMCIGTGMGAAAVFERGDGVDELRNARKVE  452

Query  226  THGYLSKDAR  197
            +HG LSKDAR
Sbjct  453  SHGLLSKDAR  462



>emb|CAA63598.1| glyoxysomal beta-ketoacyl-thiolase [Brassica napus]
Length=462

 Score =   352 bits (904),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 169/190 (89%), Positives = 181/190 (95%), Gaps = 0/190 (0%)
 Frame = -3

Query  766  LAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAV  587
            L KLKPVFKKDGTTTAGNSSQV+DGAGAVLLM+RS+A QKGLP+LGVFRTFAAVGVDPA+
Sbjct  273  LGKLKPVFKKDGTTTAGNSSQVSDGAGAVLLMRRSVATQKGLPVLGVFRTFAAVGVDPAI  332

Query  586  MGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIG  407
            MG+GPAVAIPAAVK+AGLELDDIDLFEINEAFASQ++YC+ KLGLD EKINVNGGAMAIG
Sbjct  333  MGVGPAVAIPAAVKAAGLELDDIDLFEINEAFASQFVYCRNKLGLDAEKINVNGGAMAIG  392

Query  406  HPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVE  227
            HPLGATGARCVATLLHEMKRRGKDCR+GVVSMCIGTGMGAA VFERGD  DEL NARKVE
Sbjct  393  HPLGATGARCVATLLHEMKRRGKDCRFGVVSMCIGTGMGAAAVFERGDGVDELRNARKVE  452

Query  226  THGYLSKDAR  197
            +HG LSKDAR
Sbjct  453  SHGLLSKDAR  462



>ref|XP_002881265.1| hypothetical protein ARALYDRAFT_482251 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57524.1| hypothetical protein ARALYDRAFT_482251 [Arabidopsis lyrata subsp. 
lyrata]
Length=462

 Score =   352 bits (903),  Expect = 9e-116, Method: Compositional matrix adjust.
 Identities = 169/190 (89%), Positives = 181/190 (95%), Gaps = 0/190 (0%)
 Frame = -3

Query  766  LAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAV  587
            L KLKPVFKKDGTTTAGNSSQV+DGAGAVLLMKRS+A+QKGLP+LGVFRTFAAVGVDPA+
Sbjct  273  LGKLKPVFKKDGTTTAGNSSQVSDGAGAVLLMKRSVAMQKGLPVLGVFRTFAAVGVDPAI  332

Query  586  MGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIG  407
            MGIGPAVAIPAAVK+AGLELDDIDLFEINEAFASQ++YC+ KLGL+PEKINVNGGAMAIG
Sbjct  333  MGIGPAVAIPAAVKAAGLELDDIDLFEINEAFASQFVYCRNKLGLNPEKINVNGGAMAIG  392

Query  406  HPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVE  227
            HPLGATGARCVATLLHEMKRRGKDCR+GVVSMCIGTGMGAA VFERGD  DEL NA+KVE
Sbjct  393  HPLGATGARCVATLLHEMKRRGKDCRFGVVSMCIGTGMGAAAVFERGDGVDELRNAKKVE  452

Query  226  THGYLSKDAR  197
              G LSKDAR
Sbjct  453  AQGLLSKDAR  462



>ref|XP_009132912.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Brassica 
rapa]
Length=460

 Score =   352 bits (902),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 168/190 (88%), Positives = 180/190 (95%), Gaps = 0/190 (0%)
 Frame = -3

Query  766  LAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAV  587
            L KLKPVFKKDGTTTAGNSSQV+DGAGAVLLM+RS+A QKGLP+LGVFRTFAAVGVDPA+
Sbjct  271  LGKLKPVFKKDGTTTAGNSSQVSDGAGAVLLMRRSVATQKGLPVLGVFRTFAAVGVDPAI  330

Query  586  MGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIG  407
            MG+GPAVAIPAAVK+AGLELDDIDLFEINEAFASQ++YC+ KLGLD EKINVNGGAMAIG
Sbjct  331  MGVGPAVAIPAAVKAAGLELDDIDLFEINEAFASQFVYCRNKLGLDAEKINVNGGAMAIG  390

Query  406  HPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVE  227
            HPLGATGARCVATLLHEMKRRGKDCR+GVVSMCIGTGMGAA VFERGD  DEL NARKVE
Sbjct  391  HPLGATGARCVATLLHEMKRRGKDCRFGVVSMCIGTGMGAAAVFERGDGVDELRNARKVE  450

Query  226  THGYLSKDAR  197
              G+LSKDAR
Sbjct  451  AQGFLSKDAR  460



>emb|CDX84701.1| BnaA03g15290D [Brassica napus]
Length=462

 Score =   351 bits (900),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 168/190 (88%), Positives = 180/190 (95%), Gaps = 0/190 (0%)
 Frame = -3

Query  766  LAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAV  587
            L KLKPVFKKDGTTTAGNSSQV+DGAGAVLLM+RS+A QKGLP+LGVFRTFAAVGVDPA+
Sbjct  273  LGKLKPVFKKDGTTTAGNSSQVSDGAGAVLLMRRSVATQKGLPVLGVFRTFAAVGVDPAI  332

Query  586  MGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIG  407
            MG+GPAVAIPAAVK+AGLELDDIDLFEINEAFASQ++YC+ KLGLD EKINVNGGAMAIG
Sbjct  333  MGVGPAVAIPAAVKAAGLELDDIDLFEINEAFASQFVYCRNKLGLDAEKINVNGGAMAIG  392

Query  406  HPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVE  227
            HPLGATGARCVATLLHEMKRRGKDCR+GVVSMCIGTGMGAA VFERGD  DEL NARKVE
Sbjct  393  HPLGATGARCVATLLHEMKRRGKDCRFGVVSMCIGTGMGAAAVFERGDGVDELRNARKVE  452

Query  226  THGYLSKDAR  197
              G+LSKDAR
Sbjct  453  AQGFLSKDAR  462



>ref|XP_007034450.1| Peroxisomal 3-ketoacyl-CoA thiolase 3 isoform 2 [Theobroma cacao]
 gb|EOY05376.1| Peroxisomal 3-ketoacyl-CoA thiolase 3 isoform 2 [Theobroma cacao]
Length=355

 Score =   345 bits (886),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 165/190 (87%), Positives = 182/190 (96%), Gaps = 0/190 (0%)
 Frame = -3

Query  769  DLAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPA  590
            DLAKL+PVFKKDG+TTAGNSSQV+DGAGAVLLMKRS+A+ KGLPILGVFRTFAAVGVDPA
Sbjct  165  DLAKLRPVFKKDGSTTAGNSSQVSDGAGAVLLMKRSVAMLKGLPILGVFRTFAAVGVDPA  224

Query  589  VMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAI  410
            +MG+GPAVAIPAAVK+AGLELDDIDL+EINEAFASQ++YC+KKL LDP+KINVNG AMAI
Sbjct  225  IMGVGPAVAIPAAVKAAGLELDDIDLYEINEAFASQFVYCRKKLELDPKKINVNGAAMAI  284

Query  409  GHPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKV  230
            GHPLGATGARCVATLLHEMKRRGKDCR+GV+SMCIGTGMGAA VFERGD  DEL NARKV
Sbjct  285  GHPLGATGARCVATLLHEMKRRGKDCRFGVISMCIGTGMGAAAVFERGDHTDELCNARKV  344

Query  229  ETHGYLSKDA  200
            ET+ +LSKDA
Sbjct  345  ETNSFLSKDA  354



>gb|KDO43605.1| hypothetical protein CISIN_1g012506mg [Citrus sinensis]
 gb|KDO43606.1| hypothetical protein CISIN_1g012506mg [Citrus sinensis]
 gb|KDO43607.1| hypothetical protein CISIN_1g012506mg [Citrus sinensis]
Length=345

 Score =   345 bits (885),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 163/189 (86%), Positives = 181/189 (96%), Gaps = 0/189 (0%)
 Frame = -3

Query  769  DLAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPA  590
            +LAKLKPVFKKDGTTTAGNSSQV+DGAGAVLLMKRS+A++KGLPILGVFRTFAAVGVDPA
Sbjct  155  ELAKLKPVFKKDGTTTAGNSSQVSDGAGAVLLMKRSVAMRKGLPILGVFRTFAAVGVDPA  214

Query  589  VMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAI  410
            +MG+GPAVAIPAAVKSAGL+LDDIDLFEINEAFASQ++YC+ KLGLDPEKINVNGGA+AI
Sbjct  215  IMGVGPAVAIPAAVKSAGLQLDDIDLFEINEAFASQFVYCRNKLGLDPEKINVNGGALAI  274

Query  409  GHPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKV  230
            GHPLG TGARCVATLLHEMKRRG+DCR+GV+SMCIGTGMGAA VFERGD  DEL N RKV
Sbjct  275  GHPLGTTGARCVATLLHEMKRRGRDCRFGVISMCIGTGMGAAAVFERGDCADELCNVRKV  334

Query  229  ETHGYLSKD  203
            E++ +LSKD
Sbjct  335  ESNNFLSKD  343



>gb|KHG05724.1| 3-ketoacyl-CoA thiolase 2, peroxisomal -like protein [Gossypium 
arboreum]
Length=464

 Score =   349 bits (895),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 168/191 (88%), Positives = 180/191 (94%), Gaps = 0/191 (0%)
 Frame = -3

Query  769  DLAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPA  590
            DL KLKPVFKK+GTTTAGNSSQV+DGAGAVLLMKRS+A+ KGLPILGVFRTF AVGVDPA
Sbjct  274  DLGKLKPVFKKNGTTTAGNSSQVSDGAGAVLLMKRSVAMCKGLPILGVFRTFCAVGVDPA  333

Query  589  VMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAI  410
            +MG+GPAVAIPAAVKSAGLELDD+DLFEINEAFASQ++YCQKKL LDP+KINVNGGAMAI
Sbjct  334  IMGVGPAVAIPAAVKSAGLELDDVDLFEINEAFASQFVYCQKKLELDPQKINVNGGAMAI  393

Query  409  GHPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKV  230
            GHPLGATGARCVATLLHEMKRRGKDCR+GVVSMCIGTGMGAA V ERGD  DEL NARKV
Sbjct  394  GHPLGATGARCVATLLHEMKRRGKDCRFGVVSMCIGTGMGAAAVLERGDCVDELCNARKV  453

Query  229  ETHGYLSKDAR  197
            ET+  LSKDAR
Sbjct  454  ETNSLLSKDAR  464



>ref|XP_011073762.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Sesamum 
indicum]
Length=464

 Score =   349 bits (895),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 165/191 (86%), Positives = 180/191 (94%), Gaps = 0/191 (0%)
 Frame = -3

Query  769  DLAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPA  590
            DL KLKPVFKKDG+TTAGNSSQV+DGA AVLLMKRS+A+QK LPILGVFR+FAAVGVDPA
Sbjct  274  DLGKLKPVFKKDGSTTAGNSSQVSDGAAAVLLMKRSVAMQKRLPILGVFRSFAAVGVDPA  333

Query  589  VMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAI  410
            +MG+GPAVAIPAAVKSAGLEL DIDLFEINEAFASQ++YC+KKL LDPEKINVNGGAMAI
Sbjct  334  IMGVGPAVAIPAAVKSAGLELGDIDLFEINEAFASQFVYCRKKLELDPEKINVNGGAMAI  393

Query  409  GHPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKV  230
            GHPLG TGARCVATLLHEMKRRGKDCR+GV+SMCIGTGMGAA VFERGD+CDEL N R V
Sbjct  394  GHPLGTTGARCVATLLHEMKRRGKDCRFGVISMCIGTGMGAAAVFERGDSCDELCNVRTV  453

Query  229  ETHGYLSKDAR  197
            +TH +LSKDAR
Sbjct  454  QTHNFLSKDAR  464



>emb|CDX79511.1| BnaC03g18470D [Brassica napus]
Length=462

 Score =   349 bits (895),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 167/190 (88%), Positives = 180/190 (95%), Gaps = 0/190 (0%)
 Frame = -3

Query  766  LAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAV  587
            L KLKPVFKKDGTTTAGNSSQV+DGAGAVLLM+RS+A +KGLP+LGVFRTFAAVGVDPA+
Sbjct  273  LGKLKPVFKKDGTTTAGNSSQVSDGAGAVLLMRRSVATRKGLPVLGVFRTFAAVGVDPAI  332

Query  586  MGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIG  407
            MG+GPAVAIPAAVK+AGLELDDIDLFEINEAFASQ++YC+ KLGLD EKINVNGGAMAIG
Sbjct  333  MGVGPAVAIPAAVKAAGLELDDIDLFEINEAFASQFVYCRNKLGLDAEKINVNGGAMAIG  392

Query  406  HPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVE  227
            HPLGATGARCVATLLHEMKRRGKDCR+GVVSMCIGTGMGAA VFERGD  DEL NARKVE
Sbjct  393  HPLGATGARCVATLLHEMKRRGKDCRFGVVSMCIGTGMGAAAVFERGDGVDELRNARKVE  452

Query  226  THGYLSKDAR  197
              G+LSKDAR
Sbjct  453  AQGFLSKDAR  462



>ref|XP_010069076.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Eucalyptus 
grandis]
 gb|KCW57291.1| hypothetical protein EUGRSUZ_H00090 [Eucalyptus grandis]
Length=464

 Score =   349 bits (895),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 167/191 (87%), Positives = 183/191 (96%), Gaps = 0/191 (0%)
 Frame = -3

Query  769  DLAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPA  590
            DLAKLKPVFKKDG TTAGNSSQV+DGAGAVLLMKRSLA++KGLPILGVFRTFAAVGVDPA
Sbjct  274  DLAKLKPVFKKDGCTTAGNSSQVSDGAGAVLLMKRSLAMEKGLPILGVFRTFAAVGVDPA  333

Query  589  VMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAI  410
            +MG+GPAVAIPAAVK+AGLELDDIDLFEINEAFASQ++YC+ KLGL+PEK+NVNGGAMA+
Sbjct  334  IMGVGPAVAIPAAVKAAGLELDDIDLFEINEAFASQFVYCRNKLGLEPEKVNVNGGAMAM  393

Query  409  GHPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKV  230
            GHPLGATGARCVATLLHEMKRRGKDCR+GV+SMCIGTGMGAA V ERGD+ DELSNARKV
Sbjct  394  GHPLGATGARCVATLLHEMKRRGKDCRFGVISMCIGTGMGAAAVLERGDSVDELSNARKV  453

Query  229  ETHGYLSKDAR  197
             T+  LSKDAR
Sbjct  454  GTNSLLSKDAR  464



>ref|XP_008457258.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Cucumis 
melo]
Length=461

 Score =   348 bits (894),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 166/190 (87%), Positives = 181/190 (95%), Gaps = 0/190 (0%)
 Frame = -3

Query  772  GDLAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDP  593
            GDLAKLKPVFKKDG+TTAGN+SQV+DGAGAVLLMKRS+A++KGLPILGVFRTFAAVGVDP
Sbjct  270  GDLAKLKPVFKKDGSTTAGNASQVSDGAGAVLLMKRSVAMKKGLPILGVFRTFAAVGVDP  329

Query  592  AVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMA  413
            A+MGIGPAVAIPAAVK+AGLELDDIDLFEINEAFASQ++YC+ KL L+PEKINVNGGAMA
Sbjct  330  AIMGIGPAVAIPAAVKAAGLELDDIDLFEINEAFASQFVYCRNKLELNPEKINVNGGAMA  389

Query  412  IGHPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARK  233
            IGHPLGATGARCVATLLHEMKRRGKDCR+GV+SMCIGTGMGAA VFERGD  DEL NARK
Sbjct  390  IGHPLGATGARCVATLLHEMKRRGKDCRFGVISMCIGTGMGAAAVFERGDVADELCNARK  449

Query  232  VETHGYLSKD  203
            V+ H  LSKD
Sbjct  450  VDNHNLLSKD  459



>ref|XP_007225741.1| hypothetical protein PRUPE_ppa005421mg [Prunus persica]
 gb|EMJ26940.1| hypothetical protein PRUPE_ppa005421mg [Prunus persica]
Length=429

 Score =   347 bits (890),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 166/191 (87%), Positives = 183/191 (96%), Gaps = 0/191 (0%)
 Frame = -3

Query  769  DLAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPA  590
            DLAKLKPVFKKDG+TTAGNSSQV+DGAGAVLLMKRS+A +KGLPILGVFR+F+AVGVDPA
Sbjct  239  DLAKLKPVFKKDGSTTAGNSSQVSDGAGAVLLMKRSIAERKGLPILGVFRSFSAVGVDPA  298

Query  589  VMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAI  410
            +MG+GPAVAIPAAVK+AGLELDDIDLFEINEAFASQY+YC+ KLGLDPEKINVNGGA+AI
Sbjct  299  IMGVGPAVAIPAAVKAAGLELDDIDLFEINEAFASQYVYCRNKLGLDPEKINVNGGALAI  358

Query  409  GHPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKV  230
            GHPLGATGAR VATLLHEMKRRGKDCR+GV+SMCIGTGMGAA VFERGD+ DEL NARKV
Sbjct  359  GHPLGATGARAVATLLHEMKRRGKDCRFGVISMCIGTGMGAAAVFERGDSTDELCNARKV  418

Query  229  ETHGYLSKDAR  197
            E+  +LSKDAR
Sbjct  419  ESLNHLSKDAR  429



>emb|CAN81585.1| hypothetical protein VITISV_023191 [Vitis vinifera]
Length=461

 Score =   348 bits (893),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 169/191 (88%), Positives = 180/191 (94%), Gaps = 0/191 (0%)
 Frame = -3

Query  769  DLAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPA  590
            DLAKLKPVFKK+GTTTAGNSSQV+DGAGAVLLMKRS+A++KGLPILGVFRTFAAVGVDPA
Sbjct  271  DLAKLKPVFKKNGTTTAGNSSQVSDGAGAVLLMKRSVAMRKGLPILGVFRTFAAVGVDPA  330

Query  589  VMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAI  410
            VMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQ++YC+KKL LDPEKINVNGGAMAI
Sbjct  331  VMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQFVYCRKKLDLDPEKINVNGGAMAI  390

Query  409  GHPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKV  230
            GHPLGATGARCV TLLHEMKRRGKDCR+GVVSMCIGTGMGAA VFERGD  DEL NAR  
Sbjct  391  GHPLGATGARCVGTLLHEMKRRGKDCRFGVVSMCIGTGMGAAAVFERGDCVDELRNARTA  450

Query  229  ETHGYLSKDAR  197
            E +  LSKDA+
Sbjct  451  ENNNLLSKDAQ  461



>ref|XP_002285653.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Vitis vinifera]
 emb|CBI33354.3| unnamed protein product [Vitis vinifera]
Length=461

 Score =   348 bits (893),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 169/191 (88%), Positives = 180/191 (94%), Gaps = 0/191 (0%)
 Frame = -3

Query  769  DLAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPA  590
            DLAKLKPVFKK+GTTTAGNSSQV+DGAGAVLLMKRS+A++KGLPILGVFRTFAAVGVDPA
Sbjct  271  DLAKLKPVFKKNGTTTAGNSSQVSDGAGAVLLMKRSVAMRKGLPILGVFRTFAAVGVDPA  330

Query  589  VMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAI  410
            VMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQ++YC+KKL LDPEKINVNGGAMAI
Sbjct  331  VMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQFVYCRKKLDLDPEKINVNGGAMAI  390

Query  409  GHPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKV  230
            GHPLGATGARCV TLLHEMKRRGKDCR+GVVSMCIGTGMGAA VFERGD  DEL NAR  
Sbjct  391  GHPLGATGARCVGTLLHEMKRRGKDCRFGVVSMCIGTGMGAAAVFERGDCVDELRNARTA  450

Query  229  ETHGYLSKDAR  197
            E +  LSKDA+
Sbjct  451  ENNNLLSKDAQ  461



>ref|XP_002518136.1| 3-ketoacyl-CoA thiolase B, putative [Ricinus communis]
 gb|EEF44269.1| 3-ketoacyl-CoA thiolase B, putative [Ricinus communis]
Length=460

 Score =   348 bits (893),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 167/190 (88%), Positives = 181/190 (95%), Gaps = 0/190 (0%)
 Frame = -3

Query  769  DLAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPA  590
            DL KLKPVFKKDGTTTAGNSSQV+DGAGAVLLMKR +A+ KGLPILGVFR+FAAVGVDPA
Sbjct  270  DLGKLKPVFKKDGTTTAGNSSQVSDGAGAVLLMKRCVAMHKGLPILGVFRSFAAVGVDPA  329

Query  589  VMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAI  410
            +MGIGPAVAIPAAVK+AGLEL+DIDLFEINEAFASQ++YC+KKL LDPE+INVNGGAMAI
Sbjct  330  IMGIGPAVAIPAAVKAAGLELNDIDLFEINEAFASQFVYCRKKLELDPERINVNGGAMAI  389

Query  409  GHPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKV  230
            GHPLGATGARCVATLLHEMKRRG+DCR+GVVSMCIGTGMGAA VFERGDACD+L NARKV
Sbjct  390  GHPLGATGARCVATLLHEMKRRGRDCRFGVVSMCIGTGMGAAAVFERGDACDDLCNARKV  449

Query  229  ETHGYLSKDA  200
            ET   LSKDA
Sbjct  450  ETSNLLSKDA  459



>gb|KDO43604.1| hypothetical protein CISIN_1g012506mg [Citrus sinensis]
Length=388

 Score =   345 bits (886),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 163/189 (86%), Positives = 181/189 (96%), Gaps = 0/189 (0%)
 Frame = -3

Query  769  DLAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPA  590
            +LAKLKPVFKKDGTTTAGNSSQV+DGAGAVLLMKRS+A++KGLPILGVFRTFAAVGVDPA
Sbjct  198  ELAKLKPVFKKDGTTTAGNSSQVSDGAGAVLLMKRSVAMRKGLPILGVFRTFAAVGVDPA  257

Query  589  VMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAI  410
            +MG+GPAVAIPAAVKSAGL+LDDIDLFEINEAFASQ++YC+ KLGLDPEKINVNGGA+AI
Sbjct  258  IMGVGPAVAIPAAVKSAGLQLDDIDLFEINEAFASQFVYCRNKLGLDPEKINVNGGALAI  317

Query  409  GHPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKV  230
            GHPLG TGARCVATLLHEMKRRG+DCR+GV+SMCIGTGMGAA VFERGD  DEL N RKV
Sbjct  318  GHPLGTTGARCVATLLHEMKRRGRDCRFGVISMCIGTGMGAAAVFERGDCADELCNVRKV  377

Query  229  ETHGYLSKD  203
            E++ +LSKD
Sbjct  378  ESNNFLSKD  386



>gb|KDP20330.1| hypothetical protein JCGZ_06416 [Jatropha curcas]
Length=462

 Score =   348 bits (893),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 169/190 (89%), Positives = 180/190 (95%), Gaps = 0/190 (0%)
 Frame = -3

Query  769  DLAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPA  590
            DLAKLKPVFKKDGTTTAGNSSQ+TDGAGAVLLMKRS+A++KGLPILGVFRTFAAVGVDPA
Sbjct  272  DLAKLKPVFKKDGTTTAGNSSQITDGAGAVLLMKRSVAMRKGLPILGVFRTFAAVGVDPA  331

Query  589  VMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAI  410
            +MG+GPAVAIPAAVKSAGLEL DIDLFEINEAFASQ++YC+KKL LD EKINVNGGAMAI
Sbjct  332  IMGVGPAVAIPAAVKSAGLELGDIDLFEINEAFASQFVYCRKKLELDSEKINVNGGAMAI  391

Query  409  GHPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKV  230
            GHPLGATGARCVATLLHEMKRRG+DCR+GVVSMCIGTGMGAA VFERGD CDEL NARK 
Sbjct  392  GHPLGATGARCVATLLHEMKRRGRDCRFGVVSMCIGTGMGAAAVFERGDGCDELCNARKA  451

Query  229  ETHGYLSKDA  200
            ET   LSKDA
Sbjct  452  ETDKLLSKDA  461



>ref|XP_004138952.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Cucumis 
sativus]
 gb|KGN61456.1| hypothetical protein Csa_2G129150 [Cucumis sativus]
Length=461

 Score =   348 bits (892),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 166/189 (88%), Positives = 180/189 (95%), Gaps = 0/189 (0%)
 Frame = -3

Query  769  DLAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPA  590
            DLAKLKPVFKKDG+TTAGN+SQV+DGAGAVLLMKRS+AI+KGLPILGVFRTFAAVGVDPA
Sbjct  271  DLAKLKPVFKKDGSTTAGNASQVSDGAGAVLLMKRSVAIKKGLPILGVFRTFAAVGVDPA  330

Query  589  VMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAI  410
            +MG+GPAVAIPAAVK+AGLELDDIDLFEINEAFASQ++YC+ KL LDPEKINVNGGAMAI
Sbjct  331  IMGVGPAVAIPAAVKAAGLELDDIDLFEINEAFASQFVYCRNKLELDPEKINVNGGAMAI  390

Query  409  GHPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKV  230
            GHPLGATGARCVATLLHEMKRRGKDCR+GV+SMCIGTGMGAA VFERGD  DEL NARKV
Sbjct  391  GHPLGATGARCVATLLHEMKRRGKDCRFGVISMCIGTGMGAAAVFERGDVADELCNARKV  450

Query  229  ETHGYLSKD  203
            + H  LSKD
Sbjct  451  DNHNLLSKD  459



>gb|EPS68937.1| hypothetical protein M569_05826, partial [Genlisea aurea]
Length=457

 Score =   348 bits (892),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 162/195 (83%), Positives = 183/195 (94%), Gaps = 0/195 (0%)
 Frame = -3

Query  784  KCKYGDLAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAV  605
            +    +L KLKPVFKKDG+TTAGNSSQV+DGAGAVLLMKRS+A QKGLPILGVFR+FAAV
Sbjct  263  QTSVSELGKLKPVFKKDGSTTAGNSSQVSDGAGAVLLMKRSVAAQKGLPILGVFRSFAAV  322

Query  604  GVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNG  425
            GVDPA+MGIGPAVAIPAAVK+AGLE+ DIDL+EINEAFASQ++YC+KKL LDPEKINVNG
Sbjct  323  GVDPAIMGIGPAVAIPAAVKAAGLEISDIDLYEINEAFASQFVYCRKKLELDPEKINVNG  382

Query  424  GAMAIGHPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELS  245
            GA+AIGHPLGATGARCV TLLHEMKRRG+DCR+GV+SMCIGTGMGAA VFERGD+CDELS
Sbjct  383  GAIAIGHPLGATGARCVGTLLHEMKRRGRDCRFGVISMCIGTGMGAAAVFERGDSCDELS  442

Query  244  NARKVETHGYLSKDA  200
            NARK+E H +LS+DA
Sbjct  443  NARKIERHNFLSRDA  457



>ref|XP_004296638.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Fragaria vesca 
subsp. vesca]
Length=458

 Score =   348 bits (892),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 167/191 (87%), Positives = 180/191 (94%), Gaps = 0/191 (0%)
 Frame = -3

Query  769  DLAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPA  590
            DLAKLKPVFKKDGTTTAGNSSQV+DGAGAVLLMKRS+A QKGLPILGVFR+F AVGVDPA
Sbjct  268  DLAKLKPVFKKDGTTTAGNSSQVSDGAGAVLLMKRSVADQKGLPILGVFRSFVAVGVDPA  327

Query  589  VMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAI  410
            +MG+GPA AIP AVK+AGLELDDIDLFEINEAFASQ++YC+ KLGLDPEKINVNGGAMAI
Sbjct  328  IMGVGPAAAIPVAVKAAGLELDDIDLFEINEAFASQFVYCRNKLGLDPEKINVNGGAMAI  387

Query  409  GHPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKV  230
            GHPLGATGARCVATLLHEMKRRGKDCRYGV+SMCIGTGMGAA VFERGD  DEL NARKV
Sbjct  388  GHPLGATGARCVATLLHEMKRRGKDCRYGVISMCIGTGMGAAAVFERGDRTDELCNARKV  447

Query  229  ETHGYLSKDAR  197
            ++  +LSKDAR
Sbjct  448  DSLNFLSKDAR  458



>ref|XP_007225742.1| hypothetical protein PRUPE_ppa005421mg [Prunus persica]
 gb|EMJ26941.1| hypothetical protein PRUPE_ppa005421mg [Prunus persica]
Length=462

 Score =   347 bits (891),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 166/191 (87%), Positives = 183/191 (96%), Gaps = 0/191 (0%)
 Frame = -3

Query  769  DLAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPA  590
            DLAKLKPVFKKDG+TTAGNSSQV+DGAGAVLLMKRS+A +KGLPILGVFR+F+AVGVDPA
Sbjct  272  DLAKLKPVFKKDGSTTAGNSSQVSDGAGAVLLMKRSIAERKGLPILGVFRSFSAVGVDPA  331

Query  589  VMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAI  410
            +MG+GPAVAIPAAVK+AGLELDDIDLFEINEAFASQY+YC+ KLGLDPEKINVNGGA+AI
Sbjct  332  IMGVGPAVAIPAAVKAAGLELDDIDLFEINEAFASQYVYCRNKLGLDPEKINVNGGALAI  391

Query  409  GHPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKV  230
            GHPLGATGAR VATLLHEMKRRGKDCR+GV+SMCIGTGMGAA VFERGD+ DEL NARKV
Sbjct  392  GHPLGATGARAVATLLHEMKRRGKDCRFGVISMCIGTGMGAAAVFERGDSTDELCNARKV  451

Query  229  ETHGYLSKDAR  197
            E+  +LSKDAR
Sbjct  452  ESLNHLSKDAR  462



>gb|KDO43600.1| hypothetical protein CISIN_1g012506mg [Citrus sinensis]
Length=438

 Score =   346 bits (888),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 163/189 (86%), Positives = 181/189 (96%), Gaps = 0/189 (0%)
 Frame = -3

Query  769  DLAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPA  590
            +LAKLKPVFKKDGTTTAGNSSQV+DGAGAVLLMKRS+A++KGLPILGVFRTFAAVGVDPA
Sbjct  248  ELAKLKPVFKKDGTTTAGNSSQVSDGAGAVLLMKRSVAMRKGLPILGVFRTFAAVGVDPA  307

Query  589  VMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAI  410
            +MG+GPAVAIPAAVKSAGL+LDDIDLFEINEAFASQ++YC+ KLGLDPEKINVNGGA+AI
Sbjct  308  IMGVGPAVAIPAAVKSAGLQLDDIDLFEINEAFASQFVYCRNKLGLDPEKINVNGGALAI  367

Query  409  GHPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKV  230
            GHPLG TGARCVATLLHEMKRRG+DCR+GV+SMCIGTGMGAA VFERGD  DEL N RKV
Sbjct  368  GHPLGTTGARCVATLLHEMKRRGRDCRFGVISMCIGTGMGAAAVFERGDCADELCNVRKV  427

Query  229  ETHGYLSKD  203
            E++ +LSKD
Sbjct  428  ESNNFLSKD  436



>ref|XP_007034449.1| Peroxisomal 3-ketoacyl-CoA thiolase 3 isoform 1 [Theobroma cacao]
 gb|EOY05375.1| Peroxisomal 3-ketoacyl-CoA thiolase 3 isoform 1 [Theobroma cacao]
Length=464

 Score =   347 bits (890),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 165/190 (87%), Positives = 182/190 (96%), Gaps = 0/190 (0%)
 Frame = -3

Query  769  DLAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPA  590
            DLAKL+PVFKKDG+TTAGNSSQV+DGAGAVLLMKRS+A+ KGLPILGVFRTFAAVGVDPA
Sbjct  274  DLAKLRPVFKKDGSTTAGNSSQVSDGAGAVLLMKRSVAMLKGLPILGVFRTFAAVGVDPA  333

Query  589  VMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAI  410
            +MG+GPAVAIPAAVK+AGLELDDIDL+EINEAFASQ++YC+KKL LDP+KINVNG AMAI
Sbjct  334  IMGVGPAVAIPAAVKAAGLELDDIDLYEINEAFASQFVYCRKKLELDPKKINVNGAAMAI  393

Query  409  GHPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKV  230
            GHPLGATGARCVATLLHEMKRRGKDCR+GV+SMCIGTGMGAA VFERGD  DEL NARKV
Sbjct  394  GHPLGATGARCVATLLHEMKRRGKDCRFGVISMCIGTGMGAAAVFERGDHTDELCNARKV  453

Query  229  ETHGYLSKDA  200
            ET+ +LSKDA
Sbjct  454  ETNSFLSKDA  463



>ref|XP_008224585.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Prunus mume]
Length=462

 Score =   347 bits (889),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 165/191 (86%), Positives = 183/191 (96%), Gaps = 0/191 (0%)
 Frame = -3

Query  769  DLAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPA  590
            DLAKLKPVFKKDG+TTAGNSSQV+DGAGAVLLMKRS+A +KGLPILGVFR+F+AVGVDPA
Sbjct  272  DLAKLKPVFKKDGSTTAGNSSQVSDGAGAVLLMKRSIAERKGLPILGVFRSFSAVGVDPA  331

Query  589  VMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAI  410
            +MG+GPAVAIPAAVK+AGLELDDIDLFEINEAFASQY+YC+ KLGLDPEKINVNGGA+AI
Sbjct  332  IMGVGPAVAIPAAVKAAGLELDDIDLFEINEAFASQYVYCRNKLGLDPEKINVNGGALAI  391

Query  409  GHPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKV  230
            GHPLGATGAR VATLLHEMKRRG+DCR+GV+SMCIGTGMGAA VFERGD+ DEL NARKV
Sbjct  392  GHPLGATGARAVATLLHEMKRRGRDCRFGVISMCIGTGMGAAAVFERGDSTDELCNARKV  451

Query  229  ETHGYLSKDAR  197
            E+  +LSKDAR
Sbjct  452  ESPNHLSKDAR  462



>gb|KDO43599.1| hypothetical protein CISIN_1g012506mg [Citrus sinensis]
Length=445

 Score =   346 bits (888),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 163/189 (86%), Positives = 181/189 (96%), Gaps = 0/189 (0%)
 Frame = -3

Query  769  DLAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPA  590
            +LAKLKPVFKKDGTTTAGNSSQV+DGAGAVLLMKRS+A++KGLPILGVFRTFAAVGVDPA
Sbjct  255  ELAKLKPVFKKDGTTTAGNSSQVSDGAGAVLLMKRSVAMRKGLPILGVFRTFAAVGVDPA  314

Query  589  VMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAI  410
            +MG+GPAVAIPAAVKSAGL+LDDIDLFEINEAFASQ++YC+ KLGLDPEKINVNGGA+AI
Sbjct  315  IMGVGPAVAIPAAVKSAGLQLDDIDLFEINEAFASQFVYCRNKLGLDPEKINVNGGALAI  374

Query  409  GHPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKV  230
            GHPLG TGARCVATLLHEMKRRG+DCR+GV+SMCIGTGMGAA VFERGD  DEL N RKV
Sbjct  375  GHPLGTTGARCVATLLHEMKRRGRDCRFGVISMCIGTGMGAAAVFERGDCADELCNVRKV  434

Query  229  ETHGYLSKD  203
            E++ +LSKD
Sbjct  435  ESNNFLSKD  443



>ref|XP_006420604.1| hypothetical protein CICLE_v10004931mg [Citrus clementina]
 ref|XP_006489799.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Citrus 
sinensis]
 gb|ESR33844.1| hypothetical protein CICLE_v10004931mg [Citrus clementina]
 gb|KDO43598.1| hypothetical protein CISIN_1g012506mg [Citrus sinensis]
Length=462

 Score =   346 bits (888),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 163/189 (86%), Positives = 181/189 (96%), Gaps = 0/189 (0%)
 Frame = -3

Query  769  DLAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPA  590
            +LAKLKPVFKKDGTTTAGNSSQV+DGAGAVLLMKRS+A++KGLPILGVFRTFAAVGVDPA
Sbjct  272  ELAKLKPVFKKDGTTTAGNSSQVSDGAGAVLLMKRSVAMRKGLPILGVFRTFAAVGVDPA  331

Query  589  VMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAI  410
            +MG+GPAVAIPAAVKSAGL+LDDIDLFEINEAFASQ++YC+ KLGLDPEKINVNGGA+AI
Sbjct  332  IMGVGPAVAIPAAVKSAGLQLDDIDLFEINEAFASQFVYCRNKLGLDPEKINVNGGALAI  391

Query  409  GHPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKV  230
            GHPLG TGARCVATLLHEMKRRG+DCR+GV+SMCIGTGMGAA VFERGD  DEL N RKV
Sbjct  392  GHPLGTTGARCVATLLHEMKRRGRDCRFGVISMCIGTGMGAAAVFERGDCADELCNVRKV  451

Query  229  ETHGYLSKD  203
            E++ +LSKD
Sbjct  452  ESNNFLSKD  460



>ref|XP_010522426.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Tarenaya hassleriana]
Length=464

 Score =   346 bits (887),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 168/192 (88%), Positives = 180/192 (94%), Gaps = 2/192 (1%)
 Frame = -3

Query  769  DLAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPA  590
            DLA+LKPVFKKDGTTTAGNSSQV+DGAGAVLLMKRS+A QKGLP+LGVFRTFAAVGVDPA
Sbjct  272  DLARLKPVFKKDGTTTAGNSSQVSDGAGAVLLMKRSVATQKGLPVLGVFRTFAAVGVDPA  331

