BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF008O16

Length=648
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_002533134.1|  acyl-CoA oxidase, putative                         308   1e-102   
ref|XP_009779578.1|  PREDICTED: acyl-coenzyme A oxidase 2, peroxi...    323   2e-102   Nicotiana sylvestris
ref|XP_009629828.1|  PREDICTED: acyl-coenzyme A oxidase 2, peroxi...    323   2e-102   Nicotiana tomentosiformis
emb|CDP01433.1|  unnamed protein product                                323   2e-102   Coffea canephora [robusta coffee]
ref|XP_011097594.1|  PREDICTED: acyl-coenzyme A oxidase 2, peroxi...    322   4e-102   Sesamum indicum [beniseed]
gb|EPS69661.1|  hypothetical protein M569_05102                         318   5e-101   Genlisea aurea
ref|XP_006355366.1|  PREDICTED: acyl-coenzyme A oxidase 2, peroxi...    319   5e-101   Solanum tuberosum [potatoes]
ref|XP_004237411.1|  PREDICTED: acyl-coenzyme A oxidase 2, peroxi...    317   2e-100   Solanum lycopersicum
gb|AAF14635.1|AF202987_1  acyl-CoA oxidase                              315   2e-99    Petroselinum crispum
ref|XP_006279585.1|  hypothetical protein CARUB_v10025999mg             310   2e-97    Capsella rubella
ref|XP_002866650.1|  acyl-CoA oxidase                                   308   5e-97    Arabidopsis lyrata subsp. lyrata
ref|XP_010444485.1|  PREDICTED: acyl-coenzyme A oxidase 2, peroxi...    308   5e-97    Camelina sativa [gold-of-pleasure]
ref|XP_010462257.1|  PREDICTED: acyl-coenzyme A oxidase 2, peroxi...    308   6e-97    Camelina sativa [gold-of-pleasure]
ref|XP_008361491.1|  PREDICTED: acyl-coenzyme A oxidase 2, peroxi...    303   7e-97    
ref|XP_004504056.1|  PREDICTED: acyl-coenzyme A oxidase 2, peroxi...    308   9e-97    Cicer arietinum [garbanzo]
gb|KDP46864.1|  hypothetical protein JCGZ_24073                         307   1e-96    Jatropha curcas
ref|XP_010484314.1|  PREDICTED: acyl-coenzyme A oxidase 2, peroxi...    307   1e-96    Camelina sativa [gold-of-pleasure]
ref|XP_003525063.1|  PREDICTED: acyl-coenzyme A oxidase 2, peroxi...    306   2e-96    Glycine max [soybeans]
gb|KHN38187.1|  Acyl-coenzyme A oxidase 2, peroxisomal                  306   2e-96    Glycine soja [wild soybean]
ref|XP_011022766.1|  PREDICTED: acyl-coenzyme A oxidase 2, peroxi...    306   3e-96    Populus euphratica
gb|EYU24007.1|  hypothetical protein MIMGU_mgv1a002222mg                306   4e-96    Erythranthe guttata [common monkey flower]
gb|ADD09618.1|  acyl-coA oxidase                                        304   4e-96    Trifolium repens [creeping white clover]
gb|AAC13497.1|  acyl-CoA oxidase                                        306   5e-96    Arabidopsis thaliana [mouse-ear cress]
ref|NP_201316.1|  acyl-coenzyme A oxidase 2                             306   5e-96    Arabidopsis thaliana [mouse-ear cress]
ref|XP_007159635.1|  hypothetical protein PHAVU_002G254200g             305   6e-96    Phaseolus vulgaris [French bean]
gb|KDO56615.1|  hypothetical protein CISIN_1g048624mg                   305   1e-95    Citrus sinensis [apfelsine]
ref|XP_006428162.1|  hypothetical protein CICLE_v10025052mg             305   1e-95    Citrus clementina [clementine]
emb|CDX81267.1|  BnaC09g06780D                                          305   1e-95    
ref|XP_010269210.1|  PREDICTED: acyl-coenzyme A oxidase 2, peroxi...    305   1e-95    Nelumbo nucifera [Indian lotus]
ref|XP_009112168.1|  PREDICTED: acyl-coenzyme A oxidase 2, peroxi...    304   2e-95    Brassica rapa
ref|XP_008338612.1|  PREDICTED: acyl-coenzyme A oxidase 2, peroxi...    304   3e-95    
ref|XP_010090540.1|  Acyl-coenzyme A oxidase                            304   4e-95    
ref|XP_010680574.1|  PREDICTED: acyl-coenzyme A oxidase 2, peroxi...    303   5e-95    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002306317.2|  acyl CoA oxidase family protein                    303   6e-95    
ref|XP_011030976.1|  PREDICTED: acyl-coenzyme A oxidase 2, peroxi...    302   1e-94    Populus euphratica
ref|XP_002309985.1|  acyl CoA oxidase family protein                    301   2e-94    Populus trichocarpa [western balsam poplar]
gb|ABA94670.2|  Acyl-coenzyme A oxidase 2, peroxisomal precursor,...    296   5e-94    Oryza sativa Japonica Group [Japonica rice]
gb|KEH20862.1|  peroxisomal acyl-CoA oxidase                            300   5e-94    Medicago truncatula
ref|XP_008453798.1|  PREDICTED: acyl-coenzyme A oxidase, peroxisomal    300   6e-94    Cucumis melo [Oriental melon]
ref|XP_004146872.1|  PREDICTED: acyl-coenzyme A oxidase, peroxiso...    300   7e-94    Cucumis sativus [cucumbers]
ref|XP_008678001.1|  PREDICTED: acyl-coenzyme A oxidase 2, peroxi...    300   9e-94    
ref|XP_009366361.1|  PREDICTED: acyl-coenzyme A oxidase 2, peroxi...    300   1e-93    Pyrus x bretschneideri [bai li]
ref|XP_009150593.1|  PREDICTED: acyl-coenzyme A oxidase 2, peroxi...    299   2e-93    Brassica rapa
emb|CDY08820.1|  BnaA06g24040D                                          299   2e-93    Brassica napus [oilseed rape]
ref|XP_006394077.1|  hypothetical protein EUTSA_v10003747mg             299   2e-93    Eutrema salsugineum [saltwater cress]
ref|XP_008370191.1|  PREDICTED: acyl-coenzyme A oxidase 2, peroxi...    299   3e-93    
ref|XP_009345476.1|  PREDICTED: acyl-coenzyme A oxidase 2, peroxi...    298   3e-93    Pyrus x bretschneideri [bai li]
ref|XP_006663038.1|  PREDICTED: acyl-coenzyme A oxidase 2, peroxi...    295   3e-93    
emb|CDY14540.1|  BnaC03g49190D                                          298   3e-93    Brassica napus [oilseed rape]
ref|XP_004979658.1|  PREDICTED: acyl-coenzyme A oxidase 2, peroxi...    298   4e-93    Setaria italica
gb|KFK28196.1|  hypothetical protein AALP_AA8G484800                    298   5e-93    Arabis alpina [alpine rockcress]
ref|XP_003577380.1|  PREDICTED: acyl-coenzyme A oxidase 2, peroxi...    298   5e-93    Brachypodium distachyon [annual false brome]
gb|AFQ93694.1|  acyl-CoA oxidase 2                                      297   1e-92    Prunus persica
sp|O64894.1|ACOX2_CUCMA  RecName: Full=Acyl-coenzyme A oxidase, p...    297   1e-92    Cucurbita maxima [Boston marrow]
ref|XP_007208434.1|  hypothetical protein PRUPE_ppa002282mg             297   1e-92    Prunus persica
ref|XP_009378530.1|  PREDICTED: acyl-coenzyme A oxidase, peroxiso...    297   2e-92    Pyrus x bretschneideri [bai li]
gb|EEE62556.1|  hypothetical protein OsJ_17355                          296   2e-92    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010519778.1|  PREDICTED: acyl-coenzyme A oxidase 2, peroxi...    296   4e-92    Tarenaya hassleriana [spider flower]
gb|KJB44226.1|  hypothetical protein B456_007G240800                    295   6e-92    Gossypium raimondii
gb|ABA94669.2|  Acyl-coenzyme A oxidase 2, peroxisomal precursor,...    295   6e-92    Oryza sativa Japonica Group [Japonica rice]
ref|XP_008234652.1|  PREDICTED: acyl-coenzyme A oxidase 2, peroxi...    295   1e-91    Prunus mume [ume]
dbj|BAK00905.1|  predicted protein                                      293   4e-91    Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ87486.1|  predicted protein                                      293   4e-91    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_007047997.1|  Acyl-CoA oxidase 2 isoform 1                       293   4e-91    
ref|XP_006826958.1|  hypothetical protein AMTR_s00010p00190650          293   6e-91    Amborella trichopoda
ref|XP_004288220.1|  PREDICTED: acyl-coenzyme A oxidase 2, peroxi...    292   1e-90    Fragaria vesca subsp. vesca
ref|XP_009390291.1|  PREDICTED: acyl-coenzyme A oxidase 2, peroxi...    291   3e-90    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008803753.1|  PREDICTED: acyl-coenzyme A oxidase 2, peroxi...    290   7e-90    Phoenix dactylifera
ref|XP_002269650.2|  PREDICTED: acyl-coenzyme A oxidase, peroxisomal    290   7e-90    
gb|EMT18336.1|  Acyl-coenzyme A oxidase 2, peroxisomal                  289   8e-90    
ref|XP_010025485.1|  PREDICTED: acyl-coenzyme A oxidase 2, peroxi...    289   2e-89    Eucalyptus grandis [rose gum]
ref|XP_010916902.1|  PREDICTED: acyl-coenzyme A oxidase 2, peroxi...    288   3e-89    Elaeis guineensis
gb|KJB71250.1|  hypothetical protein B456_011G112800                    287   7e-89    Gossypium raimondii
gb|AAR00586.1|U77053_1  acyl-CoA oxidase                                285   5e-88    Phalaenopsis hybrid cultivar
gb|AAB67883.1|  acyl-CoA oxidase homolog                                285   7e-88    Phalaenopsis hybrid cultivar
gb|KJB44225.1|  hypothetical protein B456_007G240800                    277   4e-85    Gossypium raimondii
gb|AAC32108.1|  acyl-CoA oxidase homolog                                258   7e-83    Picea mariana [black spruce]
ref|XP_002991925.1|  hypothetical protein SELMODRAFT_134372             262   2e-79    
ref|XP_002979998.1|  hypothetical protein SELMODRAFT_178082             262   2e-79    
gb|EMS55752.1|  Acyl-coenzyme A oxidase 2, peroxisomal                  256   8e-78    Triticum urartu
gb|ADD09596.1|  acyl-coA oxidase                                        252   4e-76    Trifolium repens [creeping white clover]
ref|XP_007159636.1|  hypothetical protein PHAVU_002G254300g             245   1e-74    Phaseolus vulgaris [French bean]
ref|XP_001786103.1|  predicted protein                                  237   7e-70    
ref|NP_001032145.1|  acyl-coenzyme A oxidase 2                          235   2e-69    Arabidopsis thaliana [mouse-ear cress]
dbj|BAH19744.1|  AT5G65110                                              235   2e-69    Arabidopsis thaliana [mouse-ear cress]
ref|XP_001754596.1|  predicted protein                                  234   9e-69    
gb|EMT32176.1|  Acyl-coenzyme A oxidase 2, peroxisomal                  219   5e-63    
gb|AFW65271.1|  ribosomal protein L15                                   201   3e-56    
gb|AFW65270.1|  ribosomal protein L15                                   201   3e-56    
tpg|DAA37870.1|  TPA: hypothetical protein ZEAMMB73_255371              195   2e-54    
tpg|DAA45395.1|  TPA: ribosomal protein L15                             190   2e-52    
tpg|DAA45394.1|  TPA: ribosomal protein L15                             190   2e-52    
ref|XP_005846219.1|  hypothetical protein CHLNCDRAFT_135478             177   4e-48    Chlorella variabilis
ref|XP_011402022.1|  Acyl-coenzyme A oxidase, peroxisomal               170   2e-45    Auxenochlorella protothecoides
ref|XP_005646249.1|  long-chain acyl-CoA oxidase                        167   3e-44    Coccomyxa subellipsoidea C-169
gb|KDD75971.1|  hypothetical protein H632_c413p1                        152   3e-40    Helicosporidium sp. ATCC 50920
dbj|BAJ98966.1|  predicted protein                                      152   1e-39    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KJB44224.1|  hypothetical protein B456_007G240800                    150   2e-38    Gossypium raimondii
ref|XP_010099275.1|  Acyl-coenzyme A oxidase 2                          145   2e-36    
ref|XP_003630052.1|  Acyl-coenzyme A oxidase, peroxisomal               133   3e-36    
gb|KJB71252.1|  hypothetical protein B456_011G112800                    139   1e-34    Gossypium raimondii
gb|ABR25385.1|  acyl coenzyme a oxidase                                 129   2e-34    Oryza sativa Indica Group [Indian rice]
ref|XP_003608263.1|  Acyl-coenzyme A oxidase 2, peroxisomal             125   1e-32    
ref|XP_004339964.1|  acylCoA dehydrogenase, middle domain contain...    125   2e-29    Acanthamoeba castellanii str. Neff
ref|WP_039751994.1|  acyl-CoA oxidase                                   123   2e-28    
ref|WP_010853776.1|  Acyl-coenzyme A oxidase 1, peroxisomal             123   2e-28    Lunatimonas lonarensis
ref|WP_020890884.1|  Acyl-coenzyme A oxidase 1, peroxisomal             123   2e-28    Cyclobacterium qasimii
ref|WP_043394213.1|  acyl-CoA oxidase                                   122   3e-28    Archangium violaceum
ref|XP_002677851.1|  acyl-coenzyme A oxidase                            122   4e-28    Naegleria gruberi strain NEG-M
ref|WP_014021931.1|  acyl-CoA oxidase                                   121   6e-28    Cyclobacterium marinum
ref|XP_002672633.1|  peroxisomal acyl-CoA oxidase                       119   1e-27    Naegleria gruberi strain NEG-M
ref|WP_009183890.1|  acyl-CoA oxidase                                   119   4e-27    Cecembia lonarensis
ref|WP_044187894.1|  acyl-CoA oxidase                                   118   7e-27    Hyalangium minutum
ref|WP_019598670.1|  hypothetical protein                               118   8e-27    Rhodonellum
ref|WP_002612916.1|  acyl-CoA dehydrogenase                             117   2e-26    Stigmatella aurantiaca
ref|WP_015352554.1|  acyl-CoA dehydrogenase                             115   1e-25    Myxococcus stipitatus
gb|AAB97825.1|  acyl-CoA oxidase                                        112   2e-25    Myxococcus xanthus DK 1622
ref|WP_014773637.1|  acyl-CoA oxidase                                   114   2e-25    Belliella baltica
gb|ABF87186.1|  putative acyl-CoA dehydrogenase                         112   8e-25    Myxococcus xanthus DK 1622
ref|WP_020478009.1|  acyl-CoA dehydrogenase                             111   2e-24    Myxococcus xanthus
ref|WP_013937938.1|  acyl-CoA dehydrogenase                             110   4e-24    Myxococcus macrosporus
ref|WP_002637005.1|  acyl-CoA dehydrogenase                             110   4e-24    Myxococcus hansupus
ref|WP_026716117.1|  acyl-CoA oxidase                                   110   5e-24    Flavobacterium gelidilacus
ref|XP_004362274.1|  acyl-CoA oxidase                                   109   6e-24    Cavenderia fasciculata
ref|WP_016988806.1|  acyl-CoA oxidase                                   108   3e-23    Flavobacterium sp. ACAM 123
ref|WP_013453510.1|  acyl-CoA oxidase                                   108   3e-23    Marivirga tractuosa
ref|WP_035694733.1|  acyl-CoA oxidase                                   107   5e-23    Flavobacterium soli
dbj|GAM18567.1|  hypothetical protein SAMD00019534_017420               106   9e-23    Acytostelium subglobosum LB1
dbj|GAK93201.1|  acyl-coenzyme A oxidase 1                              102   1e-22    Nonlabens ulvanivorans
ref|WP_018102778.1|  MULTISPECIES: acyl-CoA oxidase                     105   2e-22    Streptomyces
ref|WP_030226700.1|  acyl-CoA oxidase                                   105   2e-22    Streptomyces lavendulae
ref|WP_014044514.1|  MULTISPECIES: acyl-CoA oxidase                     105   2e-22    Streptomyces
dbj|GAK89315.1|  acyl-coenzyme A oxidase 1                              102   2e-22    Nonlabens ulvanivorans
ref|WP_006797234.1|  acyl-CoA oxidase                                   105   2e-22    Flavobacteria bacterium BBFL7
ref|WP_007810516.1|  acyl-CoA oxidase                                   105   3e-22    Flavobacterium sp. CF136
gb|EFA78532.1|  putative acyl-CoA oxidase                               104   5e-22    Heterostelium album PN500
ref|WP_043324301.1|  acyl-CoA oxidase                                   104   6e-22    
gb|AFE09438.1|  putative acyl-CoA dehydrogenase                         104   6e-22    Corallococcus coralloides DSM 2259
ref|WP_015360696.1|  acyl-CoA oxidase domain-containing protein         104   6e-22    Nonlabens dokdonensis
ref|WP_013828514.1|  acyl-CoA oxidase                                   103   8e-22    Mycolicibacter sinensis
ref|WP_036457059.1|  acyl-CoA oxidase                                   103   1e-21    Mycobacterium sp. UM_WGJ
ref|WP_036358810.1|  acyl-CoA oxidase                                   103   1e-21    Mycobacterium asiaticum
ref|WP_030220322.1|  acyl-CoA oxidase                                   103   1e-21    Streptomyces bikiniensis
ref|WP_019734689.1|  acyl-CoA oxidase                                   101   1e-21    Mycobacterium avium
ref|WP_030112306.1|  acyl-CoA oxidase                                 99.8    2e-21    
ref|WP_030762017.1|  acyl-CoA oxidase                                   102   3e-21    Streptomyces griseus
ref|WP_019683694.1|  acyl-CoA oxidase                                 99.8    3e-21    
ref|WP_018550940.1|  acyl-CoA oxidase                                   102   3e-21    Streptomyces sp. ATexAB-D23
ref|WP_033441505.1|  acyl-CoA oxidase                                   101   4e-21    
gb|EUA10788.1|  acyl-CoA dehydrogenase, C-terminal domain protein       101   4e-21    Mycobacterium kansasii 732
ref|WP_031088727.1|  acyl-CoA oxidase                                   101   4e-21    Streptomyces sp. NRRL WC-3549
ref|WP_043247513.1|  acyl-CoA oxidase                                   101   4e-21    Streptomyces vinaceus
ref|WP_031053630.1|  acyl-CoA oxidase                                   101   4e-21    Streptomyces sp. NRRL F-5702
ref|WP_030736574.1|  acyl-CoA oxidase                                   101   4e-21    Streptomyces
ref|WP_030332097.1|  acyl-CoA oxidase                                   101   4e-21    Streptomyces sp. NRRL B-1381
ref|WP_030292936.1|  MULTISPECIES: acyl-CoA oxidase                     101   4e-21    Streptomyces
ref|WP_030194549.1|  MULTISPECIES: acyl-CoA oxidase                     101   4e-21    Streptomyces puniceus subgroup
ref|WP_018524646.1|  MULTISPECIES: acyl-CoA oxidase                     101   5e-21    Streptomyces sp. KhCrAH-43
ref|WP_036402348.1|  acyl-CoA oxidase                                   101   5e-21    Mycobacterium
gb|EUA00393.1|  acyl-CoA dehydrogenase, C-terminal domain protein       101   6e-21    Mycobacterium kansasii 824
ref|WP_030389344.1|  acyl-CoA oxidase                                   101   6e-21    Streptomyces sp. NRRL S-241
ref|WP_026468560.1|  acyl-CoA oxidase                                   101   6e-21    Amycolatopsis balhimycina
gb|EUA32514.1|  acyl-CoA oxidase family protein                       97.4    6e-21    Mycobacterium xenopi 3993
ref|WP_019764300.1|  hypothetical protein                             98.6    6e-21    
gb|ADW07059.1|  acyl-CoA dehydrogenase domain-containing protein        100   8e-21    Streptomyces pratensis ATCC 33331
ref|WP_041825462.1|  acyl-CoA oxidase                                   100   8e-21    Streptomyces pratensis
gb|KEP40455.1|  acyl-CoA oxidase                                        100   8e-21    Mycobacterium kansasii
ref|WP_037831419.1|  acyl-CoA oxidase                                   100   8e-21    Streptomyces sp. NRRL S-325
ref|WP_030125188.1|  MULTISPECIES: acyl-CoA oxidase                     100   8e-21    Streptomyces
ref|WP_015576152.1|  acyl-coenzyme A oxidase 1                          100   8e-21    Streptomyces sp. PAMC 26508
ref|WP_030570486.1|  acyl-CoA oxidase                                   100   8e-21    Streptomyces cyaneofuscatus
ref|WP_023365570.1|  acyl-CoA oxidase                                   100   8e-21    Mycobacterium kansasii
ref|WP_044376178.1|  acyl-CoA oxidase                                   100   9e-21    Streptomyces
ref|WP_030811972.1|  acyl-CoA oxidase                                   100   9e-21    Streptomyces mediolani
ref|WP_026985441.1|  acyl-CoA oxidase                                   100   9e-21    Flavobacterium sp. URHB0058
ref|WP_019729355.1|  acyl-CoA oxidase                                 99.4    9e-21    Mycobacterium avium
ref|XP_004363443.2|  peroxisomal acyl-coenzyme A oxidase 3              100   9e-21    Capsaspora owczarzaki ATCC 30864
ref|WP_030704772.1|  acyl-CoA oxidase                                   100   9e-21    Streptomyces griseus
ref|WP_012381918.1|  acyl-CoA oxidase                                   100   9e-21    Streptomyces griseus
ref|WP_042906846.1|  acyl-CoA oxidase                                 99.4    9e-21    Mycobacterium avium
ref|XP_004361564.1|  putative acyl-CoA oxidase                          100   1e-20    Cavenderia fasciculata
ref|XP_646395.1|  hypothetical protein DDB_G0270990                     100   1e-20    Dictyostelium discoideum AX4
ref|WP_012025377.1|  acyl-CoA oxidase                                   100   1e-20    Flavobacterium johnsoniae
ref|WP_032779937.1|  acyl-CoA oxidase                                   100   1e-20    Streptomyces albus
ref|WP_032769032.1|  acyl-CoA oxidase                                   100   1e-20    Streptomyces sp. CNS654
ref|WP_006122746.1|  MULTISPECIES: acyl-CoA oxidase                     100   1e-20    Streptomyces
gb|EUA33411.1|  acyl-CoA dehydrogenase, C-terminal domain protein     97.8    1e-20    Mycobacterium xenopi 4042
ref|WP_013062161.1|  acyl-CoA oxidase                                   100   1e-20    Salinibacter ruber
ref|WP_011404446.1|  acyl-CoA oxidase                                   100   1e-20    Salinibacter ruber
ref|WP_042564417.1|  acyl-CoA oxidase                                   100   2e-20    Flavobacterium sp. MEB061
ref|WP_018850693.1|  acyl-CoA oxidase                                   100   2e-20    Streptomyces sp. CNT372
ref|WP_024455592.1|  acyl-CoA oxidase                                   100   2e-20    Mycobacterium
gb|ETZ74934.1|  acyl-CoA dehydrogenase, C-terminal domain protein     99.8    2e-20    Mycobacterium sp. MAC_080597_8934
dbj|BAN30767.1|  acyl-CoA oxidase                                     99.8    2e-20    Mycobacterium avium subsp. hominissuis TH135
ref|WP_036151893.1|  acyl-CoA oxidase                                   100   2e-20    Maribacter forsetii
ref|WP_032788418.1|  acyl-CoA oxidase                                 99.8    2e-20    Streptomyces sp. JS01
gb|ELP46004.1|  hypothetical protein D522_13218                       99.8    2e-20    Mycobacterium avium subsp. paratuberculosis S5
gb|EGO40578.1|  acyl-CoA dehydrogenase                                99.8    2e-20    Mycobacterium avium subsp. paratuberculosis S397
ref|WP_043786179.1|  acyl-CoA oxidase                                 99.8    2e-20    Amycolatopsis rifamycinica
ref|WP_041518765.1|  acyl-CoA oxidase                                   100   2e-20    Flavobacterium hibernum
ref|WP_020534466.1|  hypothetical protein                               100   2e-20    Lewinella cohaerens
ref|WP_024445310.1|  acyl-CoA oxidase                                 99.8    2e-20    Mycolicibacterium iranicum
ref|WP_030276558.1|  MULTISPECIES: acyl-CoA oxidase                   99.8    2e-20    Streptomyces
ref|WP_035657136.1|  acyl-CoA oxidase                                 99.8    2e-20    Flavobacterium seoulense
ref|WP_011893606.1|  acyl-CoA oxidase                                 99.8    2e-20    Mycolicibacterium gilvum
ref|WP_029182498.1|  acyl-CoA oxidase                                 99.8    2e-20    Streptomyces
ref|WP_023898649.1|  MULTISPECIES: acyl-CoA oxidase                   99.4    2e-20    Mycobacterium avium complex (MAC)
ref|WP_023868784.1|  acyl-CoA oxidase                                 99.4    2e-20    Mycobacterium avium
ref|WP_038676593.1|  acyl-CoA oxidase                                 99.4    2e-20    Pimelobacter simplex
ref|WP_011724581.1|  acyl-CoA oxidase                                 99.4    2e-20    Mycobacterium avium complex (MAC)
ref|WP_023881352.1|  acyl-CoA oxidase                                 99.4    3e-20    Mycobacterium avium complex (MAC)
gb|AHE14605.1|  peroxisomal acyl-coenzyme A oxidase                   99.4    3e-20    uncultured bacterium
ref|WP_023883147.1|  acyl-CoA oxidase                                 99.4    3e-20    Mycobacterium avium
ref|WP_015632626.1|  Acyl-coenzyme A dehydrogenaseoxidase             99.4    3e-20    Mycobacterium avium
ref|WP_010949479.1|  acyl-CoA oxidase                                 99.4    3e-20    Mycobacterium avium
ref|XP_003293464.1|  hypothetical protein DICPUDRAFT_158324           99.4    3e-20    Dictyostelium purpureum
ref|WP_030591343.1|  acyl-CoA oxidase                                 99.4    3e-20    Streptomyces anulatus
ref|WP_030760334.1|  MULTISPECIES: acyl-CoA oxidase                   99.4    3e-20    Streptomyces
ref|WP_043644508.1|  hypothetical protein                             99.4    3e-20    
ref|WP_036470198.1|  acyl-CoA oxidase                                 99.4    3e-20    Mycobacterium triplex
ref|WP_041344327.1|  acyl-CoA oxidase                                 99.0    3e-20    
ref|WP_033713247.1|  acyl-CoA oxidase                                 99.0    3e-20    Mycobacterium sp. MAC_011194_8550
ref|WP_030531740.1|  acyl-CoA oxidase                                 99.0    4e-20    Prauserella rugosa
ref|WP_003970716.1|  acyl-CoA oxidase                                 99.0    4e-20    Streptomyces sp. ACT-1
ref|WP_033300853.1|  acyl-CoA oxidase                                 98.6    5e-20    Streptomyces atroolivaceus
gb|EFA84508.1|  acyl-CoA oxidase                                      99.0    5e-20    Heterostelium album PN500
ref|WP_036396123.1|  acyl-CoA oxidase                                 98.6    6e-20    Mycolicibacterium cosmeticum
ref|WP_022834726.1|  acyl-CoA oxidase                                 98.6    6e-20    Salisaeta longa
emb|CDO05676.1|  acyl-CoA dehydrogenase domain-containing protein     98.6    6e-20    Mycolicibacterium cosmeticum
ref|WP_031456312.1|  acyl-CoA oxidase                                 98.2    7e-20    Flavobacterium chungangense
ref|WP_042295862.1|  acyl-CoA oxidase                                 98.2    8e-20    Nonlabens ulvanivorans
ref|WP_026992283.1|  acyl-CoA oxidase                                 98.2    8e-20    Flavobacterium subsaxonicum
ref|WP_044506891.1|  acyl-CoA oxidase                                 97.8    8e-20    Mycobacterium simiae
ref|WP_007171081.1|  acyl-CoA oxidase                                 97.8    8e-20    Mycobacterium
ref|WP_030697375.1|  acyl-CoA oxidase                                 97.8    9e-20    Streptomyces
ref|WP_007770344.1|  acyl-CoA oxidase                                 97.8    9e-20    Mycobacterium colombiense
ref|WP_044486229.1|  acyl-CoA oxidase                                 97.8    9e-20    Mycobacterium colombiense
ref|WP_026707256.1|  acyl-CoA oxidase                                 98.2    9e-20    Flavobacterium frigidarium
ref|WP_039819999.1|  acyl-CoA oxidase                                 97.8    9e-20    Nocardiopsis halophila
ref|WP_011856090.1|  acyl-CoA oxidase                                 97.4    1e-19    Mycobacteriaceae
gb|EPQ74968.1|  Acyl-coenzyme A oxidase 3, peroxisomal                97.4    1e-19    Mycobacterium marinum str. Europe
ref|WP_030768335.1|  acyl-CoA oxidase                                 97.4    1e-19    Streptomyces griseus
ref|WP_003946657.1|  MULTISPECIES: acyl-CoA oxidase                   97.4    1e-19    Streptomyces
ref|WP_011560818.1|  MULTISPECIES: acyl-CoA oxidase                   97.4    1e-19    Mycobacterium
ref|WP_003921933.1|  acyl-CoA oxidase                                 97.4    1e-19    Mycobacterium xenopi
ref|WP_015780052.1|  acyl-CoA oxidase                                 97.4    1e-19    Kytococcus sedentarius
gb|EJG02802.1|  acyl-CoA oxidase                                      97.4    1e-19    Flavobacterium sp. F52
ref|WP_035690755.1|  acyl-CoA oxidase                                 97.4    1e-19    Flavobacterium sp. F52
ref|WP_037186992.1|  acyl-CoA oxidase                                 97.1    1e-19    Rhodococcus
ref|WP_017557135.1|  hypothetical protein                             97.1    1e-19    Nocardiopsis baichengensis
ref|WP_003933305.1|  acyl-CoA oxidase                                 97.1    1e-19    Mycolicibacterium vaccae
ref|WP_010313150.1|  acyl-CoA oxidase                                 97.1    1e-19    Saccharopolyspora spinosa
ref|WP_015356441.1|  acyl-CoA dehydrogenase                           97.1    2e-19    
ref|WP_020786817.1|  Acyl-coenzyme A oxidase 3, peroxisomal           97.1    2e-19    Mycobacterium sp. 012931
ref|WP_012395254.1|  acyl-CoA oxidase                                 97.1    2e-19    
ref|WP_036456278.1|  acyl-CoA oxidase                                 97.1    2e-19    Mycobacterium marinum
ref|WP_031177408.1|  acyl-CoA oxidase                                 97.1    2e-19    Streptomyces
ref|WP_018471012.1|  acyl-CoA oxidase                                 97.1    2e-19    Streptomyces
ref|WP_010639493.1|  acyl-CoA oxidase                                 97.1    2e-19    
ref|WP_026238320.1|  acyl-CoA oxidase                                 97.1    2e-19    Streptomyces sp. CcalMP-8W
ref|WP_038580130.1|  acyl-CoA oxidase                                 97.1    2e-19    
ref|WP_030580799.1|  acyl-CoA oxidase                                 97.1    2e-19    Streptomyces globisporus
ref|WP_039119472.1|  acyl-CoA oxidase                                 97.1    2e-19    Flavobacterium sp. JRM
ref|WP_035305307.1|  acyl-CoA oxidase                                 97.1    2e-19    Actinokineospora inagensis
ref|WP_029450063.1|  acyl-CoA oxidase                                 97.1    2e-19    
ref|WP_008713698.1|  Acyl-CoA dehydrogenase domain protein            97.1    2e-19    Rhodococcus sp. AW25M09
ref|WP_036344488.1|  acyl-CoA oxidase                                 96.7    2e-19    Mycolicibacterium aromaticivorans
dbj|GAM21273.1|  hypothetical protein SAMD00019534_044480             97.1    2e-19    Acytostelium subglobosum LB1
ref|WP_034664791.1|  acyl-CoA oxidase                                 97.1    2e-19    
ref|WP_027862959.1|  acyl-CoA oxidase                                 96.7    2e-19    
ref|WP_023420722.1|  MULTISPECIES: Acyl-coenzyme A oxidase 1, per...  96.7    2e-19    Streptomyces
ref|WP_033948443.1|  acyl-CoA oxidase                                 96.7    2e-19    Streptomyces
ref|WP_018894104.1|  acyl-CoA oxidase                                 96.7    2e-19    Streptomyces sp. CNY228
ref|WP_030714432.1|  acyl-CoA oxidase                                 96.7    2e-19    Streptomyces
ref|WP_036565630.1|  acyl-CoA oxidase                                 96.7    2e-19    
ref|WP_035622798.1|  acyl-CoA oxidase                                 96.7    2e-19    Flavobacterium hydatis
ref|WP_029447141.1|  acyl-CoA oxidase                                 96.7    3e-19    
ref|WP_042246211.1|  acyl-CoA oxidase                                 96.7    3e-19    Nonlabens ulvanivorans
ref|WP_042270257.1|  acyl-CoA oxidase                                 96.7    3e-19    Nonlabens ulvanivorans
ref|WP_036581400.1|  acyl-CoA oxidase                                 96.7    3e-19    
ref|WP_039500185.1|  acyl-CoA oxidase                                 96.3    3e-19    
ref|WP_036491874.1|  acyl-CoA oxidase                                 96.3    3e-19    
ref|WP_035644791.1|  acyl-CoA oxidase                                 96.3    3e-19    
gb|EON25586.1|  acyl-CoA oxidase domain-containing protein            96.3    3e-19    
ref|WP_039115718.1|  acyl-CoA oxidase                                 96.3    4e-19    
ref|WP_005144785.1|  acyl-CoA oxidase                                 95.9    4e-19    
ref|WP_037662951.1|  acyl-CoA oxidase                                 95.9    4e-19    
ref|WP_029269714.1|  acyl-CoA oxidase                                 96.3    4e-19    
ref|WP_033431876.1|  acyl-CoA oxidase                                 95.9    4e-19    
ref|WP_014212607.1|  acyl-CoA oxidase                                 95.9    4e-19    
ref|WP_033238735.1|  acyl-CoA oxidase                                 95.5    5e-19    
ref|WP_003924602.1|  acyl-CoA oxidase                                 95.5    5e-19    
ref|WP_036550021.1|  acyl-CoA oxidase                                 95.5    5e-19    
ref|WP_033226284.1|  acyl-CoA oxidase                                 95.5    5e-19    
ref|WP_036449269.1|  acyl-CoA oxidase                                 95.5    6e-19    
ref|WP_022827387.1|  acyl-CoA oxidase                                 95.5    6e-19    
ref|WP_025615938.1|  acyl-CoA oxidase                                 95.5    6e-19    
ref|WP_013229814.1|  acyl-CoA oxidase                                 95.1    7e-19    
ref|WP_026245499.1|  acyl-CoA oxidase                                 95.1    7e-19    
ref|WP_027064968.1|  acyl-CoA oxidase                                 95.5    7e-19    
ref|WP_018599328.1|  acyl-CoA oxidase                                 95.1    7e-19    
ref|WP_017497064.1|  acyl-CoA oxidase                                 95.5    8e-19    
ref|WP_044524267.1|  acyl-CoA oxidase                                 94.7    9e-19    
ref|WP_032755520.1|  acyl-CoA oxidase                                 94.7    9e-19    
ref|WP_031121894.1|  acyl-CoA oxidase                                 94.7    9e-19    
ref|WP_026242212.1|  acyl-CoA oxidase                                 94.7    1e-18    
ref|WP_012787563.1|  acyl-CoA oxidase                                 94.7    1e-18    
ref|WP_003879598.1|  MULTISPECIES: acyl-CoA oxidase                   94.7    1e-18    
ref|WP_030133589.1|  acyl-CoA oxidase                                 94.7    1e-18    
ref|WP_023986016.1|  MULTISPECIES: acyl-CoA oxidase                   94.7    1e-18    
gb|EFA76041.1|  hypothetical protein PPL_10620                        94.4    1e-18    
ref|WP_036460965.1|  acyl-CoA oxidase                                 94.4    1e-18    
ref|WP_027498339.1|  MULTISPECIES: acyl-CoA oxidase                   94.4    1e-18    
ref|WP_036442896.1|  acyl-CoA oxidase                                 94.4    1e-18    
ref|WP_036372117.1|  MULTISPECIES: acyl-CoA oxidase                   94.4    1e-18    
gb|ABM14589.1|  acyl-CoA dehydrogenase domain protein                 94.4    1e-18    
ref|WP_032365221.1|  acyl-CoA oxidase                                 94.4    1e-18    
ref|WP_030629375.1|  acyl-CoA oxidase                                 94.0    2e-18    
ref|WP_030081577.1|  acyl-CoA oxidase                                 94.0    2e-18    
ref|WP_037185147.1|  acyl-CoA oxidase                                 94.0    2e-18    
ref|WP_003080258.1|  acyl-CoA oxidase                                 94.0    2e-18    
ref|WP_011753930.1|  acyl-CoA oxidase                                 94.0    2e-18    
ref|XP_004333085.1|  acylCoA oxidase                                  89.7    2e-18    
ref|WP_035680554.1|  acyl-CoA oxidase                                 94.0    2e-18    
ref|WP_026729518.1|  acyl-CoA oxidase                                 94.0    2e-18    
ref|WP_011739426.1|  acyl-CoA oxidase                                 94.0    2e-18    
ref|WP_029373113.1|  acyl-CoA oxidase                                 93.6    2e-18    
ref|WP_019969895.1|  acyl-CoA oxidase                                 93.6    2e-18    
gb|AFJ34889.1|  acyl-CoA oxidase                                      93.6    2e-18    
gb|ELR84632.1|  acyl-CoA oxidase                                      93.6    2e-18    
ref|WP_037171831.1|  acyl-CoA oxidase                                 93.6    2e-18    
ref|WP_037153748.1|  acyl-CoA oxidase                                 93.6    2e-18    
ref|WP_032401875.1|  acyl-CoA oxidase                                 93.6    2e-18    
ref|WP_032380392.1|  acyl-CoA oxidase                                 93.6    2e-18    
ref|WP_032390396.1|  acyl-CoA oxidase                                 93.6    3e-18    
ref|WP_024481861.1|  acyl-CoA oxidase                                 93.6    3e-18    
gb|EUA26848.1|  acyl-CoA dehydrogenase, C-terminal domain protein     92.4    3e-18    
ref|WP_028418867.1|  acyl-CoA oxidase                                 93.6    3e-18    
ref|WP_043221719.1|  acyl-CoA oxidase                                 93.6    3e-18    
ref|WP_020937550.1|  acyl-CoA dehydrogenase                           93.6    3e-18    
ref|WP_041297823.1|  acyl-CoA oxidase                                 93.2    3e-18    
ref|WP_019343338.1|  acyl-CoA oxidase                                 93.2    3e-18    
ref|WP_014379818.1|  MULTISPECIES: acyl-CoA oxidase                   93.2    3e-18    
ref|XP_637610.2|  acyl-CoA oxidase                                    93.2    3e-18    
ref|WP_014384406.1|  acyl-CoA oxidase                                 93.2    3e-18    
ref|WP_043410495.1|  acyl-CoA oxidase                                 93.2    4e-18    
ref|WP_042377454.1|  acyl-CoA oxidase                                 93.2    4e-18    
ref|WP_036393685.1|  acyl-CoA oxidase                                 92.8    4e-18    
ref|WP_034716536.1|  acyl-CoA oxidase                                 92.8    4e-18    
ref|WP_037114191.1|  acyl-CoA oxidase                                 92.8    4e-18    
ref|WP_020112517.1|  acyl-CoA oxidase                                 92.8    5e-18    
ref|WP_019666492.1|  MULTISPECIES: acyl-CoA oxidase                   92.8    5e-18    
ref|WP_003895830.1|  acyl-CoA oxidase                                 92.4    5e-18    
ref|WP_020391585.1|  acyl-CoA oxidase                                 92.4    6e-18    
ref|WP_011729863.1|  acyl-CoA oxidase                                 92.4    6e-18    
ref|WP_028638761.1|  acyl-CoA oxidase                                 92.4    6e-18    
ref|WP_008735487.1|  acyl-CoA oxidase                                 92.4    6e-18    
ref|WP_027078216.1|  acyl-CoA oxidase                                 92.4    7e-18    
ref|WP_043391714.1|  MULTISPECIES: acyl-CoA oxidase                   92.4    7e-18    
ref|WP_010842026.1|  Acyl-CoA dehydrogenase                           92.4    7e-18    
ref|WP_014925550.1|  acyl-CoA oxidase                                 92.4    8e-18    
ref|WP_030317285.1|  acyl-CoA oxidase                                 92.0    8e-18    
ref|WP_039380663.1|  acyl-CoA oxidase                                 92.0    8e-18    
ref|WP_005628484.1|  acyl-CoA oxidase                                 92.0    8e-18    
ref|WP_039321983.1|  acyl-CoA oxidase                                 92.0    8e-18    
ref|WP_014816551.1|  acyl-CoA oxidase                                 92.0    8e-18    
ref|WP_044852233.1|  acyl-CoA oxidase                                 91.7    1e-17    
ref|WP_032393893.1|  acyl-CoA oxidase                                 91.7    1e-17    
ref|WP_015607106.1|  Acyl-CoA oxidase domain-containing protein       91.7    1e-17    
ref|WP_029109612.1|  acyl-CoA oxidase                                 91.7    1e-17    
ref|WP_029104814.1|  acyl-CoA oxidase                                 91.3    2e-17    
ref|WP_029121178.1|  acyl-CoA oxidase                                 91.3    2e-17    
ref|WP_037306481.1|  acyl-CoA oxidase                                 90.9    2e-17    
ref|WP_026449386.1|  acyl-CoA oxidase                                 90.9    2e-17    
ref|WP_020214166.1|  hypothetical protein                             90.9    2e-17    
ref|WP_004019946.1|  acyl-CoA oxidase                                 90.9    2e-17    
ref|WP_035847687.1|  acyl-CoA oxidase                                 90.5    2e-17    
ref|WP_017933227.1|  hypothetical protein                             90.5    2e-17    
ref|WP_033346146.1|  acyl-CoA oxidase                                 90.5    2e-17    
ref|WP_038237921.1|  acyl-CoA oxidase                                 90.5    3e-17    
ref|XP_003287521.1|  hypothetical protein DICPUDRAFT_97730            90.5    3e-17    
ref|WP_030433418.1|  acyl-CoA oxidase                                 89.7    4e-17    
ref|WP_006358547.1|  acyl-CoA oxidase                                 90.1    4e-17    
ref|WP_006241046.1|  acyl-CoA oxidase                                 90.1    4e-17    
ref|WP_006437568.1|  putative acyl-CoA oxidase                        90.1    4e-17    
ref|WP_007028884.1|  acyl-CoA oxidase domain-containing protein       89.7    5e-17    
ref|XP_009305865.1|  PREDICTED: acyl-coenzyme A oxidase-like prot...  88.6    5e-17    
ref|WP_034305416.1|  acyl-CoA oxidase                                 89.7    5e-17    
ref|WP_005194221.1|  acyl-CoA oxidase                                 89.7    6e-17    
ref|WP_028785613.1|  acyl-CoA oxidase                                 89.4    6e-17    
ref|WP_026847236.1|  acyl-CoA oxidase                                 89.4    6e-17    
ref|WP_020631448.1|  acyl-CoA oxidase                                 89.4    7e-17    
ref|WP_005168178.1|  Acyl-coenzyme A oxidase 1, peroxisomal           89.4    7e-17    
ref|WP_026978660.1|  acyl-CoA oxidase                                 89.4    7e-17    
ref|WP_037367820.1|  acyl-CoA oxidase                                 89.0    8e-17    
ref|WP_037340849.1|  acyl-CoA oxidase                                 89.0    9e-17    
ref|WP_040710503.1|  acyl-CoA oxidase                                 89.0    9e-17    
ref|WP_015100482.1|  Acyl-CoA oxidase                                 89.0    9e-17    
ref|WP_038508394.1|  acyl-CoA oxidase                                 89.0    1e-16    
ref|WP_016337188.1|  acyl-CoA oxidase                                 89.0    1e-16    
ref|XP_009305864.1|  PREDICTED: acyl-coenzyme A oxidase-like prot...  88.6    1e-16    
ref|WP_010540070.1|  acyl-CoA oxidase                                 89.0    1e-16    
ref|XP_697559.4|  PREDICTED: acyl-coenzyme A oxidase-like protein...  88.6    1e-16    
ref|WP_037816709.1|  acyl-CoA oxidase                                 88.6    1e-16    
ref|WP_015307895.1|  acyl-CoA dehydrogenase                           88.6    1e-16    
ref|WP_006865285.1|  acyl-CoA oxidase                                 88.6    1e-16    
ref|WP_028075354.1|  acyl-CoA oxidase                                 88.6    1e-16    
ref|WP_006899076.1|  putative acyl-CoA oxidase                        88.6    1e-16    
ref|WP_036336177.1|  acyl-CoA oxidase                                 88.6    1e-16    
ref|WP_008611975.1|  acyl-CoA oxidase                                 88.6    2e-16    
ref|WP_007317217.1|  acyl-CoA oxidase                                 88.2    2e-16    
ref|WP_028655548.1|  acyl-CoA oxidase                                 87.8    2e-16    
ref|WP_005169429.1|  putative acyl-CoA oxidase                        88.2    2e-16    
ref|WP_022925252.1|  acyl-CoA oxidase                                 87.8    2e-16    
ref|WP_012924042.1|  acyl-CoA oxidase                                 87.8    2e-16    
ref|WP_043567466.1|  acyl-CoA oxidase                                 87.8    2e-16    
gb|EFV91839.1|  acyl-CoA dehydrogenase domain-containing protein      87.8    2e-16    
ref|WP_044101585.1|  acyl-CoA oxidase                                 87.8    2e-16    
ref|WP_033293761.1|  acyl-CoA oxidase                                 87.4    3e-16    
ref|WP_020497070.1|  hypothetical protein                             87.4    3e-16    
ref|WP_013993723.1|  acyl-CoA oxidase                                 87.8    3e-16    
gb|KIQ18411.1|  acyl-CoA oxidase                                      87.4    3e-16    
gb|ADV49363.1|  Acyl-CoA oxidase                                      87.4    3e-16    
ref|WP_041557690.1|  acyl-CoA oxidase                                 87.4    4e-16    
ref|WP_042574090.1|  acyl-CoA oxidase                                 87.0    4e-16    
ref|WP_043716325.1|  acyl-CoA oxidase                                 87.0    4e-16    
ref|WP_040270575.1|  acyl-CoA oxidase                                 87.0    4e-16    
ref|WP_012832911.1|  acyl-CoA oxidase                                 87.0    4e-16    
ref|WP_005188340.1|  acyl-CoA oxidase                                 87.0    4e-16    
ref|WP_033400952.1|  acyl-CoA oxidase                                 87.0    4e-16    
ref|WP_027504516.1|  acyl-CoA oxidase                                 87.0    5e-16    
ref|WP_027391884.1|  acyl-CoA oxidase                                 87.0    5e-16    
ref|WP_028709678.1|  acyl-CoA oxidase                                 86.7    5e-16    
ref|WP_033229275.1|  acyl-CoA oxidase                                 86.7    6e-16    
ref|WP_017619701.1|  acyl-CoA oxidase                                 86.7    6e-16    
gb|EMP11646.1|  acyl-CoA dehydrogenase, middle domain protein         86.3    6e-16    
ref|WP_042330281.1|  acyl-CoA oxidase                                 86.7    6e-16    
gb|EYT65221.1|  acyl-CoA oxidase                                      86.7    6e-16    
ref|WP_026863296.1|  acyl-CoA oxidase                                 86.3    7e-16    
ref|WP_036382477.1|  acyl-CoA oxidase                                 86.7    7e-16    
ref|WP_028643473.1|  acyl-CoA oxidase                                 86.3    8e-16    
ref|WP_007023318.1|  acyl-CoA oxidase                                 85.9    9e-16    
ref|WP_026453893.1|  acyl-CoA oxidase                                 85.9    1e-15    
ref|WP_022915912.1|  acyl-CoA oxidase                                 85.9    1e-15    
ref|WP_029117994.1|  acyl-CoA oxidase                                 85.9    1e-15    
ref|WP_026912172.1|  acyl-CoA oxidase                                 85.5    1e-15    
ref|WP_019809905.1|  acyl-CoA oxidase                                 85.5    1e-15    
ref|WP_017972609.1|  acyl-CoA oxidase                                 85.5    1e-15    
ref|WP_009945757.1|  acyl-CoA oxidase                                 85.5    1e-15    
ref|WP_020664913.1|  acyl-CoA oxidase                                 85.5    1e-15    
ref|WP_039855121.1|  acyl-CoA oxidase                                 85.5    2e-15    
ref|XP_008646459.1|  PREDICTED: acyl-coenzyme A oxidase 2, peroxi...  80.9    2e-15    
ref|XP_005993608.1|  PREDICTED: acyl-coenzyme A oxidase-like prot...  83.6    2e-15    
ref|WP_029430245.1|  acyl-CoA oxidase                                 85.5    2e-15    
ref|WP_026810093.1|  acyl-CoA oxidase                                 85.5    2e-15    
dbj|GAB38637.1|  putative acyl-CoA oxidase                            85.5    2e-15    
ref|WP_043569659.1|  acyl-CoA oxidase                                 85.1    2e-15    
gb|EFL10817.1|  acyl-CoA oxidase                                      85.1    2e-15    
ref|WP_011292662.1|  acyl-CoA oxidase                                 85.1    2e-15    
ref|WP_025744009.1|  acyl-CoA oxidase                                 85.5    2e-15    
ref|WP_029720473.1|  acyl-CoA oxidase                                 84.7    2e-15    
ref|WP_026204649.1|  acyl-CoA oxidase                                 84.7    2e-15    
ref|WP_037715592.1|  acyl-CoA oxidase                                 84.7    2e-15    
ref|XP_010868037.1|  PREDICTED: acyl-coenzyme A oxidase-like protein  84.7    3e-15    
ref|WP_019814246.1|  acyl-CoA oxidase                                 84.3    3e-15    
ref|WP_036194533.1|  acyl-CoA oxidase                                 84.3    3e-15    
dbj|GAB09656.1|  putative acyl-CoA oxidase                            84.3    3e-15    
ref|WP_014738397.1|  acyl-CoA oxidase                                 84.3    3e-15    
ref|WP_014359023.1|  acyl-CoA oxidase                                 84.3    4e-15    
gb|AEI48674.1|  Acyl-CoA oxidase                                      84.3    4e-15    
ref|XP_007892130.1|  PREDICTED: acyl-coenzyme A oxidase-like protein  84.0    4e-15    
ref|WP_041342837.1|  hypothetical protein                             84.3    4e-15    
ref|WP_020172265.1|  acyl-CoA oxidase                                 84.0    4e-15    
ref|WP_017588837.1|  acyl-CoA oxidase                                 84.0    4e-15    
ref|WP_006372698.1|  acyl-CoA oxidase                                 84.0    4e-15    
ref|WP_006239330.1|  acyl-CoA oxidase                                 84.0    4e-15    
ref|XP_006156694.1|  PREDICTED: acyl-coenzyme A oxidase-like prot...  83.6    5e-15    
ref|WP_005466173.1|  acyl-CoA oxidase                                 83.6    5e-15    
ref|XP_002937489.2|  PREDICTED: acyl-coenzyme A oxidase-like protein  83.2    6e-15    
ref|XP_004686171.1|  PREDICTED: acyl-coenzyme A oxidase-like protein  83.6    6e-15    
ref|WP_041801916.1|  acyl-CoA oxidase                                 84.0    6e-15    
gb|AEM70899.1|  Acyl-CoA oxidase                                      83.6    6e-15    
gb|ERE69859.1|  acyl-coenzyme A oxidase-like protein                  81.3    6e-15    
ref|XP_005630476.1|  PREDICTED: acyl-CoA oxidase-like isoform X1      83.6    6e-15    
ref|WP_030096915.1|  acyl-CoA oxidase                                 83.6    6e-15    
ref|WP_040407217.1|  acyl-CoA oxidase                                 83.6    6e-15    
ref|WP_017565178.1|  acyl-CoA oxidase                                 83.6    7e-15    
ref|XP_007532237.1|  PREDICTED: acyl-coenzyme A oxidase-like protein  80.5    7e-15    
ref|WP_040522213.1|  acyl-CoA oxidase                                 83.2    8e-15    
ref|WP_017614281.1|  acyl-CoA oxidase                                 83.2    9e-15    
ref|WP_043077692.1|  acyl-CoA oxidase                                 83.2    9e-15    
dbj|GAM21272.1|  hypothetical protein SAMD00019534_044470             82.8    9e-15    
ref|WP_043828107.1|  acyl-CoA oxidase                                 83.2    9e-15    
ref|XP_007957610.1|  PREDICTED: LOW QUALITY PROTEIN: acyl-coenzym...  82.0    9e-15    
ref|WP_007619749.1|  putative acyl-CoA oxidase                        83.2    1e-14    
ref|WP_017204937.1|  acyl-CoA oxidase                                 82.8    1e-14    
ref|WP_035751757.1|  acyl-CoA oxidase                                 82.8    1e-14    
ref|WP_006935934.1|  MULTISPECIES: Acyl-coenzyme A oxidase 3, per...  82.8    1e-14    
ref|WP_025239597.1|  acyl-CoA oxidase                                 82.8    1e-14    
ref|WP_016891967.1|  acyl-CoA oxidase                                 82.8    1e-14    



