BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF008O12

Length=482
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004241330.1|  PREDICTED: photosystem I subunit O                 232   6e-75   Solanum lycopersicum
ref|XP_006361086.1|  PREDICTED: uncharacterized protein LOC102602224    231   1e-74   Solanum tuberosum [potatoes]
ref|XP_009587811.1|  PREDICTED: photosystem I subunit O-like            229   6e-74   Nicotiana tomentosiformis
ref|XP_009609016.1|  PREDICTED: photosystem I subunit O-like            220   4e-70   Nicotiana tomentosiformis
gb|KFK43159.1|  hypothetical protein AALP_AA1G087600                    217   6e-69   Arabis alpina [alpine rockcress]
gb|KJB55588.1|  hypothetical protein B456_009G083700                    217   9e-69   Gossypium raimondii
ref|XP_009118377.1|  PREDICTED: uncharacterized protein LOC103843400    216   1e-68   Brassica rapa
ref|XP_010262927.1|  PREDICTED: photosystem I subunit O                 215   3e-68   Nelumbo nucifera [Indian lotus]
ref|XP_010102022.1|  hypothetical protein L484_016312                   215   4e-68   Morus notabilis
ref|XP_006305762.1|  hypothetical protein CARUB_v10010597mg             214   6e-68   Capsella rubella
ref|XP_006417699.1|  hypothetical protein EUTSA_v10009047mg             214   7e-68   Eutrema salsugineum [saltwater cress]
ref|XP_007015746.1|  Photosystem I subunit O                            214   8e-68   
emb|CDX95064.1|  BnaC05g06070D                                          214   1e-67   
ref|XP_009789385.1|  PREDICTED: photosystem I subunit O-like isof...    214   1e-67   Nicotiana sylvestris
ref|NP_563815.1|  photosystem I subunit O                               213   2e-67   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011088934.1|  PREDICTED: photosystem I subunit O                 213   4e-67   Sesamum indicum [beniseed]
ref|XP_009148097.1|  PREDICTED: uncharacterized protein LOC103871585    212   5e-67   Brassica rapa
ref|XP_010488808.1|  PREDICTED: photosystem I subunit O-like            212   5e-67   Camelina sativa [gold-of-pleasure]
ref|XP_008361123.1|  PREDICTED: uncharacterized protein LOC103424...    212   5e-67   Malus domestica [apple tree]
ref|XP_010475635.1|  PREDICTED: photosystem I subunit O-like            212   6e-67   Camelina sativa [gold-of-pleasure]
ref|XP_002523852.1|  conserved hypothetical protein                     212   6e-67   Ricinus communis
ref|XP_002892455.1|  hypothetical protein ARALYDRAFT_470899             211   8e-67   Arabidopsis lyrata subsp. lyrata
gb|AAM97011.1|  expressed protein                                       211   8e-67   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009344568.1|  PREDICTED: photosystem I subunit O-like isof...    211   1e-66   Pyrus x bretschneideri [bai li]
emb|CDY22686.1|  BnaC08g43200D                                          211   1e-66   Brassica napus [oilseed rape]
ref|XP_010458074.1|  PREDICTED: photosystem I subunit O                 210   3e-66   Camelina sativa [gold-of-pleasure]
ref|XP_009789384.1|  PREDICTED: photosystem I subunit O-like isof...    209   1e-65   Nicotiana sylvestris
ref|XP_010912341.1|  PREDICTED: photosystem I subunit O                 209   1e-65   Elaeis guineensis
ref|XP_009793460.1|  PREDICTED: photosystem I subunit O-like            207   3e-65   Nicotiana sylvestris
emb|CDX93566.1|  BnaA06g04820D                                          207   3e-65   
ref|XP_010694990.1|  PREDICTED: photosystem I subunit O                 207   3e-65   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008361116.1|  PREDICTED: uncharacterized protein LOC103424...    207   3e-65   Malus domestica [apple tree]
ref|XP_009344567.1|  PREDICTED: photosystem I subunit O-like isof...    207   5e-65   Pyrus x bretschneideri [bai li]
ref|XP_010557432.1|  PREDICTED: photosystem I subunit O                 207   7e-65   Tarenaya hassleriana [spider flower]