Query  589  VMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAI  410
            +MG+GPAVAIPAAVK+AGLELDDIDLFEINEAFASQ++YC+ KLGLD EKINVNGGAMAI
Sbjct  332  IMGVGPAVAIPAAVKAAGLELDDIDLFEINEAFASQFVYCRNKLGLDAEKINVNGGAMAI  391

Query  409  GHPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKV  230
            GHPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAA VFERGDA D LSNAR+V
Sbjct  392  GHPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAAVFERGDAVDSLSNARRV  451

Query  229  ET--HGYLSKDA  200
            E      LSKD+
Sbjct  452  EAAHSSLLSKDS  463



>ref|XP_004164123.1| PREDICTED: LOW QUALITY PROTEIN: 3-ketoacyl-CoA thiolase 2, peroxisomal-like 
[Cucumis sativus]
Length=461

 Score =   346 bits (887),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 165/189 (87%), Positives = 179/189 (95%), Gaps = 0/189 (0%)
 Frame = -3

Query  769  DLAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPA  590
            DLAKLKPVFKKDG+TTAGN+SQV+DGAGAVLLMKRS+A +KGLPILGVFRTFAAVGVDPA
Sbjct  271  DLAKLKPVFKKDGSTTAGNASQVSDGAGAVLLMKRSVAXKKGLPILGVFRTFAAVGVDPA  330

Query  589  VMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAI  410
            +MG+GPAVAIPAAVK+AGLELDDIDLFEINEAFASQ++YC+ KL LDPEKINVNGGAMAI
Sbjct  331  IMGVGPAVAIPAAVKAAGLELDDIDLFEINEAFASQFVYCRNKLELDPEKINVNGGAMAI  390

Query  409  GHPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKV  230
            GHPLGATGARCVATLLHEMKRRGKDCR+GV+SMCIGTGMGAA VFERGD  DEL NARKV
Sbjct  391  GHPLGATGARCVATLLHEMKRRGKDCRFGVISMCIGTGMGAAAVFERGDVADELCNARKV  450

Query  229  ETHGYLSKD  203
            + H  LSKD
Sbjct  451  DNHNLLSKD  459



>gb|AFK34605.1| unknown [Lotus japonicus]
Length=296

 Score =   340 bits (872),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 166/190 (87%), Positives = 179/190 (94%), Gaps = 1/190 (1%)
 Frame = -3

Query  769  DLAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPA  590
            DLAKLKPVFKKDGTTTAGNSSQV+DGAGAVLLMKRS+A+QKGLPILGVFRTFAAVGVDPA
Sbjct  105  DLAKLKPVFKKDGTTTAGNSSQVSDGAGAVLLMKRSVAMQKGLPILGVFRTFAAVGVDPA  164

Query  589  VMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAI  410
            VMG+GPA AIP AVK+AGLELDDIDLFEINEAFASQ++YC+ KLGLD EKINVNGGAMAI
Sbjct  165  VMGVGPAAAIPVAVKAAGLELDDIDLFEINEAFASQFVYCRNKLGLDLEKINVNGGAMAI  224

Query  409  GHPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKV  230
            GHPLGATGARCVATLLHEMKRRG+DCR+GV+SMCIGTGMGAA VFERGD  DEL NARKV
Sbjct  225  GHPLGATGARCVATLLHEMKRRGRDCRFGVISMCIGTGMGAAAVFERGDGVDELRNARKV  284

Query  229  ETHGYLSKDA  200
            +   +LSKDA
Sbjct  285  DNL-HLSKDA  293



>ref|XP_009376354.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Pyrus x bretschneideri]
Length=459

 Score =   346 bits (887),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 169/192 (88%), Positives = 183/192 (95%), Gaps = 1/192 (1%)
 Frame = -3

Query  769  DLAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPA  590
            DLAKLKPVFKKDG+TTAGNSSQV+DGAGAVLLMKRS+A QKGLPILGVFR+F+AVGVDPA
Sbjct  268  DLAKLKPVFKKDGSTTAGNSSQVSDGAGAVLLMKRSVAEQKGLPILGVFRSFSAVGVDPA  327

Query  589  VMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAI  410
            +MG+GPAVAIPAAVK+AGLELDDIDLFEINEAFASQYLYC+ KLGLDPEKINVNGGA+AI
Sbjct  328  IMGVGPAVAIPAAVKAAGLELDDIDLFEINEAFASQYLYCRNKLGLDPEKINVNGGALAI  387

Query  409  GHPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKV  230
            GHPLGATGAR VATLLHEMKRRGKDCR+GV+SMCIGTGMGAA VFERGD+ D L NARKV
Sbjct  388  GHPLGATGARTVATLLHEMKRRGKDCRFGVISMCIGTGMGAAAVFERGDSVDGLCNARKV  447

Query  229  ETHGY-LSKDAR  197
            ETH + LSKDAR
Sbjct  448  ETHIHLLSKDAR  459



>ref|XP_008380600.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Malus domestica]
Length=459

 Score =   344 bits (883),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 168/192 (88%), Positives = 183/192 (95%), Gaps = 1/192 (1%)
 Frame = -3

Query  769  DLAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPA  590
            DLAKLKPVFKKDG+TTAGNSSQV+DGAGAVLLMKRS+A QKGLPILGVFR+F+AVGVDPA
Sbjct  268  DLAKLKPVFKKDGSTTAGNSSQVSDGAGAVLLMKRSVAEQKGLPILGVFRSFSAVGVDPA  327

Query  589  VMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAI  410
            +MG+GPAVAIPAAVK+AGLELDDIDLFEINEAFASQYLYC+ KLGLDPEKINVNGGA+AI
Sbjct  328  IMGVGPAVAIPAAVKAAGLELDDIDLFEINEAFASQYLYCRNKLGLDPEKINVNGGALAI  387

Query  409  GHPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKV  230
            GHPLGATGAR VATLLHEMKRRGKDCR+GV+SMCIGTGMGAA VFERGD+ D L NARKV
Sbjct  388  GHPLGATGARAVATLLHEMKRRGKDCRFGVISMCIGTGMGAAAVFERGDSVDGLCNARKV  447

Query  229  ETHGY-LSKDAR  197
            E+H + LSKDAR
Sbjct  448  ESHIHLLSKDAR  459



>pir||S72532 acetyl-CoA C-acyltransferase (EC 2.3.1.16) precursor - cucurbit
 dbj|BAA11117.1| 3-ketoacyl-CoA thiolase [Cucurbita cv. Kurokawa Amakuri]
Length=461

 Score =   344 bits (883),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 165/191 (86%), Positives = 179/191 (94%), Gaps = 0/191 (0%)
 Frame = -3

Query  769  DLAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPA  590
            DL KLKPVFKKDGTTTAGNSSQV+DGAGAVLLMKRS+A+QKGLPILGVFRTF AVGVDPA
Sbjct  271  DLGKLKPVFKKDGTTTAGNSSQVSDGAGAVLLMKRSVAMQKGLPILGVFRTFTAVGVDPA  330

Query  589  VMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAI  410
            +MG+GPAVAIPAAVK+AGLEL+DIDLFEINEAFASQ++YC+ KLGLDPEKINVNGGA+AI
Sbjct  331  IMGVGPAVAIPAAVKAAGLELNDIDLFEINEAFASQFVYCRNKLGLDPEKINVNGGAIAI  390

Query  409  GHPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKV  230
            GHPLG TGARCVATLLHEMKRRGKDCR+GV+SMCIGTGMGAA VFERGD  DEL NA+KV
Sbjct  391  GHPLGTTGARCVATLLHEMKRRGKDCRFGVISMCIGTGMGAAAVFERGDCVDELCNAKKV  450

Query  229  ETHGYLSKDAR  197
            E    LSKDAR
Sbjct  451  EGINLLSKDAR  461



>ref|XP_004497755.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Cicer 
arietinum]
Length=458

 Score =   344 bits (882),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 166/191 (87%), Positives = 180/191 (94%), Gaps = 1/191 (1%)
 Frame = -3

Query  769  DLAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPA  590
            DLAKLKPVFKKDGTTTAGNSSQV+DGAGAVLLMKRS+AIQKGLPILGVFR+F AVGVDPA
Sbjct  269  DLAKLKPVFKKDGTTTAGNSSQVSDGAGAVLLMKRSIAIQKGLPILGVFRSFVAVGVDPA  328

Query  589  VMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAI  410
            +MG+GPA AIP AVK+AGLELDDIDLFEINEAFASQ++YC+ KLGLD +KINVNGGAMAI
Sbjct  329  IMGVGPAAAIPVAVKAAGLELDDIDLFEINEAFASQFVYCRNKLGLDSQKINVNGGAMAI  388

Query  409  GHPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKV  230
            GHPLGATGARCVATLLHEMKRRGKDCR+GV+SMCIGTGMGAA VFERGD+ DEL NARKV
Sbjct  389  GHPLGATGARCVATLLHEMKRRGKDCRFGVISMCIGTGMGAAAVFERGDSVDELRNARKV  448

Query  229  ETHGYLSKDAR  197
            +   YLSKDAR
Sbjct  449  DDL-YLSKDAR  458



>gb|ABK94786.1| unknown [Populus trichocarpa]
Length=346

 Score =   340 bits (871),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 163/191 (85%), Positives = 181/191 (95%), Gaps = 1/191 (1%)
 Frame = -3

Query  766  LAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAV  587
            L KLK VFKKDGTTTAGNSSQ++DGAGAVLLMKRS+A+QKGLPILGVFRTFAAVGVDPA+
Sbjct  156  LGKLKTVFKKDGTTTAGNSSQISDGAGAVLLMKRSVAVQKGLPILGVFRTFAAVGVDPAI  215

Query  586  MGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIG  407
            MG+GPAVAIPAAVK+AGLEL+DIDLFEINEAFASQ++YC+KKL LDP+KINVNGGAMAIG
Sbjct  216  MGVGPAVAIPAAVKAAGLELEDIDLFEINEAFASQFVYCRKKLELDPQKINVNGGAMAIG  275

Query  406  HPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSN-ARKV  230
            HPLGATGARCVATLLHEMKRRG+DCR+GVVSMCIGTGMGAA VFERGD CDEL N  RKV
Sbjct  276  HPLGATGARCVATLLHEMKRRGRDCRFGVVSMCIGTGMGAAAVFERGDGCDELCNGGRKV  335

Query  229  ETHGYLSKDAR  197
            E++  LS+D+R
Sbjct  336  ESNNLLSRDSR  346



>ref|XP_006443651.1| hypothetical protein CICLE_v10020068mg [Citrus clementina]
 ref|XP_006480201.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Citrus 
sinensis]
 gb|ESR56891.1| hypothetical protein CICLE_v10020068mg [Citrus clementina]
Length=461

 Score =   343 bits (881),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 164/191 (86%), Positives = 180/191 (94%), Gaps = 0/191 (0%)
 Frame = -3

Query  769  DLAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPA  590
            DLAKLKP FKKDGTTTAGN+SQV+DGAGAVLLMKRSLA+QKGLPILGVFR+FAAVGVDP+
Sbjct  271  DLAKLKPAFKKDGTTTAGNASQVSDGAGAVLLMKRSLAVQKGLPILGVFRSFAAVGVDPS  330

Query  589  VMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAI  410
            VMGIGPAVAIPAAVKSAGL+LDDI+LFEINEAFASQY+YC KKLGLDPEK+NVNGGA+A+
Sbjct  331  VMGIGPAVAIPAAVKSAGLQLDDINLFEINEAFASQYVYCIKKLGLDPEKVNVNGGAVAL  390

Query  409  GHPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKV  230
            GHPLGATGARCVATLL EMKRRGKDCR+GV+SMCIG+GMGAA V ERGD  DEL NAR V
Sbjct  391  GHPLGATGARCVATLLSEMKRRGKDCRFGVISMCIGSGMGAAAVLERGDCVDELCNARMV  450

Query  229  ETHGYLSKDAR  197
             TH +LSKDA+
Sbjct  451  PTHTHLSKDAK  461



>ref|XP_011002175.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Populus euphratica]
Length=462

 Score =   342 bits (876),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 163/190 (86%), Positives = 181/190 (95%), Gaps = 1/190 (1%)
 Frame = -3

Query  766  LAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAV  587
            L KLKPVFKKDGTTTAGNSSQ++DGAGAVLLMKRS+A+QKGLPILGVFRTFAAVGVDPA+
Sbjct  272  LGKLKPVFKKDGTTTAGNSSQISDGAGAVLLMKRSVAVQKGLPILGVFRTFAAVGVDPAI  331

Query  586  MGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIG  407
            MG+GPAVAIPAAVK+AGLEL+DIDLFEINEAFASQ++YC+KKL LDP+KINVNGGAMAIG
Sbjct  332  MGVGPAVAIPAAVKAAGLELEDIDLFEINEAFASQFVYCRKKLELDPQKINVNGGAMAIG  391

Query  406  HPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSN-ARKV  230
            HPLGATGARCVATLLHEMKRRG+DCR+GVVSMCIGTGMGAA VFERGD CDEL N  RKV
Sbjct  392  HPLGATGARCVATLLHEMKRRGRDCRFGVVSMCIGTGMGAAAVFERGDGCDELCNGGRKV  451

Query  229  ETHGYLSKDA  200
            E++  LS+D+
Sbjct  452  ESNNLLSRDS  461



>ref|XP_010243983.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Nelumbo nucifera]
Length=460

 Score =   341 bits (874),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 165/188 (88%), Positives = 178/188 (95%), Gaps = 0/188 (0%)
 Frame = -3

Query  766  LAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAV  587
            LAKLKPVFK+DG+TTAGNSSQV+DGAGAVLLMKRS+A+QKGLPILGVFR+FAAVGVDPAV
Sbjct  271  LAKLKPVFKRDGSTTAGNSSQVSDGAGAVLLMKRSVAMQKGLPILGVFRSFAAVGVDPAV  330

Query  586  MGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIG  407
            MG+GPAVAIPAAVKSAGLELDDIDLFEINEAFASQY+YC KKL LDPEK+NVNGGAMAIG
Sbjct  331  MGVGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYVYCCKKLELDPEKVNVNGGAMAIG  390

Query  406  HPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVE  227
            HPLGATGARCVATLLHEMKRRGKDCR+GV+SMCIGTGMGAA VFERGD  D L NAR+V 
Sbjct  391  HPLGATGARCVATLLHEMKRRGKDCRFGVISMCIGTGMGAAAVFERGDCVDPLCNARQVG  450

Query  226  THGYLSKD  203
            T+  LSKD
Sbjct  451  TNNLLSKD  458



>ref|XP_002299284.2| hypothetical protein POPTR_0001s14280g [Populus trichocarpa]
 gb|EEE84089.2| hypothetical protein POPTR_0001s14280g [Populus trichocarpa]
Length=461

 Score =   340 bits (873),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 163/191 (85%), Positives = 181/191 (95%), Gaps = 1/191 (1%)
 Frame = -3

Query  766  LAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAV  587
            L KLK VFKKDGTTTAGNSSQ++DGAGAVLLMKRS+A+QKGLPILGVFRTFAAVGVDPA+
Sbjct  271  LGKLKTVFKKDGTTTAGNSSQISDGAGAVLLMKRSVAVQKGLPILGVFRTFAAVGVDPAI  330

Query  586  MGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIG  407
            MG+GPAVAIPAAVK+AGLEL+DIDLFEINEAFASQ++YC+KKL LDP+KINVNGGAMAIG
Sbjct  331  MGVGPAVAIPAAVKAAGLELEDIDLFEINEAFASQFVYCRKKLELDPQKINVNGGAMAIG  390

Query  406  HPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSN-ARKV  230
            HPLGATGARCVATLLHEMKRRG+DCR+GVVSMCIGTGMGAA VFERGD CDEL N  RKV
Sbjct  391  HPLGATGARCVATLLHEMKRRGRDCRFGVVSMCIGTGMGAAAVFERGDGCDELCNGGRKV  450

Query  229  ETHGYLSKDAR  197
            E++  LS+D+R
Sbjct  451  ESNNLLSRDSR  461



>ref|XP_006854408.1| hypothetical protein AMTR_s00039p00196630 [Amborella trichopoda]
 gb|ERN15875.1| hypothetical protein AMTR_s00039p00196630 [Amborella trichopoda]
Length=460

 Score =   338 bits (866),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 160/190 (84%), Positives = 177/190 (93%), Gaps = 0/190 (0%)
 Frame = -3

Query  769  DLAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPA  590
            DLAKLKPVFKKDGTTTAGNSSQV+DGAGAVLLM+RS+A+QKGLPI GVFR+F AVGVDPA
Sbjct  270  DLAKLKPVFKKDGTTTAGNSSQVSDGAGAVLLMRRSVALQKGLPIFGVFRSFVAVGVDPA  329

Query  589  VMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAI  410
            VMG+GPAVAIPAAVK+AGLEL+DIDLFEINEAF SQ++YC+ KLGLDPEK+NVNGGAMAI
Sbjct  330  VMGVGPAVAIPAAVKAAGLELNDIDLFEINEAFGSQFVYCRNKLGLDPEKVNVNGGAMAI  389

Query  409  GHPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKV  230
            GHPLGATGARCVATLLHEMKR+GKDCR+GV+SMCIGTGMGAA VFERGD  D L+NARK+
Sbjct  390  GHPLGATGARCVATLLHEMKRQGKDCRFGVISMCIGTGMGAAAVFERGDGVDPLNNARKI  449

Query  229  ETHGYLSKDA  200
                 LSKDA
Sbjct  450  GASNLLSKDA  459



>gb|AFW68655.1| hypothetical protein ZEAMMB73_512974 [Zea mays]
Length=230

 Score =   329 bits (844),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 154/189 (81%), Positives = 177/189 (94%), Gaps = 0/189 (0%)
 Frame = -3

Query  766  LAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAV  587
            L+KLKP F KDG+TTAGN+SQV+DGAGAVLLM+R +A++KGLP+LGVFRTFAAVGVDPAV
Sbjct  41   LSKLKPAFSKDGSTTAGNASQVSDGAGAVLLMRRDVAMKKGLPVLGVFRTFAAVGVDPAV  100

Query  586  MGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIG  407
            MGIGPAVAIPAAVK+AGL++DDIDLFEINEAFASQY+YC KKL LDP K+NVNGGAMA+G
Sbjct  101  MGIGPAVAIPAAVKAAGLQMDDIDLFEINEAFASQYVYCCKKLKLDPAKVNVNGGAMALG  160

Query  406  HPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVE  227
            HPLGATGARCV+TLL+EMKRRGKDCR+GV+SMCIG+GMGAA VFERGD  DEL+NAR + 
Sbjct  161  HPLGATGARCVSTLLNEMKRRGKDCRFGVISMCIGSGMGAAAVFERGDGVDELTNARGIS  220

Query  226  THGYLSKDA  200
            TH +LSKDA
Sbjct  221  THNWLSKDA  229



>ref|NP_001267690.1| 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Cucumis sativus]
 emb|CAA47926.1| 3-ketoacyl-CoA thiolase [Cucumis sativus]
 gb|KGN56763.1| hypothetical protein Csa_3G133140 [Cucumis sativus]
Length=462

 Score =   337 bits (865),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 164/192 (85%), Positives = 180/192 (94%), Gaps = 1/192 (1%)
 Frame = -3

Query  769  DLAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPA  590
            DL KLK VFKKDGTTTAGNSSQV+DGAGAVLLMKRS+A++KGLPILGVFRTF+AVGVDPA
Sbjct  271  DLGKLKAVFKKDGTTTAGNSSQVSDGAGAVLLMKRSVAMRKGLPILGVFRTFSAVGVDPA  330

Query  589  VMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAI  410
            +MG+GPAVAIPAAVK+AGLEL+DIDLFEINEAFASQ++YC+ KLGLDPEKINVNGGA+AI
Sbjct  331  IMGVGPAVAIPAAVKAAGLELNDIDLFEINEAFASQFVYCRNKLGLDPEKINVNGGAIAI  390

Query  409  GHPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKV  230
            GHPLGATGARCVATLLHEMKRRGKDCR+GV+SMCIGTGMGAA VFERGD  DEL NA+KV
Sbjct  391  GHPLGATGARCVATLLHEMKRRGKDCRFGVISMCIGTGMGAAAVFERGDCVDELCNAKKV  450

Query  229  ETH-GYLSKDAR  197
            E     LSKDAR
Sbjct  451  EGGVNLLSKDAR  462



>ref|NP_001142099.1| uncharacterized protein LOC100274263 [Zea mays]
 gb|ACF87638.1| unknown [Zea mays]
Length=230

 Score =   328 bits (841),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 153/189 (81%), Positives = 177/189 (94%), Gaps = 0/189 (0%)
 Frame = -3

Query  766  LAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAV  587
            L+KLKP F KDG+TTAGN+SQV+DGAGAVLLM+R +A++KGLP+LGVFRTFAAVGVDPAV
Sbjct  41   LSKLKPAFSKDGSTTAGNASQVSDGAGAVLLMRRDVAMKKGLPVLGVFRTFAAVGVDPAV  100

Query  586  MGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIG  407
            MGIGPAVAIPAAVK+AGL++DDIDLFEINEAFASQY+YC +KL LDP K+NVNGGAMA+G
Sbjct  101  MGIGPAVAIPAAVKAAGLQMDDIDLFEINEAFASQYVYCCRKLKLDPAKVNVNGGAMALG  160

Query  406  HPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVE  227
            HPLGATGARCV+TLL+EMKRRGKDCR+GV+SMCIG+GMGAA VFERGD  DEL+NAR + 
Sbjct  161  HPLGATGARCVSTLLNEMKRRGKDCRFGVISMCIGSGMGAAAVFERGDGVDELTNARGIS  220

Query  226  THGYLSKDA  200
            TH +LSKDA
Sbjct  221  THNWLSKDA  229



>gb|AFW68656.1| hypothetical protein ZEAMMB73_512974 [Zea mays]
Length=295

 Score =   330 bits (846),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 154/189 (81%), Positives = 177/189 (94%), Gaps = 0/189 (0%)
 Frame = -3

Query  766  LAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAV  587
            L+KLKP F KDG+TTAGN+SQV+DGAGAVLLM+R +A++KGLP+LGVFRTFAAVGVDPAV
Sbjct  106  LSKLKPAFSKDGSTTAGNASQVSDGAGAVLLMRRDVAMKKGLPVLGVFRTFAAVGVDPAV  165

Query  586  MGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIG  407
            MGIGPAVAIPAAVK+AGL++DDIDLFEINEAFASQY+YC KKL LDP K+NVNGGAMA+G
Sbjct  166  MGIGPAVAIPAAVKAAGLQMDDIDLFEINEAFASQYVYCCKKLKLDPAKVNVNGGAMALG  225

Query  406  HPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVE  227
            HPLGATGARCV+TLL+EMKRRGKDCR+GV+SMCIG+GMGAA VFERGD  DEL+NAR + 
Sbjct  226  HPLGATGARCVSTLLNEMKRRGKDCRFGVISMCIGSGMGAAAVFERGDGVDELTNARGIS  285

Query  226  THGYLSKDA  200
            TH +LSKDA
Sbjct  286  THNWLSKDA  294



>ref|XP_007145410.1| hypothetical protein PHAVU_007G236600g [Phaseolus vulgaris]
 gb|ESW17404.1| hypothetical protein PHAVU_007G236600g [Phaseolus vulgaris]
Length=458

 Score =   335 bits (860),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 162/194 (84%), Positives = 177/194 (91%), Gaps = 1/194 (1%)
 Frame = -3

Query  778  KYGDLAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGV  599
            K+ DL +LKPVFKKDGTTTAGNSSQV+DGA AVLLMKRS+A QKGLPILGVFRTF AVGV
Sbjct  266  KFSDLERLKPVFKKDGTTTAGNSSQVSDGAAAVLLMKRSVAQQKGLPILGVFRTFTAVGV  325

Query  598  DPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGA  419
            DPA+MG+GPA AIP AVK+AGLELDDIDLFEINEAFASQ+LYC+ KLGLDPEKINVNGGA
Sbjct  326  DPAIMGVGPAAAIPVAVKAAGLELDDIDLFEINEAFASQFLYCRNKLGLDPEKINVNGGA  385

Query  418  MAIGHPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNA  239
            MAIGHPLGATGARCVATLLHEM++RG+DCR+GV+SMCIGTGMGAA VFE GD  DEL NA
Sbjct  386  MAIGHPLGATGARCVATLLHEMRKRGRDCRFGVISMCIGTGMGAAAVFESGDCADELCNA  445

Query  238  RKVETHGYLSKDAR  197
            RKV+    LSKDAR
Sbjct  446  RKVDDL-LLSKDAR  458



>ref|XP_010099126.1| 3-ketoacyl-CoA thiolase 2 [Morus notabilis]
 gb|EXB76920.1| 3-ketoacyl-CoA thiolase 2 [Morus notabilis]
Length=464

 Score =   335 bits (860),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 162/191 (85%), Positives = 175/191 (92%), Gaps = 0/191 (0%)
 Frame = -3

Query  769  DLAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPA  590
            DLAKLKPVFKKDGTTTAGNSSQV+DGAGAVLLMKRS+A +KGLPILG+FR F AVGVDPA
Sbjct  274  DLAKLKPVFKKDGTTTAGNSSQVSDGAGAVLLMKRSVAEKKGLPILGIFRNFVAVGVDPA  333

Query  589  VMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAI  410
            +MG+GPA AIPAAVK+AGLELDDIDLFEINEAFASQ++YC+ KLGLDPEKINVNGGAMAI
Sbjct  334  IMGVGPAFAIPAAVKAAGLELDDIDLFEINEAFASQFVYCRNKLGLDPEKINVNGGAMAI  393

Query  409  GHPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKV  230
            GHPLGATGARCVATLLHEMKRRGKDCR+GV+SMCIGTGMGAA VFER    DEL NAR  
Sbjct  394  GHPLGATGARCVATLLHEMKRRGKDCRFGVISMCIGTGMGAAAVFERAGHTDELCNARVA  453

Query  229  ETHGYLSKDAR  197
             T+  LSKDAR
Sbjct  454  ATNSLLSKDAR  464



>gb|AFW68657.1| hypothetical protein ZEAMMB73_512974 [Zea mays]
Length=345

 Score =   330 bits (847),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 154/189 (81%), Positives = 177/189 (94%), Gaps = 0/189 (0%)
 Frame = -3

Query  766  LAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAV  587
            L+KLKP F KDG+TTAGN+SQV+DGAGAVLLM+R +A++KGLP+LGVFRTFAAVGVDPAV
Sbjct  156  LSKLKPAFSKDGSTTAGNASQVSDGAGAVLLMRRDVAMKKGLPVLGVFRTFAAVGVDPAV  215

Query  586  MGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIG  407
            MGIGPAVAIPAAVK+AGL++DDIDLFEINEAFASQY+YC KKL LDP K+NVNGGAMA+G
Sbjct  216  MGIGPAVAIPAAVKAAGLQMDDIDLFEINEAFASQYVYCCKKLKLDPAKVNVNGGAMALG  275

Query  406  HPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVE  227
            HPLGATGARCV+TLL+EMKRRGKDCR+GV+SMCIG+GMGAA VFERGD  DEL+NAR + 
Sbjct  276  HPLGATGARCVSTLLNEMKRRGKDCRFGVISMCIGSGMGAAAVFERGDGVDELTNARGIS  335

Query  226  THGYLSKDA  200
            TH +LSKDA
Sbjct  336  THNWLSKDA  344



>ref|NP_001238475.1| peroxisomal 3-ketoacyl-CoA thiolase [Glycine max]
 dbj|BAG09380.1| peroxisomal 3-ketoacyl-CoA thiolase precursor [Glycine max]
 gb|KHN21671.1| 3-ketoacyl-CoA thiolase 2, peroxisomal [Glycine soja]
Length=463

 Score =   334 bits (856),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 161/191 (84%), Positives = 177/191 (93%), Gaps = 1/191 (1%)
 Frame = -3

Query  769  DLAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPA  590
            DL +LKPVFKKDG+TTAGNSSQVTDGA AVLLMKRS+A+QKGLPILGVFRTFAAVGVDPA
Sbjct  272  DLGRLKPVFKKDGSTTAGNSSQVTDGASAVLLMKRSVALQKGLPILGVFRTFAAVGVDPA  331

Query  589  VMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAI  410
            +MG+GPA AIP AVK+AGLELDDIDLFEINEAFASQ++YC+ KLGLDPEKINVNGGAMAI
Sbjct  332  IMGVGPAAAIPVAVKAAGLELDDIDLFEINEAFASQFVYCRNKLGLDPEKINVNGGAMAI  391

Query  409  GHPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKV  230
            GHPLG+TGARCVATLLHEMK+RG+DCR+GV+SMCIGTGMGAA VFE GD  DEL NARKV
Sbjct  392  GHPLGSTGARCVATLLHEMKKRGRDCRFGVISMCIGTGMGAAAVFESGDCADELCNARKV  451

Query  229  ETHGYLSKDAR  197
            +    LSKDAR
Sbjct  452  DDL-LLSKDAR  461



>ref|XP_006662414.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Oryza 
brachyantha]
Length=460

 Score =   333 bits (854),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 154/189 (81%), Positives = 179/189 (95%), Gaps = 0/189 (0%)
 Frame = -3

Query  766  LAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAV  587
            L+KLKP F KDGTTTAGN+SQV+DGAGAVLLM+R +A+QKGLP+LGVFR+FAAVGVDPAV
Sbjct  270  LSKLKPAFSKDGTTTAGNASQVSDGAGAVLLMRRDIAMQKGLPVLGVFRSFAAVGVDPAV  329

Query  586  MGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIG  407
            MG+GPAVAIPAAVK+AGL++DD+DLFEINEAFASQY+YC KKLGLDP K+NVNGGAMA+G
Sbjct  330  MGVGPAVAIPAAVKAAGLQIDDVDLFEINEAFASQYVYCCKKLGLDPTKVNVNGGAMALG  389

Query  406  HPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVE  227
            HPLGATGARCV+TLL+EMKRRGKDCR+GV+SMCIG+GMGAA VFERGDA DEL+NAR + 
Sbjct  390  HPLGATGARCVSTLLNEMKRRGKDCRFGVISMCIGSGMGAAAVFERGDAVDELTNARGIP  449

Query  226  THGYLSKDA  200
            +H +LSKDA
Sbjct  450  SHNWLSKDA  458



>ref|XP_011034453.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Populus 
euphratica]
Length=455

 Score =   333 bits (853),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 158/191 (83%), Positives = 176/191 (92%), Gaps = 0/191 (0%)
 Frame = -3

Query  769  DLAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPA  590
            DL KLK VFKKDGTTTAGNSSQ++DGA AVLLMKRS+A+ KGLPILGVFRTF  VGVDPA
Sbjct  265  DLGKLKAVFKKDGTTTAGNSSQISDGAAAVLLMKRSVAMHKGLPILGVFRTFVVVGVDPA  324

Query  589  VMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAI  410
            +MG+GPAVAIPAAVK+AGLEL+DIDLFEINEAFASQ++YC KKL LD +KINVNGGA+AI
Sbjct  325  IMGVGPAVAIPAAVKAAGLELEDIDLFEINEAFASQFVYCCKKLELDLQKINVNGGAIAI  384

Query  409  GHPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKV  230
            GHPLG TGARCVAT+LHEMKRRG+DCR+GVVSMCIGTGMGAA VFERGD CDEL NARKV
Sbjct  385  GHPLGTTGARCVATILHEMKRRGRDCRFGVVSMCIGTGMGAAAVFERGDDCDELCNARKV  444

Query  229  ETHGYLSKDAR  197
            E++  LSKD+R
Sbjct  445  ESNNLLSKDSR  455



>ref|XP_006368897.1| hypothetical protein POPTR_0001s14290g [Populus trichocarpa]
 gb|ERP65466.1| hypothetical protein POPTR_0001s14290g [Populus trichocarpa]
Length=455

 Score =   333 bits (853),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 158/191 (83%), Positives = 177/191 (93%), Gaps = 0/191 (0%)
 Frame = -3

Query  769  DLAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPA  590
            DL KLK VFKKDGTTTAGNSSQ++DGA AVLLMKRS+A++KGLPILGVFRTF  VGVDPA
Sbjct  265  DLGKLKAVFKKDGTTTAGNSSQISDGAAAVLLMKRSVAMRKGLPILGVFRTFVVVGVDPA  324

Query  589  VMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAI  410
            +MG+GPAVAIPAAVK+AGLEL+DIDLFEINEAFASQ++YC KKL LD +KINVNGGA+AI
Sbjct  325  IMGVGPAVAIPAAVKAAGLELEDIDLFEINEAFASQFVYCCKKLELDLQKINVNGGAIAI  384

Query  409  GHPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKV  230
            GHPLG TGARCVAT+LHEMKRRG+DCR+GVVSMCIGTGMGAA VFERGD CDEL NARKV
Sbjct  385  GHPLGTTGARCVATILHEMKRRGRDCRFGVVSMCIGTGMGAAAVFERGDGCDELCNARKV  444

Query  229  ETHGYLSKDAR  197
            E++  LSKD+R
Sbjct  445  ESNNLLSKDSR  455



>pdb|2WUA|A Chain A, Structure Of The Peroxisomal 3-Ketoacyl-Coa Thiolase 
From Sunflower
 pdb|2WUA|B Chain B, Structure Of The Peroxisomal 3-Ketoacyl-Coa Thiolase 
From Sunflower
Length=440

 Score =   332 bits (852),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 156/178 (88%), Positives = 173/178 (97%), Gaps = 0/178 (0%)
 Frame = -3

Query  769  DLAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPA  590
            DLAKLKPVF+KDG+TTAG SSQV+DGAGAVLLMKRS+A+QKGLPILGVFRTFAAVGV P+
Sbjct  255  DLAKLKPVFRKDGSTTAGTSSQVSDGAGAVLLMKRSIALQKGLPILGVFRTFAAVGVPPS  314

Query  589  VMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAI  410
            +MGIGPAVAIPAAVK+AGL++DDIDLFEINEAFASQ++YCQKKL +DP+KINVNGGAMAI
Sbjct  315  IMGIGPAVAIPAAVKAAGLQIDDIDLFEINEAFASQFVYCQKKLEIDPQKINVNGGAMAI  374

Query  409  GHPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNAR  236
            GHPLGATGARCVATLLHEMKRRG+DCR+GVVSMCIGTGMGAA VFERGDACDEL NA+
Sbjct  375  GHPLGATGARCVATLLHEMKRRGRDCRFGVVSMCIGTGMGAAAVFERGDACDELCNAK  432



>gb|ABB45810.1| acetoacetyl-CoA thiolase [Salvia miltiorrhiza]
Length=172

 Score =   322 bits (826),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 155/172 (90%), Positives = 164/172 (95%), Gaps = 0/172 (0%)
 Frame = -3

Query  712  SSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGL  533
            SSQV+DGAGAVLLMKRS+A+QKGLPILGVFRTF AVGVDPA+MG+GPAVAIPAAVKSAGL
Sbjct  1    SSQVSDGAGAVLLMKRSVALQKGLPILGVFRTFVAVGVDPAIMGVGPAVAIPAAVKSAGL  60

Query  532  ELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEM  353
            EL+DIDLFEINEAFASQ+LYC+ KLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEM
Sbjct  61   ELEDIDLFEINEAFASQFLYCRNKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEM  120

Query  352  KRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDAR  197
            KRRGKDCRYGVVSMCIGTGMGAA VFERGDACDEL N RKVE   +LSKDAR
Sbjct  121  KRRGKDCRYGVVSMCIGTGMGAAAVFERGDACDELCNTRKVEAQNFLSKDAR  172



>gb|ACV70032.1| 3-ketoacyl CoA thiolase 1 [Petunia x hybrida]
Length=462

 Score =   332 bits (852),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 157/190 (83%), Positives = 176/190 (93%), Gaps = 0/190 (0%)
 Frame = -3

Query  766  LAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAV  587
            L KLKP FK DGTTTAGN+SQV+DGA AVLLMKRS+A++KGLPILGVFR+FAAVGVDPAV
Sbjct  273  LGKLKPAFKNDGTTTAGNASQVSDGAAAVLLMKRSVAMKKGLPILGVFRSFAAVGVDPAV  332

Query  586  MGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIG  407
            MGIGPAVAIP AVKSAGL+LDDIDL+EINEAFASQ++YCQKKL LDPEK+NVNGGAMA+G
Sbjct  333  MGIGPAVAIPPAVKSAGLDLDDIDLYEINEAFASQFVYCQKKLNLDPEKVNVNGGAMALG  392

Query  406  HPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVE  227
            HPLGATGARCVATLLHEMKRRGKDCR+GV+SMCIG+GMGAA VFERGDA D+L NAR   
Sbjct  393  HPLGATGARCVATLLHEMKRRGKDCRFGVISMCIGSGMGAAAVFERGDAVDDLCNARVSN  452

Query  226  THGYLSKDAR  197
             + +LSKDA+
Sbjct  453  NNSFLSKDAK  462



>ref|XP_011002176.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Populus 
euphratica]
Length=455

 Score =   332 bits (852),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 158/191 (83%), Positives = 176/191 (92%), Gaps = 0/191 (0%)
 Frame = -3