>ref|XP_002533134.1| acyl-CoA oxidase, putative [Ricinus communis]
 gb|EEF29246.1| acyl-CoA oxidase, putative [Ricinus communis]
Length=235

 Score =   308 bits (790),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 143/176 (81%), Positives = 159/176 (90%), Gaps = 2/176 (1%)
 Frame = -3

Query  646  QPNPVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGAWNRCLNHL  467
            QPNPVT+RWEGE+HLRDP FQLDAFRYRTSRLLQSVA+RL+KHSK LG FGAWNRCLNHL
Sbjct  62   QPNPVTARWEGEEHLRDPKFQLDAFRYRTSRLLQSVAVRLRKHSKTLGSFGAWNRCLNHL  121

Query  466  LTLAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPN  287
            LTLAESHIES IL  FI+AV++CPDPSSRAALKLVCDLYAL+RIW+DIGTYRNVDYVAPN
Sbjct  122  LTLAESHIESVILAKFIEAVQNCPDPSSRAALKLVCDLYALDRIWSDIGTYRNVDYVAPN  181

Query  286  KAKAINKLTEYLCFQVRNTAKDLVDAFDLPDYVIRAPIALQDSEQVYLQYAQYAGF  119
            KAKAI+KLTEYLCFQVRN A++L+DAFDLPD+V RAPIA+  +   Y QY  Y GF
Sbjct  182  KAKAIHKLTEYLCFQVRNIARELIDAFDLPDHVTRAPIAM--NSDAYGQYTHYVGF  235



>ref|XP_009779578.1| PREDICTED: acyl-coenzyme A oxidase 2, peroxisomal [Nicotiana 
sylvestris]
Length=694

 Score =   323 bits (827),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 150/176 (85%), Positives = 161/176 (91%), Gaps = 0/176 (0%)
 Frame = -3

Query  646  QPNPVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGAWNRCLNHL  467
            QPNPVT+RWEGE HLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSK LGGFGAWNRCLNHL
Sbjct  519  QPNPVTARWEGEAHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKTLGGFGAWNRCLNHL  578

Query  466  LTLAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPN  287
            LTLAESHIESFILE FI+AVK+C D SSRAALKLVCDLYAL+RIWNDIGTYRNVDYVAPN
Sbjct  579  LTLAESHIESFILEKFIEAVKNCLDESSRAALKLVCDLYALDRIWNDIGTYRNVDYVAPN  638

Query  286  KAKAINKLTEYLCFQVRNTAKDLVDAFDLPDYVIRAPIALQDSEQVYLQYAQYAGF  119
            KAKAI+KLTEYLCFQV+N A++LVDAFDLPDYV RAPI +Q + + Y QY Q  GF
Sbjct  639  KAKAIHKLTEYLCFQVKNVARELVDAFDLPDYVTRAPIGVQAASEAYSQYTQIVGF  694



>ref|XP_009629828.1| PREDICTED: acyl-coenzyme A oxidase 2, peroxisomal [Nicotiana 
tomentosiformis]
Length=694

 Score =   323 bits (827),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 150/176 (85%), Positives = 161/176 (91%), Gaps = 0/176 (0%)
 Frame = -3

Query  646  QPNPVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGAWNRCLNHL  467
            QPNPVT+RWEGE HLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSK LGGFGAWNRCLNHL
Sbjct  519  QPNPVTARWEGEAHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKTLGGFGAWNRCLNHL  578

Query  466  LTLAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPN  287
            LTLAESHIESFILE FI+AVK+ PD +SRAALKLVCDLYALNRIWNDIGTYRNVDYVAPN
Sbjct  579  LTLAESHIESFILEKFIEAVKNYPDENSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPN  638

Query  286  KAKAINKLTEYLCFQVRNTAKDLVDAFDLPDYVIRAPIALQDSEQVYLQYAQYAGF  119
            KAKAI+KLTEYLCFQV+N A++LVDAFDLPDYV RAPI +Q + + Y QY Q  GF
Sbjct  639  KAKAIHKLTEYLCFQVKNVARELVDAFDLPDYVTRAPIGVQAASEAYSQYTQIVGF  694



>emb|CDP01433.1| unnamed protein product [Coffea canephora]
Length=707

 Score =   323 bits (827),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 150/176 (85%), Positives = 160/176 (91%), Gaps = 0/176 (0%)
 Frame = -3

Query  646  QPNPVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGAWNRCLNHL  467
            QPNPVTSRWEGEDHLRDP FQLDAFRYRTSRLLQSVA RLQKHSK LGGFGAWNRCLNHL
Sbjct  532  QPNPVTSRWEGEDHLRDPKFQLDAFRYRTSRLLQSVAARLQKHSKTLGGFGAWNRCLNHL  591

Query  466  LTLAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPN  287
            LTLAESHIES ILE FI+AV+SCPD  SR+ALKLVCDLYAL+RIWNDIGTYRNVDYVAPN
Sbjct  592  LTLAESHIESVILERFIEAVRSCPDEGSRSALKLVCDLYALDRIWNDIGTYRNVDYVAPN  651

Query  286  KAKAINKLTEYLCFQVRNTAKDLVDAFDLPDYVIRAPIALQDSEQVYLQYAQYAGF  119
            KAKAI+KLTEY+CFQVRN A++LVDAFDLPDYVIRAPI LQ   + Y QY Q+ GF
Sbjct  652  KAKAIHKLTEYVCFQVRNIARELVDAFDLPDYVIRAPIGLQTPGEAYSQYTQHVGF  707



>ref|XP_011097594.1| PREDICTED: acyl-coenzyme A oxidase 2, peroxisomal [Sesamum indicum]
Length=696

 Score =   322 bits (825),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 147/176 (84%), Positives = 162/176 (92%), Gaps = 0/176 (0%)
 Frame = -3

Query  646  QPNPVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGAWNRCLNHL  467
            QPNPVT+RWEGEDHLRDP FQLDAFRYRTSRLLQSVA+RL+KHSK LG FGAWNRCLNHL
Sbjct  521  QPNPVTARWEGEDHLRDPKFQLDAFRYRTSRLLQSVAVRLRKHSKTLGSFGAWNRCLNHL  580

Query  466  LTLAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPN  287
            LTLAESHIES IL  FI AV+SCPDPSSRAALKL+CDLYAL+RIWNDIGTYRNVDYVAPN
Sbjct  581  LTLAESHIESVILAKFIDAVRSCPDPSSRAALKLLCDLYALDRIWNDIGTYRNVDYVAPN  640

Query  286  KAKAINKLTEYLCFQVRNTAKDLVDAFDLPDYVIRAPIALQDSEQVYLQYAQYAGF  119
            KAKAI+KLTEYLCFQV+N +++LVDAFDLPDYV RAPI +Q +E+ Y QY Q+AGF
Sbjct  641  KAKAIHKLTEYLCFQVKNISRELVDAFDLPDYVTRAPIGMQAAEEAYAQYTQFAGF  696



>gb|EPS69661.1| hypothetical protein M569_05102, partial [Genlisea aurea]
Length=676

 Score =   318 bits (816),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 148/176 (84%), Positives = 158/176 (90%), Gaps = 0/176 (0%)
 Frame = -3

Query  646  QPNPVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGAWNRCLNHL  467
            QPNPVT+RWEG DHLRDPNFQLDAFRYRTSRLL SVA+RLQKHSK+LGGFGAWNRCLNHL
Sbjct  501  QPNPVTARWEGGDHLRDPNFQLDAFRYRTSRLLHSVAVRLQKHSKSLGGFGAWNRCLNHL  560

Query  466  LTLAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPN  287
            LTLAESHIES IL  FI AVKSCPD SSR ALKL+CDLYAL+RIWNDIGTYRNVDYVAPN
Sbjct  561  LTLAESHIESVILAKFIDAVKSCPDASSRTALKLLCDLYALDRIWNDIGTYRNVDYVAPN  620

Query  286  KAKAINKLTEYLCFQVRNTAKDLVDAFDLPDYVIRAPIALQDSEQVYLQYAQYAGF  119
            KAKAI+KL EYLCFQV+N AK+LVDAFDLPDYV RAPI +Q +E  Y  Y QYAGF
Sbjct  621  KAKAIHKLVEYLCFQVKNIAKELVDAFDLPDYVTRAPIGMQAAEDAYTVYTQYAGF  676



>ref|XP_006355366.1| PREDICTED: acyl-coenzyme A oxidase 2, peroxisomal-like [Solanum 
tuberosum]
Length=693

 Score =   319 bits (817),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 147/176 (84%), Positives = 160/176 (91%), Gaps = 0/176 (0%)
 Frame = -3

Query  646  QPNPVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGAWNRCLNHL  467
            QPNPVT+RWE EDHLR+PNFQLDAFRYRTSRLLQSVAIRLQKHSK LGGFGAWNRCLNHL
Sbjct  518  QPNPVTARWESEDHLRNPNFQLDAFRYRTSRLLQSVAIRLQKHSKTLGGFGAWNRCLNHL  577

Query  466  LTLAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPN  287
            LTLAESHIESFILE FI+AVK+CPD +SRAALKLVCDLYAL+RIWNDIGTYRNVDYVAPN
Sbjct  578  LTLAESHIESFILEKFIEAVKNCPDENSRAALKLVCDLYALDRIWNDIGTYRNVDYVAPN  637

Query  286  KAKAINKLTEYLCFQVRNTAKDLVDAFDLPDYVIRAPIALQDSEQVYLQYAQYAGF  119
            KAKAI+KL +YLCFQV+N A++LVDAFDLPDYV RAPI +Q   + Y QY Q  GF
Sbjct  638  KAKAIHKLADYLCFQVKNIARELVDAFDLPDYVTRAPIGVQTPSEAYTQYTQNVGF  693



>ref|XP_004237411.1| PREDICTED: acyl-coenzyme A oxidase 2, peroxisomal [Solanum lycopersicum]
Length=688

 Score =   317 bits (813),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 146/176 (83%), Positives = 160/176 (91%), Gaps = 0/176 (0%)
 Frame = -3

Query  646  QPNPVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGAWNRCLNHL  467
            QPNPVT+RWE E+HLR+PNFQLDAFRYRTSRLLQSVAIRLQKHSK LGGFGAWNRCLNHL
Sbjct  513  QPNPVTARWESEEHLRNPNFQLDAFRYRTSRLLQSVAIRLQKHSKTLGGFGAWNRCLNHL  572

Query  466  LTLAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPN  287
            LTLAESHIESFILE FI+AVK+CPD +SRAALKLVCDLYAL+RIWNDIGTYRNVDYVAPN
Sbjct  573  LTLAESHIESFILEKFIEAVKNCPDENSRAALKLVCDLYALDRIWNDIGTYRNVDYVAPN  632

Query  286  KAKAINKLTEYLCFQVRNTAKDLVDAFDLPDYVIRAPIALQDSEQVYLQYAQYAGF  119
            KAKAI+KL +YLCFQV+N A++LVDAFDLPDYV RAPI +Q   + Y QY Q  GF
Sbjct  633  KAKAIHKLADYLCFQVKNIARELVDAFDLPDYVTRAPIGVQTPSEAYTQYTQNVGF  688



>gb|AAF14635.1|AF202987_1 acyl-CoA oxidase [Petroselinum crispum]
Length=694

 Score =   315 bits (807),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 144/176 (82%), Positives = 159/176 (90%), Gaps = 0/176 (0%)
 Frame = -3

Query  646  QPNPVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGAWNRCLNHL  467
            QPNP+TSRWEGEDHLRDP FQLDAFRYRTSRLLQS A+RLQKHSKNLGGFGAWNRCLNHL
Sbjct  517  QPNPLTSRWEGEDHLRDPKFQLDAFRYRTSRLLQSAAVRLQKHSKNLGGFGAWNRCLNHL  576

Query  466  LTLAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPN  287
            LTLAESHIES ILE FI+AVK+CPD SSRAALKLVCDLYA++RIWNDIGTYRNVDY+APN
Sbjct  577  LTLAESHIESVILETFIKAVKNCPDASSRAALKLVCDLYAMDRIWNDIGTYRNVDYMAPN  636

Query  286  KAKAINKLTEYLCFQVRNTAKDLVDAFDLPDYVIRAPIALQDSEQVYLQYAQYAGF  119
            KAKAI+KLTEYL FQVRN  ++LVDAFD+PD+VIRAPI  Q   + Y +Y Q+ GF
Sbjct  637  KAKAIHKLTEYLSFQVRNITRELVDAFDMPDHVIRAPIGKQTPVEAYSEYRQHVGF  692



>ref|XP_006279585.1| hypothetical protein CARUB_v10025999mg [Capsella rubella]
 gb|EOA12483.1| hypothetical protein CARUB_v10025999mg [Capsella rubella]
Length=692

 Score =   310 bits (793),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 144/176 (82%), Positives = 157/176 (89%), Gaps = 2/176 (1%)
 Frame = -3

Query  646  QPNPVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGAWNRCLNHL  467
            QPNPVT+RWEGEDHLRDP FQLDAFRYRTSRLLQ+VA RLQKHSK LGGFGAWNRCLNHL
Sbjct  519  QPNPVTARWEGEDHLRDPKFQLDAFRYRTSRLLQNVAARLQKHSKTLGGFGAWNRCLNHL  578

Query  466  LTLAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPN  287
            LTLAESHIE+ IL  FI+AVK+CP+PS+RAALKL CDLYAL+RIW DIGTYRNVDYVAPN
Sbjct  579  LTLAESHIETVILAKFIEAVKNCPEPSARAALKLACDLYALDRIWKDIGTYRNVDYVAPN  638

Query  286  KAKAINKLTEYLCFQVRNTAKDLVDAFDLPDYVIRAPIALQDSEQVYLQYAQYAGF  119
            KAKAI+KLTEYLCFQVRN AK+LVDAF+LPD+V RAPIA+Q     Y QY Q  GF
Sbjct  639  KAKAIHKLTEYLCFQVRNVAKELVDAFELPDHVTRAPIAMQ--SDAYSQYTQVVGF  692



>ref|XP_002866650.1| acyl-CoA oxidase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH42909.1| acyl-CoA oxidase [Arabidopsis lyrata subsp. lyrata]
Length=689

 Score =   308 bits (790),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 145/176 (82%), Positives = 157/176 (89%), Gaps = 2/176 (1%)
 Frame = -3

Query  646  QPNPVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGAWNRCLNHL  467
            QPNPVT+RWEGEDHLRDP FQLDAFRYRTSRLLQ+VA RLQKHSK LGGFGAWNRCLNHL
Sbjct  516  QPNPVTARWEGEDHLRDPKFQLDAFRYRTSRLLQNVAARLQKHSKTLGGFGAWNRCLNHL  575

Query  466  LTLAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPN  287
            LTLAESHIE+ IL  FI+AVK+CPDPS+RAALKLVCDLYAL+RIW DIGTYRNVDYVAPN
Sbjct  576  LTLAESHIETVILAKFIEAVKNCPDPSARAALKLVCDLYALDRIWKDIGTYRNVDYVAPN  635

Query  286  KAKAINKLTEYLCFQVRNTAKDLVDAFDLPDYVIRAPIALQDSEQVYLQYAQYAGF  119
            KAKAI+KLTEYL FQVRN AK+LVDAF+LPD+V RAPIA+Q     Y QY Q  GF
Sbjct  636  KAKAIHKLTEYLSFQVRNVAKELVDAFELPDHVTRAPIAMQ--SDAYSQYTQVVGF  689



>ref|XP_010444485.1| PREDICTED: acyl-coenzyme A oxidase 2, peroxisomal-like [Camelina 
sativa]
Length=696

 Score =   308 bits (790),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 145/176 (82%), Positives = 156/176 (89%), Gaps = 2/176 (1%)
 Frame = -3

Query  646  QPNPVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGAWNRCLNHL  467
            QPNPVT+RWEGEDHLRDP FQLDAFRYRTSRLLQ+VA RLQKHSK LGGFGAWNRCLNHL
Sbjct  523  QPNPVTARWEGEDHLRDPKFQLDAFRYRTSRLLQNVAARLQKHSKTLGGFGAWNRCLNHL  582

Query  466  LTLAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPN  287
            LTLAESHIES IL  FI+AVK+CPDPS+RAALKL CDLYAL+RIW DIGTYRNVDYVAPN
Sbjct  583  LTLAESHIESVILAKFIEAVKNCPDPSARAALKLACDLYALDRIWKDIGTYRNVDYVAPN  642

Query  286  KAKAINKLTEYLCFQVRNTAKDLVDAFDLPDYVIRAPIALQDSEQVYLQYAQYAGF  119
            KAKAI+KLTEYL FQVRN AK+LVDAF+LPD+V RAPIA+Q     Y QY Q  GF
Sbjct  643  KAKAIHKLTEYLSFQVRNVAKELVDAFELPDHVTRAPIAMQ--SDAYSQYTQVVGF  696



>ref|XP_010462257.1| PREDICTED: acyl-coenzyme A oxidase 2, peroxisomal-like isoform 
X1 [Camelina sativa]
 ref|XP_010462266.1| PREDICTED: acyl-coenzyme A oxidase 2, peroxisomal-like isoform 
X2 [Camelina sativa]
Length=693

 Score =   308 bits (790),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 145/176 (82%), Positives = 156/176 (89%), Gaps = 2/176 (1%)
 Frame = -3

Query  646  QPNPVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGAWNRCLNHL  467
            QPNPVT+RWEGEDHLRDP FQLDAFRYRTSRLLQ+VA RLQKHSK LGGFGAWNRCLNHL
Sbjct  520  QPNPVTARWEGEDHLRDPKFQLDAFRYRTSRLLQNVAARLQKHSKTLGGFGAWNRCLNHL  579

Query  466  LTLAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPN  287
            LTLAESHIES IL  FI+AVK+CPDPS+RAALKL CDLYAL+RIW DIGTYRNVDYVAPN
Sbjct  580  LTLAESHIESVILAKFIEAVKNCPDPSARAALKLACDLYALDRIWKDIGTYRNVDYVAPN  639

Query  286  KAKAINKLTEYLCFQVRNTAKDLVDAFDLPDYVIRAPIALQDSEQVYLQYAQYAGF  119
            KAKAI+KLTEYL FQVRN AK+LVDAF+LPD+V RAPIA+Q     Y QY Q  GF
Sbjct  640  KAKAIHKLTEYLSFQVRNVAKELVDAFELPDHVTRAPIAMQ--SDAYSQYTQVVGF  693



>ref|XP_008361491.1| PREDICTED: acyl-coenzyme A oxidase 2, peroxisomal-like [Malus 
domestica]
Length=532

 Score =   303 bits (777),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 142/176 (81%), Positives = 152/176 (86%), Gaps = 2/176 (1%)
 Frame = -3

Query  646  QPNPVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGAWNRCLNHL  467
            QPNPVT+RWE EDHLRDP FQLDAFRYRTSRLLQSVA+RL+KHSK LG FGAWNRCLNHL
Sbjct  359  QPNPVTARWESEDHLRDPKFQLDAFRYRTSRLLQSVAVRLRKHSKTLGSFGAWNRCLNHL  418

Query  466  LTLAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPN  287
            LTLAESHIES IL  F++AV+ CPDPSSRAALKLVCDLYAL RIW DIGTYRNVDYVAPN
Sbjct  419  LTLAESHIESVILAKFVEAVQKCPDPSSRAALKLVCDLYALERIWKDIGTYRNVDYVAPN  478

Query  286  KAKAINKLTEYLCFQVRNTAKDLVDAFDLPDYVIRAPIALQDSEQVYLQYAQYAGF  119
            KAKAI+KL EYL FQVRN AK+LVDAFD+PDYV RAPIA+Q     Y  Y  Y GF
Sbjct  479  KAKAIHKLMEYLSFQVRNIAKELVDAFDIPDYVTRAPIAMQ--SXAYSHYTHYVGF  532



>ref|XP_004504056.1| PREDICTED: acyl-coenzyme A oxidase 2, peroxisomal-like [Cicer 
arietinum]
Length=690

 Score =   308 bits (788),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 146/176 (83%), Positives = 158/176 (90%), Gaps = 2/176 (1%)
 Frame = -3

Query  646  QPNPVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGAWNRCLNHL  467
            QPNPVT+RWEGEDHLRD  FQLDAFRYRTSRLLQSVA+RL+KHSK+LG FGAWNRCLNHL
Sbjct  516  QPNPVTARWEGEDHLRDSKFQLDAFRYRTSRLLQSVAVRLRKHSKSLGDFGAWNRCLNHL  575

Query  466  LTLAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPN  287
            LTLAESHIES +L  FI+AV+SCPDPSS+AALKLVCDLYAL+RIWNDIGTYRNVDYVAPN
Sbjct  576  LTLAESHIESVVLAKFIEAVQSCPDPSSQAALKLVCDLYALDRIWNDIGTYRNVDYVAPN  635

Query  286  KAKAINKLTEYLCFQVRNTAKDLVDAFDLPDYVIRAPIALQDSEQVYLQYAQYAGF  119
            KAKAI+KLTEYL FQVRN AK+LVDAFDLPD+V RAPIA Q     Y QY QY GF
Sbjct  636  KAKAIHKLTEYLSFQVRNIAKELVDAFDLPDHVTRAPIAKQSG--AYSQYTQYVGF  689



>gb|KDP46864.1| hypothetical protein JCGZ_24073 [Jatropha curcas]
Length=689

 Score =   307 bits (787),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 144/176 (82%), Positives = 158/176 (90%), Gaps = 2/176 (1%)
 Frame = -3

Query  646  QPNPVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGAWNRCLNHL  467
            QPNPVT+RWEGEDHLRDP FQLDAFRYRTSRLLQSVA+RL+KHSK+LG FGAWNRCLNHL
Sbjct  516  QPNPVTARWEGEDHLRDPKFQLDAFRYRTSRLLQSVAVRLRKHSKSLGSFGAWNRCLNHL  575

Query  466  LTLAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPN  287
            LTLAESH+ES IL  FI+AV++CPD SSRAALKLVCDLYAL+RIWNDIGTYRNVDYVAPN
Sbjct  576  LTLAESHVESVILAKFIEAVQNCPDASSRAALKLVCDLYALDRIWNDIGTYRNVDYVAPN  635

Query  286  KAKAINKLTEYLCFQVRNTAKDLVDAFDLPDYVIRAPIALQDSEQVYLQYAQYAGF  119
            KAKAI+KLTEYL FQVRN A++LVDAFD PD+V RAPIA+Q     Y QY QY GF
Sbjct  636  KAKAIHKLTEYLSFQVRNIARELVDAFDFPDHVTRAPIAMQ--SDAYAQYTQYVGF  689



>ref|XP_010484314.1| PREDICTED: acyl-coenzyme A oxidase 2, peroxisomal [Camelina sativa]
Length=694

 Score =   307 bits (787),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 145/176 (82%), Positives = 156/176 (89%), Gaps = 2/176 (1%)
 Frame = -3

Query  646  QPNPVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGAWNRCLNHL  467
            QPNPVT+RWEGEDHLRDP FQLDAFRYRTSRLLQ+VA RLQKHSK LGGFGAWNRCLNHL
Sbjct  521  QPNPVTARWEGEDHLRDPKFQLDAFRYRTSRLLQNVAARLQKHSKTLGGFGAWNRCLNHL  580

Query  466  LTLAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPN  287
            LTLAESHIES IL  FI+AVK+CPDPS+RAALKL CDLYAL+RIW DIGTYRNVDYVAPN
Sbjct  581  LTLAESHIESVILAKFIEAVKNCPDPSARAALKLACDLYALDRIWKDIGTYRNVDYVAPN  640

Query  286  KAKAINKLTEYLCFQVRNTAKDLVDAFDLPDYVIRAPIALQDSEQVYLQYAQYAGF  119
            KAKAI+KLTEYL FQVRN AK+LVDAF+LPD+V RAPIA+Q     Y QY Q  GF
Sbjct  641  KAKAIHKLTEYLSFQVRNVAKELVDAFELPDHVTRAPIAMQ--SDAYSQYTQVVGF  694



>ref|XP_003525063.1| PREDICTED: acyl-coenzyme A oxidase 2, peroxisomal-like [Glycine 
max]
Length=676

 Score =   306 bits (785),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 145/176 (82%), Positives = 158/176 (90%), Gaps = 2/176 (1%)
 Frame = -3

Query  646  QPNPVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGAWNRCLNHL  467
            QPNPVT+RWEGEDHLRDP FQLDAFRYRTSRLLQSVA+RL+KHSK+LG FGAWNRCLNHL
Sbjct  503  QPNPVTARWEGEDHLRDPKFQLDAFRYRTSRLLQSVAVRLRKHSKSLGDFGAWNRCLNHL  562

Query  466  LTLAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPN  287
            LTLAESHIES IL  FI+AV+SCPDPSS+AALKLVCDLYAL+RIWNDIGTYRNVDYVAPN
Sbjct  563  LTLAESHIESVILAKFIEAVQSCPDPSSQAALKLVCDLYALDRIWNDIGTYRNVDYVAPN  622

Query  286  KAKAINKLTEYLCFQVRNTAKDLVDAFDLPDYVIRAPIALQDSEQVYLQYAQYAGF  119
            KAKAI+KL EYL FQVRN A++LVDAFDLPD+V RAPIA +     Y QY QY GF
Sbjct  623  KAKAIHKLAEYLSFQVRNIARELVDAFDLPDHVTRAPIAKRSG--AYSQYTQYVGF  676



>gb|KHN38187.1| Acyl-coenzyme A oxidase 2, peroxisomal [Glycine soja]
Length=676

 Score =   306 bits (785),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 145/176 (82%), Positives = 158/176 (90%), Gaps = 2/176 (1%)
 Frame = -3

Query  646  QPNPVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGAWNRCLNHL  467
            QPNPVT+RWEGEDHLRDP FQLDAFRYRTSRLLQSVA+RL+KHSK+LG FGAWNRCLNHL
Sbjct  503  QPNPVTARWEGEDHLRDPKFQLDAFRYRTSRLLQSVAVRLRKHSKSLGDFGAWNRCLNHL  562

Query  466  LTLAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPN  287
            LTLAESHIES IL  FI+AV+SCPDPSS+AALKLVCDLYAL+RIWNDIGTYRNVDYVAPN
Sbjct  563  LTLAESHIESVILAKFIEAVQSCPDPSSQAALKLVCDLYALDRIWNDIGTYRNVDYVAPN  622

Query  286  KAKAINKLTEYLCFQVRNTAKDLVDAFDLPDYVIRAPIALQDSEQVYLQYAQYAGF  119
            KAKAI+KL EYL FQVRN A++LVDAFDLPD+V RAPIA +     Y QY QY GF
Sbjct  623  KAKAIHKLAEYLSFQVRNIARELVDAFDLPDHVTRAPIAKRSG--AYSQYTQYVGF  676



>ref|XP_011022766.1| PREDICTED: acyl-coenzyme A oxidase 2, peroxisomal-like [Populus 
euphratica]
Length=689

 Score =   306 bits (785),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 143/176 (81%), Positives = 157/176 (89%), Gaps = 2/176 (1%)
 Frame = -3

Query  646  QPNPVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGAWNRCLNHL  467
            QPNPVTSRWEG +HL+DP FQLDAFRYRTSRLLQS A+RL+KHSK LGGFGAWNRCLNHL
Sbjct  516  QPNPVTSRWEGAEHLQDPKFQLDAFRYRTSRLLQSAAVRLRKHSKTLGGFGAWNRCLNHL  575

Query  466  LTLAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPN  287
            LTLAESHIES IL  FI+AV+ CPDP+S+AALKLVCDLYALNRIWNDIGTYRNVDYVAPN
Sbjct  576  LTLAESHIESVILAKFIEAVEKCPDPNSQAALKLVCDLYALNRIWNDIGTYRNVDYVAPN  635

Query  286  KAKAINKLTEYLCFQVRNTAKDLVDAFDLPDYVIRAPIALQDSEQVYLQYAQYAGF  119
            KAKAI+KLT+YL FQVRN AK+LVD FDLPD+V RAPIA+Q   + Y QY QY GF
Sbjct  636  KAKAIHKLTDYLSFQVRNIAKELVDGFDLPDHVTRAPIAMQS--EAYAQYKQYVGF  689



>gb|EYU24007.1| hypothetical protein MIMGU_mgv1a002222mg [Erythranthe guttata]
Length=699

 Score =   306 bits (785),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 139/176 (79%), Positives = 157/176 (89%), Gaps = 0/176 (0%)
 Frame = -3

Query  646  QPNPVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGAWNRCLNHL  467
            QPNPVT+RWEGEDHLRDP FQLDAFRYRTSRLLQSVA+RL+KH+KNLG FGAWNRCLNHL
Sbjct  524  QPNPVTARWEGEDHLRDPKFQLDAFRYRTSRLLQSVAVRLRKHTKNLGSFGAWNRCLNHL  583

Query  466  LTLAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPN  287
            LTLAESHIE+ IL  FI +V+SCPD  SR ALKL+CDLYAL+RIWNDIGTYRNVDYVAPN
Sbjct  584  LTLAESHIETVILAKFIDSVRSCPDSGSRDALKLLCDLYALDRIWNDIGTYRNVDYVAPN  643

Query  286  KAKAINKLTEYLCFQVRNTAKDLVDAFDLPDYVIRAPIALQDSEQVYLQYAQYAGF  119
            KAKAI+KLTE L FQV+N +K+LVDAFD+PDYV RAPI +Q +E+ Y  Y Q+AGF
Sbjct  644  KAKAIHKLTELLSFQVKNVSKELVDAFDIPDYVTRAPIGMQATEEAYSHYTQFAGF  699



>gb|ADD09618.1| acyl-coA oxidase [Trifolium repens]
Length=627

 Score =   304 bits (779),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 145/176 (82%), Positives = 156/176 (89%), Gaps = 2/176 (1%)
 Frame = -3

Query  646  QPNPVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGAWNRCLNHL  467
            QPNPVT+RWEG DHLRDP FQLDAFRYRTSRLL SVA+RLQKHSK LG FGAWNRCLNHL
Sbjct  453  QPNPVTARWEGGDHLRDPKFQLDAFRYRTSRLLHSVAVRLQKHSKPLGQFGAWNRCLNHL  512

Query  466  LTLAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPN  287
            LTLAESHIES IL  FI+AV+SCPDPS++AALKLVCDLYAL+RIWNDIGTYRNVDYVAPN
Sbjct  513  LTLAESHIESVILAKFIEAVQSCPDPSAQAALKLVCDLYALDRIWNDIGTYRNVDYVAPN  572

Query  286  KAKAINKLTEYLCFQVRNTAKDLVDAFDLPDYVIRAPIALQDSEQVYLQYAQYAGF  119
            KAKAI+KL+EYL FQVRN AK+LVDAFDLPD+V RAPIA Q     Y QY QY GF
Sbjct  573  KAKAIHKLSEYLSFQVRNIAKELVDAFDLPDHVTRAPIAKQSG--AYSQYTQYVGF  626



>gb|AAC13497.1| acyl-CoA oxidase [Arabidopsis thaliana]
Length=692

 Score =   306 bits (783),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 143/176 (81%), Positives = 156/176 (89%), Gaps = 2/176 (1%)
 Frame = -3

Query  646  QPNPVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGAWNRCLNHL  467
            QPNPVT+RWEGEDHLRDP FQLDAFRYRTSRLLQ+VA RLQKHSK LGGFGAWNRCLNHL
Sbjct  519  QPNPVTARWEGEDHLRDPKFQLDAFRYRTSRLLQNVAARLQKHSKTLGGFGAWNRCLNHL  578

Query  466  LTLAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPN  287
            LTLAESHIE+ IL  FI+AVK+CPDPS++AALKL CDLYAL+RIW DIGTYRNVDYVAPN
Sbjct  579  LTLAESHIETVILAKFIEAVKNCPDPSAKAALKLACDLYALDRIWKDIGTYRNVDYVAPN  638

Query  286  KAKAINKLTEYLCFQVRNTAKDLVDAFDLPDYVIRAPIALQDSEQVYLQYAQYAGF  119
            KAKAI+KLTEYL FQVRN AK+LVDAF+LPD+V RAPIA+Q     Y QY Q  GF
Sbjct  639  KAKAIHKLTEYLSFQVRNVAKELVDAFELPDHVTRAPIAMQ--SDAYSQYTQVVGF  692



>ref|NP_201316.1| acyl-coenzyme A oxidase 2 [Arabidopsis thaliana]
 sp|O65201.2|ACOX2_ARATH RecName: Full=Acyl-coenzyme A oxidase 2, peroxisomal; Short=AOX 
2; AltName: Full=Long-chain acyl-CoA oxidase; Short=AtCX2; 
Flags: Precursor [Arabidopsis thaliana]
 dbj|BAB11647.1| acyl-CoA oxidase [Arabidopsis thaliana]
 gb|AED98003.1| acyl-coenzyme A oxidase 2 [Arabidopsis thaliana]
Length=692

 Score =   306 bits (783),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 143/176 (81%), Positives = 156/176 (89%), Gaps = 2/176 (1%)
 Frame = -3

Query  646  QPNPVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGAWNRCLNHL  467
            QPNPVT+RWEGEDHLRDP FQLDAFRYRTSRLLQ+VA RLQKHSK LGGFGAWNRCLNHL
Sbjct  519  QPNPVTARWEGEDHLRDPKFQLDAFRYRTSRLLQNVAARLQKHSKTLGGFGAWNRCLNHL  578

Query  466  LTLAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPN  287
            LTLAESHIE+ IL  FI+AVK+CPDPS++AALKL CDLYAL+RIW DIGTYRNVDYVAPN
Sbjct  579  LTLAESHIETVILAKFIEAVKNCPDPSAKAALKLACDLYALDRIWKDIGTYRNVDYVAPN  638

Query  286  KAKAINKLTEYLCFQVRNTAKDLVDAFDLPDYVIRAPIALQDSEQVYLQYAQYAGF  119
            KAKAI+KLTEYL FQVRN AK+LVDAF+LPD+V RAPIA+Q     Y QY Q  GF
Sbjct  639  KAKAIHKLTEYLSFQVRNVAKELVDAFELPDHVTRAPIAMQ--SDAYSQYTQVVGF  692



>ref|XP_007159635.1| hypothetical protein PHAVU_002G254200g [Phaseolus vulgaris]
 gb|ESW31629.1| hypothetical protein PHAVU_002G254200g [Phaseolus vulgaris]
Length=687

 Score =   305 bits (782),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 145/176 (82%), Positives = 157/176 (89%), Gaps = 2/176 (1%)
 Frame = -3

Query  646  QPNPVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGAWNRCLNHL  467
            QPNPVTSRWEG DHLRDP FQLDAFRYRTSRLLQSVA+RL+KHSK+LG FGAWNRCLNHL
Sbjct  514  QPNPVTSRWEGGDHLRDPKFQLDAFRYRTSRLLQSVAVRLRKHSKSLGEFGAWNRCLNHL  573

Query  466  LTLAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPN  287
            LTLAESHIES IL  FI+AV+SCPDPSS+AALKLVCDLYAL+RIWNDIGTYRNVDYVAPN
Sbjct  574  LTLAESHIESVILAKFIEAVQSCPDPSSQAALKLVCDLYALDRIWNDIGTYRNVDYVAPN  633

Query  286  KAKAINKLTEYLCFQVRNTAKDLVDAFDLPDYVIRAPIALQDSEQVYLQYAQYAGF  119
            KAKAI+KL EYL FQVRN A++LVDAFDLPD+V RAPIA +     Y QY QY GF
Sbjct  634  KAKAIHKLAEYLSFQVRNVARELVDAFDLPDHVTRAPIAKRSG--AYSQYTQYVGF  687



>gb|KDO56615.1| hypothetical protein CISIN_1g048624mg [Citrus sinensis]
Length=673

 Score =   305 bits (780),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 145/176 (82%), Positives = 155/176 (88%), Gaps = 2/176 (1%)
 Frame = -3

Query  646  QPNPVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGAWNRCLNHL  467
            QPNPVT+RWEGE+HLRDP FQLDAFRYRTSRLLQSVA+RL+KHSK LG FGAWNRCLNHL
Sbjct  500  QPNPVTARWEGEEHLRDPKFQLDAFRYRTSRLLQSVAVRLRKHSKTLGSFGAWNRCLNHL  559

Query  466  LTLAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPN  287
            LTLAESHIES IL  FI+AV++CPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPN
Sbjct  560  LTLAESHIESVILAKFIEAVQNCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPN  619

Query  286  KAKAINKLTEYLCFQVRNTAKDLVDAFDLPDYVIRAPIALQDSEQVYLQYAQYAGF  119
            KAKAI+KLTEYL FQVRN A +L+DAFDLPDYV RAPIA Q     Y  Y Q  GF
Sbjct  620  KAKAIHKLTEYLSFQVRNIAGELIDAFDLPDYVTRAPIARQSDAYAY--YTQIVGF  673



>ref|XP_006428162.1| hypothetical protein CICLE_v10025052mg [Citrus clementina]
 ref|XP_006464214.1| PREDICTED: acyl-coenzyme A oxidase 2, peroxisomal-like [Citrus 
sinensis]
 gb|ESR41402.1| hypothetical protein CICLE_v10025052mg [Citrus clementina]
Length=688

 Score =   305 bits (781),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 145/176 (82%), Positives = 155/176 (88%), Gaps = 2/176 (1%)
 Frame = -3

Query  646  QPNPVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGAWNRCLNHL  467
            QPNPVT+RWEGE+HLRDP FQLDAFRYRTSRLLQSVA+RL+KHSK LG FGAWNRCLNHL
Sbjct  515  QPNPVTARWEGEEHLRDPKFQLDAFRYRTSRLLQSVAVRLRKHSKTLGSFGAWNRCLNHL  574

Query  466  LTLAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPN  287
            LTLAESHIES IL  FI+AV++CPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPN
Sbjct  575  LTLAESHIESVILAKFIEAVQNCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPN  634

Query  286  KAKAINKLTEYLCFQVRNTAKDLVDAFDLPDYVIRAPIALQDSEQVYLQYAQYAGF  119
            KAKAI+KLTEYL FQVRN A +L+DAFDLPDYV RAPIA Q     Y  Y Q  GF
Sbjct  635  KAKAIHKLTEYLSFQVRNIAGELIDAFDLPDYVTRAPIARQSDAYAY--YTQIVGF  688



>emb|CDX81267.1| BnaC09g06780D [Brassica napus]
Length=680

 Score =   305 bits (780),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 142/176 (81%), Positives = 155/176 (88%), Gaps = 2/176 (1%)
 Frame = -3

Query  646  QPNPVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGAWNRCLNHL  467
            QPNPVT+RWEGEDHLRDP FQLDAFRYRTSRLLQSVA+RL+KHSK LG FGAWNRCLNHL
Sbjct  507  QPNPVTARWEGEDHLRDPKFQLDAFRYRTSRLLQSVAMRLKKHSKTLGTFGAWNRCLNHL  566

Query  466  LTLAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPN  287
            LTLAESHIE+ IL  FI+AV+ CPDPS+RA LKLVCDLYAL+RIWNDIGTYRNVDYVAPN
Sbjct  567  LTLAESHIETVILAKFIEAVRKCPDPSARAGLKLVCDLYALDRIWNDIGTYRNVDYVAPN  626

Query  286  KAKAINKLTEYLCFQVRNTAKDLVDAFDLPDYVIRAPIALQDSEQVYLQYAQYAGF  119
            KAKAI+KL EYL FQVRN AK+LVDAF+LPD+V RAPIA+Q     Y QY Q  GF
Sbjct  627  KAKAIHKLAEYLSFQVRNVAKELVDAFELPDHVTRAPIAMQ--ADAYAQYTQVVGF  680



>ref|XP_010269210.1| PREDICTED: acyl-coenzyme A oxidase 2, peroxisomal [Nelumbo nucifera]
Length=688

 Score =   305 bits (781),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 141/176 (80%), Positives = 157/176 (89%), Gaps = 2/176 (1%)
 Frame = -3

Query  646  QPNPVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGAWNRCLNHL  467
            QPNPVT+RWEGEDHLRDPNFQLDAFRYRTSRLLQSVA+RL+KHSK LGGFGAWNRCLNHL
Sbjct  515  QPNPVTARWEGEDHLRDPNFQLDAFRYRTSRLLQSVAVRLRKHSKTLGGFGAWNRCLNHL  574

Query  466  LTLAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPN  287
            LT+AESHIES IL  FI+AV+ CPD ++RAALKL+CDLYALNRIWNDIGTYRNVDYVAPN
Sbjct  575  LTVAESHIESVILAKFIEAVQKCPDDNTRAALKLICDLYALNRIWNDIGTYRNVDYVAPN  634