Query  769  DLAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPA  590
            DL KLK VFKKDGTTTAGNSSQ++DGA AVLLMKRS+A+ KGLPILGVFRTF  VGVDPA
Sbjct  265  DLGKLKAVFKKDGTTTAGNSSQISDGAAAVLLMKRSVAMHKGLPILGVFRTFVVVGVDPA  324

Query  589  VMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAI  410
            +MG+GPAVAIPAAVK+AGLEL+DIDLFEINEAFASQ++YC KKL LD +KINVNGGA+AI
Sbjct  325  IMGVGPAVAIPAAVKAAGLELEDIDLFEINEAFASQFVYCCKKLELDLQKINVNGGAIAI  384

Query  409  GHPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKV  230
            GHPLG TGARCVAT+LHEMKRRG+DCR+GVVSMCIGTGMGAA VFERGD CDEL NARKV
Sbjct  385  GHPLGTTGARCVATILHEMKRRGRDCRFGVVSMCIGTGMGAAAVFERGDDCDELCNARKV  444

Query  229  ETHGYLSKDAR  197
            E++  LSKD+R
Sbjct  445  ESNNLLSKDSR  455



>gb|KEH41248.1| 3-ketoacyl-CoA thiolase 2, peroxisomal-like protein [Medicago 
truncatula]
Length=462

 Score =   332 bits (852),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 161/191 (84%), Positives = 177/191 (93%), Gaps = 1/191 (1%)
 Frame = -3

Query  769  DLAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPA  590
            DL KLK VFKKDGTTTAGNSSQV+DGAGAVLLMKRS+A+QKGLPILGVFR+F AVGVDPA
Sbjct  273  DLGKLKAVFKKDGTTTAGNSSQVSDGAGAVLLMKRSIAMQKGLPILGVFRSFVAVGVDPA  332

Query  589  VMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAI  410
            +MG+GPA AIP AVK+AGLELDDIDLFEINEAFASQ++YC+ KLGLD +KINVNGGAMAI
Sbjct  333  IMGVGPAAAIPVAVKAAGLELDDIDLFEINEAFASQFVYCRNKLGLDSQKINVNGGAMAI  392

Query  409  GHPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKV  230
            GHPLGATGARCVATLLHEMK+RGKDCRYGV+SMCIGTGMGAA VFERGD+ DEL NARK 
Sbjct  393  GHPLGATGARCVATLLHEMKKRGKDCRYGVISMCIGTGMGAAAVFERGDSVDELCNARKG  452

Query  229  ETHGYLSKDAR  197
            +   +LSKDAR
Sbjct  453  DNL-FLSKDAR  462



>gb|ACN39947.1| unknown [Picea sitchensis]
 gb|ACN40646.1| unknown [Picea sitchensis]
Length=462

 Score =   332 bits (852),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 157/191 (82%), Positives = 177/191 (93%), Gaps = 0/191 (0%)
 Frame = -3

Query  769  DLAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPA  590
            DLAKLKP FKK G+TTAGNSSQV+DGAGAVLLMKR++A+QKGLPILGVFR+F AVGVDPA
Sbjct  272  DLAKLKPAFKKGGSTTAGNSSQVSDGAGAVLLMKRTVAMQKGLPILGVFRSFTAVGVDPA  331

Query  589  VMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAI  410
            VMG+GPAVAIPAAVK+AGLE+DDIDLFEINEAFASQ+ YC +KL LDPEK+NVNGGA+A+
Sbjct  332  VMGVGPAVAIPAAVKAAGLEIDDIDLFEINEAFASQFTYCSQKLELDPEKVNVNGGALAL  391

Query  409  GHPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKV  230
            GHPLGATGARCVATLLHEMKRRGKDCR+GV+SMCIGTGMGAA VFERG A D+L NAR +
Sbjct  392  GHPLGATGARCVATLLHEMKRRGKDCRFGVISMCIGTGMGAAAVFERGSAVDQLCNARPI  451

Query  229  ETHGYLSKDAR  197
            + H  LSKDA+
Sbjct  452  KDHTSLSKDAQ  462



>gb|AAQ77242.1| acetoacetyl CoA thiolase [Helianthus annuus]
Length=449

 Score =   332 bits (850),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 156/178 (88%), Positives = 173/178 (97%), Gaps = 0/178 (0%)
 Frame = -3

Query  769  DLAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPA  590
            DLAKLKPVF+KDG+TTAG SSQV+DGAGAVLLMKRS+A+QKGLPILGVFRTFAAVGV P+
Sbjct  270  DLAKLKPVFRKDGSTTAGTSSQVSDGAGAVLLMKRSIALQKGLPILGVFRTFAAVGVPPS  329

Query  589  VMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAI  410
            +MGIGPAVAIPAAVK+AGL++DDIDLFEINEAFASQ++YCQKKL +DP+KINVNGGAMAI
Sbjct  330  IMGIGPAVAIPAAVKAAGLQIDDIDLFEINEAFASQFVYCQKKLEIDPQKINVNGGAMAI  389

Query  409  GHPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNAR  236
            GHPLGATGARCVATLLHEMKRRG+DCR+GVVSMCIGTGMGAA VFERGDACDEL NA+
Sbjct  390  GHPLGATGARCVATLLHEMKRRGRDCRFGVVSMCIGTGMGAAAVFERGDACDELCNAK  447



>ref|XP_003555712.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like isoform 
X1 [Glycine max]
 gb|KHN18010.1| 3-ketoacyl-CoA thiolase 2, peroxisomal [Glycine soja]
Length=461

 Score =   332 bits (850),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 159/191 (83%), Positives = 176/191 (92%), Gaps = 1/191 (1%)
 Frame = -3

Query  769  DLAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPA  590
            DL +LKPVFKKDG+TTAGNSSQV+DGA AVLLMKRS+A+QKGLPILGVFRTFAAVGVDPA
Sbjct  272  DLGRLKPVFKKDGSTTAGNSSQVSDGAAAVLLMKRSVALQKGLPILGVFRTFAAVGVDPA  331

Query  589  VMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAI  410
            +MG+GPA AIP AVK+AGLELDDIDLFEINEAFASQ++YC+  LGLDPEKINVNGGAMAI
Sbjct  332  IMGVGPAAAIPVAVKAAGLELDDIDLFEINEAFASQFVYCRNNLGLDPEKINVNGGAMAI  391

Query  409  GHPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKV  230
            GHPLG+TGARCVATLLHEMK+RG+DCR+GV+SMCIGTGMGAA VFE GD  DEL NARKV
Sbjct  392  GHPLGSTGARCVATLLHEMKKRGRDCRFGVISMCIGTGMGAAAVFESGDCADELCNARKV  451

Query  229  ETHGYLSKDAR  197
            +    LSKDAR
Sbjct  452  DDL-LLSKDAR  461



>ref|XP_004954382.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Setaria 
italica]
Length=461

 Score =   331 bits (849),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 154/190 (81%), Positives = 180/190 (95%), Gaps = 0/190 (0%)
 Frame = -3

Query  766  LAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAV  587
            LAKLKP+FKKDGTTTAGNSSQV+DGAGAVLLMKRS+A++KGLPILGVFR+FAAVGVDPAV
Sbjct  272  LAKLKPIFKKDGTTTAGNSSQVSDGAGAVLLMKRSVALKKGLPILGVFRSFAAVGVDPAV  331

Query  586  MGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIG  407
            MG+GPAVAIPAAVKSAGLE++DIDLFE+NEAFASQ++YC  KLGLD  K+NVNGGA+A+G
Sbjct  332  MGVGPAVAIPAAVKSAGLEIEDIDLFELNEAFASQFVYCCNKLGLDRSKVNVNGGAIAMG  391

Query  406  HPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVE  227
            HPLGATGARCVATLL+EMKRRG+DCR+GVV+MCIG+GMGAA VFERGD  DELSN R ++
Sbjct  392  HPLGATGARCVATLLNEMKRRGRDCRFGVVTMCIGSGMGAAAVFERGDTVDELSNVRDIQ  451

Query  226  THGYLSKDAR  197
            +H +LS+DA+
Sbjct  452  SHNFLSRDAK  461



>ref|XP_008235516.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Prunus mume]
Length=467

 Score =   331 bits (849),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 160/192 (83%), Positives = 175/192 (91%), Gaps = 0/192 (0%)
 Frame = -3

Query  772  GDLAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDP  593
             DLAKLKP FK DG+TTAGN+SQV+DGAGAVLLMKRSLA+QKGLPILGVFR+FAAVGVDP
Sbjct  276  NDLAKLKPAFKADGSTTAGNASQVSDGAGAVLLMKRSLAMQKGLPILGVFRSFAAVGVDP  335

Query  592  AVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMA  413
            AVMGIGPA AIP AVKSAGLELDDIDLFEINEAFASQY+YC KKL LDPEK+NVNGGA+A
Sbjct  336  AVMGIGPAAAIPVAVKSAGLELDDIDLFEINEAFASQYVYCCKKLELDPEKVNVNGGAIA  395

Query  412  IGHPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARK  233
            +GHPLGATGARCVATLL+EMKRRGKD R+GV+SMCIG+GMGAA VFERGD+ DEL N R 
Sbjct  396  LGHPLGATGARCVATLLNEMKRRGKDHRFGVISMCIGSGMGAAAVFERGDSVDELCNVRT  455

Query  232  VETHGYLSKDAR  197
            VE +  LS DAR
Sbjct  456  VERNNLLSNDAR  467



>ref|XP_011020688.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like isoform 
X2 [Populus euphratica]
Length=458

 Score =   331 bits (848),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 158/188 (84%), Positives = 175/188 (93%), Gaps = 0/188 (0%)
 Frame = -3

Query  769  DLAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPA  590
            +L KLKP+FKKDGTTTAGNSSQV+DGAGAVLLMKRS+A+ KGLPILGVFRTF AVGVDPA
Sbjct  270  ELGKLKPLFKKDGTTTAGNSSQVSDGAGAVLLMKRSVAMHKGLPILGVFRTFTAVGVDPA  329

Query  589  VMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAI  410
            +MG+GPAVAIPAAVK+AGL L+DIDLFEINEAFASQ++YC+KKL LD +KINVNGGAMAI
Sbjct  330  IMGVGPAVAIPAAVKAAGLALEDIDLFEINEAFASQFVYCRKKLELDSQKINVNGGAMAI  389

Query  409  GHPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKV  230
            GHPLGATGARCVATLLHEMKRRG+DCR+GVVSMCIGTGMGAA VFERGD CDEL N RKV
Sbjct  390  GHPLGATGARCVATLLHEMKRRGRDCRFGVVSMCIGTGMGAAAVFERGDGCDELCNGRKV  449

Query  229  ETHGYLSK  206
            E++  LS 
Sbjct  450  ESNNLLSN  457



>ref|XP_010918893.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Elaeis 
guineensis]
Length=460

 Score =   331 bits (848),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 155/189 (82%), Positives = 178/189 (94%), Gaps = 0/189 (0%)
 Frame = -3

Query  766  LAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAV  587
            LAKLKP FKKDG+TTAGN+SQV+DGAGAVLLM+R +A+QKGLPILGVFR+FAAVGVDPAV
Sbjct  271  LAKLKPAFKKDGSTTAGNASQVSDGAGAVLLMRRDVAMQKGLPILGVFRSFAAVGVDPAV  330

Query  586  MGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIG  407
            MGIGPAVAIPAAVK+AGL++DDIDLFEINEAFASQY+YC KKL LDP K+NVNGGAMA G
Sbjct  331  MGIGPAVAIPAAVKAAGLQIDDIDLFEINEAFASQYVYCCKKLELDPSKVNVNGGAMAFG  390

Query  406  HPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVE  227
            HPLGATGARCV+TLL+EMKRRGKDCR+GV+SMCIG+GMGAA VFERGD  D+LSNAR+++
Sbjct  391  HPLGATGARCVSTLLNEMKRRGKDCRFGVISMCIGSGMGAAAVFERGDVVDQLSNARRIQ  450

Query  226  THGYLSKDA  200
            ++  LSKDA
Sbjct  451  SNNQLSKDA  459



>ref|XP_011020687.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like isoform 
X1 [Populus euphratica]
Length=460

 Score =   331 bits (848),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 158/188 (84%), Positives = 175/188 (93%), Gaps = 0/188 (0%)
 Frame = -3

Query  769  DLAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPA  590
            +L KLKP+FKKDGTTTAGNSSQV+DGAGAVLLMKRS+A+ KGLPILGVFRTF AVGVDPA
Sbjct  272  ELGKLKPLFKKDGTTTAGNSSQVSDGAGAVLLMKRSVAMHKGLPILGVFRTFTAVGVDPA  331

Query  589  VMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAI  410
            +MG+GPAVAIPAAVK+AGL L+DIDLFEINEAFASQ++YC+KKL LD +KINVNGGAMAI
Sbjct  332  IMGVGPAVAIPAAVKAAGLALEDIDLFEINEAFASQFVYCRKKLELDSQKINVNGGAMAI  391

Query  409  GHPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKV  230
            GHPLGATGARCVATLLHEMKRRG+DCR+GVVSMCIGTGMGAA VFERGD CDEL N RKV
Sbjct  392  GHPLGATGARCVATLLHEMKRRGRDCRFGVVSMCIGTGMGAAAVFERGDGCDELCNGRKV  451

Query  229  ETHGYLSK  206
            E++  LS 
Sbjct  452  ESNNLLSN  459



>ref|XP_007201004.1| hypothetical protein PRUPE_ppa005303mg [Prunus persica]
 gb|EMJ02203.1| hypothetical protein PRUPE_ppa005303mg [Prunus persica]
Length=467

 Score =   330 bits (847),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 160/191 (84%), Positives = 175/191 (92%), Gaps = 0/191 (0%)
 Frame = -3

Query  769  DLAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPA  590
            DLAKLKP FK DG+TTAGN+SQV+DGAGAVLLMKRSLA+QKGLPILGVFR+FAAVGVDPA
Sbjct  277  DLAKLKPAFKADGSTTAGNASQVSDGAGAVLLMKRSLAMQKGLPILGVFRSFAAVGVDPA  336

Query  589  VMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAI  410
            VMGIGPA AIP AVKSAGLELDDIDLFEINEAFASQY+YC KKL LDPEK+NVNGGA+A+
Sbjct  337  VMGIGPAAAIPVAVKSAGLELDDIDLFEINEAFASQYVYCCKKLELDPEKVNVNGGAIAL  396

Query  409  GHPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKV  230
            GHPLGATGARCVATLL+EMKRRGKD R+GV+SMCIG+GMGAA VFERGD+ DEL N R V
Sbjct  397  GHPLGATGARCVATLLNEMKRRGKDHRFGVISMCIGSGMGAAAVFERGDSVDELCNVRTV  456

Query  229  ETHGYLSKDAR  197
            E +  LS DAR
Sbjct  457  ERNNLLSNDAR  467



>gb|ACN29136.1| unknown [Zea mays]
 gb|AFW68658.1| hypothetical protein ZEAMMB73_512974 [Zea mays]
Length=461

 Score =   330 bits (845),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 154/189 (81%), Positives = 177/189 (94%), Gaps = 0/189 (0%)
 Frame = -3

Query  766  LAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAV  587
            L+KLKP F KDG+TTAGN+SQV+DGAGAVLLM+R +A++KGLP+LGVFRTFAAVGVDPAV
Sbjct  272  LSKLKPAFSKDGSTTAGNASQVSDGAGAVLLMRRDVAMKKGLPVLGVFRTFAAVGVDPAV  331

Query  586  MGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIG  407
            MGIGPAVAIPAAVK+AGL++DDIDLFEINEAFASQY+YC KKL LDP K+NVNGGAMA+G
Sbjct  332  MGIGPAVAIPAAVKAAGLQMDDIDLFEINEAFASQYVYCCKKLKLDPAKVNVNGGAMALG  391

Query  406  HPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVE  227
            HPLGATGARCV+TLL+EMKRRGKDCR+GV+SMCIG+GMGAA VFERGD  DEL+NAR + 
Sbjct  392  HPLGATGARCVSTLLNEMKRRGKDCRFGVISMCIGSGMGAAAVFERGDGVDELTNARGIS  451

Query  226  THGYLSKDA  200
            TH +LSKDA
Sbjct  452  THNWLSKDA  460



>ref|XP_009796305.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like isoform 
X2 [Nicotiana sylvestris]
Length=462

 Score =   330 bits (845),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 158/191 (83%), Positives = 177/191 (93%), Gaps = 0/191 (0%)
 Frame = -3

Query  769  DLAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPA  590
            +LAKLKP FK DGTTTAG +SQV+DGA AVLLMKRS+A+QKGLPILGVFR+FAAVGVDPA
Sbjct  272  NLAKLKPAFKSDGTTTAGTASQVSDGAAAVLLMKRSVAMQKGLPILGVFRSFAAVGVDPA  331

Query  589  VMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAI  410
            VMGIGPAVAIPAAVKSAGLELD+IDLFEINEAFASQ++YC+KKL LD EK+NVNGGAMA+
Sbjct  332  VMGIGPAVAIPAAVKSAGLELDNIDLFEINEAFASQFVYCRKKLNLDSEKVNVNGGAMAL  391

Query  409  GHPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKV  230
            GHPLGATGARCVATLLHEMKRRGKDCR+GV+SMCIG+GMGAA VFERGDA D+L NAR  
Sbjct  392  GHPLGATGARCVATLLHEMKRRGKDCRFGVISMCIGSGMGAAAVFERGDAVDDLCNARVN  451

Query  229  ETHGYLSKDAR  197
              + +LSKDA+
Sbjct  452  NNNNFLSKDAK  462



>dbj|BAI66423.1| 3-ketoacyl-CoA thiolase-like protein [Triticum aestivum]
Length=459

 Score =   329 bits (844),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 154/189 (81%), Positives = 178/189 (94%), Gaps = 0/189 (0%)
 Frame = -3

Query  766  LAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAV  587
            LAKLK VFKKDGTTTAGNSSQV+DGAGAVLLMKRS+A+ KGLPILGVFR+FAAVGVDPAV
Sbjct  269  LAKLKTVFKKDGTTTAGNSSQVSDGAGAVLLMKRSVAVSKGLPILGVFRSFAAVGVDPAV  328

Query  586  MGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIG  407
            MG+GPAVAIPAAVKSAGLE+DDIDLFE+NEAFASQ++YC  KLGLD  K+NVNGGA+A+G
Sbjct  329  MGVGPAVAIPAAVKSAGLEIDDIDLFELNEAFASQFVYCCNKLGLDRSKVNVNGGAIAMG  388

Query  406  HPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVE  227
            HPLGATGARC++TLL+EMKRRG+DCR+GVV+MCIG+GMGAA VFERGD+ DELSN R ++
Sbjct  389  HPLGATGARCISTLLNEMKRRGRDCRFGVVTMCIGSGMGAAAVFERGDSVDELSNVRHIQ  448

Query  226  THGYLSKDA  200
            +H +LSKDA
Sbjct  449  SHNFLSKDA  457



>ref|XP_009796304.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like isoform 
X1 [Nicotiana sylvestris]
Length=486

 Score =   330 bits (846),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 158/191 (83%), Positives = 177/191 (93%), Gaps = 0/191 (0%)
 Frame = -3

Query  769  DLAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPA  590
            +LAKLKP FK DGTTTAG +SQV+DGA AVLLMKRS+A+QKGLPILGVFR+FAAVGVDPA
Sbjct  296  NLAKLKPAFKSDGTTTAGTASQVSDGAAAVLLMKRSVAMQKGLPILGVFRSFAAVGVDPA  355

Query  589  VMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAI  410
            VMGIGPAVAIPAAVKSAGLELD+IDLFEINEAFASQ++YC+KKL LD EK+NVNGGAMA+
Sbjct  356  VMGIGPAVAIPAAVKSAGLELDNIDLFEINEAFASQFVYCRKKLNLDSEKVNVNGGAMAL  415

Query  409  GHPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKV  230
            GHPLGATGARCVATLLHEMKRRGKDCR+GV+SMCIG+GMGAA VFERGDA D+L NAR  
Sbjct  416  GHPLGATGARCVATLLHEMKRRGKDCRFGVISMCIGSGMGAAAVFERGDAVDDLCNARVN  475

Query  229  ETHGYLSKDAR  197
              + +LSKDA+
Sbjct  476  NNNNFLSKDAK  486



>ref|NP_001131193.1| acetyl-CoA C-acyltransferase-like protein [Zea mays]
 gb|ACF79501.1| unknown [Zea mays]
 gb|AFW74042.1| LOW QUALITY PROTEIN: acetyl-CoA C-acyltransferase-like protein 
[Zea mays]
Length=461

 Score =   329 bits (844),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 156/190 (82%), Positives = 178/190 (94%), Gaps = 0/190 (0%)
 Frame = -3

Query  766  LAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAV  587
            LAKLKPVFKKDGTTTAGNSSQV+DGAGAVLLMKRS+A++KGLPILGVFR+FAAVGVDPAV
Sbjct  272  LAKLKPVFKKDGTTTAGNSSQVSDGAGAVLLMKRSVALKKGLPILGVFRSFAAVGVDPAV  331

Query  586  MGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIG  407
            MG+GPAVAIPAAVKSAGLE+ DIDLFE+NEAFASQ++YC  KLGLD  K+NVNGGA+A+G
Sbjct  332  MGVGPAVAIPAAVKSAGLEIGDIDLFELNEAFASQFVYCCNKLGLDRSKVNVNGGAIALG  391

Query  406  HPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVE  227
            HPLGATGARCVATLL+EMKRRG+DCR+GVV+MCIG+GMGAA VFERGDA D LSN R ++
Sbjct  392  HPLGATGARCVATLLNEMKRRGRDCRFGVVTMCIGSGMGAAAVFERGDAVDGLSNVRDIQ  451

Query  226  THGYLSKDAR  197
             H +LSKDA+
Sbjct  452  AHNFLSKDAK  461



>gb|EMT31542.1| 3-ketoacyl-CoA thiolase 2, peroxisomal [Aegilops tauschii]
Length=459

 Score =   329 bits (843),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 153/189 (81%), Positives = 178/189 (94%), Gaps = 0/189 (0%)
 Frame = -3

Query  766  LAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAV  587
            LAKLK VFKKDGTTTAGNSSQV+DGAGAVLLMKRS+A+ KGLP+LGVFR+FAAVGVDPAV
Sbjct  269  LAKLKTVFKKDGTTTAGNSSQVSDGAGAVLLMKRSVAVSKGLPVLGVFRSFAAVGVDPAV  328

Query  586  MGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIG  407
            MG+GPAVAIPAAVKSAGLE+DDIDLFE+NEAFASQ++YC  KLGLD  K+NVNGGA+A+G
Sbjct  329  MGVGPAVAIPAAVKSAGLEIDDIDLFELNEAFASQFVYCCNKLGLDRSKVNVNGGAIAMG  388

Query  406  HPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVE  227
            HPLGATGARC++TLL+EMKRRG+DCR+GVV+MCIG+GMGAA VFERGD+ DELSN R ++
Sbjct  389  HPLGATGARCISTLLNEMKRRGRDCRFGVVTMCIGSGMGAAAVFERGDSVDELSNVRHIQ  448

Query  226  THGYLSKDA  200
            +H +LSKDA
Sbjct  449  SHNFLSKDA  457



>ref|XP_009629663.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Nicotiana 
tomentosiformis]
Length=494

 Score =   330 bits (846),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 158/191 (83%), Positives = 177/191 (93%), Gaps = 0/191 (0%)
 Frame = -3

Query  769  DLAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPA  590
            +LAKLKP FK DGTTTAG +SQV+DGA AVLLMKRS+A+QKGLPILGVFR+FAAVGVDPA
Sbjct  304  NLAKLKPAFKSDGTTTAGTASQVSDGAAAVLLMKRSVAMQKGLPILGVFRSFAAVGVDPA  363

Query  589  VMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAI  410
            VMGIGPAVAIPAAVKSAGLELD+IDLFEINEAFASQ++YC+KKL LD EK+NVNGGAMA+
Sbjct  364  VMGIGPAVAIPAAVKSAGLELDNIDLFEINEAFASQFVYCRKKLNLDSEKVNVNGGAMAL  423

Query  409  GHPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKV  230
            GHPLGATGARCVATLLHEMKRRGKDCR+GV+SMCIG+GMGAA VFERGDA D+L NAR  
Sbjct  424  GHPLGATGARCVATLLHEMKRRGKDCRFGVISMCIGSGMGAAAVFERGDAVDDLCNARVN  483

Query  229  ETHGYLSKDAR  197
              + +LSKDA+
Sbjct  484  NNNNFLSKDAK  494



>ref|XP_008349047.1| PREDICTED: LOW QUALITY PROTEIN: 3-ketoacyl-CoA thiolase 2, peroxisomal-like 
[Malus domestica]
Length=292

 Score =   323 bits (827),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 154/191 (81%), Positives = 175/191 (92%), Gaps = 0/191 (0%)
 Frame = -3

Query  769  DLAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPA  590
            DLAKL+P FK DG+TTAGN+SQV+DGAGAVLLMKRSLA+QKGLPILGVFR+FAAVGVDP 
Sbjct  102  DLAKLRPAFKPDGSTTAGNASQVSDGAGAVLLMKRSLAMQKGLPILGVFRSFAAVGVDPT  161

Query  589  VMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAI  410
            VMG+GPA AIP AVKSAGLELDDIDLFEINEAFASQY+YC KKL LDPEK+NVNGGA+A+
Sbjct  162  VMGVGPAAAIPVAVKSAGLELDDIDLFEINEAFASQYVYCCKKLELDPEKVNVNGGAIAL  221

Query  409  GHPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKV  230
            GHPLGATGARCVATLL+EMKRRG+D R+GV+SMCIG+GMGAA VFERGD+ DEL NAR V
Sbjct  222  GHPLGATGARCVATLLNEMKRRGRDHRFGVISMCIGSGMGAAAVFERGDSVDELCNARTV  281

Query  229  ETHGYLSKDAR  197
             ++  +S DA+
Sbjct  282  XSNNLVSNDAK  292



>gb|EYU17978.1| hypothetical protein MIMGU_mgv1a005895mg [Erythranthe guttata]
Length=466

 Score =   328 bits (842),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 156/190 (82%), Positives = 174/190 (92%), Gaps = 0/190 (0%)
 Frame = -3

Query  769  DLAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPA  590
            DLAKLKP FK +GTTTAGN+SQ++DGAGAVLLMKRSLAIQKGLPILG+FR+FAAVGVDP 
Sbjct  276  DLAKLKPAFKNNGTTTAGNASQISDGAGAVLLMKRSLAIQKGLPILGIFRSFAAVGVDPG  335

Query  589  VMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAI  410
            VMGIGPAVAIPAAV SAGLE+ DIDLFEINEAFASQ++YC KKL LDPEK+NVNGGAMA+
Sbjct  336  VMGIGPAVAIPAAVNSAGLEIADIDLFEINEAFASQFVYCCKKLDLDPEKVNVNGGAMAL  395

Query  409  GHPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKV  230
            GHPLGATGARCVATLL+EMKRRGKDCR+GV+SMCIG+GMGAA V ERGD  DELSNA+ +
Sbjct  396  GHPLGATGARCVATLLNEMKRRGKDCRFGVISMCIGSGMGAAAVLERGDCVDELSNAQAI  455

Query  229  ETHGYLSKDA  200
                +LSKDA
Sbjct  456  SAQNFLSKDA  465



>ref|NP_001241698.1| 3-ketoacyl-CoA thiolase 2, peroxisomal precursor [Zea mays]
 gb|ACG36949.1| 3-ketoacyl-CoA thiolase 2, peroxisomal precursor [Zea mays]
Length=461

 Score =   328 bits (841),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 156/190 (82%), Positives = 178/190 (94%), Gaps = 0/190 (0%)
 Frame = -3

Query  766  LAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAV  587
            LAKLKPVFKKDGTTTAGNSSQV+DGAGAVLLMKRS+A++KGLPILGVFR+FAAVGVDPAV
Sbjct  272  LAKLKPVFKKDGTTTAGNSSQVSDGAGAVLLMKRSVALKKGLPILGVFRSFAAVGVDPAV  331

Query  586  MGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIG  407
            MG+GPAVAIPAAVKSAGLE+ DIDLFE+NEAFASQ++YC  KLGLD  K+NVNGGA+A+G
Sbjct  332  MGVGPAVAIPAAVKSAGLEIGDIDLFELNEAFASQFVYCCNKLGLDRSKVNVNGGAIALG  391

Query  406  HPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVE  227
            HPLGATGARCVATLL+EMKRRG+DCR+GVV+MCIG+GMGAA VFERGDA D LSN R ++
Sbjct  392  HPLGATGARCVATLLNEMKRRGRDCRFGVVTMCIGSGMGAAAVFERGDAVDGLSNVRDMQ  451

Query  226  THGYLSKDAR  197
             H +LSKDA+
Sbjct  452  AHNFLSKDAK  461



>dbj|BAJ87577.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=460

 Score =   328 bits (841),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 154/189 (81%), Positives = 177/189 (94%), Gaps = 0/189 (0%)
 Frame = -3

Query  766  LAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAV  587
            LAKLK VFKKDGTTTAGNSSQV+DGAGAVLLMKRS+A+ KGLPILGVFR+F AVGVDPAV
Sbjct  270  LAKLKTVFKKDGTTTAGNSSQVSDGAGAVLLMKRSVAVSKGLPILGVFRSFVAVGVDPAV  329

Query  586  MGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIG  407
            MGIGPAVAIPAAVKSAGLE+DDIDLFE+NEAFASQ++YC  KLGLD  K+NVNGGA+A+G
Sbjct  330  MGIGPAVAIPAAVKSAGLEIDDIDLFELNEAFASQFVYCCNKLGLDRSKVNVNGGAIAMG  389

Query  406  HPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVE  227
            HPLGATGARC++TLL+EMKRRG+DCR+GVV+MCIG+GMGAA VFERGD+ DELSN R ++
Sbjct  390  HPLGATGARCISTLLNEMKRRGRDCRFGVVTMCIGSGMGAAAVFERGDSVDELSNVRHIQ  449

Query  226  THGYLSKDA  200
            +H +LSKDA
Sbjct  450  SHNFLSKDA  458



>gb|KHG11493.1| 3-ketoacyl-CoA thiolase 2, peroxisomal -like protein [Gossypium 
arboreum]
Length=463

 Score =   328 bits (841),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 160/190 (84%), Positives = 175/190 (92%), Gaps = 0/190 (0%)
 Frame = -3

Query  769  DLAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPA  590
            DLAKLKP FKKDGTTTAGN+SQV+DGAGAVLLMKRSLA+QKGLPILGVFR+FAAVGVDPA
Sbjct  274  DLAKLKPAFKKDGTTTAGNASQVSDGAGAVLLMKRSLAMQKGLPILGVFRSFAAVGVDPA  333

Query  589  VMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAI  410
            VMGIGPAVAIPAA+KSAGLELDDIDLFEINEAFASQ++Y  KKLGLD EK+NVNGGA+A+
Sbjct  334  VMGIGPAVAIPAAIKSAGLELDDIDLFEINEAFASQFVYSCKKLGLDREKVNVNGGAIAL  393

Query  409  GHPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKV  230
            GHPLGATGARCV TLL+EMKRRGKDCR+GV+SMCIG+GMGAA VFERGD  DE  NAR V
Sbjct  394  GHPLGATGARCVGTLLNEMKRRGKDCRFGVISMCIGSGMGAASVFERGDCVDEFCNARAV  453

Query  229  ETHGYLSKDA  200
              +  LSKDA
Sbjct  454  HKNELLSKDA  463



>ref|XP_009400955.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009400962.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Musa 
acuminata subsp. malaccensis]
Length=459

 Score =   328 bits (840),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 150/189 (79%), Positives = 179/189 (95%), Gaps = 0/189 (0%)
 Frame = -3

Query  766  LAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAV  587
            LAKL+PVFKKDG+TTAGNSSQV+DGAGAVLLM+R +A+QKG PILGVFR+FAAVGVDPAV
Sbjct  270  LAKLRPVFKKDGSTTAGNSSQVSDGAGAVLLMRRDVAMQKGFPILGVFRSFAAVGVDPAV  329

Query  586  MGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIG  407
            MG+GPA+AIPAAVKSAGL+++D+DLFEINEAFASQ++YC+KKL LDP K+NVNGGA+A+G
Sbjct  330  MGVGPAIAIPAAVKSAGLQIEDVDLFEINEAFASQFVYCRKKLELDPAKVNVNGGAIALG  389

Query  406  HPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVE  227
            HPLGATGARCV+TLL+EMKRRGKDCR+GV+SMCIG+GMGAA VFERGDA D L+NAR++ 
Sbjct  390  HPLGATGARCVSTLLNEMKRRGKDCRFGVISMCIGSGMGAAAVFERGDAVDGLTNARQIH  449

Query  226  THGYLSKDA  200
            +H  LS+DA
Sbjct  450  SHNLLSEDA  458



>ref|XP_002467133.1| hypothetical protein SORBIDRAFT_01g020150 [Sorghum bicolor]
 gb|EER94131.1| hypothetical protein SORBIDRAFT_01g020150 [Sorghum bicolor]
Length=462

 Score =   328 bits (840),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 154/189 (81%), Positives = 176/189 (93%), Gaps = 0/189 (0%)
 Frame = -3

Query  766  LAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAV  587
            L+KLKP F KDGTTTAGN+SQV+DGAGAVLLM+R +A++KGLPILGVFRTFAAVGVDPAV
Sbjct  273  LSKLKPAFSKDGTTTAGNASQVSDGAGAVLLMRRDVAMKKGLPILGVFRTFAAVGVDPAV  332

Query  586  MGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIG  407
            MGIGPAVAIPAAVK+AGL++DDIDLFEINEAFASQY+YC KKL LDP K+NVNGGAMA+G
Sbjct  333  MGIGPAVAIPAAVKAAGLQMDDIDLFEINEAFASQYVYCCKKLELDPAKVNVNGGAMALG  392

Query  406  HPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVE  227
            HPLG TGARCV+TLL+EMKRRGKDCR+GV+SMCIG+GMGAA VFERGD  DEL+N+R + 
Sbjct  393  HPLGCTGARCVSTLLNEMKRRGKDCRFGVISMCIGSGMGAAAVFERGDCVDELTNSRGIP  452

Query  226  THGYLSKDA  200
            TH +LSKDA
Sbjct  453  THNWLSKDA  461



>ref|XP_006350308.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Solanum 
tuberosum]
Length=456

 Score =   327 bits (839),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 159/190 (84%), Positives = 177/190 (93%), Gaps = 0/190 (0%)
 Frame = -3

Query  766  LAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAV  587
            LAKLKP FK+DG TTAGNSSQV+DGA AVLLMKRS+A+QKGLPILGVFR+FAAVGVDPAV
Sbjct  267  LAKLKPAFKRDGATTAGNSSQVSDGAAAVLLMKRSIAMQKGLPILGVFRSFAAVGVDPAV  326

Query  586  MGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIG  407
            MGIGPAVAIPAAVKSAGLEL++IDLFEINEAFASQY+YCQKKL LDPE +NVNGGA+A+G
Sbjct  327  MGIGPAVAIPAAVKSAGLELNNIDLFEINEAFASQYVYCQKKLNLDPENVNVNGGALALG  386

Query  406  HPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVE  227
            HPLGATGARCVATLLHEMKRRGKDCR+GV+SMCIG+GMGAA VFERGDA D+L NAR   
Sbjct  387  HPLGATGARCVATLLHEMKRRGKDCRFGVISMCIGSGMGAAAVFERGDAVDDLCNARANN  446

Query  226  THGYLSKDAR  197
             + +LSKDA+
Sbjct  447  NNNFLSKDAK  456



>gb|EEC67095.1| hypothetical protein OsI_33888 [Oryza sativa Indica Group]
Length=461

 Score =   327 bits (839),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 154/189 (81%), Positives = 177/189 (94%), Gaps = 0/189 (0%)
 Frame = -3

Query  766  LAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAV  587
            L+KLKP F KDGTTTAGN+SQV+DGAGAVLLM+R +A+QKGLPI+GVFR+FAAVGVDPAV
Sbjct  272  LSKLKPAFSKDGTTTAGNASQVSDGAGAVLLMRRDIAMQKGLPIVGVFRSFAAVGVDPAV  331

Query  586  MGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIG  407
            MG+GPAVAIPAAVK+AGL++DD+DLFEINEAFASQY+YC KKLGLDP K+NVNGGAMA+G
Sbjct  332  MGVGPAVAIPAAVKAAGLQIDDVDLFEINEAFASQYVYCCKKLGLDPAKVNVNGGAMALG  391

Query  406  HPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVE  227
            HPLGATGAR V+TLL+EMKRRGKDCR+GV+SMCIG+GMGAA VFERGDA DEL+NAR + 
Sbjct  392  HPLGATGARSVSTLLNEMKRRGKDCRFGVISMCIGSGMGAAAVFERGDAVDELTNARCIP  451

Query  226  THGYLSKDA  200
            TH  LSKDA
Sbjct  452  THNRLSKDA  460



>ref|XP_002521123.1| 3-ketoacyl-CoA thiolase B, putative [Ricinus communis]
 gb|EEF41274.1| 3-ketoacyl-CoA thiolase B, putative [Ricinus communis]
Length=467

 Score =   327 bits (839),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 158/191 (83%), Positives = 175/191 (92%), Gaps = 0/191 (0%)
 Frame = -3

Query  769  DLAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPA  590
            DL+KLKP FKKDG+TTAGN+SQV+DGAGAVLL KRS+A+QKGLPILGVFR+FAAVGVDPA
Sbjct  277  DLSKLKPAFKKDGSTTAGNASQVSDGAGAVLLAKRSVAVQKGLPILGVFRSFAAVGVDPA  336

Query  589  VMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAI  410
            VMG+GPA AIPAAVK+AGLELD+IDLFEINEAFASQY+YC KKL LDPEK+NVNGGA+A+
Sbjct  337  VMGVGPAFAIPAAVKAAGLELDNIDLFEINEAFASQYVYCCKKLELDPEKVNVNGGAIAL  396

Query  409  GHPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKV  230
            GHPLGATGARCVATLLHEMKR GKDCR+GV+SMCIGTGMGAA VFERGD  DEL NAR V
Sbjct  397  GHPLGATGARCVATLLHEMKRCGKDCRFGVISMCIGTGMGAAAVFERGDCVDELCNARPV  456

Query  229  ETHGYLSKDAR  197
              +  LSKDA 
Sbjct  457  NGNDLLSKDAH  467



>ref|NP_001064764.1| Os10g0457600 [Oryza sativa Japonica Group]
 gb|AAK54299.1|AC034258_17 putative thiolase [Oryza sativa Japonica Group]
 gb|AAP54100.1| 3-ketoacyl-CoA thiolase 2, peroxisomal precursor, putative, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF26678.1| Os10g0457600 [Oryza sativa Japonica Group]
 gb|EAZ16317.1| hypothetical protein OsJ_31778 [Oryza sativa Japonica Group]
 dbj|BAG92981.1| unnamed protein product [Oryza sativa Japonica Group]
Length=461

 Score =   327 bits (838),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 153/189 (81%), Positives = 177/189 (94%), Gaps = 0/189 (0%)
 Frame = -3

Query  766  LAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAV  587
            L+KLKP F KDGTTTAGN+SQV+DGAGAVLLM+R +A+QKGLPI+GVFR+FAAVGVDPA+
Sbjct  272  LSKLKPAFSKDGTTTAGNASQVSDGAGAVLLMRRDIAMQKGLPIVGVFRSFAAVGVDPAI  331

Query  586  MGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIG  407
            MG+GPAVAIPAAVK+AGL++DD+DLFEINEAFASQY+YC KKLGLDP K+NVNGGAMA+G
Sbjct  332  MGVGPAVAIPAAVKAAGLQIDDVDLFEINEAFASQYVYCCKKLGLDPAKVNVNGGAMALG  391

Query  406  HPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVE  227
            HPLGATGAR V+TLL+EMKRRGKDCR+GV+SMCIG+GMGAA VFERGDA DEL+NAR + 
Sbjct  392  HPLGATGARSVSTLLNEMKRRGKDCRFGVISMCIGSGMGAAAVFERGDAVDELTNARCIP  451

Query  226  THGYLSKDA  200
            TH  LSKDA
Sbjct  452  THNRLSKDA  460



>ref|XP_010038353.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Eucalyptus 
grandis]
 ref|XP_010038354.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Eucalyptus 
grandis]
 gb|KCW50167.1| hypothetical protein EUGRSUZ_K03601 [Eucalyptus grandis]
 gb|KCW50168.1| hypothetical protein EUGRSUZ_K03601 [Eucalyptus grandis]
Length=466

 Score =   327 bits (838),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 156/191 (82%), Positives = 177/191 (93%), Gaps = 0/191 (0%)
 Frame = -3

Query  769  DLAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPA  590
            DLAKLKP F+KDG TTAGN+SQV+DGAGAVLLMKRS+A+QKGLPILGVFR+FAAVGVDPA
Sbjct  276  DLAKLKPAFRKDGATTAGNASQVSDGAGAVLLMKRSVAVQKGLPILGVFRSFAAVGVDPA  335

Query  589  VMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAI  410
            VMGIGPAVAIPAAVKSAGL LDDIDL EINEAFASQY+YC KKLGLDPEK+NVNGGA+A+
Sbjct  336  VMGIGPAVAIPAAVKSAGLTLDDIDLLEINEAFASQYVYCCKKLGLDPEKVNVNGGALAL  395

Query  409  GHPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKV  230
            GHPLGATGARCVATLL+EMKR+G+D R+GV+SMCIG+GMGAA VFERGD  DEL NAR +
Sbjct  396  GHPLGATGARCVATLLNEMKRQGRDSRFGVISMCIGSGMGAAAVFERGDCADELCNARPI  455

Query  229  ETHGYLSKDAR  197
            + +  LS+DA+
Sbjct  456  KINNLLSRDAQ  466



>ref|XP_004247103.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Solanum lycopersicum]
Length=456

 Score =   327 bits (837),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 159/190 (84%), Positives = 177/190 (93%), Gaps = 0/190 (0%)
 Frame = -3

Query  766  LAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAV  587
            LAKLKP FK+DG TTAGNSSQV+DGA AVLLMKRS+A+QKGLPILGVFR+FAAVGVDPAV
Sbjct  267  LAKLKPAFKRDGATTAGNSSQVSDGAAAVLLMKRSVAMQKGLPILGVFRSFAAVGVDPAV  326

Query  586  MGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIG  407
            MGIGPAVAIPAAVKSAGLEL++IDLFEINEAFASQY+YCQKKL LDPE +NVNGGA+A+G
Sbjct  327  MGIGPAVAIPAAVKSAGLELNNIDLFEINEAFASQYVYCQKKLNLDPENVNVNGGALALG  386

Query  406  HPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVE  227
            HPLGATGARCVATLLHEMKRRGKDCR+GV+SMCIG+GMGAA VFERGDA D+L NAR   
Sbjct  387  HPLGATGARCVATLLHEMKRRGKDCRFGVISMCIGSGMGAAAVFERGDAVDDLCNARANN  446

Query  226  THGYLSKDAR  197
             + +LSKDA+
Sbjct  447  NNNFLSKDAK  456



>ref|XP_007049825.1| Peroxisomal 3-ketoacyl-CoA thiolase 3 isoform 1 [Theobroma cacao]
 gb|EOX93982.1| Peroxisomal 3-ketoacyl-CoA thiolase 3 isoform 1 [Theobroma cacao]
Length=470

 Score =   327 bits (838),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 158/191 (83%), Positives = 175/191 (92%), Gaps = 0/191 (0%)
 Frame = -3

Query  769  DLAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPA  590
            DLAKLKP F+KDG TTAGN+SQV+DGAGAVLLMKRSLA+QKGLPILGVFR+FAAVGVDPA
Sbjct  280  DLAKLKPAFRKDGATTAGNASQVSDGAGAVLLMKRSLAMQKGLPILGVFRSFAAVGVDPA  339

Query  589  VMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAI  410
            VMGIGPAVAIPAAVKSAG+EL DIDLFEINEAFASQY+YC KKL LD EK+NVNGGA+A+
Sbjct  340  VMGIGPAVAIPAAVKSAGIELADIDLFEINEAFASQYVYCCKKLELDSEKVNVNGGAIAL  399

Query  409  GHPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKV  230
            GHPLGATGARCV TLL+EMKRRGKDCR+GV+SMCIG+GMGAA VFERGD  DE  N R V
Sbjct  400  GHPLGATGARCVGTLLYEMKRRGKDCRFGVISMCIGSGMGAAAVFERGDCVDEFCNVRAV  459

Query  229  ETHGYLSKDAR  197
            + + +LSKDAR
Sbjct  460  KYNEFLSKDAR  470



>gb|KJB10128.1| hypothetical protein B456_001G185200 [Gossypium raimondii]
Length=465

 Score =   327 bits (837),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 158/191 (83%), Positives = 175/191 (92%), Gaps = 0/191 (0%)
 Frame = -3

Query  769  DLAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPA  590
            DLAKLKP FKKDGTTTAGN+SQV+DGAGA LLMKRSLA+QKG PILGVFR+FAAVGVDPA
Sbjct  275  DLAKLKPAFKKDGTTTAGNASQVSDGAGAALLMKRSLAMQKGFPILGVFRSFAAVGVDPA  334

Query  589  VMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAI  410
            VMGIGPAVAIPAA+KSAGLELDDIDLFEINEAFASQ++Y  KKLGLD EK+NVNGGA+A+
Sbjct  335  VMGIGPAVAIPAAIKSAGLELDDIDLFEINEAFASQFVYSCKKLGLDREKVNVNGGAIAL  394

Query  409  GHPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKV  230
            GHPLGATGARCV TLL+EMKRRGKDCR+GV+SMCIG+GMGAA VFERGD  D+  NAR V
Sbjct  395  GHPLGATGARCVGTLLNEMKRRGKDCRFGVISMCIGSGMGAAAVFERGDCVDDFCNARAV  454

Query  229  ETHGYLSKDAR  197
            + +  LSKDAR
Sbjct  455  QKNDLLSKDAR  465



>ref|XP_011006998.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Populus 
euphratica]
Length=457

 Score =   326 bits (836),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 156/191 (82%), Positives = 176/191 (92%), Gaps = 0/191 (0%)
 Frame = -3

Query  769  DLAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPA  590
            +L++LKP FKKDG+TTAGN+SQV+DGAGAVLLMKRSLA QKGLPILGVFR+FAAVGVDPA
Sbjct  267  ELSRLKPAFKKDGSTTAGNASQVSDGAGAVLLMKRSLAAQKGLPILGVFRSFAAVGVDPA  326

Query  589  VMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAI  410
            VMG+GPA AIPAAV+SAGLEL+DIDLFEINEAFASQY+YC KKL LDPEK+NVNGGA+A+
Sbjct  327  VMGVGPAAAIPAAVQSAGLELNDIDLFEINEAFASQYVYCIKKLELDPEKVNVNGGAIAL  386

Query  409  GHPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKV  230
            GHPLGATGARCV TLL+EMKRRGKD R+GV+SMCIG+GMGAA VFERGD  D L N RKV
Sbjct  387  GHPLGATGARCVGTLLNEMKRRGKDSRFGVISMCIGSGMGAAAVFERGDCVDALCNVRKV  446

Query  229  ETHGYLSKDAR  197
            E++  LSKDAR
Sbjct  447  ESNDLLSKDAR  457



>ref|XP_011083116.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Sesamum indicum]
Length=463

 Score =   326 bits (835),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 157/190 (83%), Positives = 174/190 (92%), Gaps = 0/190 (0%)
 Frame = -3

Query  769  DLAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPA  590
            DLAKLKP FKK+GTTTAGN+SQV+DGAGAVLLMKRSLA+QKGLPILG+FR+FAAVGVDP 
Sbjct  273  DLAKLKPAFKKNGTTTAGNASQVSDGAGAVLLMKRSLAMQKGLPILGIFRSFAAVGVDPG  332

Query  589  VMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAI  410
            VMGIGPAVAIP AVKSAGLEL DIDLFEINEAFASQ++YC KKL LD EK+NVNGGAMA+
Sbjct  333  VMGIGPAVAIPPAVKSAGLELSDIDLFEINEAFASQFVYCCKKLDLDREKVNVNGGAMAL  392

Query  409  GHPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKV  230
            GHPLGATGARCVATLL+EMKRRGKDCR+GV+SMCIG+GMGAA V ERGD  D+L NAR V
Sbjct  393  GHPLGATGARCVATLLNEMKRRGKDCRFGVISMCIGSGMGAAAVLERGDCVDDLCNARAV  452

Query  229  ETHGYLSKDA  200
              + +LSKDA
Sbjct  453  SENNFLSKDA  462



>ref|XP_010940650.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Elaeis 
guineensis]
Length=461

 Score =   325 bits (833),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 153/189 (81%), Positives = 175/189 (93%), Gaps = 0/189 (0%)
 Frame = -3

Query  766  LAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAV  587
            LAKLKPVFKKDG+TTAGNSSQV+DGAGAVLLM+R +A+QKG PILGVFR+FAAVGVDPAV
Sbjct  272  LAKLKPVFKKDGSTTAGNSSQVSDGAGAVLLMRRDVAMQKGFPILGVFRSFAAVGVDPAV  331

Query  586  MGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIG  407
            MGIGPAVAIPAAVKSAGL+++DIDLFE+NEAFASQ++YC KKL LDP K+NVNGGA+A+G
Sbjct  332  MGIGPAVAIPAAVKSAGLQIEDIDLFELNEAFASQFVYCCKKLELDPAKVNVNGGAIALG  391

Query  406  HPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVE  227
            HPLGATGARCV TLL+EMKRRGKDCR+GVV+MCIG+GMGAA VFERGD  DEL N RK++
Sbjct  392  HPLGATGARCVGTLLNEMKRRGKDCRFGVVTMCIGSGMGAAAVFERGDGVDELCNTRKIQ  451

Query  226  THGYLSKDA  200
            +   LSKDA
Sbjct  452  SQNLLSKDA  460



>pdb|2C7Y|A Chain A, Plant Enzyme
 pdb|2C7Y|B Chain B, Plant Enzyme
 pdb|2C7Z|A Chain A, Plant Enzyme Crystal Form Ii
Length=404

 Score =   323 bits (827),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 155/168 (92%), Positives = 165/168 (98%), Gaps = 0/168 (0%)
 Frame = -3

Query  766  LAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAV  587
            L KLKPVFKKDGTTTAGNSSQV+DGAGAVLLMKRS+A+QKGLP+LGVFRTFAAVGVDPA+
Sbjct  236  LGKLKPVFKKDGTTTAGNSSQVSDGAGAVLLMKRSVAMQKGLPVLGVFRTFAAVGVDPAI  295

Query  586  MGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIG  407
            MGIGPAVAIPAAVK+AGLELDDIDLFEINEAFASQ++YC+ KLGLDPEKINVNGGAMAIG
Sbjct  296  MGIGPAVAIPAAVKAAGLELDDIDLFEINEAFASQFVYCRNKLGLDPEKINVNGGAMAIG  355

Query  406  HPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGD  263
            HPLGATGARCVATLLHEMKRRGKDCR+GVVSMCIGTGMGAA VFERGD
Sbjct  356  HPLGATGARCVATLLHEMKRRGKDCRFGVVSMCIGTGMGAAAVFERGD  403



>emb|CDP03848.1| unnamed protein product [Coffea canephora]
Length=466

 Score =   325 bits (832),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 155/191 (81%), Positives = 174/191 (91%), Gaps = 0/191 (0%)
 Frame = -3

Query  769  DLAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPA  590
            DLAKLKP FKKDGTTTAGN+SQ++DGAGAVLLMKRSLA++KGLPILG+FR+F+  GVDPA
Sbjct  276  DLAKLKPAFKKDGTTTAGNASQISDGAGAVLLMKRSLAMEKGLPILGIFRSFSVAGVDPA  335

Query  589  VMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAI  410
            VMGIGPAVAIPAA KSAGL +DDIDLFEINEAFASQY+YC KKL LD EK+NVNGGAMA+
Sbjct  336  VMGIGPAVAIPAAAKSAGLGVDDIDLFEINEAFASQYVYCCKKLELDMEKVNVNGGAMAL  395

Query  409  GHPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKV  230
            GHPLGATGARCVATLLHEMKRRG+DCR+GV+SMCIG+GMGAAGVFERGD+ D+L NAR V
Sbjct  396  GHPLGATGARCVATLLHEMKRRGRDCRFGVISMCIGSGMGAAGVFERGDSTDDLCNARPV  455

Query  229  ETHGYLSKDAR  197
                 LSKD +
Sbjct  456  SKVNLLSKDVK  466



>ref|XP_002963753.1| hypothetical protein SELMODRAFT_450889 [Selaginella moellendorffii]
 gb|EFJ35624.1| hypothetical protein SELMODRAFT_450889 [Selaginella moellendorffii]
Length=462

 Score =   324 bits (830),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 157/191 (82%), Positives = 173/191 (91%), Gaps = 0/191 (0%)
 Frame = -3

Query  769  DLAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPA  590
            DLAKLKP FKK GTTTAGNSSQV+DGAGAVLLMKRS+AIQ+GLPILGVFR+FAAVGVDPA
Sbjct  272  DLAKLKPAFKKGGTTTAGNSSQVSDGAGAVLLMKRSVAIQRGLPILGVFRSFAAVGVDPA  331

Query  589  VMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAI  410
            VMGIGPAVAIP AVK AGLE+ DIDLFE+NEAFASQ+ Y  KKL LD EK+NVNGGAMA+
Sbjct  332  VMGIGPAVAIPKAVKDAGLEISDIDLFELNEAFASQFTYSCKKLDLDIEKVNVNGGAMAL  391

Query  409  GHPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKV  230
            GHPLGATGARCVATLLHEM +RGKDCR+GV+SMCIG+GMGAA VFERG+A D LSNAR V
Sbjct  392  GHPLGATGARCVATLLHEMSKRGKDCRFGVISMCIGSGMGAAAVFERGNAVDNLSNARPV  451

Query  229  ETHGYLSKDAR  197
            + +  LSKDAR
Sbjct  452  QNNSLLSKDAR  462



>ref|XP_003570403.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Brachypodium 
distachyon]
Length=461

 Score =   323 bits (829),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 152/190 (80%), Positives = 177/190 (93%), Gaps = 0/190 (0%)
 Frame = -3

Query  766  LAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAV  587
            LAKLK VFKKDGTTTAGNSSQV+DGAGAVLLM+R++A+ KGLPILGVFR+FAAVGVDPAV
Sbjct  272  LAKLKTVFKKDGTTTAGNSSQVSDGAGAVLLMRRAVAMSKGLPILGVFRSFAAVGVDPAV  331

Query  586  MGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIG  407
            MG+GPAVAIPAAVKSAGLE+DDIDLFE+NEAFASQ++YC K LGLD  K+NVNGGA+A+G
Sbjct  332  MGVGPAVAIPAAVKSAGLEIDDIDLFELNEAFASQFVYCCKTLGLDRSKVNVNGGAIAMG  391

Query  406  HPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVE  227
            HPLGATGARC+ATLL+EMKRRG+DCR+GVV+MCIG+GMGAA VFERGD+ DELSN R V 
Sbjct  392  HPLGATGARCIATLLNEMKRRGRDCRFGVVTMCIGSGMGAAAVFERGDSVDELSNVRHVP  451

Query  226  THGYLSKDAR  197
            +  +LS+DA+
Sbjct  452  SQNFLSRDAK  461



>ref|XP_010933143.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Elaeis 
guineensis]
Length=460

 Score =   323 bits (828),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 152/189 (80%), Positives = 175/189 (93%), Gaps = 0/189 (0%)
 Frame = -3

Query  766  LAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAV  587
            LAKLKP FKKDGTTTAGN+SQV+DGAGAVLLM+R +A+QKGLPILGVFR+F AVGVDPAV
Sbjct  271  LAKLKPAFKKDGTTTAGNASQVSDGAGAVLLMRRDVAMQKGLPILGVFRSFGAVGVDPAV  330

Query  586  MGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIG  407
            MGIGPAVAIPAAVK+AGL++DDIDLFEINEAFASQ++YC KKL LDP K+NVNGGA+A+G
Sbjct  331  MGIGPAVAIPAAVKAAGLQIDDIDLFEINEAFASQFVYCCKKLELDPSKVNVNGGAIALG  390

Query  406  HPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVE  227
            HPLGATGARCV TLL+EMKRRGK CR+GV+SMCIG+GMGAA VFERGD  D+LSNAR+++
Sbjct  391  HPLGATGARCVITLLNEMKRRGKKCRFGVISMCIGSGMGAAAVFERGDVVDQLSNARRIQ  450

Query  226  THGYLSKDA  200
            +   LSKDA
Sbjct  451  STSLLSKDA  459



>gb|EMS60447.1| 3-ketoacyl-CoA thiolase 2, peroxisomal [Triticum urartu]
Length=435

 Score =   322 bits (825),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 149/188 (79%), Positives = 175/188 (93%), Gaps = 0/188 (0%)
 Frame = -3

Query  766  LAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAV  587
            L+KLKP F KDGTTTAGN+SQV+DGAGAVLLM+R +A QKGLPILG++R+FAAVGVDPAV
Sbjct  246  LSKLKPAFSKDGTTTAGNASQVSDGAGAVLLMRRDVATQKGLPILGIYRSFAAVGVDPAV  305

Query  586  MGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIG  407
            MG+GPAVAIPAAVK+AGL+++D+DLFEINEAFASQY+YC KKL LDP K+NVNGGA+A+G
Sbjct  306  MGVGPAVAIPAAVKAAGLQINDVDLFEINEAFASQYVYCSKKLDLDPAKVNVNGGAIALG  365

Query  406  HPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVE  227
            HPLGATGARCV+TLL+EMKRRGKDCR+GV+SMCIG+GMGAA VFERGDA DEL+NAR V 
Sbjct  366  HPLGATGARCVSTLLNEMKRRGKDCRFGVISMCIGSGMGAAAVFERGDAVDELTNARGVP  425

Query  226  THGYLSKD  203
            +  +LSKD
Sbjct  426  SLNWLSKD  433



>gb|ABR16781.1| unknown [Picea sitchensis]
Length=462

 Score =   322 bits (826),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 153/190 (81%), Positives = 173/190 (91%), Gaps = 0/190 (0%)
 Frame = -3

Query  766  LAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAV  587
            L KLKP FKK G+TTAGNSSQV+DGAGAVLLMKR +A+QKGLPILGVFR+F AVGVDPAV
Sbjct  273  LGKLKPAFKKGGSTTAGNSSQVSDGAGAVLLMKRVVAMQKGLPILGVFRSFTAVGVDPAV  332

Query  586  MGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIG  407
            MG+GPAVAIPAAVK+AGLE+DDIDLFEINEAFASQ+ YC +KL LDPEK+NVNGGA+A+G
Sbjct  333  MGVGPAVAIPAAVKAAGLEIDDIDLFEINEAFASQFTYCSQKLELDPEKVNVNGGAIALG  392

Query  406  HPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVE  227
            HPLGATGARCVATLLHEMKRRGKDCR+GV+SMCIGTGMGAA VFER  A D+L NAR ++
Sbjct  393  HPLGATGARCVATLLHEMKRRGKDCRFGVISMCIGTGMGAAAVFERSGAVDQLCNARPIK  452

Query  226  THGYLSKDAR  197
             H  LS+DA+
Sbjct  453  DHTSLSRDAQ  462



>gb|KJB42403.1| hypothetical protein B456_007G152600 [Gossypium raimondii]
Length=372

 Score =   319 bits (818),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 155/181 (86%), Positives = 169/181 (93%), Gaps = 0/181 (0%)
 Frame = -3

Query  766  LAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAV  587
            LAKLKP FKKDGTTTAGN+SQV+DGAGAVLLMKRSLA+QKGLPILGVFR+FAAVGVDPAV
Sbjct  192  LAKLKPAFKKDGTTTAGNASQVSDGAGAVLLMKRSLALQKGLPILGVFRSFAAVGVDPAV  251

Query  586  MGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIG  407
            MGIGPAVAIPAAVKSAGLE+DDIDLFEINEAFASQ++Y  KKLGLD EK+NVNGGA+A+G
Sbjct  252  MGIGPAVAIPAAVKSAGLEIDDIDLFEINEAFASQFVYSCKKLGLDREKVNVNGGAIALG  311

Query  406  HPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVE  227
            HPLG TGARCV TLL+EMKRRGKDCR+GV+SMCIGTGMGAA VFERGD  DEL NAR V+
Sbjct  312  HPLGVTGARCVGTLLYEMKRRGKDCRFGVISMCIGTGMGAAAVFERGDCVDELCNARAVK  371

Query  226  T  224
             
Sbjct  372  N  372



>ref|XP_009371217.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Pyrus x bretschneideri]
Length=453

 Score =   322 bits (825),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 154/181 (85%), Positives = 171/181 (94%), Gaps = 0/181 (0%)
 Frame = -3

Query  772  GDLAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDP  593
             DLAKLKP FK+DG+TTAGN+SQV+DGAGAVLLMKRSLA+QKGLPILGVFR+FAAVGVDP
Sbjct  273  NDLAKLKPAFKRDGSTTAGNASQVSDGAGAVLLMKRSLAMQKGLPILGVFRSFAAVGVDP  332

Query  592  AVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMA  413
            AVMG+GPA AIP AVKSAGLELDDIDLFE+NEAFASQY+YC KKL LDPEK+NVNGGA+A
Sbjct  333  AVMGVGPAAAIPVAVKSAGLELDDIDLFEMNEAFASQYVYCIKKLELDPEKVNVNGGAIA  392

Query  412  IGHPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARK  233
            +GHPLGATGARCVATLL+EMKRRGKD R+GV+SMCIG+GMGAA VFERGD+ DELSNAR 
Sbjct  393  LGHPLGATGARCVATLLNEMKRRGKDNRFGVISMCIGSGMGAAAVFERGDSVDELSNARA  452

Query  232  V  230
            V
Sbjct  453  V  453



>ref|XP_002974835.1| hypothetical protein SELMODRAFT_101898 [Selaginella moellendorffii]
 gb|EFJ24355.1| hypothetical protein SELMODRAFT_101898 [Selaginella moellendorffii]
Length=454

 Score =   322 bits (825),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 156/191 (82%), Positives = 173/191 (91%), Gaps = 0/191 (0%)
 Frame = -3

Query  769  DLAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPA  590
            DLAKLKP FKK GTTTAGNSSQV+DGAGAVLLMKRS+AIQ+GLPILGVFR+FAAVGVDPA
Sbjct  264  DLAKLKPAFKKGGTTTAGNSSQVSDGAGAVLLMKRSVAIQRGLPILGVFRSFAAVGVDPA  323

Query  589  VMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAI  410
            VMGIGPAVAIP AVK AGLE+ DIDLFE+NEAFASQ+ Y  KKL LD EK+NVNGGA+A+
Sbjct  324  VMGIGPAVAIPKAVKDAGLEISDIDLFELNEAFASQFTYSCKKLDLDMEKVNVNGGAIAL  383

Query  409  GHPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKV  230
            GHPLGATGARCVATLLHEM +RGKDCR+GV+SMCIG+GMGAA VFERG+A D LSNAR V
Sbjct  384  GHPLGATGARCVATLLHEMSKRGKDCRFGVISMCIGSGMGAAAVFERGNAVDNLSNARPV  443

Query  229  ETHGYLSKDAR  197
            + +  LSKDAR
Sbjct  444  QNNSLLSKDAR  454



>ref|XP_008800565.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Phoenix 
dactylifera]
Length=461

 Score =   322 bits (825),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 151/189 (80%), Positives = 175/189 (93%), Gaps = 0/189 (0%)
 Frame = -3

Query  766  LAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAV  587
            LAKLKPVF+KDG+TTAGNSSQV+DGA AVLLM+R +AI+KG PI GVFR+FAAVGVDPAV
Sbjct  272  LAKLKPVFQKDGSTTAGNSSQVSDGAAAVLLMRRDVAIKKGFPIFGVFRSFAAVGVDPAV  331

Query  586  MGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIG  407
            MGIGPAVAIPAAVKSAGL+++DIDLFE+NEAFASQ++YC KKL LDP K+NVNGGA+A+G
Sbjct  332  MGIGPAVAIPAAVKSAGLQIEDIDLFELNEAFASQFVYCCKKLELDPAKVNVNGGAIALG  391

Query  406  HPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVE  227
            HPLGATGARCVATLL+EMKR+GKDCR+GVV+MCIG+GMGAA VFERGD  DEL NARK++
Sbjct  392  HPLGATGARCVATLLNEMKRKGKDCRFGVVTMCIGSGMGAAAVFERGDGVDELCNARKIQ  451

Query  226  THGYLSKDA  200
            +   LSKDA
Sbjct  452  SQNLLSKDA  460



>ref|XP_002889522.1| hypothetical protein ARALYDRAFT_470458 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65781.1| hypothetical protein ARALYDRAFT_470458 [Arabidopsis lyrata subsp. 
lyrata]
Length=419

 Score =   320 bits (821),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 151/179 (84%), Positives = 172/179 (96%), Gaps = 0/179 (0%)
 Frame = -3

Query  766  LAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAV  587
            LAKL+PVFK+DGTTTAGNSSQ++DGAGAVLLM+R++A+QKGLPILGVFRTFAAVGVDPA+
Sbjct  239  LAKLRPVFKEDGTTTAGNSSQLSDGAGAVLLMRRNVAMQKGLPILGVFRTFAAVGVDPAI  298

Query  586  MGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIG  407
            MG+GPAVAIPAAVK+AGLEL+DIDLFEINEAFASQ++YC+ KLG+DPEK+NVNGGA+AIG
Sbjct  299  MGVGPAVAIPAAVKAAGLELNDIDLFEINEAFASQFVYCRNKLGIDPEKVNVNGGAIAIG  358

Query  406  HPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKV  230
            HPLGATGARCVATLLHEMKRRGKDCR+GVVSMCIG+GMGAA VFERG   DEL + RKV
Sbjct  359  HPLGATGARCVATLLHEMKRRGKDCRFGVVSMCIGSGMGAAAVFERGGGVDELCDVRKV  417



>ref|XP_010457531.1| PREDICTED: 3-ketoacyl-CoA thiolase 1, peroxisomal [Camelina sativa]
Length=439

 Score =   321 bits (822),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 151/178 (85%), Positives = 169/178 (95%), Gaps = 0/178 (0%)
 Frame = -3

Query  766  LAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAV  587
            L KLKPVFKKDGTTTAGNSSQ++DGAGAVLLM+R++A+QKGLPILGVFRTFAAVGVDPA+
Sbjct  262  LTKLKPVFKKDGTTTAGNSSQLSDGAGAVLLMRRNVAMQKGLPILGVFRTFAAVGVDPAI  321

Query  586  MGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIG  407
            MG+GPA+AIPAAVK+AGLELDDIDLFEINEAFASQY+YC+ KLGL+PE INVNGGA+AIG
Sbjct  322  MGVGPALAIPAAVKAAGLELDDIDLFEINEAFASQYVYCRNKLGLNPENINVNGGAIAIG  381

Query  406  HPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARK  233
            HPLGATGARCVATLLHEMKRRGKDCR+GVVSMCIG+GMGAA VFERG + DEL N  +
Sbjct  382  HPLGATGARCVATLLHEMKRRGKDCRFGVVSMCIGSGMGAAAVFERGGSVDELPNVSR  439



>ref|XP_010109695.1| 3-ketoacyl-CoA thiolase 2 [Morus notabilis]
 gb|EXC24165.1| 3-ketoacyl-CoA thiolase 2 [Morus notabilis]
Length=452

 Score =   321 bits (822),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 151/178 (85%), Positives = 171/178 (96%), Gaps = 0/178 (0%)
 Frame = -3

Query  769  DLAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPA  590
            DLAKLKP F+KDG+TTAGN+SQV+DG+GAVLLMKRSLAI+KGLP+LGVFR+FAAVGVDPA
Sbjct  273  DLAKLKPAFRKDGSTTAGNASQVSDGSGAVLLMKRSLAIKKGLPVLGVFRSFAAVGVDPA  332

Query  589  VMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAI  410
            VMGIGPAVAIPAAVKSAGLEL+DIDLFEINEAFASQY+YC KKLGLDPEK+NVNGGA+A+
Sbjct  333  VMGIGPAVAIPAAVKSAGLELNDIDLFEINEAFASQYVYCIKKLGLDPEKVNVNGGALAL  392

Query  409  GHPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNAR  236
            GHPLGATGAR V+TLL+EMKRRGKDCR+G++SMCIG+GMGAA V ERGD+ DEL NAR
Sbjct  393  GHPLGATGARSVSTLLNEMKRRGKDCRFGIISMCIGSGMGAAAVLERGDSVDELRNAR  450



>ref|XP_006307517.1| hypothetical protein CARUB_v10009140mg [Capsella rubella]
 gb|EOA40415.1| hypothetical protein CARUB_v10009140mg [Capsella rubella]
Length=444

 Score =   320 bits (821),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 151/175 (86%), Positives = 168/175 (96%), Gaps = 0/175 (0%)
 Frame = -3

Query  766  LAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAV  587
            L KLKPVFKKDGTTTAGNSSQ++DGAGAVLLM+RS+A++KGLPILGVFRTFAAVGVDPA+
Sbjct  265  LMKLKPVFKKDGTTTAGNSSQLSDGAGAVLLMRRSVAMEKGLPILGVFRTFAAVGVDPAI  324

Query  586  MGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIG  407
            MGIGPAVAIP AVK+A LELDDIDLFEINEAFASQ++YC+ KLG++PEKINVNGGA+AIG
Sbjct  325  MGIGPAVAIPTAVKAASLELDDIDLFEINEAFASQFVYCRNKLGINPEKINVNGGAIAIG  384

Query  406  HPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSN  242
            HPLGATGARCVATLLHEMKRRGKDCR+GVVSMCIG+GMGAA VFERGD+ DEL N
Sbjct  385  HPLGATGARCVATLLHEMKRRGKDCRFGVVSMCIGSGMGAAAVFERGDSVDELRN  439



>ref|XP_008372446.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Malus domestica]
Length=453

 Score =   320 bits (821),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 153/180 (85%), Positives = 169/180 (94%), Gaps = 0/180 (0%)
 Frame = -3

Query  769  DLAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPA  590
            DLAKLKP FK+DG+TTAGN+SQV+DGAGAVLLMKRSLA QKGLPI GVFR+FAAVGVDPA
Sbjct  274  DLAKLKPAFKRDGSTTAGNASQVSDGAGAVLLMKRSLAXQKGLPIXGVFRSFAAVGVDPA  333

Query  589  VMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAI  410
            VMG+GPA AIP AVKSAGLE+DDIDLFEINEAFASQY+YC KKL LDPEK+NVNGGA+A+
Sbjct  334  VMGVGPAAAIPVAVKSAGLEIDDIDLFEINEAFASQYVYCVKKLELDPEKVNVNGGAIAL  393

Query  409  GHPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKV  230
            GHPLGATGARCVATLL+EMKRRGKD R+GV+SMCIG+GMGAA VFERGD+ DELSNAR V
Sbjct  394  GHPLGATGARCVATLLNEMKRRGKDNRFGVISMCIGSGMGAAAVFERGDSVDELSNARAV  453



>ref|XP_009411367.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Musa 
acuminata subsp. malaccensis]
Length=459

 Score =   320 bits (821),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 150/189 (79%), Positives = 177/189 (94%), Gaps = 0/189 (0%)
 Frame = -3

Query  766  LAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAV  587
            LAKLKP FKKDG+TTAGN+SQV+DGAGAVLLM+R +A+QKGLPILGVFR+FAAVGV+P V
Sbjct  270  LAKLKPAFKKDGSTTAGNASQVSDGAGAVLLMRRDVAMQKGLPILGVFRSFAAVGVEPGV  329

Query  586  MGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIG  407
            MGIGPAVAIPAAV++AGL+ DDID+FEINEAFASQ++YC KKL LDPEK+NVNGGA+A+G
Sbjct  330  MGIGPAVAIPAAVRAAGLQPDDIDIFEINEAFASQFVYCCKKLELDPEKVNVNGGAIALG  389

Query  406  HPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVE  227
            HPLGATGARCV+TLL+EMKRRGKDCR+GV+SMCIG+GMGAA VFE GD  D+L+NAR+VE
Sbjct  390  HPLGATGARCVSTLLNEMKRRGKDCRFGVISMCIGSGMGAAAVFEHGDVVDQLTNARQVE  449

Query  226  THGYLSKDA  200
             + +LSKDA
Sbjct  450  ANSFLSKDA  458



>ref|XP_008804452.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Phoenix 
dactylifera]
Length=460

 Score =   320 bits (821),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 150/189 (79%), Positives = 175/189 (93%), Gaps = 0/189 (0%)
 Frame = -3

Query  766  LAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAV  587
            LAKLKP FKKDG+TTAGN+SQV+DGAGAVLLM+R +A++KGLPILGVFR+FAAVGVDPAV
Sbjct  271  LAKLKPAFKKDGSTTAGNASQVSDGAGAVLLMRRDVAMKKGLPILGVFRSFAAVGVDPAV  330

Query  586  MGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIG  407
            MGIGPAVAIPAAV +AGL+ DDIDLFEINEAFASQ++YC KKL LDP K+NVNGGA+A+G
Sbjct  331  MGIGPAVAIPAAVNAAGLQTDDIDLFEINEAFASQFVYCCKKLELDPSKVNVNGGALALG  390

Query  406  HPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVE  227
            HPLG TGARCV+TLL+EMKRRGKDCR+GV+SMCIG+GMGAA VFERGD  D+LSNAR++ 
Sbjct  391  HPLGDTGARCVSTLLNEMKRRGKDCRFGVISMCIGSGMGAAAVFERGDVVDQLSNARRIR  450

Query  226  THGYLSKDA  200
            ++  LSKDA
Sbjct  451  SNNLLSKDA  459



>ref|XP_009385864.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Musa 
acuminata subsp. malaccensis]
Length=463

 Score =   320 bits (821),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 152/189 (80%), Positives = 175/189 (93%), Gaps = 0/189 (0%)
 Frame = -3

Query  766  LAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAV  587
            LAKLKPVFKKDG+TTAGNSSQV+DGAGAVLLM+R +A+Q G PILGVFR+FAAVGVDPAV
Sbjct  273  LAKLKPVFKKDGSTTAGNSSQVSDGAGAVLLMRRDVAMQNGFPILGVFRSFAAVGVDPAV  332