Query  286  KAKAINKLTEYLCFQVRNTAKDLVDAFDLPDYVIRAPIALQDSEQVYLQYAQYAGF  119
            KAKAI+KLTEYL FQVRN A++ V AFDLPD+V+RAPI L+   + Y  Y QY GF
Sbjct  635  KAKAIHKLTEYLSFQVRNIAREFVVAFDLPDHVLRAPIGLE--SEAYTHYTQYVGF  688



>ref|XP_009112168.1| PREDICTED: acyl-coenzyme A oxidase 2, peroxisomal-like [Brassica 
rapa]
 emb|CDY18687.1| BnaA09g07080D [Brassica napus]
Length=680

 Score =   304 bits (779),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 142/176 (81%), Positives = 155/176 (88%), Gaps = 2/176 (1%)
 Frame = -3

Query  646  QPNPVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGAWNRCLNHL  467
            QPNPVT+RWEGEDHLRDP FQLDAFRYRTSRLLQSVA+RL+KHSK LG FGAWNRCLNHL
Sbjct  507  QPNPVTARWEGEDHLRDPKFQLDAFRYRTSRLLQSVAMRLKKHSKTLGTFGAWNRCLNHL  566

Query  466  LTLAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPN  287
            LTLAESHIE+ IL  FI+AV+ CPDPS+RA LKLVCDLYAL+RIWNDIGTYRNVDYVAPN
Sbjct  567  LTLAESHIETVILAKFIEAVRKCPDPSARAGLKLVCDLYALDRIWNDIGTYRNVDYVAPN  626

Query  286  KAKAINKLTEYLCFQVRNTAKDLVDAFDLPDYVIRAPIALQDSEQVYLQYAQYAGF  119
            KAKAI+KL EYL FQVRN AK+LVDAF+LPD+V RAPIA+Q     Y QY Q  GF
Sbjct  627  KAKAIHKLAEYLSFQVRNVAKELVDAFELPDHVTRAPIAMQ--ADAYSQYTQVVGF  680



>ref|XP_008338612.1| PREDICTED: acyl-coenzyme A oxidase 2, peroxisomal-like isoform 
X1 [Malus domestica]
Length=690

 Score =   304 bits (778),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 142/176 (81%), Positives = 152/176 (86%), Gaps = 2/176 (1%)
 Frame = -3

Query  646  QPNPVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGAWNRCLNHL  467
            QPNPVT+RWE EDHLRDP FQLDAFRYRTSRLLQSVA+RL+KHSK LG FGAWNRCLNHL
Sbjct  517  QPNPVTARWESEDHLRDPKFQLDAFRYRTSRLLQSVAVRLRKHSKTLGSFGAWNRCLNHL  576

Query  466  LTLAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPN  287
            LTLAESHIES IL  F++AV+ CPDPSSRAALKLVCDLYAL RIW DIGTYRNVDYVAPN
Sbjct  577  LTLAESHIESVILAKFVEAVQKCPDPSSRAALKLVCDLYALERIWKDIGTYRNVDYVAPN  636

Query  286  KAKAINKLTEYLCFQVRNTAKDLVDAFDLPDYVIRAPIALQDSEQVYLQYAQYAGF  119
            KAKAI+KL EYL FQVRN AK+LVDAFD+PDYV RAPIA+Q     Y  Y  Y GF
Sbjct  637  KAKAIHKLMEYLSFQVRNIAKELVDAFDIPDYVTRAPIAMQ--SXAYSHYTHYVGF  690



>ref|XP_010090540.1| Acyl-coenzyme A oxidase [Morus notabilis]
 gb|EXB39746.1| Acyl-coenzyme A oxidase [Morus notabilis]
Length=715

 Score =   304 bits (779),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 144/176 (82%), Positives = 155/176 (88%), Gaps = 2/176 (1%)
 Frame = -3

Query  646  QPNPVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGAWNRCLNHL  467
            QPNPVT+RWE EDHLRDP FQLDAFRYRTSRLLQSVA+RL+KHSKNLG FGAWNRCLNHL
Sbjct  542  QPNPVTARWESEDHLRDPKFQLDAFRYRTSRLLQSVAVRLRKHSKNLGSFGAWNRCLNHL  601

Query  466  LTLAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPN  287
            LTLAESHIES IL  FI AV+SCPD SSRAALKLVCDLYAL+RIW DIGTYRNVDYVAPN
Sbjct  602  LTLAESHIESVILAKFIDAVQSCPDTSSRAALKLVCDLYALDRIWKDIGTYRNVDYVAPN  661

Query  286  KAKAINKLTEYLCFQVRNTAKDLVDAFDLPDYVIRAPIALQDSEQVYLQYAQYAGF  119
            KAKAI+KLTEYL FQVRN A +LVDAFDLPD V RAPIA++   + Y QY Q+ GF
Sbjct  662  KAKAIHKLTEYLSFQVRNIATELVDAFDLPDQVTRAPIAMK--SEAYAQYTQFVGF  715



>ref|XP_010680574.1| PREDICTED: acyl-coenzyme A oxidase 2, peroxisomal [Beta vulgaris 
subsp. vulgaris]
Length=690

 Score =   303 bits (777),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 143/176 (81%), Positives = 155/176 (88%), Gaps = 2/176 (1%)
 Frame = -3

Query  646  QPNPVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGAWNRCLNHL  467
            QPNPVT+RWEGE+HLRDP FQLDAFRYRTSRLL SVA+RL KHSK LG FGAWNRCLNHL
Sbjct  517  QPNPVTARWEGEEHLRDPQFQLDAFRYRTSRLLHSVAMRLNKHSKTLGSFGAWNRCLNHL  576

Query  466  LTLAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPN  287
            LTLAESHIES IL  FI+AVKSCPD SSRAALKLVCDLYAL  IWNDIGTYRNVDYVAPN
Sbjct  577  LTLAESHIESVILAKFIEAVKSCPDESSRAALKLVCDLYALEHIWNDIGTYRNVDYVAPN  636

Query  286  KAKAINKLTEYLCFQVRNTAKDLVDAFDLPDYVIRAPIALQDSEQVYLQYAQYAGF  119
            KAKAI+KL +YL FQV+N AK+LVDAFDLPD V RAPIA+Q  ++ YLQY Q+ GF
Sbjct  637  KAKAIHKLVDYLSFQVKNIAKELVDAFDLPDGVTRAPIAMQ--KEAYLQYTQHVGF  690



>ref|XP_002306317.2| acyl CoA oxidase family protein [Populus trichocarpa]
 gb|EEE93313.2| acyl CoA oxidase family protein [Populus trichocarpa]
Length=691

 Score =   303 bits (776),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 141/176 (80%), Positives = 156/176 (89%), Gaps = 2/176 (1%)
 Frame = -3

Query  646  QPNPVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGAWNRCLNHL  467
            QPNPVT+RWEG +HLRDP FQLDAFRYRTSRLLQS A+RL+KHSK LGGFGAWNRCLNHL
Sbjct  518  QPNPVTARWEGTEHLRDPKFQLDAFRYRTSRLLQSAAVRLRKHSKTLGGFGAWNRCLNHL  577

Query  466  LTLAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPN  287
            LTLAESHIES IL  FI+ V+ CPD S+RAALKLVCDLYALN+IWNDIGTYRNVDYVAPN
Sbjct  578  LTLAESHIESVILAKFIETVEKCPDASTRAALKLVCDLYALNQIWNDIGTYRNVDYVAPN  637

Query  286  KAKAINKLTEYLCFQVRNTAKDLVDAFDLPDYVIRAPIALQDSEQVYLQYAQYAGF  119
            KAKAI+KLT+YL FQVRN AK+LVDAFDLP++V RAPIA+Q   + Y QY QY GF
Sbjct  638  KAKAIHKLTDYLSFQVRNIAKELVDAFDLPNHVTRAPIAMQS--EAYAQYTQYVGF  691



>ref|XP_011030976.1| PREDICTED: acyl-coenzyme A oxidase 2, peroxisomal-like [Populus 
euphratica]
Length=691

 Score =   302 bits (774),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 140/176 (80%), Positives = 156/176 (89%), Gaps = 2/176 (1%)
 Frame = -3

Query  646  QPNPVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGAWNRCLNHL  467
            QPNPVT+RWEG +HLRDP FQLDAFRYRTSRLLQS A+RL+KHSK LGGFGAWNRCLNHL
Sbjct  518  QPNPVTARWEGTEHLRDPKFQLDAFRYRTSRLLQSAAVRLRKHSKTLGGFGAWNRCLNHL  577

Query  466  LTLAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPN  287
            LTL+ESHIES IL  FI+ V+ CPD S+RAALKLVCDLYALN+IWNDIGTYRNVDYVAPN
Sbjct  578  LTLSESHIESVILAKFIETVEKCPDASTRAALKLVCDLYALNQIWNDIGTYRNVDYVAPN  637

Query  286  KAKAINKLTEYLCFQVRNTAKDLVDAFDLPDYVIRAPIALQDSEQVYLQYAQYAGF  119
            KAKAI+KLT+YL FQVRN AK+LVDAFDLP++V RAPIA+Q   + Y QY QY GF
Sbjct  638  KAKAIHKLTDYLSFQVRNIAKELVDAFDLPNHVTRAPIAMQS--EAYAQYTQYVGF  691



>ref|XP_002309985.1| acyl CoA oxidase family protein [Populus trichocarpa]
 gb|EEE90435.1| acyl CoA oxidase family protein [Populus trichocarpa]
Length=689

 Score =   301 bits (772),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 141/176 (80%), Positives = 156/176 (89%), Gaps = 2/176 (1%)
 Frame = -3

Query  646  QPNPVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGAWNRCLNHL  467
            QPNPVTSRWEG +HL+DP FQLDAFRYRTSRLLQS A+RL+KHSK LGGFGAWNRCLNHL
Sbjct  516  QPNPVTSRWEGAEHLQDPKFQLDAFRYRTSRLLQSAAVRLRKHSKTLGGFGAWNRCLNHL  575

Query  466  LTLAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPN  287
            LTLAESHIES IL  FI+AV+ CPD SS+AALKLVCDLYALNRIWNDIGTYRNVDYVAPN
Sbjct  576  LTLAESHIESVILAKFIEAVEKCPDASSQAALKLVCDLYALNRIWNDIGTYRNVDYVAPN  635

Query  286  KAKAINKLTEYLCFQVRNTAKDLVDAFDLPDYVIRAPIALQDSEQVYLQYAQYAGF  119
            KAKAI+KLT+YL FQVRN AK+LVDAFDLPD+V RAPIA+Q   + Y +Y  + GF
Sbjct  636  KAKAIHKLTDYLSFQVRNIAKELVDAFDLPDHVTRAPIAMQS--EAYARYTHHVGF  689



>gb|ABA94670.2| Acyl-coenzyme A oxidase 2, peroxisomal precursor, putative, expressed 
[Oryza sativa Japonica Group]
Length=509

 Score =   296 bits (757),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 139/176 (79%), Positives = 151/176 (86%), Gaps = 2/176 (1%)
 Frame = -3

Query  646  QPNPVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGAWNRCLNHL  467
            QPNPVTSRWEGEDHLRDPNFQLDAFRYRTSRLL SVA RLQKHSK LGGFGAWNRCLNHL
Sbjct  336  QPNPVTSRWEGEDHLRDPNFQLDAFRYRTSRLLHSVAARLQKHSKTLGGFGAWNRCLNHL  395

Query  466  LTLAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPN  287
            LTLAESHIES IL  FI+AVK CPD  +R  LKLVCDLYAL+RIW DIGTYRNVDYVAPN
Sbjct  396  LTLAESHIESVILAKFIEAVKRCPDEKTRELLKLVCDLYALDRIWKDIGTYRNVDYVAPN  455

Query  286  KAKAINKLTEYLCFQVRNTAKDLVDAFDLPDYVIRAPIALQDSEQVYLQYAQYAGF  119
            KAKAI+KL +YL +QVR  A++LVDAFDLPD +IRAPI +Q   + Y QY Q+ GF
Sbjct  456  KAKAIHKLADYLSYQVRLVAQELVDAFDLPDLIIRAPIGMQ--SEAYAQYTQHVGF  509



>gb|KEH20862.1| peroxisomal acyl-CoA oxidase [Medicago truncatula]
Length=689

 Score =   300 bits (769),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 143/176 (81%), Positives = 156/176 (89%), Gaps = 2/176 (1%)
 Frame = -3

Query  646  QPNPVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGAWNRCLNHL  467
            QPNPVT+RWEGEDHLRDP FQLDAFRYRTSRLL SVA+RL+KHSK LG FGAWNRCLNHL
Sbjct  515  QPNPVTARWEGEDHLRDPKFQLDAFRYRTSRLLHSVAVRLRKHSKPLGDFGAWNRCLNHL  574

Query  466  LTLAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPN  287
            LTLAESHIES IL  FI+AV+SCPD S++AALKLVCDLYAL+RIWNDIGTYRNVDYVAPN
Sbjct  575  LTLAESHIESVILAKFIEAVQSCPDASAQAALKLVCDLYALDRIWNDIGTYRNVDYVAPN  634

Query  286  KAKAINKLTEYLCFQVRNTAKDLVDAFDLPDYVIRAPIALQDSEQVYLQYAQYAGF  119
            KAKAI+KL+EYL FQVRN AK+LVDAFDLPD+V RAPIA Q     Y QY Q+ GF
Sbjct  635  KAKAIHKLSEYLSFQVRNIAKELVDAFDLPDHVTRAPIAKQSG--AYSQYTQFVGF  688



>ref|XP_008453798.1| PREDICTED: acyl-coenzyme A oxidase, peroxisomal [Cucumis melo]
Length=692

 Score =   300 bits (769),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 138/176 (78%), Positives = 157/176 (89%), Gaps = 2/176 (1%)
 Frame = -3

Query  646  QPNPVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGAWNRCLNHL  467
            QPNPVT+RWE  DHLRDP FQLDAF+YRTSRLLQSVA+RL+KH+K LGGFGAWNRCLNHL
Sbjct  519  QPNPVTARWESTDHLRDPKFQLDAFQYRTSRLLQSVAVRLRKHTKTLGGFGAWNRCLNHL  578

Query  466  LTLAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPN  287
            LTLAESHIES IL  FI+A++ CP+ +++A LKLVCDLYAL+RIWNDIGTYRNVDYVAPN
Sbjct  579  LTLAESHIESVILAQFIEAIQRCPNANTQATLKLVCDLYALDRIWNDIGTYRNVDYVAPN  638

Query  286  KAKAINKLTEYLCFQVRNTAKDLVDAFDLPDYVIRAPIALQDSEQVYLQYAQYAGF  119
            KAKAI+KLTEYLCFQVRN A++LVDAFDLPD+V RAPIA+Q +   Y QY QY GF
Sbjct  639  KAKAIHKLTEYLCFQVRNIAQELVDAFDLPDHVTRAPIAMQSN--AYSQYTQYVGF  692



>ref|XP_004146872.1| PREDICTED: acyl-coenzyme A oxidase, peroxisomal-like [Cucumis 
sativus]
 ref|XP_004168009.1| PREDICTED: acyl-coenzyme A oxidase, peroxisomal-like [Cucumis 
sativus]
 gb|KGN53221.1| hypothetical protein Csa_4G028450 [Cucumis sativus]
Length=693

 Score =   300 bits (769),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 138/176 (78%), Positives = 157/176 (89%), Gaps = 2/176 (1%)
 Frame = -3

Query  646  QPNPVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGAWNRCLNHL  467
            QPNPVT+RWE  DHLRDP FQLDAF+YRTSRLLQSVA+RL+KH+K LGGFGAWNRCLNHL
Sbjct  520  QPNPVTARWESADHLRDPKFQLDAFQYRTSRLLQSVAVRLRKHTKTLGGFGAWNRCLNHL  579

Query  466  LTLAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPN  287
            LTLAESHIES IL  FI+A++ CP+ +++A LKLVCDLYAL+RIWNDIGTYRNVDYVAPN
Sbjct  580  LTLAESHIESVILAQFIEAIQRCPNANTQATLKLVCDLYALDRIWNDIGTYRNVDYVAPN  639

Query  286  KAKAINKLTEYLCFQVRNTAKDLVDAFDLPDYVIRAPIALQDSEQVYLQYAQYAGF  119
            KAKAI+KLTEYLCFQVRN A++LVDAFDLPD+V RAPIA+Q +   Y QY QY GF
Sbjct  640  KAKAIHKLTEYLCFQVRNVAQELVDAFDLPDHVTRAPIAMQSN--AYSQYTQYVGF  693



>ref|XP_008678001.1| PREDICTED: acyl-coenzyme A oxidase 2, peroxisomal-like [Zea mays]
 gb|AFW60418.1| hypothetical protein ZEAMMB73_491408 [Zea mays]
Length=689

 Score =   300 bits (768),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 141/176 (80%), Positives = 153/176 (87%), Gaps = 2/176 (1%)
 Frame = -3

Query  646  QPNPVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGAWNRCLNHL  467
            QPNPVT+RWEGEDHLRDPNFQLDAFRYRTSRLL SVA RLQKHSK LGGFGAWNRCLNHL
Sbjct  516  QPNPVTARWEGEDHLRDPNFQLDAFRYRTSRLLHSVAARLQKHSKTLGGFGAWNRCLNHL  575

Query  466  LTLAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPN  287
            LTLAESHIES IL  FI++VKSCPD  SR  LKLVCDLYAL+RIW DIGTYRNVDYVAPN
Sbjct  576  LTLAESHIESVILAKFIESVKSCPDEKSREVLKLVCDLYALDRIWQDIGTYRNVDYVAPN  635

Query  286  KAKAINKLTEYLCFQVRNTAKDLVDAFDLPDYVIRAPIALQDSEQVYLQYAQYAGF  119
            KAKAI+KLT+YL +QVR  A++LVDAFDLPD +IRAPI +Q   + Y QY QY GF
Sbjct  636  KAKAIHKLTDYLSYQVRLVARELVDAFDLPDLIIRAPIGMQ--SEAYAQYTQYVGF  689



>ref|XP_009366361.1| PREDICTED: acyl-coenzyme A oxidase 2, peroxisomal [Pyrus x bretschneideri]
Length=690

 Score =   300 bits (767),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 139/176 (79%), Positives = 151/176 (86%), Gaps = 2/176 (1%)
 Frame = -3

Query  646  QPNPVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGAWNRCLNHL  467
            QPNPVT+RW+ EDHLRDP FQLDAFRYRTSRLLQSVA+RL+KHSK LG FGAWNRCLNHL
Sbjct  517  QPNPVTARWDSEDHLRDPKFQLDAFRYRTSRLLQSVAVRLRKHSKTLGSFGAWNRCLNHL  576

Query  466  LTLAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPN  287
            LTLAESHIES IL  F++AV+ CPDPSSRAALKLVCDLYAL RIW DIGTYRNVDYVAPN
Sbjct  577  LTLAESHIESVILAKFVEAVQKCPDPSSRAALKLVCDLYALERIWKDIGTYRNVDYVAPN  636

Query  286  KAKAINKLTEYLCFQVRNTAKDLVDAFDLPDYVIRAPIALQDSEQVYLQYAQYAGF  119
            KAKAI+KL EYL FQVRN A++LVD FD+PDYV RAPIA+Q     Y  Y  Y GF
Sbjct  637  KAKAIHKLMEYLSFQVRNIARELVDTFDIPDYVTRAPIAMQ--SDAYSHYTHYVGF  690



>ref|XP_009150593.1| PREDICTED: acyl-coenzyme A oxidase 2, peroxisomal [Brassica rapa]
Length=690

 Score =   299 bits (766),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 139/176 (79%), Positives = 151/176 (86%), Gaps = 2/176 (1%)
 Frame = -3

Query  646  QPNPVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGAWNRCLNHL  467
            QPNPVT+RWEGEDHLRDP FQLDAFRYRTSRLLQSVA+RL KH+K LG FGAWNRCLNHL
Sbjct  517  QPNPVTARWEGEDHLRDPKFQLDAFRYRTSRLLQSVAMRLTKHTKTLGSFGAWNRCLNHL  576

Query  466  LTLAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPN  287
            LTLAESHIES IL  FI+AV+ CPDP ++A LKL CDLYAL+ IW DIGTYRNVDYVAPN
Sbjct  577  LTLAESHIESVILAKFIEAVRKCPDPRAKAGLKLACDLYALDHIWKDIGTYRNVDYVAPN  636

Query  286  KAKAINKLTEYLCFQVRNTAKDLVDAFDLPDYVIRAPIALQDSEQVYLQYAQYAGF  119
            KAKAI+KLTEYL FQVRN AK+LVDAFDLPD+V RAPIA+Q     Y QY Q  GF
Sbjct  637  KAKAIHKLTEYLSFQVRNVAKELVDAFDLPDHVTRAPIAMQ--SDAYAQYTQVVGF  690



>emb|CDY08820.1| BnaA06g24040D [Brassica napus]
Length=690

 Score =   299 bits (766),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 139/176 (79%), Positives = 151/176 (86%), Gaps = 2/176 (1%)
 Frame = -3

Query  646  QPNPVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGAWNRCLNHL  467
            QPNPVT+RWEGEDHLRDP FQLDAFRYRTSRLLQSVA+RL KH+K LG FGAWNRCLNHL
Sbjct  517  QPNPVTARWEGEDHLRDPKFQLDAFRYRTSRLLQSVAMRLTKHTKTLGSFGAWNRCLNHL  576

Query  466  LTLAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPN  287
            LTLAESHIES IL  FI+AV+ CPDP ++A LKL CDLYAL+ IW DIGTYRNVDYVAPN
Sbjct  577  LTLAESHIESVILAKFIEAVRKCPDPRAKAGLKLACDLYALDHIWKDIGTYRNVDYVAPN  636

Query  286  KAKAINKLTEYLCFQVRNTAKDLVDAFDLPDYVIRAPIALQDSEQVYLQYAQYAGF  119
            KAKAI+KLTEYL FQVRN AK+LVDAFDLPD+V RAPIA+Q     Y QY Q  GF
Sbjct  637  KAKAIHKLTEYLSFQVRNVAKELVDAFDLPDHVTRAPIAMQ--SDAYAQYTQVVGF  690



>ref|XP_006394077.1| hypothetical protein EUTSA_v10003747mg [Eutrema salsugineum]
 dbj|BAJ33887.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ31363.1| hypothetical protein EUTSA_v10003747mg [Eutrema salsugineum]
Length=688

 Score =   299 bits (766),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 141/176 (80%), Positives = 155/176 (88%), Gaps = 2/176 (1%)
 Frame = -3

Query  646  QPNPVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGAWNRCLNHL  467
            QPNPVT+RWEGEDHLRDP FQLDAFRYRTSRLLQSVA+RL+KH+K LG FGAWNRCLNHL
Sbjct  515  QPNPVTARWEGEDHLRDPKFQLDAFRYRTSRLLQSVAMRLKKHTKTLGTFGAWNRCLNHL  574

Query  466  LTLAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPN  287
            LTLAESHIES IL  FI+AV++C D S+RAALKLVCDLYAL+RIW DIGTYRNVDYVAPN
Sbjct  575  LTLAESHIESVILARFIEAVQNCSDASARAALKLVCDLYALDRIWKDIGTYRNVDYVAPN  634

Query  286  KAKAINKLTEYLCFQVRNTAKDLVDAFDLPDYVIRAPIALQDSEQVYLQYAQYAGF  119
            KAKAI+KLTEYL FQVRN AK+LVDAF+LPD+V RAPIA+Q     Y QY Q  GF
Sbjct  635  KAKAIHKLTEYLSFQVRNVAKELVDAFELPDHVTRAPIAMQ--SDAYAQYTQVVGF  688



>ref|XP_008370191.1| PREDICTED: acyl-coenzyme A oxidase 2, peroxisomal-like [Malus 
domestica]
Length=689

 Score =   299 bits (765),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 139/176 (79%), Positives = 151/176 (86%), Gaps = 2/176 (1%)
 Frame = -3

Query  646  QPNPVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGAWNRCLNHL  467
            QPNPVT+RWE EDHLRDP FQLDAFRYRTSRLLQSVA+RL+KHSK LG FGAWN+CLNHL
Sbjct  516  QPNPVTARWESEDHLRDPKFQLDAFRYRTSRLLQSVAVRLRKHSKTLGSFGAWNQCLNHL  575

Query  466  LTLAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPN  287
            LTLAESHIES IL  F++AV+ CPDPSSRAALKLVCDLYAL RIW DIGTYRNVDYVAPN
Sbjct  576  LTLAESHIESVILAKFVEAVQKCPDPSSRAALKLVCDLYALERIWKDIGTYRNVDYVAPN  635

Query  286  KAKAINKLTEYLCFQVRNTAKDLVDAFDLPDYVIRAPIALQDSEQVYLQYAQYAGF  119
            KAKAI+KL EYL FQVRN A++LVD FD+PDYV RAPIA+Q     Y  Y  Y GF
Sbjct  636  KAKAIHKLMEYLSFQVRNIARELVDTFDIPDYVTRAPIAMQ--SDAYSHYTHYVGF  689



>ref|XP_009345476.1| PREDICTED: acyl-coenzyme A oxidase 2, peroxisomal-like [Pyrus 
x bretschneideri]
Length=689

 Score =   298 bits (764),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 139/176 (79%), Positives = 151/176 (86%), Gaps = 2/176 (1%)
 Frame = -3

Query  646  QPNPVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGAWNRCLNHL  467
            QPNPVT+RWE E+HLRDP FQLDAFRYRTSRLLQSVA+RL+KHSK LG FGAWNRCLNHL
Sbjct  516  QPNPVTARWESEEHLRDPKFQLDAFRYRTSRLLQSVAVRLRKHSKTLGSFGAWNRCLNHL  575

Query  466  LTLAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPN  287
            LTLAESHIES IL  F++AV+ CPDPSSRAALKLVCDLYAL RIW DIGTYRNVDYVAPN
Sbjct  576  LTLAESHIESVILAKFVEAVQKCPDPSSRAALKLVCDLYALERIWKDIGTYRNVDYVAPN  635

Query  286  KAKAINKLTEYLCFQVRNTAKDLVDAFDLPDYVIRAPIALQDSEQVYLQYAQYAGF  119
            KAKAI+KL EYL FQVRN A++LVD FD+PDYV RAPIA+Q     Y  Y  Y GF
Sbjct  636  KAKAIHKLMEYLSFQVRNIARELVDTFDIPDYVTRAPIAMQ--SDAYSHYTHYVGF  689



>ref|XP_006663038.1| PREDICTED: acyl-coenzyme A oxidase 2, peroxisomal-like [Oryza 
brachyantha]
Length=572

 Score =   295 bits (756),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 139/176 (79%), Positives = 151/176 (86%), Gaps = 2/176 (1%)
 Frame = -3

Query  646  QPNPVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGAWNRCLNHL  467
            QPNPVTSRWEGEDHLRDPNFQLDAFRYRTSRLL SVA RLQKHSK LGGFGAWNRCLNHL
Sbjct  399  QPNPVTSRWEGEDHLRDPNFQLDAFRYRTSRLLHSVAARLQKHSKTLGGFGAWNRCLNHL  458

Query  466  LTLAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPN  287
            LTLAESHIES IL  FI+AVK CPD  +R  LKLVCDLYAL+RIW DIGTYRNVDYVAPN
Sbjct  459  LTLAESHIESVILAKFIEAVKRCPDEKTRELLKLVCDLYALDRIWKDIGTYRNVDYVAPN  518

Query  286  KAKAINKLTEYLCFQVRNTAKDLVDAFDLPDYVIRAPIALQDSEQVYLQYAQYAGF  119
            KAKAI+KL +YL +QVR  A++LVDAFDLPD +IRAPI +Q   + Y QY Q+ GF
Sbjct  519  KAKAIHKLADYLSYQVRLVAQELVDAFDLPDLIIRAPIGMQ--SEAYAQYTQHVGF  572



>emb|CDY14540.1| BnaC03g49190D [Brassica napus]
Length=689

 Score =   298 bits (764),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 139/176 (79%), Positives = 151/176 (86%), Gaps = 2/176 (1%)
 Frame = -3

Query  646  QPNPVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGAWNRCLNHL  467
            QPNPVT+RWEGEDHLRDP FQLDAFRYRTSRLLQSVA+RL KH+K LG FGAWNRCLNHL
Sbjct  516  QPNPVTARWEGEDHLRDPKFQLDAFRYRTSRLLQSVAMRLTKHTKTLGPFGAWNRCLNHL  575

Query  466  LTLAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPN  287
            LTLAESHIES IL  FI+AV+ CPDP ++A LKL CDLYAL+ IW DIGTYRNVDYVAPN
Sbjct  576  LTLAESHIESVILAKFIEAVRKCPDPRAKAGLKLACDLYALDHIWKDIGTYRNVDYVAPN  635

Query  286  KAKAINKLTEYLCFQVRNTAKDLVDAFDLPDYVIRAPIALQDSEQVYLQYAQYAGF  119
            KAKAI+KLTEYL FQVRN AK+LVDAFDLPD+V RAPIA+Q     Y QY Q  GF
Sbjct  636  KAKAIHKLTEYLSFQVRNVAKELVDAFDLPDHVTRAPIAMQ--SDAYAQYTQVVGF  689



>ref|XP_004979658.1| PREDICTED: acyl-coenzyme A oxidase 2, peroxisomal-like [Setaria 
italica]
Length=700

 Score =   298 bits (764),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 139/176 (79%), Positives = 153/176 (87%), Gaps = 2/176 (1%)
 Frame = -3

Query  646  QPNPVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGAWNRCLNHL  467
            QPNPVT+RWEGEDHLRDPNFQLDAFRYRTSRLL SVA RLQKHSK LGGFGAWNRCLNHL
Sbjct  527  QPNPVTARWEGEDHLRDPNFQLDAFRYRTSRLLHSVAARLQKHSKTLGGFGAWNRCLNHL  586

Query  466  LTLAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPN  287
            LTLAESHIES IL  FI++V+SCPD  +R  LKLVCDLYAL+RIW DIGTYRNVDYVAPN
Sbjct  587  LTLAESHIESVILAKFIESVRSCPDEKTREVLKLVCDLYALDRIWKDIGTYRNVDYVAPN  646

Query  286  KAKAINKLTEYLCFQVRNTAKDLVDAFDLPDYVIRAPIALQDSEQVYLQYAQYAGF  119
            KAKAI+KLT+YL +QVR  A++LVDAFDLPD +IRAPI +Q   + Y QY QY GF
Sbjct  647  KAKAIHKLTDYLSYQVRLVAQELVDAFDLPDLIIRAPIGMQ--SEAYAQYTQYVGF  700



>gb|KFK28196.1| hypothetical protein AALP_AA8G484800 [Arabis alpina]
Length=697

 Score =   298 bits (763),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 139/176 (79%), Positives = 155/176 (88%), Gaps = 2/176 (1%)
 Frame = -3

Query  646  QPNPVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGAWNRCLNHL  467
            QPNPVT+RWEGE+HLRDP FQLDAFRYRTSRLLQSVA+RL KH+K LG FGAWNRCLNHL
Sbjct  524  QPNPVTARWEGEEHLRDPKFQLDAFRYRTSRLLQSVALRLNKHTKTLGTFGAWNRCLNHL  583

Query  466  LTLAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPN  287
            LTLAESHIES IL  FI+AV++C +PS++AALKLVCDLYAL+RIW DIGTYRNVDYVAPN
Sbjct  584  LTLAESHIESVILAKFIEAVQNCSEPSAKAALKLVCDLYALDRIWGDIGTYRNVDYVAPN  643

Query  286  KAKAINKLTEYLCFQVRNTAKDLVDAFDLPDYVIRAPIALQDSEQVYLQYAQYAGF  119
            KAKAI+KLTEYL FQVRN AK+LVDAF+LPD+V RAPIA+Q     Y QY Q  GF
Sbjct  644  KAKAIHKLTEYLSFQVRNVAKELVDAFELPDHVTRAPIAMQ--SDAYAQYTQVVGF  697



>ref|XP_003577380.1| PREDICTED: acyl-coenzyme A oxidase 2, peroxisomal [Brachypodium 
distachyon]
Length=692

 Score =   298 bits (763),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 139/176 (79%), Positives = 152/176 (86%), Gaps = 2/176 (1%)
 Frame = -3

Query  646  QPNPVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGAWNRCLNHL  467
            QPNPVT+RWEGEDHLRDPNFQLDAFRYRTSRLL SVA RLQKH K LGGFGAWNRCLNHL
Sbjct  519  QPNPVTARWEGEDHLRDPNFQLDAFRYRTSRLLHSVAARLQKHMKTLGGFGAWNRCLNHL  578

Query  466  LTLAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPN  287
            LTLAESHIES IL  FI+AVKSCPD  +R  LKLVCDLYAL+RIWNDIGTYRNVDYVAPN
Sbjct  579  LTLAESHIESIILARFIEAVKSCPDEKTREVLKLVCDLYALDRIWNDIGTYRNVDYVAPN  638

Query  286  KAKAINKLTEYLCFQVRNTAKDLVDAFDLPDYVIRAPIALQDSEQVYLQYAQYAGF  119
            KAKAI+KL +YL +QVR  A++LVDAFDLPD +IRAPI +Q   + Y QY Q+ GF
Sbjct  639  KAKAIHKLVDYLSYQVRLVARELVDAFDLPDQIIRAPIGMQ--SEAYAQYTQFVGF  692



>gb|AFQ93694.1| acyl-CoA oxidase 2 [Prunus persica]
Length=692

 Score =   297 bits (760),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 138/176 (78%), Positives = 154/176 (88%), Gaps = 2/176 (1%)
 Frame = -3

Query  646  QPNPVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGAWNRCLNHL  467
            QPNPVT+RWE EDHLRDP FQLDAFRYRTSRLLQSVA+RL+KHSK LG FGAWNRCLNHL
Sbjct  519  QPNPVTARWESEDHLRDPKFQLDAFRYRTSRLLQSVAVRLRKHSKTLGSFGAWNRCLNHL  578

Query  466  LTLAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPN  287
            LTLAESHIES IL  FI++V++CPD SSRAALKLVCDLYAL RIW DIGTYRNVDYVAPN
Sbjct  579  LTLAESHIESVILATFIESVQNCPDASSRAALKLVCDLYALERIWKDIGTYRNVDYVAPN  638

Query  286  KAKAINKLTEYLCFQVRNTAKDLVDAFDLPDYVIRAPIALQDSEQVYLQYAQYAGF  119
            KAKAI+KL+EYL F+VRN A++L+DAFD+PD+V RAPIA+Q     Y  Y QY GF
Sbjct  639  KAKAIHKLSEYLSFRVRNIARELIDAFDIPDHVTRAPIAMQ--SDAYSHYTQYVGF  692



>sp|O64894.1|ACOX2_CUCMA RecName: Full=Acyl-coenzyme A oxidase, peroxisomal; Short=AOX; 
AltName: Full=Long-chain acyl-CoA oxidase; Flags: Precursor 
[Cucurbita maxima]
 pir||T07901 acyl CoA oxidase homolog - cucurbit
 gb|AAC15870.1| acyl CoA oxidase homolog [Cucurbita cv. Kurokawa Amakuri]
Length=690

 Score =   297 bits (760),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 137/176 (78%), Positives = 157/176 (89%), Gaps = 2/176 (1%)
 Frame = -3

Query  646  QPNPVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGAWNRCLNHL  467
            QPNPVT+RWE  DHLRDP FQLDAF+YRTSRLLQSVA+RL+KH+KNLG FGAWNRCLNHL
Sbjct  517  QPNPVTARWESADHLRDPKFQLDAFQYRTSRLLQSVAVRLRKHTKNLGSFGAWNRCLNHL  576

Query  466  LTLAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPN  287
            LTLAESHIES IL  FI++V+ CP+ +++A LKLVCDLYAL+RIWNDIGTYRNVDYVAPN
Sbjct  577  LTLAESHIESVILAQFIESVQRCPNANTQATLKLVCDLYALDRIWNDIGTYRNVDYVAPN  636

Query  286  KAKAINKLTEYLCFQVRNTAKDLVDAFDLPDYVIRAPIALQDSEQVYLQYAQYAGF  119
            KAKAI+KLTEYLCFQVRN A++LVDAFDLPD+V RAPIA++ +   Y QY QY GF
Sbjct  637  KAKAIHKLTEYLCFQVRNIAQELVDAFDLPDHVTRAPIAMKSN--AYSQYTQYIGF  690



>ref|XP_007208434.1| hypothetical protein PRUPE_ppa002282mg [Prunus persica]
 gb|EMJ09633.1| hypothetical protein PRUPE_ppa002282mg [Prunus persica]
Length=692

 Score =   297 bits (760),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 138/176 (78%), Positives = 154/176 (88%), Gaps = 2/176 (1%)
 Frame = -3

Query  646  QPNPVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGAWNRCLNHL  467
            QPNPVT+RWE EDHLRDP FQLDAFRYRTSRLLQSVA+RL+KHSK LG FGAWNRCLNHL
Sbjct  519  QPNPVTARWESEDHLRDPKFQLDAFRYRTSRLLQSVAVRLRKHSKTLGSFGAWNRCLNHL  578

Query  466  LTLAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPN  287
            LTLAESHIES IL  FI++V++CPD SSRAALKLVCDLYAL RIW DIGTYRNVDYVAPN
Sbjct  579  LTLAESHIESVILATFIESVQNCPDASSRAALKLVCDLYALERIWKDIGTYRNVDYVAPN  638

Query  286  KAKAINKLTEYLCFQVRNTAKDLVDAFDLPDYVIRAPIALQDSEQVYLQYAQYAGF  119
            KAKAI+KL+EYL F+VRN A++L+DAFD+PD+V RAPIA+Q     Y  Y QY GF
Sbjct  639  KAKAIHKLSEYLSFRVRNIARELIDAFDIPDHVTRAPIAMQ--SDAYSHYTQYVGF  692



>ref|XP_009378530.1| PREDICTED: acyl-coenzyme A oxidase, peroxisomal-like [Pyrus x 
bretschneideri]
Length=689

 Score =   297 bits (760),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 138/176 (78%), Positives = 151/176 (86%), Gaps = 2/176 (1%)
 Frame = -3

Query  646  QPNPVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGAWNRCLNHL  467
            QPNPVT+RWE E+HLRDP FQLDAFRYRTSRLLQSVA+RL+KHSK LG FGAWNRCLNHL
Sbjct  516  QPNPVTARWESEEHLRDPKFQLDAFRYRTSRLLQSVAVRLRKHSKTLGSFGAWNRCLNHL  575

Query  466  LTLAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPN  287
            LTLAESHIES IL  F++AV+ CPDPSS+AALKLVCDLYAL RIW DIGTYRNVDYVAPN
Sbjct  576  LTLAESHIESVILAKFVEAVQKCPDPSSQAALKLVCDLYALERIWKDIGTYRNVDYVAPN  635

Query  286  KAKAINKLTEYLCFQVRNTAKDLVDAFDLPDYVIRAPIALQDSEQVYLQYAQYAGF  119
            KAKAI+KL EYL FQVRN A++LVD FD+PDYV RAPIA+Q     Y  Y  Y GF
Sbjct  636  KAKAIHKLMEYLSFQVRNIARELVDTFDIPDYVTRAPIAMQ--SDAYSHYTHYVGF  689



>gb|EEE62556.1| hypothetical protein OsJ_17355 [Oryza sativa Japonica Group]
Length=671

 Score =   296 bits (758),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 139/176 (79%), Positives = 151/176 (86%), Gaps = 2/176 (1%)
 Frame = -3

Query  646  QPNPVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGAWNRCLNHL  467
            QPNPVTSRWEGEDHLRDPNFQLDAFRYRTSRLL SVA RLQKHSK LGGFGAWNRCLNHL
Sbjct  498  QPNPVTSRWEGEDHLRDPNFQLDAFRYRTSRLLHSVAARLQKHSKTLGGFGAWNRCLNHL  557

Query  466  LTLAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPN  287
            LTLAESHIES IL  FI+AVK CPD  +R  LKLVCDLYAL+RIW DIGTYRNVDYVAPN
Sbjct  558  LTLAESHIESVILAKFIEAVKRCPDEKTRELLKLVCDLYALDRIWKDIGTYRNVDYVAPN  617

Query  286  KAKAINKLTEYLCFQVRNTAKDLVDAFDLPDYVIRAPIALQDSEQVYLQYAQYAGF  119
            KAKAI+KL +YL +QVR  A++LVDAFDLPD +IRAPI +Q   + Y QY Q+ GF
Sbjct  618  KAKAIHKLADYLSYQVRLVAQELVDAFDLPDLIIRAPIGMQ--SEAYAQYTQHVGF  671



>ref|XP_010519778.1| PREDICTED: acyl-coenzyme A oxidase 2, peroxisomal [Tarenaya hassleriana]
Length=689

 Score =   296 bits (757),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 139/176 (79%), Positives = 154/176 (88%), Gaps = 2/176 (1%)
 Frame = -3

Query  646  QPNPVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGAWNRCLNHL  467
            QPNPVT+RWEGEDHLRDP FQLDAFRYRTSRLLQSVA+RL+KH+K LGGFGAWNRCLNHL
Sbjct  516  QPNPVTARWEGEDHLRDPKFQLDAFRYRTSRLLQSVAVRLRKHTKALGGFGAWNRCLNHL  575

Query  466  LTLAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPN  287
            LTLAESHIES IL  FI AV++CPD  +RAALKL CDLYAL+RIW DIGTYRNVDYVAPN
Sbjct  576  LTLAESHIESVILAKFIDAVQNCPDQKARAALKLCCDLYALDRIWKDIGTYRNVDYVAPN  635

Query  286  KAKAINKLTEYLCFQVRNTAKDLVDAFDLPDYVIRAPIALQDSEQVYLQYAQYAGF  119
            KAKAI+K TEYL +QVR+ AK+LVDAFDLPD+V RAPIA+Q     Y QY Q+ GF
Sbjct  636  KAKAIHKQTEYLSYQVRSVAKELVDAFDLPDHVTRAPIAMQ--SHAYSQYTQHVGF  689



>gb|KJB44226.1| hypothetical protein B456_007G240800 [Gossypium raimondii]
Length=688

 Score =   295 bits (755),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 138/176 (78%), Positives = 153/176 (87%), Gaps = 2/176 (1%)
 Frame = -3

Query  646  QPNPVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGAWNRCLNHL  467
            QPNPVT+RWE EDHLRDP FQLDAFRYRTSRLLQSVA RLQKH+K LG FGAWNRCLNHL
Sbjct  515  QPNPVTARWESEDHLRDPKFQLDAFRYRTSRLLQSVAARLQKHTKTLGSFGAWNRCLNHL  574

Query  466  LTLAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPN  287
            LTLAESHIES IL  FI+AV++CPD SS+AALKL+CDLYAL+RIW DIGTYRNVDYVAPN
Sbjct  575  LTLAESHIESVILAKFIEAVQNCPDASSQAALKLLCDLYALDRIWKDIGTYRNVDYVAPN  634

Query  286  KAKAINKLTEYLCFQVRNTAKDLVDAFDLPDYVIRAPIALQDSEQVYLQYAQYAGF  119
            KAKAINKLT+YL FQVRN A + +DAFDLP Y++RAPIA+Q   + Y QY Q  GF
Sbjct  635  KAKAINKLTQYLSFQVRNIAGEFIDAFDLPPYILRAPIAMQ--SEAYSQYTQLVGF  688



>gb|ABA94669.2| Acyl-coenzyme A oxidase 2, peroxisomal precursor, putative, expressed 
[Oryza sativa Japonica Group]
Length=699

 Score =   295 bits (756),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 139/176 (79%), Positives = 151/176 (86%), Gaps = 2/176 (1%)
 Frame = -3

Query  646  QPNPVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGAWNRCLNHL  467
            QPNPVTSRWEGEDHLRDPNFQLDAFRYRTSRLL SVA RLQKHSK LGGFGAWNRCLNHL
Sbjct  526  QPNPVTSRWEGEDHLRDPNFQLDAFRYRTSRLLHSVAARLQKHSKTLGGFGAWNRCLNHL  585

Query  466  LTLAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPN  287
            LTLAESHIES IL  FI+AVK CPD  +R  LKLVCDLYAL+RIW DIGTYRNVDYVAPN
Sbjct  586  LTLAESHIESVILAKFIEAVKRCPDEKTRELLKLVCDLYALDRIWKDIGTYRNVDYVAPN  645

Query  286  KAKAINKLTEYLCFQVRNTAKDLVDAFDLPDYVIRAPIALQDSEQVYLQYAQYAGF  119
            KAKAI+KL +YL +QVR  A++LVDAFDLPD +IRAPI +Q   + Y QY Q+ GF
Sbjct  646  KAKAIHKLADYLSYQVRLVAQELVDAFDLPDLIIRAPIGMQ--SEAYAQYTQHVGF  699



>ref|XP_008234652.1| PREDICTED: acyl-coenzyme A oxidase 2, peroxisomal [Prunus mume]
 ref|XP_008245967.1| PREDICTED: acyl-coenzyme A oxidase 2, peroxisomal-like [Prunus 
mume]
Length=692

 Score =   295 bits (754),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 137/176 (78%), Positives = 154/176 (88%), Gaps = 2/176 (1%)
 Frame = -3

Query  646  QPNPVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGAWNRCLNHL  467
            QPNPVT+RWE E+HLRDP FQLDAFRYRTSRLLQSVA+RL+KHSK LG FGAWNRCLNHL
Sbjct  519  QPNPVTARWESEEHLRDPKFQLDAFRYRTSRLLQSVAVRLRKHSKTLGSFGAWNRCLNHL  578

Query  466  LTLAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPN  287
            LTLAESHIES IL  FI++V++CPD SSRAALKLVCDLYAL RIW DIGTYRNVDYVAPN
Sbjct  579  LTLAESHIESVILAKFIESVQNCPDASSRAALKLVCDLYALERIWKDIGTYRNVDYVAPN  638

Query  286  KAKAINKLTEYLCFQVRNTAKDLVDAFDLPDYVIRAPIALQDSEQVYLQYAQYAGF  119
            KAKAI+KL+EYL F+VRN A++L+DAFD+PD+V RAPIA+Q     Y  Y QY GF
Sbjct  639  KAKAIHKLSEYLSFRVRNIARELIDAFDIPDHVTRAPIAMQ--SDAYSHYTQYVGF  692



>dbj|BAK00905.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=696

 Score =   293 bits (751),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 139/176 (79%), Positives = 150/176 (85%), Gaps = 2/176 (1%)
 Frame = -3

Query  646  QPNPVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGAWNRCLNHL  467
            QPNPVT+RWEGEDHLRDP FQLDAFRYRTSRLL SVA RLQKH K LGGFGAWNRCLNHL
Sbjct  523  QPNPVTARWEGEDHLRDPKFQLDAFRYRTSRLLHSVAARLQKHMKTLGGFGAWNRCLNHL  582

Query  466  LTLAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPN  287
            LTLAESHIES IL  FI+AVKSCPD  +R  LKLVCDLYAL+RIW DIGTYRNVDYVAPN
Sbjct  583  LTLAESHIESVILARFIEAVKSCPDEKTREVLKLVCDLYALDRIWKDIGTYRNVDYVAPN  642

Query  286  KAKAINKLTEYLCFQVRNTAKDLVDAFDLPDYVIRAPIALQDSEQVYLQYAQYAGF  119
            KAKAI+KL +YL +QVR  A++LVDAFDLPD VIRAPI LQ   + Y QY Q+ GF
Sbjct  643  KAKAIHKLVDYLSYQVRLVARELVDAFDLPDEVIRAPIGLQ--SEAYAQYTQHIGF  696