Query  586  MGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIG  407
            MG+GPAVAIPAAVKSAGL+++DIDLFEINEAFASQ++YC KKL LD  K+NVNGGA+A+G
Sbjct  333  MGVGPAVAIPAAVKSAGLQIEDIDLFEINEAFASQFVYCCKKLELDATKVNVNGGAIALG  392

Query  406  HPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVE  227
            HPLGATGAR V+TLL+EMKRRGKDCR GV+SMCIGTGMGAA VFERGDA D L+NAR+++
Sbjct  393  HPLGATGARSVSTLLNEMKRRGKDCRLGVISMCIGTGMGAAAVFERGDATDGLTNARRMQ  452

Query  226  THGYLSKDA  200
            +H  LSKDA
Sbjct  453  SHNLLSKDA  461



>ref|XP_010547052.1| PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxisomal isoform X3 
[Tarenaya hassleriana]
Length=426

 Score =   319 bits (818),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 154/191 (81%), Positives = 172/191 (90%), Gaps = 0/191 (0%)
 Frame = -3

Query  769  DLAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPA  590
            DLAKLKP FK  G+TTAGN+SQV+DGAGAVLLMKRSLA+QKGLPILGVFR+FA  GVDPA
Sbjct  236  DLAKLKPAFKPGGSTTAGNASQVSDGAGAVLLMKRSLAVQKGLPILGVFRSFAVTGVDPA  295

Query  589  VMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAI  410
            VMG+GPA AIPAA K AGL + DIDLFEINEAFASQ++Y  KKL LD EK+NVNGGA+A+
Sbjct  296  VMGVGPAFAIPAAAKLAGLRVSDIDLFEINEAFASQFVYSCKKLELDREKVNVNGGAIAL  355

Query  409  GHPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKV  230
            GHPLGATGARCVATLLHEMKRRGKDCR+GV+SMCIGTGMGAA VFERGDA D+LSNAR V
Sbjct  356  GHPLGATGARCVATLLHEMKRRGKDCRFGVISMCIGTGMGAAAVFERGDAVDDLSNARTV  415

Query  229  ETHGYLSKDAR  197
              +G+LSKDA+
Sbjct  416  NLNGHLSKDAK  426



>ref|XP_010935683.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Elaeis 
guineensis]
Length=461

 Score =   320 bits (821),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 151/190 (79%), Positives = 174/190 (92%), Gaps = 0/190 (0%)
 Frame = -3

Query  766  LAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAV  587
            LAKLKPVF+KDG+TTAGNSSQV+DGA AVLLM+R +AI+KG PI GVFR+FAAVGVDPAV
Sbjct  272  LAKLKPVFQKDGSTTAGNSSQVSDGAAAVLLMRRDVAIKKGFPIFGVFRSFAAVGVDPAV  331

Query  586  MGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIG  407
            MGIGPAVAIPAAVKSAGL+++DIDLFE+NEAFASQ++YC KKL LDP K+NVNGGA+A+G
Sbjct  332  MGIGPAVAIPAAVKSAGLQIEDIDLFELNEAFASQFVYCCKKLELDPAKVNVNGGAIALG  391

Query  406  HPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVE  227
            HPLGATGARCV+TLL+EMKRRGKDCR+GVV+MCIG+GMGAA VFERGD  D L NARK+ 
Sbjct  392  HPLGATGARCVSTLLNEMKRRGKDCRFGVVTMCIGSGMGAAAVFERGDGVDALCNARKIP  451

Query  226  THGYLSKDAR  197
            +   LSKDAR
Sbjct  452  SQNLLSKDAR  461



>ref|XP_008804745.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Phoenix dactylifera]
Length=460

 Score =   320 bits (820),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 149/189 (79%), Positives = 176/189 (93%), Gaps = 0/189 (0%)
 Frame = -3

Query  766  LAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAV  587
            LAKLKP FKKDG+TTAGN+SQV+DGAGAVLLM++ +A+QKG PILGVFR+FAAVGVDPAV
Sbjct  271  LAKLKPAFKKDGSTTAGNASQVSDGAGAVLLMRKDVAMQKGFPILGVFRSFAAVGVDPAV  330

Query  586  MGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIG  407
            MGIGPAVAIPAAVK+AGL++DDIDLFEINEAFASQ++YC KKL LDP K+NVNGGA+A+G
Sbjct  331  MGIGPAVAIPAAVKAAGLQIDDIDLFEINEAFASQFVYCCKKLELDPSKVNVNGGAIALG  390

Query  406  HPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVE  227
            HPLGATGAR V+TLL+EMKRRGKDCR+GV+SMCIG+GMGAA VFERGD  D+LSN R+++
Sbjct  391  HPLGATGARSVSTLLNEMKRRGKDCRFGVISMCIGSGMGAAAVFERGDVVDQLSNVRRIQ  450

Query  226  THGYLSKDA  200
            ++  LSKDA
Sbjct  451  SNNLLSKDA  459



>ref|XP_010484155.1| PREDICTED: 3-ketoacyl-CoA thiolase 1, peroxisomal-like isoform 
X2 [Camelina sativa]
Length=440

 Score =   319 bits (817),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 151/176 (86%), Positives = 168/176 (95%), Gaps = 0/176 (0%)
 Frame = -3

Query  766  LAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAV  587
            L KLK VFKKDGTTTAGNSSQ++DGAGAVLLM+R++A+QKGLPILGVFRTFAAVGVDP +
Sbjct  262  LTKLKSVFKKDGTTTAGNSSQLSDGAGAVLLMRRNVAMQKGLPILGVFRTFAAVGVDPEI  321

Query  586  MGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIG  407
            MG+GPAVAIPAAVK+AGLELDDIDLFEINEAFASQY+YC+ KLGL+PEKINVNGGA+AIG
Sbjct  322  MGVGPAVAIPAAVKAAGLELDDIDLFEINEAFASQYVYCRNKLGLNPEKINVNGGAIAIG  381

Query  406  HPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNA  239
            HPLGATGARCVATLLHEMKRRGKDCR+GVVSMCIG+GMGAA VFERG + DEL N+
Sbjct  382  HPLGATGARCVATLLHEMKRRGKDCRFGVVSMCIGSGMGAAAVFERGGSVDELPNS  437



>ref|XP_010547051.1| PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxisomal isoform X2 
[Tarenaya hassleriana]
Length=468

 Score =   320 bits (819),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 154/191 (81%), Positives = 172/191 (90%), Gaps = 0/191 (0%)
 Frame = -3

Query  769  DLAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPA  590
            DLAKLKP FK  G+TTAGN+SQV+DGAGAVLLMKRSLA+QKGLPILGVFR+FA  GVDPA
Sbjct  278  DLAKLKPAFKPGGSTTAGNASQVSDGAGAVLLMKRSLAVQKGLPILGVFRSFAVTGVDPA  337

Query  589  VMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAI  410
            VMG+GPA AIPAA K AGL + DIDLFEINEAFASQ++Y  KKL LD EK+NVNGGA+A+
Sbjct  338  VMGVGPAFAIPAAAKLAGLRVSDIDLFEINEAFASQFVYSCKKLELDREKVNVNGGAIAL  397

Query  409  GHPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKV  230
            GHPLGATGARCVATLLHEMKRRGKDCR+GV+SMCIGTGMGAA VFERGDA D+LSNAR V
Sbjct  398  GHPLGATGARCVATLLHEMKRRGKDCRFGVISMCIGTGMGAAAVFERGDAVDDLSNARTV  457

Query  229  ETHGYLSKDAR  197
              +G+LSKDA+
Sbjct  458  NLNGHLSKDAK  468



>gb|KJB42405.1| hypothetical protein B456_007G152600 [Gossypium raimondii]
Length=454

 Score =   319 bits (817),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 155/181 (86%), Positives = 169/181 (93%), Gaps = 0/181 (0%)
 Frame = -3

Query  766  LAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAV  587
            LAKLKP FKKDGTTTAGN+SQV+DGAGAVLLMKRSLA+QKGLPILGVFR+FAAVGVDPAV
Sbjct  274  LAKLKPAFKKDGTTTAGNASQVSDGAGAVLLMKRSLALQKGLPILGVFRSFAAVGVDPAV  333

Query  586  MGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIG  407
            MGIGPAVAIPAAVKSAGLE+DDIDLFEINEAFASQ++Y  KKLGLD EK+NVNGGA+A+G
Sbjct  334  MGIGPAVAIPAAVKSAGLEIDDIDLFEINEAFASQFVYSCKKLGLDREKVNVNGGAIALG  393

Query  406  HPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVE  227
            HPLG TGARCV TLL+EMKRRGKDCR+GV+SMCIGTGMGAA VFERGD  DEL NAR V+
Sbjct  394  HPLGVTGARCVGTLLYEMKRRGKDCRFGVISMCIGTGMGAAAVFERGDCVDELCNARAVK  453

Query  226  T  224
             
Sbjct  454  N  454



>gb|KHG13200.1| 3-ketoacyl-CoA thiolase 2, peroxisomal -like protein [Gossypium 
arboreum]
 gb|KHG18802.1| 3-ketoacyl-CoA thiolase 2, peroxisomal -like protein [Gossypium 
arboreum]
Length=454

 Score =   319 bits (817),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 155/181 (86%), Positives = 169/181 (93%), Gaps = 0/181 (0%)
 Frame = -3

Query  766  LAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAV  587
            LAKLKP FKKDGTTTAGN+SQV+DGAGAVLLMKRSLA+QKGLPILGVFR+FAAVGVDPAV
Sbjct  274  LAKLKPAFKKDGTTTAGNASQVSDGAGAVLLMKRSLALQKGLPILGVFRSFAAVGVDPAV  333

Query  586  MGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIG  407
            MGIGPAVAIPAAVKSAGLE+DDIDLFEINEAFASQ++Y  KKLGLD EK+NVNGGA+A+G
Sbjct  334  MGIGPAVAIPAAVKSAGLEIDDIDLFEINEAFASQFVYSCKKLGLDREKVNVNGGAIALG  393

Query  406  HPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVE  227
            HPLG TGARCV TLL+EMKRRGKDCR+GV+SMCIGTGMGAA VFERGD  DEL NAR V+
Sbjct  394  HPLGVTGARCVGTLLNEMKRRGKDCRFGVISMCIGTGMGAAAVFERGDCVDELCNARAVK  453

Query  226  T  224
             
Sbjct  454  N  454



>ref|XP_004982961.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Setaria 
italica]
Length=461

 Score =   319 bits (818),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 150/189 (79%), Positives = 175/189 (93%), Gaps = 0/189 (0%)
 Frame = -3

Query  766  LAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAV  587
            L+KLKP F KDGTTTAGN+SQV+DGAGAVLLM+R +A++KGLPILGVFR+FAAVGVDPAV
Sbjct  272  LSKLKPAFSKDGTTTAGNASQVSDGAGAVLLMRRDVAMKKGLPILGVFRSFAAVGVDPAV  331

Query  586  MGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIG  407
            MGIGPAVAIPAAV++AGL++ DIDLFEINEAFASQY+YC KKL LDP K+NVNGGA+A+G
Sbjct  332  MGIGPAVAIPAAVQAAGLQIGDIDLFEINEAFASQYVYCCKKLELDPTKVNVNGGAIALG  391

Query  406  HPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVE  227
            HPLGATGARCV+TLL+EMKRRGKDCR+GV+SMCIG+GMGAA VFERGD  DEL+NAR + 
Sbjct  392  HPLGATGARCVSTLLNEMKRRGKDCRFGVISMCIGSGMGAAAVFERGDGVDELTNARDIP  451

Query  226  THGYLSKDA  200
            +  +LSKDA
Sbjct  452  SLNWLSKDA  460



>emb|CDX86611.1| BnaC08g00920D [Brassica napus]
Length=451

 Score =   319 bits (817),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 161/180 (89%), Positives = 175/180 (97%), Gaps = 0/180 (0%)
 Frame = -3

Query  766  LAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAV  587
            LAKLKPVFK+DG+TTAGNSSQV+DGAGAVLLMKRS+A+QKGLPILGVFRTFAAVGVDPAV
Sbjct  272  LAKLKPVFKQDGSTTAGNSSQVSDGAGAVLLMKRSVAMQKGLPILGVFRTFAAVGVDPAV  331

Query  586  MGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIG  407
            MG+GPA AIPAAVK+AGLELDDIDLFEINEAFASQ++YC+ KLGLDPEKINVNGGA+AIG
Sbjct  332  MGVGPAAAIPAAVKAAGLELDDIDLFEINEAFASQFVYCRNKLGLDPEKINVNGGAIAIG  391

Query  406  HPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVE  227
            HPLGATGARCVATLLHEMKRRGKDCR+GVV+MCIG+GMGAAGVFERGD  DELSN RKVE
Sbjct  392  HPLGATGARCVATLLHEMKRRGKDCRFGVVTMCIGSGMGAAGVFERGDGVDELSNVRKVE  451



>ref|XP_008438387.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Cucumis melo]
Length=462

 Score =   319 bits (818),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 164/192 (85%), Positives = 181/192 (94%), Gaps = 1/192 (1%)
 Frame = -3

Query  769  DLAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPA  590
            DL KLKPVFKKDGTTTAGNSSQV+DGAGAVLLMKRS+A++KGLPILGVFRTF+AVGVDPA
Sbjct  271  DLGKLKPVFKKDGTTTAGNSSQVSDGAGAVLLMKRSVAMRKGLPILGVFRTFSAVGVDPA  330

Query  589  VMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAI  410
            +MG+GPA AIPAAVK+AGLEL+DIDLFEINEAFASQ++YC++KLGLDPEKINVNGGA+AI
Sbjct  331  IMGVGPAAAIPAAVKAAGLELNDIDLFEINEAFASQFVYCREKLGLDPEKINVNGGAIAI  390

Query  409  GHPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKV  230
            GHPLGATGARCVATLLHEMKRRGKDCR+GV+SMCIGTGMGAA VFERGD  DEL NA+KV
Sbjct  391  GHPLGATGARCVATLLHEMKRRGKDCRFGVISMCIGTGMGAAAVFERGDCVDELCNAKKV  450

Query  229  ETH-GYLSKDAR  197
            E     LSKDAR
Sbjct  451  EGGVNLLSKDAR  462



>ref|NP_171965.1| 3-ketoacyl-CoA thiolase 1 [Arabidopsis thaliana]
 sp|Q8LF48.2|THIK1_ARATH RecName: Full=3-ketoacyl-CoA thiolase 1, peroxisomal; AltName: 
Full=Acetyl-CoA acyltransferase 1; AltName: Full=Beta-ketothiolase 
1; AltName: Full=Peroxisomal 3-oxoacyl-CoA thiolase 
1; Flags: Precursor [Arabidopsis thaliana]
 gb|AAM20592.1| putative acetyl-CoA acyltransferase [Arabidopsis thaliana]
 gb|AAO30078.1| putative acetyl-CoA acyltransferase [Arabidopsis thaliana]
 gb|AEE27736.1| 3-ketoacyl-CoA thiolase 1 [Arabidopsis thaliana]
Length=443

 Score =   318 bits (816),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 151/179 (84%), Positives = 171/179 (96%), Gaps = 0/179 (0%)
 Frame = -3

Query  766  LAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAV  587
            LAKLKPVFK+DGTTTAGNSSQ++DGAGAVLLM+R++A+QKGLPILGVFRTF+AVGVDPA+
Sbjct  265  LAKLKPVFKEDGTTTAGNSSQLSDGAGAVLLMRRNVAMQKGLPILGVFRTFSAVGVDPAI  324

Query  586  MGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIG  407
            MG+GPAVAIPAAVK+AGLEL+D+DLFEINEAFASQ++YC+ KLGLD EKINVNGGA+AIG
Sbjct  325  MGVGPAVAIPAAVKAAGLELNDVDLFEINEAFASQFVYCRNKLGLDAEKINVNGGAIAIG  384

Query  406  HPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKV  230
            HPLGATGARCVATLLHEMKRRGKDCR+GVVSMCIG+GMGAA VFERG   DEL + RKV
Sbjct  385  HPLGATGARCVATLLHEMKRRGKDCRFGVVSMCIGSGMGAAAVFERGGGVDELCDVRKV  443



>ref|XP_010547050.1| PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxisomal isoform X1 
[Tarenaya hassleriana]
Length=474

 Score =   319 bits (818),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 154/191 (81%), Positives = 172/191 (90%), Gaps = 0/191 (0%)
 Frame = -3

Query  769  DLAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPA  590
            DLAKLKP FK  G+TTAGN+SQV+DGAGAVLLMKRSLA+QKGLPILGVFR+FA  GVDPA
Sbjct  284  DLAKLKPAFKPGGSTTAGNASQVSDGAGAVLLMKRSLAVQKGLPILGVFRSFAVTGVDPA  343

Query  589  VMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAI  410
            VMG+GPA AIPAA K AGL + DIDLFEINEAFASQ++Y  KKL LD EK+NVNGGA+A+
Sbjct  344  VMGVGPAFAIPAAAKLAGLRVSDIDLFEINEAFASQFVYSCKKLELDREKVNVNGGAIAL  403

Query  409  GHPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKV  230
            GHPLGATGARCVATLLHEMKRRGKDCR+GV+SMCIGTGMGAA VFERGDA D+LSNAR V
Sbjct  404  GHPLGATGARCVATLLHEMKRRGKDCRFGVISMCIGTGMGAAAVFERGDAVDDLSNARTV  463

Query  229  ETHGYLSKDAR  197
              +G+LSKDA+
Sbjct  464  NLNGHLSKDAK  474



>ref|XP_010475137.1| PREDICTED: 3-ketoacyl-CoA thiolase 1, peroxisomal-like [Camelina 
sativa]
Length=446

 Score =   318 bits (815),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 152/180 (84%), Positives = 169/180 (94%), Gaps = 0/180 (0%)
 Frame = -3

Query  766  LAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAV  587
            L KL PVFKKDGTTTAGNSSQ++DGAGAVLLM+RS+A+QKGLPILGVFR+FAAVGVDPA+
Sbjct  261  LTKLIPVFKKDGTTTAGNSSQLSDGAGAVLLMRRSVAMQKGLPILGVFRSFAAVGVDPAI  320

Query  586  MGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIG  407
            MG+GPAVAIPAAVK+AGLELDDIDLFEINEAFASQY+YC+ KLG++PEKINVNGGA+AIG
Sbjct  321  MGVGPAVAIPAAVKAAGLELDDIDLFEINEAFASQYVYCRNKLGINPEKINVNGGAIAIG  380

Query  406  HPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVE  227
            HPLGATGARCVATLLHEMKRRGK CR+GVVSMCIG+GMGAA VFERG + DEL N  K E
Sbjct  381  HPLGATGARCVATLLHEMKRRGKYCRFGVVSMCIGSGMGAAAVFERGGSVDELRNVSKGE  440



>ref|XP_003574006.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Brachypodium 
distachyon]
Length=453

 Score =   317 bits (813),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 149/188 (79%), Positives = 173/188 (92%), Gaps = 0/188 (0%)
 Frame = -3

Query  766  LAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAV  587
            L+KLKP F KDGTTTAGN+SQV+DGAGAVLLM+R +A QKGLPILG++R+FAAVGVDPAV
Sbjct  264  LSKLKPAFSKDGTTTAGNASQVSDGAGAVLLMRRDVATQKGLPILGIYRSFAAVGVDPAV  323

Query  586  MGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIG  407
            MG+GPAVAIPAAVK+AGL+++D+DLFEINEAFASQ++YC KKL LDP KINVNGGAMA+G
Sbjct  324  MGVGPAVAIPAAVKAAGLQINDVDLFEINEAFASQFVYCAKKLELDPVKINVNGGAMALG  383

Query  406  HPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVE  227
            HPLGATGARCV+TLL+EMKRRGKDCR+GV+SMCIG+GMGAA VFERGDA DEL+NAR   
Sbjct  384  HPLGATGARCVSTLLNEMKRRGKDCRFGVISMCIGSGMGAAAVFERGDAVDELTNARGTP  443

Query  226  THGYLSKD  203
            +   LSKD
Sbjct  444  SLNLLSKD  451



>ref|XP_009111084.1| PREDICTED: 3-ketoacyl-CoA thiolase 1, peroxisomal [Brassica rapa]
Length=451

 Score =   317 bits (812),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 160/180 (89%), Positives = 175/180 (97%), Gaps = 0/180 (0%)
 Frame = -3

Query  766  LAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAV  587
            LAKLKPVFK+DG+TTAGNSSQV+DGAGAVLLMKRS+AI+KGLPILGVFRTFAAVGVDPAV
Sbjct  272  LAKLKPVFKQDGSTTAGNSSQVSDGAGAVLLMKRSVAIKKGLPILGVFRTFAAVGVDPAV  331

Query  586  MGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIG  407
            MG+GPA AIPAAVK+AGLE+DDIDLFEINEAFASQ++YC+ KLGLDP+KINVNGGA+AIG
Sbjct  332  MGVGPAAAIPAAVKAAGLEVDDIDLFEINEAFASQFVYCRNKLGLDPQKINVNGGAIAIG  391

Query  406  HPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVE  227
            HPLGATGARCVATLLHEMKRRGKDCR+GVVSMCIG+GMGAAGVFERGD  DELSN RKVE
Sbjct  392  HPLGATGARCVATLLHEMKRRGKDCRFGVVSMCIGSGMGAAGVFERGDGVDELSNVRKVE  451



>ref|XP_004290230.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Fragaria 
vesca subsp. vesca]
Length=456

 Score =   317 bits (811),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 151/178 (85%), Positives = 167/178 (94%), Gaps = 0/178 (0%)
 Frame = -3

Query  769  DLAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPA  590
            DLAKLKP FK DGTTTAGN+SQV+DGAGAVLLMKRS+AIQKGLPI+GVFR+FAAVGVDPA
Sbjct  276  DLAKLKPAFKSDGTTTAGNASQVSDGAGAVLLMKRSVAIQKGLPIIGVFRSFAAVGVDPA  335

Query  589  VMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAI  410
            VMG+GPA AIP AVKSAGLEL DIDLFEINEAFASQY+YCQKKL LD +K+NVNGGA+A+
Sbjct  336  VMGVGPAAAIPVAVKSAGLELGDIDLFEINEAFASQYVYCQKKLELDSDKVNVNGGAIAL  395

Query  409  GHPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNAR  236
            GHPLGATGARCVATLL+EMKRRGKDCR+GV+SMCIG+GMGAA V ERGD+ DEL NAR
Sbjct  396  GHPLGATGARCVATLLNEMKRRGKDCRFGVISMCIGSGMGAAAVLERGDSVDELCNAR  453



>gb|AAM61609.1| putative acetyl-CoA acyltransferase [Arabidopsis thaliana]
Length=443

 Score =   316 bits (809),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 150/179 (84%), Positives = 170/179 (95%), Gaps = 0/179 (0%)
 Frame = -3

Query  766  LAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAV  587
            LAKLKPVFK+DGTTTAGNSSQ++DGAGAVLLM+R++A+QKGLPILGVFRTF+AVGVDPA+
Sbjct  265  LAKLKPVFKEDGTTTAGNSSQLSDGAGAVLLMRRNVAMQKGLPILGVFRTFSAVGVDPAI  324

Query  586  MGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIG  407
            MG+GPAVAIPAAVK+AGLEL+D+DLFEINEAFASQ++YC+ KLG D EKINVNGGA+AIG
Sbjct  325  MGVGPAVAIPAAVKAAGLELNDVDLFEINEAFASQFVYCRNKLGQDAEKINVNGGAIAIG  384

Query  406  HPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKV  230
            HPLGATGARCVATLLHEMKRRGKDCR+GVVSMCIG+GMGAA VFERG   DEL + RKV
Sbjct  385  HPLGATGARCVATLLHEMKRRGKDCRFGVVSMCIGSGMGAAAVFERGGDVDELCDVRKV  443



>gb|ABR17647.1| unknown [Picea sitchensis]
Length=462

 Score =   316 bits (810),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 151/190 (79%), Positives = 171/190 (90%), Gaps = 0/190 (0%)
 Frame = -3

Query  766  LAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAV  587
            L KLKP FKK G+TTAGNSSQV+DGAGAVLLMKR +A+QKGLPILGVFR+F AVGVDPAV
Sbjct  273  LGKLKPAFKKGGSTTAGNSSQVSDGAGAVLLMKRVVAMQKGLPILGVFRSFTAVGVDPAV  332

Query  586  MGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIG  407
            MG+GPAVAIPAAVK+AGLE+DDIDLFEINEAFASQ+ YC +KL LDPEK+NVNGGA+A+G
Sbjct  333  MGVGPAVAIPAAVKAAGLEIDDIDLFEINEAFASQFTYCSQKLELDPEKVNVNGGAIALG  392

Query  406  HPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVE  227
            HPLGATGA CVATLLHEMK RGKDCR+GV+SMCIGTGMGAA VFER  A D+L NAR ++
Sbjct  393  HPLGATGALCVATLLHEMKLRGKDCRFGVISMCIGTGMGAAAVFERSGAVDQLCNARPIK  452

Query  226  THGYLSKDAR  197
             H  LS+DA+
Sbjct  453  DHTSLSRDAQ  462



>gb|KDP26413.1| hypothetical protein JCGZ_17571 [Jatropha curcas]
Length=452

 Score =   315 bits (808),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 148/177 (84%), Positives = 168/177 (95%), Gaps = 0/177 (0%)
 Frame = -3

Query  769  DLAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPA  590
            DL+ LKP FKKDG TTAGN+SQV+DGAGAVLLMKRS+A++KGLPILGVFR+FAAVGVDPA
Sbjct  276  DLSMLKPAFKKDGCTTAGNASQVSDGAGAVLLMKRSVALKKGLPILGVFRSFAAVGVDPA  335

Query  589  VMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAI  410
            VMG+GPA AIPAAVK+AGLEL+DI LFEINEAFASQY+YC KKLGLDPEK+NVNGGA+A+
Sbjct  336  VMGVGPAYAIPAAVKAAGLELNDISLFEINEAFASQYVYCIKKLGLDPEKVNVNGGALAL  395

Query  409  GHPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNA  239
            GHPLGATGARCV+T+LHEMKRRGKDCR+GV+SMCIG+GMGAA VFERGD  DELS+A
Sbjct  396  GHPLGATGARCVSTILHEMKRRGKDCRFGVISMCIGSGMGAAAVFERGDGVDELSSA  452



>emb|CDY15520.1| BnaA08g28040D [Brassica napus]
Length=451

 Score =   314 bits (805),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 161/180 (89%), Positives = 173/180 (96%), Gaps = 0/180 (0%)
 Frame = -3

Query  766  LAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAV  587
            LAKLKPVFKKDG+TTAGNSSQV+DGAGAVLLMKRS+AI+K LPILGVFRTFAAVGVDPAV
Sbjct  272  LAKLKPVFKKDGSTTAGNSSQVSDGAGAVLLMKRSVAIKKELPILGVFRTFAAVGVDPAV  331

Query  586  MGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIG  407
            MG+GPA AIPAAVK+AGLELDDIDLFEINEAFASQ++YC+ KLGL PEKINVNGGA+AIG
Sbjct  332  MGVGPAAAIPAAVKAAGLELDDIDLFEINEAFASQFVYCRNKLGLVPEKINVNGGAIAIG  391

Query  406  HPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVE  227
            HPLGATGARCVATLLHEMKRRGKDCR+GVVSMCIG+GMGAAGVFERGD  DELSN RKVE
Sbjct  392  HPLGATGARCVATLLHEMKRRGKDCRFGVVSMCIGSGMGAAGVFERGDGVDELSNVRKVE  451



>dbj|BAD94007.1| peroxisomal-3-keto-acyl-CoA thiolase 1 [Arabidopsis thaliana]
Length=213

 Score =   305 bits (780),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 146/178 (82%), Positives = 164/178 (92%), Gaps = 0/178 (0%)
 Frame = -3

Query  769  DLAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPA  590
            DLAKLK VFK++G+TTAGN+SQ++DGAGAVLLMKRSLA++KGLPILGVFR+FA  GV+P+
Sbjct  29   DLAKLKTVFKQNGSTTAGNASQISDGAGAVLLMKRSLAMKKGLPILGVFRSFAVTGVEPS  88

Query  589  VMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAI  410
            VMGIGPAVAIPAA K AGL + DIDLFEINEAFASQY+Y  KKL LD EK+NVNGGA+AI
Sbjct  89   VMGIGPAVAIPAATKLAGLNVSDIDLFEINEAFASQYVYSCKKLELDMEKVNVNGGAIAI  148

Query  409  GHPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNAR  236
            GHPLGATGARCVATLLHEMKRRGKDCR+GV+SMCIGTGMGAA VFERGD+ D LSNAR
Sbjct  149  GHPLGATGARCVATLLHEMKRRGKDCRFGVISMCIGTGMGAAAVFERGDSVDNLSNAR  206



>ref|XP_001762605.1| predicted protein [Physcomitrella patens]
 gb|EDQ72728.1| predicted protein [Physcomitrella patens]
Length=455

 Score =   313 bits (802),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 150/191 (79%), Positives = 171/191 (90%), Gaps = 0/191 (0%)
 Frame = -3

Query  769  DLAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPA  590
            DL+KLK VFKK GTTTAGNSSQV+DGA AVLLMKR  A++K LP+LGVFR+FAAVGVDP+
Sbjct  265  DLSKLKTVFKKSGTTTAGNSSQVSDGAAAVLLMKRRTALEKNLPVLGVFRSFAAVGVDPS  324

Query  589  VMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAI  410
            VMGIGPAVAIPAAVK+AGLEL DIDLFEINEAFASQ+ YC ++LGLD EK+NVNGGAMA+
Sbjct  325  VMGIGPAVAIPAAVKAAGLELSDIDLFEINEAFASQFTYCAQELGLDEEKVNVNGGAMAL  384

Query  409  GHPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKV  230
            GHPLGATGARC ATLLHEMK+RGKDCR+G+VSMCIG+GMGAA VFE+G A D LSNAR V
Sbjct  385  GHPLGATGARCTATLLHEMKKRGKDCRFGIVSMCIGSGMGAAAVFEQGGAIDPLSNARAV  444

Query  229  ETHGYLSKDAR  197
              +  LS+DA+
Sbjct  445  GQNNLLSRDAK  455



>ref|XP_010484150.1| PREDICTED: 3-ketoacyl-CoA thiolase 1, peroxisomal-like isoform 
X1 [Camelina sativa]
Length=446

 Score =   312 bits (799),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 151/182 (83%), Positives = 168/182 (92%), Gaps = 6/182 (3%)
 Frame = -3

Query  766  LAKLKPVFKKDGTTTA------GNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAV  605
            L KLK VFKKDGTTTA      GNSSQ++DGAGAVLLM+R++A+QKGLPILGVFRTFAAV
Sbjct  262  LTKLKSVFKKDGTTTAALLDGAGNSSQLSDGAGAVLLMRRNVAMQKGLPILGVFRTFAAV  321

Query  604  GVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNG  425
            GVDP +MG+GPAVAIPAAVK+AGLELDDIDLFEINEAFASQY+YC+ KLGL+PEKINVNG
Sbjct  322  GVDPEIMGVGPAVAIPAAVKAAGLELDDIDLFEINEAFASQYVYCRNKLGLNPEKINVNG  381

Query  424  GAMAIGHPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELS  245
            GA+AIGHPLGATGARCVATLLHEMKRRGKDCR+GVVSMCIG+GMGAA VFERG + DEL 
Sbjct  382  GAIAIGHPLGATGARCVATLLHEMKRRGKDCRFGVVSMCIGSGMGAAAVFERGGSVDELP  441

Query  244  NA  239
            N+
Sbjct  442  NS  443



>gb|KJB42404.1| hypothetical protein B456_007G152600 [Gossypium raimondii]
Length=453

 Score =   312 bits (800),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 154/181 (85%), Positives = 168/181 (93%), Gaps = 1/181 (1%)
 Frame = -3

Query  766  LAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAV  587
            LAKLKP FKKDGTTTAGN+SQV+DGAGAVLLMKRSLA+QKGLPILGVF +FAAVGVDPAV
Sbjct  274  LAKLKPAFKKDGTTTAGNASQVSDGAGAVLLMKRSLALQKGLPILGVF-SFAAVGVDPAV  332

Query  586  MGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIG  407
            MGIGPAVAIPAAVKSAGLE+DDIDLFEINEAFASQ++Y  KKLGLD EK+NVNGGA+A+G
Sbjct  333  MGIGPAVAIPAAVKSAGLEIDDIDLFEINEAFASQFVYSCKKLGLDREKVNVNGGAIALG  392

Query  406  HPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVE  227
            HPLG TGARCV TLL+EMKRRGKDCR+GV+SMCIGTGMGAA VFERGD  DEL NAR V+
Sbjct  393  HPLGVTGARCVGTLLYEMKRRGKDCRFGVISMCIGTGMGAAAVFERGDCVDELCNARAVK  452

Query  226  T  224
             
Sbjct  453  N  453



>ref|XP_001764272.1| predicted protein [Physcomitrella patens]
 gb|EDQ70826.1| predicted protein [Physcomitrella patens]
Length=460

 Score =   312 bits (799),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 149/191 (78%), Positives = 172/191 (90%), Gaps = 0/191 (0%)
 Frame = -3

Query  769  DLAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPA  590
            DL+KLK VFKK GTTTAGNSSQV+DGAGAVLLMKR  A+++ LPILGVFR+FAAVGVDPA
Sbjct  270  DLSKLKTVFKKSGTTTAGNSSQVSDGAGAVLLMKRKTALERNLPILGVFRSFAAVGVDPA  329

Query  589  VMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAI  410
            VMGIGPAVAIPAA+K+AGLE++DIDLFEINEAFASQ+ YC ++LGLD EKINVNGGA+A+
Sbjct  330  VMGIGPAVAIPAAIKAAGLEINDIDLFEINEAFASQFTYCAQELGLDEEKINVNGGAIAL  389

Query  409  GHPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKV  230
            GHPLGATGARC ATLLHEMK+RGKDCR+GV+SMCIG+GMGAA VFE+G A D LSN R V
Sbjct  390  GHPLGATGARCTATLLHEMKKRGKDCRFGVISMCIGSGMGAAAVFEQGGAIDPLSNVRAV  449

Query  229  ETHGYLSKDAR  197
              +  LS+DA+
Sbjct  450  GQNNLLSRDAK  460



>gb|ACU19231.1| unknown [Glycine max]
Length=198

 Score =   302 bits (773),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 143/169 (85%), Positives = 159/169 (94%), Gaps = 0/169 (0%)
 Frame = -3

Query  769  DLAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPA  590
            DLAKLKP F+KDGTTTAGN+SQ++DGA AVLLMKR +A+QKGLPILG+FR+FAAVGVDPA
Sbjct  29   DLAKLKPAFQKDGTTTAGNASQISDGAAAVLLMKRRVAVQKGLPILGIFRSFAAVGVDPA  88

Query  589  VMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAI  410
            VMG+GPAVAIPAAVKS GLEL +IDLFEINEAFASQY+YC KKLGLDP K+NVNGGA+A+
Sbjct  89   VMGVGPAVAIPAAVKSVGLELGNIDLFEINEAFASQYVYCLKKLGLDPRKVNVNGGAIAL  148

Query  409  GHPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGD  263
            GHPLG TGARCVATLL EMKRRGKDCRYGV+SMCIG+GMGAA VFERGD
Sbjct  149  GHPLGVTGARCVATLLSEMKRRGKDCRYGVISMCIGSGMGAAAVFERGD  197



>gb|AAB80634.1| Strong similarity to Cucumis acetyl-CoA acyltransferase (gb|D70895) 
[Arabidopsis thaliana]
Length=460

 Score =   311 bits (796),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 151/186 (81%), Positives = 171/186 (92%), Gaps = 7/186 (4%)
 Frame = -3

Query  766  LAKLKPVFKKDGTTTAG-------NSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAA  608
            LAKLKPVFK+DGTTTAG       NSSQ++DGAGAVLLM+R++A+QKGLPILGVFRTF+A
Sbjct  275  LAKLKPVFKEDGTTTAGTFPRLIGNSSQLSDGAGAVLLMRRNVAMQKGLPILGVFRTFSA  334

Query  607  VGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVN  428
            VGVDPA+MG+GPAVAIPAAVK+AGLEL+D+DLFEINEAFASQ++YC+ KLGLD EKINVN
Sbjct  335  VGVDPAIMGVGPAVAIPAAVKAAGLELNDVDLFEINEAFASQFVYCRNKLGLDAEKINVN  394

Query  427  GGAMAIGHPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDEL  248
            GGA+AIGHPLGATGARCVATLLHEMKRRGKDCR+GVVSMCIG+GMGAA VFERG   DEL
Sbjct  395  GGAIAIGHPLGATGARCVATLLHEMKRRGKDCRFGVVSMCIGSGMGAAAVFERGGGVDEL  454

Query  247  SNARKV  230
             + RKV
Sbjct  455  CDVRKV  460



>ref|XP_010684942.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Beta vulgaris 
subsp. vulgaris]
Length=453

 Score =   310 bits (794),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 148/183 (81%), Positives = 166/183 (91%), Gaps = 0/183 (0%)
 Frame = -3

Query  769  DLAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPA  590
            DL KLKP FKKDGT+TAGNSSQ++DGAGAVLLMKRSLA  KGLPILGVFR+FAAVGVDPA
Sbjct  270  DLTKLKPSFKKDGTSTAGNSSQISDGAGAVLLMKRSLATNKGLPILGVFRSFAAVGVDPA  329

Query  589  VMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAI  410
            VMGIGPA AIPAAVKSAGL+LDDI+LFEINEAFASQY+YC KKL LDP K+NVNGGA+A+
Sbjct  330  VMGIGPAFAIPAAVKSAGLKLDDINLFEINEAFASQYVYCCKKLNLDPAKVNVNGGALAL  389

Query  409  GHPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKV  230
            GHPLGATGARCVATLL+EM RRG DCR+GV+SMCIG+GMGAA VFERGD  + L+N R  
Sbjct  390  GHPLGATGARCVATLLNEMNRRGTDCRFGVISMCIGSGMGAAAVFERGDHANGLTNTRAA  449

Query  229  ETH  221
            +T+
Sbjct  450  QTN  452



>ref|XP_009336051.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Pyrus 
x bretschneideri]
Length=453

 Score =   310 bits (793),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 149/181 (82%), Positives = 166/181 (92%), Gaps = 0/181 (0%)
 Frame = -3

Query  772  GDLAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDP  593
             DLAKLKP FK DG+TTAGN+SQV+DGAGAVLLMKRSLA+QKGLPILGVFR+FAA+GVDP
Sbjct  273  NDLAKLKPAFKPDGSTTAGNASQVSDGAGAVLLMKRSLAMQKGLPILGVFRSFAAIGVDP  332

Query  592  AVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMA  413
            AVMG+GPA AIP AVKSAGLELDDIDLFEINEAFASQY+YC KKLGLDPEK+NVNGGA+A
Sbjct  333  AVMGVGPAAAIPVAVKSAGLELDDIDLFEINEAFASQYVYCCKKLGLDPEKVNVNGGAIA  392

Query  412  IGHPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARK  233
            +GHPLGAT    VATLL+EMKRRG+D R+GV+SMCIG+GMGAA VFERGD+ DEL NAR 
Sbjct  393  LGHPLGATXXXXVATLLNEMKRRGRDHRFGVISMCIGSGMGAAAVFERGDSVDELCNART  452

Query  232  V  230
            V
Sbjct  453  V  453



>ref|XP_002865685.1| KAT5/PKT1/PKT2 peroxisomal 3-keto-acyl-CoA thiolase [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH41944.1| KAT5/PKT1/PKT2 peroxisomal 3-keto-acyl-CoA thiolase [Arabidopsis 
lyrata subsp. lyrata]
Length=457

 Score =   309 bits (791),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 148/178 (83%), Positives = 165/178 (93%), Gaps = 0/178 (0%)
 Frame = -3

Query  769  DLAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPA  590
            DLAKLK VFK++G+TTAGN+SQ++DGAGAVLLMKRSLA++KGLPILGVFR+FA  GVDP+
Sbjct  273  DLAKLKTVFKQNGSTTAGNASQISDGAGAVLLMKRSLAMKKGLPILGVFRSFAVTGVDPS  332

Query  589  VMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAI  410
            VMGIGPAVAIPAA K AGL + DIDLFEINEAFASQY+YC KKL LD EK+NVNGGA+AI
Sbjct  333  VMGIGPAVAIPAATKLAGLNVSDIDLFEINEAFASQYVYCCKKLELDMEKVNVNGGAIAI  392

Query  409  GHPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNAR  236
            GHPLGATGARCVATLLHEMKRRGKDCR+GV+SMCIGTGMGAA VFERGD+ D LSNAR
Sbjct  393  GHPLGATGARCVATLLHEMKRRGKDCRFGVISMCIGTGMGAAAVFERGDSVDNLSNAR  450



>ref|XP_010439770.1| PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxisomal isoform X2 
[Camelina sativa]
Length=414

 Score =   306 bits (785),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 149/185 (81%), Positives = 165/185 (89%), Gaps = 0/185 (0%)
 Frame = -3

Query  769  DLAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPA  590
            DLAKLK VFKKDG+TTAGN+SQ++DGAGAVLLMKRSLA++KGLPILGVFR+FA  GVDP+
Sbjct  230  DLAKLKTVFKKDGSTTAGNASQISDGAGAVLLMKRSLAMKKGLPILGVFRSFAVTGVDPS  289

Query  589  VMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAI  410
            VMGIGPAVAIPAA   AGL + DIDLFEINEAFASQY+Y  KKL LD +K+NVNGGA+AI
Sbjct  290  VMGIGPAVAIPAATNLAGLNVSDIDLFEINEAFASQYVYSCKKLDLDMKKVNVNGGAIAI  349

Query  409  GHPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKV  230
            GHPLGATGARCVATLLHEMKRRGKDCR+GVVSMCIGTGMGAA VFERGD+ D LSNAR  
Sbjct  350  GHPLGATGARCVATLLHEMKRRGKDCRFGVVSMCIGTGMGAAAVFERGDSVDNLSNARVA  409

Query  229  ETHGY  215
               G+
Sbjct  410  NGEGH  414



>ref|XP_006649171.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Oryza 
brachyantha]
Length=449

 Score =   307 bits (787),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 144/177 (81%), Positives = 168/177 (95%), Gaps = 0/177 (0%)
 Frame = -3

Query  766  LAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAV  587
            LAKLKPVF+KDG+TTAGNSSQV+DGAGAVLLM+R +A++KGLPILGVFR+FAAVGVDPAV
Sbjct  271  LAKLKPVFRKDGSTTAGNSSQVSDGAGAVLLMRRDVAMKKGLPILGVFRSFAAVGVDPAV  330

Query  586  MGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIG  407
            MGIGPAVAIPAAVKSAGL+++DIDLFE+NEAFASQ++YC  KLGLD  K+NVNGGA+A+G
Sbjct  331  MGIGPAVAIPAAVKSAGLQIEDIDLFELNEAFASQFVYCCNKLGLDRSKVNVNGGAIALG  390

Query  406  HPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNAR  236
            HPLGATGARCVATLL+EMKRRG+DCR+GVV+MCIG+GMGAA VFERGD+ D+ SN R
Sbjct  391  HPLGATGARCVATLLNEMKRRGRDCRFGVVTMCIGSGMGAAAVFERGDSVDQFSNVR  447



>ref|NP_001048523.1| Os02g0817700 [Oryza sativa Japonica Group]
 gb|AAO72588.1| 3-ketoacyl-CoA thiolase-like protein [Oryza sativa Japonica Group]
 dbj|BAD21525.1| putative 3-ketoacyl-CoA thiolase; acetyl-CoA acyltransferase 
[Oryza sativa Japonica Group]
 dbj|BAF10437.1| Os02g0817700 [Oryza sativa Japonica Group]
 gb|EAY88029.1| hypothetical protein OsI_09452 [Oryza sativa Indica Group]
Length=448

 Score =   307 bits (786),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 144/177 (81%), Positives = 168/177 (95%), Gaps = 0/177 (0%)
 Frame = -3

Query  766  LAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAV  587
            LAKLKPVF+KDGTTTAGNSSQV+DGAGAVLLM+R +A++KGLPILGVFR+FAAVGVDPAV
Sbjct  270  LAKLKPVFRKDGTTTAGNSSQVSDGAGAVLLMRRDVAMKKGLPILGVFRSFAAVGVDPAV  329

Query  586  MGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIG  407
            MG+GPAVAIPAAVKSAGL+++DIDLFE+NEAFASQ++YC  KLGLD  K+NVNGGA+A+G
Sbjct  330  MGVGPAVAIPAAVKSAGLQIEDIDLFELNEAFASQFVYCCNKLGLDRSKVNVNGGAIALG  389

Query  406  HPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNAR  236
            HPLGATGARCVATLL+EMKRRG+DCR+GVV+MCIG+GMGAA VFERGD+ D+ SN R
Sbjct  390  HPLGATGARCVATLLNEMKRRGRDCRFGVVTMCIGSGMGAAAVFERGDSVDQFSNVR  446



>ref|XP_010442338.1| PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxisomal-like isoform 
X2 [Camelina sativa]
Length=414

 Score =   306 bits (783),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 148/185 (80%), Positives = 164/185 (89%), Gaps = 0/185 (0%)
 Frame = -3

Query  769  DLAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPA  590
            DLAKLK VFKKDG+TTAGN+SQ++DGAGAVLLMKRSLA++KGLPILGV R+FA  GVDP+
Sbjct  230  DLAKLKTVFKKDGSTTAGNASQISDGAGAVLLMKRSLAMKKGLPILGVLRSFAVTGVDPS  289

Query  589  VMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAI  410
            VMGIGPAVAIPAA   AGL + DIDLFEINEAFASQY+Y  KKL LD EK+NVNGGA+AI
Sbjct  290  VMGIGPAVAIPAATNLAGLNVSDIDLFEINEAFASQYVYSCKKLDLDMEKVNVNGGAIAI  349

Query  409  GHPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKV  230
            GHPLGATGARCVATLLHEMKRRGKDCR+GV+SMCIGTGMGAA VFERGD+ D LSNAR  
Sbjct  350  GHPLGATGARCVATLLHEMKRRGKDCRFGVISMCIGTGMGAAAVFERGDSVDNLSNARVA  409

Query  229  ETHGY  215
               G+
Sbjct  410  NGEGH  414



>ref|XP_009129751.1| PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxisomal isoform X2 
[Brassica rapa]
Length=415

 Score =   306 bits (783),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 148/180 (82%), Positives = 165/180 (92%), Gaps = 0/180 (0%)
 Frame = -3

Query  769  DLAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPA  590
            DLAKLK VFK +G+TTAGN+SQ++DGAGAVLLMKRSLA++KGLPILGVFR+FA  GVDPA
Sbjct  230  DLAKLKTVFKPNGSTTAGNASQISDGAGAVLLMKRSLAMKKGLPILGVFRSFAVTGVDPA  289

Query  589  VMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAI  410
            VMGIGPA AIPAA   AGL++ DIDLFEINEAFASQY+YC KKL LD EK+NVNGGA+AI
Sbjct  290  VMGIGPAYAIPAAANLAGLKVSDIDLFEINEAFASQYVYCCKKLELDVEKVNVNGGAIAI  349

Query  409  GHPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKV  230
            GHPLGATGARCVATLLHEMKRRGKDCR+GV+SMCIGTGMGAA VFERGD+ D+LSNAR V
Sbjct  350  GHPLGATGARCVATLLHEMKRRGKDCRFGVISMCIGTGMGAAAVFERGDSVDDLSNARVV  409



>ref|XP_010439766.1| PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxisomal isoform X1 
[Camelina sativa]
Length=456

 Score =   307 bits (786),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 149/185 (81%), Positives = 165/185 (89%), Gaps = 0/185 (0%)
 Frame = -3

Query  769  DLAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPA  590
            DLAKLK VFKKDG+TTAGN+SQ++DGAGAVLLMKRSLA++KGLPILGVFR+FA  GVDP+
Sbjct  272  DLAKLKTVFKKDGSTTAGNASQISDGAGAVLLMKRSLAMKKGLPILGVFRSFAVTGVDPS  331

Query  589  VMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAI  410
            VMGIGPAVAIPAA   AGL + DIDLFEINEAFASQY+Y  KKL LD +K+NVNGGA+AI
Sbjct  332  VMGIGPAVAIPAATNLAGLNVSDIDLFEINEAFASQYVYSCKKLDLDMKKVNVNGGAIAI  391

Query  409  GHPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKV  230
            GHPLGATGARCVATLLHEMKRRGKDCR+GVVSMCIGTGMGAA VFERGD+ D LSNAR  
Sbjct  392  GHPLGATGARCVATLLHEMKRRGKDCRFGVVSMCIGTGMGAAAVFERGDSVDNLSNARVA  451

Query  229  ETHGY  215
               G+
Sbjct  452  NGEGH  456



>dbj|BAF02017.1| peroxisomal-3-keto-acyl-CoA thiolase 1 [Arabidopsis thaliana]
Length=414

 Score =   305 bits (782),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 147/178 (83%), Positives = 164/178 (92%), Gaps = 0/178 (0%)
 Frame = -3

Query  769  DLAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPA  590
            DLAKLK VFK+DG+TTAGN+SQ++DGAGAVLLMKRSLA++KGLPILGVFR+FA  GV+P+
Sbjct  230  DLAKLKTVFKQDGSTTAGNASQISDGAGAVLLMKRSLAMKKGLPILGVFRSFAVTGVEPS  289

Query  589  VMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAI  410
            VMGIGPAVAIPAA K AGL + DIDLFEINEAFASQY+Y  KKL LD EK+NVNGGA+AI
Sbjct  290  VMGIGPAVAIPAATKLAGLNVSDIDLFEINEAFASQYVYSCKKLELDMEKVNVNGGAIAI  349

Query  409  GHPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNAR  236
            GHPLGATGARCVATLLHEMKRRGKDCR+GV+SMCIGTGMGAA VFERGD+ D LSNAR
Sbjct  350  GHPLGATGARCVATLLHEMKRRGKDCRFGVISMCIGTGMGAAAVFERGDSVDNLSNAR  407



>emb|CDY33940.1| BnaA02g30470D [Brassica napus]
Length=456

 Score =   306 bits (784),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 148/180 (82%), Positives = 165/180 (92%), Gaps = 0/180 (0%)
 Frame = -3

Query  769  DLAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPA  590
            DLAKLK VFK +G+TTAGN+SQ++DGAGAVLLMKRSLA++KGLPILGVFR+FA  GVDPA
Sbjct  271  DLAKLKTVFKPNGSTTAGNASQISDGAGAVLLMKRSLAMKKGLPILGVFRSFAVTGVDPA  330

Query  589  VMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAI  410
            VMGIGPA AIPAA   AGL++ DIDLFEINEAFASQY+YC KKL LD EK+NVNGGA+AI
Sbjct  331  VMGIGPAYAIPAAANLAGLKVSDIDLFEINEAFASQYVYCCKKLELDVEKVNVNGGAIAI  390

Query  409  GHPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKV  230
            GHPLGATGARCVATLLHEMKRRGKDCR+GV+SMCIGTGMGAA VFERGD+ D+LSNAR V
Sbjct  391  GHPLGATGARCVATLLHEMKRRGKDCRFGVISMCIGTGMGAAAVFERGDSVDDLSNARVV  450



>ref|XP_006395130.1| hypothetical protein EUTSA_v10004174mg [Eutrema salsugineum]
 gb|ESQ32416.1| hypothetical protein EUTSA_v10004174mg [Eutrema salsugineum]
Length=414

 Score =   305 bits (781),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 146/185 (79%), Positives = 166/185 (90%), Gaps = 0/185 (0%)
 Frame = -3

Query  769  DLAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPA  590
            DLAKLK VFK DG+TTAGN+SQ++DGAGAVLLMKRSLA++KGLPILG+FR+FA  GV+PA
Sbjct  230  DLAKLKTVFKPDGSTTAGNASQISDGAGAVLLMKRSLAMKKGLPILGIFRSFAVTGVEPA  289

Query  589  VMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAI  410
            VMG+GPA AIPAA   AGL++ DIDLFEINEAFASQY+YC KKL LD EK+NVNGGA+AI
Sbjct  290  VMGVGPAYAIPAATNLAGLKVSDIDLFEINEAFASQYVYCCKKLELDLEKVNVNGGAIAI  349

Query  409  GHPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKV  230
            GHPLGATGARCVATLLHEMKRRGKDCR+GV+SMCIGTGMGAA VFERGD+ DELSNA+  
Sbjct  350  GHPLGATGARCVATLLHEMKRRGKDCRFGVISMCIGTGMGAAAVFERGDSVDELSNAQVA  409

Query  229  ETHGY  215
               G+
Sbjct  410  NGDGH  414



>ref|XP_009129750.1| PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxisomal isoform X1 
[Brassica rapa]
Length=456

 Score =   306 bits (784),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 148/180 (82%), Positives = 165/180 (92%), Gaps = 0/180 (0%)
 Frame = -3

Query  769  DLAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPA  590
            DLAKLK VFK +G+TTAGN+SQ++DGAGAVLLMKRSLA++KGLPILGVFR+FA  GVDPA
Sbjct  271  DLAKLKTVFKPNGSTTAGNASQISDGAGAVLLMKRSLAMKKGLPILGVFRSFAVTGVDPA  330

Query  589  VMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAI  410
            VMGIGPA AIPAA   AGL++ DIDLFEINEAFASQY+YC KKL LD EK+NVNGGA+AI
Sbjct  331  VMGIGPAYAIPAAANLAGLKVSDIDLFEINEAFASQYVYCCKKLELDVEKVNVNGGAIAI  390

Query  409  GHPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKV  230
            GHPLGATGARCVATLLHEMKRRGKDCR+GV+SMCIGTGMGAA VFERGD+ D+LSNAR V
Sbjct  391  GHPLGATGARCVATLLHEMKRRGKDCRFGVISMCIGTGMGAAAVFERGDSVDDLSNARVV  450



>ref|XP_006280441.1| hypothetical protein CARUB_v10026373mg [Capsella rubella]
 gb|EOA13339.1| hypothetical protein CARUB_v10026373mg [Capsella rubella]
Length=457

 Score =   306 bits (783),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 147/185 (79%), Positives = 165/185 (89%), Gaps = 0/185 (0%)
 Frame = -3

Query  769  DLAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPA  590
            DLAKLK VFKKDG+TTAGN+SQ++DGAGAVLL+KRSLA++KGLPILGVFR+FA  GVDP+
Sbjct  273  DLAKLKTVFKKDGSTTAGNASQISDGAGAVLLIKRSLAMKKGLPILGVFRSFAVTGVDPS  332

Query  589  VMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAI  410
            VMGIGP+VAIPAA   AGL + DIDLFEINEAFASQY+Y  KKL LD EK+NVNGGA+AI
Sbjct  333  VMGIGPSVAIPAATNLAGLNVSDIDLFEINEAFASQYVYSCKKLELDMEKVNVNGGAIAI  392

Query  409  GHPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKV  230
            GHPLGATGARCVATLLHEMKRRGKDCR+GV+SMCIGTGMGAA VFERGD+ D LSNAR  
Sbjct  393  GHPLGATGARCVATLLHEMKRRGKDCRFGVISMCIGTGMGAAAVFERGDSVDNLSNARVA  452

Query  229  ETHGY  215
               G+
Sbjct  453  NGDGH  457



>ref|XP_006395129.1| hypothetical protein EUTSA_v10004174mg [Eutrema salsugineum]
 gb|ESQ32415.1| hypothetical protein EUTSA_v10004174mg [Eutrema salsugineum]
Length=460

 Score =   306 bits (783),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 146/185 (79%), Positives = 166/185 (90%), Gaps = 0/185 (0%)
 Frame = -3

Query  769  DLAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPA  590
            DLAKLK VFK DG+TTAGN+SQ++DGAGAVLLMKRSLA++KGLPILG+FR+FA  GV+PA
Sbjct  276  DLAKLKTVFKPDGSTTAGNASQISDGAGAVLLMKRSLAMKKGLPILGIFRSFAVTGVEPA  335

Query  589  VMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAI  410
            VMG+GPA AIPAA   AGL++ DIDLFEINEAFASQY+YC KKL LD EK+NVNGGA+AI
Sbjct  336  VMGVGPAYAIPAATNLAGLKVSDIDLFEINEAFASQYVYCCKKLELDLEKVNVNGGAIAI  395

Query  409  GHPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKV  230
            GHPLGATGARCVATLLHEMKRRGKDCR+GV+SMCIGTGMGAA VFERGD+ DELSNA+  
Sbjct  396  GHPLGATGARCVATLLHEMKRRGKDCRFGVISMCIGTGMGAAAVFERGDSVDELSNAQVA  455

Query  229  ETHGY  215
               G+
Sbjct  456  NGDGH  460



>ref|XP_010442336.1| PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxisomal-like isoform 
X1 [Camelina sativa]
Length=458

 Score =   305 bits (782),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 148/185 (80%), Positives = 164/185 (89%), Gaps = 0/185 (0%)
 Frame = -3

Query  769  DLAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPA  590
            DLAKLK VFKKDG+TTAGN+SQ++DGAGAVLLMKRSLA++KGLPILGV R+FA  GVDP+
Sbjct  274  DLAKLKTVFKKDGSTTAGNASQISDGAGAVLLMKRSLAMKKGLPILGVLRSFAVTGVDPS  333

Query  589  VMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAI  410
            VMGIGPAVAIPAA   AGL + DIDLFEINEAFASQY+Y  KKL LD EK+NVNGGA+AI
Sbjct  334  VMGIGPAVAIPAATNLAGLNVSDIDLFEINEAFASQYVYSCKKLDLDMEKVNVNGGAIAI  393

Query  409  GHPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKV  230
            GHPLGATGARCVATLLHEMKRRGKDCR+GV+SMCIGTGMGAA VFERGD+ D LSNAR  
Sbjct  394  GHPLGATGARCVATLLHEMKRRGKDCRFGVISMCIGTGMGAAAVFERGDSVDNLSNARVA  453

Query  229  ETHGY  215
               G+
Sbjct  454  NGEGH  458



>gb|AIB06952.1| 3-ketoacyl-CoA thiolase [Vanda hybrid cultivar]
Length=450

 Score =   305 bits (781),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 141/177 (80%), Positives = 166/177 (94%), Gaps = 0/177 (0%)
 Frame = -3

Query  766  LAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAV  587
            LAKLKP FK+ G+TTAGN+SQV+DGAGAVLLM+R +AIQKGLPILG+FR+FAAVGVDPAV
Sbjct  270  LAKLKPAFKEGGSTTAGNASQVSDGAGAVLLMRRDVAIQKGLPILGIFRSFAAVGVDPAV  329

Query  586  MGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIG  407
            MGIGPAVAIPAAVK+AGL++ DIDL+EINEAFASQ++YC K+LGLDPEK+NVNGGA+A+G
Sbjct  330  MGIGPAVAIPAAVKAAGLQIKDIDLYEINEAFASQFVYCIKELGLDPEKVNVNGGAIALG  389

Query  406  HPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNAR  236
            HPLGATGARCV+TLL+EMKRRG DCR+G++SMCIG+GMGAA VFERGD  D LSN +
Sbjct  390  HPLGATGARCVSTLLNEMKRRGNDCRFGIISMCIGSGMGAAAVFERGDVADRLSNVQ  446



>ref|XP_007034451.1| Peroxisomal 3-ketoacyl-CoA thiolase 3 isoform 3 [Theobroma cacao]
 gb|EOY05377.1| Peroxisomal 3-ketoacyl-CoA thiolase 3 isoform 3 [Theobroma cacao]
Length=326

 Score =   301 bits (770),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 148/190 (78%), Positives = 164/190 (86%), Gaps = 19/190 (10%)
 Frame = -3

Query  769  DLAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPA  590
            DLAKL+PVFKKDG+TTAGNSSQV+DGAGAVLLMKRS+A+ KGLPILGVFRTFAAVGVDPA
Sbjct  155  DLAKLRPVFKKDGSTTAGNSSQVSDGAGAVLLMKRSVAMLKGLPILGVFRTFAAVGVDPA  214

Query  589  VMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAI  410
            +MG+GPAVAIPAAVK+AGLELDDIDL+EINEAFASQ++YC+KKL LDP            
Sbjct  215  IMGVGPAVAIPAAVKAAGLELDDIDLYEINEAFASQFVYCRKKLELDP------------  262

Query  409  GHPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKV  230
                   GARCVATLLHEMKRRGKDCR+GV+SMCIGTGMGAA VFERGD  DEL NARKV
Sbjct  263  -------GARCVATLLHEMKRRGKDCRFGVISMCIGTGMGAAAVFERGDHTDELCNARKV  315

Query  229  ETHGYLSKDA  200
            ET+ +LSKDA
Sbjct  316  ETNSFLSKDA  325



>ref|NP_851157.1| 3-keto-acyl-CoA thiolase 2 [Arabidopsis thaliana]
 gb|AAC17876.1| 3-keto-acyl-CoA-thiolase 1 [Arabidopsis thaliana]
 gb|AAC19122.1| peroxisomal-3-keto-acyl-CoA thiolase 1 [Arabidopsis thaliana]
 gb|AAM97120.1| 3-keto-acyl-CoA thiolase 2 [Arabidopsis thaliana]
 gb|AAO00954.1| 3-keto-acyl-CoA thiolase 2 [Arabidopsis thaliana]
 gb|AED95736.1| 3-keto-acyl-CoA thiolase 2 [Arabidopsis thaliana]
Length=414

 Score =   303 bits (777),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 146/178 (82%), Positives = 164/178 (92%), Gaps = 0/178 (0%)
 Frame = -3

Query  769  DLAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPA  590
            DLAKLK VFK++G+TTAGN+SQ++DGAGAVLLMKRSLA++KGLPILGVFR+FA  GV+P+
Sbjct  230  DLAKLKTVFKQNGSTTAGNASQISDGAGAVLLMKRSLAMKKGLPILGVFRSFAVTGVEPS  289

Query  589  VMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAI  410
            VMGIGPAVAIPAA K AGL + DIDLFEINEAFASQY+Y  KKL LD EK+NVNGGA+AI
Sbjct  290  VMGIGPAVAIPAATKLAGLNVSDIDLFEINEAFASQYVYSCKKLELDMEKVNVNGGAIAI  349

Query  409  GHPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNAR  236
            GHPLGATGARCVATLLHEMKRRGKDCR+GV+SMCIGTGMGAA VFERGD+ D LSNAR
Sbjct  350  GHPLGATGARCVATLLHEMKRRGKDCRFGVISMCIGTGMGAAAVFERGDSVDNLSNAR  407



>ref|NP_001237076.1| 3-ketoacyl-CoA thiolase [Glycine max]
 ref|XP_006605407.1| PREDICTED: 3-ketoacyl-CoA thiolase isoform X1 [Glycine max]
 gb|AAQ93070.1| 3-ketoacyl-CoA thiolase [Glycine max]
 gb|KHM99006.1| 3-ketoacyl-CoA thiolase 2, peroxisomal [Glycine soja]
Length=445

 Score =   304 bits (778),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 143/169 (85%), Positives = 160/169 (95%), Gaps = 0/169 (0%)
 Frame = -3

Query  769  DLAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPA  590
            DLAKLKP F+KDGTTTAGN+SQ++DGA AVLLMKR +A+QKGLPILG+FR+FAAVGVDPA
Sbjct  276  DLAKLKPAFQKDGTTTAGNASQISDGAAAVLLMKRRVAVQKGLPILGIFRSFAAVGVDPA  335

Query  589  VMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAI  410
            VMG+GPAVAIPAAVKS GLEL +IDLFEINEAFASQY+YC KKLGLDP K+NVNGGA+A+
Sbjct  336  VMGVGPAVAIPAAVKSVGLELGNIDLFEINEAFASQYVYCLKKLGLDPRKVNVNGGAIAL  395

Query  409  GHPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGD  263
            GHPLG TGARCVATLL+EMKRRGKDCRYGV+SMCIG+GMGAA VFERGD
Sbjct  396  GHPLGVTGARCVATLLNEMKRRGKDCRYGVISMCIGSGMGAAAVFERGD  444



>ref|NP_568704.2| 3-keto-acyl-CoA thiolase 2 [Arabidopsis thaliana]
 ref|NP_001032037.1| 3-keto-acyl-CoA thiolase 2 [Arabidopsis thaliana]
 sp|Q570C8.2|THIK5_ARATH RecName: Full=3-ketoacyl-CoA thiolase 5, peroxisomal; AltName: 
Full=Acetyl-CoA acyltransferase 5; AltName: Full=Beta-ketothiolase 
5; AltName: Full=Peroxisomal 3-oxoacyl-CoA thiolase 
5; Flags: Precursor [Arabidopsis thaliana]
 gb|AAC17877.1| 3-keto-acyl-CoA thiolase 2 [Arabidopsis thaliana]
 gb|AAC23571.1| peroxisomal 3-keto-acyl-CoA thiolase 2 precursor [Arabidopsis 
thaliana]
 dbj|BAB09441.1| 3-keto-acyl-CoA thiolase 2 [Arabidopsis thaliana]
 gb|AAL84980.1| AT5g48880/K24G6_22 [Arabidopsis thaliana]
 gb|AED95737.1| 3-keto-acyl-CoA thiolase 2 [Arabidopsis thaliana]
 gb|AED95738.1| 3-keto-acyl-CoA thiolase 2 [Arabidopsis thaliana]
Length=457

 Score =   304 bits (779),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 146/178 (82%), Positives = 164/178 (92%), Gaps = 0/178 (0%)
 Frame = -3

Query  769  DLAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPA  590
            DLAKLK VFK++G+TTAGN+SQ++DGAGAVLLMKRSLA++KGLPILGVFR+FA  GV+P+
Sbjct  273  DLAKLKTVFKQNGSTTAGNASQISDGAGAVLLMKRSLAMKKGLPILGVFRSFAVTGVEPS  332

Query  589  VMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAI  410
            VMGIGPAVAIPAA K AGL + DIDLFEINEAFASQY+Y  KKL LD EK+NVNGGA+AI
Sbjct  333  VMGIGPAVAIPAATKLAGLNVSDIDLFEINEAFASQYVYSCKKLELDMEKVNVNGGAIAI  392

Query  409  GHPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNAR  236
            GHPLGATGARCVATLLHEMKRRGKDCR+GV+SMCIGTGMGAA VFERGD+ D LSNAR
Sbjct  393  GHPLGATGARCVATLLHEMKRRGKDCRFGVISMCIGTGMGAAAVFERGDSVDNLSNAR  450



>emb|CDY05657.1| BnaC02g38800D [Brassica napus]
Length=462

 Score =   304 bits (779),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 150/185 (81%), Positives = 169/185 (91%), Gaps = 2/185 (1%)
 Frame = -3

Query  769  DLAKLKPVFKKDGTTTA-GNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDP  593
            DLAKLK VFK +G+TTA GN+SQ++DGAGAVLLMKRSLA++KGLPILG+FR+FA  GVDP
Sbjct  276  DLAKLKTVFKPNGSTTAVGNASQISDGAGAVLLMKRSLAMKKGLPILGIFRSFAVTGVDP  335

Query  592  AVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMA  413
            AVMGIGPA AIPAA   AGL++ DIDLFEINEAFASQY+YC KKL LD EK+NVNGGA+A
Sbjct  336  AVMGIGPAYAIPAAANLAGLKVSDIDLFEINEAFASQYVYCCKKLELDVEKVNVNGGAIA  395

Query  412  IGHPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARK  233
            IGHPLGATGARCVATLLHEMKRRGKDCR+GV+SMCIGTGMGAA VFERGD+ D+LSNAR 
Sbjct  396  IGHPLGATGARCVATLLHEMKRRGKDCRFGVISMCIGTGMGAAAVFERGDSVDDLSNAR-  454

Query  232  VETHG  218
            VET+G
Sbjct  455  VETNG  459



>ref|XP_008454505.1| PREDICTED: 3-ketoacyl-CoA thiolase 1, peroxisomal-like isoform 
X2 [Cucumis melo]
Length=461

 Score =   304 bits (778),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 149/177 (84%), Positives = 160/177 (90%), Gaps = 0/177 (0%)
 Frame = -3

Query  766  LAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAV  587
            LAKLKP FKK+G TTAGNSSQV+DGA AVLLMKRSLAIQKGLPILGVFR+F+ VGVDPAV
Sbjct  281  LAKLKPAFKKNGCTTAGNSSQVSDGAAAVLLMKRSLAIQKGLPILGVFRSFSVVGVDPAV  340

Query  586  MGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIG  407
            MGIGPAVAIPAAVKSAGL L DIDLFEINEAFASQY+YC KKL LD EK+NVNGGA+A+G
Sbjct  341  MGIGPAVAIPAAVKSAGLTLQDIDLFEINEAFASQYVYCCKKLKLDTEKVNVNGGAIALG  400

Query  406  HPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNAR  236
            HPLGATGARCVATLL EMKRRG+D R+GV+SMCIGTGMGAA V ERGD  DE  NAR
Sbjct  401  HPLGATGARCVATLLSEMKRRGRDSRFGVISMCIGTGMGAAAVIERGDYVDEFCNAR  457



>ref|XP_002301570.1| hypothetical protein POPTR_0002s22410g [Populus trichocarpa]
 gb|EEE80843.1| hypothetical protein POPTR_0002s22410g [Populus trichocarpa]
Length=457

 Score =   303 bits (776),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 154/191 (81%), Positives = 175/191 (92%), Gaps = 0/191 (0%)
 Frame = -3

Query  769  DLAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPA  590
            +L++LKP FKKDG+TTAGN+SQV+DGAGAVLLMKRSLA QKGLPILGVFR+FAAVGVDPA
Sbjct  267  ELSRLKPAFKKDGSTTAGNASQVSDGAGAVLLMKRSLAAQKGLPILGVFRSFAAVGVDPA  326

Query  589  VMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAI  410
            VMG+GPA AIPAAV++AGLEL+DIDLFEINEAFASQY+YC KKL LDPEK+NVNGGA+A+
Sbjct  327  VMGVGPAAAIPAAVQAAGLELNDIDLFEINEAFASQYVYCIKKLELDPEKVNVNGGAIAL  386

Query  409  GHPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKV  230
            GHPLGATGARCV TLL+EMKRRGKD R+GV+SMCIG+GMGAA VFERGD  D L N RKV
Sbjct  387  GHPLGATGARCVGTLLNEMKRRGKDSRFGVISMCIGSGMGAAAVFERGDCVDALCNVRKV  446

Query  229  ETHGYLSKDAR  197
             ++  LSKDAR
Sbjct  447  GSNDLLSKDAR  457



>ref|XP_003604976.1| 3-ketoacyl-CoA thiolase 2, peroxisomal [Medicago truncatula]
 gb|AES87173.1| 3-ketoacyl-CoA thiolase 2, peroxisomal-like protein [Medicago 
truncatula]
Length=435

 Score =   302 bits (774),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 143/169 (85%), Positives = 160/169 (95%), Gaps = 0/169 (0%)
 Frame = -3

Query  769  DLAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPA  590
            DLAKLKP FKKDGTTTAGN+SQV+DGA AVLLMKRS+A+QKGLPILG+FR+F+AVGVDPA
Sbjct  266  DLAKLKPAFKKDGTTTAGNASQVSDGAAAVLLMKRSVAVQKGLPILGIFRSFSAVGVDPA  325

Query  589  VMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAI  410
            VMG+GPA AIPAAVKSAGLEL +IDL+EINEAFASQ++Y  KKLGLDP K+NVNGGAMA 
Sbjct  326  VMGVGPAFAIPAAVKSAGLELSNIDLYEINEAFASQFVYSCKKLGLDPTKVNVNGGAMAF  385

Query  409  GHPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGD  263
            GHPLGATGARCVATLL+EMKRRGKDCR+GV+SMCIG+GMGAA VFERGD
Sbjct  386  GHPLGATGARCVATLLNEMKRRGKDCRFGVISMCIGSGMGAAAVFERGD  434



>ref|XP_004152018.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Cucumis 
sativus]
 ref|XP_004163039.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Cucumis 
sativus]
 gb|KGN58339.1| hypothetical protein Csa_3G624070 [Cucumis sativus]
Length=452

 Score =   303 bits (775),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 148/177 (84%), Positives = 159/177 (90%), Gaps = 0/177 (0%)
 Frame = -3

Query  766  LAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAV  587
            L KLKP FKK+G TTAGNSSQV+DGA AVLLMKRSLAIQKGLPILGVFR+F+ VGVDPAV
Sbjct  272  LGKLKPAFKKNGCTTAGNSSQVSDGAAAVLLMKRSLAIQKGLPILGVFRSFSVVGVDPAV  331

Query  586  MGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIG  407
            MGIGPAVAIPAAVKSAGL L DIDLFEINEAFASQY+YC KKL LD EK+NVNGGA+A+G
Sbjct  332  MGIGPAVAIPAAVKSAGLTLQDIDLFEINEAFASQYVYCCKKLNLDTEKVNVNGGAIALG  391

Query  406  HPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNAR  236
            HPLG TGARCVATLL EMKRRG+D R+GV+SMCIGTGMGAA V ERGD  DEL NAR
Sbjct  392  HPLGTTGARCVATLLSEMKRRGRDSRFGVISMCIGTGMGAAAVIERGDYVDELRNAR  448



>gb|ADE77908.1| unknown [Picea sitchensis]
Length=444

 Score =   302 bits (773),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 150/180 (83%), Positives = 163/180 (91%), Gaps = 6/180 (3%)
 Frame = -3

Query  769  DLAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPA  590
            DLAKLKP FKK G TTAGNSSQVTDGAGAVLLMKR +A+QKGLPILGVFR+FAAVG DPA
Sbjct  271  DLAKLKPAFKKGGGTTAGNSSQVTDGAGAVLLMKRKMAMQKGLPILGVFRSFAAVGCDPA  330

Query  589  VMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAI  410
            VMGIGPAVAIPAAVK+AGL++ DIDLFEINEAFASQY+YC +KL LDPEK+NVNGGA+A+
Sbjct  331  VMGIGPAVAIPAAVKAAGLQIGDIDLFEINEAFASQYVYCCQKLELDPEKVNVNGGAIAL  390