>dbj|BAJ87486.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=696

 Score =   293 bits (750),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 139/176 (79%), Positives = 150/176 (85%), Gaps = 2/176 (1%)
 Frame = -3

Query  646  QPNPVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGAWNRCLNHL  467
            QPNPVT+RWEGEDHLRDP FQLDAFRYRTSRLL SVA RLQKH K LGGFGAWNRCLNHL
Sbjct  523  QPNPVTARWEGEDHLRDPKFQLDAFRYRTSRLLHSVAARLQKHMKTLGGFGAWNRCLNHL  582

Query  466  LTLAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPN  287
            LTLAESHIES IL  FI+AVKSCPD  +R  LKLVCDLYAL+RIW DIGTYRNVDYVAPN
Sbjct  583  LTLAESHIESVILARFIEAVKSCPDEKTREVLKLVCDLYALDRIWKDIGTYRNVDYVAPN  642

Query  286  KAKAINKLTEYLCFQVRNTAKDLVDAFDLPDYVIRAPIALQDSEQVYLQYAQYAGF  119
            KAKAI+KL +YL +QVR  A++LVDAFDLPD VIRAPI LQ   + Y QY Q+ GF
Sbjct  643  KAKAIHKLVDYLSYQVRLVARELVDAFDLPDEVIRAPIGLQ--SEAYAQYTQHIGF  696



>ref|XP_007047997.1| Acyl-CoA oxidase 2 isoform 1 [Theobroma cacao]
 ref|XP_007047998.1| Acyl-CoA oxidase 2 isoform 1 [Theobroma cacao]
 gb|EOX92154.1| Acyl-CoA oxidase 2 isoform 1 [Theobroma cacao]
 gb|EOX92155.1| Acyl-CoA oxidase 2 isoform 1 [Theobroma cacao]
Length=688

 Score =   293 bits (750),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 140/176 (80%), Positives = 150/176 (85%), Gaps = 2/176 (1%)
 Frame = -3

Query  646  QPNPVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGAWNRCLNHL  467
            QPNPVT+RWE  DHLRDP FQLDAFRYRTSRLLQSVA RL+KHSK LG FGAWNRCLNHL
Sbjct  515  QPNPVTARWESTDHLRDPKFQLDAFRYRTSRLLQSVAARLRKHSKTLGSFGAWNRCLNHL  574

Query  466  LTLAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPN  287
            LTLAESHIES IL  FI AV++CPD  SRAALKLVCDLYAL+RIW DIGTYRNVDYVAPN
Sbjct  575  LTLAESHIESVILAKFIDAVQNCPDARSRAALKLVCDLYALDRIWKDIGTYRNVDYVAPN  634

Query  286  KAKAINKLTEYLCFQVRNTAKDLVDAFDLPDYVIRAPIALQDSEQVYLQYAQYAGF  119
            KAKAI+KLTEYL FQVRN A +L+DAFDLP YV RAPIA+Q   + Y QY Q  GF
Sbjct  635  KAKAIHKLTEYLSFQVRNIAGELIDAFDLPPYVTRAPIAMQ--SEAYAQYTQRVGF  688



>ref|XP_006826958.1| hypothetical protein AMTR_s00010p00190650 [Amborella trichopoda]
 gb|ERM94195.1| hypothetical protein AMTR_s00010p00190650 [Amborella trichopoda]
Length=696

 Score =   293 bits (749),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 137/176 (78%), Positives = 153/176 (87%), Gaps = 2/176 (1%)
 Frame = -3

Query  646  QPNPVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGAWNRCLNHL  467
            QPNPVT+RWEG++HLRDP FQLDAF+YRTSRLLQ+VA+RL+KHSK LG FGAWNRCLNHL
Sbjct  523  QPNPVTARWEGQEHLRDPKFQLDAFQYRTSRLLQTVAVRLRKHSKTLGAFGAWNRCLNHL  582

Query  466  LTLAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPN  287
            LTLAESHIES IL  FI+AV+SCPD ++R  LKLVCDLYAL+RIWNDIGTYR VDYVAPN
Sbjct  583  LTLAESHIESVILAKFIEAVQSCPDRNTRNVLKLVCDLYALDRIWNDIGTYRIVDYVAPN  642

Query  286  KAKAINKLTEYLCFQVRNTAKDLVDAFDLPDYVIRAPIALQDSEQVYLQYAQYAGF  119
            KAKAI+KLTEYLCFQVRN A++LVD FDLPD V RAPI LQ   + Y  Y QY GF
Sbjct  643  KAKAIHKLTEYLCFQVRNVARELVDTFDLPDEVTRAPIGLQ--SEPYAHYTQYVGF  696



>ref|XP_004288220.1| PREDICTED: acyl-coenzyme A oxidase 2, peroxisomal [Fragaria vesca 
subsp. vesca]
Length=693

 Score =   292 bits (747),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 139/176 (79%), Positives = 152/176 (86%), Gaps = 2/176 (1%)
 Frame = -3

Query  646  QPNPVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGAWNRCLNHL  467
            QPNPVT+RWE EDHLRDP FQLDAFRYRTSRLLQSVA+RL+KHSK LG FGAWNRCLNHL
Sbjct  517  QPNPVTARWESEDHLRDPKFQLDAFRYRTSRLLQSVAVRLRKHSKPLGSFGAWNRCLNHL  576

Query  466  LTLAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPN  287
            LTLAESHIES IL  FI+AV++CPD SSRAALKLV DLYAL+RIW DIGTYRNVDYVAPN
Sbjct  577  LTLAESHIESVILAKFIEAVQNCPDASSRAALKLVSDLYALDRIWKDIGTYRNVDYVAPN  636

Query  286  KAKAINKLTEYLCFQVRNTAKDLVDAFDLPDYVIRAPIALQDSEQVYLQYAQYAGF  119
            KAKAI+KLT YL F+VRN A +LVDAFD+P YV RAPIA+Q     Y QY Q+ GF
Sbjct  637  KAKAIHKLTAYLSFRVRNIAGELVDAFDIPGYVTRAPIAMQ--SDAYSQYTQHVGF  690



>ref|XP_009390291.1| PREDICTED: acyl-coenzyme A oxidase 2, peroxisomal [Musa acuminata 
subsp. malaccensis]
Length=704

 Score =   291 bits (745),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 135/176 (77%), Positives = 151/176 (86%), Gaps = 2/176 (1%)
 Frame = -3

Query  646  QPNPVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGAWNRCLNHL  467
            Q NPVT+RWEG DHLR+P+FQLDAFRYRTSRLLQSVA+RLQKHS+ LGGFGAWNRCLNHL
Sbjct  531  QSNPVTARWEGTDHLRNPSFQLDAFRYRTSRLLQSVAMRLQKHSQTLGGFGAWNRCLNHL  590

Query  466  LTLAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPN  287
            LTLAESHIES IL  FI+AV+SCPD  ++  LKLVCDLYAL+RIWNDIGTYRNVDYVAPN
Sbjct  591  LTLAESHIESVILAKFIEAVQSCPDKKTKDVLKLVCDLYALDRIWNDIGTYRNVDYVAPN  650

Query  286  KAKAINKLTEYLCFQVRNTAKDLVDAFDLPDYVIRAPIALQDSEQVYLQYAQYAGF  119
            KAKAI+KLTEYL FQVR  A++L+DAFDLPD   RAPI +  S + Y  Y QY GF
Sbjct  651  KAKAIHKLTEYLSFQVRGVARELIDAFDLPDIATRAPIGM--SSEAYSHYTQYIGF  704



>ref|XP_008803753.1| PREDICTED: acyl-coenzyme A oxidase 2, peroxisomal [Phoenix dactylifera]
Length=691

 Score =   290 bits (742),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 136/176 (77%), Positives = 151/176 (86%), Gaps = 2/176 (1%)
 Frame = -3

Query  646  QPNPVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGAWNRCLNHL  467
            QPNP+T+RWE EDHLRDP FQLDAFRYRTSRLLQ+VA+RLQKHS  LGGFGAWNRCLNHL
Sbjct  518  QPNPLTARWEREDHLRDPKFQLDAFRYRTSRLLQTVAVRLQKHSTRLGGFGAWNRCLNHL  577

Query  466  LTLAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPN  287
            LTLAESHIES IL  FI +V+SCPD ++R  LKLVCDLYAL+RIW+ IGTYRN DYVAPN
Sbjct  578  LTLAESHIESIILAKFINSVQSCPDKNTRHVLKLVCDLYALDRIWHYIGTYRNDDYVAPN  637

Query  286  KAKAINKLTEYLCFQVRNTAKDLVDAFDLPDYVIRAPIALQDSEQVYLQYAQYAGF  119
            KAKAI+KLTEYL FQVR  A++LVDAFDLPDYV RAPI +  S + Y  Y QYAGF
Sbjct  638  KAKAIHKLTEYLSFQVRGVARELVDAFDLPDYVTRAPIGM--SSEAYAHYTQYAGF  691



>ref|XP_002269650.2| PREDICTED: acyl-coenzyme A oxidase, peroxisomal [Vitis vinifera]
 emb|CBI23497.3| unnamed protein product [Vitis vinifera]
Length=687

 Score =   290 bits (742),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 137/176 (78%), Positives = 154/176 (88%), Gaps = 3/176 (2%)
 Frame = -3

Query  646  QPNPVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGAWNRCLNHL  467
            QPNPVT+RWEGE+HLRDP FQLDAFRYRTSRLLQSVA+RL+KHSK LG FGAWNRCLNHL
Sbjct  515  QPNPVTARWEGEEHLRDPKFQLDAFRYRTSRLLQSVAVRLRKHSKTLGSFGAWNRCLNHL  574

Query  466  LTLAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPN  287
            LTLAESHIES IL  FI+AV+SCP+  +R  LKLVCDLYAL+RIWNDIGTYR VDYVAPN
Sbjct  575  LTLAESHIESVILAKFIEAVQSCPE-ETRVTLKLVCDLYALDRIWNDIGTYRIVDYVAPN  633

Query  286  KAKAINKLTEYLCFQVRNTAKDLVDAFDLPDYVIRAPIALQDSEQVYLQYAQYAGF  119
            KAKAI+KLTEYL FQ+RN A +LVDAF+LPD+V RAPIA+Q   + Y QY Q+ GF
Sbjct  634  KAKAIHKLTEYLSFQLRNVAGELVDAFNLPDHVTRAPIAMQ--SEAYSQYTQHVGF  687



>gb|EMT18336.1| Acyl-coenzyme A oxidase 2, peroxisomal [Aegilops tauschii]
Length=649

 Score =   289 bits (739),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 136/176 (77%), Positives = 148/176 (84%), Gaps = 2/176 (1%)
 Frame = -3

Query  646  QPNPVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGAWNRCLNHL  467
            QPNPVT+RWEGEDHLRDP FQLDAFRYRTSRLL SVA RLQKH K LGGFGAWNRCLNHL
Sbjct  471  QPNPVTARWEGEDHLRDPKFQLDAFRYRTSRLLHSVAARLQKHMKTLGGFGAWNRCLNHL  530

Query  466  LTLAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPN  287
            LTLAESHIES IL  FI+AVKSCPD  +R  LKLVCDLYAL RIW DIGTYRNVDYVAPN
Sbjct  531  LTLAESHIESVILARFIEAVKSCPDEKTREVLKLVCDLYALERIWKDIGTYRNVDYVAPN  590

Query  286  KAKAINKLTEYLCFQVRNTAKDLVDAFDLPDYVIRAPIALQDSEQVYLQYAQYAGF  119
            KAKAI+KL +YL +QVR  A++LVDAFD+PD +IRAPI +Q   + Y QY Q  GF
Sbjct  591  KAKAIHKLVDYLSYQVRLVARELVDAFDVPDQIIRAPIGMQ--SEAYAQYTQGVGF  644



>ref|XP_010025485.1| PREDICTED: acyl-coenzyme A oxidase 2, peroxisomal [Eucalyptus 
grandis]
 gb|KCW62151.1| hypothetical protein EUGRSUZ_H04812 [Eucalyptus grandis]
Length=701

 Score =   289 bits (739),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 135/176 (77%), Positives = 150/176 (85%), Gaps = 2/176 (1%)
 Frame = -3

Query  646  QPNPVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGAWNRCLNHL  467
            QPNPV +RWE E+HLRDP FQLDAFRYRTSRLLQSVA RLQKH+K LG FGAWNRCLNHL
Sbjct  528  QPNPVIARWESEEHLRDPKFQLDAFRYRTSRLLQSVAARLQKHTKTLGSFGAWNRCLNHL  587

Query  466  LTLAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPN  287
            LTLAESHIES IL  FI+AV+ CPD S+RA LKL CDLYAL+RIWNDIGTYRNVDYVAPN
Sbjct  588  LTLAESHIESVILAKFIEAVERCPDASARAVLKLACDLYALDRIWNDIGTYRNVDYVAPN  647

Query  286  KAKAINKLTEYLCFQVRNTAKDLVDAFDLPDYVIRAPIALQDSEQVYLQYAQYAGF  119
            KAKAI+KL +YL FQ+RN A +LVDAFDLPD+V RAPIA++   + Y QY Q  GF
Sbjct  648  KAKAIHKLADYLSFQIRNVAGELVDAFDLPDHVTRAPIAMK--SEAYSQYTQCVGF  701



>ref|XP_010916902.1| PREDICTED: acyl-coenzyme A oxidase 2, peroxisomal [Elaeis guineensis]
Length=691

 Score =   288 bits (737),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 135/176 (77%), Positives = 149/176 (85%), Gaps = 2/176 (1%)
 Frame = -3

Query  646  QPNPVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGAWNRCLNHL  467
            QPNP+T+RWE EDHLRDP FQLDAFRYRTSRLLQ+VA+RLQKH+K LGGFGAWNRCLNHL
Sbjct  518  QPNPLTARWEREDHLRDPKFQLDAFRYRTSRLLQTVAVRLQKHAKKLGGFGAWNRCLNHL  577

Query  466  LTLAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPN  287
            LTLAESHIES IL  FI  V+SCPD ++R  LKLVCDLYAL+RIWN IGTYRN DYVAPN
Sbjct  578  LTLAESHIESVILGKFINCVQSCPDQNTRHVLKLVCDLYALDRIWNYIGTYRNDDYVAPN  637

Query  286  KAKAINKLTEYLCFQVRNTAKDLVDAFDLPDYVIRAPIALQDSEQVYLQYAQYAGF  119
            KAKAI+KLTEYL FQVR  A++LVDAFD PDYV RAPI +  S + Y  Y QY GF
Sbjct  638  KAKAIHKLTEYLSFQVRGVARELVDAFDFPDYVTRAPIGM--SSEAYAHYTQYVGF  691



>gb|KJB71250.1| hypothetical protein B456_011G112800 [Gossypium raimondii]
Length=689

 Score =   287 bits (735),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 136/176 (77%), Positives = 147/176 (84%), Gaps = 2/176 (1%)
 Frame = -3

Query  646  QPNPVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGAWNRCLNHL  467
            QPNP+ +RWE  DHLRDP FQLDAFRYRTSRLLQSVA RL+KHSK LG FGAWNRCLNHL
Sbjct  516  QPNPIIARWESADHLRDPKFQLDAFRYRTSRLLQSVAARLRKHSKTLGTFGAWNRCLNHL  575

Query  466  LTLAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPN  287
            L LAESH ES IL  FI+AV +CPD SSRAALKLVCDLYAL+ IWNDIGTYRNVDYVAPN
Sbjct  576  LLLAESHTESVILAKFIEAVHNCPDASSRAALKLVCDLYALDHIWNDIGTYRNVDYVAPN  635

Query  286  KAKAINKLTEYLCFQVRNTAKDLVDAFDLPDYVIRAPIALQDSEQVYLQYAQYAGF  119
            KAKAI+KLTEYLCFQVRN A +LVD FDLP  V RAPIA+Q   + Y QY  + GF
Sbjct  636  KAKAIHKLTEYLCFQVRNIAGELVDGFDLPASVTRAPIAMQ--SEAYAQYTHHIGF  689



>gb|AAR00586.1|U77053_1 acyl-CoA oxidase [Phalaenopsis hybrid cultivar]
Length=709

 Score =   285 bits (730),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 131/176 (74%), Positives = 151/176 (86%), Gaps = 2/176 (1%)
 Frame = -3

Query  646  QPNPVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGAWNRCLNHL  467
            QPNPVT+RW+GE+HLRDPNFQLDAFRYRTSRLLQS+ +RL+KH+K LGGFGAWNRCLNHL
Sbjct  536  QPNPVTARWQGEEHLRDPNFQLDAFRYRTSRLLQSLGLRLRKHTKTLGGFGAWNRCLNHL  595

Query  466  LTLAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPN  287
            LTLAESHIES IL  FI+AV+ CPD ++   LKL+CDLYAL+RIWNDIGTYRNVDYVAPN
Sbjct  596  LTLAESHIESVILAKFIEAVQKCPDKNTGNVLKLLCDLYALDRIWNDIGTYRNVDYVAPN  655

Query  286  KAKAINKLTEYLCFQVRNTAKDLVDAFDLPDYVIRAPIALQDSEQVYLQYAQYAGF  119
            KAKAI+KL +YL FQVR  A +LVDAF LP+ VIRAPI +  S + Y QY +Y GF
Sbjct  656  KAKAIHKLVDYLSFQVRGIAGELVDAFGLPEIVIRAPIGM--SSEAYSQYTEYVGF  709



>gb|AAB67883.1| acyl-CoA oxidase homolog [Phalaenopsis hybrid cultivar]
Length=699

 Score =   285 bits (728),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 130/176 (74%), Positives = 151/176 (86%), Gaps = 2/176 (1%)
 Frame = -3

Query  646  QPNPVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGAWNRCLNHL  467
            QPNPVT+RW+GE+HLRDPNFQLDAFRYRTSRLLQS+ +RL+KH+K LGGFGAWNRCLNHL
Sbjct  526  QPNPVTARWQGEEHLRDPNFQLDAFRYRTSRLLQSLGLRLRKHTKTLGGFGAWNRCLNHL  585

Query  466  LTLAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPN  287
            LTLAESHIES IL  FI+AV+ CPD ++   LKL+CDLYAL+RIWNDIGTYRNVDYVAPN
Sbjct  586  LTLAESHIESVILAKFIEAVQKCPDKNTGNVLKLLCDLYALDRIWNDIGTYRNVDYVAPN  645

Query  286  KAKAINKLTEYLCFQVRNTAKDLVDAFDLPDYVIRAPIALQDSEQVYLQYAQYAGF  119
            KAKAI+KL +YL FQVR  A +LVDAF LP+ V+RAPI +  S + Y QY +Y GF
Sbjct  646  KAKAIHKLVDYLSFQVRGIAGELVDAFGLPEIVVRAPIGM--SSEAYSQYTEYVGF  699



>gb|KJB44225.1| hypothetical protein B456_007G240800 [Gossypium raimondii]
Length=682

 Score =   277 bits (709),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 133/176 (76%), Positives = 148/176 (84%), Gaps = 8/176 (5%)
 Frame = -3

Query  646  QPNPVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGAWNRCLNHL  467
            QPNPVT+RWE EDHLRDP FQLDAFRYRTSRLLQSVA RLQKH+K LG FGAWNRCLNHL
Sbjct  515  QPNPVTARWESEDHLRDPKFQLDAFRYRTSRLLQSVAARLQKHTKTLGSFGAWNRCLNHL  574

Query  466  LTLAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPN  287
            LTLAESHIES IL  FI+AV+      ++AALKL+CDLYAL+RIW DIGTYRNVDYVAPN
Sbjct  575  LTLAESHIESVILAKFIEAVQ------NQAALKLLCDLYALDRIWKDIGTYRNVDYVAPN  628

Query  286  KAKAINKLTEYLCFQVRNTAKDLVDAFDLPDYVIRAPIALQDSEQVYLQYAQYAGF  119
            KAKAINKLT+YL FQVRN A + +DAFDLP Y++RAPIA+Q   + Y QY Q  GF
Sbjct  629  KAKAINKLTQYLSFQVRNIAGEFIDAFDLPPYILRAPIAMQ--SEAYSQYTQLVGF  682



>gb|AAC32108.1| acyl-CoA oxidase homolog [Picea mariana]
Length=223

 Score =   258 bits (658),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 119/176 (68%), Positives = 144/176 (82%), Gaps = 2/176 (1%)
 Frame = -3

Query  646  QPNPVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGAWNRCLNHL  467
            + NPV +R EG DHLRD  FQLDAFRYRTSRLL + A+RL+KHSK+LG F AWNRCLNHL
Sbjct  50   EANPVIARREGVDHLRDSKFQLDAFRYRTSRLLHTAALRLRKHSKSLGSFEAWNRCLNHL  109

Query  466  LTLAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPN  287
            L LAESHIES IL  FI+AV SC D ++RA LKL+CDLYAL+RIW DIG+YRNVDYV+PN
Sbjct  110  LVLAESHIESVILARFIEAVNSCKDRNARAVLKLLCDLYALDRIWKDIGSYRNVDYVSPN  169

Query  286  KAKAINKLTEYLCFQVRNTAKDLVDAFDLPDYVIRAPIALQDSEQVYLQYAQYAGF  119
            KAKAI +LTEYL F+VR+ A++LVDAF +PD+ +RAPI +Q  +  Y +Y Q+ GF
Sbjct  170  KAKAILRLTEYLSFEVRSVARELVDAFGIPDFALRAPIGMQSGQ--YAEYTQFVGF  223



>ref|XP_002991925.1| hypothetical protein SELMODRAFT_134372 [Selaginella moellendorffii]
 gb|EFJ07036.1| hypothetical protein SELMODRAFT_134372 [Selaginella moellendorffii]
Length=694

 Score =   262 bits (670),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 121/176 (69%), Positives = 142/176 (81%), Gaps = 2/176 (1%)
 Frame = -3

Query  646  QPNPVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGAWNRCLNHL  467
            Q NPV +  EG  HLRDPNFQLDAF+YRT+RLL + A+RL+KHS+ LG FGAWNRCLNHL
Sbjct  521  QTNPVVTHREGHGHLRDPNFQLDAFQYRTARLLHTAALRLRKHSQRLGSFGAWNRCLNHL  580

Query  466  LTLAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPN  287
            LTLAESHIES IL  FI+AV  CPD   R+ LKLVCDLYAL+RIW DIGTYRN DYVAPN
Sbjct  581  LTLAESHIESVILAKFIEAVNRCPDKDVRSLLKLVCDLYALDRIWEDIGTYRNQDYVAPN  640

Query  286  KAKAINKLTEYLCFQVRNTAKDLVDAFDLPDYVIRAPIALQDSEQVYLQYAQYAGF  119
            KAKAI++L EYL ++VR  AK+LVD F +PD+V+RAPI LQ+ +  Y +Y QY GF
Sbjct  641  KAKAIHRLVEYLSYEVRGVAKELVDGFGVPDFVLRAPIGLQNGQ--YSEYMQYVGF  694



>ref|XP_002979998.1| hypothetical protein SELMODRAFT_178082 [Selaginella moellendorffii]
 gb|EFJ18868.1| hypothetical protein SELMODRAFT_178082 [Selaginella moellendorffii]
Length=694

 Score =   262 bits (670),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 121/176 (69%), Positives = 142/176 (81%), Gaps = 2/176 (1%)
 Frame = -3

Query  646  QPNPVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGAWNRCLNHL  467
            Q NPV +  EG  HLRDPNFQLDAF+YRT+RLL + A+RL+KHS+ LG FGAWNRCLNHL
Sbjct  521  QTNPVVTHREGHGHLRDPNFQLDAFQYRTARLLHTAALRLRKHSQRLGSFGAWNRCLNHL  580

Query  466  LTLAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPN  287
            LTLAESHIES IL  FI+AV  CPD   R+ LKLVCDLYAL+RIW DIGTYRN DYVAPN
Sbjct  581  LTLAESHIESVILAKFIEAVNRCPDKDVRSLLKLVCDLYALDRIWEDIGTYRNQDYVAPN  640

Query  286  KAKAINKLTEYLCFQVRNTAKDLVDAFDLPDYVIRAPIALQDSEQVYLQYAQYAGF  119
            KAKAI++L EYL ++VR  AK+LVD F +PD+V+RAPI LQ+ +  Y +Y QY GF
Sbjct  641  KAKAIHRLVEYLSYEVRGVAKELVDGFGVPDFVLRAPIGLQNGQ--YSEYMQYVGF  694



>gb|EMS55752.1| Acyl-coenzyme A oxidase 2, peroxisomal [Triticum urartu]
Length=577

 Score =   256 bits (653),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 123/176 (70%), Positives = 136/176 (77%), Gaps = 17/176 (10%)
 Frame = -3

Query  646  QPNPVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGAWNRCLNHL  467
            QPNPVT+RWEGEDHLRDP FQLDAFR               KH K LGGFGAWNRCLNHL
Sbjct  419  QPNPVTARWEGEDHLRDPKFQLDAFR---------------KHMKTLGGFGAWNRCLNHL  463

Query  466  LTLAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPN  287
            LTLAESH+E+ IL  FI+AVKSCPD  +R  LKLVCDLYAL+RIW DIGTYRNVDYVAPN
Sbjct  464  LTLAESHVEAVILARFIEAVKSCPDAKTREVLKLVCDLYALDRIWKDIGTYRNVDYVAPN  523

Query  286  KAKAINKLTEYLCFQVRNTAKDLVDAFDLPDYVIRAPIALQDSEQVYLQYAQYAGF  119
            KAKAI+KL +YL +QVR  A++LVDAFDLPD VIRAPI +Q   + Y QY Q  GF
Sbjct  524  KAKAIHKLVDYLSYQVRLVARELVDAFDLPDEVIRAPIGMQ--SEAYAQYTQCVGF  577



>gb|ADD09596.1| acyl-coA oxidase [Trifolium repens]
Length=626

 Score =   252 bits (644),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 122/151 (81%), Positives = 133/151 (88%), Gaps = 2/151 (1%)
 Frame = -3

Query  571  RYRTSRLLQSVAIRLQKHSKNLGGFGAWNRCLNHLLTLAESHIESFILEIFIQAVKSCPD  392
            +YRTSRLL SVA+RLQKHSK LG FGAWNRCLNHLLTLAESHIES IL  FI+AV+SCPD
Sbjct  477  QYRTSRLLHSVAVRLQKHSKPLGQFGAWNRCLNHLLTLAESHIESVILAKFIEAVQSCPD  536

Query  391  PSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPNKAKAINKLTEYLCFQVRNTAKDLVD  212
            PS++AALKLVCDLYAL+RIWNDIGTYRNVDYVAPNKAKAI+KL+EYL FQVRN AK+LVD
Sbjct  537  PSAQAALKLVCDLYALDRIWNDIGTYRNVDYVAPNKAKAIHKLSEYLSFQVRNIAKELVD  596

Query  211  AFDLPDYVIRAPIALQDSEQVYLQYAQYAGF  119
            AFDLPD+V RAPIA Q     Y QY QY GF
Sbjct  597  AFDLPDHVTRAPIAKQSG--AYSQYTQYVGF  625



>ref|XP_007159636.1| hypothetical protein PHAVU_002G254300g, partial [Phaseolus vulgaris]
 gb|ESW31630.1| hypothetical protein PHAVU_002G254300g, partial [Phaseolus vulgaris]
Length=483

 Score =   245 bits (625),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 117/152 (77%), Positives = 132/152 (87%), Gaps = 7/152 (5%)
 Frame = -3

Query  646  QPNPVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGAWNRCLNHL  467
            QPNPVT+RWEG+DHLRD  FQLDAFRYRTSRLLQSVA+RL+KHSK LG FGAWNRCLNHL
Sbjct  313  QPNPVTARWEGKDHLRDSKFQLDAFRYRTSRLLQSVAVRLRKHSKTLGVFGAWNRCLNHL  372

Query  466  LTLAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPN  287
            LTLA+SHIES IL  FI+ V++C +PSS+AALKLVCDLYAL+ IWNDIGTYRNVDY    
Sbjct  373  LTLAKSHIESVILAKFIEPVQNCSEPSSQAALKLVCDLYALDPIWNDIGTYRNVDY----  428

Query  286  KAKAINKLTEYLCFQVRNTAKDLVDAFDLPDY  191
               AI+KL EYL FQVRN A++LVDAFDLPD+
Sbjct  429  ---AIHKLAEYLSFQVRNVARELVDAFDLPDH  457



>ref|XP_001786103.1| predicted protein [Physcomitrella patens]
 gb|EDQ49085.1| predicted protein [Physcomitrella patens]
Length=691

 Score =   237 bits (605),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 108/176 (61%), Positives = 135/176 (77%), Gaps = 2/176 (1%)
 Frame = -3

Query  646  QPNPVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGAWNRCLNHL  467
            Q NPV +  EG  HLRDP FQLDAF+YRT+RLL + A+RL+KHSK LG FGAWNRCLNHL
Sbjct  517  QTNPVVTHREGYSHLRDPRFQLDAFQYRTARLLHTAALRLRKHSKRLGSFGAWNRCLNHL  576

Query  466  LTLAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPN  287
            LTLAESHIES IL  F +A++ C D ++R  L ++ DLYAL+RIW DIGTYRN DY+APN
Sbjct  577  LTLAESHIESVILAKFTEAIERCEDRNTRKVLNMLRDLYALDRIWKDIGTYRNQDYIAPN  636

Query  286  KAKAINKLTEYLCFQVRNTAKDLVDAFDLPDYVIRAPIALQDSEQVYLQYAQYAGF  119
            KAKAI++L EYL F+++  A  LVD F +PD ++RAPI LQ  +  Y +Y+ + GF
Sbjct  637  KAKAIHRLVEYLSFELKGVAGSLVDGFGIPDVLLRAPIGLQSGQ--YTEYSHHIGF  690



>ref|NP_001032145.1| acyl-coenzyme A oxidase 2 [Arabidopsis thaliana]
 gb|AED98004.1| acyl-coenzyme A oxidase 2 [Arabidopsis thaliana]
Length=646

 Score =   235 bits (600),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 107/123 (87%), Positives = 115/123 (93%), Gaps = 0/123 (0%)
 Frame = -3

Query  646  QPNPVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGAWNRCLNHL  467
            QPNPVT+RWEGEDHLRDP FQLDAFRYRTSRLLQ+VA RLQKHSK LGGFGAWNRCLNHL
Sbjct  519  QPNPVTARWEGEDHLRDPKFQLDAFRYRTSRLLQNVAARLQKHSKTLGGFGAWNRCLNHL  578

Query  466  LTLAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPN  287
            LTLAESHIE+ IL  FI+AVK+CPDPS++AALKL CDLYAL+RIW DIGTYRNVDYVAPN
Sbjct  579  LTLAESHIETVILAKFIEAVKNCPDPSAKAALKLACDLYALDRIWKDIGTYRNVDYVAPN  638

Query  286  KAK  278
            KAK
Sbjct  639  KAK  641



>dbj|BAH19744.1| AT5G65110 [Arabidopsis thaliana]
Length=646

 Score =   235 bits (600),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 107/123 (87%), Positives = 115/123 (93%), Gaps = 0/123 (0%)
 Frame = -3

Query  646  QPNPVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGAWNRCLNHL  467
            QPNPVT+RWEGEDHLRDP FQLDAFRYRTSRLLQ+VA RLQKHSK LGGFGAWNRCLNHL
Sbjct  519  QPNPVTARWEGEDHLRDPKFQLDAFRYRTSRLLQNVAARLQKHSKTLGGFGAWNRCLNHL  578

Query  466  LTLAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPN  287
            LTLAESHIE+ IL  FI+AVK+CPDPS++AALKL CDLYAL+RIW DIGTYRNVDYVAPN
Sbjct  579  LTLAESHIETVILAKFIEAVKNCPDPSAKAALKLACDLYALDRIWKDIGTYRNVDYVAPN  638

Query  286  KAK  278
            KAK
Sbjct  639  KAK  641



>ref|XP_001754596.1| predicted protein [Physcomitrella patens]
 gb|EDQ80566.1| predicted protein [Physcomitrella patens]
Length=682

 Score =   234 bits (596),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 108/176 (61%), Positives = 133/176 (76%), Gaps = 2/176 (1%)
 Frame = -3

Query  646  QPNPVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGAWNRCLNHL  467
            Q NPV +  EG  HLRDP FQLDAF+YRT+RLL + A+RL+KHSK  G FGAWNRCLNHL
Sbjct  508  QTNPVATHREGYTHLRDPRFQLDAFQYRTARLLHTAALRLRKHSKRFGSFGAWNRCLNHL  567

Query  466  LTLAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPN  287
            LTLAESHIES IL  F +A++ C D  +R  L +V DLYAL+RIW DIGTYRN DYV+PN
Sbjct  568  LTLAESHIESVILAKFNEAIERCEDRQTRKVLNMVRDLYALDRIWKDIGTYRNQDYVSPN  627

Query  286  KAKAINKLTEYLCFQVRNTAKDLVDAFDLPDYVIRAPIALQDSEQVYLQYAQYAGF  119
            KAKAI++L EYL ++++  A  LVD F +PD ++RAPI LQ  +  Y +Y+ Y GF
Sbjct  628  KAKAIHRLVEYLSYELKGAAGSLVDGFGIPDALLRAPIGLQSGQ--YSEYSHYVGF  681



>gb|EMT32176.1| Acyl-coenzyme A oxidase 2, peroxisomal [Aegilops tauschii]
Length=714

 Score =   219 bits (558),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 115/179 (64%), Positives = 128/179 (72%), Gaps = 11/179 (6%)
 Frame = -3

Query  646  QPNPVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGAWNRCLNHL  467
            QPNPVT+RWEGEDHLRDP FQLDAFRYRTSRLL SVA RLQKH K LGGF      +   
Sbjct  544  QPNPVTARWEGEDHLRDPKFQLDAFRYRTSRLLHSVAARLQKHMKTLGGFAEPQTEIKGE  603

Query  466  L---TLAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYV  296
            L   TL    + +     FI     CPD  +R  LKLVCDLYAL+RIW DIGTYRNVDYV
Sbjct  604  LSKRTLTRCCVRNPF--DFIH----CPDAKTREVLKLVCDLYALDRIWKDIGTYRNVDYV  657

Query  295  APNKAKAINKLTEYLCFQVRNTAKDLVDAFDLPDYVIRAPIALQDSEQVYLQYAQYAGF  119
            APNKAKAI+KL +YL +QVR  A++LVDAFDLPD VIRAPI +Q   + Y QY Q  GF
Sbjct  658  APNKAKAIHKLVDYLSYQVRLVARELVDAFDLPDEVIRAPIGMQ--SEAYAQYTQCVGF  714



>gb|AFW65271.1| ribosomal protein L15 [Zea mays]
Length=749

 Score =   201 bits (510),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 96/124 (77%), Positives = 100/124 (81%), Gaps = 15/124 (12%)
 Frame = -3

Query  646  QPNPVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGAWNRCLNHL  467
            QPNPVT+RWEGEDHLRDPNFQLDAFR               KHSK LGGFGAWNRCLNHL
Sbjct  465  QPNPVTARWEGEDHLRDPNFQLDAFR---------------KHSKTLGGFGAWNRCLNHL  509

Query  466  LTLAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPN  287
            LTLAESHIES IL  FI++VKSCPD  SR  LKLVCDLYAL+RIW DIGTYRNVDYVAPN
Sbjct  510  LTLAESHIESVILAKFIESVKSCPDEKSREVLKLVCDLYALDRIWQDIGTYRNVDYVAPN  569

Query  286  KAKA  275
            KAKA
Sbjct  570  KAKA  573



>gb|AFW65270.1| ribosomal protein L15 [Zea mays]
Length=759

 Score =   201 bits (511),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 96/124 (77%), Positives = 100/124 (81%), Gaps = 15/124 (12%)
 Frame = -3

Query  646  QPNPVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGAWNRCLNHL  467
            QPNPVT+RWEGEDHLRDPNFQLDAFR               KHSK LGGFGAWNRCLNHL
Sbjct  475  QPNPVTARWEGEDHLRDPNFQLDAFR---------------KHSKTLGGFGAWNRCLNHL  519

Query  466  LTLAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPN  287
            LTLAESHIES IL  FI++VKSCPD  SR  LKLVCDLYAL+RIW DIGTYRNVDYVAPN
Sbjct  520  LTLAESHIESVILAKFIESVKSCPDEKSREVLKLVCDLYALDRIWQDIGTYRNVDYVAPN  579

Query  286  KAKA  275
            KAKA
Sbjct  580  KAKA  583



>tpg|DAA37870.1| TPA: hypothetical protein ZEAMMB73_255371 [Zea mays]
Length=670

 Score =   195 bits (495),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 95/124 (77%), Positives = 99/124 (80%), Gaps = 16/124 (13%)
 Frame = -3

Query  646  QPNPVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGAWNRCLNHL  467
            QPNPVT+RWEGEDHLRDPNFQLDAFR               KHSK LGGFGAWNRCLNHL
Sbjct  463  QPNPVTARWEGEDHLRDPNFQLDAFR---------------KHSKTLGGFGAWNRCLNHL  507

Query  466  LTLAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPN  287
            LTL ESHIES IL  FI++VKSCPD  SR  LKLVCDLYAL+RIW DIGTYRNVDYVAPN
Sbjct  508  LTL-ESHIESVILAKFIESVKSCPDEKSREVLKLVCDLYALDRIWQDIGTYRNVDYVAPN  566

Query  286  KAKA  275
            KAKA
Sbjct  567  KAKA  570



>tpg|DAA45395.1| TPA: ribosomal protein L15 [Zea mays]
Length=696

 Score =   190 bits (482),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 93/126 (74%), Positives = 98/126 (78%), Gaps = 16/126 (13%)
 Frame = -3

Query  646  QPNPVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGAWNRCLNHL  467
            QPNPVT+RWEGEDHLRDPNFQLDAFR               KHSK LGGFGAWNRCLNHL
Sbjct  465  QPNPVTARWEGEDHLRDPNFQLDAFR---------------KHSKTLGGFGAWNRCLNHL  509

Query  466  LTLAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPN  287
            LTL ESHIES IL  FI++VKSCPD  S   LKLVCDLYAL+RIW DIGTYRNVDYVAPN
Sbjct  510  LTL-ESHIESVILAKFIESVKSCPDEKSWEVLKLVCDLYALDRIWQDIGTYRNVDYVAPN  568

Query  286  KAKAIN  269
            KAK  +
Sbjct  569  KAKVFD  574



>tpg|DAA45394.1| TPA: ribosomal protein L15 [Zea mays]
Length=706

 Score =   190 bits (482),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 93/126 (74%), Positives = 98/126 (78%), Gaps = 16/126 (13%)
 Frame = -3

Query  646  QPNPVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGAWNRCLNHL  467
            QPNPVT+RWEGEDHLRDPNFQLDAFR               KHSK LGGFGAWNRCLNHL
Sbjct  475  QPNPVTARWEGEDHLRDPNFQLDAFR---------------KHSKTLGGFGAWNRCLNHL  519

Query  466  LTLAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPN  287
            LTL ESHIES IL  FI++VKSCPD  S   LKLVCDLYAL+RIW DIGTYRNVDYVAPN
Sbjct  520  LTL-ESHIESVILAKFIESVKSCPDEKSWEVLKLVCDLYALDRIWQDIGTYRNVDYVAPN  578

Query  286  KAKAIN  269
            KAK  +
Sbjct  579  KAKVFD  584



>ref|XP_005846219.1| hypothetical protein CHLNCDRAFT_135478 [Chlorella variabilis]
 gb|EFN54117.1| hypothetical protein CHLNCDRAFT_135478 [Chlorella variabilis]
Length=675

 Score =   177 bits (450),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 88/175 (50%), Positives = 120/175 (69%), Gaps = 2/175 (1%)
 Frame = -3

Query  640  NPVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGAWNRCLNHLLT  461
            NP+ +      HLRDP F + A RYR++RLL ++A RL+KHS+ +G F AWN+CL H+L 
Sbjct  500  NPLVTHETDVSHLRDPAFLVRALRYRSARLLHTLAARLRKHSRRVGEFTAWNKCLLHVLA  559

Query  460  LAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPNKA  281
            L+ +HIES +L   + AV +C DP  R +LK + DL+AL+RI+ DI T+RN DY+AP KA
Sbjct  560  LSRAHIESVMLVEMLAAVNACVDPDCRRSLKALADLFALDRIYTDI-TFRNDDYIAPEKA  618

Query  280  KAINKLTEYLCFQVRNTAKDLVDAFDLPDYVIRAPIALQ-DSEQVYLQYAQYAGF  119
            KAI +L E LC +VR  A  LVDAF +PD+++R+PI L   S   Y +Y   AGF
Sbjct  619  KAIYRLIEALCGEVRGVAVPLVDAFAIPDHILRSPIGLSTTSVDPYSEYLAAAGF  673



>ref|XP_011402022.1| Acyl-coenzyme A oxidase, peroxisomal [Auxenochlorella protothecoides]
 gb|KFM28973.1| Acyl-coenzyme A oxidase, peroxisomal [Auxenochlorella protothecoides]
Length=676

 Score =   170 bits (430),  Expect = 2e-45, Method: Composition-based stats.
 Identities = 83/175 (47%), Positives = 116/175 (66%), Gaps = 2/175 (1%)
 Frame = -3

Query  640  NPVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGAWNRCLNHLLT  461
            NP+ +      HLRDP F + A R+RT+R+L +VA RL+KH++  G F AWNRCL HLL 
Sbjct  501  NPLLAHDTTPRHLRDPRFLISALRHRTARMLHTVAARLRKHTRRHGAFKAWNRCLLHLLD  560

Query  460  LAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPNKA  281
            LA +HIES  LE     V+ C DP  R++LK + DL+AL+RI  DI  +RN DY++P KA
Sbjct  561  LARAHIESVALESMYAGVQRCNDPDCRSSLKALADLFALSRIHADI-LFRNDDYLSPEKA  619

Query  280  KAINKLTEYLCFQVRNTAKDLVDAFDLPDYVIRAPIALQDSEQ-VYLQYAQYAGF  119
            KA+ ++ E LC ++R  A  LVDAF +PD+++RAPI L  ++   Y +Y    G+
Sbjct  620  KAVKRMVESLCGELRGVAVALVDAFGIPDHILRAPIGLASAQHDPYGEYLAATGW  674



>ref|XP_005646249.1| long-chain acyl-CoA oxidase [Coccomyxa subellipsoidea C-169]
 gb|EIE21705.1| long-chain acyl-CoA oxidase [Coccomyxa subellipsoidea C-169]
Length=683

 Score =   167 bits (422),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 82/174 (47%), Positives = 117/174 (67%), Gaps = 3/174 (2%)
 Frame = -3

Query  643  PNPVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGAWNRCLNHLL  464
            PNP+ S      HLRDP F + A RYRT +LL ++A RL KH++ +G F AWN+CL+H+L
Sbjct  503  PNPLVSHETSVRHLRDPAFLVRALRYRTGKLLFTLAQRLSKHTRRMGQFQAWNKCLSHIL  562

Query  463  TLAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPNK  284
            TLA +HIES + E F+  V +CPD   + +LK++ +++AL RI  D+  +RN DYVA  K
Sbjct  563  TLARAHIESVMFERFLDGVNNCPDADCKKSLKVMAEVFALQRIQADV-MFRNDDYVAAEK  621

Query  283  AKAINKLTEYLCFQVRNTAKDLVDAFDLPDYVIRAPIAL--QDSEQVYLQYAQY  128
             KAI +L E L  ++R  A  LVDAF++PD+++R+PI L  QD    YL+ A +
Sbjct  622  VKAIGRLLERLRAEIRAQAVPLVDAFNIPDHILRSPIGLSHQDPYDHYLEGAGW  675



>gb|KDD75971.1| hypothetical protein H632_c413p1, partial [Helicosporidium sp. 
ATCC 50920]
Length=373

 Score =   152 bits (383),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 81/176 (46%), Positives = 114/176 (65%), Gaps = 2/176 (1%)
 Frame = -3

Query  643  PNPVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGAWNRCLNHLL  464
            PNP+ +      HLRDP F   A R+R +RLL ++A RL+KH    G F AW  CL H++
Sbjct  197  PNPLVTHETDVAHLRDPAFLRAAMRHRAARLLHTLAARLRKHRGRQGDFFAWRTCLVHVV  256

Query  463  TLAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPNK  284
             LA +H+ES I++ F  AV +C D   RA+LK + D++AL+R+  D+  +RN DY+AP K
Sbjct  257  ALANAHVESVIVDAFYDAVDACADRDCRASLKALADIFALSRVHADV-AFRNDDYIAPEK  315

Query  283  AKAINKLTEYLCFQVRNTAKDLVDAFDLPDYVIRAPIALQDSEQ-VYLQYAQYAGF  119
            AKAI++L + LC +VR  A  LVDAF +PD+V+RAPI L  ++   Y  Y +  GF
Sbjct  316  AKAIHRLLQKLCAKVRGVALPLVDAFGIPDFVLRAPIGLSTAQHDPYGDYLEAVGF  371



>dbj|BAJ98966.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=447

 Score =   152 bits (383),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 72/91 (79%), Positives = 76/91 (84%), Gaps = 7/91 (8%)
 Frame = -3

Query  646  QPNPVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGAWNRCLNHL  467
            QPNPVT+RWEGEDHLRDP FQLDAFRYRTS+LL SVA RLQKH K LGGFGAWNRCLNHL
Sbjct  344  QPNPVTARWEGEDHLRDPKFQLDAFRYRTSKLLHSVAARLQKHMKTLGGFGAWNRCLNHL  403

Query  466  LTLAESHIESFILEIFIQAVK-------SCP  395
            LTLAESHIES IL  FI+AVK       +CP
Sbjct  404  LTLAESHIESVILARFIEAVKRYRFCAVTCP  434



>gb|KJB44224.1| hypothetical protein B456_007G240800 [Gossypium raimondii]
Length=630

 Score =   150 bits (378),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 69/81 (85%), Positives = 73/81 (90%), Gaps = 0/81 (0%)
 Frame = -3

Query  646  QPNPVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGAWNRCLNHL  467
            QPNPVT+RWE EDHLRDP FQLDAFRYRTSRLLQSVA RLQKH+K LG FGAWNRCLNHL
Sbjct  515  QPNPVTARWESEDHLRDPKFQLDAFRYRTSRLLQSVAARLQKHTKTLGSFGAWNRCLNHL  574

Query  466  LTLAESHIESFILEIFIQAVK  404
            LTLAESHIES IL  FI+AV+
Sbjct  575  LTLAESHIESVILAKFIEAVQ  595



>ref|XP_010099275.1| Acyl-coenzyme A oxidase 2 [Morus notabilis]
 gb|EXB77539.1| Acyl-coenzyme A oxidase 2 [Morus notabilis]
Length=668

 Score =   145 bits (365),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 68/81 (84%), Positives = 72/81 (89%), Gaps = 0/81 (0%)
 Frame = -3

Query  646  QPNPVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGAWNRCLNHL  467
            QPNPVT+RWE EDHLRDP FQLDAFRYRTSRLLQSVA+RL+KHSKNLG FG WNR LNHL
Sbjct  225  QPNPVTARWESEDHLRDPKFQLDAFRYRTSRLLQSVAVRLRKHSKNLGSFGDWNRSLNHL  284