Query  409  GHPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKV  230
            GHPLGATGARCV TLLHEMKRRGKDCR+GVVSMCIGTGMGAA VFERG      SNAR +
Sbjct  391  GHPLGATGARCVGTLLHEMKRRGKDCRFGVVSMCIGTGMGAAAVFERG------SNARPI  444



>ref|XP_008454504.1| PREDICTED: 3-ketoacyl-CoA thiolase 1, peroxisomal-like isoform 
X1 [Cucumis melo]
Length=502

 Score =   304 bits (778),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 149/177 (84%), Positives = 160/177 (90%), Gaps = 0/177 (0%)
 Frame = -3

Query  766  LAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAV  587
            LAKLKP FKK+G TTAGNSSQV+DGA AVLLMKRSLAIQKGLPILGVFR+F+ VGVDPAV
Sbjct  322  LAKLKPAFKKNGCTTAGNSSQVSDGAAAVLLMKRSLAIQKGLPILGVFRSFSVVGVDPAV  381

Query  586  MGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIG  407
            MGIGPAVAIPAAVKSAGL L DIDLFEINEAFASQY+YC KKL LD EK+NVNGGA+A+G
Sbjct  382  MGIGPAVAIPAAVKSAGLTLQDIDLFEINEAFASQYVYCCKKLKLDTEKVNVNGGAIALG  441

Query  406  HPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNAR  236
            HPLGATGARCVATLL EMKRRG+D R+GV+SMCIGTGMGAA V ERGD  DE  NAR
Sbjct  442  HPLGATGARCVATLLSEMKRRGRDSRFGVISMCIGTGMGAAAVIERGDYVDEFCNAR  498



>gb|AFK40880.1| unknown [Medicago truncatula]
Length=435

 Score =   301 bits (770),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 143/169 (85%), Positives = 159/169 (94%), Gaps = 0/169 (0%)
 Frame = -3

Query  769  DLAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPA  590
            DLAKLKP FKKDGTTTAGN+SQV+DGA AVLLMKRS+A+QKGLPILG+FR+F+AVGVDPA
Sbjct  266  DLAKLKPAFKKDGTTTAGNASQVSDGAAAVLLMKRSVAVQKGLPILGIFRSFSAVGVDPA  325

Query  589  VMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAI  410
            VMG+GPA AIPAAVKSAGLEL +IDL+EINEAFASQ++Y  KKLGLDP K+NVNGGAMA 
Sbjct  326  VMGVGPAFAIPAAVKSAGLELSNIDLYEINEAFASQFVYSCKKLGLDPTKVNVNGGAMAF  385

Query  409  GHPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGD  263
            GHPLGATGARCVATLL+EMKRRGKDCR+GV+SMCIG GMGAA VFERGD
Sbjct  386  GHPLGATGARCVATLLNEMKRRGKDCRFGVISMCIGFGMGAAAVFERGD  434



>ref|XP_007153157.1| hypothetical protein PHAVU_003G011600g [Phaseolus vulgaris]
 gb|ESW25151.1| hypothetical protein PHAVU_003G011600g [Phaseolus vulgaris]
Length=445

 Score =   300 bits (768),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 142/169 (84%), Positives = 160/169 (95%), Gaps = 0/169 (0%)
 Frame = -3

Query  769  DLAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPA  590
            DLAKLKP F KDGTTTAGN+SQ++DGAGAVLLMKR +A+QKGLPILG+FR+FAAVGVDPA
Sbjct  276  DLAKLKPAFHKDGTTTAGNASQISDGAGAVLLMKRRVAVQKGLPILGIFRSFAAVGVDPA  335

Query  589  VMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAI  410
            VMG+GPAVAIPAAVKSAGLEL +I L+EINEAFASQY+YC KKLGLDP K+NVNGGA+A+
Sbjct  336  VMGVGPAVAIPAAVKSAGLELGNIGLYEINEAFASQYVYCCKKLGLDPRKVNVNGGAIAL  395

Query  409  GHPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGD  263
            GHPLGATGARCVATLL+EMKR GKDCRYGV+SMCIG+GMGAA VFERG+
Sbjct  396  GHPLGATGARCVATLLNEMKRHGKDCRYGVISMCIGSGMGAAAVFERGE  444



>gb|KHN15993.1| 3-ketoacyl-CoA thiolase 2, peroxisomal [Glycine soja]
Length=445

 Score =   300 bits (768),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 142/169 (84%), Positives = 160/169 (95%), Gaps = 0/169 (0%)
 Frame = -3

Query  769  DLAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPA  590
            DLAKLKP F+KDGTTTAGN+SQ++DGA AVLLMKR +A+QKGLPILG+FR+FAAVGVDPA
Sbjct  276  DLAKLKPAFQKDGTTTAGNASQISDGAAAVLLMKRRVAVQKGLPILGIFRSFAAVGVDPA  335

Query  589  VMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAI  410
            VMG+GPAVAIPAAVKSAGLEL +IDLFEINEAFASQY+YC KKLGLDP K+NVNGGA+A+
Sbjct  336  VMGVGPAVAIPAAVKSAGLELGNIDLFEINEAFASQYVYCLKKLGLDPRKVNVNGGAIAL  395

Query  409  GHPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGD  263
            GHPLG TGARCVATLL+EMKR GKDCR+GV+SMCIG+GMGAA VFERGD
Sbjct  396  GHPLGVTGARCVATLLNEMKRGGKDCRFGVISMCIGSGMGAAAVFERGD  444



>gb|KJB72152.1| hypothetical protein B456_011G161700 [Gossypium raimondii]
Length=453

 Score =   300 bits (768),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 142/157 (90%), Positives = 154/157 (98%), Gaps = 0/157 (0%)
 Frame = -3

Query  769  DLAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPA  590
            DL KLKPVFKK+GTTTAGNSSQV+DGAGAVLLMKRS+A++KGLPILGVFRTFAAVGVDPA
Sbjct  274  DLGKLKPVFKKNGTTTAGNSSQVSDGAGAVLLMKRSVAMRKGLPILGVFRTFAAVGVDPA  333

Query  589  VMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAI  410
            +MG+GPAVAIPAAVKSAGLELDD+DLFEINEAFASQ++YCQKKL LDP+KINVNGGAMAI
Sbjct  334  IMGVGPAVAIPAAVKSAGLELDDVDLFEINEAFASQFVYCQKKLELDPQKINVNGGAMAI  393

Query  409  GHPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGT  299
            GHPLG TGARCVATLLHEMKRRGKDCR+GVVSMCIGT
Sbjct  394  GHPLGVTGARCVATLLHEMKRRGKDCRFGVVSMCIGT  430



>ref|XP_004506669.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Cicer 
arietinum]
Length=440

 Score =   299 bits (766),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 143/169 (85%), Positives = 160/169 (95%), Gaps = 0/169 (0%)
 Frame = -3

Query  769  DLAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPA  590
            DLAKL+P FKKDGTTTAGN+SQV+DGA AVLLMKRS+A+QKGLPILG+FR+FAAVGVDPA
Sbjct  271  DLAKLRPAFKKDGTTTAGNASQVSDGAAAVLLMKRSVAVQKGLPILGIFRSFAAVGVDPA  330

Query  589  VMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAI  410
            VMG+GPA AIPAAVKSAGLEL +IDLFEINEAFASQ++Y  KKLGLDP K+NVNGGA+A+
Sbjct  331  VMGVGPAFAIPAAVKSAGLELGNIDLFEINEAFASQFVYSCKKLGLDPSKVNVNGGAIAL  390

Query  409  GHPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGD  263
            GHPLGATGAR VATLL+EMKRRGKDCRYGV+SMCIG+GMGAA VFERGD
Sbjct  391  GHPLGATGARTVATLLNEMKRRGKDCRYGVISMCIGSGMGAAAVFERGD  439



>ref|NP_001242568.1| uncharacterized protein LOC100789930 [Glycine max]
 gb|ACU23006.1| unknown [Glycine max]
Length=445

 Score =   298 bits (764),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 141/169 (83%), Positives = 159/169 (94%), Gaps = 0/169 (0%)
 Frame = -3

Query  769  DLAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPA  590
            DLAKLKP F+KDGTTTAGN+SQ++DGA AVLLMKR +A+QKGLPILG+FR+FAAVGVDPA
Sbjct  276  DLAKLKPAFQKDGTTTAGNASQISDGAAAVLLMKRRVAVQKGLPILGIFRSFAAVGVDPA  335

Query  589  VMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAI  410
            VMG+GPAVAIPAAVKSAGLEL +IDLFEINEAFASQY+YC KKLGLDP K+NVNGGA+A+
Sbjct  336  VMGVGPAVAIPAAVKSAGLELGNIDLFEINEAFASQYVYCLKKLGLDPRKVNVNGGAIAL  395

Query  409  GHPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGD  263
            GHPLG TGARCVATLL+EMKR GKDCR+GV+SMCIG+GMGA  VFERGD
Sbjct  396  GHPLGVTGARCVATLLNEMKRGGKDCRFGVISMCIGSGMGATAVFERGD  444



>emb|CAA53078.1| 3-ketoacyl-CoA thiolase B [Mangifera indica]
Length=430

 Score =   297 bits (761),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 140/155 (90%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  769  DLAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPA  590
            DLAKLKPVFKKDG+TTAGNSSQV+DGAGAVLLMKRS+A++KGLPILGVFRTFAAVGVDPA
Sbjct  272  DLAKLKPVFKKDGSTTAGNSSQVSDGAGAVLLMKRSVAMRKGLPILGVFRTFAAVGVDPA  331

Query  589  VMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAI  410
            +MG+GPAVAIPAAVK+AGLELDDIDLFEINEAFASQ++YC+ KLGLDPEKINVNGGAMAI
Sbjct  332  IMGVGPAVAIPAAVKAAGLELDDIDLFEINEAFASQFVYCRNKLGLDPEKINVNGGAMAI  391

Query  409  GHPLGATGARCVATLLHEMKRRGKDCRYGVVSMCI  305
            GHPLGATGARCVATLLHEMKRRG+DCR+GV+SMCI
Sbjct  392  GHPLGATGARCVATLLHEMKRRGRDCRFGVISMCI  426



>ref|XP_008382649.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Malus 
domestica]
 ref|XP_008382650.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Malus 
domestica]
 ref|XP_008382651.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Malus 
domestica]
Length=181

 Score =   288 bits (737),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 142/180 (79%), Positives = 160/180 (89%), Gaps = 1/180 (1%)
 Frame = -3

Query  769  DLAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPA  590
            D AKLKP FK+DG+TTAGN+SQV+D AGAVLLMKRSL +QKGLPILGVF +FAA+GVDPA
Sbjct  3    DXAKLKPAFKRDGSTTAGNASQVSDDAGAVLLMKRSLTMQKGLPILGVFGSFAAIGVDPA  62

Query  589  VMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAI  410
            VMG+GPA AIP AVKSAGLELDDIDLFEINEAFASQY+ C KKL LDPEK+N NGGA+A+
Sbjct  63   VMGVGPAAAIPVAVKSAGLELDDIDLFEINEAFASQYVXCCKKLELDPEKVNANGGAIAL  122

Query  409  GHPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKV  230
            GH LGATGARCVAT+L+EMKRRG+D  +GV SMCIG+GM AA VFERGD+ DEL NAR V
Sbjct  123  GH-LGATGARCVATVLNEMKRRGRDHSFGVTSMCIGSGMEAAAVFERGDSVDELCNARTV  181



>ref|XP_010482155.1| PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxisomal-like isoform 
X2 [Camelina sativa]
Length=414

 Score =   296 bits (757),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 144/185 (78%), Positives = 162/185 (88%), Gaps = 0/185 (0%)
 Frame = -3

Query  769  DLAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPA  590
            DLAKLK VFKKDG+TTAGN+SQ++DGAGAVLLMKRSLA++KGLPILGVFR+FA  GVDP+
Sbjct  230  DLAKLKTVFKKDGSTTAGNASQISDGAGAVLLMKRSLAMKKGLPILGVFRSFAVTGVDPS  289

Query  589  VMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAI  410
            VMGIGPAVAIPAA   AGL + DIDLFEINEAFASQY+Y  KKL LD EK+NVNGGA+AI
Sbjct  290  VMGIGPAVAIPAATNLAGLNVSDIDLFEINEAFASQYVYSCKKLDLDMEKVNVNGGAIAI  349

Query  409  GHPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKV  230
            GHPLGATGARCVATLLHEMKRRGKDCR+GV+SMCIGTGMGAA VFE GD+    S+A+  
Sbjct  350  GHPLGATGARCVATLLHEMKRRGKDCRFGVISMCIGTGMGAAAVFESGDSFKNNSDAQVA  409

Query  229  ETHGY  215
               G+
Sbjct  410  NGEGH  414



>ref|XP_004506590.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Cicer 
arietinum]
Length=440

 Score =   296 bits (758),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 142/169 (84%), Positives = 159/169 (94%), Gaps = 0/169 (0%)
 Frame = -3

Query  769  DLAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPA  590
            DLAKLKP FKKDGTTTAGN+SQ++DGA AVLLMKRS+A+QKGLPILG+FR+FAAVGVDPA
Sbjct  271  DLAKLKPAFKKDGTTTAGNASQISDGAAAVLLMKRSVAVQKGLPILGIFRSFAAVGVDPA  330

Query  589  VMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAI  410
            VMG+GPA AIPAAVKSAGLEL +IDLFEINEAFASQ++Y  KKLGLD  K+NVNGGA+A+
Sbjct  331  VMGVGPAFAIPAAVKSAGLELGNIDLFEINEAFASQFVYSCKKLGLDRSKVNVNGGAIAL  390

Query  409  GHPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGD  263
            GHPLGATGAR VATLL+EMKRRGKDCRYGV+SMCIG+GMGAA VFERGD
Sbjct  391  GHPLGATGARSVATLLNEMKRRGKDCRYGVISMCIGSGMGAAAVFERGD  439



>gb|KDO43601.1| hypothetical protein CISIN_1g012506mg [Citrus sinensis]
Length=437

 Score =   296 bits (757),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 139/156 (89%), Positives = 154/156 (99%), Gaps = 0/156 (0%)
 Frame = -3

Query  769  DLAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPA  590
            +LAKLKPVFKKDGTTTAGNSSQV+DGAGAVLLMKRS+A++KGLPILGVFRTFAAVGVDPA
Sbjct  272  ELAKLKPVFKKDGTTTAGNSSQVSDGAGAVLLMKRSVAMRKGLPILGVFRTFAAVGVDPA  331

Query  589  VMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAI  410
            +MG+GPAVAIPAAVKSAGL+LDDIDLFEINEAFASQ++YC+ KLGLDPEKINVNGGA+AI
Sbjct  332  IMGVGPAVAIPAAVKSAGLQLDDIDLFEINEAFASQFVYCRNKLGLDPEKINVNGGALAI  391

Query  409  GHPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIG  302
            GHPLG TGARCVATLLHEMKRRG+DCR+GV+SMCIG
Sbjct  392  GHPLGTTGARCVATLLHEMKRRGRDCRFGVISMCIG  427



>ref|XP_009336047.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Pyrus 
x bretschneideri]
Length=443

 Score =   295 bits (755),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 144/181 (80%), Positives = 159/181 (88%), Gaps = 10/181 (6%)
 Frame = -3

Query  772  GDLAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDP  593
             DLAKLKP FK DG+TTAGN+SQV          KRSLA+QKGLPILGVFR+FAAVGVDP
Sbjct  273  NDLAKLKPAFKPDGSTTAGNASQV----------KRSLAMQKGLPILGVFRSFAAVGVDP  322

Query  592  AVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMA  413
            AVMG+GPA AIP AVKS GLELDDIDLFEINEAFASQY+YC KKLGLDPEK+NVNGGA+A
Sbjct  323  AVMGVGPAAAIPVAVKSPGLELDDIDLFEINEAFASQYVYCCKKLGLDPEKVNVNGGAIA  382

Query  412  IGHPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARK  233
            +GHPLGATGARCVATLL+EMKRRG+D R+GV+SMCIG+GMGAA VFERGD+ DEL NAR 
Sbjct  383  LGHPLGATGARCVATLLNEMKRRGRDHRFGVISMCIGSGMGAAAVFERGDSVDELCNART  442

Query  232  V  230
            V
Sbjct  443  V  443



>ref|XP_010482154.1| PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxisomal-like isoform 
X1 [Camelina sativa]
Length=458

 Score =   295 bits (756),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 144/185 (78%), Positives = 162/185 (88%), Gaps = 0/185 (0%)
 Frame = -3

Query  769  DLAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPA  590
            DLAKLK VFKKDG+TTAGN+SQ++DGAGAVLLMKRSLA++KGLPILGVFR+FA  GVDP+
Sbjct  274  DLAKLKTVFKKDGSTTAGNASQISDGAGAVLLMKRSLAMKKGLPILGVFRSFAVTGVDPS  333

Query  589  VMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAI  410
            VMGIGPAVAIPAA   AGL + DIDLFEINEAFASQY+Y  KKL LD EK+NVNGGA+AI
Sbjct  334  VMGIGPAVAIPAATNLAGLNVSDIDLFEINEAFASQYVYSCKKLDLDMEKVNVNGGAIAI  393

Query  409  GHPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKV  230
            GHPLGATGARCVATLLHEMKRRGKDCR+GV+SMCIGTGMGAA VFE GD+    S+A+  
Sbjct  394  GHPLGATGARCVATLLHEMKRRGKDCRFGVISMCIGTGMGAAAVFESGDSFKNNSDAQVA  453

Query  229  ETHGY  215
               G+
Sbjct  454  NGEGH  458



>gb|EMS48058.1| 3-ketoacyl-CoA thiolase 2, peroxisomal [Triticum urartu]
Length=453

 Score =   293 bits (750),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 142/189 (75%), Positives = 164/189 (87%), Gaps = 15/189 (8%)
 Frame = -3

Query  766  LAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAV  587
            LAKLK VFKKDGTTTAGNSSQV+DGAGAVLLMKRS               FAAVGVDPAV
Sbjct  278  LAKLKTVFKKDGTTTAGNSSQVSDGAGAVLLMKRS---------------FAAVGVDPAV  322

Query  586  MGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIG  407
            MG+GPAVAIPAAVKSAGL++DDIDLFE+NEAFASQ++YC  KLGLD  K+NVNGGA+A+G
Sbjct  323  MGVGPAVAIPAAVKSAGLDIDDIDLFELNEAFASQFVYCCNKLGLDRSKVNVNGGAIAMG  382

Query  406  HPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVE  227
            HPLGATGARC++TLL+EMKRRG+DCR+GVV+MCIG+GMGAA VFERGD+ DELSN R ++
Sbjct  383  HPLGATGARCISTLLNEMKRRGRDCRFGVVTMCIGSGMGAAAVFERGDSVDELSNVRHIQ  442

Query  226  THGYLSKDA  200
            +H +LSKDA
Sbjct  443  SHNFLSKDA  451



>gb|KFK42814.1| hypothetical protein AALP_AA1G042000 [Arabis alpina]
Length=439

 Score =   292 bits (747),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 148/168 (88%), Positives = 165/168 (98%), Gaps = 0/168 (0%)
 Frame = -3

Query  766  LAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAV  587
            LAKLKPVFKKDG+TTAGNSSQ++DGAGAVLLM+RS+A++KGLPIL VFRTFAAVGVDPA+
Sbjct  268  LAKLKPVFKKDGSTTAGNSSQLSDGAGAVLLMRRSVAMRKGLPILCVFRTFAAVGVDPAI  327

Query  586  MGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIG  407
            MG+GPA AIPAAVK+AGLEL+DIDLFEINEAFASQ++YC+ KLGLDPEKINVNGGA+AIG
Sbjct  328  MGVGPAAAIPAAVKAAGLELNDIDLFEINEAFASQFVYCRNKLGLDPEKINVNGGAIAIG  387

Query  406  HPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGD  263
            HPLGATGARCVATLLHEMKRRGKDCR+GVVSMCIG+GMGAAGVFERGD
Sbjct  388  HPLGATGARCVATLLHEMKRRGKDCRFGVVSMCIGSGMGAAGVFERGD  435



>ref|XP_009384048.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Musa 
acuminata subsp. malaccensis]
Length=451

 Score =   290 bits (742),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 145/179 (81%), Positives = 164/179 (92%), Gaps = 0/179 (0%)
 Frame = -3

Query  766  LAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAV  587
            L+KLKP FKKDGTTTAGNSSQVTDGA AVLLM+R  A++KGLP+LGVFR+F AVGV+P +
Sbjct  269  LSKLKPAFKKDGTTTAGNSSQVTDGAAAVLLMRRDAAMKKGLPVLGVFRSFVAVGVEPNI  328

Query  586  MGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIG  407
            MGIGP  AIPAAVK+AGLELDDIDLFEINEAFASQY+YC KKL LDP K+NVNGGAMA+G
Sbjct  329  MGIGPVAAIPAAVKAAGLELDDIDLFEINEAFASQYVYCCKKLKLDPAKVNVNGGAMALG  388

Query  406  HPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKV  230
            HPLG TGARCV+TLL+EMKRRGKDCR+GV+SMCIG+GMGAA VFERGD  D+LSNAR+V
Sbjct  389  HPLGCTGARCVSTLLYEMKRRGKDCRFGVISMCIGSGMGAAAVFERGDGVDQLSNARQV  447



>ref|XP_003632434.2| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Vitis 
vinifera]
 emb|CBI37268.3| unnamed protein product [Vitis vinifera]
Length=443

 Score =   288 bits (737),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 135/169 (80%), Positives = 158/169 (93%), Gaps = 0/169 (0%)
 Frame = -3

Query  766  LAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAV  587
            LAKLKP F KDG+TTAGN+SQV+DGAG  LLMKRSLA+++GLPILG+FR++AAVGV+P V
Sbjct  274  LAKLKPAFAKDGSTTAGNASQVSDGAGGALLMKRSLAMKRGLPILGLFRSYAAVGVEPGV  333

Query  586  MGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIG  407
            MG+GPAVAIP A K+AGLE+ DIDLFEINEAFASQY+YC KKL LDP+K+NVNGGA+A+G
Sbjct  334  MGVGPAVAIPIAAKNAGLEVADIDLFEINEAFASQYVYCCKKLDLDPKKVNVNGGALALG  393

Query  406  HPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDA  260
            HPLGATGARCV+TLL+EMKRRGKDCRYGV+SMCIG+GMGAA VFERGD+
Sbjct  394  HPLGATGARCVSTLLYEMKRRGKDCRYGVISMCIGSGMGAAAVFERGDS  442



>ref|XP_005646163.1| thiolase [Coccomyxa subellipsoidea C-169]
 gb|EIE21619.1| thiolase [Coccomyxa subellipsoidea C-169]
Length=470

 Score =   287 bits (735),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 137/189 (72%), Positives = 158/189 (84%), Gaps = 0/189 (0%)
 Frame = -3

Query  766  LAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAV  587
            L  L+ VFKK+GTTTAGNSSQ++DGA AVLLMKR  A ++GLP+LG+FR+FAAVGVDPAV
Sbjct  280  LGGLRAVFKKNGTTTAGNSSQISDGAAAVLLMKRREAAKRGLPVLGIFRSFAAVGVDPAV  339

Query  586  MGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIG  407
            MGIGPAVAIPAAV+ AGL +DDID+FE+NEAFASQ  YC KKLGLDPE++N NGGA+A+G
Sbjct  340  MGIGPAVAIPAAVQKAGLSIDDIDVFELNEAFASQATYCVKKLGLDPERVNPNGGAVALG  399

Query  406  HPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVE  227
            HPLG TGARC ATLLHEM +RGK  R+GVVSMCIG+GMGAA VFERG   D L NA    
Sbjct  400  HPLGCTGARCTATLLHEMNKRGKASRFGVVSMCIGSGMGAAAVFERGGEVDALRNAAPTH  459

Query  226  THGYLSKDA  200
              G+LS DA
Sbjct  460  AQGFLSHDA  468



>gb|AFK47277.1| unknown [Medicago truncatula]
Length=158

 Score =   275 bits (704),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 132/159 (83%), Positives = 147/159 (92%), Gaps = 1/159 (1%)
 Frame = -3

Query  673  MKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEA  494
            MKRS+A+QKGLPILGVFR+F AVGVDPA+MG+GPA AIP AVK+AGLELDDIDLFEINEA
Sbjct  1    MKRSIAMQKGLPILGVFRSFVAVGVDPAIMGVGPAAAIPVAVKAAGLELDDIDLFEINEA  60

Query  493  FASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRYGVVS  314
            FASQ++YC+ KLGLD +KINVNGGAMAIGHPLGATGARCVATLLHEMK+RGKDCRYGV+S
Sbjct  61   FASQFVYCRNKLGLDSQKINVNGGAMAIGHPLGATGARCVATLLHEMKKRGKDCRYGVIS  120

Query  313  MCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDAR  197
            MCIGTGMGAA VFERGD+ DEL NARK +   +LSKDAR
Sbjct  121  MCIGTGMGAAAVFERGDSVDELCNARKGDNL-FLSKDAR  158



>ref|XP_008365692.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like, partial 
[Malus domestica]
Length=162

 Score =   274 bits (700),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 133/162 (82%), Positives = 147/162 (91%), Gaps = 0/162 (0%)
 Frame = -3

Query  715  NSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAG  536
            N+SQV+DGAGAVLLMKRSLA+QKGLPILGVFR+FAAVGVDP VMG+GPA AIP AVKSAG
Sbjct  1    NASQVSDGAGAVLLMKRSLAMQKGLPILGVFRSFAAVGVDPTVMGVGPAAAIPVAVKSAG  60

Query  535  LELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHE  356
            LELDDIDLFEINEAFASQY+YC KKL LDPEK+N NGGA+A+GHPLGATGARCVAT L+E
Sbjct  61   LELDDIDLFEINEAFASQYVYCCKKLELDPEKVNXNGGAIALGHPLGATGARCVATXLNE  120

Query  355  MKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKV  230
            MKRRG+D  +GV SMCIG+GM AA VFERGD+ DEL NAR V
Sbjct  121  MKRRGRDHXFGVXSMCIGSGMXAAAVFERGDSVDELCNARTV  162



>ref|XP_002989683.1| hypothetical protein SELMODRAFT_447769 [Selaginella moellendorffii]
 gb|EFJ09160.1| hypothetical protein SELMODRAFT_447769 [Selaginella moellendorffii]
Length=408

 Score =   281 bits (720),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 136/170 (80%), Positives = 149/170 (88%), Gaps = 0/170 (0%)
 Frame = -3

Query  772  GDLAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDP  593
            G LA+LKP FK  GT+TAGNSSQV+DGAGAVLLMKRS A Q+GLP+LG FR+FA VGV+P
Sbjct  238  GVLARLKPAFKSGGTSTAGNSSQVSDGAGAVLLMKRSCASQRGLPVLGAFRSFAVVGVEP  297

Query  592  AVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMA  413
             VMGIGPAVAIP A+K AGLE+ DI LFEINEAFASQY YC KKL LDP K+NVNGGA+A
Sbjct  298  GVMGIGPAVAIPKAIKDAGLEISDIHLFEINEAFASQYTYCCKKLQLDPAKVNVNGGAIA  357

Query  412  IGHPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGD  263
            +GHPLGATGARCVATLLHEM +RG  CRYGVVSMCIGTGMGAA VFERGD
Sbjct  358  LGHPLGATGARCVATLLHEMAKRGSACRYGVVSMCIGTGMGAAAVFERGD  407



>ref|XP_007049826.1| Peroxisomal 3-ketoacyl-CoA thiolase 3 isoform 2 [Theobroma cacao]
 gb|EOX93983.1| Peroxisomal 3-ketoacyl-CoA thiolase 3 isoform 2 [Theobroma cacao]
Length=472

 Score =   280 bits (717),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 135/155 (87%), Positives = 148/155 (95%), Gaps = 0/155 (0%)
 Frame = -3

Query  769  DLAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPA  590
            DLAKLKP F+KDG TTAGN+SQV+DGAGAVLLMKRSLA+QKGLPILGVFR+FAAVGVDPA
Sbjct  280  DLAKLKPAFRKDGATTAGNASQVSDGAGAVLLMKRSLAMQKGLPILGVFRSFAAVGVDPA  339

Query  589  VMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAI  410
            VMGIGPAVAIPAAVKSAG+EL DIDLFEINEAFASQY+YC KKL LD EK+NVNGGA+A+
Sbjct  340  VMGIGPAVAIPAAVKSAGIELADIDLFEINEAFASQYVYCCKKLELDSEKVNVNGGAIAL  399

Query  409  GHPLGATGARCVATLLHEMKRRGKDCRYGVVSMCI  305
            GHPLGATGARCV TLL+EMKRRGKDCR+GV+SMCI
Sbjct  400  GHPLGATGARCVGTLLYEMKRRGKDCRFGVISMCI  434



>gb|KCW50166.1| hypothetical protein EUGRSUZ_K03601 [Eucalyptus grandis]
Length=474

 Score =   277 bits (709),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 133/161 (83%), Positives = 151/161 (94%), Gaps = 0/161 (0%)
 Frame = -3

Query  772  GDLAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDP  593
             DLAKLKP F+KDG TTAGN+SQV+DGAGAVLLMKRS+A+QKGLPILGVFR+FAAVGVDP
Sbjct  275  NDLAKLKPAFRKDGATTAGNASQVSDGAGAVLLMKRSVAVQKGLPILGVFRSFAAVGVDP  334

Query  592  AVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMA  413
            AVMGIGPAVAIPAAVKSAGL LDDIDL EINEAFASQY+YC KKLGLDPEK+NVNGGA+A
Sbjct  335  AVMGIGPAVAIPAAVKSAGLTLDDIDLLEINEAFASQYVYCCKKLGLDPEKVNVNGGALA  394

Query  412  IGHPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMG  290
            +GHPLGATGARCVATLL+EMKR+G+D R+GV+S+ I + +G
Sbjct  395  LGHPLGATGARCVATLLNEMKRQGRDSRFGVISILITSCLG  435



>ref|XP_010473862.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Camelina 
sativa]
Length=157

 Score =   264 bits (674),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 127/142 (89%), Positives = 134/142 (94%), Gaps = 0/142 (0%)
 Frame = -3

Query  622  RTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPE  443
            RTFAAVGVDPA+MGIGPAVAIPAAVK+AGLELDDIDLFEINEAFASQ++YC+ KLGLDPE
Sbjct  16   RTFAAVGVDPAIMGIGPAVAIPAAVKAAGLELDDIDLFEINEAFASQFVYCRNKLGLDPE  75

Query  442  KINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGD  263
            KINVNGGA+AIGHPLGATGARCVATLLHEMKRRGKDCR+GVVSMCIGTGMGAA VFERGD
Sbjct  76   KINVNGGALAIGHPLGATGARCVATLLHEMKRRGKDCRFGVVSMCIGTGMGAAAVFERGD  135

Query  262  ACDELSNARKVETHGYLSKDAR  197
              DEL NARKVE  G LSKDAR
Sbjct  136  GVDELRNARKVEAQGLLSKDAR  157



>ref|XP_002991797.1| hypothetical protein SELMODRAFT_236388 [Selaginella moellendorffii]
 gb|EFJ07201.1| hypothetical protein SELMODRAFT_236388 [Selaginella moellendorffii]
Length=395

 Score =   271 bits (693),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 133/168 (79%), Positives = 145/168 (86%), Gaps = 3/168 (2%)
 Frame = -3

Query  766  LAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAV  587
            LA+LKP FK  GT+TAGNSSQV+DGAGAVLLMKRS A Q+GLP+LG FR+FA VGV+P V
Sbjct  230  LARLKPAFKSGGTSTAGNSSQVSDGAGAVLLMKRSCATQRGLPVLGAFRSFAVVGVEPGV  289

Query  586  MGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIG  407
            MGIGPAVAIP AVK AGLE+ DI LFEINEAFASQY YC KKL LDP K+NVNGGA+A+G
Sbjct  290  MGIGPAVAIPKAVKDAGLEISDIHLFEINEAFASQYTYCCKKLQLDPAKVNVNGGAIALG  349

Query  406  HPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGD  263
            HPL   GARCVATLLHEM +RG  CRYGVVSMCIGTGMGAA VFERGD
Sbjct  350  HPL---GARCVATLLHEMAKRGSACRYGVVSMCIGTGMGAAAVFERGD  394



>gb|ABR25554.1| peroxisomal 3-ketoacyl-coa thiolase 2 precursor [Oryza sativa 
Indica Group]
Length=243

 Score =   252 bits (644),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 120/159 (75%), Positives = 141/159 (89%), Gaps = 0/159 (0%)
 Frame = -3

Query  766  LAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAV  587
            L KLKPVF+KDGTTTAGNSSQV+DGAGAVLLM+R + +  GLPILGVF++FAAVGV PAV
Sbjct  85   LTKLKPVFRKDGTTTAGNSSQVSDGAGAVLLMRRDIPMNNGLPILGVFKSFAAVGVHPAV  144

Query  586  MGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIG  407
            MG+GPAVAIPAAV SAGL+++DIDLFE+NEAFASQ +YC  KLGLD  K+NVNGGA+A+G
Sbjct  145  MGVGPAVAIPAAVNSAGLQIEDIDLFELNEAFASQLVYCCNKLGLDRSKVNVNGGAIALG  204

Query  406  HPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMG  290
            HPLGAT A+CVATLL+EM RRG DC + VV+MCI +GMG
Sbjct  205  HPLGATRAQCVATLLNEMNRRGTDCIFSVVTMCIVSGMG  243



>ref|XP_002946078.1| hypothetical protein VOLCADRAFT_102696 [Volvox carteri f. nagariensis]
 gb|EFJ53073.1| hypothetical protein VOLCADRAFT_102696 [Volvox carteri f. nagariensis]
Length=462

 Score =   256 bits (653),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 132/189 (70%), Positives = 156/189 (83%), Gaps = 0/189 (0%)
 Frame = -3

Query  766  LAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAV  587
            L+ LKP F+K+GTTTAGNSSQVTDGA AVL+M R+ A ++GLPILG+FR+FAAVGVDP++
Sbjct  272  LSGLKPAFRKNGTTTAGNSSQVTDGAAAVLMMTRAEAHRRGLPILGIFRSFAAVGVDPSI  331

Query  586  MGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIG  407
            MGIGPAVAIP AV  AGL LDDID++EINEAFASQ  YC  KLG+D  K+N NGGA+A+G
Sbjct  332  MGIGPAVAIPEAVARAGLSLDDIDVYEINEAFASQASYCVAKLGIDENKVNPNGGAIAMG  391

Query  406  HPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVE  227
            HPLGATGARC ATLLHE++RRG+  R+GVVSMCIG+GMGAA VFE G   D+   AR V+
Sbjct  392  HPLGATGARCTATLLHELRRRGRGSRFGVVSMCIGSGMGAAAVFETGGEVDKFMTARAVK  451

Query  226  THGYLSKDA  200
                LSKDA
Sbjct  452  GQVLLSKDA  460



>ref|XP_008678417.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Zea mays]
Length=230

 Score =   247 bits (631),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 121/158 (77%), Positives = 141/158 (89%), Gaps = 0/158 (0%)
 Frame = -3

Query  715  NSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAG  536
            NSSQV+DGAGAVLLMKRS+A++KGLPILGVFR+FAAVGVDPA MG+GPAVAIPAAVK AG
Sbjct  33   NSSQVSDGAGAVLLMKRSVALKKGLPILGVFRSFAAVGVDPADMGVGPAVAIPAAVKFAG  92

Query  535  LELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHE  356
            LE+ DIDLFE+NE FASQ++YC  KLGLD  K+NVNGGA+A+GHPL ATGARC+ATLL+E
Sbjct  93   LEIGDIDLFELNEPFASQFVYCCNKLGLDRSKVNVNGGAIALGHPLDATGARCMATLLNE  152

Query  355  MKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSN  242
            MKR+G DCR+GVV+MCIG+GMGAA VFE   A  E+S 
Sbjct  153  MKRQGIDCRFGVVTMCIGSGMGAAAVFELCSARLEVST  190



>gb|AFK39397.1| unknown [Lotus japonicus]
Length=138

 Score =   237 bits (605),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 112/137 (82%), Positives = 128/137 (93%), Gaps = 0/137 (0%)
 Frame = -3

Query  673  MKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEA  494
            MKR +A+QKGLPILG+FR+FAAVGVDP+VMG+GPA AIPAAVKSAGLEL +IDLFEINEA
Sbjct  1    MKRRVAVQKGLPILGIFRSFAAVGVDPSVMGVGPAFAIPAAVKSAGLELGNIDLFEINEA  60

Query  493  FASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRYGVVS  314
            FASQ++Y  KKLGLD  K+NVNGGA+A+GHPLGATGARCVATLL+EMKRRGKDCR+G +S
Sbjct  61   FASQFVYSCKKLGLDTRKVNVNGGAIALGHPLGATGARCVATLLNEMKRRGKDCRFGAIS  120

Query  313  MCIGTGMGAAGVFERGD  263
            MCIG+GMGAA VFERGD
Sbjct  121  MCIGSGMGAAAVFERGD  137



>ref|XP_008355236.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Malus 
domestica]
Length=145

 Score =   236 bits (601),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 117/148 (79%), Positives = 130/148 (88%), Gaps = 3/148 (2%)
 Frame = -3