Query  466  LTLAESHIESFILEIFIQAVK  404
            LTLAESHIES IL  FI AV+
Sbjct  285  LTLAESHIESVILAKFIDAVQ  305



>ref|XP_003630052.1| Acyl-coenzyme A oxidase, peroxisomal, partial [Medicago truncatula]
Length=82

 Score =   133 bits (335),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 65/83 (78%), Positives = 71/83 (86%), Gaps = 2/83 (2%)
 Frame = -3

Query  367  LVCDLYALNRIWNDIGTYRNVDYVAPNKAKAINKLTEYLCFQVRNTAKDLVDAFDLPDYV  188
            LVCDLYAL+RIWNDIGTYRNVDYVAPNKAKAI+KL+EYL FQVRN AK+LVDAFDLPD+V
Sbjct  1    LVCDLYALDRIWNDIGTYRNVDYVAPNKAKAIHKLSEYLSFQVRNIAKELVDAFDLPDHV  60

Query  187  IRAPIALQDSEQVYLQYAQYAGF  119
             RAPIA Q     Y QY Q+ GF
Sbjct  61   TRAPIAKQSG--AYSQYTQFVGF  81



>gb|KJB71252.1| hypothetical protein B456_011G112800 [Gossypium raimondii]
Length=615

 Score =   139 bits (350),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 64/80 (80%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = -3

Query  646  QPNPVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGAWNRCLNHL  467
            QPNP+ +RWE  DHLRDP FQLDAFRYRTSRLLQSVA RL+KHSK LG FGAWNRCLNHL
Sbjct  516  QPNPIIARWESADHLRDPKFQLDAFRYRTSRLLQSVAARLRKHSKTLGTFGAWNRCLNHL  575

Query  466  LTLAESHIESFILEIFIQAV  407
            L LAESH ES IL  FI+AV
Sbjct  576  LLLAESHTESVILAKFIEAV  595



>gb|ABR25385.1| acyl coenzyme a oxidase [Oryza sativa Indica Group]
Length=88

 Score =   129 bits (323),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 62/90 (69%), Positives = 73/90 (81%), Gaps = 2/90 (2%)
 Frame = -3

Query  388  SSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPNKAKAINKLTEYLCFQVRNTAKDLVDA  209
             +R  LKLVCDLYAL+RIW DIGTYRNVDYVAPNKAKAI+KL +YL +QVR  A++LVDA
Sbjct  1    KTRELLKLVCDLYALDRIWKDIGTYRNVDYVAPNKAKAIHKLADYLSYQVRLVAQELVDA  60

Query  208  FDLPDYVIRAPIALQDSEQVYLQYAQYAGF  119
            FDLPD +IRAPI +Q   + Y QY Q+ GF
Sbjct  61   FDLPDLIIRAPIGMQ--FEAYAQYTQHVGF  88



>ref|XP_003608263.1| Acyl-coenzyme A oxidase 2, peroxisomal [Medicago truncatula]
 gb|AES90460.1| acyl-coenzyme A oxidase [Medicago truncatula]
Length=125

 Score =   125 bits (314),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 59/71 (83%), Positives = 66/71 (93%), Gaps = 0/71 (0%)
 Frame = -3

Query  400  CPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPNKAKAINKLTEYLCFQVRNTAKD  221
            CPD S++AALKLVCDLYAL+RIWNDIG Y NVDYVAPNKAKAI+KL+EYL FQVRN AK+
Sbjct  11   CPDQSAQAALKLVCDLYALDRIWNDIGMYCNVDYVAPNKAKAIHKLSEYLSFQVRNIAKE  70

Query  220  LVDAFDLPDYV  188
            LVDAFDLPD+V
Sbjct  71   LVDAFDLPDHV  81



>ref|XP_004339964.1| acylCoA dehydrogenase, middle domain containing protein [Acanthamoeba 
castellanii str. Neff]
 gb|ELR17948.1| acylCoA dehydrogenase, middle domain containing protein [Acanthamoeba 
castellanii str. Neff]
Length=742

 Score =   125 bits (315),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 68/182 (37%), Positives = 100/182 (55%), Gaps = 21/182 (12%)
 Frame = -3

Query  646  QPNPVTSRWEGEDHLRDPNFQLD---------------------AFRYRTSRLLQSVAIR  530
            + NP  +      HLRD  FQ +                     AF YR +RLL + A  
Sbjct  536  ESNPYVTNMASWTHLRDQEFQKEYALGPQLNVATSSRWPHRFGIAFDYRVARLLHNTAQL  595

Query  529  LQKHSKNLGGFGAWNRCLNHLLTLAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLY  350
            LQK +KN   F AWN+ L  LL +AE+H+E  +++ F++ V  CPD + +  LKL+CDLY
Sbjct  596  LQKRAKNNDFFTAWNQTLPELLHVAEAHVERVVVKQFVRRVNDCPDINCKHVLKLLCDLY  655

Query  349  ALNRIWNDIGTYRNVDYVAPNKAKAINKLTEYLCFQVRNTAKDLVDAFDLPDYVIRAPIA  170
            AL +I  D+  +    Y+   KA AI++L   LC +VR  A  LVDAF++ D+++ AP+ 
Sbjct  656  ALTKIEKDLAVFSKEGYIKKRKANAISELITELCQEVRIHALHLVDAFEVDDFIVHAPLG  715

Query  169  LQ  164
            L+
Sbjct  716  LK  717



>ref|WP_039751994.1| acyl-CoA oxidase [Hassallia byssoidea]
 gb|KIF31115.1| acyl-CoA oxidase [Hassallia byssoidea VB512170]
Length=769

 Score =   123 bits (309),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 65/159 (41%), Positives = 95/159 (60%), Gaps = 1/159 (1%)
 Frame = -3

Query  640  NPVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKH-SKNLGGFGAWNRCLNHLL  464
            NP+  R   +DHL DP F L+AF+YR   +L S A RL++H    +  F A+N   +HL+
Sbjct  609  NPIIVRNTDDDHLMDPEFHLNAFKYRERDILTSAAKRLKRHIDSGMDSFDAFNVSQHHLV  668

Query  463  TLAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPNK  284
             +  ++IE  ILE FI+ V    D   +A LK +C L+AL++I  + G Y    Y+   K
Sbjct  669  QVGHAYIERVILEQFIKQVDQTKDAGCKAILKKLCALFALSQIEKNKGWYLEQGYMEGVK  728

Query  283  AKAINKLTEYLCFQVRNTAKDLVDAFDLPDYVIRAPIAL  167
             KAI KL   LC+ +R  A  LVDAF++P+ ++ APIA+
Sbjct  729  TKAIRKLMNQLCWDIRQEAVPLVDAFNIPNELLSAPIAV  767



>ref|WP_010853776.1| Acyl-coenzyme A oxidase 1, peroxisomal [Cyclobacteriaceae bacterium 
AK24]
 gb|EON77924.1| Acyl-coenzyme A oxidase 1, peroxisomal [Cyclobacteriaceae bacterium 
AK24]
Length=768

 Score =   123 bits (308),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 64/159 (40%), Positives = 96/159 (60%), Gaps = 1/159 (1%)
 Frame = -3

Query  646  QPNPVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKH-SKNLGGFGAWNRCLNH  470
            + NP+  R   E HL DP+FQL+AF YR + L+ S A R+++  S+ +  F A+N C +H
Sbjct  603  EKNPLIVRNTDESHLTDPDFQLNAFEYRANGLVDSAARRMRRLISEGMDPFDAFNVCQHH  662

Query  469  LLTLAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAP  290
             + + ++ IE  +LE FI+A K+    S    LK +CDLYAL+ +  + G Y    Y+  
Sbjct  663  FVNVGKAFIEKVVLEQFIEAAKTAQKESYGEVLKKLCDLYALHTMEENKGWYLEQGYMEG  722

Query  289  NKAKAINKLTEYLCFQVRNTAKDLVDAFDLPDYVIRAPI  173
             K KAI KL   LC+++R  A  LV+AFD+P+  + API
Sbjct  723  VKTKAIRKLINQLCWEIRRDAVPLVNAFDIPESCLAAPI  761



>ref|WP_020890884.1| Acyl-coenzyme A oxidase 1, peroxisomal [Cyclobacterium qasimii]
 gb|EPR68221.1| Acyl-coenzyme A oxidase 1, peroxisomal [Cyclobacterium qasimii 
M12-11B]
Length=765

 Score =   123 bits (308),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 65/160 (41%), Positives = 95/160 (59%), Gaps = 1/160 (1%)
 Frame = -3

Query  646  QPNPVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQK-HSKNLGGFGAWNRCLNH  470
            + NP+  R   E+HL DP F L+AF+YR + +L S   RL++   + +  F A N   +H
Sbjct  605  EKNPLIIRNTDENHLLDPEFHLNAFQYRENSILSSAGKRLKRLMDEGMDPFDAVNVAQHH  664

Query  469  LLTLAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAP  290
            L TLA + IE  ILE FI+ ++   DP  +  LK +CDL+AL +I    G Y    Y+  
Sbjct  665  LFTLAMAFIERVILEKFIEKIEQTTDPELKQVLKRLCDLFALYQIETHNGWYLEQGYMEG  724

Query  289  NKAKAINKLTEYLCFQVRNTAKDLVDAFDLPDYVIRAPIA  170
             K+KAI K+   LC+++R  A  LV+AF++PD  + APIA
Sbjct  725  IKSKAIRKMVNQLCWEIRKDAVPLVNAFNIPDSCLSAPIA  764



>ref|WP_043394213.1| acyl-CoA oxidase [Cystobacter violaceus]
 gb|KFA92834.1| acyl-CoA oxidase [Cystobacter violaceus Cb vi76]
Length=779

 Score =   122 bits (307),  Expect = 3e-28, Method: Composition-based stats.
 Identities = 66/159 (42%), Positives = 93/159 (58%), Gaps = 1/159 (1%)
 Frame = -3

Query  640  NPVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKH-SKNLGGFGAWNRCLNHLL  464
            NP + R  G +HLRD +FQL A R+R S LL S A RL++  S  +  F A+N+C +HLL
Sbjct  616  NPFSVRRTGSEHLRDGDFQLRALRFRESDLLASAARRLRERLSAGVDSFEAFNQCQDHLL  675

Query  463  TLAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPNK  284
             LA +H+E  +LE F+  V    DP+ +  L  +CD+Y L  + +  G +   D++   K
Sbjct  676  ALANAHVERVVLEQFLLGVAEVKDPALKTVLGRLCDVYGLGCLQDASGWFLENDHIEGAK  735

Query  283  AKAINKLTEYLCFQVRNTAKDLVDAFDLPDYVIRAPIAL  167
            AKAI K    LC ++R  A  L  AF +PD  + APIAL
Sbjct  736  AKAIRKEVTRLCAELRPDAVALTKAFGIPDSCLAAPIAL  774



>ref|XP_002677851.1| acyl-coenzyme A oxidase [Naegleria gruberi]
 gb|EFC45107.1| acyl-coenzyme A oxidase [Naegleria gruberi]
Length=750

 Score =   122 bits (306),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 61/160 (38%), Positives = 95/160 (59%), Gaps = 2/160 (1%)
 Frame = -3

Query  640  NPVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGAWNRCLNHLLT  461
            NPV +R+  + HLR+  F L AF YRT++LLQ  AI +    K  G F A+N  L  L+ 
Sbjct  541  NPVITRFASKKHLRNSEFHLQAFEYRTAKLLQECAIEINGRKKKQGMFHAFNESLPKLIR  600

Query  460  LAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPNKA  281
            L  +++E   L+ F+  +++  D   +  LKL+ DL+AL+ +  +IG +  +D +  NK 
Sbjct  601  LGRAYVEQVALQDFLSEIENITDSELKRILKLMADLFALDTMSKNIGEF--LDLIKKNKF  658

Query  280  KAINKLTEYLCFQVRNTAKDLVDAFDLPDYVIRAPIALQD  161
             AI  + E+LC ++R  A  LVDAF  PD+++ API  +D
Sbjct  659  SAIQNMIEWLCDELRVHAVSLVDAFGFPDFLLDAPIGKRD  698



>ref|WP_014021931.1| acyl-CoA oxidase [Cyclobacterium marinum]
 gb|AEL27646.1| acyl-CoA oxidase domain-containing protein [Cyclobacterium marinum 
DSM 745]
Length=765

 Score =   121 bits (304),  Expect = 6e-28, Method: Composition-based stats.
 Identities = 64/161 (40%), Positives = 97/161 (60%), Gaps = 1/161 (1%)
 Frame = -3

Query  646  QPNPVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQK-HSKNLGGFGAWNRCLNH  470
            + N + +R +GE HL D  F ++AF YR + +L S A RL++  S+ +  F A N   +H
Sbjct  605  EKNLIITRNKGEAHLLDSEFHMNAFYYRENSILNSAANRLKRLMSEGMDPFDAVNVAQHH  664

Query  469  LLTLAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAP  290
            L TL+ + IE  +LE FI+ ++   DP  +  LK +CDLYAL++I    G Y    Y+  
Sbjct  665  LYTLSLAFIERVVLEKFIEKIEQTSDPELKQVLKQLCDLYALHQIEKHNGWYLEQGYMEG  724

Query  289  NKAKAINKLTEYLCFQVRNTAKDLVDAFDLPDYVIRAPIAL  167
             K+KAI K+   LC+ +R  A  LV+AF++PD  + APIA+
Sbjct  725  GKSKAIRKMVNQLCWDIRKDAVPLVNAFNIPDACLAAPIAI  765



>ref|XP_002672633.1| peroxisomal acyl-CoA oxidase [Naegleria gruberi]
 gb|EFC39889.1| peroxisomal acyl-CoA oxidase [Naegleria gruberi]
Length=601

 Score =   119 bits (299),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 58/162 (36%), Positives = 97/162 (60%), Gaps = 2/162 (1%)
 Frame = -3

Query  646  QPNPVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGAWNRCLNHL  467
            Q NP+ +R   + HLR+ ++ L AF YRT++LLQ  A+ +  + K  G F A+   L  L
Sbjct  436  QRNPLITRLSSKKHLRNSDYHLQAFEYRTAKLLQECALEINVNKKKQGIFRAFGESLPKL  495

Query  466  LTLAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPN  287
            + L  +++E   L  ++  ++   DP  +  LK++ DLYAL+ I  ++G +  +D +  N
Sbjct  496  IRLGRAYVEQVALHDYLHGIEQVQDPELKPILKMMGDLYALDIISKNVGDF--IDLIKKN  553

Query  286  KAKAINKLTEYLCFQVRNTAKDLVDAFDLPDYVIRAPIALQD  161
            K  AI+ + E+LC ++R  A  LVD+F  PD+++ APIA +D
Sbjct  554  KLSAIHDMVEWLCEELRVHAVSLVDSFGFPDFLLDAPIAKRD  595



>ref|WP_009183890.1| acyl-CoA oxidase [Cecembia lonarensis]
 gb|EKB50464.1| Acyl-CoA dehydrogenase, short-chain specific [Cecembia lonarensis 
LW9]
Length=764

 Score =   119 bits (298),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 62/160 (39%), Positives = 92/160 (58%), Gaps = 1/160 (1%)
 Frame = -3

Query  646  QPNPVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKH-SKNLGGFGAWNRCLNH  470
            + NP+ +R   E HL D NF L AFRYR   +L S A R+++H    +  F A+N   +H
Sbjct  601  EKNPIITRSTDESHLLDFNFHLSAFRYRERAILSSAARRIKRHIDDGMDSFDAFNVVQHH  660

Query  469  LLTLAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAP  290
            L+ + +++IE  ILE F + ++   +   +A L  +C L+AL  + N+ G Y    Y+  
Sbjct  661  LVNVGQAYIERVILESFQEGIQKISNAGCKAVLSQLCQLFALYTLENNRGWYLEQGYMEG  720

Query  289  NKAKAINKLTEYLCFQVRNTAKDLVDAFDLPDYVIRAPIA  170
             K KAI K+   LC+ VR  A  L DAFD+P+  I+APIA
Sbjct  721  VKTKAIRKMVNQLCWDVRKDALALTDAFDIPESCIKAPIA  760



>ref|WP_044187894.1| acyl-CoA oxidase [Hyalangium minutum]
 gb|KFE69122.1| Acyl-coenzyme A oxidase 1, peroxisomal [Hyalangium minutum]
Length=781

 Score =   118 bits (296),  Expect = 7e-27, Method: Composition-based stats.
 Identities = 65/159 (41%), Positives = 90/159 (57%), Gaps = 1/159 (1%)
 Frame = -3

Query  640  NPVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKH-SKNLGGFGAWNRCLNHLL  464
            NP   R  G +HLRD +FQ+ A R+R S LL S A RL+K     +  F A+ +  +HL 
Sbjct  618  NPFQVRRTGSEHLRDGDFQVRALRFRESDLLASAAARLRKRLGTGVDSFQAFIQVQDHLQ  677

Query  463  TLAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPNK  284
             LA +H+E  +LE F+  V+   DP+ +A L  +CDLY L  +    G +   D++   K
Sbjct  678  ALAHAHVERVVLEQFLAGVEQVEDPAVKAVLGKLCDLYGLGCLVEASGWFLENDHIESGK  737

Query  283  AKAINKLTEYLCFQVRNTAKDLVDAFDLPDYVIRAPIAL  167
            AKAI K    LC ++R  A  LV AFD+PD  + API L
Sbjct  738  AKAIRKEVTRLCAELRPDAVALVRAFDIPDSALAAPIGL  776



>ref|WP_019598670.1| hypothetical protein [Rhodonellum psychrophilum]
 gb|ERM81639.1| hypothetical protein P872_19995 [Rhodonellum psychrophilum GCM71 
= DSM 17998]
Length=767

 Score =   118 bits (296),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 62/164 (38%), Positives = 98/164 (60%), Gaps = 1/164 (1%)
 Frame = -3

Query  646  QPNPVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKH-SKNLGGFGAWNRCLNH  470
            + NP+  R    +HL D +F L+AFRYR   +L S A RL++  +  +  F A+N C +H
Sbjct  603  EKNPLIIRSTNSEHLLDFDFHLNAFRYREQAILGSAASRLKRLINGGMDSFDAFNVCQHH  662

Query  469  LLTLAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAP  290
            L+ + +++IE  +LE F + +KS  D  S+ AL  +C LYAL+ +  + G +   DY+  
Sbjct  663  LINVGQAYIERVVLEQFQEKIKSIADKGSKKALTQMCQLYALHTLEKNRGWFLEQDYMEG  722

Query  289  NKAKAINKLTEYLCFQVRNTAKDLVDAFDLPDYVIRAPIALQDS  158
             K KAI K+   LC+++R  A  L DAF +P+  + APIA ++S
Sbjct  723  VKTKAIRKMVNQLCWEIRPDAIALTDAFAIPESCLSAPIAKRES  766



>ref|WP_002612916.1| acyl-CoA dehydrogenase [Stigmatella aurantiaca]
 gb|EAU67561.1| acyl-coenzyme A oxidase, peroxisomal [Stigmatella aurantiaca 
DW4/3-1]
 gb|ADO74925.1| acyl-CoA dehydrogenase [Stigmatella aurantiaca DW4/3-1]
Length=777

 Score =   117 bits (293),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 64/159 (40%), Positives = 88/159 (55%), Gaps = 1/159 (1%)
 Frame = -3

Query  640  NPVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKH-SKNLGGFGAWNRCLNHLL  464
            NP  +R  G +HLRD +FQL A R+R + L+ S A RL+K     +  F A+N C +HLL
Sbjct  614  NPFQARRTGSEHLRDGDFQLGALRFREADLVASAARRLRKRLGSGMDSFQAFNECQDHLL  673

Query  463  TLAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPNK  284
             LA +H+E  +LE FI  +    D  +R  L  +CDLY L  + +  G +   D +   K
Sbjct  674  ALAHAHVERVVLEQFIAGIAWVEDLPTRTVLSKLCDLYGLGCLMDAGGWFVENDLLEGAK  733

Query  283  AKAINKLTEYLCFQVRNTAKDLVDAFDLPDYVIRAPIAL  167
            AKAI K    LC ++R  A  L  AF +PD  + API L
Sbjct  734  AKAIRKEVARLCAELRPDAVALTHAFGIPDTCLAAPIGL  772



>ref|WP_015352554.1| acyl-CoA dehydrogenase [Myxococcus stipitatus]
 ref|YP_007363984.1| acyl-CoA dehydrogenase [Myxococcus stipitatus DSM 14675]
 gb|AGC48300.1| acyl-CoA dehydrogenase [Myxococcus stipitatus DSM 14675]
Length=780

 Score =   115 bits (287),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 64/159 (40%), Positives = 91/159 (57%), Gaps = 1/159 (1%)
 Frame = -3

Query  640  NPVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKH-SKNLGGFGAWNRCLNHLL  464
            NP  +R    +HLRD +FQL   RYR   LL SVA RL+K  +  +  F A+N+   HL+
Sbjct  617  NPFAARRTDSEHLRDGDFQLRLLRYREEDLLASVAKRLRKRMAAGVEAFTAFNQVQAHLV  676

Query  463  TLAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPNK  284
             L+E+H+E  +LE F+  V+   DP  +  L  +CDLY L+ + +  G ++    V  +K
Sbjct  677  ALSEAHVERVVLEQFLLGVEKVQDPGLKTVLGRLCDLYGLSCLESGSGWFQEHGLVEASK  736

Query  283  AKAINKLTEYLCFQVRNTAKDLVDAFDLPDYVIRAPIAL  167
            A AI K    LC ++R  A  LVDAF +PD  + API L
Sbjct  737  ALAIRKEVVKLCTELRPDAVALVDAFGIPDTCLAAPIGL  775



>gb|AAB97825.1| acyl-CoA oxidase [Myxococcus xanthus DK 1622]
Length=433

 Score =   112 bits (279),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 60/159 (38%), Positives = 90/159 (57%), Gaps = 1/159 (1%)
 Frame = -3

Query  640  NPVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKH-SKNLGGFGAWNRCLNHLL  464
            NP  +R    DHLRD ++ L A R+R   LL +V+ R++K  S  +  F A+N+   HLL
Sbjct  270  NPFAARRTDSDHLRDNDYHLRALRFREEELLATVSQRIRKRLSAGVEAFEAFNQVQVHLL  329

Query  463  TLAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPNK  284
             LA +H+E  +LE F++ V    DP  +  L  +CDLY L+ + +  G ++   ++   K
Sbjct  330  ELAHAHVERLVLEQFLKGVADVKDPGLKTVLGRLCDLYGLSCLESANGWFQEHGWLEGTK  389

Query  283  AKAINKLTEYLCFQVRNTAKDLVDAFDLPDYVIRAPIAL  167
             KAI K    LC ++R  A  LV+AF +PD  + API L
Sbjct  390  VKAIRKEVTRLCAELRPDAVALVNAFGVPDTCLAAPIGL  428



>ref|WP_014773637.1| acyl-CoA oxidase [Belliella baltica]
 gb|AFL85697.1| acyl-CoA dehydrogenase [Belliella baltica DSM 15883]
Length=763

 Score =   114 bits (285),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 63/163 (39%), Positives = 91/163 (56%), Gaps = 1/163 (1%)
 Frame = -3

Query  646  QPNPVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKH-SKNLGGFGAWNRCLNH  470
            + NP+  R   + HL D +F L AF+YR   +L S A R+++H    +  F A+N   +H
Sbjct  601  EKNPLIIRSTEQTHLLDMDFHLSAFKYRERAILSSAAQRIKRHIDDGMDSFDAFNVVQHH  660

Query  469  LLTLAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAP  290
            L+ + +++IE  +LE F + V    D   + AL  +C LYALN I  + G Y    Y+  
Sbjct  661  LVNVGQAYIERVVLEEFQKEVMDTNDGDCKDALLQLCQLYALNTIEKNRGWYLEQGYMEG  720

Query  289  NKAKAINKLTEYLCFQVRNTAKDLVDAFDLPDYVIRAPIALQD  161
             K KAI K    LC++VR  A  L DAFD+P+  I APIA +D
Sbjct  721  VKTKAIRKEVNQLCWEVRKNALALTDAFDIPESCIAAPIASRD  763



>gb|ABF87186.1| putative acyl-CoA dehydrogenase [Myxococcus xanthus DK 1622]
Length=660

 Score =   112 bits (280),  Expect = 8e-25, Method: Composition-based stats.
 Identities = 60/159 (38%), Positives = 90/159 (57%), Gaps = 1/159 (1%)
 Frame = -3

Query  640  NPVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKH-SKNLGGFGAWNRCLNHLL  464
            NP  +R    DHLRD ++ L A R+R   LL +V+ R++K  S  +  F A+N+   HLL
Sbjct  497  NPFAARRTDSDHLRDNDYHLRALRFREEELLATVSKRIRKRLSAGVEAFEAFNQVQVHLL  556

Query  463  TLAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPNK  284
             LA +H+E  +LE F++ V    DP  +  L  +CDLY L+ + +  G ++   ++   K
Sbjct  557  ELAHAHVERLVLEQFLKGVADVKDPGLKTVLGRLCDLYGLSCLESANGWFQEHGWLEGTK  616

Query  283  AKAINKLTEYLCFQVRNTAKDLVDAFDLPDYVIRAPIAL  167
             KAI K    LC ++R  A  LV+AF +PD  + API L
Sbjct  617  VKAIRKEVTRLCAELRPDAVALVNAFGVPDTCLAAPIGL  655



>ref|WP_020478009.1| acyl-CoA dehydrogenase [Myxococcus xanthus]
Length=777

 Score =   111 bits (278),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 60/159 (38%), Positives = 90/159 (57%), Gaps = 1/159 (1%)
 Frame = -3

Query  640  NPVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKH-SKNLGGFGAWNRCLNHLL  464
            NP  +R    DHLRD ++ L A R+R   LL +V+ R++K  S  +  F A+N+   HLL
Sbjct  614  NPFAARRTDSDHLRDNDYHLRALRFREEELLATVSKRIRKRLSAGVEAFEAFNQVQVHLL  673

Query  463  TLAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPNK  284
             LA +H+E  +LE F++ V    DP  +  L  +CDLY L+ + +  G ++   ++   K
Sbjct  674  ELAHAHVERLVLEQFLKGVADVKDPGLKTVLGRLCDLYGLSCLESANGWFQEHGWLEGTK  733

Query  283  AKAINKLTEYLCFQVRNTAKDLVDAFDLPDYVIRAPIAL  167
             KAI K    LC ++R  A  LV+AF +PD  + API L
Sbjct  734  VKAIRKEVTRLCAELRPDAVALVNAFGVPDTCLAAPIGL  772



>ref|WP_013937938.1| acyl-CoA dehydrogenase [Myxococcus fulvus]
 gb|AEI64784.1| putative acyl-CoA dehydrogenase [Myxococcus fulvus HW-1]
Length=777

 Score =   110 bits (276),  Expect = 4e-24, Method: Composition-based stats.
 Identities = 61/159 (38%), Positives = 88/159 (55%), Gaps = 1/159 (1%)
 Frame = -3

Query  640  NPVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKH-SKNLGGFGAWNRCLNHLL  464
            NP  +R    DHLRD ++ L A R+R   LL +V+ R++K  S  +  F A+N+   HLL
Sbjct  614  NPFAARRTDSDHLRDNDYHLRALRFRVEELLATVSRRIRKRLSAGVEAFEAFNQVQVHLL  673

Query  463  TLAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPNK  284
             LA +H+E   LE F+  V    +P  +  L  +CDLY L+ +    G ++   ++   K
Sbjct  674  ELAHAHVERLALEQFLAGVAEVKEPGLKTVLGRLCDLYGLSCLEAASGWFQEHGWLEGTK  733

Query  283  AKAINKLTEYLCFQVRNTAKDLVDAFDLPDYVIRAPIAL  167
            AKAI K    LC ++R  A  LVDAF +PD  + API L
Sbjct  734  AKAIRKEVTRLCAELRPDAVALVDAFGVPDTCLAAPIGL  772



>ref|WP_002637005.1| acyl-CoA dehydrogenase [Myxococcus sp. (contaminant ex DSM 436)]
 gb|ERK90529.1| Acyl-coenzyme A oxidase 1, peroxisomal protein [Myxococcus sp. 
(contaminant ex DSM 436)]
Length=777

 Score =   110 bits (276),  Expect = 4e-24, Method: Composition-based stats.
 Identities = 60/159 (38%), Positives = 88/159 (55%), Gaps = 1/159 (1%)
 Frame = -3

Query  640  NPVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKH-SKNLGGFGAWNRCLNHLL  464
            NP  +R    DHLRD ++ L A R+R   LL +V+ R++K     +  F A+N+   H+L
Sbjct  614  NPFAARRTDSDHLRDNDYHLRALRFREEELLATVSKRIRKRLGAGVEAFEAFNQVQVHML  673

Query  463  TLAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPNK  284
             LA +H+E   LE F++ V    DP  +  L  +CDLY L+ +    G ++   ++   K
Sbjct  674  ELAHAHVERLALEQFLKGVAQVKDPGLKTVLGRLCDLYGLSCLEAASGWFQEHGWLEGAK  733

Query  283  AKAINKLTEYLCFQVRNTAKDLVDAFDLPDYVIRAPIAL  167
            AKAI K    LC ++R  A  LVDAF +PD  + API L
Sbjct  734  AKAIRKEVTRLCAELRPDAVALVDAFGIPDTCLAAPIGL  772



>ref|WP_026716117.1| acyl-CoA oxidase [Flavobacterium gelidilacus]
Length=755

 Score =   110 bits (275),  Expect = 5e-24, Method: Composition-based stats.
 Identities = 59/161 (37%), Positives = 94/161 (58%), Gaps = 1/161 (1%)
 Frame = -3

Query  646  QPNPVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKH-SKNLGGFGAWNRCLNH  470
            + NP+T+R   E+HL D +F L AF+YR   ++ S A R++K   K +  + A+N   + 
Sbjct  594  EKNPITTRNTDEEHLLDNDFHLKAFQYREKSIVASAANRIKKLIDKGMEPYDAFNVVQHQ  653

Query  469  LLTLAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAP  290
            +L +A++++E   LE F QA+++  D + + AL  V  LYAL++I  +   Y    Y+  
Sbjct  654  MLEVAQAYLERVTLEQFQQAIETIEDEAVKTALTKVAQLYALHQIEKNKAWYLEQGYMEA  713

Query  289  NKAKAINKLTEYLCFQVRNTAKDLVDAFDLPDYVIRAPIAL  167
             K KA+ K+   LC+ +R  A  LVDAF +PD  + APIA 
Sbjct  714  VKTKAVRKMVNQLCWDIRPDAIALVDAFAIPDSCLAAPIAF  754



>ref|XP_004362274.1| acyl-CoA oxidase [Dictyostelium fasciculatum]
 gb|EGG24423.1| acyl-CoA oxidase [Dictyostelium fasciculatum]
Length=661

 Score =   109 bits (273),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 59/163 (36%), Positives = 93/163 (57%), Gaps = 1/163 (1%)
 Frame = -3

Query  640  NPVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGG-FGAWNRCLNHLL  464
            NP+T+R   E H+    F LDA  YR+S+LL   A  + K+ K     F +WN  L  L+
Sbjct  474  NPITTRRSDEKHILSLKFLLDAMEYRSSKLLIDSANTVAKNYKETKKPFDSWNVSLEILV  533

Query  463  TLAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPNK  284
             LA++H E+ I+  FI+++K+  D   + +LK +C LYAL +I  D   +RN +Y+   K
Sbjct  534  HLAKAHTETIIVTKFIESIKAVQDRELKDSLKKLCQLYALCKIREDFEFFRNTNYLKNGK  593

Query  283  AKAINKLTEYLCFQVRNTAKDLVDAFDLPDYVIRAPIALQDSE  155
            A AI K+   LCF++   A  LV+ F   + ++ +P+ L D +
Sbjct  594  AIAIGKIISTLCFELSREAITLVEGFGNDEELLESPLGLADGD  636



>ref|WP_016988806.1| acyl-CoA oxidase [Flavobacterium sp. ACAM 123]
Length=752

 Score =   108 bits (269),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 58/161 (36%), Positives = 93/161 (58%), Gaps = 1/161 (1%)
 Frame = -3

Query  646  QPNPVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKH-SKNLGGFGAWNRCLNH  470
            + NP+ +R   + HL D  F LDAF+YR    L S A R++K     L  + A+N   + 
Sbjct  592  EKNPIVTRKTDDSHLIDEEFHLDAFQYREKTTLASAAKRIKKLIDSGLDPYDAFNIVQHQ  651

Query  469  LLTLAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAP  290
            ++ +A++++E  +LE F +AV++  D +S+  +  +  LYAL++I  + G Y    Y+  
Sbjct  652  MIDVAQAYLERVVLEQFQEAVQNIEDKNSKEVMLKLYQLYALSQIEKNKGWYLEDGYMEA  711

Query  289  NKAKAINKLTEYLCFQVRNTAKDLVDAFDLPDYVIRAPIAL  167
             K KAI K+   LC+++R  A  LV AFD+PD  + APIA 
Sbjct  712  VKTKAIRKMVNQLCWEIRPDAVSLVKAFDIPDSCLAAPIAF  752



>ref|WP_013453510.1| acyl-CoA oxidase [Marivirga tractuosa]
 gb|ADR21361.1| acyl-CoA oxidase domain-containing protein [Marivirga tractuosa 
DSM 4126]
Length=764

 Score =   108 bits (269),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 59/161 (37%), Positives = 90/161 (56%), Gaps = 1/161 (1%)
 Frame = -3

Query  646  QPNPVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKH-SKNLGGFGAWNRCLNH  470
            + NP+T R   E HL D  F L+AF+YR   ++ S   R+++   + +  F A N   +H
Sbjct  603  EKNPITVRSTDEKHLLDFEFHLNAFKYRERAIVASAGQRIKRLVDEGMDSFDAVNVAQHH  662

Query  469  LLTLAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAP  290
            L+ +  S+IE  +LE F  AV++  + + R AL+ +C LYAL+ I  + G Y    Y+  
Sbjct  663  LINVGRSYIERKVLERFQLAVETTQNKACREALQQLCQLYALHTIEQNKGWYLEQGYMEG  722

Query  289  NKAKAINKLTEYLCFQVRNTAKDLVDAFDLPDYVIRAPIAL  167
             K KAI K+   LC++ R  A    DAF +PD ++ APIA 
Sbjct  723  VKTKAIRKMVNQLCWESRQDAIGFTDAFGIPDKLLAAPIAF  763



>ref|WP_035694733.1| acyl-CoA oxidase [Flavobacterium soli]
Length=753

 Score =   107 bits (268),  Expect = 5e-23, Method: Composition-based stats.
 Identities = 57/159 (36%), Positives = 92/159 (58%), Gaps = 1/159 (1%)
 Frame = -3

Query  646  QPNPVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKH-SKNLGGFGAWNRCLNH  470
            Q NP  +R   E HL D  F L+AF+YR  ++L S A RL+K   + L  + A+N   + 
Sbjct  592  QKNPFATRNTDEAHLLDKEFHLNAFQYREKQILNSAAKRLKKLIDEGLDSYDAFNVVQHQ  651

Query  469  LLTLAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAP  290
            ++ +A++++E   LE F   ++S  D + +  L  +C LYAL++I  + G +    Y+  
Sbjct  652  MIEVAQAYLERVTLEQFYTEIESIKDENCKTILTELCQLYALSQIEKNKGWFLEDGYMEG  711

Query  289  NKAKAINKLTEYLCFQVRNTAKDLVDAFDLPDYVIRAPI  173
             K KAI K+   LC+++R  A  LV+AFD+P+  + API
Sbjct  712  VKTKAIRKMVNQLCWEIRPNAVALVEAFDIPESCLAAPI  750



>dbj|GAM18567.1| hypothetical protein SAMD00019534_017420 [Acytostelium subglobosum 
LB1]
Length=672

 Score =   106 bits (265),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 59/159 (37%), Positives = 90/159 (57%), Gaps = 3/159 (2%)
 Frame = -3

Query  640  NPVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSV--AIRLQKHSKNLGGFGAWNRCLNHL  467
            N    R   E HL DP   LDAF YR  ++L+ +  ++R +  S+ + G  AWN  L+ +
Sbjct  502  NFFVKRLHTEAHLLDPEMLLDAFIYREFKVLRQLVKSLRTKVKSEKMTGAKAWNASLDLV  561

Query  466  LTLAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPN  287
            + LA  ++E   +E F+Q ++   D   +  L L+C L+ L +I  D+G + +  Y AP 
Sbjct  562  MKLATCYVERLTIERFLQEIQKSSD-DVKPILNLLCVLFCLTKIERDMGWFLSNKYFAPV  620

Query  286  KAKAINKLTEYLCFQVRNTAKDLVDAFDLPDYVIRAPIA  170
            KA+AI      +C  +R+ A  LV AFD+PDY+I APIA
Sbjct  621  KAQAIENAINKVCVSMRDHALPLVKAFDIPDYLISAPIA  659



>dbj|GAK93201.1| acyl-coenzyme A oxidase 1 [Nonlabens ulvanivorans]
Length=288

 Score =   102 bits (255),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 58/161 (36%), Positives = 93/161 (58%), Gaps = 5/161 (3%)
 Frame = -3

Query  646  QPNPVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGAWNRCLN--  473
            + N + +R   E+HL    FQL AF YR    L+S+A+RL K  K  GG  ++   L+  
Sbjct  127  ELNALVTRDTSEEHLLGDEFQLAAFTYREEYSLRSLAMRLSKKIK--GGMDSYEAFLDVQ  184

Query  472  -HLLTLAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYV  296
             HL+ +A ++I+  +LE FI+ +K     S +  L  + +LYAL+RI    G Y   DY+
Sbjct  185  VHLIDMASAYIDRIVLEQFIETIKEQEQNSVKEVLISLKNLYALHRIEEYKGWYLEHDYI  244

Query  295  APNKAKAINKLTEYLCFQVRNTAKDLVDAFDLPDYVIRAPI  173
            + +K+ AINKL   LC +++  ++ LVDAFD+P ++    +
Sbjct  245  SASKSLAINKLVSKLCKELKEESQHLVDAFDIPAHMTATAL  285



>ref|WP_018102778.1| MULTISPECIES: acyl-CoA oxidase [Streptomyces]
Length=651

 Score =   105 bits (263),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 56/155 (36%), Positives = 89/155 (57%), Gaps = 1/155 (1%)
 Frame = -3

Query  637  PVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGA-WNRCLNHLLT  461
            P    W+ E  L DP +QL   R+R   +L  VA RL++        GA ++R  +H++ 
Sbjct  493  PGGDEWDREAGLLDPEYQLAMVRFREEHMLAGVARRLKRGMDAHEDPGAVFSRVQDHVIA  552

Query  460  LAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPNKA  281
            +A +H+E  +LE F   V++ PD   + AL+L+CDL+AL+ I  D   +     +   ++
Sbjct  553  VARAHVERLVLEAFTDRVRALPDGGDKEALRLLCDLFALSVIEADRAWFMEHGRLTVQRS  612

Query  280  KAINKLTEYLCFQVRNTAKDLVDAFDLPDYVIRAP  176
            KAI++    LC +VR  A DLVDA+ +PD ++RAP
Sbjct  613  KAISREVNDLCRKVRPLAVDLVDAWGIPDEMLRAP  647



>ref|WP_030226700.1| acyl-CoA oxidase [Streptomyces lavendulae]
Length=656

 Score =   105 bits (262),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 56/155 (36%), Positives = 89/155 (57%), Gaps = 1/155 (1%)
 Frame = -3

Query  637  PVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGA-WNRCLNHLLT  461
            P    W+ E  L DP +QL  FR+R   LL  +A R+++        GA +++  +H++ 
Sbjct  498  PGGDDWDREAGLLDPEYQLAMFRFREEHLLAGLARRIKRGIDQERAAGAVFSQVQDHVIA  557

Query  460  LAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPNKA  281
            LA SH+E  + E F+  V++ P+   +AAL L+CDL+AL+ I  D   +     +   ++
Sbjct  558  LARSHVERLVAEAFVDQVRALPEGGGKAALGLLCDLFALSAIEADRAWFMEHGRLTVQRS  617

Query  280  KAINKLTEYLCFQVRNTAKDLVDAFDLPDYVIRAP  176
            KAI++    LC +VR  A DLVDA+ +P  V+RAP
Sbjct  618  KAISREVNDLCRKVRPLAVDLVDAWGVPSAVLRAP  652



>ref|WP_014044514.1| MULTISPECIES: acyl-CoA oxidase [Streptomyces]
 gb|AEN08522.1| acyl-CoA oxidase domain protein [Streptomyces sp. SirexAA-E]
Length=653

 Score =   105 bits (262),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 54/155 (35%), Positives = 89/155 (57%), Gaps = 1/155 (1%)
 Frame = -3

Query  637  PVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGA-WNRCLNHLLT  461
            P    W+ E  L D  +QL   RYR   +L  VA RL++     G  G  +++  +H++ 
Sbjct  495  PGGDEWDQEAGLLDSEYQLAMLRYREEHMLAGVARRLKRGVDQKGNPGVVFSQVQDHVIA  554

Query  460  LAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPNKA  281
            +A +H+E  +LE F++ V++ PD  ++ AL L+CDL+AL+ I  D   +     +   ++
Sbjct  555  VAHAHVERLVLEAFVEKVRALPDSGNKVALGLLCDLFALSTIEADRAWFMEHGRLTVQRS  614

Query  280  KAINKLTEYLCFQVRNTAKDLVDAFDLPDYVIRAP  176
            KAI++    LC +VR  A DLVDA+ +P  ++RAP
Sbjct  615  KAISREVNDLCRKVRPLAVDLVDAWGIPSEMLRAP  649



>dbj|GAK89315.1| acyl-coenzyme A oxidase 1 [Nonlabens ulvanivorans]
Length=288

 Score =   102 bits (254),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 58/161 (36%), Positives = 93/161 (58%), Gaps = 5/161 (3%)
 Frame = -3

Query  646  QPNPVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGAWNRCLN--  473
            + N + +R   E+HL    FQL AF YR    L+S+A+RL K  K  GG  ++   L+  
Sbjct  127  ELNALVTRDTSEEHLLGDEFQLAAFTYREEYSLRSLAMRLSKKIK--GGMDSYEAFLDVQ  184

Query  472  -HLLTLAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYV  296
             HL+ +A ++I+  +LE FI+ +K     S +  L  + +LYAL+RI    G Y   DY+
Sbjct  185  VHLIDMASAYIDRIVLEQFIKTIKEQEQNSVKEVLISLKNLYALHRIEEYKGWYLEHDYI  244

Query  295  APNKAKAINKLTEYLCFQVRNTAKDLVDAFDLPDYVIRAPI  173
            + +K+ AINKL   LC +++  ++ LVDAFD+P ++    +
Sbjct  245  SASKSLAINKLVSKLCKELKEESQHLVDAFDIPAHMTATAL  285



>ref|WP_006797234.1| acyl-CoA oxidase [Flavobacteria bacterium BBFL7]
 gb|EAS19960.1| acyl-CoA oxidase [Flavobacteria bacterium BBFL7]
Length=768

 Score =   105 bits (262),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 57/152 (38%), Positives = 92/152 (61%), Gaps = 1/152 (1%)
 Frame = -3

Query  640  NPVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKN-LGGFGAWNRCLNHLL  464
            NP+ +R   EDHL D +F L AF YR    L+S+A+RL K  KN +  + A+ +   HL+
Sbjct  609  NPLVTRDTSEDHLLDNDFLLSAFSYREEYSLRSLAMRLSKKIKNGMDSYEAFLQVQVHLI  668

Query  463  TLAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPNK  284
             +A ++I+  +LE FI  +    + S +  L  + +LYAL+RI  + G Y   DY++ +K
Sbjct  669  DMASAYIDRIVLERFIATIDEQENESVKEILTSLKNLYALHRIEENKGWYLEHDYISGSK  728

Query  283  AKAINKLTEYLCFQVRNTAKDLVDAFDLPDYV  188
            + AINKL + LC + +  ++ LVD FD+P ++
Sbjct  729  SLAINKLVQKLCEEFKEDSQHLVDVFDIPKHM  760



>ref|WP_007810516.1| acyl-CoA oxidase [Flavobacterium sp. CF136]
 gb|EJL60869.1| acyl-CoA dehydrogenase [Flavobacterium sp. CF136]
Length=753

 Score =   105 bits (261),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 58/161 (36%), Positives = 93/161 (58%), Gaps = 1/161 (1%)
 Frame = -3

Query  646  QPNPVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKH-SKNLGGFGAWNRCLNH  470
            + NP+ +R    +HL D  F L AF +R   +L S A R++K   + L  + A+N   + 
Sbjct  592  EKNPIITRKTDGEHLLDNQFHLQAFHHREKTILASAARRIKKLIDEGLEAYDAFNVVQHQ  651

Query  469  LLTLAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAP  290
            ++ +A++++E  +LE F +AVKS  D  S+  L  +  LYAL++I  + G Y    Y+  
Sbjct  652  MIDVAQAYLERVVLEQFQEAVKSVEDEKSKEILIKLNQLYALSQIEKNKGWYLEDGYMEA  711

Query  289  NKAKAINKLTEYLCFQVRNTAKDLVDAFDLPDYVIRAPIAL  167
             K KAI K+   LC+ +R  A  LV+AFD+P+  + APIA+
Sbjct  712  VKTKAIRKMVNQLCWDIRPDAVSLVNAFDIPESCLAAPIAV  752



>gb|EFA78532.1| putative acyl-CoA oxidase [Polysphondylium pallidum PN500]
Length=669

 Score =   104 bits (259),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 60/159 (38%), Positives = 89/159 (56%), Gaps = 3/159 (2%)
 Frame = -3

Query  640  NPVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKN--LGGFGAWNRCLNHL  467
            N    R   E HL D    LDAF YR  +LL+ +   L+   KN  + G  AWN CL+ +
Sbjct  499  NFFVKRLHTESHLLDAEMLLDAFIYREFKLLRQLVKSLRTKVKNEKMSGAKAWNSCLDLV  558

Query  466  LTLAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPN  287
              LA S++E   +E F++ ++   D   +  L L+C L+AL +I  D+G + +  Y AP 
Sbjct  559  HKLAISYVERVTIEKFLEEIQKS-DEGIKPILSLLCILFALTKIEGDMGWFLSNKYFAPV  617

Query  286  KAKAINKLTEYLCFQVRNTAKDLVDAFDLPDYVIRAPIA  170
            KA+AI      +C  +R  A  LV+AFD+P+++I APIA
Sbjct  618  KAQAIENAINKVCGALREHALPLVNAFDIPEHLISAPIA  656



>ref|WP_043324301.1| acyl-CoA oxidase, partial [Corallococcus coralloides]
Length=781

 Score =   104 bits (260),  Expect = 6e-22, Method: Composition-based stats.
 Identities = 59/159 (37%), Positives = 89/159 (56%), Gaps = 1/159 (1%)
 Frame = -3

Query  640  NPVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKH-SKNLGGFGAWNRCLNHLL  464
            NP+  R    DHLRD +FQL A R+R   LL SV+ R++K  +  +  F A+N+   HLL
Sbjct  618  NPIAGRRTDTDHLRDSDFQLRALRFREEALLASVSKRIRKRLTAGVEAFEAFNQVQAHLL  677

Query  463  TLAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPNK  284
             LA + +E  +LE F++ V    D + +  L  + DL+ L+ + +  G +    ++   K
Sbjct  678  ALAHASVERIVLEQFLRGVADVKDEALKPVLGRMADLFGLSCLESASGWFLEHGWLTAPK  737

Query  283  AKAINKLTEYLCFQVRNTAKDLVDAFDLPDYVIRAPIAL  167
            A+AI K    LC ++R  A  LVDAF +PD  + API L
Sbjct  738  AQAIRKERVKLCEELRPDAVGLVDAFGIPDTCLAAPIGL  776



>gb|AFE09438.1| putative acyl-CoA dehydrogenase [Corallococcus coralloides DSM 
2259]
Length=804

 Score =   104 bits (260),  Expect = 6e-22, Method: Composition-based stats.
 Identities = 59/159 (37%), Positives = 89/159 (56%), Gaps = 1/159 (1%)
 Frame = -3

Query  640  NPVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKH-SKNLGGFGAWNRCLNHLL  464
            NP+  R    DHLRD +FQL A R+R   LL SV+ R++K  +  +  F A+N+   HLL
Sbjct  618  NPIAGRRTDTDHLRDSDFQLRALRFREEALLASVSKRIRKRLTAGVEAFEAFNQVQAHLL  677

Query  463  TLAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPNK  284
             LA + +E  +LE F++ V    D + +  L  + DL+ L+ + +  G +    ++   K
Sbjct  678  ALAHASVERIVLEQFLRGVADVKDEALKPVLGRMADLFGLSCLESASGWFLEHGWLTAPK  737

Query  283  AKAINKLTEYLCFQVRNTAKDLVDAFDLPDYVIRAPIAL  167
            A+AI K    LC ++R  A  LVDAF +PD  + API L
Sbjct  738  AQAIRKERVKLCEELRPDAVGLVDAFGIPDTCLAAPIGL  776



>ref|WP_015360696.1| acyl-CoA oxidase domain-containing protein [Nonlabens dokdonensis]
 gb|AGC75198.1| acyl-CoA oxidase domain-containing protein [Nonlabens dokdonensis 
DSW-6]
Length=768

 Score =   104 bits (259),  Expect = 6e-22, Method: Composition-based stats.
 Identities = 56/152 (37%), Positives = 92/152 (61%), Gaps = 1/152 (1%)
 Frame = -3

Query  640  NPVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKN-LGGFGAWNRCLNHLL  464
            NP+ +R   E+HL   +FQL AF YR    L+S+A+RL K  K  +  + A+     HL+
Sbjct  609  NPLVTRDTSEEHLLSNDFQLAAFTYREEYSLRSLAMRLSKKIKEGMDSYDAFLHVQVHLI  668

Query  463  TLAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPNK  284
             +A ++I+  +LE FI  +    D S +  L  + +LYAL+RI  + G Y   DY++ +K
Sbjct  669  DMASAYIDRIVLERFIATIDEQEDASLKEILTSLKNLYALHRIEENKGWYLEHDYISGSK  728

Query  283  AKAINKLTEYLCFQVRNTAKDLVDAFDLPDYV  188
            + +INKL + LC +++  ++ LVDAFD+P ++
Sbjct  729  SLSINKLVQKLCKELKEESQHLVDAFDIPKHM  760



>ref|WP_013828514.1| acyl-CoA oxidase [Mycobacterium sp. JDM601]
 gb|AEF35578.1| acyl-CoA dehydrogenase [Mycobacterium sp. JDM601]
Length=649

 Score =   103 bits (257),  Expect = 8e-22, Method: Composition-based stats.
 Identities = 55/142 (39%), Positives = 84/142 (59%), Gaps = 0/142 (0%)
 Frame = -3

Query  619  EGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGAWNRCLNHLLTLAESHIE  440
            E E  L +   QL  F  R   LL SVA RL+  S+ +  F A+N   +H+L  A +HI+
Sbjct  489  EEEGSLFNRGTQLHMFTDREEYLLTSVARRLRAKSEEMSDFDAFNAVQDHVLHAAAAHID  548

Query  439  SFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPNKAKAINKLT  260
              +LE F+  ++SCPD ++R  L+LVCDLYAL+ I +D   Y    Y++ ++AKA+ +  
Sbjct  549  RVVLEAFVAGIESCPDAAARELLELVCDLYALSVIEDDKAWYIEHRYLSTDRAKAVTRGI  608

Query  259  EYLCFQVRNTAKDLVDAFDLPD  194
               C ++R  A+ LVD F +P+
Sbjct  609  NDRCRKLRPHAETLVDGFGIPE  630



>ref|WP_036457059.1| acyl-CoA oxidase [Mycobacterium sp. UM_WGJ]
Length=651

 Score =   103 bits (257),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 53/142 (37%), Positives = 83/142 (58%), Gaps = 0/142 (0%)
 Frame = -3

Query  619  EGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGAWNRCLNHLLTLAESHIE  440
            E E  L +   Q+  F  R   LL SVA RL+  ++ +  F A+N   +HLL  A +HI+
Sbjct  487  EEEGSLFNRGTQVHMFEDREEYLLTSVARRLRGKAQEMSDFDAFNAVQDHLLHAATAHID  546

Query  439  SFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPNKAKAINKLT  260
              +LE F+  + SCPDP +R  L+LVCDLYAL+ I +D   +    Y++ ++AKA+ +  
Sbjct  547  RVVLEAFVAGIDSCPDPDARELLELVCDLYALSVIEDDKAWFIEHRYLSTDRAKAVTRGI  606

Query  259  EYLCFQVRNTAKDLVDAFDLPD  194
               C ++R  A+ L+D F +P+
Sbjct  607  NDRCRKLRPHAQTLIDGFGIPE  628



>ref|WP_036358810.1| acyl-CoA oxidase [Mycobacterium asiaticum]
Length=646

 Score =   103 bits (256),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 53/142 (37%), Positives = 80/142 (56%), Gaps = 0/142 (0%)
 Frame = -3

Query  619  EGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGAWNRCLNHLLTLAESHIE  440
            E E  L +   Q+  F  R   LL SVA RLQ  SK +  F A+N   +H+L  A++HI+
Sbjct  490  EEEGSLFNRGTQVSMFEDREDYLLSSVARRLQGKSKEMSAFDAFNAVQDHVLHAAQAHID  549

Query  439  SFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPNKAKAINKLT  260
              +LE F+  + +CPDP +R  L ++CDLYAL+ I  D   +    Y++  +AKA+ +  
Sbjct  550  RIVLEAFVAGIDACPDPEARELLDVICDLYALSVIEEDKAWFIEHRYLSTERAKAVTRGI  609

Query  259  EYLCFQVRNTAKDLVDAFDLPD  194
               C  +R  A+ LVD F +P+
Sbjct  610  NDRCRVLRPHARTLVDGFGIPE  631



>ref|WP_030220322.1| acyl-CoA oxidase [Streptomyces bikiniensis]
Length=653

 Score =   103 bits (256),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 55/155 (35%), Positives = 88/155 (57%), Gaps = 1/155 (1%)
 Frame = -3

Query  637  PVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGA-WNRCLNHLLT  461
            P    W+ E  L DP +QL   RYR   +L  VA RL+         GA +++  +H++ 
Sbjct  495  PGGDEWDREAGLLDPEYQLAMLRYREEHMLAGVARRLKHGIDRKQDPGAVFSQVQDHVIA  554

Query  460  LAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPNKA  281
            LA +H+E  +LE F++ V++ P+  ++ AL L+CDL+AL+ I  D   +     +   ++
Sbjct  555  LAHAHVERLVLEAFVEKVRALPEGGNKDALGLLCDLFALSTIEADRAWFMEHGRLTVQRS  614

Query  280  KAINKLTEYLCFQVRNTAKDLVDAFDLPDYVIRAP  176
            KAI +    LC +VR  A DLVDA+ +P  ++RAP
Sbjct  615  KAITREVNDLCRKVRPLAADLVDAWRVPPEMLRAP  649



>ref|WP_019734689.1| acyl-CoA oxidase, partial [Mycobacterium avium]
Length=461

 Score =   101 bits (252),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 54/142 (38%), Positives = 82/142 (58%), Gaps = 0/142 (0%)
 Frame = -3

Query  619  EGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGAWNRCLNHLLTLAESHIE  440
            E E  L +   Q+  F  R   LL SVA RL+  S  +  F A+N   +H+L  A +HI+
Sbjct  306  EEEGSLFNRGTQVHMFEDREEYLLTSVARRLRAKSSEMSDFDAFNAVQDHVLHAAAAHID  365

Query  439  SFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPNKAKAINKLT  260
              +LE F+  ++SCPD  +R  L+LVCDLYAL+ I +D   Y    Y++ ++AKA+ +  
Sbjct  366  RVVLEAFVAGIESCPDAEARELLELVCDLYALSVIEDDKAWYIEHRYLSTDRAKAVTRGI  425

Query  259  EYLCFQVRNTAKDLVDAFDLPD  194
               C ++R  A+ LVD F +P+
Sbjct  426  NDRCRKLRPHAQTLVDGFGIPE  447



>ref|WP_030112306.1| acyl-CoA oxidase, partial [Streptomyces californicus]
Length=303

 Score = 99.8 bits (247),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 53/155 (34%), Positives = 84/155 (54%), Gaps = 1/155 (1%)
 Frame = -3

Query  637  PVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGA-WNRCLNHLLT  461
            P    W+ E  L D  +QL   RYR   +L  VA RL++        G  ++   +H++ 
Sbjct  143  PGGDEWDQEAGLLDSEYQLAMVRYREEHMLAGVARRLKRGMDQKRDPGTVFSEVQDHVIA  202

Query  460  LAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPNKA  281
            LA +H+E  +LE F+  V++ PD   + AL L+CDL+AL  I  D   +     +   ++
Sbjct  203  LAHAHMERLVLEAFVDRVRALPDGGDKVALGLLCDLHALTTIEADRAWFMEHGRLTVQRS  262

Query  280  KAINKLTEYLCFQVRNTAKDLVDAFDLPDYVIRAP  176
            K+I +    LC ++R  A DLVDA+++P  V+RAP
Sbjct  263  KSITREVNDLCRKIRPLAGDLVDAWNIPSAVLRAP  297



>ref|WP_030762017.1| acyl-CoA oxidase [Streptomyces griseus]
Length=653

 Score =   102 bits (254),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 55/155 (35%), Positives = 89/155 (57%), Gaps = 1/155 (1%)
 Frame = -3

Query  637  PVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGA-WNRCLNHLLT  461
            P    W+ E  L DP +QL   R+R   +L  +A RL+         GA ++   +H++ 
Sbjct  495  PGGDEWDREAGLLDPEYQLAMVRFREEHMLGGLARRLKAGVDGGRDPGAVFSSVQDHVIA  554

Query  460  LAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPNKA  281
            LA +H+E  +LE F+ AV++ P+  ++ ALKL+CDL+AL+ I  D   +     +   ++
Sbjct  555  LAHAHVERLVLESFVHAVRALPEGGNKTALKLLCDLHALSAIEADRAWFMEHGRLTVQRS  614

Query  280  KAINKLTEYLCFQVRNTAKDLVDAFDLPDYVIRAP  176
            KAI++    LC +VR  A DLVDA+ +P  ++RAP
Sbjct  615  KAISREVNELCREVRPLAVDLVDAWQVPPPLLRAP  649



>ref|WP_019683694.1| acyl-CoA oxidase, partial [Mycobacterium avium]
Length=356

 Score = 99.8 bits (247),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 53/142 (37%), Positives = 78/142 (55%), Gaps = 0/142 (0%)
 Frame = -3

Query  619  EGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGAWNRCLNHLLTLAESHIE  440
            E E  L +   Q+  F  R   LL SVA RLQ  SK +  F A+N   +H+L  A +HI+
Sbjct  196  EEEGSLFNRGTQIKMFEDREEYLLASVARRLQAKSKEMSEFDAFNSVQDHVLHAASAHID  255

Query  439  SFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPNKAKAINKLT  260
              +LE F+  +  CPD  +R  L ++CDLYAL+ I +D   Y    Y++  +AKA+ +  
Sbjct  256  RVVLEAFVAGIDGCPDEQARELLGILCDLYALSVIEDDKAWYIEHRYLSTERAKAVTRGI  315

Query  259  EYLCFQVRNTAKDLVDAFDLPD  194
               C  +R  A+ LVD F +P+
Sbjct  316  NDRCRALRPHAQTLVDGFGIPE  337



>ref|WP_018550940.1| acyl-CoA oxidase [Streptomyces sp. ATexAB-D23]
Length=653

 Score =   102 bits (253),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 55/155 (35%), Positives = 88/155 (57%), Gaps = 1/155 (1%)
 Frame = -3

Query  637  PVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGA-WNRCLNHLLT  461
            P    W+ E  L DP +QL   R+R   +L  VA RL++   +    GA +++  +H++ 
Sbjct  495  PGGDEWDREAGLLDPEYQLAMVRFREEHMLAGVARRLKRGIDDRRDPGAVFSQVQDHVIA  554

Query  460  LAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPNKA  281
            LA +H+E  +LE F   V+  P+  +R AL L+CDL+AL+ I  D   +     +   ++
Sbjct  555  LARAHVERLVLEAFTDKVRGLPEGGNRTALGLLCDLFALSTIEADRAWFMEHGRLTVQRS  614

Query  280  KAINKLTEYLCFQVRNTAKDLVDAFDLPDYVIRAP  176
            KAI++    LC +VR  A DLVDA+ +P  ++RAP
Sbjct  615  KAISREVNDLCRKVRPLAVDLVDAWGIPPEMLRAP  649



>ref|WP_033441505.1| acyl-CoA oxidase [Saccharothrix sp. NRRL B-16314]
Length=617

 Score =   101 bits (252),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 54/146 (37%), Positives = 85/146 (58%), Gaps = 1/146 (1%)
 Frame = -3

Query  610  DHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGAWNRCLNHLLTLAESHIESFI  431
            D L D  +Q+  F  R   +L+ +A RL++ SK    F  +N   +H+L  A +H++  +
Sbjct  471  DALLDRGWQVRQFEDREKHVLEGLARRLRRASKE-NAFDVFNAAQDHVLHAARAHVDRVV  529

Query  430  LEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPNKAKAINKLTEYL  251
            LE F+ AV  C DPS+ A L  VCDLYAL+ I  D   +     + P +AKA+++    L
Sbjct  530  LEAFVAAVDRCGDPSTSALLDEVCDLYALSTIEADRAWFLEHGRLTPQRAKAVSQAVNEL  589

Query  250  CFQVRNTAKDLVDAFDLPDYVIRAPI  173
            C ++R  A+ LVDAF +P+ ++ AP+
Sbjct  590  CGRLRPHARALVDAFGIPESLLTAPM  615



>gb|EUA10788.1| acyl-CoA dehydrogenase, C-terminal domain protein [Mycobacterium 
kansasii 732]
Length=621

 Score =   101 bits (252),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 54/142 (38%), Positives = 80/142 (56%), Gaps = 0/142 (0%)
 Frame = -3

Query  619  EGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGAWNRCLNHLLTLAESHIE  440
            E E  L +   Q+  F  R   LL SVA RLQ  S  +  F A+N   +H+L  A++HI+
Sbjct  465  EEEGSLFNRGTQVKMFEDREEYLLSSVARRLQSKSNEMSAFDAFNAVQDHVLHAAQAHID  524

Query  439  SFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPNKAKAINKLT  260
              +LE F+  ++SCPD  +R  L+ VCDLYAL+ I +D   Y    +++  +AKA+ +  
Sbjct  525  RVVLEAFVAGIESCPDREAREVLEAVCDLYALSVIEDDKAWYIEHRFLSTERAKAVTRGI  584

Query  259  EYLCFQVRNTAKDLVDAFDLPD  194
               C  +R  AK LVD F +P+
Sbjct  585  NDRCRVLRPHAKTLVDGFGIPE  606



>ref|WP_031088727.1| acyl-CoA oxidase [Streptomyces sp. NRRL WC-3549]
Length=653

 Score =   101 bits (252),  Expect = 4e-21, Method: Composition-based stats.
 Identities = 53/155 (34%), Positives = 90/155 (58%), Gaps = 1/155 (1%)
 Frame = -3

Query  637  PVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGA-WNRCLNHLLT  461
            P    W+ E  L DP +QL   RYR   +L  VA RL++        GA +++  +H++ 
Sbjct  495  PGGDEWDREAGLLDPEYQLAMLRYREEHMLAGVARRLKRGVDQERDPGAVFSQVQDHVIA  554

Query  460  LAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPNKA  281
            +A +H+E  +LE F++ +++ P+  ++ AL L+CDL+AL+ I  D   +     +   ++
Sbjct  555  VAHAHVERLVLEAFVEKLRALPEGGNKVALGLLCDLFALSTIEADRAWFMEHGRLTVPRS  614

Query  280  KAINKLTEYLCFQVRNTAKDLVDAFDLPDYVIRAP  176
            KAI++    LC +VR  A DLVDA+ +P  ++RAP
Sbjct  615  KAISREVNDLCRKVRPLAVDLVDAWGIPPEMLRAP  649



>ref|WP_043247513.1| acyl-CoA oxidase [Streptomyces vinaceus]
Length=655

 Score =   101 bits (252),  Expect = 4e-21, Method: Composition-based stats.
 Identities = 54/155 (35%), Positives = 84/155 (54%), Gaps = 1/155 (1%)
 Frame = -3

Query  637  PVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGA-WNRCLNHLLT  461
            P    W+ E  L D  +QL   RYR   +L  VA RL++        G  ++   +H++ 
Sbjct  495  PGGDEWDQEAGLLDSEYQLAMVRYREEHMLAGVARRLKRGMDQKRDPGTVFSEVQDHVIA  554

Query  460  LAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPNKA  281
            LA +H+E  +LE F+  V++ PD   + AL L+CDLYAL  I  D   +     +   ++
Sbjct  555  LAHAHMERLVLEAFVDRVRALPDGGDKVALGLLCDLYALTTIEADRAWFMEHGRLTVQRS  614

Query  280  KAINKLTEYLCFQVRNTAKDLVDAFDLPDYVIRAP  176
            K+I +    LC ++R  A DLVDA+++P  V+RAP
Sbjct  615  KSITREVNDLCRKIRPLAGDLVDAWNIPSAVLRAP  649



>ref|WP_031053630.1| acyl-CoA oxidase [Streptomyces sp. NRRL F-5702]
Length=655

 Score =   101 bits (252),  Expect = 4e-21, Method: Composition-based stats.
 Identities = 54/155 (35%), Positives = 84/155 (54%), Gaps = 1/155 (1%)
 Frame = -3

Query  637  PVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGA-WNRCLNHLLT  461
            P    W+ E  L D  +QL   RYR   +L  VA RL++        G  ++   +H++ 
Sbjct  495  PGGDEWDQEAGLLDSEYQLAMVRYREEHMLAGVARRLKRGMDQKRDPGTVFSEVQDHVIA  554

Query  460  LAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPNKA  281
            LA +H+E  +LE F+  V++ PD   + AL L+CDLYAL  I  D   +     +   ++
Sbjct  555  LAHAHMERLVLEAFVDRVRALPDGGDKVALGLLCDLYALTTIEADRAWFMEHGRLTVQRS  614

Query  280  KAINKLTEYLCFQVRNTAKDLVDAFDLPDYVIRAP  176
            K+I +    LC ++R  A DLVDA+++P  V+RAP
Sbjct  615  KSITREVNDLCRKIRPLAGDLVDAWNIPSAVLRAP  649



>ref|WP_030736574.1| acyl-CoA oxidase [Streptomyces griseus]
Length=655

 Score =   101 bits (252),  Expect = 4e-21, Method: Composition-based stats.
 Identities = 54/155 (35%), Positives = 84/155 (54%), Gaps = 1/155 (1%)
 Frame = -3

Query  637  PVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGA-WNRCLNHLLT  461
            P    W+ E  L D  +QL   RYR   +L  VA RL++        G  ++   +H++ 
Sbjct  495  PGGDEWDQEAGLLDSEYQLAMVRYREEHMLAGVARRLKRGMDQKRDPGTVFSEVQDHVIA  554

Query  460  LAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPNKA  281
            LA +H+E  +LE F+  V++ PD   + AL L+CDLYAL  I  D   +     +   ++
Sbjct  555  LAHAHMERLVLEAFVDRVRALPDGGDKVALGLLCDLYALTTIEADRAWFMEHGRLTVQRS  614

Query  280  KAINKLTEYLCFQVRNTAKDLVDAFDLPDYVIRAP  176
            K+I +    LC ++R  A DLVDA+++P  V+RAP
Sbjct  615  KSITREVNDLCRKIRPLAGDLVDAWNIPSAVLRAP  649



>ref|WP_030332097.1| acyl-CoA oxidase [Streptomyces sp. NRRL B-1381]
Length=655

 Score =   101 bits (252),  Expect = 4e-21, Method: Composition-based stats.
 Identities = 54/155 (35%), Positives = 84/155 (54%), Gaps = 1/155 (1%)
 Frame = -3

Query  637  PVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGA-WNRCLNHLLT  461
            P    W+ E  L D  +QL   RYR   +L  VA RL++        G  ++   +H++ 
Sbjct  495  PGGDEWDQEAGLLDSEYQLAMVRYREEHMLAGVARRLKRGMDQKRDPGTVFSEVQDHVIA  554

Query  460  LAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPNKA  281
            LA +H+E  +LE F+  V++ PD   + AL L+CDLYAL  I  D   +     +   ++
Sbjct  555  LAHAHMERLVLEAFVDRVRALPDGGDKVALGLLCDLYALTTIEADRAWFMEHGRLTVQRS  614

Query  280  KAINKLTEYLCFQVRNTAKDLVDAFDLPDYVIRAP  176
            K+I +    LC ++R  A DLVDA+++P  V+RAP
Sbjct  615  KSITREVNDLCRKIRPLAGDLVDAWNIPSAVLRAP  649



>ref|WP_030292936.1| MULTISPECIES: acyl-CoA oxidase [Streptomyces]
Length=655

 Score =   101 bits (252),  Expect = 4e-21, Method: Composition-based stats.
 Identities = 54/155 (35%), Positives = 84/155 (54%), Gaps = 1/155 (1%)
 Frame = -3

Query  637  PVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGA-WNRCLNHLLT  461
            P    W+ E  L D  +QL   RYR   +L  VA RL++        G  ++   +H++ 
Sbjct  495  PGGDEWDQEAGLLDSEYQLAMVRYREEHMLAGVARRLKRGMDQKRDPGTVFSEVQDHVIA  554

Query  460  LAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPNKA  281
            LA +H+E  +LE F+  V++ PD   + AL L+CDLYAL  I  D   +     +   ++
Sbjct  555  LAHAHMERLVLEAFVDRVRALPDGGDKVALGLLCDLYALTTIEADRAWFMEHGRLTVQRS  614

Query  280  KAINKLTEYLCFQVRNTAKDLVDAFDLPDYVIRAP  176
            K+I +    LC ++R  A DLVDA+++P  V+RAP
Sbjct  615  KSITREVNDLCRKIRPLAGDLVDAWNIPSAVLRAP  649



>ref|WP_030194549.1| MULTISPECIES: acyl-CoA oxidase [Streptomyces puniceus subgroup]
Length=655

 Score =   101 bits (252),  Expect = 4e-21, Method: Composition-based stats.
 Identities = 54/155 (35%), Positives = 84/155 (54%), Gaps = 1/155 (1%)
 Frame = -3

Query  637  PVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGA-WNRCLNHLLT  461
            P    W+ E  L D  +QL   RYR   +L  VA RL++        G  ++   +H++ 
Sbjct  495  PGGDEWDQEAGLLDSEYQLAMVRYREEHMLAGVARRLKRGMDQKRDPGTVFSEVQDHVIA  554

Query  460  LAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPNKA  281
            LA +H+E  +LE F+  V++ PD   + AL L+CDLYAL  I  D   +     +   ++
Sbjct  555  LAHAHMERLVLEAFVDRVRALPDGGDKVALGLLCDLYALTTIEADRAWFMEHGRLTVQRS  614

Query  280  KAINKLTEYLCFQVRNTAKDLVDAFDLPDYVIRAP  176
            K+I +    LC ++R  A DLVDA+++P  V+RAP
Sbjct  615  KSITREVNDLCRKIRPLAGDLVDAWNIPSAVLRAP  649



>ref|WP_018524646.1| MULTISPECIES: acyl-CoA oxidase [Streptomyces]
Length=652

 Score =   101 bits (252),  Expect = 5e-21, Method: Composition-based stats.
 Identities = 54/155 (35%), Positives = 89/155 (57%), Gaps = 1/155 (1%)
 Frame = -3

Query  637  PVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGA-WNRCLNHLLT  461
            P    W+ E  L D  +QL   R+R   +L  VA RL++        GA ++   +H++ 
Sbjct  494  PGGDEWDREAGLLDSEYQLAMVRFREEHMLAGVARRLKRGIDEHRDPGAVFSYVQDHVIA  553

Query  460  LAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPNKA  281
            LA +H+E  +LE F++ V++ P+  ++ AL L+CDL+AL+ I  D   +     +   ++
Sbjct  554  LARAHVERLVLEAFVEKVRALPEGGNKEALGLLCDLFALSTIEADRAWFMEHGRLTVQRS  613

Query  280  KAINKLTEYLCFQVRNTAKDLVDAFDLPDYVIRAP  176
            KAI++    LC +VR  A DLVDA+ +PD ++RAP
Sbjct  614  KAISREVNDLCRKVRPLAADLVDAWGIPDEMLRAP  648



>ref|WP_036402348.1| acyl-CoA oxidase [Mycobacterium kansasii]
Length=650

 Score =   101 bits (251),  Expect = 5e-21, Method: Composition-based stats.
 Identities = 54/142 (38%), Positives = 80/142 (56%), Gaps = 0/142 (0%)
 Frame = -3

Query  619  EGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGAWNRCLNHLLTLAESHIE  440
            E E  L +   Q+  F  R   LL SVA RLQ  S  +  F A+N   +H+L  A++HI+
Sbjct  494  EEEGSLFNRGTQVKMFEDREEYLLSSVARRLQSKSNEMSAFDAFNAVQDHVLHAAQAHID  553

Query  439  SFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPNKAKAINKLT  260
              +LE F+  ++SCPD  +R  L+ VCDLYAL+ I +D   Y    +++  +AKA+ +  
Sbjct  554  RVVLEAFVAGIESCPDREAREVLEAVCDLYALSVIEDDKAWYIEHRFLSTERAKAVTRGI  613

Query  259  EYLCFQVRNTAKDLVDAFDLPD  194
               C  +R  AK LVD F +P+
Sbjct  614  NDRCRVLRPHAKTLVDGFGIPE  635



>gb|EUA00393.1| acyl-CoA dehydrogenase, C-terminal domain protein [Mycobacterium 
kansasii 824]
Length=621

 Score =   101 bits (251),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 54/142 (38%), Positives = 80/142 (56%), Gaps = 0/142 (0%)
 Frame = -3

Query  619  EGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGAWNRCLNHLLTLAESHIE  440
            E E  L +   Q+  F  R   LL SVA RLQ  S  +  F A+N   +H+L  A++HI+
Sbjct  465  EEEGSLFNRGTQVKMFEDREEYLLSSVARRLQSKSNEMSAFDAFNAVQDHVLHAAQAHID  524

Query  439  SFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPNKAKAINKLT  260
              +LE F+  ++SCPD  +R  L+ VCDLYAL+ I +D   Y    +++  +AKA+ +  
Sbjct  525  RVVLEAFVAGIESCPDHEARDVLEAVCDLYALSVIEDDKAWYIEHRFLSTERAKAVTRGI  584

Query  259  EYLCFQVRNTAKDLVDAFDLPD  194
               C  +R  AK LVD F +P+
Sbjct  585  NDRCRVLRPHAKTLVDGFGIPE  606



>ref|WP_030389344.1| acyl-CoA oxidase [Streptomyces sp. NRRL S-241]
Length=654

 Score =   101 bits (251),  Expect = 6e-21, Method: Composition-based stats.
 Identities = 53/155 (34%), Positives = 87/155 (56%), Gaps = 1/155 (1%)
 Frame = -3

Query  637  PVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGA-WNRCLNHLLT  461
            P    W+ E  L D  +QL   R+R   +L  +A R+++     G  GA +++  +H++ 
Sbjct  496  PGGEEWDREAGLLDSEYQLAMVRFREEHMLAGLARRIKRGIDRKGAPGAVFSQVQDHVIA  555

Query  460  LAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPNKA  281
            LA +H+E  + E F+  V+S P+   + AL L+CDL+AL+ I  D   +     +   ++
Sbjct  556  LARAHVERLVTEAFVDKVRSLPEGGEKEALALLCDLFALSTIEADRAWFMEHGRLTVQRS  615

Query  280  KAINKLTEYLCFQVRNTAKDLVDAFDLPDYVIRAP  176
            KAI++    LC +VR  A DLVDA+ +P  V+RAP
Sbjct  616  KAISREVNDLCRKVRPVAVDLVDAWGIPSAVLRAP  650



>ref|WP_026468560.1| acyl-CoA oxidase [Amycolatopsis balhimycina]
Length=629

 Score =   101 bits (251),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 51/140 (36%), Positives = 81/140 (58%), Gaps = 2/140 (1%)
 Frame = -3

Query  592  NFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGAWNRCLNHLLTLAESHIESFILEIFIQ  413
            ++QL  F  R   +++ VA RL+K + +   FG +N   +H+L     H+E  +LE F  
Sbjct  489  DWQLRLFEDREDHVVEGVAKRLRKAASD--PFGVFNSAQDHVLRAGRVHVERLVLEAFAS  546

Query  412  AVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPNKAKAINKLTEYLCFQVRN  233
            A++ C DP +RA L+ VCDLYAL+ I  D+  +     +  ++AKA+      LC ++R 
Sbjct  547  AIERCEDPDARALLERVCDLYALSAIEEDLAWFLGHGRLTASRAKAVTSAVNRLCSELRP  606

Query  232  TAKDLVDAFDLPDYVIRAPI  173
             A+ LVDAF +PD  + AP+
Sbjct  607  HARTLVDAFAIPDQFLAAPM  626



>gb|EUA32514.1| acyl-CoA oxidase family protein [Mycobacterium xenopi 3993]
Length=239

 Score = 97.4 bits (241),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 52/142 (37%), Positives = 79/142 (56%), Gaps = 0/142 (0%)
 Frame = -3

Query  619  EGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGAWNRCLNHLLTLAESHIE  440
            E E  L +   Q+  F  R   LL SVA RLQ  S  +  F A+N   +H+L  A +H++
Sbjct  83   EEEGSLFNRGTQVKMFEDREEYLLSSVARRLQAKSNEMSAFDAFNAVQDHVLHAASAHVD  142

Query  439  SFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPNKAKAINKLT  260
              +LE F+  + SC D  +R  L+LVCDLYAL+ I +D   Y    +++ ++AKA+ +  
Sbjct  143  RVVLEAFVAGIDSCEDDEARHVLELVCDLYALSVIEDDKAWYIEHRFLSTDRAKAVTRGI  202

Query  259  EYLCFQVRNTAKDLVDAFDLPD  194
               C  +R  A+ LVD F +P+
Sbjct  203  NDRCRALRPYAQTLVDGFGIPE  224



>ref|WP_019764300.1| hypothetical protein, partial [Streptomyces sp. Wigar10]
Length=306

 Score = 98.6 bits (244),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 51/155 (33%), Positives = 86/155 (55%), Gaps = 1/155 (1%)
 Frame = -3

Query  637  PVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGA-WNRCLNHLLT  461
            P    W+ E  L D  +QL   RYR   +L  VA RL+         GA ++   +H++ 
Sbjct  148  PGGDEWDQEAGLLDSEYQLAMVRYREEHMLAGVARRLKSGIDRKRDAGAVFSEVQDHVIA  207

Query  460  LAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPNKA  281
            +A +H+E  +LE F++ +++ P+  ++ AL L+CDL+AL+ I  D   +     +   ++
Sbjct  208  VAHAHVERLVLEAFVEKMRTLPEGGNKVALGLLCDLFALSTIEADRAWFMEHGRLTVQRS  267

Query  280  KAINKLTEYLCFQVRNTAKDLVDAFDLPDYVIRAP  176
            KAI +    LC ++R  A DLVDA+ +P  ++RAP
Sbjct  268  KAITREVNDLCRKIRPLAGDLVDAWGIPAEMLRAP  302



>gb|ADW07059.1| acyl-CoA dehydrogenase domain-containing protein [Streptomyces 
pratensis ATCC 33331]
Length=640

 Score =   100 bits (250),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 53/155 (34%), Positives = 89/155 (57%), Gaps = 1/155 (1%)
 Frame = -3

Query  637  PVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGA-WNRCLNHLLT  461
            P    W+ E  LRD  +QL   RYR   +L  VA RL++        GA +++  +H++ 
Sbjct  482  PGGDEWDQEAGLRDSEYQLAMLRYREEHMLAGVARRLKRGIDQKRDPGAVFSQVQDHVIA  541

Query  460  LAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPNKA  281
            +A +H+E  +LE F+  +++ P+  ++ AL L+CDL+AL+ I  D   +     +   ++
Sbjct  542  VAHAHVERLVLEAFVDKLRAQPEGGNKVALGLLCDLFALSTIEADRAWFMEHGRLTVQRS  601

Query  280  KAINKLTEYLCFQVRNTAKDLVDAFDLPDYVIRAP  176
            KAI++    LC +VR  A DLVDA+ +P  ++RAP
Sbjct  602  KAISREVHDLCRKVRPLAVDLVDAWGIPPEMLRAP  636



>ref|WP_041825462.1| acyl-CoA oxidase [Streptomyces pratensis]
Length=653

 Score =   100 bits (250),  Expect = 8e-21, Method: Composition-based stats.
 Identities = 53/155 (34%), Positives = 89/155 (57%), Gaps = 1/155 (1%)
 Frame = -3

Query  637  PVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGA-WNRCLNHLLT  461
            P    W+ E  LRD  +QL   RYR   +L  VA RL++        GA +++  +H++ 
Sbjct  495  PGGDEWDQEAGLRDSEYQLAMLRYREEHMLAGVARRLKRGIDQKRDPGAVFSQVQDHVIA  554

Query  460  LAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPNKA  281
            +A +H+E  +LE F+  +++ P+  ++ AL L+CDL+AL+ I  D   +     +   ++
Sbjct  555  VAHAHVERLVLEAFVDKLRAQPEGGNKVALGLLCDLFALSTIEADRAWFMEHGRLTVQRS  614

Query  280  KAINKLTEYLCFQVRNTAKDLVDAFDLPDYVIRAP  176
            KAI++    LC +VR  A DLVDA+ +P  ++RAP
Sbjct  615  KAISREVHDLCRKVRPLAVDLVDAWGIPPEMLRAP  649



>gb|KEP40455.1| acyl-CoA oxidase [Mycobacterium kansasii]
Length=646

 Score =   100 bits (250),  Expect = 8e-21, Method: Composition-based stats.
 Identities = 54/142 (38%), Positives = 80/142 (56%), Gaps = 0/142 (0%)
 Frame = -3

Query  619  EGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGAWNRCLNHLLTLAESHIE  440
            E E  L +   Q+  F  R   LL SVA RLQ  S  +  F A+N   +H+L  A++HI+
Sbjct  490  EEEGSLFNRGTQVKMFEDREEYLLSSVARRLQSKSNEMSAFDAFNAVQDHVLHAAQAHID  549

Query  439  SFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPNKAKAINKLT  260
              +LE F+  ++SCPD  +R  L+ VCDLYAL+ I +D   Y    +++  +AKA+ +  
Sbjct  550  RVVLEAFVAGIESCPDHEARDVLEAVCDLYALSVIEDDKAWYIEHRFLSTERAKAVTRGI  609

Query  259  EYLCFQVRNTAKDLVDAFDLPD  194
               C  +R  AK LVD F +P+
Sbjct  610  NDRCRVLRPHAKTLVDGFGIPE  631



>ref|WP_037831419.1| acyl-CoA oxidase [Streptomyces sp. NRRL S-325]
Length=653

 Score =   100 bits (250),  Expect = 8e-21, Method: Composition-based stats.
 Identities = 53/155 (34%), Positives = 89/155 (57%), Gaps = 1/155 (1%)
 Frame = -3

Query  637  PVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGA-WNRCLNHLLT  461
            P    W+ E  LRD  +QL   RYR   +L  VA RL++        GA +++  +H++ 
Sbjct  495  PGGDEWDQEAGLRDSEYQLAMLRYREEHMLAGVARRLKRGIDQKRDPGAVFSQVQDHVIA  554

Query  460  LAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPNKA  281
            +A +H+E  +LE F+  +++ P+  ++ AL L+CDL+AL+ I  D   +     +   ++
Sbjct  555  VAHAHVERLVLEAFVDKLRAQPEGGNKVALGLLCDLFALSTIEADRAWFMEHGRLTVQRS  614

Query  280  KAINKLTEYLCFQVRNTAKDLVDAFDLPDYVIRAP  176
            KAI++    LC +VR  A DLVDA+ +P  ++RAP
Sbjct  615  KAISREVNDLCRKVRPLAVDLVDAWGIPPEMLRAP  649



>ref|WP_030125188.1| MULTISPECIES: acyl-CoA oxidase [Streptomyces]
Length=653

 Score =   100 bits (250),  Expect = 8e-21, Method: Composition-based stats.
 Identities = 53/155 (34%), Positives = 89/155 (57%), Gaps = 1/155 (1%)
 Frame = -3

Query  637  PVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGA-WNRCLNHLLT  461
            P    W+ E  LRD  +QL   RYR   +L  VA RL++        GA +++  +H++ 
Sbjct  495  PGGDEWDQEAGLRDSEYQLAMLRYREEHMLAGVARRLKRGIDQKRDPGAVFSQVQDHVIA  554

Query  460  LAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPNKA  281
            +A +H+E  +LE F+  +++ P+  ++ AL L+CDL+AL+ I  D   +     +   ++
Sbjct  555  VAHAHVERLVLEAFVDKLRAQPEGGNKVALGLLCDLFALSTIEADRAWFMEHGRLTVQRS  614

Query  280  KAINKLTEYLCFQVRNTAKDLVDAFDLPDYVIRAP  176
            KAI++    LC +VR  A DLVDA+ +P  ++RAP
Sbjct  615  KAISREVNDLCRKVRPLAVDLVDAWGIPPEMLRAP  649



>ref|WP_015576152.1| acyl-coenzyme A oxidase 1 [Streptomyces sp. PAMC26508]
 gb|AGJ53444.1| acyl-coenzyme A oxidase 1 [Streptomyces sp. PAMC26508]
Length=653

 Score =   100 bits (250),  Expect = 8e-21, Method: Composition-based stats.
 Identities = 53/155 (34%), Positives = 89/155 (57%), Gaps = 1/155 (1%)
 Frame = -3

Query  637  PVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGA-WNRCLNHLLT  461
            P    W+ E  LRD  +QL   RYR   +L  VA RL++        GA +++  +H++ 
Sbjct  495  PGGDEWDQEAGLRDSEYQLAMLRYREEHMLAGVARRLKRGIDQKRDPGAVFSQVQDHVIA  554

Query  460  LAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPNKA  281
            +A +H+E  +LE F+  +++ P+  ++ AL L+CDL+AL+ I  D   +     +   ++
Sbjct  555  VAHAHVERLVLEAFVDKLRAQPEGGNKVALGLLCDLFALSTIEADRAWFMEHGRLTVQRS  614

Query  280  KAINKLTEYLCFQVRNTAKDLVDAFDLPDYVIRAP  176
            KAI++    LC +VR  A DLVDA+ +P  ++RAP
Sbjct  615  KAISREVNDLCRKVRPLAVDLVDAWGIPPEMLRAP  649



>ref|WP_030570486.1| acyl-CoA oxidase [Streptomyces cyaneofuscatus]
Length=653

 Score =   100 bits (250),  Expect = 8e-21, Method: Composition-based stats.
 Identities = 54/155 (35%), Positives = 87/155 (56%), Gaps = 1/155 (1%)
 Frame = -3

Query  637  PVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGA-WNRCLNHLLT  461
            P    W+ E  L D  +QL  FRYR   +L  VA RL+         GA ++   +H++ 
Sbjct  495  PGGDEWDQEAGLLDSEYQLAMFRYREEHMLAGVARRLKAGIDRKRDPGAVFSEVQDHVIA  554

Query  460  LAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPNKA  281
            +A +H+E  +LE F++ +++ P+  ++ AL L+CDLYAL+ I  D   +     +   ++
Sbjct  555  VAHAHVERLVLEAFVEKMRTLPEGGNKVALGLLCDLYALSTIEADRAWFMEHGRLTVQRS  614

Query  280  KAINKLTEYLCFQVRNTAKDLVDAFDLPDYVIRAP  176
            KAI +    LC +VR  A DLVDA+ +P  ++RAP
Sbjct  615  KAITREVTDLCRKVRPLAGDLVDAWGVPAAMLRAP  649



>ref|WP_023365570.1| acyl-CoA oxidase [Mycobacterium kansasii]
 gb|AGZ49640.1| acyl-CoA oxidase [Mycobacterium kansasii ATCC 12478]
 gb|EUA18726.1| acyl-CoA dehydrogenase, C-terminal domain protein [Mycobacterium 
kansasii 662]
 gb|AIR17490.1| acyl-CoA oxidase [Mycobacterium kansasii 662]
 gb|AIR27038.1| acyl-CoA oxidase [Mycobacterium kansasii 824]
Length=650

 Score =   100 bits (250),  Expect = 8e-21, Method: Composition-based stats.
 Identities = 54/142 (38%), Positives = 80/142 (56%), Gaps = 0/142 (0%)
 Frame = -3

Query  619  EGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGAWNRCLNHLLTLAESHIE  440
            E E  L +   Q+  F  R   LL SVA RLQ  S  +  F A+N   +H+L  A++HI+
Sbjct  494  EEEGSLFNRGTQVKMFEDREEYLLSSVARRLQSKSNEMSAFDAFNAVQDHVLHAAQAHID  553

Query  439  SFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPNKAKAINKLT  260
              +LE F+  ++SCPD  +R  L+ VCDLYAL+ I +D   Y    +++  +AKA+ +  
Sbjct  554  RVVLEAFVAGIESCPDHEARDVLEAVCDLYALSVIEDDKAWYIEHRFLSTERAKAVTRGI  613

Query  259  EYLCFQVRNTAKDLVDAFDLPD  194
               C  +R  AK LVD F +P+
Sbjct  614  NDRCRVLRPHAKTLVDGFGIPE  635



>ref|WP_044376178.1| acyl-CoA oxidase [Streptomyces griseus]
 gb|KIX33233.1| Acyl-coenzyme A oxidase 1, peroxisomal [Streptomyces griseus]
Length=655

 Score =   100 bits (250),  Expect = 9e-21, Method: Composition-based stats.
 Identities = 53/155 (34%), Positives = 87/155 (56%), Gaps = 1/155 (1%)
 Frame = -3

Query  637  PVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGA-WNRCLNHLLT  461
            P    W+ E  L D  +QL   RYR   +L  VA RL+         GA ++   +H++ 
Sbjct  495  PGGDEWDQEAGLLDSEYQLAMVRYREEHMLAGVARRLKSGIDRKRDPGAVFSEVQDHVIA  554

Query  460  LAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPNKA  281
            +A +H+E  +LE F++ +++ PD  ++ AL L+CDLYAL+ I  D   +     +   ++
Sbjct  555  VARAHMERLVLEAFVEKMRTLPDGGNKVALGLLCDLYALSTIEADRAWFMEHGRLTVQRS  614

Query  280  KAINKLTEYLCFQVRNTAKDLVDAFDLPDYVIRAP  176
            KAI +    LC ++R  A +LVDA+ +PD ++RAP
Sbjct  615  KAITREVNDLCRKIRPLAGELVDAWGIPDAMLRAP  649



>ref|WP_030811972.1| acyl-CoA oxidase [Streptomyces mediolani]
Length=655

 Score =   100 bits (250),  Expect = 9e-21, Method: Composition-based stats.
 Identities = 53/155 (34%), Positives = 87/155 (56%), Gaps = 1/155 (1%)
 Frame = -3

Query  637  PVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGA-WNRCLNHLLT  461
            P    W+ E  L D  +QL   RYR   +L  VA RL+         GA ++   +H++ 
Sbjct  495  PGGDEWDQEAGLLDSEYQLAMVRYREEHMLAGVARRLKSGIDRKRDPGAVFSEVQDHVIA  554

Query  460  LAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPNKA  281
            +A +H+E  +LE F++ +++ PD  ++ AL L+CDLYAL+ I  D   +     +   ++
Sbjct  555  VARAHMERLVLEAFVEKMRTLPDGGNKVALGLLCDLYALSTIEADRAWFMEHGRLTVQRS  614

Query  280  KAINKLTEYLCFQVRNTAKDLVDAFDLPDYVIRAP  176
            KAI +    LC ++R  A +LVDA+ +PD ++RAP
Sbjct  615  KAITREVNDLCRKIRPLAGELVDAWGIPDAMLRAP  649



>ref|WP_026985441.1| acyl-CoA oxidase [Flavobacterium sp. URHB0058]
Length=753

 Score =   100 bits (250),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 56/161 (35%), Positives = 93/161 (58%), Gaps = 1/161 (1%)
 Frame = -3

Query  646  QPNPVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKN-LGGFGAWNRCLNH  470
            + NP+ +R   ++HL D  F L AF +R   +L S A R++K   N L  + A+N   + 
Sbjct  592  EKNPIATRRTDDEHLLDDQFHLQAFIHREKTILASAAQRIKKLVDNGLEPYDAFNVVQHQ  651

Query  469  LLTLAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAP  290
            ++ +A++++E  +LE F  A+K+  D  S+  L  +  LYAL+++  + G Y    Y+  
Sbjct  652  MIDVAQAYLERVVLEQFQAAIKTVQDEKSKEILTKLNQLYALSQLEKNKGWYLEDGYMEA  711

Query  289  NKAKAINKLTEYLCFQVRNTAKDLVDAFDLPDYVIRAPIAL  167
             K KAI K+   LC+ +R  A  LV+AFD+P+  + APIA+
Sbjct  712  VKTKAIRKMVNQLCWDIRPDAVALVNAFDIPESCLAAPIAV  752



>ref|WP_019729355.1| acyl-CoA oxidase, partial [Mycobacterium avium]
Length=475

 Score = 99.4 bits (246),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 53/142 (37%), Positives = 78/142 (55%), Gaps = 0/142 (0%)
 Frame = -3

Query  619  EGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGAWNRCLNHLLTLAESHIE  440
            E E  L +   Q+  F  R   LL SVA RLQ  SK +  F A+N   +H+L  A +HI+
Sbjct  315  EEEGSLFNRGTQIKMFEDREEYLLASVARRLQAKSKEMSEFDAFNSVQDHVLHAASAHID  374