Query  673  MKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEA  494
            MKRSLA+QKGLPILGVFR+FAA+GVDPAVMG+GPA AIP AVKSAGLELDDIDLFEINEA
Sbjct  1    MKRSLAMQKGLPILGVFRSFAAIGVDPAVMGVGPAAAIPVAVKSAGLELDDIDLFEINEA  60

Query  493  FASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRYGVVS  314
            FASQY+ C KKL LDPEK+N NGGA+A+G   GATGARCVAT L+EMKRRG+D  +GV S
Sbjct  61   FASQYVSCCKKLELDPEKVNANGGAIALG---GATGARCVATXLNEMKRRGRDHSFGVTS  117

Query  313  MCIGTGMGAAGVFERGDACDELSNARKV  230
            MCIG+GM AA VFERGD+ DEL NAR V
Sbjct  118  MCIGSGMEAAAVFERGDSVDELCNARTV  145



>gb|AAK76732.1| 3-ketoacyl-CoA thiolase [Gossypium hirsutum]
Length=133

 Score =   235 bits (600),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 113/133 (85%), Positives = 125/133 (94%), Gaps = 0/133 (0%)
 Frame = -3

Query  673  MKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEA  494
            MKRSLA+QKGLPILGVFR+FAAVGVDPAVMGIGPAVAIPAAVKSAGLE+DDIDLFEINEA
Sbjct  1    MKRSLALQKGLPILGVFRSFAAVGVDPAVMGIGPAVAIPAAVKSAGLEIDDIDLFEINEA  60

Query  493  FASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRYGVVS  314
            FASQ++Y  KKLGLD EK+NVNGGA+A+GHPLG TGARCV TLL+EMKRRGKDCR+GV+S
Sbjct  61   FASQFVYSCKKLGLDREKVNVNGGAIALGHPLGVTGARCVGTLLYEMKRRGKDCRFGVIS  120

Query  313  MCIGTGMGAAGVF  275
            MCIGTGMG +  F
Sbjct  121  MCIGTGMGGSSCF  133



>ref|XP_010172441.1| PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal [Caprimulgus 
carolinensis]
Length=272

 Score =   240 bits (612),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 121/165 (73%), Positives = 138/165 (84%), Gaps = 1/165 (1%)
 Frame = -3

Query  766  LAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAV  587
            LAKLKP FK+DG+TTAGN+SQV+DGA AVLL KRS A Q GLP+LGV R+FA VGV P V
Sbjct  105  LAKLKPAFKEDGSTTAGNASQVSDGAAAVLLAKRSKAAQLGLPVLGVLRSFAVVGVPPDV  164

Query  586  MGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIG  407
            MGIGPA AIP AV+ AGL L+DID++EINEAFASQ +YC +KLG+  EK+N  GGA+A+G
Sbjct  165  MGIGPAYAIPVAVEKAGLTLNDIDIYEINEAFASQAVYCVEKLGIPMEKVNPLGGAIALG  224

Query  406  HPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  272
            HPLG TGAR V TLLHE+KRRGK   YGVVSMCIGTGMGAA VFE
Sbjct  225  HPLGCTGARQVVTLLHELKRRGKRA-YGVVSMCIGTGMGAAAVFE  268



>ref|XP_002500295.1| acetyl-coa acyltransferase [Micromonas sp. RCC299]
 gb|ACO61553.1| acetyl-coa acyltransferase [Micromonas sp. RCC299]
Length=425

 Score =   244 bits (622),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 123/166 (74%), Positives = 141/166 (85%), Gaps = 3/166 (2%)
 Frame = -3

Query  766  LAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAV  587
            LAKL  VFKK G+TT GN+SQV+DGAG V+L KRS A+ KGLPI+G F +FAAVGVDP V
Sbjct  259  LAKLPAVFKKGGSTTPGNASQVSDGAGCVVLAKRSYALAKGLPIMGRFVSFAAVGVDPKV  318

Query  586  MGIGPAVAIPAAVKSAGLE-LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAI  410
            MGIGPAVAIP A++ AGL  + D+DLFE+NEAFASQ  YC  KLGLD EK+NVNGGA+A+
Sbjct  319  MGIGPAVAIPVAIEKAGLRSVADVDLFELNEAFASQATYCATKLGLDVEKVNVNGGAIAL  378

Query  409  GHPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  272
            GHPLGATGARCVATL+HEM+RRG   R GVVSMCIG+GMGAAGVFE
Sbjct  379  GHPLGATGARCVATLMHEMQRRG--ARNGVVSMCIGSGMGAAGVFE  422



>ref|XP_011400620.1| 3-ketoacyl-CoA thiolase 2, peroxisomal [Auxenochlorella protothecoides]
 gb|KFM27633.1| 3-ketoacyl-CoA thiolase 2, peroxisomal [Auxenochlorella protothecoides]
Length=455

 Score =   244 bits (624),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 122/188 (65%), Positives = 147/188 (78%), Gaps = 1/188 (1%)
 Frame = -3

Query  766  LAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAV  587
            LA LKP FKK G+TTAG+SSQ TDGA AVL+M R  A ++GLP+L +FR+FAAVGV PA+
Sbjct  264  LAALKPAFKKGGSTTAGSSSQTTDGAAAVLMMTRREARRRGLPVLAIFRSFAAVGVPPAI  323

Query  586  MGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIG  407
            MGIGP  AIP AV+ AGL LDD+D+FEINEAFASQ LY  KKLGLD E++N NGGA+A+G
Sbjct  324  MGIGPVAAIPEAVRRAGLGLDDVDVFEINEAFASQALYTVKKLGLDLERVNPNGGAIALG  383

Query  406  HPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVE  227
            HPLG TGAR  ATL++EM+RRGK  R+GV+SMCIG+GMGAA V ER  + D   +AR   
Sbjct  384  HPLGCTGARQAATLINEMQRRGKAARFGVISMCIGSGMGAAAVLERDFSDDAERSARPAT  443

Query  226  -THGYLSK  206
              H  LS+
Sbjct  444  GVHAGLSR  451



>ref|XP_009505170.1| PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal [Phalacrocorax 
carbo]
Length=272

 Score =   237 bits (604),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 120/165 (73%), Positives = 138/165 (84%), Gaps = 1/165 (1%)
 Frame = -3

Query  766  LAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAV  587
            LAKLKP FK+DG+TTAGN+SQV+DGA AVLL KRS A Q GLP+LGV R+FA VGV P V
Sbjct  105  LAKLKPAFKEDGSTTAGNASQVSDGAAAVLLAKRSKAAQLGLPVLGVLRSFAVVGVPPDV  164

Query  586  MGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIG  407
            MGIGPA AIP AV+ AGL L+DID++EINEAFASQ +YC +KLG+  EK+N  GGA+A+G
Sbjct  165  MGIGPAYAIPVAVEKAGLTLNDIDIYEINEAFASQAVYCVEKLGIPMEKVNPLGGAIALG  224

Query  406  HPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  272
            HPLG TGAR V TLL+E+KRRGK   YGVVSMCIGTGMGAA VFE
Sbjct  225  HPLGCTGARQVVTLLNELKRRGKRA-YGVVSMCIGTGMGAAAVFE  268



>gb|KJB72151.1| hypothetical protein B456_011G161700 [Gossypium raimondii]
Length=415

 Score =   241 bits (616),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 115/131 (88%), Positives = 126/131 (96%), Gaps = 0/131 (0%)
 Frame = -3

Query  769  DLAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPA  590
            DL KLKPVFKK+GTTTAGNSSQV+DGAGAVLLMKRS+A++KGLPILGVFRTFAAVGVDPA
Sbjct  274  DLGKLKPVFKKNGTTTAGNSSQVSDGAGAVLLMKRSVAMRKGLPILGVFRTFAAVGVDPA  333

Query  589  VMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAI  410
            +MG+GPAVAIPAAVKSAGLELDD+DLFEINEAFASQ++YCQKKL LDP+KINVNGGAMAI
Sbjct  334  IMGVGPAVAIPAAVKSAGLELDDVDLFEINEAFASQFVYCQKKLELDPQKINVNGGAMAI  393

Query  409  GHPLGATGARC  377
            GHPLG TG  C
Sbjct  394  GHPLGVTGISC  404



>ref|XP_003061899.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH53611.1| predicted protein [Micromonas pusilla CCMP1545]
Length=332

 Score =   239 bits (609),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 121/167 (72%), Positives = 138/167 (83%), Gaps = 3/167 (2%)
 Frame = -3

Query  766  LAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAV  587
            LAKL  VFKK G+TT GN+SQV+DGAG VLL  R+ A +  LPI+G F +FAAVGVDP V
Sbjct  166  LAKLPAVFKKGGSTTPGNASQVSDGAGCVLLASRAYAQRHNLPIMGTFVSFAAVGVDPIV  225

Query  586  MGIGPAVAIPAAVKSAG-LELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAI  410
            MGIGPAVAIP A+K AG L +DD+DLFE+NEAFASQ  YC +KLGLD EK+NVNGGA+A+
Sbjct  226  MGIGPAVAIPEALKRAGNLSVDDVDLFELNEAFASQATYCAEKLGLDSEKVNVNGGAIAL  285

Query  409  GHPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFER  269
            GHPLGATGARCVATL+HEM RR  D   GVVSMCIG+GMGAAGVF R
Sbjct  286  GHPLGATGARCVATLMHEMHRRRSDV--GVVSMCIGSGMGAAGVFAR  330



>gb|KDD73648.1| beta-ketoacyl-ACP synthase, partial [Helicosporidium sp. ATCC 
50920]
Length=427

 Score =   241 bits (614),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 122/190 (64%), Positives = 144/190 (76%), Gaps = 0/190 (0%)
 Frame = -3

Query  766  LAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAV  587
            L KL+PVFKK G+TTAGNSSQ TDGA AV+LM R  A ++GL ++GVFR+FAAVGV P +
Sbjct  238  LGKLRPVFKKGGSTTAGNSSQTTDGAAAVMLMTRREAQRRGLAVMGVFRSFAAVGVPPRI  297

Query  586  MGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIG  407
            MGIGPA AIPAAVK AGL + D+D++EINEAFASQ  Y    L +DP K+N NGGA+A+G
Sbjct  298  MGIGPAFAIPAAVKLAGLGVQDVDVYEINEAFASQASYSVDTLKIDPAKVNPNGGAIALG  357

Query  406  HPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVE  227
            HPLG TGAR  ATLL+EM RRGK  R+GVVSMCIG+GMGAA VFER  + D  S A    
Sbjct  358  HPLGCTGARQTATLLYEMARRGKTARFGVVSMCIGSGMGAAAVFEREGSEDRTSFAAPAT  417

Query  226  THGYLSKDAR  197
                LS DA+
Sbjct  418  ARTGLSADAQ  427



>gb|KFW92214.1| 3-ketoacyl-CoA thiolase A, peroxisomal, partial [Phalacrocorax 
carbo]
Length=292

 Score =   236 bits (602),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 120/165 (73%), Positives = 138/165 (84%), Gaps = 1/165 (1%)
 Frame = -3

Query  766  LAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAV  587
            LAKLKP FK+DG+TTAGN+SQV+DGA AVLL KRS A Q GLP+LGV R+FA VGV P V
Sbjct  125  LAKLKPAFKEDGSTTAGNASQVSDGAAAVLLAKRSKAAQLGLPVLGVLRSFAVVGVPPDV  184

Query  586  MGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIG  407
            MGIGPA AIP AV+ AGL L+DID++EINEAFASQ +YC +KLG+  EK+N  GGA+A+G
Sbjct  185  MGIGPAYAIPVAVEKAGLTLNDIDIYEINEAFASQAVYCVEKLGIPMEKVNPLGGAIALG  244

Query  406  HPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  272
            HPLG TGAR V TLL+E+KRRGK   YGVVSMCIGTGMGAA VFE
Sbjct  245  HPLGCTGARQVVTLLNELKRRGKRA-YGVVSMCIGTGMGAAAVFE  288



>gb|KFV08282.1| 3-ketoacyl-CoA thiolase B, peroxisomal, partial [Tauraco erythrolophus]
Length=369

 Score =   239 bits (609),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 121/165 (73%), Positives = 138/165 (84%), Gaps = 1/165 (1%)
 Frame = -3

Query  766  LAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAV  587
            LAKLKP FK+DG+TTAGN+SQV+DGA AVLL KRS A Q GLP+LGV R+FA VGV P V
Sbjct  202  LAKLKPAFKEDGSTTAGNASQVSDGAAAVLLAKRSKAAQLGLPVLGVLRSFAVVGVPPDV  261

Query  586  MGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIG  407
            MGIGPA AIP AV+ AGL L+DID++EINEAFASQ +YC +KLG+  EK+N  GGA+A+G
Sbjct  262  MGIGPAYAIPVAVEKAGLTLNDIDIYEINEAFASQAVYCVEKLGIPMEKVNPLGGAIALG  321

Query  406  HPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  272
            HPLG TGAR V TLLHE+KRRGK   YGVVSMCIGTGMGAA VFE
Sbjct  322  HPLGCTGARQVVTLLHELKRRGKRA-YGVVSMCIGTGMGAAAVFE  365



>gb|KDO43602.1| hypothetical protein CISIN_1g012506mg [Citrus sinensis]
Length=406

 Score =   239 bits (611),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 115/131 (88%), Positives = 127/131 (97%), Gaps = 0/131 (0%)
 Frame = -3

Query  769  DLAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPA  590
            +LAKLKPVFKKDGTTTAGNSSQV+DGAGAVLLMKRS+A++KGLPILGVFRTFAAVGVDPA
Sbjct  272  ELAKLKPVFKKDGTTTAGNSSQVSDGAGAVLLMKRSVAMRKGLPILGVFRTFAAVGVDPA  331

Query  589  VMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAI  410
            +MG+GPAVAIPAAVKSAGL+LDDIDLFEINEAFASQ++YC+ KLGLDPEKINVNGGA+AI
Sbjct  332  IMGVGPAVAIPAAVKSAGLQLDDIDLFEINEAFASQFVYCRNKLGLDPEKINVNGGALAI  391

Query  409  GHPLGATGARC  377
            GHPLG TG  C
Sbjct  392  GHPLGTTGNCC  402



>gb|ELU09588.1| hypothetical protein CAPTEDRAFT_229355 [Capitella teleta]
Length=428

 Score =   240 bits (612),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 120/165 (73%), Positives = 138/165 (84%), Gaps = 0/165 (0%)
 Frame = -3

Query  766  LAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAV  587
            LA+LKP FK+ GTTTAGNSSQV+DGA AVL+ +RS A + GLPILGVFR+FA VGV P V
Sbjct  260  LARLKPAFKEGGTTTAGNSSQVSDGAAAVLMARRSAAKKHGLPILGVFRSFAVVGVPPDV  319

Query  586  MGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIG  407
            MGIGPAVAIPAA+K AGL +DDID++EINEAFASQ  YC +KLG+  EK+N  GGA+A+G
Sbjct  320  MGIGPAVAIPAALKKAGLAVDDIDVYEINEAFASQARYCVEKLGIPMEKVNPKGGAIALG  379

Query  406  HPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  272
            HPLG TGAR +ATLLHEMKRRGK    GV+SMCIGTGMGAA V E
Sbjct  380  HPLGCTGARQMATLLHEMKRRGKKRSNGVISMCIGTGMGAAAVIE  424



>ref|XP_004339798.1| acetylCoA acyltransferase, putative [Acanthamoeba castellanii 
str. Neff]
 gb|ELR17785.1| acetylCoA acyltransferase, putative [Acanthamoeba castellanii 
str. Neff]
Length=430

 Score =   240 bits (612),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 116/166 (70%), Positives = 143/166 (86%), Gaps = 2/166 (1%)
 Frame = -3

Query  766  LAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAV  587
            L KL+PVFK+ G+TTAGNSSQV+DGA A ++ KRS+A + GLPI GVFR+FAAVGV+PAV
Sbjct  265  LGKLRPVFKEGGSTTAGNSSQVSDGAAACIVTKRSVAQKLGLPIFGVFRSFAAVGVEPAV  324

Query  586  MGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIG  407
            MGIGPAVAIPAAV+ AG+ L D+D++EINEAFASQ +YC +KLG+  EK+N NGGA+A+G
Sbjct  325  MGIGPAVAIPAAVQKAGISLQDVDVYEINEAFASQAVYCVQKLGIPVEKVNPNGGAIALG  384

Query  406  HPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFER  269
            HPLG TGAR  ATLL+E+KRR  + R+GVVSMCIG+GMGAA V+ER
Sbjct  385  HPLGCTGARQTATLLNELKRR--NARFGVVSMCIGSGMGAAAVYER  428



>gb|KFQ33519.1| 3-ketoacyl-CoA thiolase B, peroxisomal, partial [Merops nubicus]
Length=369

 Score =   238 bits (607),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 120/165 (73%), Positives = 139/165 (84%), Gaps = 1/165 (1%)
 Frame = -3

Query  766  LAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAV  587
            LAKLKP FK+DG+TTAGN+SQV+DGA AVLL +RS A Q GLP+LGV R+FA VGV PAV
Sbjct  202  LAKLKPAFKEDGSTTAGNASQVSDGAAAVLLARRSKAAQLGLPVLGVLRSFAVVGVPPAV  261

Query  586  MGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIG  407
            MGIGPA AIPAAV+ AGL L+DID++EINEAFASQ +YC +KLG+  EK+N  GGA+A+G
Sbjct  262  MGIGPAYAIPAAVEKAGLTLNDIDIYEINEAFASQAVYCVEKLGIPMEKVNPLGGAIALG  321

Query  406  HPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  272
            HPLG TG R V TLL+E+KRRGK   YGVVSMCIGTGMGAA VFE
Sbjct  322  HPLGCTGTRQVVTLLNELKRRGKRA-YGVVSMCIGTGMGAAAVFE  365



>gb|KFW09333.1| 3-ketoacyl-CoA thiolase A, peroxisomal, partial [Fulmarus glacialis]
Length=367

 Score =   238 bits (606),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 121/165 (73%), Positives = 139/165 (84%), Gaps = 1/165 (1%)
 Frame = -3

Query  766  LAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAV  587
            LAKLKP FK+DG+TTAGN+SQV+DGA AVLL KRS A Q GLP+LGV R+FA VGV P V
Sbjct  200  LAKLKPAFKEDGSTTAGNASQVSDGAAAVLLAKRSKAAQLGLPVLGVLRSFAVVGVPPDV  259

Query  586  MGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIG  407
            MGIGPA AIPAAV+ AGL L+DID++EINEAFASQ +YC +KLG+  EK+N  GGA+A+G
Sbjct  260  MGIGPAYAIPAAVEKAGLTLNDIDIYEINEAFASQAVYCVEKLGIPMEKVNPLGGAIALG  319

Query  406  HPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  272
            HPLG TGAR V TLL+E+KRRGK   YGVVSMCIGTGMGAA VFE
Sbjct  320  HPLGCTGARQVVTLLNELKRRGKRA-YGVVSMCIGTGMGAAAVFE  363



>ref|XP_009941382.1| PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal [Opisthocomus 
hoazin]
Length=356

 Score =   237 bits (605),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 121/165 (73%), Positives = 139/165 (84%), Gaps = 1/165 (1%)
 Frame = -3

Query  766  LAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAV  587
            LAKLKP FK+DG+TTAGN+SQV+DGA AVLL KRS A Q GLP+LGV R+FA VGV P V
Sbjct  189  LAKLKPAFKEDGSTTAGNASQVSDGAAAVLLAKRSKAAQLGLPVLGVLRSFAVVGVPPDV  248

Query  586  MGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIG  407
            MGIGPA AIPAAV+ AGL L+DID++EINEAFASQ +YC +KLG+  EK+N  GGA+A+G
Sbjct  249  MGIGPAYAIPAAVEKAGLTLNDIDIYEINEAFASQAVYCVEKLGIPMEKVNPLGGAIALG  308

Query  406  HPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  272
            HPLG TGAR V TLL+E+KRRGK   YGVVSMCIGTGMGAA VFE
Sbjct  309  HPLGCTGARQVVTLLNELKRRGKRA-YGVVSMCIGTGMGAAAVFE  352



>gb|EMC83181.1| 3-ketoacyl-CoA thiolase B, peroxisomal, partial [Columba livia]
Length=367

 Score =   238 bits (606),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 121/165 (73%), Positives = 138/165 (84%), Gaps = 1/165 (1%)
 Frame = -3

Query  766  LAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAV  587
            LAKLKP FK+DG+TTAGN+SQV+DGA AVLL KRS A Q GLP+LGV R+FA VGV P V
Sbjct  200  LAKLKPAFKEDGSTTAGNASQVSDGAAAVLLAKRSKAAQLGLPVLGVLRSFAVVGVPPDV  259

Query  586  MGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIG  407
            MGIGPA AIPAA++ AGL L+DID+FEINEAFASQ +YC +KLG+  EK+N  GGA+A+G
Sbjct  260  MGIGPAYAIPAALEKAGLTLNDIDIFEINEAFASQAMYCVEKLGIPMEKVNPLGGAIALG  319

Query  406  HPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  272
            HPLG TGAR V TLL E+KRRGK   YGVVSMCIGTGMGAA VFE
Sbjct  320  HPLGCTGARQVVTLLSELKRRGKRA-YGVVSMCIGTGMGAAAVFE  363



>ref|XP_010075883.1| PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal, partial [Pterocles 
gutturalis]
Length=367

 Score =   237 bits (605),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 123/165 (75%), Positives = 139/165 (84%), Gaps = 1/165 (1%)
 Frame = -3

Query  766  LAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAV  587
            LAKLKP FK+ G+TTAGN+SQV+DGA AVLL KRS A Q GLPILGV R+FA VGV P V
Sbjct  200  LAKLKPAFKEGGSTTAGNASQVSDGAAAVLLAKRSKAAQLGLPILGVLRSFAVVGVPPDV  259

Query  586  MGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIG  407
            MGIGPA AIPAAV++AGL LDDID+FEINEAFASQ LYC +KLG+  EK+N  GGA+A+G
Sbjct  260  MGIGPAYAIPAAVENAGLTLDDIDVFEINEAFASQALYCVEKLGIPMEKVNPLGGAIALG  319

Query  406  HPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  272
            HPLG TGAR V TLL+E+KRRGK   YGVVSMCIGTGMGAA VF+
Sbjct  320  HPLGCTGARQVVTLLNELKRRGKRA-YGVVSMCIGTGMGAAAVFK  363



>ref|XP_008942616.1| PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal, partial [Merops 
nubicus]
Length=375

 Score =   238 bits (606),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 120/165 (73%), Positives = 139/165 (84%), Gaps = 1/165 (1%)
 Frame = -3

Query  766  LAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAV  587
            LAKLKP FK+DG+TTAGN+SQV+DGA AVLL +RS A Q GLP+LGV R+FA VGV PAV
Sbjct  208  LAKLKPAFKEDGSTTAGNASQVSDGAAAVLLARRSKAAQLGLPVLGVLRSFAVVGVPPAV  267

Query  586  MGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIG  407
            MGIGPA AIPAAV+ AGL L+DID++EINEAFASQ +YC +KLG+  EK+N  GGA+A+G
Sbjct  268  MGIGPAYAIPAAVEKAGLTLNDIDIYEINEAFASQAVYCVEKLGIPMEKVNPLGGAIALG  327

Query  406  HPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  272
            HPLG TG R V TLL+E+KRRGK   YGVVSMCIGTGMGAA VFE
Sbjct  328  HPLGCTGTRQVVTLLNELKRRGKRA-YGVVSMCIGTGMGAAAVFE  371



>gb|KFW01783.1| 3-ketoacyl-CoA thiolase B, peroxisomal, partial [Eurypyga helias]
Length=336

 Score =   236 bits (602),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 120/165 (73%), Positives = 138/165 (84%), Gaps = 1/165 (1%)
 Frame = -3

Query  766  LAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAV  587
            LAKLKP FK+DG+TTAGN+SQV+DGA AVLL KRS A Q GLP+LGV R+FA VGV P V
Sbjct  169  LAKLKPAFKEDGSTTAGNASQVSDGAAAVLLAKRSKAAQLGLPVLGVLRSFAVVGVPPDV  228

Query  586  MGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIG  407
            MGIGPA AIP AV+ AGL L+DID++EINEAFASQ +YC +KLG+  EK+N  GGA+A+G
Sbjct  229  MGIGPAYAIPVAVEKAGLTLNDIDIYEINEAFASQAVYCVEKLGIPMEKVNPLGGAIALG  288

Query  406  HPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  272
            HPLG TGAR V TLL+E+KRRGK   YGVVSMCIGTGMGAA VFE
Sbjct  289  HPLGCTGARQVVTLLNELKRRGKRA-YGVVSMCIGTGMGAAAVFE  332



>gb|KFR17430.1| 3-ketoacyl-CoA thiolase B, peroxisomal, partial [Opisthocomus 
hoazin]
Length=367

 Score =   237 bits (605),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 121/165 (73%), Positives = 139/165 (84%), Gaps = 1/165 (1%)
 Frame = -3

Query  766  LAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAV  587
            LAKLKP FK+DG+TTAGN+SQV+DGA AVLL KRS A Q GLP+LGV R+FA VGV P V
Sbjct  200  LAKLKPAFKEDGSTTAGNASQVSDGAAAVLLAKRSKAAQLGLPVLGVLRSFAVVGVPPDV  259

Query  586  MGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIG  407
            MGIGPA AIPAAV+ AGL L+DID++EINEAFASQ +YC +KLG+  EK+N  GGA+A+G
Sbjct  260  MGIGPAYAIPAAVEKAGLTLNDIDIYEINEAFASQAVYCVEKLGIPMEKVNPLGGAIALG  319

Query  406  HPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  272
            HPLG TGAR V TLL+E+KRRGK   YGVVSMCIGTGMGAA VFE
Sbjct  320  HPLGCTGARQVVTLLNELKRRGKRA-YGVVSMCIGTGMGAAAVFE  363



>ref|XP_002199792.2| PREDICTED: 3-ketoacyl-CoA thiolase B, peroxisomal-like, partial 
[Taeniopygia guttata]
Length=382

 Score =   238 bits (606),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 120/165 (73%), Positives = 138/165 (84%), Gaps = 1/165 (1%)
 Frame = -3

Query  766  LAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAV  587
            LAKLKP FK+DG+TTAGN+SQV+DGA AVLL KRS A Q GLP+LGV R+FA VGV P V
Sbjct  215  LAKLKPAFKEDGSTTAGNASQVSDGAAAVLLAKRSKAAQLGLPVLGVLRSFAVVGVPPDV  274

Query  586  MGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIG  407
            MGIGPA AIP AV+ AGL L+DID++EINEAFASQ +YC +KLG+  EK+N  GGA+A+G
Sbjct  275  MGIGPAYAIPVAVEKAGLTLNDIDIYEINEAFASQAVYCVEKLGIPMEKVNPLGGAIALG  334

Query  406  HPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  272
            HPLG TGAR V TLL+E+KRRGK   YGVVSMCIGTGMGAA VFE
Sbjct  335  HPLGCTGARQVVTLLNELKRRGKRA-YGVVSMCIGTGMGAAAVFE  378



>ref|XP_009963091.1| PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal [Tyto alba]
Length=356

 Score =   236 bits (603),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 120/165 (73%), Positives = 139/165 (84%), Gaps = 1/165 (1%)
 Frame = -3

Query  766  LAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAV  587
            LAKLKP FK+DG+TTAGN+SQV+DGA AVLL KRS A Q GLP+LGV R+FA VGV P V
Sbjct  189  LAKLKPAFKEDGSTTAGNASQVSDGAAAVLLAKRSKAAQLGLPVLGVLRSFAVVGVPPDV  248

Query  586  MGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIG  407
            MGIGPA AIPAAV+ AGL L+DID++EINEAFASQ +YC +KLG+  EK+N  GGA+A+G
Sbjct  249  MGIGPAYAIPAAVEKAGLTLNDIDIYEINEAFASQAVYCVEKLGIPMEKVNPLGGAIALG  308

Query  406  HPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  272
            HPLG TGAR V TLL+E+KRRG+   YGVVSMCIGTGMGAA VFE
Sbjct  309  HPLGCTGARQVVTLLNELKRRGRRA-YGVVSMCIGTGMGAAAVFE  352



>ref|XP_005424411.1| PREDICTED: 3-ketoacyl-CoA thiolase B, peroxisomal-like [Geospiza 
fortis]
Length=416

 Score =   238 bits (608),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 121/165 (73%), Positives = 138/165 (84%), Gaps = 1/165 (1%)
 Frame = -3

Query  766  LAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAV  587
            LAKLKP FK+DG+TTAGN+SQV+DGA AVLL KRS A Q GLP+LGV R+FA VGV P V
Sbjct  249  LAKLKPAFKEDGSTTAGNASQVSDGAAAVLLAKRSKAAQLGLPVLGVLRSFAVVGVPPDV  308

Query  586  MGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIG  407
            MGIGPA AIP AV+ AGL L+DID++EINEAFASQ +YC +KLG+  EK+N  GGA+A+G
Sbjct  309  MGIGPAYAIPVAVEKAGLTLNDIDIYEINEAFASQAVYCVEKLGIPMEKVNPLGGAIALG  368

Query  406  HPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  272
            HPLG TGAR V TLLHE+KRRGK   YGVVSMCIGTGMGAA VFE
Sbjct  369  HPLGCTGARQVVTLLHELKRRGKRA-YGVVSMCIGTGMGAAAVFE  412



>ref|XP_010146289.1| PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal, partial [Eurypyga 
helias]
Length=351

 Score =   236 bits (603),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 120/165 (73%), Positives = 138/165 (84%), Gaps = 1/165 (1%)
 Frame = -3

Query  766  LAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAV  587
            LAKLKP FK+DG+TTAGN+SQV+DGA AVLL KRS A Q GLP+LGV R+FA VGV P V
Sbjct  184  LAKLKPAFKEDGSTTAGNASQVSDGAAAVLLAKRSKAAQLGLPVLGVLRSFAVVGVPPDV  243

Query  586  MGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIG  407
            MGIGPA AIP AV+ AGL L+DID++EINEAFASQ +YC +KLG+  EK+N  GGA+A+G
Sbjct  244  MGIGPAYAIPVAVEKAGLTLNDIDIYEINEAFASQAVYCVEKLGIPMEKVNPLGGAIALG  303

Query  406  HPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  272
            HPLG TGAR V TLL+E+KRRGK   YGVVSMCIGTGMGAA VFE
Sbjct  304  HPLGCTGARQVVTLLNELKRRGKRA-YGVVSMCIGTGMGAAAVFE  347



>ref|XP_009580990.1| PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal [Fulmarus glacialis]
Length=396

 Score =   238 bits (606),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 121/165 (73%), Positives = 139/165 (84%), Gaps = 1/165 (1%)
 Frame = -3

Query  766  LAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAV  587
            LAKLKP FK+DG+TTAGN+SQV+DGA AVLL KRS A Q GLP+LGV R+FA VGV P V
Sbjct  229  LAKLKPAFKEDGSTTAGNASQVSDGAAAVLLAKRSKAAQLGLPVLGVLRSFAVVGVPPDV  288

Query  586  MGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIG  407
            MGIGPA AIPAAV+ AGL L+DID++EINEAFASQ +YC +KLG+  EK+N  GGA+A+G
Sbjct  289  MGIGPAYAIPAAVEKAGLTLNDIDIYEINEAFASQAVYCVEKLGIPMEKVNPLGGAIALG  348

Query  406  HPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  272
            HPLG TGAR V TLL+E+KRRGK   YGVVSMCIGTGMGAA VFE
Sbjct  349  HPLGCTGARQVVTLLNELKRRGKRA-YGVVSMCIGTGMGAAAVFE  392



>ref|XP_009975644.1| PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal [Tauraco erythrolophus]
Length=396

 Score =   238 bits (606),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 121/165 (73%), Positives = 138/165 (84%), Gaps = 1/165 (1%)
 Frame = -3

Query  766  LAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAV  587
            LAKLKP FK+DG+TTAGN+SQV+DGA AVLL KRS A Q GLP+LGV R+FA VGV P V
Sbjct  229  LAKLKPAFKEDGSTTAGNASQVSDGAAAVLLAKRSKAAQLGLPVLGVLRSFAVVGVPPDV  288

Query  586  MGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIG  407
            MGIGPA AIP AV+ AGL L+DID++EINEAFASQ +YC +KLG+  EK+N  GGA+A+G
Sbjct  289  MGIGPAYAIPVAVEKAGLTLNDIDIYEINEAFASQAVYCVEKLGIPMEKVNPLGGAIALG  348

Query  406  HPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  272
            HPLG TGAR V TLLHE+KRRGK   YGVVSMCIGTGMGAA VFE
Sbjct  349  HPLGCTGARQVVTLLHELKRRGKRA-YGVVSMCIGTGMGAAAVFE  392



>ref|XP_009556582.1| PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal [Cuculus canorus]
Length=356

 Score =   236 bits (603),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 120/165 (73%), Positives = 138/165 (84%), Gaps = 1/165 (1%)
 Frame = -3

Query  766  LAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAV  587
            LAKLKP FK+DG+TTAGN+SQV+DGA AVLL KRS A Q GLP+LGV R+FA VGV P V
Sbjct  189  LAKLKPAFKEDGSTTAGNASQVSDGAAAVLLAKRSKAAQLGLPVLGVLRSFAVVGVPPDV  248

Query  586  MGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIG  407
            MGIGPA AIP AV+ AGL L+DID++EINEAFASQ +YC +KLG+  EK+N  GGA+A+G
Sbjct  249  MGIGPAYAIPVAVEKAGLTLNDIDIYEINEAFASQAVYCVEKLGIPMEKVNPLGGAIALG  308

Query  406  HPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  272
            HPLG TGAR V TLL+E+KRRGK   YGVVSMCIGTGMGAA VFE
Sbjct  309  HPLGCTGARQVVTLLNELKRRGKRA-YGVVSMCIGTGMGAAAVFE  352



>ref|XP_005509181.1| PREDICTED: 3-ketoacyl-CoA thiolase B, peroxisomal-like [Columba 
livia]
Length=389

 Score =   237 bits (605),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 121/165 (73%), Positives = 138/165 (84%), Gaps = 1/165 (1%)
 Frame = -3

Query  766  LAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAV  587
            LAKLKP FK+DG+TTAGN+SQV+DGA AVLL KRS A Q GLP+LGV R+FA VGV P V
Sbjct  222  LAKLKPAFKEDGSTTAGNASQVSDGAAAVLLAKRSKAAQLGLPVLGVLRSFAVVGVPPDV  281

Query  586  MGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIG  407
            MGIGPA AIPAA++ AGL L+DID+FEINEAFASQ +YC +KLG+  EK+N  GGA+A+G
Sbjct  282  MGIGPAYAIPAALEKAGLTLNDIDIFEINEAFASQAMYCVEKLGIPMEKVNPLGGAIALG  341

Query  406  HPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  272
            HPLG TGAR V TLL E+KRRGK   YGVVSMCIGTGMGAA VFE
Sbjct  342  HPLGCTGARQVVTLLSELKRRGKRA-YGVVSMCIGTGMGAAAVFE  385



>gb|KFP47895.1| 3-ketoacyl-CoA thiolase B, peroxisomal, partial [Cathartes aura]
Length=367

 Score =   236 bits (603),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 120/165 (73%), Positives = 138/165 (84%), Gaps = 1/165 (1%)
 Frame = -3

Query  766  LAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAV  587
            LAKLKP FK+DG+TTAGN+SQV+DGA AVLL KRS A Q GLP+LGV R+FA VGV P V
Sbjct  200  LAKLKPAFKEDGSTTAGNASQVSDGAAAVLLAKRSKAAQLGLPVLGVLRSFAVVGVPPDV  259

Query  586  MGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIG  407
            MGIGPA AIP AV+ AGL L+DID++EINEAFASQ +YC +KLG+  EK+N  GGA+A+G
Sbjct  260  MGIGPAYAIPVAVEKAGLTLNDIDIYEINEAFASQAVYCVEKLGIPMEKVNPLGGAIALG  319

Query  406  HPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  272
            HPLG TGAR V TLL+E+KRRGK   YGVVSMCIGTGMGAA VFE
Sbjct  320  HPLGCTGARQVVTLLNELKRRGKRA-YGVVSMCIGTGMGAAAVFE  363



>gb|KFV42249.1| 3-ketoacyl-CoA thiolase B, peroxisomal, partial [Tyto alba]
Length=367

 Score =   236 bits (603),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 120/165 (73%), Positives = 139/165 (84%), Gaps = 1/165 (1%)
 Frame = -3

Query  766  LAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAV  587
            LAKLKP FK+DG+TTAGN+SQV+DGA AVLL KRS A Q GLP+LGV R+FA VGV P V
Sbjct  200  LAKLKPAFKEDGSTTAGNASQVSDGAAAVLLAKRSKAAQLGLPVLGVLRSFAVVGVPPDV  259

Query  586  MGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIG  407
            MGIGPA AIPAAV+ AGL L+DID++EINEAFASQ +YC +KLG+  EK+N  GGA+A+G
Sbjct  260  MGIGPAYAIPAAVEKAGLTLNDIDIYEINEAFASQAVYCVEKLGIPMEKVNPLGGAIALG  319

Query  406  HPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  272
            HPLG TGAR V TLL+E+KRRG+   YGVVSMCIGTGMGAA VFE
Sbjct  320  HPLGCTGARQVVTLLNELKRRGRRA-YGVVSMCIGTGMGAAAVFE  363



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1561126461570