Query  439  SFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPNKAKAINKLT  260
              +LE F+  +  CPD  +R  L ++CDLYAL+ I +D   Y    Y++  +AKA+ +  
Sbjct  375  RVVLEAFVAGIDGCPDEQARELLGILCDLYALSVIEDDKAWYIEHRYLSTERAKAVTRGI  434

Query  259  EYLCFQVRNTAKDLVDAFDLPD  194
               C  +R  A+ LVD F +P+
Sbjct  435  NDRCRALRPHAQTLVDGFGIPE  456



>ref|XP_004363443.2| peroxisomal acyl-coenzyme A oxidase 3 [Capsaspora owczarzaki 
ATCC 30864]
 gb|KJE92816.1| peroxisomal acyl-coenzyme A oxidase 3 [Capsaspora owczarzaki 
ATCC 30864]
Length=717

 Score =   100 bits (250),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 59/166 (36%), Positives = 88/166 (53%), Gaps = 6/166 (4%)
 Frame = -3

Query  634  VTSRW--EGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQ---KHSKNLGGFGAWNRCLNH  470
            + S+W  E E  L  P   L A  YRT+ LLQ    +LQ   +  K++  F AWN+   H
Sbjct  503  IGSKWAVESEGDLLKPAVLLHAMHYRTAYLLQEAGTKLQSIMESGKDVDTFSAWNQTQVH  562

Query  469  LL-TLAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVA  293
             L   A++++E+ I+  F  A++SCP  S R  L  +  L+AL R+  DI   R  D++ 
Sbjct  563  YLHAAAKAYLEAVIVAQFDAAIQSCPTVSLRGVLSKLLALFALWRLEGDIAVLREDDFIT  622

Query  292  PNKAKAINKLTEYLCFQVRNTAKDLVDAFDLPDYVIRAPIALQDSE  155
              +AK + +    LC QV++ A  LVDA   PD ++ +PI   D E
Sbjct  623  GQQAKLLKETVLALCLQVKDEAVSLVDAVAPPDQILFSPIGRSDGE  668



>ref|WP_030704772.1| acyl-CoA oxidase [Streptomyces griseus]
Length=653

 Score =   100 bits (249),  Expect = 9e-21, Method: Composition-based stats.
 Identities = 52/155 (34%), Positives = 87/155 (56%), Gaps = 1/155 (1%)
 Frame = -3

Query  637  PVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGA-WNRCLNHLLT  461
            P    W+ E  L D  +QL  FRYR   +L   A RL++     G  G  +++  +H++ 
Sbjct  495  PGGDEWDQEAGLLDSEYQLAMFRYREEHMLAGAARRLKRGIDQKGDPGTVFSQVQDHVIA  554

Query  460  LAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPNKA  281
            +A +H+E  +LE F+  +++ P+  ++ AL L+CDL+AL+ I  D   +     +   ++
Sbjct  555  VARAHVERLVLEAFVDKMRALPEGGNKVALGLLCDLFALSTIEADRAWFMEHGRLTVQRS  614

Query  280  KAINKLTEYLCFQVRNTAKDLVDAFDLPDYVIRAP  176
            KAI +    LC +VR  A DLVDA+ +P  ++RAP
Sbjct  615  KAITREVNDLCRKVRPLAGDLVDAWGIPPELLRAP  649



>ref|WP_012381918.1| acyl-CoA oxidase [Streptomyces griseus]
 dbj|BAG23233.1| putative acyl-CoA oxidase [Streptomyces griseus subsp. griseus 
NBRC 13350]
Length=653

 Score =   100 bits (249),  Expect = 9e-21, Method: Composition-based stats.
 Identities = 52/155 (34%), Positives = 87/155 (56%), Gaps = 1/155 (1%)
 Frame = -3

Query  637  PVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGA-WNRCLNHLLT  461
            P    W+ E  L D  +QL  FRYR   +L   A RL++     G  G  +++  +H++ 
Sbjct  495  PGGDEWDQEAGLLDSEYQLAMFRYREEHMLAGAARRLKRGIDQKGDPGTVFSQVQDHVIA  554

Query  460  LAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPNKA  281
            +A +H+E  +LE F+  +++ P+  ++ AL L+CDL+AL+ I  D   +     +   ++
Sbjct  555  VARAHVERLVLEAFVDKMRALPEGGNKVALGLLCDLFALSTIEADRAWFMEHGRLTVQRS  614

Query  280  KAINKLTEYLCFQVRNTAKDLVDAFDLPDYVIRAP  176
            KAI +    LC +VR  A DLVDA+ +P  ++RAP
Sbjct  615  KAITREVNDLCRKVRPLAGDLVDAWGIPPELLRAP  649



>ref|WP_042906846.1| acyl-CoA oxidase, partial [Mycobacterium avium]
Length=479

 Score = 99.4 bits (246),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 53/142 (37%), Positives = 78/142 (55%), Gaps = 0/142 (0%)
 Frame = -3

Query  619  EGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGAWNRCLNHLLTLAESHIE  440
            E E  L +   Q+  F  R   LL SVA RLQ  SK +  F A+N   +H+L  A +HI+
Sbjct  319  EEEGSLFNRGTQIKMFEDREEYLLASVARRLQAKSKEMSEFDAFNSVQDHVLHAASAHID  378

Query  439  SFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPNKAKAINKLT  260
              +LE F+  +  CPD  +R  L ++CDLYAL+ I +D   Y    Y++  +AKA+ +  
Sbjct  379  RVVLEAFVAGIDGCPDEQARELLGILCDLYALSVIEDDKAWYIEHRYLSTERAKAVTRGI  438

Query  259  EYLCFQVRNTAKDLVDAFDLPD  194
               C  +R  A+ LVD F +P+
Sbjct  439  NDRCRALRPHAQTLVDGFGIPE  460



>ref|XP_004361564.1| putative acyl-CoA oxidase [Dictyostelium fasciculatum]
 gb|EGG23713.1| putative acyl-CoA oxidase [Dictyostelium fasciculatum]
Length=688

 Score =   100 bits (250),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 57/160 (36%), Positives = 91/160 (57%), Gaps = 4/160 (3%)
 Frame = -3

Query  640  NPVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKN---LGGFGAWNRCLNH  470
            N    R   E HL DP+  LDAF YR  +LL+ +   L+  +     +    AWN+ L+ 
Sbjct  517  NFFVKRLHTEAHLLDPDMLLDAFIYREFKLLRMLVKSLRSKTSGPDKMPAAKAWNQSLDL  576

Query  469  LLTLAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAP  290
            ++ L  +++E   +E F++++ +  + S R  L+L+C L+AL +I  D+G + +  Y AP
Sbjct  577  VMHLGTAYVERVTIEKFLESIAN-EEESIRPVLRLLCILFALTKIEEDMGWFLSNKYFAP  635

Query  289  NKAKAINKLTEYLCFQVRNTAKDLVDAFDLPDYVIRAPIA  170
             KAKAI      +C  VR  A  LV AF++PD+++ APIA
Sbjct  636  VKAKAIQNSINKVCGMVREHAIPLVKAFNIPDHLMTAPIA  675



>ref|XP_646395.1| hypothetical protein DDB_G0270990 [Dictyostelium discoideum AX4]
 gb|EAL72845.1| hypothetical protein DDB_G0270990 [Dictyostelium discoideum AX4]
Length=692

 Score =   100 bits (249),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 59/158 (37%), Positives = 88/158 (56%), Gaps = 3/158 (2%)
 Frame = -3

Query  640  NPVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKN--LGGFGAWNRCLNHL  467
            N  T R   E HL DP+  LDAF YR  +LL+++   L+   KN  + G  AWN  L+ +
Sbjct  522  NFFTKRLHTESHLLDPDVLLDAFIYREFKLLRNLIKTLRAKVKNEKMTGLQAWNSSLDLV  581

Query  466  LTLAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPN  287
            L LA ++IE   +E F++ V+  P+   +  L  +C LY L +I ND+G + +  Y AP 
Sbjct  582  LQLANAYIERVSIEKFLEEVQKSPE-DIKPILTSLCILYELTKIENDLGWFLSNKYFAPV  640

Query  286  KAKAINKLTEYLCFQVRNTAKDLVDAFDLPDYVIRAPI  173
            K +AI      +C  +++ A  LV AFD+P   + API
Sbjct  641  KGQAIGNTINKVCGALKDHAIPLVKAFDIPSQFLTAPI  678



>ref|WP_012025377.1| acyl-CoA oxidase [Flavobacterium johnsoniae]
 gb|ABQ06408.1| predicted acyl-CoA oxidase domain protein [Flavobacterium johnsoniae 
UW101]
Length=752

 Score =   100 bits (250),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 55/161 (34%), Positives = 93/161 (58%), Gaps = 1/161 (1%)
 Frame = -3

Query  646  QPNPVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKH-SKNLGGFGAWNRCLNH  470
            + NP+ +R   ++HL D  F L AF +R   +L S A R++K     L  + A+N   + 
Sbjct  592  EKNPIATRRTDDEHLLDKEFHLQAFVHREKTILASAARRIKKLVDGGLEAYDAFNVVQHQ  651

Query  469  LLTLAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAP  290
            ++ +A++++E  +LE F +AVK+  D +S+  L  +  LYAL++I  +   Y    Y+  
Sbjct  652  MIDVAQAYLERIVLEQFQEAVKTIEDENSKQILTKLYQLYALSQIEKNKAWYLEDGYMEA  711

Query  289  NKAKAINKLTEYLCFQVRNTAKDLVDAFDLPDYVIRAPIAL  167
             K KA+ K+   LC+ +R  A  LV+AFD+P+  + APIA+
Sbjct  712  VKTKAVRKIVNQLCWDIRPDAVALVNAFDIPESCLAAPIAV  752



>ref|WP_032779937.1| acyl-CoA oxidase [Streptomyces albus]
Length=655

 Score =   100 bits (249),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 53/155 (34%), Positives = 86/155 (55%), Gaps = 1/155 (1%)
 Frame = -3

Query  637  PVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGA-WNRCLNHLLT  461
            P    W+ E  L D  +QL   RYR   +L  VA RL+         GA ++   +H++ 
Sbjct  495  PGGDEWDQEAGLLDSEYQLAMVRYREEHMLAGVARRLKSGIDRKRDPGAVFSEVQDHVIA  554

Query  460  LAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPNKA  281
            +A +H+E  +LE F++  ++ PD  ++ AL L+CDLYAL+ I  D   +     +   ++
Sbjct  555  VARAHMERLVLEAFVEKTRTLPDGGNKVALGLLCDLYALSTIEADRAWFMEHGRLTVQRS  614

Query  280  KAINKLTEYLCFQVRNTAKDLVDAFDLPDYVIRAP  176
            KAI +    LC ++R  A +LVDA+ +PD ++RAP
Sbjct  615  KAITREVNDLCRKIRPLAGELVDAWGIPDAMLRAP  649



>ref|WP_032769032.1| acyl-CoA oxidase [Streptomyces sp. CNS654]
Length=655

 Score =   100 bits (249),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 53/155 (34%), Positives = 86/155 (55%), Gaps = 1/155 (1%)
 Frame = -3

Query  637  PVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGA-WNRCLNHLLT  461
            P    W+ E  L D  +QL   RYR   +L  VA RL+         GA ++   +H++ 
Sbjct  495  PGGDEWDQEAGLLDSEYQLAMVRYREEHMLAGVARRLKSGIDRKRDPGAVFSEVQDHVIA  554

Query  460  LAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPNKA  281
            +A +H+E  +LE F++  ++ PD  ++ AL L+CDLYAL+ I  D   +     +   ++
Sbjct  555  VARAHMERLVLEAFVEKTRTLPDGGNKVALGLLCDLYALSTIEADRAWFMEHGRLTVQRS  614

Query  280  KAINKLTEYLCFQVRNTAKDLVDAFDLPDYVIRAP  176
            KAI +    LC ++R  A +LVDA+ +PD ++RAP
Sbjct  615  KAITREVNDLCRKIRPLAGELVDAWGIPDAMLRAP  649



>ref|WP_006122746.1| MULTISPECIES: acyl-CoA oxidase [Streptomyces]
 gb|EFE72809.1| acyl-CoA oxidase domain-containing protein [Streptomyces roseosporus 
NRRL 15998]
 gb|ESU50420.1| putative acyl-CoA oxidase [Streptomyces sp. HCCB10043]
 gb|EWS90055.1| acyl-CoA oxidase domain-containing protein [Streptomyces roseosporus 
NRRL 11379]
Length=655

 Score =   100 bits (249),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 53/155 (34%), Positives = 86/155 (55%), Gaps = 1/155 (1%)
 Frame = -3

Query  637  PVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGA-WNRCLNHLLT  461
            P    W+ E  L D  +QL   RYR   +L  VA RL+         GA ++   +H++ 
Sbjct  495  PGGDEWDQEAGLLDSEYQLAMVRYREEHMLAGVARRLKSGIDRKRDPGAVFSEVQDHVIA  554

Query  460  LAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPNKA  281
            +A +H+E  +LE F++  ++ PD  ++ AL L+CDLYAL+ I  D   +     +   ++
Sbjct  555  VARAHMERLVLEAFVEKTRTLPDGGNKVALGLLCDLYALSTIEADRAWFMEHGRLTVQRS  614

Query  280  KAINKLTEYLCFQVRNTAKDLVDAFDLPDYVIRAP  176
            KAI +    LC ++R  A +LVDA+ +PD ++RAP
Sbjct  615  KAITREVNDLCRKIRPLAGELVDAWGIPDAMLRAP  649



>gb|EUA33411.1| acyl-CoA dehydrogenase, C-terminal domain protein [Mycobacterium 
xenopi 4042]
Length=321

 Score = 97.8 bits (242),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 52/142 (37%), Positives = 79/142 (56%), Gaps = 0/142 (0%)
 Frame = -3

Query  619  EGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGAWNRCLNHLLTLAESHIE  440
            E E  L +   Q+  F  R   LL SVA RLQ  S  +  F A+N   +H+L  A +H++
Sbjct  165  EEEGSLFNRGTQVKMFEDREEYLLSSVARRLQAKSNEMSAFDAFNAVQDHVLHAASAHVD  224

Query  439  SFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPNKAKAINKLT  260
              +LE F+  + SC D  +R  L+LVCDLYAL+ I +D   Y    +++ ++AKA+ +  
Sbjct  225  RVVLEAFVAGIDSCEDDEARHVLELVCDLYALSVIEDDKAWYIEHRFLSTDRAKAVTRGI  284

Query  259  EYLCFQVRNTAKDLVDAFDLPD  194
               C  +R  A+ LVD F +P+
Sbjct  285  NDRCRALRPYAQTLVDGFGIPE  306



>ref|WP_013062161.1| acyl-CoA oxidase [Salinibacter ruber]
 emb|CBH24828.1| acyl-Coenzyme A oxidase [Salinibacter ruber M8]
Length=768

 Score =   100 bits (249),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 62/160 (39%), Positives = 86/160 (54%), Gaps = 1/160 (1%)
 Frame = -3

Query  640  NPVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKH-SKNLGGFGAWNRCLNHLL  464
            NPV +R    DHLR   FQ  A  YR  + LQ+V  RLQ+     +  F A+    +HL+
Sbjct  603  NPVVTRTTDPDHLRALPFQQSALTYRAEKQLQNVGRRLQRRIDDGMEPFDAFVDVQDHLV  662

Query  463  TLAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPNK  284
              A +  E  ILE F  AV+   D   R  L  +  L+AL+RI  D+  +    YV+ +K
Sbjct  663  QCARADAERVILERFADAVEGVEDADLRETLTTLRRLFALSRIEADLDWFLEAGYVSGSK  722

Query  283  AKAINKLTEYLCFQVRNTAKDLVDAFDLPDYVIRAPIALQ  164
            AKAI      LC +VR  A+ LV+AF +PD ++ APIA +
Sbjct  723  AKAIRGAVNDLCDEVRPQAEALVNAFGIPDALLGAPIATK  762



>ref|WP_011404446.1| acyl-CoA oxidase [Salinibacter ruber]
 ref|YP_445820.1| acyl-coenzyme A oxidase I [Salinibacter ruber DSM 13855]
 gb|ABC46051.1| acyl-coenzyme A oxidase I, putative [Salinibacter ruber DSM 13855]
Length=786

 Score =   100 bits (249),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 62/160 (39%), Positives = 86/160 (54%), Gaps = 1/160 (1%)
 Frame = -3

Query  640  NPVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKH-SKNLGGFGAWNRCLNHLL  464
            NPV +R    DHLR   FQ  A  YR  + LQ+V  RLQ+     +  F A+    +HL+
Sbjct  621  NPVVTRTTDPDHLRALPFQQSALTYRAEKQLQNVGRRLQRRIDDGMEPFDAFVDVQDHLV  680

Query  463  TLAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPNK  284
              A +  E  ILE F  AV+   D   R  L  +  L+AL+RI  D+  +    YV+ +K
Sbjct  681  QCARADAERVILERFADAVEGVEDADLRETLTTLRRLFALSRIEADLDWFLEAGYVSGSK  740

Query  283  AKAINKLTEYLCFQVRNTAKDLVDAFDLPDYVIRAPIALQ  164
            AKAI      LC +VR  A+ LV+AF +PD ++ APIA +
Sbjct  741  AKAIRGAVNDLCDEVRPQAEALVNAFGIPDALLGAPIATK  780



>ref|WP_042564417.1| acyl-CoA oxidase [Flavobacterium sp. MEB061]
 gb|KIQ22343.1| acyl-CoA oxidase [Flavobacterium sp. MEB061]
Length=753

 Score =   100 bits (249),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 54/161 (34%), Positives = 92/161 (57%), Gaps = 1/161 (1%)
 Frame = -3

Query  646  QPNPVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKH-SKNLGGFGAWNRCLNH  470
            + NP+ +R   ++HL D  F L AF +R   +L S A R++K     L  + A+N   + 
Sbjct  592  EKNPIATRRTDDEHLLDSEFHLQAFIHREKTILASAARRIKKLVDGGLEPYDAFNVVQHQ  651

Query  469  LLTLAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAP  290
            ++ +A++++E  +LE F +A+K+  D  S+  L  +  LYAL++I  +   Y    Y+  
Sbjct  652  MIDVAQAYLERIVLEQFQEAIKTVEDEKSKEILTKLYQLYALSQIEKNKAWYLEDGYMEA  711

Query  289  NKAKAINKLTEYLCFQVRNTAKDLVDAFDLPDYVIRAPIAL  167
             K KA+ K+   LC+ +R  A  LV+AFD+P+  + APIA+
Sbjct  712  VKTKAVRKIVNQLCWDIRPDAVALVNAFDIPESCLAAPIAV  752



>ref|WP_018850693.1| acyl-CoA oxidase [Streptomyces sp. CNT372]
Length=653

 Score =   100 bits (248),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 54/156 (35%), Positives = 87/156 (56%), Gaps = 3/156 (2%)
 Frame = -3

Query  637  PVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGA--WNRCLNHLL  464
            P    W+ E  L DP +QL   RYR   +L  +A RL KH  +     A  +++  +H +
Sbjct  495  PGGDEWDQEAGLLDPEYQLAMLRYREEHMLAGLARRL-KHGADHKRHPAAVYSQVQDHAI  553

Query  463  TLAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPNK  284
             LA +H+E  +LE F+   ++ PD  ++ A  L+CDL+AL+ I  D   +     +   +
Sbjct  554  ALAHAHVERLMLEAFVDTFRAMPDGGNKVAAGLLCDLFALSTIEADRAWFMEHGRLTAQR  613

Query  283  AKAINKLTEYLCFQVRNTAKDLVDAFDLPDYVIRAP  176
            +KAI++    LC +VR  A DLVDA+++P  ++RAP
Sbjct  614  SKAISREVNDLCRKVRPLAVDLVDAWNIPPELLRAP  649



>ref|WP_024455592.1| acyl-CoA oxidase [Mycobacterium sp. UM_RHS]
Length=656

 Score =   100 bits (248),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 52/142 (37%), Positives = 80/142 (56%), Gaps = 0/142 (0%)
 Frame = -3

Query  619  EGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGAWNRCLNHLLTLAESHIE  440
            E E  L +   Q+  F  R   LL +VA RLQ  +K +  F A+N   +H+L  A +HI+
Sbjct  482  EEEGSLFNRGTQVQMFEDREQYLLSTVARRLQGKAKEVSAFDAFNAVQDHVLHAATAHID  541

Query  439  SFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPNKAKAINKLT  260
              +LE F+  + +C DP++R  L LVCDLYAL+ I  D   Y    +++  +AKA+ +  
Sbjct  542  RIVLEAFVAGIDTCEDPTAREILDLVCDLYALSIIEEDKAWYVEHRFLSTERAKAVTRAI  601

Query  259  EYLCFQVRNTAKDLVDAFDLPD  194
               C ++R  A+ LVD F +P+
Sbjct  602  NDRCRKLRPHAELLVDGFGIPE  623



>gb|ETZ74934.1| acyl-CoA dehydrogenase, C-terminal domain protein [Mycobacterium 
sp. MAC_080597_8934]
Length=624

 Score = 99.8 bits (247),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 53/142 (37%), Positives = 78/142 (55%), Gaps = 0/142 (0%)
 Frame = -3

Query  619  EGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGAWNRCLNHLLTLAESHIE  440
            E E  L +   Q+  F  R   LL SVA RLQ  SK +  F A+N   +H+L  A +HI+
Sbjct  464  EEEGSLFNRGTQIKMFEDREEYLLASVARRLQAKSKEMSEFDAFNSVQDHVLHAASAHID  523

Query  439  SFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPNKAKAINKLT  260
              +LE F+  +  CPD  +R  L ++CDLYAL+ I +D   Y    Y++  +AKA+ +  
Sbjct  524  RVVLEAFVAGIDGCPDEQARELLGILCDLYALSVIEDDKAWYIEHRYLSTERAKAVTRGI  583

Query  259  EYLCFQVRNTAKDLVDAFDLPD  194
               C  +R  A+ LVD F +P+
Sbjct  584  NDRCRALRPHAQTLVDGFGIPE  605



>dbj|BAN30767.1| acyl-CoA oxidase [Mycobacterium avium subsp. hominissuis TH135]
 gb|ETZ43394.1| acyl-CoA dehydrogenase, C-terminal domain protein [Mycobacterium 
avium MAV_120809_2495]
 gb|ETZ45717.1| acyl-CoA dehydrogenase, C-terminal domain protein [Mycobacterium 
avium MAV_061107_1842]
 gb|EUA38906.1| acyl-CoA dehydrogenase, C-terminal domain protein [Mycobacterium 
avium subsp. avium 2285 (R)]
 gb|KBR68691.1| hypothetical protein X425_00393 [Mycobacterium avium XTB13-223]
Length=624

 Score = 99.8 bits (247),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 53/142 (37%), Positives = 78/142 (55%), Gaps = 0/142 (0%)
 Frame = -3

Query  619  EGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGAWNRCLNHLLTLAESHIE  440
            E E  L +   Q+  F  R   LL SVA RLQ  SK +  F A+N   +H+L  A +HI+
Sbjct  464  EEEGSLFNRGTQIKMFEDREEYLLASVARRLQAKSKEMSEFDAFNSVQDHVLHAASAHID  523

Query  439  SFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPNKAKAINKLT  260
              +LE F+  +  CPD  +R  L ++CDLYAL+ I +D   Y    Y++  +AKA+ +  
Sbjct  524  RVVLEAFVAGIDGCPDEQARELLGILCDLYALSVIEDDKAWYIEHRYLSTERAKAVTRGI  583

Query  259  EYLCFQVRNTAKDLVDAFDLPD  194
               C  +R  A+ LVD F +P+
Sbjct  584  NDRCRALRPHAQTLVDGFGIPE  605



>ref|WP_036151893.1| acyl-CoA oxidase [Maribacter forsetii]
Length=754

 Score =   100 bits (248),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 52/158 (33%), Positives = 88/158 (56%), Gaps = 1/158 (1%)
 Frame = -3

Query  640  NPVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKH-SKNLGGFGAWNRCLNHLL  464
            NP+ +    +DHL +P F + AF +RT RL  ++A+R++ +  K +  + A+ +   HL+
Sbjct  596  NPLYTNKTDKDHLYNPKFHVHAFEHRTRRLTYTIAMRIRGYIKKGIPSYQAFLKVQTHLM  655

Query  463  TLAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPNK  284
            TL +++      + FI    +  DP  +A  + +  LYAL+ I  D   Y    Y++  K
Sbjct  656  TLGKAYSAELAYKSFIAHNDTMTDPEYKALFEKLGTLYALHEIRKDASWYLEQGYISGTK  715

Query  283  AKAINKLTEYLCFQVRNTAKDLVDAFDLPDYVIRAPIA  170
            +KAI +  E LC ++R     LVD F +PD+++ APIA
Sbjct  716  SKAIRQRVERLCTELRPHLNSLVDGFGIPDHLMTAPIA  753



>ref|WP_032788418.1| acyl-CoA oxidase [Streptomyces sp. JS01]
 gb|KFK86129.1| acyl-CoA oxidase [Streptomyces sp. JS01]
Length=655

 Score = 99.8 bits (247),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 52/155 (34%), Positives = 87/155 (56%), Gaps = 1/155 (1%)
 Frame = -3

Query  637  PVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGA-WNRCLNHLLT  461
            P    W+ E  L D  +QL   RYR   +L  VA RL+         GA ++   +H++ 
Sbjct  495  PGGDEWDQEAGLLDSEYQLAMVRYREEHMLAGVARRLKSGIDRKRDAGAVFSEVQDHVIA  554

Query  460  LAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPNKA  281
            +A +H+E  +LE F++ +++ PD  ++ AL L+CDL+AL+ I  D   +     +   ++
Sbjct  555  VARAHMERLVLEAFVEKMRTLPDGGNKVALGLLCDLFALSTIEADRAWFMEHGRLTVQRS  614

Query  280  KAINKLTEYLCFQVRNTAKDLVDAFDLPDYVIRAP  176
            KAI +    LC ++R  A +LVDA+ +PD ++RAP
Sbjct  615  KAITREVNDLCRKIRPLAGELVDAWGIPDAMLRAP  649



>gb|ELP46004.1| hypothetical protein D522_13218 [Mycobacterium avium subsp. paratuberculosis 
S5]
Length=624

 Score = 99.8 bits (247),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 53/142 (37%), Positives = 78/142 (55%), Gaps = 0/142 (0%)
 Frame = -3

Query  619  EGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGAWNRCLNHLLTLAESHIE  440
            E E  L +   Q+  F  R   LL SVA RLQ  SK +  F A+N   +H+L  A +HI+
Sbjct  464  EEEGSLFNRGTQIKMFEDREEYLLASVARRLQAKSKEMSEFDAFNSVQDHVLHAASAHID  523

Query  439  SFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPNKAKAINKLT  260
              +LE F+  +  CPD  +R  L ++CDLYAL+ I +D   Y    Y++  +AKA+ +  
Sbjct  524  RVVLEAFVAGIDGCPDEQARELLGILCDLYALSVIEDDKAWYIEHRYLSTERAKAVTRGI  583

Query  259  EYLCFQVRNTAKDLVDAFDLPD  194
               C  +R  A+ LVD F +P+
Sbjct  584  NDRCRALRPHAQTLVDGFGIPE  605



>gb|EGO40578.1| acyl-CoA dehydrogenase [Mycobacterium avium subsp. paratuberculosis 
S397]
Length=624

 Score = 99.8 bits (247),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 53/142 (37%), Positives = 78/142 (55%), Gaps = 0/142 (0%)
 Frame = -3

Query  619  EGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGAWNRCLNHLLTLAESHIE  440
            E E  L +   Q+  F  R   LL SVA RLQ  SK +  F A+N   +H+L  A +HI+
Sbjct  464  EEEGSLFNRGTQIKMFEDREEYLLASVARRLQAKSKEMSEFDAFNSVQDHVLHAASAHID  523

Query  439  SFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPNKAKAINKLT  260
              +LE F+  +  CPD  +R  L ++CDLYAL+ I +D   Y    Y++  +AKA+ +  
Sbjct  524  RVVLEAFVAGIDGCPDEQARELLGILCDLYALSVIEDDKAWYIEHRYLSTERAKAVTRGI  583

Query  259  EYLCFQVRNTAKDLVDAFDLPD  194
               C  +R  A+ LVD F +P+
Sbjct  584  NDRCRALRPHAQTLVDGFGIPE  605



>ref|WP_043786179.1| acyl-CoA oxidase [Amycolatopsis rifamycinica]
 gb|KDN18460.1| acyl-CoA oxidase [Amycolatopsis rifamycinica]
Length=629

 Score = 99.8 bits (247),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 51/140 (36%), Positives = 81/140 (58%), Gaps = 2/140 (1%)
 Frame = -3

Query  592  NFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGAWNRCLNHLLTLAESHIESFILEIFIQ  413
             +QL  F  R   +++ VA RL+K + +   FG +N   +H+L     H+E  +LE F  
Sbjct  489  EWQLRLFEDREDHVVEGVAKRLRKAASDP--FGVFNAAQDHVLRAGRVHVERLVLEAFAA  546

Query  412  AVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPNKAKAINKLTEYLCFQVRN  233
            AV+ C DP +RA L+ VCDLYAL+ I  D+  +     ++ ++AKA+      LC ++R 
Sbjct  547  AVERCSDPEARALLERVCDLYALSAIEEDLAWFLGHGRLSASRAKAVTSAVNRLCAELRP  606

Query  232  TAKDLVDAFDLPDYVIRAPI  173
             A+ LVDAF +P+  + AP+
Sbjct  607  HARTLVDAFAIPEQFLAAPM  626



>ref|WP_041518765.1| acyl-CoA oxidase [Flavobacterium hibernum]
 gb|KIO51986.1| acyl-CoA oxidase [Flavobacterium hibernum]
Length=752

 Score =   100 bits (248),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 55/161 (34%), Positives = 92/161 (57%), Gaps = 1/161 (1%)
 Frame = -3

Query  646  QPNPVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKH-SKNLGGFGAWNRCLNH  470
            + NP+ +R   E+HL D  F L AF++R   +L S A R++K     L  + A+N   + 
Sbjct  592  EKNPIATRRTDEEHLLDGEFHLQAFQHREKTILASAAKRIKKLVDGGLEAYDAFNVVQHQ  651

Query  469  LLTLAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAP  290
            ++ +A++++E  +LE F  A+++  D  S+  L  +  LYAL++I  +   Y    Y+  
Sbjct  652  MIDVAQAYLERVVLEQFQLAIQAVEDKKSKEILVKLNQLYALSQIEKNRAWYLEDGYMEA  711

Query  289  NKAKAINKLTEYLCFQVRNTAKDLVDAFDLPDYVIRAPIAL  167
             K KAI K+   LC+ +R  A  LV+AFD+P+  + APIA+
Sbjct  712  VKTKAIRKMVNQLCWDIRPDAVSLVNAFDIPESCLAAPIAV  752



>ref|WP_020534466.1| hypothetical protein [Lewinella cohaerens]
Length=769

 Score =   100 bits (248),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 63/161 (39%), Positives = 86/161 (53%), Gaps = 1/161 (1%)
 Frame = -3

Query  646  QPNPVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKN-LGGFGAWNRCLNH  470
            + NP   R     HLR   FQL AF++R  RLL S+A RL+ H K+    + A   C  H
Sbjct  608  ETNPFAIRNTDGGHLRSTEFQLAAFQFRERRLLFSLAQRLRGHIKDGKSAYEAGLICQTH  667

Query  469  LLTLAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAP  290
            +L LAE+ IE   LE   +AV      S    L+ +  LYAL+ I      Y   DY+A 
Sbjct  668  MLALAEAFIERVTLESTAKAVSEAKGTSIYNILRKLRSLYALHTIEKHAAWYLEQDYLAG  727

Query  289  NKAKAINKLTEYLCFQVRNTAKDLVDAFDLPDYVIRAPIAL  167
             K+KAI K  + LC ++R  A  LV+AF +P+ +I API +
Sbjct  728  TKSKAIRKQVDQLCGELRPEAVALVEAFGIPESLIAAPIVM  768



>ref|WP_024445310.1| acyl-CoA oxidase [Mycobacterium iranicum]
Length=653

 Score = 99.8 bits (247),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 59/170 (35%), Positives = 93/170 (55%), Gaps = 4/170 (2%)
 Frame = -3

Query  619  EGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGAWNRCLNHLLTLAESHIE  440
            E E  L +   Q+  F  R   +L SVA RLQ  SK +  F A+N   +H+L +A++HI+
Sbjct  482  EEEGSLFNRGTQVKMFEDREEYMLASVARRLQSKSKEMSAFEAFNSVQDHVLHVAQAHID  541

Query  439  SFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPNKAKAINKLT  260
              ILE F+  + SC D ++R  L +VCDLYAL+ I  D   +    +++  +AKA+ +  
Sbjct  542  RIILEAFVAGIASCEDRTAREILGMVCDLYALSVIEEDKAWFVEHRFLSTERAKAVTRGI  601

Query  259  EYLCFQVRNTAKDLVDAFDLPDYVIRA----PIALQDSEQVYLQYAQYAG  122
               C ++R  A+ LVD F +P+ +  A    P  + D+++   Q A  AG
Sbjct  602  NDRCRRLRPYAELLVDGFGIPEQLRYAEMLHPEHIPDADEHTPQNATSAG  651



>ref|WP_030276558.1| MULTISPECIES: acyl-CoA oxidase [Streptomyces]
Length=655

 Score = 99.8 bits (247),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 53/155 (34%), Positives = 84/155 (54%), Gaps = 1/155 (1%)
 Frame = -3

Query  637  PVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGA-WNRCLNHLLT  461
            P    W+ E  L D  +QL   RYR   +L  VA RL++        G  ++   +H++ 
Sbjct  495  PGGDEWDQEAGLLDSEYQLAMVRYREEHMLAGVARRLKRGMDQKRDPGTVFSEVQDHVIA  554

Query  460  LAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPNKA  281
            LA +H+E  +LE F+  V++ PD   + AL L+CDL+AL  I  D   +     +   ++
Sbjct  555  LAHAHMERLVLEAFVDRVRALPDGGDKVALGLLCDLHALTTIEADRAWFMEHGRLTVQRS  614

Query  280  KAINKLTEYLCFQVRNTAKDLVDAFDLPDYVIRAP  176
            K+I +    LC ++R  A DLVDA+++P  V+RAP
Sbjct  615  KSITREVNDLCRKIRPLAGDLVDAWNIPSAVLRAP  649



>ref|WP_035657136.1| acyl-CoA oxidase [Flavobacterium sp. EM1321]
 gb|KDN56812.1| acyl-CoA oxidase [Flavobacterium sp. EM1321]
Length=755

 Score = 99.8 bits (247),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 56/161 (35%), Positives = 91/161 (57%), Gaps = 1/161 (1%)
 Frame = -3

Query  646  QPNPVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKH-SKNLGGFGAWNRCLNH  470
            + NPV  R   ++HL D  F L AF++R   +L S A R++K     L  + A+N   + 
Sbjct  592  EKNPVVIRKTDDEHLLDSQFHLQAFQHREKTILASAAKRIKKLVDSGLDAYDAFNVVQHQ  651

Query  469  LLTLAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAP  290
            ++ +AE++++S +LE F  A+++  D  S+A L  +  L+AL++I  +   Y    Y+  
Sbjct  652  MIDVAEAYLDSVVLEQFQIAIEAVKDEKSKAILTKLNQLFALSQIEINKAWYLEDGYMEA  711

Query  289  NKAKAINKLTEYLCFQVRNTAKDLVDAFDLPDYVIRAPIAL  167
             K KAI K+   LC+ +R  A  LVDAF +PD  + API +
Sbjct  712  VKTKAIRKMVNQLCWDIRPDAVALVDAFAIPDSCLAAPIVV  752



>ref|WP_011893606.1| acyl-CoA oxidase [Mycobacterium gilvum]
 gb|ABP45203.1| acyl-CoA dehydrogenase domain protein [Mycobacterium gilvum PYR-GCK]
 gb|ADT98817.1| acyl-CoA dehydrogenase [Mycobacterium gilvum Spyr1]
Length=653

 Score = 99.8 bits (247),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 59/170 (35%), Positives = 92/170 (54%), Gaps = 4/170 (2%)
 Frame = -3

Query  619  EGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGAWNRCLNHLLTLAESHIE  440
            E E  L +   Q+  F  R   +L SVA R+Q  SK +G F A+N   +H+L  A++HI+
Sbjct  482  EEEGSLFNRGTQVQMFEDREQYMLSSVARRIQSKSKEMGAFDAFNSVQDHVLHTAQAHID  541

Query  439  SFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPNKAKAINKLT  260
              ILE F+  + SC D  +R  L +VCDLYAL+ I  D   +    +++  +AKA+ +  
Sbjct  542  RIILEAFVAGIDSCQDRQAREILGMVCDLYALSVIEEDKAWFVEHRFLSTERAKAVTRGI  601

Query  259  EYLCFQVRNTAKDLVDAFDLPDYVIRA----PIALQDSEQVYLQYAQYAG  122
               C ++R  A+ LVD F +P+ +  A    P  + D+++   Q A  AG
Sbjct  602  NDRCRRLRPYAELLVDGFGIPENLRYAEMLHPENIPDADEHTSQDATSAG  651



>ref|WP_029182498.1| acyl-CoA oxidase [Streptomyces globisporus]
Length=655

 Score = 99.8 bits (247),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 52/155 (34%), Positives = 87/155 (56%), Gaps = 1/155 (1%)
 Frame = -3

Query  637  PVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGA-WNRCLNHLLT  461
            P    W+ E  L D  +QL   RYR   +L  VA RL+         GA ++   +H++ 
Sbjct  495  PGGDEWDQEAGLLDSEYQLAMVRYREEHMLAGVARRLKSGIDRKRDAGAVFSEVQDHVIA  554

Query  460  LAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPNKA  281
            +A +H+E  +LE F++ +++ P+  ++ AL L+CDLYAL+ I  D   +     +   ++
Sbjct  555  VARAHMERLVLEAFVEKMRTLPEGGNKVALGLLCDLYALSTIEADRAWFMEHGRLTVQRS  614

Query  280  KAINKLTEYLCFQVRNTAKDLVDAFDLPDYVIRAP  176
            KAI +    LC ++R  A +LVDA+ +PD ++RAP
Sbjct  615  KAITREVNDLCRKIRPLAGELVDAWGIPDAMLRAP  649



>ref|WP_023898649.1| MULTISPECIES: acyl-CoA oxidase [Mycobacterium avium complex (MAC)]
 gb|ETB53909.1| acyl-CoA oxidase [Mycobacterium avium 10-5560]
 gb|KDP10097.1| acyl-CoA oxidase [Mycobacterium avium subsp. hominissuis 100]
Length=650

 Score = 99.4 bits (246),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 53/142 (37%), Positives = 78/142 (55%), Gaps = 0/142 (0%)
 Frame = -3

Query  619  EGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGAWNRCLNHLLTLAESHIE  440
            E E  L +   Q+  F  R   LL SVA RLQ  SK +  F A+N   +H+L  A +HI+
Sbjct  490  EEEGSLFNRGTQIKMFEDREEYLLASVARRLQAKSKEMSEFDAFNSVQDHVLHAASAHID  549

Query  439  SFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPNKAKAINKLT  260
              +LE F+  +  CPD  +R  L ++CDLYAL+ I +D   Y    Y++  +AKA+ +  
Sbjct  550  RVVLEAFVAGIDGCPDEQARELLGILCDLYALSVIEDDKAWYIEHRYLSTERAKAVTRGI  609

Query  259  EYLCFQVRNTAKDLVDAFDLPD  194
               C  +R  A+ LVD F +P+
Sbjct  610  NDRCRALRPHAQTLVDGFGIPE  631



>ref|WP_023868784.1| acyl-CoA oxidase [Mycobacterium avium]
 gb|ETA98669.1| acyl-CoA oxidase [Mycobacterium avium 10-5581]
Length=650

 Score = 99.4 bits (246),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 53/142 (37%), Positives = 78/142 (55%), Gaps = 0/142 (0%)
 Frame = -3

Query  619  EGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGAWNRCLNHLLTLAESHIE  440
            E E  L +   Q+  F  R   LL SVA RLQ  SK +  F A+N   +H+L  A +HI+
Sbjct  490  EEEGSLFNRGTQIKMFEDREEYLLASVARRLQAKSKEMSEFDAFNSVQDHVLHAASAHID  549

Query  439  SFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPNKAKAINKLT  260
              +LE F+  +  CPD  +R  L ++CDLYAL+ I +D   Y    Y++  +AKA+ +  
Sbjct  550  RVVLEAFVAGIDGCPDEQARELLGILCDLYALSVIEDDKAWYIEHRYLSTERAKAVTRGI  609

Query  259  EYLCFQVRNTAKDLVDAFDLPD  194
               C  +R  A+ LVD F +P+
Sbjct  610  NDRCRALRPHAQTLVDGFGIPE  631



>ref|WP_038676593.1| acyl-CoA oxidase [Pimelobacter simplex]
 gb|AIY16020.1| Acyl-coenzyme A oxidase 1, peroxisomal [Pimelobacter simplex]
Length=657

 Score = 99.4 bits (246),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 50/150 (33%), Positives = 83/150 (55%), Gaps = 1/150 (1%)
 Frame = -3

Query  622  WEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKH-SKNLGGFGAWNRCLNHLLTLAESH  446
            W+ +  LRDP++ L  FR+R    +  VA RL+      +     ++R  +H++  A +H
Sbjct  501  WDTDSGLRDPSYHLAMFRFREEHRIGGVARRLKSGVDAGMNAGEVFSRVQDHVIAAARAH  560

Query  445  IESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPNKAKAINK  266
            +E  +LE F+  V++  D   +A L  VCDLYAL+ I  D   +     +   ++KAI +
Sbjct  561  VERLVLEAFVDQVEALDDGEVKATLNAVCDLYALSEIEADAAWFIEHGRLGVQRSKAITR  620

Query  265  LTEYLCFQVRNTAKDLVDAFDLPDYVIRAP  176
                LC ++R  A++LVD F +PD ++RAP
Sbjct  621  EVGDLCRRLRPVARELVDGFAVPDALLRAP  650



>ref|WP_011724581.1| acyl-CoA oxidase [Mycobacterium avium]
 gb|ABK66197.1| acyl-CoA oxidase [Mycobacterium avium 104]
 gb|ETA92948.1| acyl-CoA oxidase [Mycobacterium avium 05-4293]
 gb|ETB14128.1| acyl-CoA oxidase [Mycobacterium avium subsp. silvaticum ATCC 
49884]
 gb|ETB21838.1| acyl-CoA oxidase [Mycobacterium avium subsp. avium 11-4751]
 gb|ETB26018.1| acyl-CoA oxidase [Mycobacterium avium 09-5983]
 gb|ETB42229.1| acyl-CoA oxidase [Mycobacterium avium subsp. hominissuis 10-5606]
 gb|ETZ41808.1| acyl-CoA dehydrogenase, C-terminal domain protein [Mycobacterium 
avium MAV_120709_2344]
 gb|KDO96822.1| acyl-CoA oxidase [Mycobacterium avium subsp. hominissuis A5]
 gb|KDP06720.1| acyl-CoA oxidase [Mycobacterium avium subsp. hominissuis 101]
 gb|AIR56244.1| acyl-CoA oxidase [Mycobacterium avium subsp. avium 2285 (R)]
 gb|AIV24803.1| acyl-CoA oxidase [Mycobacterium avium subsp. avium]
Length=650

 Score = 99.4 bits (246),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 53/142 (37%), Positives = 78/142 (55%), Gaps = 0/142 (0%)
 Frame = -3

Query  619  EGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGAWNRCLNHLLTLAESHIE  440
            E E  L +   Q+  F  R   LL SVA RLQ  SK +  F A+N   +H+L  A +HI+
Sbjct  490  EEEGSLFNRGTQIKMFEDREEYLLASVARRLQAKSKEMSEFDAFNSVQDHVLHAASAHID  549

Query  439  SFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPNKAKAINKLT  260
              +LE F+  +  CPD  +R  L ++CDLYAL+ I +D   Y    Y++  +AKA+ +  
Sbjct  550  RVVLEAFVAGIDGCPDEQARELLGILCDLYALSVIEDDKAWYIEHRYLSTERAKAVTRGI  609

Query  259  EYLCFQVRNTAKDLVDAFDLPD  194
               C  +R  A+ LVD F +P+
Sbjct  610  NDRCRALRPHAQTLVDGFGIPE  631



>ref|WP_023881352.1| acyl-CoA oxidase [Mycobacterium avium]
 gb|ETB48051.1| acyl-CoA oxidase [Mycobacterium avium 11-0986]
 gb|KDP00542.1| acyl-CoA oxidase [Mycobacterium avium subsp. hominissuis 3388]
Length=650

 Score = 99.4 bits (246),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 53/142 (37%), Positives = 78/142 (55%), Gaps = 0/142 (0%)
 Frame = -3

Query  619  EGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGAWNRCLNHLLTLAESHIE  440
            E E  L +   Q+  F  R   LL SVA RLQ  SK +  F A+N   +H+L  A +HI+
Sbjct  490  EEEGSLFNRGTQIKMFEDREEYLLASVARRLQAKSKEMSEFDAFNSVQDHVLHAASAHID  549

Query  439  SFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPNKAKAINKLT  260
              +LE F+  +  CPD  +R  L ++CDLYAL+ I +D   Y    Y++  +AKA+ +  
Sbjct  550  RVVLEAFVAGIDGCPDEQARELLGILCDLYALSVIEDDKAWYIEHRYLSTERAKAVTRGI  609

Query  259  EYLCFQVRNTAKDLVDAFDLPD  194
               C  +R  A+ LVD F +P+
Sbjct  610  NDRCRALRPHAQTLVDGFGIPE  631



>gb|AHE14605.1| peroxisomal acyl-coenzyme A oxidase [uncultured bacterium]
Length=664

 Score = 99.4 bits (246),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 57/150 (38%), Positives = 83/150 (55%), Gaps = 1/150 (1%)
 Frame = -3

Query  613  EDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSK-NLGGFGAWNRCLNHLLTLAESHIES  437
            E +L D  +Q+  F  R  R+L  V  RL+   K +   F ++N   +H+L  A +H+E 
Sbjct  501  EANLLDRGYQIKLFEGREERILDGVMRRLRTGMKISKDPFKSFNTVQDHVLLAARAHVER  560

Query  436  FILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPNKAKAINKLTE  257
             ILE F  A+  C DP   A L  VCDLYAL+ I  + G +   D ++  + K +     
Sbjct  561  IILECFCDAIDRCEDPGVAALLDKVCDLYALSVIEREKGWFLEHDRLSSVRTKLVTIAVN  620

Query  256  YLCFQVRNTAKDLVDAFDLPDYVIRAPIAL  167
             LC ++R  A+ LVDAFD+PD ++ APIAL
Sbjct  621  QLCEELRPYAELLVDAFDIPDELLGAPIAL  650



>ref|WP_023883147.1| acyl-CoA oxidase [Mycobacterium avium]
 gb|ETB40529.1| acyl-CoA oxidase [Mycobacterium avium subsp. paratuberculosis 
11-1786]
Length=650

 Score = 99.4 bits (246),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 53/142 (37%), Positives = 78/142 (55%), Gaps = 0/142 (0%)
 Frame = -3

Query  619  EGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGAWNRCLNHLLTLAESHIE  440
            E E  L +   Q+  F  R   LL SVA RLQ  SK +  F A+N   +H+L  A +HI+
Sbjct  490  EEEGSLFNRGTQIKMFEDREEYLLASVARRLQAKSKEMSEFDAFNSVQDHVLHAASAHID  549

Query  439  SFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPNKAKAINKLT  260
              +LE F+  +  CPD  +R  L ++CDLYAL+ I +D   Y    Y++  +AKA+ +  
Sbjct  550  RVVLEAFVAGIDGCPDEQARELLGILCDLYALSVIEDDKAWYIEHRYLSTERAKAVTRGI  609

Query  259  EYLCFQVRNTAKDLVDAFDLPD  194
               C  +R  A+ LVD F +P+
Sbjct  610  NDRCRALRPHAQTLVDGFGIPE  631



>ref|WP_015632626.1| Acyl-coenzyme A dehydrogenaseoxidase [Mycobacterium avium]
 gb|AGL36641.1| Acyl-coenzyme A dehydrogenaseoxidase [Mycobacterium avium subsp. 
paratuberculosis MAP4]
Length=650

 Score = 99.4 bits (246),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 53/142 (37%), Positives = 78/142 (55%), Gaps = 0/142 (0%)
 Frame = -3

Query  619  EGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGAWNRCLNHLLTLAESHIE  440
            E E  L +   Q+  F  R   LL SVA RLQ  SK +  F A+N   +H+L  A +HI+
Sbjct  490  EEEGSLFNRGTQIKMFEDREEYLLASVARRLQAKSKEMSEFDAFNSVQDHVLHAASAHID  549

Query  439  SFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPNKAKAINKLT  260
              +LE F+  +  CPD  +R  L ++CDLYAL+ I +D   Y    Y++  +AKA+ +  
Sbjct  550  RVVLEAFVAGIDGCPDEQARELLGILCDLYALSVIEDDKAWYIEHRYLSTERAKAVTRGI  609

Query  259  EYLCFQVRNTAKDLVDAFDLPD  194
               C  +R  A+ LVD F +P+
Sbjct  610  NDRCRALRPHAQTLVDGFGIPE  631



>ref|WP_010949479.1| acyl-CoA oxidase [Mycobacterium avium]
 gb|AAS04418.1| hypothetical protein MAP_2101 [Mycobacterium avium subsp. paratuberculosis 
K-10]
 gb|ETB03376.1| acyl-CoA oxidase [Mycobacterium avium subsp. paratuberculosis 
10-4404]
 gb|ETB33078.1| acyl-CoA oxidase [Mycobacterium avium subsp. paratuberculosis 
10-5975]
 gb|ETB52493.1| acyl-CoA oxidase [Mycobacterium avium subsp. paratuberculosis 
10-8425]
 gb|AJK75074.1| acyl-CoA oxidase [Mycobacterium avium subsp. paratuberculosis]
 gb|AJK79234.1| acyl-CoA oxidase [Mycobacterium avium subsp. paratuberculosis]
Length=650

 Score = 99.4 bits (246),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 53/142 (37%), Positives = 78/142 (55%), Gaps = 0/142 (0%)
 Frame = -3

Query  619  EGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGAWNRCLNHLLTLAESHIE  440
            E E  L +   Q+  F  R   LL SVA RLQ  SK +  F A+N   +H+L  A +HI+
Sbjct  490  EEEGSLFNRGTQIKMFEDREEYLLASVARRLQAKSKEMSEFDAFNSVQDHVLHAASAHID  549

Query  439  SFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPNKAKAINKLT  260
              +LE F+  +  CPD  +R  L ++CDLYAL+ I +D   Y    Y++  +AKA+ +  
Sbjct  550  RVVLEAFVAGIDGCPDEQARELLGILCDLYALSVIEDDKAWYIEHRYLSTERAKAVTRGI  609

Query  259  EYLCFQVRNTAKDLVDAFDLPD  194
               C  +R  A+ LVD F +P+
Sbjct  610  NDRCRALRPHAQTLVDGFGIPE  631



>ref|XP_003293464.1| hypothetical protein DICPUDRAFT_158324 [Dictyostelium purpureum]
 gb|EGC30018.1| hypothetical protein DICPUDRAFT_158324 [Dictyostelium purpureum]
Length=684

 Score = 99.4 bits (246),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 60/158 (38%), Positives = 85/158 (54%), Gaps = 3/158 (2%)
 Frame = -3

Query  640  NPVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKN--LGGFGAWNRCLNHL  467
            N  T R   E HL DP+  LDAF YR  +LL+ +   L+   KN  + G  AWN  L+ +
Sbjct  514  NFFTKRLHTESHLLDPDVLLDAFIYREFKLLRLLIKTLRGKVKNEKMSGIQAWNSSLDLV  573

Query  466  LTLAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPN  287
            L LA +++E   +E F++ V+   D      L L C LY L +I ND+G + +  Y AP 
Sbjct  574  LQLANAYVERVSIEKFLEEVQKASDDIKPVLLSL-CVLYELTKIENDLGWFLSNKYFAPI  632

Query  286  KAKAINKLTEYLCFQVRNTAKDLVDAFDLPDYVIRAPI  173
            K +AI      +C  +R+ A  LV AFD+P   + API
Sbjct  633  KGQAIGNTINKVCNSLRDHAIPLVKAFDIPSQFLTAPI  670



>ref|WP_030591343.1| acyl-CoA oxidase [Streptomyces anulatus]
Length=653

 Score = 99.4 bits (246),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 52/155 (34%), Positives = 88/155 (57%), Gaps = 1/155 (1%)
 Frame = -3

Query  637  PVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGA-WNRCLNHLLT  461
            P    W+ E  L D  +QL   RYR   +L  +A RL++        G  +++  +H++ 
Sbjct  495  PGGDEWDQEAGLLDSEYQLAMVRYREEHMLAGLARRLKRGIDQKRDPGVVFSQVQDHVIA  554

Query  460  LAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPNKA  281
            +A +H+E  +LE F++ V++ PD  ++ AL L+CDL+AL+ I  D   +     +   ++
Sbjct  555  VAHAHVERLVLEAFVERVRALPDGGNKVALGLLCDLFALSTIEADRAWFMEHGRLTVQRS  614

Query  280  KAINKLTEYLCFQVRNTAKDLVDAFDLPDYVIRAP  176
            KAI++    LC +VR  A DLVDA+ +P  ++RAP
Sbjct  615  KAISREVNGLCRKVRPLAGDLVDAWGIPSEMLRAP  649



>ref|WP_030760334.1| MULTISPECIES: acyl-CoA oxidase [Streptomyces]
Length=660

 Score = 99.4 bits (246),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 52/155 (34%), Positives = 87/155 (56%), Gaps = 1/155 (1%)
 Frame = -3

Query  637  PVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGA-WNRCLNHLLT  461
            P    W+ E  L D  +QL   R+R   +L  +A R+++        GA +++  +H++ 
Sbjct  495  PGGDEWDREAGLLDSEYQLAMVRFREEHMLAGLARRIKRGIDRKQAAGAVFSQVQDHVIA  554

Query  460  LAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPNKA  281
            LA +H+E  + E F+  V++ P+   +AAL L+CDL+AL+ I  D   +     +   ++
Sbjct  555  LARAHVERLVTEAFVDKVRTLPEGGEKAALALLCDLFALSTIEADRAWFMEHGRLTVQRS  614

Query  280  KAINKLTEYLCFQVRNTAKDLVDAFDLPDYVIRAP  176
            KAI++    LC +VR  A DLVDA+ +P  V+RAP
Sbjct  615  KAISREVNDLCRKVRPLAVDLVDAWGIPSTVLRAP  649



>ref|WP_043644508.1| hypothetical protein, partial [Nocardioides alkalitolerans]
Length=665

 Score = 99.4 bits (246),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 54/155 (35%), Positives = 86/155 (55%), Gaps = 1/155 (1%)
 Frame = -3

Query  637  PVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGA-WNRCLNHLLT  461
            P    W+ E  L DP +QL   RYR  +++ S A RL++   +    GA ++R  +H++ 
Sbjct  499  PGGDDWDSEAGLLDPAYQLAMLRYREEQIISSAARRLKRGVDDGENPGAVFSRVQDHVIA  558

Query  460  LAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPNKA  281
             A +H++  +LE FI AV   P+   + AL L+ DL+AL+ I  D   +     +   ++
Sbjct  559  AARAHVDRVVLEAFIAAVDQVPEGDEKVALNLLVDLHALSTIEGDRAWFLEHGRMTAARS  618

Query  280  KAINKLTEYLCFQVRNTAKDLVDAFDLPDYVIRAP  176
            KAI +    LC ++R  A DLVDAF +P  ++RAP
Sbjct  619  KAITREVGDLCRKLRPLAGDLVDAFGVPPEILRAP  653



>ref|WP_036470198.1| acyl-CoA oxidase [Mycobacterium triplex]
 emb|CDO89561.1| acyl-CoA dehydrogenase [Mycobacterium triplex]
Length=648

 Score = 99.4 bits (246),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 53/142 (37%), Positives = 80/142 (56%), Gaps = 0/142 (0%)
 Frame = -3

Query  619  EGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGAWNRCLNHLLTLAESHIE  440
            E E  L +   Q++ F  R   LL SVA RLQ  SK +  F A+N   +H+L  A +HI+
Sbjct  490  EEEGSLFNRGTQVNMFEEREQYLLSSVARRLQGKSKEMSEFDAFNAVQDHVLHAASAHID  549

Query  439  SFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPNKAKAINKLT  260
              +LE F+  +  C + ++R  L++VCDLYAL+ I +D   Y    Y++  +AKA+ +  
Sbjct  550  RIVLEAFVAGIDGCENEAARELLEIVCDLYALSVIEDDKAWYIEHGYLSTGRAKAVTRGI  609

Query  259  EYLCFQVRNTAKDLVDAFDLPD  194
               C  +R  AK LVD F +P+
Sbjct  610  NDRCRALRPHAKTLVDGFGIPE  631



>ref|WP_041344327.1| acyl-CoA oxidase [Mycobacterium avium]
 gb|AIR23425.1| acyl-CoA oxidase [Mycobacterium avium subsp. avium 2285 (S)]
Length=650

 Score = 99.0 bits (245),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 53/142 (37%), Positives = 78/142 (55%), Gaps = 0/142 (0%)
 Frame = -3

Query  619  EGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGAWNRCLNHLLTLAESHIE  440
            E E  L +   Q+  F  R   LL SVA RLQ  SK +  F A+N   +H+L  A +HI+
Sbjct  490  EEEGSLFNRGTQIKMFEDREEYLLASVARRLQAKSKEMSEFDAFNSVQDHVLHAASAHID  549

Query  439  SFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPNKAKAINKLT  260
              +LE F+  +  CPD  +R  L ++CDLYAL+ I +D   Y    Y++  +AKA+ +  
Sbjct  550  RVVLEAFVAGIDGCPDEQARELLGILCDLYALSVIEDDKAWYIEHRYLSTERAKAVTRGI  609

Query  259  EYLCFQVRNTAKDLVDAFDLPD  194
               C  +R  A+ LVD F +P+
Sbjct  610  NDRCRALRPHAQTLVDGFGIPE  631



>ref|WP_033713247.1| acyl-CoA oxidase [Mycobacterium sp. MAC_011194_8550]
 gb|ETZ52057.1| acyl-CoA dehydrogenase, C-terminal domain protein [Mycobacterium 
sp. MAC_011194_8550]
Length=650

 Score = 99.0 bits (245),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 53/142 (37%), Positives = 78/142 (55%), Gaps = 0/142 (0%)
 Frame = -3

Query  619  EGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGAWNRCLNHLLTLAESHIE  440
            E E  L +   Q+  F  R   LL SVA RLQ  SK +  F A+N   +H+L  A +HI+
Sbjct  490  EEEGSLFNRGTQIKMFEDREEYLLASVARRLQAKSKEMSEFDAFNSVQDHVLHAASAHID  549

Query  439  SFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPNKAKAINKLT  260
              +LE F+  +  CPD  +R  L ++CDLYAL+ I +D   Y    Y++  +AKA+ +  
Sbjct  550  RVVLEAFVAGIDGCPDEQARELLGILCDLYALSVIEDDKAWYIEHRYLSTERAKAVTRGI  609

Query  259  EYLCFQVRNTAKDLVDAFDLPD  194
               C  +R  A+ LVD F +P+
Sbjct  610  NDRCRALRPHAQTLVDGFGIPE  631



>ref|WP_030531740.1| acyl-CoA oxidase [Prauserella rugosa]
Length=628

 Score = 99.0 bits (245),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 52/153 (34%), Positives = 83/153 (54%), Gaps = 1/153 (1%)
 Frame = -3

Query  631  TSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGAWNRCLNHLLTLAE  452
            + R + ED L D  +Q+  F  R   +L S+  RL++  ++  GF  +N   +H+L    
Sbjct  474  SPRRDDEDSLYDRAWQISMFEDREEHVLDSLVKRLRRAGRD-NGFEVFNSAQDHVLRAGR  532

Query  451  SHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPNKAKAI  272
             H++  +LE F+ A+  C DP ++A L+ VCDLYAL  I  D   +         + KA+
Sbjct  533  VHVDRIVLEAFVGAIDRCTDPDTKALLERVCDLYALANIEADRAWFLEHGRFTAQRGKAV  592

Query  271  NKLTEYLCFQVRNTAKDLVDAFDLPDYVIRAPI  173
                  LC ++R  A++LVDAF +P+  +RAPI
Sbjct  593  VAAVNELCAELRPRARELVDAFAVPERFLRAPI  625



>ref|WP_003970716.1| acyl-CoA oxidase [Streptomyces sp. ACT-1]
 gb|EGE46039.1| Acyl-CoA oxidase [Streptomyces sp. ACT-1]
Length=653

 Score = 99.0 bits (245),  Expect = 4e-20, Method: Composition-based stats.
 Identities = 52/155 (34%), Positives = 86/155 (55%), Gaps = 1/155 (1%)
 Frame = -3

Query  637  PVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGA-WNRCLNHLLT  461
            P    W+ E  L D  +QL  FRYR   +L   A RL++     G  G  +++  +H++ 
Sbjct  495  PGGDEWDQEAGLLDSEYQLAMFRYREEHMLAGAARRLKRGIDQKGDPGTVFSQVQDHVIA  554

Query  460  LAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPNKA  281
            +A +H+E  +LE F+  ++  P+  ++ AL L+CDL+AL+ I  D   +     +   ++
Sbjct  555  VARAHMERLVLEAFVDKMRVLPEGGNKVALGLLCDLFALSTIEADRAWFMEHGRLTVQRS  614

Query  280  KAINKLTEYLCFQVRNTAKDLVDAFDLPDYVIRAP  176
            KAI +    LC +VR  A DLVDA+ +P  ++RAP
Sbjct  615  KAITREVNDLCRKVRPLAGDLVDAWGIPPELLRAP  649



>ref|WP_033300853.1| acyl-CoA oxidase [Streptomyces atroolivaceus]
Length=653

 Score = 98.6 bits (244),  Expect = 5e-20, Method: Composition-based stats.
 Identities = 54/159 (34%), Positives = 88/159 (55%), Gaps = 9/159 (6%)
 Frame = -3

Query  637  PVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRL-----QKHSKNLGGFGAWNRCLN  473
            P    W+ E  L D  +QL   RYR   +L  VA RL     QK S  +     +++  +
Sbjct  495  PGGDEWDQEAGLLDSEYQLAMLRYREEHMLAGVARRLKRGIDQKRSPGV----VFSQVQD  550

Query  472  HLLTLAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVA  293
            H++ +A +H+E  +LE F+  V++ P+  ++ AL L+CDLYAL+ I +D   +     + 
Sbjct  551  HVIAVAHAHVERLVLEAFVDKVRALPESGNKVALGLLCDLYALSTIESDRAWFMEHGRLT  610

Query  292  PNKAKAINKLTEYLCFQVRNTAKDLVDAFDLPDYVIRAP  176
              ++KAI++    LC +VR  A  LVDA+ +P  ++RAP
Sbjct  611  VQRSKAISREVNDLCRKVRPLAGGLVDAWGIPPEMLRAP  649



>gb|EFA84508.1| acyl-CoA oxidase [Polysphondylium pallidum PN500]
Length=700

 Score = 99.0 bits (245),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 57/160 (36%), Positives = 87/160 (54%), Gaps = 1/160 (1%)
 Frame = -3

Query  631  TSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSK-NLGGFGAWNRCLNHLLTLA  455
            T+    +DHL +  F      YR+S+LL   A  + K  K +   F +WN+ L  L+ LA
Sbjct  515  TTYRSDKDHLLNLQFLRSCMEYRSSKLLIDSANTVSKAYKVSKDAFDSWNQSLETLIHLA  574

Query  454  ESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPNKAKA  275
            +SH E  I+  FI +VK+  D  +R  LK +C LYAL  I  D+  +RN +Y+  NKAKA
Sbjct  575  KSHTEMMIVSKFIDSVKNVQDKETRETLKKLCQLYALKCIREDMEFFRNTNYLKKNKAKA  634

Query  274  INKLTEYLCFQVRNTAKDLVDAFDLPDYVIRAPIALQDSE  155
            I+KL   LC  +   + +LV  +   + +I +P+   D +
Sbjct  635  ISKLISSLCHDLSKQSLELVAGYGNEEALIESPLGQLDGD  674



>ref|WP_036396123.1| acyl-CoA oxidase [Mycobacterium cosmeticum]
Length=656

 Score = 98.6 bits (244),  Expect = 6e-20, Method: Composition-based stats.
 Identities = 51/142 (36%), Positives = 80/142 (56%), Gaps = 0/142 (0%)
 Frame = -3

Query  619  EGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGAWNRCLNHLLTLAESHIE  440
            E E  L +   Q+  F  R   LL +VA RLQ  +K +  F A+N   +H+L  A +HI+
Sbjct  482  EEEGSLFNRGTQVQMFEDREQYLLSTVARRLQGKAKEVSAFDAFNAVQDHVLHAATAHID  541

Query  439  SFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPNKAKAINKLT  260
              +LE F+  + +C DP++R  L LVCDLYAL+ I  D   +    +++  +AKA+ +  
Sbjct  542  RIVLEAFVAGIDTCEDPTAREILDLVCDLYALSIIEEDKAWFVEHRFLSTERAKAVTRAI  601

Query  259  EYLCFQVRNTAKDLVDAFDLPD  194
               C ++R  A+ LVD F +P+
Sbjct  602  NDRCRKLRPHAELLVDGFGIPE  623



>ref|WP_022834726.1| acyl-CoA oxidase [Salisaeta longa]
Length=758

 Score = 98.6 bits (244),  Expect = 6e-20, Method: Composition-based stats.
 Identities = 58/159 (36%), Positives = 85/159 (53%), Gaps = 3/159 (2%)
 Frame = -3

Query  640  NPVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGG--FGAWNRCLNHL  467
            NP+  R    +HLR+ + Q DA R+R   L+QS A RL KH  + G   F A+    +HL
Sbjct  600  NPIVKRATDTEHLREADMQGDALRFRERALVQSAAQRL-KHRMDNGAAPFDAFVEVQDHL  658

Query  466  LTLAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPN  287
            LTLA +H E  + E F+  + +  D SSR+ L  +  LY L+R+      +    Y    
Sbjct  659  LTLAHAHAERVVFERFVDRIATVEDASSRSVLNTIRCLYGLHRLEAHRAWFLEKGYFEAP  718

Query  286  KAKAINKLTEYLCFQVRNTAKDLVDAFDLPDYVIRAPIA  170
            K+KAI      LC ++R  A+ L DA+ +P   ++APIA
Sbjct  719  KSKAIRTEVNTLCGEIRPWARALTDAWQIPSGALQAPIA  757



>emb|CDO05676.1| acyl-CoA dehydrogenase domain-containing protein [Mycobacterium 
cosmeticum]
Length=666

 Score = 98.6 bits (244),  Expect = 6e-20, Method: Composition-based stats.
 Identities = 51/142 (36%), Positives = 80/142 (56%), Gaps = 0/142 (0%)
 Frame = -3

Query  619  EGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGAWNRCLNHLLTLAESHIE  440
            E E  L +   Q+  F  R   LL +VA RLQ  +K +  F A+N   +H+L  A +HI+
Sbjct  492  EEEGSLFNRGTQVQMFEDREQYLLSTVARRLQGKAKEVSAFDAFNAVQDHVLHAATAHID  551

Query  439  SFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPNKAKAINKLT  260
              +LE F+  + +C DP++R  L LVCDLYAL+ I  D   +    +++  +AKA+ +  
Sbjct  552  RIVLEAFVAGIDTCEDPTAREILDLVCDLYALSIIEEDKAWFVEHRFLSTERAKAVTRAI  611

Query  259  EYLCFQVRNTAKDLVDAFDLPD  194
               C ++R  A+ LVD F +P+
Sbjct  612  NDRCRKLRPHAELLVDGFGIPE  633



>ref|WP_031456312.1| acyl-CoA oxidase [Flavobacterium chungangense]
Length=752

 Score = 98.2 bits (243),  Expect = 7e-20, Method: Composition-based stats.
 Identities = 54/161 (34%), Positives = 91/161 (57%), Gaps = 1/161 (1%)
 Frame = -3

Query  646  QPNPVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKH-SKNLGGFGAWNRCLNH  470
            + NP+ +R   ++HL D  F L AF +R   +L S A R++K   + L  + A+N   + 
Sbjct  592  EKNPIITRKTDDEHLLDNQFHLQAFVHREKTILASAARRIKKLIDEGLEAYDAFNVVQHQ  651

Query  469  LLTLAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAP  290
            ++ +AE+++E  +LE F   ++   D  ++  L  +  LYAL++I  + G Y    Y+  
Sbjct  652  MIDVAEAYLERVVLEQFQITIEKVEDVKTKEILLKLNQLYALSQIEKNKGWYLEDGYMEA  711

Query  289  NKAKAINKLTEYLCFQVRNTAKDLVDAFDLPDYVIRAPIAL  167
             K KAI K+   LC+ +R  A  LV+AFD+P+  + APIA+
Sbjct  712  VKTKAIRKMVNQLCWDIRPDAVSLVNAFDIPESCLAAPIAV  752



>ref|WP_042295862.1| acyl-CoA oxidase [Nonlabens ulvanivorans]
 dbj|GAL75016.1| acyl-coenzyme A oxidase 1 [Nonlabens ulvanivorans]
Length=768

 Score = 98.2 bits (243),  Expect = 8e-20, Method: Composition-based stats.
 Identities = 56/152 (37%), Positives = 90/152 (59%), Gaps = 1/152 (1%)
 Frame = -3

Query  640  NPVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKN-LGGFGAWNRCLNHLL  464
            N + +R   +DHL    FQL AF YR    L+++A+RL K  K+ +  + A+     HL+
Sbjct  609  NALVTRDTSQDHLLGDEFQLAAFTYREEYSLRTLAMRLNKKIKSGMDSYEAFLDVQVHLI  668

Query  463  TLAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPNK  284
             +A ++I+  +LE FI A+K     S +  L  + +LYAL+RI    G Y   DY++ +K
Sbjct  669  DMASAYIDRIVLEQFIGAIKKQEQNSVKEVLTSLKNLYALHRIEEYKGWYLEHDYISGSK  728

Query  283  AKAINKLTEYLCFQVRNTAKDLVDAFDLPDYV  188
            + AINKL   LC +++  ++ LVDAFD+P ++
Sbjct  729  SLAINKLVSKLCKELKEESQHLVDAFDIPAHM  760



>ref|WP_026992283.1| acyl-CoA oxidase [Flavobacterium subsaxonicum]
 gb|KGO94903.1| acyl-CoA oxidase [Flavobacterium subsaxonicum WB 4.1-42 = DSM 
21790]
Length=768

 Score = 98.2 bits (243),  Expect = 8e-20, Method: Composition-based stats.
 Identities = 53/151 (35%), Positives = 84/151 (56%), Gaps = 1/151 (1%)
 Frame = -3

Query  646  QPNPVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKN-LGGFGAWNRCLNH  470
            + NP+ +R   E HL+DP F L AF+YR   ++ S A R +K   + L  F A N    H
Sbjct  603  EKNPIATRNTDEAHLKDPAFHLQAFQYREKEIVSSAARRFKKLVDDGLDAFDAANIMHPH  662

Query  469  LLTLAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAP  290
            +L +A+S+++  +LE F   ++   D + +  L  + +L+ALN+I      Y    Y+  
Sbjct  663  MLQIADSYLDRVVLEQFQIKLQDTKDEALKEVLTRLYNLFALNKIGEHKAWYLEQGYMEG  722

Query  289  NKAKAINKLTEYLCFQVRNTAKDLVDAFDLP  197
             K KA+ KL   LC+++R  A  LVDAF++P
Sbjct  723  VKTKAVRKLVSQLCWEIRQDAVPLVDAFNIP  753



>ref|WP_044506891.1| acyl-CoA oxidase [Mycobacterium simiae]
Length=646

 Score = 97.8 bits (242),  Expect = 8e-20, Method: Composition-based stats.
 Identities = 52/142 (37%), Positives = 77/142 (54%), Gaps = 0/142 (0%)
 Frame = -3

Query  619  EGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGAWNRCLNHLLTLAESHIE  440
            E E  L +   Q++ F  R   LL SVA RLQ  SK +  F A+N   +H+L  A +HI+
Sbjct  490  EEEGSLFNRGTQVNMFEEREQYLLSSVARRLQSKSKEMSAFDAFNAVQDHVLHAASAHID  549

Query  439  SFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPNKAKAINKLT  260
              +LE F+  + +C +  +R  L +VCDLYAL  I  D   Y    Y++  +AKA+ +  
Sbjct  550  RIVLEAFVAGIDACENEEARELLGIVCDLYALTAIEEDKAWYIEHGYLSTQRAKAVTRGI  609

Query  259  EYLCFQVRNTAKDLVDAFDLPD  194
               C  +R  A+ LVD F +P+
Sbjct  610  NDRCRALRPHAQTLVDGFGIPE  631



>ref|WP_007171081.1| acyl-CoA oxidase [Mycobacterium parascrofulaceum]
 gb|EFG77870.1| acyl-CoA dehydrogenase, middle domain protein [Mycobacterium 
parascrofulaceum ATCC BAA-614]
Length=650

 Score = 97.8 bits (242),  Expect = 8e-20, Method: Composition-based stats.
 Identities = 51/142 (36%), Positives = 81/142 (57%), Gaps = 0/142 (0%)
 Frame = -3

Query  619  EGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGAWNRCLNHLLTLAESHIE  440
            E E  L +   Q+  F  R   L+ SVA RLQ  SK +  F A+N   +H+L  A++HI+
Sbjct  490  EEEGSLFNRGTQIKMFEDREEYLIASVARRLQAKSKEMSEFDAFNAVQDHVLHAAQAHID  549

Query  439  SFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPNKAKAINKLT  260
              +LE F+  +++CP   +R  L ++CDLYAL+ I +D   Y    Y++ ++AKA+ +  
Sbjct  550  RVVLEAFVAGIEACPHEETRELLGILCDLYALSVIEDDKAWYIEHRYLSTDRAKAVTRGI  609

Query  259  EYLCFQVRNTAKDLVDAFDLPD  194
               C  +R  A+ LVD F +P+
Sbjct  610  NDRCRALRPHAETLVDGFGIPE  631



>ref|WP_030697375.1| acyl-CoA oxidase [Streptomyces griseus]
Length=653

 Score = 97.8 bits (242),  Expect = 9e-20, Method: Composition-based stats.
 Identities = 53/155 (34%), Positives = 85/155 (55%), Gaps = 1/155 (1%)
 Frame = -3

Query  637  PVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGA-WNRCLNHLLT  461
            P    W+ E  L D  +QL   RYR   +L  VA RL++        GA +++  +H++ 
Sbjct  495  PGGDAWDQEAGLLDSEYQLAMVRYREEHMLAGVARRLKRGVDQKRDPGAVFSQVQDHVIA  554

Query  460  LAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPNKA  281
            LA +H+E  +LE F+  V+  P+   + AL L+CDL+AL+ I  D   +     +   ++
Sbjct  555  LAHAHVERLVLEAFVAKVRELPEGGEKVALGLLCDLFALSVIEGDRAWFMEHGRLTGQRS  614

Query  280  KAINKLTEYLCFQVRNTAKDLVDAFDLPDYVIRAP  176
            KAI +    LC ++R  A DLVDA+ +P  ++RAP
Sbjct  615  KAITREVNDLCRKIRPLALDLVDAWGVPPELLRAP  649



>ref|WP_007770344.1| acyl-CoA oxidase [Mycobacterium colombiense]
 gb|EJO89710.1| acyl-CoA oxidase [Mycobacterium colombiense CECT 3035]
Length=650

 Score = 97.8 bits (242),  Expect = 9e-20, Method: Composition-based stats.
 Identities = 52/141 (37%), Positives = 78/141 (55%), Gaps = 0/141 (0%)
 Frame = -3

Query  619  EGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGAWNRCLNHLLTLAESHIE  440
            E E  L +   Q+  F  R   LL SVA RLQ  SK +  F A+N   +H+L  A +HI+
Sbjct  490  EEEGSLFNRGTQIKMFEDREEYLLASVARRLQAKSKEMSEFDAFNSVQDHVLHAASAHID  549

Query  439  SFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPNKAKAINKLT  260
              +LE F+  + +CPD  +R  L ++CDLYAL+ I +D   Y    Y++  +AKA+ +  
Sbjct  550  RVVLEAFVAGIDACPDEQARELLGILCDLYALSVIEDDKAWYIEHRYLSTERAKAVTRGI  609

Query  259  EYLCFQVRNTAKDLVDAFDLP  197
               C  +R  A+ +VD F +P
Sbjct  610  NDRCRALRPHAETVVDGFGVP  630



>ref|WP_044486229.1| acyl-CoA oxidase [Mycobacterium tuberculosis]
 gb|KBZ60796.1| hypothetical protein K875_03745 [Mycobacterium tuberculosis TKK-01-0051]
Length=650

 Score = 97.8 bits (242),  Expect = 9e-20, Method: Composition-based stats.
 Identities = 52/141 (37%), Positives = 78/141 (55%), Gaps = 0/141 (0%)
 Frame = -3

Query  619  EGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGAWNRCLNHLLTLAESHIE  440
            E E  L +   Q+  F  R   LL SVA RLQ  SK +  F A+N   +H+L  A +HI+
Sbjct  490  EEEGSLFNRGTQIKMFEDREEYLLASVARRLQAKSKEMSEFDAFNSVQDHVLHAASAHID  549

Query  439  SFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPNKAKAINKLT  260
              +LE F+  + +CPD  +R  L ++CDLYAL+ I +D   Y    Y++  +AKA+ +  
Sbjct  550  RVVLEAFVAGIDACPDEQARELLGILCDLYALSVIEDDKAWYIEHRYLSTERAKAVTRGI  609

Query  259  EYLCFQVRNTAKDLVDAFDLP  197
               C  +R  A+ +VD F +P
Sbjct  610  NDRCRALRPHAETVVDGFGVP  630



>ref|WP_026707256.1| acyl-CoA oxidase [Flavobacterium frigidarium]
Length=750

 Score = 98.2 bits (243),  Expect = 9e-20, Method: Composition-based stats.
 Identities = 54/161 (34%), Positives = 87/161 (54%), Gaps = 1/161 (1%)
 Frame = -3

Query  646  QPNPVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKH-SKNLGGFGAWNRCLNH  470
            + NP+ +R    +HL D  F L AF +R   +L S A RL+K     L  + A+N   + 
Sbjct  589  EKNPIATRKTDSEHLLDGQFHLQAFEHRERTILASAARRLKKLIESGLEAYDAFNVVQHQ  648

Query  469  LLTLAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAP  290
            ++ +A+++++  +LE F  A+ +  D   +  L  +  LYAL++I  +   Y    Y+  
Sbjct  649  MIDVAQAYLDRVVLEQFQVAIATVKDSDEKNILDKLAQLYALSQIEKNKSWYLEDGYMEA  708

Query  289  NKAKAINKLTEYLCFQVRNTAKDLVDAFDLPDYVIRAPIAL  167
             K KAI K+   LC+ +R +A  LVDAF +PD  + APIA 
Sbjct  709  VKTKAIRKMVNQLCWDIRPSAVALVDAFAIPDSCLAAPIAF  749



>ref|WP_039819999.1| acyl-CoA oxidase [Nocardiopsis halophila]
Length=663

 Score = 97.8 bits (242),  Expect = 9e-20, Method: Composition-based stats.
 Identities = 54/150 (36%), Positives = 81/150 (54%), Gaps = 2/150 (1%)
 Frame = -3

Query  610  DHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLG--GFGAWNRCLNHLLTLAESHIES  437
            D LRD  +QL     R    +  +A RL++     G   F A+N+  +HLL  A  H++ 
Sbjct  497  DELRDRGWQLRLLEDREEHTVAGLARRLRRAGGGDGRSAFAAFNQAQDHLLRAARVHVDR  556

Query  436  FILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPNKAKAINKLTE  257
             +LE F+  +  C D  +R  L+ VCDLY L+ +  D   +   + ++  +AKA+ K  +
Sbjct  557  VVLEAFVAGIDRCSDAGARRLLEKVCDLYVLSVVEEDRAWFLEHERLSGTRAKAVVKAVD  616

Query  256  YLCFQVRNTAKDLVDAFDLPDYVIRAPIAL  167
             LC  +R  A+ LVDAF LPD  + APIAL
Sbjct  617  ELCADLRPHARTLVDAFGLPDEWLAAPIAL  646



>ref|WP_011856090.1| acyl-CoA oxidase [Mycobacterium sp. JLS]
 gb|ABN99224.1| acyl-CoA dehydrogenase domain protein [Mycobacterium sp. JLS]
Length=645

 Score = 97.4 bits (241),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 52/142 (37%), Positives = 78/142 (55%), Gaps = 0/142 (0%)
 Frame = -3

Query  619  EGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGAWNRCLNHLLTLAESHIE  440
            E E  L +   Q+  F  R   LL SVA RLQ  SK +  F A+N   +H+L  A++HI+
Sbjct  485  EEEGSLFNRGTQVQMFEDREEYLLSSVARRLQGKSKEMSAFDAFNAVQDHVLHTAQAHID  544

Query  439  SFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPNKAKAINKLT  260
              +LE F+  + +C D  +R  L +VCDLYAL+ I  D   Y    +++  +AKA+ +  
Sbjct  545  RIVLEAFVAGIDACEDEEARNILGMVCDLYALSVIEEDKAWYIEHRFLSTERAKAVTRGI  604

Query  259  EYLCFQVRNTAKDLVDAFDLPD  194
               C  +R  A+ LVD F +P+
Sbjct  605  NERCRSLRPYAELLVDGFGIPE  626



>gb|EPQ74968.1| Acyl-coenzyme A oxidase 3, peroxisomal [Mycobacterium marinum 
str. Europe]
Length=643

 Score = 97.4 bits (241),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 53/141 (38%), Positives = 77/141 (55%), Gaps = 0/141 (0%)
 Frame = -3

Query  619  EGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGAWNRCLNHLLTLAESHIE  440
            E E  L +   Q+  F  R   LL SVA RLQ  S  +  F A+N   +H+L  A++HI+
Sbjct  487  EEEGSLFNRGTQVKMFEDREDYLLSSVARRLQNKSNEMSAFDAFNAVQDHVLHAAQAHID  546

Query  439  SFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPNKAKAINKLT  260
              +LE F+  ++SC D  +R  L +VCDLYAL+ I  D   Y    Y++  +AKA+ +  
Sbjct  547  RVVLEAFVAGIESCTDEQARELLGVVCDLYALSVIEEDKAWYIEHRYLSTERAKAVTRGI  606

Query  259  EYLCFQVRNTAKDLVDAFDLP  197
               C  +R  A+ LVD F +P
Sbjct  607  NDRCRVLRPHARTLVDGFGIP  627



>ref|WP_030768335.1| acyl-CoA oxidase [Streptomyces griseus]
Length=653

 Score = 97.4 bits (241),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 53/155 (34%), Positives = 84/155 (54%), Gaps = 1/155 (1%)
 Frame = -3

Query  637  PVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGA-WNRCLNHLLT  461
            P    W+ E  L D  +QL   RYR   +L  VA RL+         GA +++  +H++ 
Sbjct  495  PGGDEWDQEAGLLDSEYQLAMVRYREEHMLAGVARRLKSGVDQKRDPGAVFSQVQDHVIA  554

Query  460  LAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPNKA  281
            LA +H+E  +LE F+  V+  P+   + AL L+CDL+AL+ I  D   +     +   ++
Sbjct  555  LAHAHVERLVLEAFVAKVRELPEGGEKVALGLLCDLFALSTIEADRAWFMEHGRLTVQRS  614

Query  280  KAINKLTEYLCFQVRNTAKDLVDAFDLPDYVIRAP  176
            KAI +    LC ++R  A DLVDA+ +P  ++RAP
Sbjct  615  KAITREVNDLCRKIRPLALDLVDAWGVPPELLRAP  649



>ref|WP_003946657.1| MULTISPECIES: acyl-CoA oxidase [Streptomyces]
 gb|EFE79776.1| acyl-CoA oxidase domain-containing protein [Streptomyces albus 
J1074]
 gb|EKC93763.1| acyl-CoA dehydrogenase [Streptomyces sp. SM8]
 gb|AGI92041.1| Acyl-coenzyme A oxidase 1, peroxisomal [Streptomyces albus J1074]
Length=653

 Score = 97.4 bits (241),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 53/155 (34%), Positives = 84/155 (54%), Gaps = 1/155 (1%)
 Frame = -3

Query  637  PVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGA-WNRCLNHLLT  461
            P    W+ E  L D  +QL   RYR   +L  VA RL+         GA +++  +H++ 
Sbjct  495  PGGDEWDQEAGLLDSEYQLAMVRYREEHMLAGVARRLKSGVDQKRDPGAVFSQVQDHVIA  554

Query  460  LAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPNKA  281
            LA +H+E  +LE F+  V+  P+   + AL L+CDL+AL+ I  D   +     +   ++
Sbjct  555  LAHAHVERLVLEAFVAKVRELPEGGEKVALGLLCDLFALSTIEADRAWFMEHGRLTVQRS  614

Query  280  KAINKLTEYLCFQVRNTAKDLVDAFDLPDYVIRAP  176
            KAI +    LC ++R  A DLVDA+ +P  ++RAP
Sbjct  615  KAITREVNDLCRKIRPLALDLVDAWGVPPELLRAP  649



>ref|WP_011560818.1| MULTISPECIES: acyl-CoA oxidase [Mycobacterium]
 gb|ABG09542.1| acyl-CoA dehydrogenase-like protein [Mycobacterium sp. MCS]
 gb|ABL92692.1| acyl-CoA dehydrogenase domain protein [Mycobacterium sp. KMS]
Length=645

 Score = 97.4 bits (241),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 52/142 (37%), Positives = 78/142 (55%), Gaps = 0/142 (0%)
 Frame = -3

Query  619  EGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGAWNRCLNHLLTLAESHIE  440
            E E  L +   Q+  F  R   LL SVA RLQ  SK +  F A+N   +H+L  A++HI+
Sbjct  485  EEEGSLFNRGTQVQMFEDREEYLLSSVARRLQGKSKEMSAFDAFNAVQDHVLHTAQAHID  544

Query  439  SFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPNKAKAINKLT  260
              +LE F+  + +C D  +R  L +VCDLYAL+ I  D   Y    +++  +AKA+ +  
Sbjct  545  RIVLEAFVAGIDACEDEEARNILGMVCDLYALSVIEEDKAWYIEHRFLSTERAKAVTRGI  604

Query  259  EYLCFQVRNTAKDLVDAFDLPD  194
               C  +R  A+ LVD F +P+
Sbjct  605  NERCRSLRPYAELLVDGFGIPE  626



>ref|WP_003921933.1| acyl-CoA oxidase [Mycobacterium xenopi]
 gb|EID11703.1| acyl-CoA oxidase [Mycobacterium xenopi RIVM700367]
Length=646

 Score = 97.4 bits (241),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 52/142 (37%), Positives = 79/142 (56%), Gaps = 0/142 (0%)
 Frame = -3

Query  619  EGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGAWNRCLNHLLTLAESHIE  440
            E E  L +   Q+  F  R   LL SVA RLQ  S  +  F A+N   +H+L  A +H++
Sbjct  490  EEEGSLFNRGTQVKMFEDREEYLLSSVARRLQAKSNEMSAFDAFNAVQDHVLHAASAHVD  549

Query  439  SFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPNKAKAINKLT  260
              +LE F+  + SC D  +R  L+LVCDLYAL+ I +D   Y    +++ ++AKA+ +  
Sbjct  550  RVVLEAFVAGIDSCEDDEARHVLELVCDLYALSVIEDDKAWYIEHRFLSTDRAKAVTRGI  609

Query  259  EYLCFQVRNTAKDLVDAFDLPD  194
               C  +R  A+ LVD F +P+
Sbjct  610  NDRCRALRPYAQTLVDGFGIPE  631



>ref|WP_015780052.1| acyl-CoA oxidase [Kytococcus sedentarius]
 gb|ACV07116.1| acyl-CoA dehydrogenase [Kytococcus sedentarius DSM 20547]
Length=663

 Score = 97.4 bits (241),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 51/146 (35%), Positives = 81/146 (55%), Gaps = 2/146 (1%)
 Frame = -3

Query  625  RWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGG--FGAWNRCLNHLLTLAE  452
            R + ED + D  +Q++ F +R   LL++ A R+++  +      F A+N   +HLL  A 
Sbjct  498  RRDTEDVVMDRAWQVECFEFREKHLLETAAQRMRRADRGTEAEQFAAFNDVQDHLLLAAR  557

Query  451  SHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPNKAKAI  272
            +HI+  +LE F Q V+ C DP+    L  VCDLYAL+ I  +   +   +++ P K+K++
Sbjct  558  AHIDRVVLEAFAQQVEECEDPALTELLDQVCDLYALSVIEENAAWFLEHEHMRPAKSKSV  617

Query  271  NKLTEYLCFQVRNTAKDLVDAFDLPD  194
                  LC  +R  A  LVDAF +PD
Sbjct  618  TSTINALCADLRPHAVTLVDAFAIPD  643



>gb|EJG02802.1| acyl-CoA oxidase [Flavobacterium sp. F52]
Length=765

 Score = 97.4 bits (241),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 55/161 (34%), Positives = 91/161 (57%), Gaps = 1/161 (1%)
 Frame = -3

Query  646  QPNPVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKH-SKNLGGFGAWNRCLNH  470
            + NP+ +R   ++HL D  F L AF +R   +L S A R++K     L  + A+N   + 
Sbjct  605  EKNPIATRRTEDEHLLDGEFHLQAFVHREKTILASAARRIKKLIDGGLEPYDAFNVVQHQ  664

Query  469  LLTLAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAP  290
            ++ +A++++E  +LE F  A+K+  D  S+A L  +  LYAL+ I  +   Y    Y+  
Sbjct  665  MIDVAQAYLERIVLEQFQIAIKAVEDEPSKAILTKLNQLYALSTIEKNKAWYLEDGYMEA  724

Query  289  NKAKAINKLTEYLCFQVRNTAKDLVDAFDLPDYVIRAPIAL  167
             K KA+ K+   LC+ +R  A  LV+AFD+P+  + APIA+
Sbjct  725  VKTKAVRKMVNQLCWDIRPDAVALVNAFDIPESCLAAPIAI  765



>ref|WP_035690755.1| acyl-CoA oxidase [Flavobacterium sp. F52]
Length=752

 Score = 97.4 bits (241),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 55/161 (34%), Positives = 91/161 (57%), Gaps = 1/161 (1%)
 Frame = -3

Query  646  QPNPVTSRWEGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKH-SKNLGGFGAWNRCLNH  470
            + NP+ +R   ++HL D  F L AF +R   +L S A R++K     L  + A+N   + 
Sbjct  592  EKNPIATRRTEDEHLLDGEFHLQAFVHREKTILASAARRIKKLIDGGLEPYDAFNVVQHQ  651

Query  469  LLTLAESHIESFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAP  290
            ++ +A++++E  +LE F  A+K+  D  S+A L  +  LYAL+ I  +   Y    Y+  
Sbjct  652  MIDVAQAYLERIVLEQFQIAIKAVEDEPSKAILTKLNQLYALSTIEKNKAWYLEDGYMEA  711

Query  289  NKAKAINKLTEYLCFQVRNTAKDLVDAFDLPDYVIRAPIAL  167
             K KA+ K+   LC+ +R  A  LV+AFD+P+  + APIA+
Sbjct  712  VKTKAVRKMVNQLCWDIRPDAVALVNAFDIPESCLAAPIAI  752



>ref|WP_037186992.1| acyl-CoA oxidase [Rhodococcus fascians]
Length=655

 Score = 97.1 bits (240),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 54/149 (36%), Positives = 81/149 (54%), Gaps = 0/149 (0%)
 Frame = -3

Query  619  EGEDHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLGGFGAWNRCLNHLLTLAESHIE  440
            E E  L +   Q+  F  R   LL +VA RLQ  SK    F A+N   +H+L  A +HI+
Sbjct  487  EEEGSLFNRGTQVKMFEDREEYLLSTVARRLQSKSKETSPFEAFNAVQDHVLHAASAHID  546

Query  439  SFILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPNKAKAINKLT  260
              I E FI  ++SC DP+++  L  VCDLYAL+ I  D   +    Y++  ++KA+ +  
Sbjct  547  RIIFEAFIAGIESCEDPATKDLLDEVCDLYALSVIEADKAWFIEHRYLSTERSKAVTRAI  606

Query  259  EYLCFQVRNTAKDLVDAFDLPDYVIRAPI  173
               C  +R  A+ LVD F +PD ++ A +
Sbjct  607  NERCRTLRPHAELLVDGFGIPDALVGAAM  635



>ref|WP_017557135.1| hypothetical protein [Nocardiopsis baichengensis]
Length=663

 Score = 97.1 bits (240),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 54/150 (36%), Positives = 81/150 (54%), Gaps = 2/150 (1%)
 Frame = -3

Query  610  DHLRDPNFQLDAFRYRTSRLLQSVAIRLQKHSKNLG--GFGAWNRCLNHLLTLAESHIES  437
            D LRD  +QL     R    +  +A RL++     G   F A+N+  +HLL  A  H++ 
Sbjct  497  DELRDRGWQLRLLEDREEHTVAGLARRLRRAGGGDGRSAFDAFNQAQDHLLRAARVHVDR  556

Query  436  FILEIFIQAVKSCPDPSSRAALKLVCDLYALNRIWNDIGTYRNVDYVAPNKAKAINKLTE  257
             +LE F+  +  C D  +R  L+ VCDLY L+ +  D   +   + ++  +AKA+ K  +
Sbjct  557  VVLEAFVAGIDRCSDAGARRLLEKVCDLYVLSVVEEDRAWFLEHERLSGTRAKAVVKAVD  616

Query  256  YLCFQVRNTAKDLVDAFDLPDYVIRAPIAL  167
             LC  +R  A+ LVDAF LPD  + APIAL
Sbjct  617  ELCADLRPHARTLVDAFGLPDEWLAAPIAL  646



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 987899701625