ref|XP_007206116.1|  hypothetical protein PRUPE_ppa013064mg             206   9e-65   Prunus persica
emb|CDP06878.1|  unnamed protein product                                206   1e-64   Coffea canephora [robusta coffee]
gb|KJB09104.1|  hypothetical protein B456_001G123200                    206   1e-64   Gossypium raimondii
ref|XP_002273037.1|  PREDICTED: photosystem I subunit O                 206   1e-64   Vitis vinifera
ref|XP_008784066.1|  PREDICTED: uncharacterized protein LOC103703121    206   2e-64   Phoenix dactylifera
ref|XP_008463649.1|  PREDICTED: uncharacterized protein LOC103501744    205   3e-64   Cucumis melo [Oriental melon]
ref|XP_008229763.1|  PREDICTED: uncharacterized protein LOC103329109    203   2e-63   Prunus mume [ume]
ref|XP_009403671.1|  PREDICTED: photosystem I subunit O isoform X2      203   2e-63   
ref|XP_010045182.1|  PREDICTED: photosystem I subunit O                 203   2e-63   Eucalyptus grandis [rose gum]
gb|KHG06613.1|  DNA mismatch repair mutL                                202   3e-63   Gossypium arboreum [tree cotton]
ref|XP_004139499.1|  PREDICTED: uncharacterized protein LOC101209111    202   5e-63   Cucumis sativus [cucumbers]
emb|CDY31154.1|  BnaA08g27040D                                          201   6e-63   Brassica napus [oilseed rape]
emb|CAN83522.1|  hypothetical protein VITISV_019056                     201   7e-63   Vitis vinifera
ref|XP_006417697.1|  hypothetical protein EUTSA_v10009047mg             199   3e-62   
gb|AGU28452.1|  photosystem I subunit O                                 200   3e-62   Sinapis alba [bai jie]
gb|AEQ39072.1|  putative chloroplast photosystem I subunit O            200   3e-62   Wolffia arrhiza
gb|ADB77878.1|  chloroplast photosystem I subunit O                     199   6e-62   Wolffia arrhiza
gb|ACZ54009.1|  PsaO                                                    198   1e-61   Wolffia arrhiza
ref|XP_006424153.1|  hypothetical protein CICLE_v10029515mg             198   1e-61   Citrus clementina [clementine]
gb|KDP24032.1|  hypothetical protein JCGZ_26726                         198   2e-61   Jatropha curcas
ref|XP_009403670.1|  PREDICTED: photosystem I subunit O isoform X1      197   7e-61   
ref|XP_002313603.1|  hypothetical protein POPTR_0009s16240g             196   2e-60   Populus trichocarpa [western balsam poplar]
ref|XP_006384772.1|  hypothetical protein POPTR_0004s20960g             195   3e-60   Populus trichocarpa [western balsam poplar]
ref|XP_011006585.1|  PREDICTED: photosystem I subunit O-like            195   4e-60   Populus euphratica
ref|XP_011459420.1|  PREDICTED: photosystem I subunit O                 194   7e-60   Fragaria vesca subsp. vesca
ref|XP_006846460.1|  hypothetical protein AMTR_s00018p00092490          193   1e-59   Amborella trichopoda
gb|ACJ86143.1|  unknown                                                 192   2e-59   Medicago truncatula
ref|XP_009340874.1|  PREDICTED: photosystem I subunit O-like            192   3e-59   Pyrus x bretschneideri [bai li]
ref|XP_004506203.1|  PREDICTED: uncharacterized protein LOC101500027    192   4e-59   Cicer arietinum [garbanzo]
ref|XP_009374967.1|  PREDICTED: photosystem I subunit O-like            191   8e-59   Pyrus x bretschneideri [bai li]
gb|AFK44563.1|  unknown                                                 190   3e-58   Lotus japonicus
gb|AEC10974.1|  16kda membrane protein                                  189   4e-58   Camellia sinensis [black tea]
gb|ADH43621.1|  sex-linked protein 9                                    189   5e-58   Silene latifolia
gb|EYU28533.1|  hypothetical protein MIMGU_mgv1a023828mg                187   1e-57   Erythranthe guttata [common monkey flower]
gb|AFK38505.1|  unknown                                                 188   1e-57   Medicago truncatula
ref|XP_007132467.1|  hypothetical protein PHAVU_011G096400g             186   6e-57   Phaseolus vulgaris [French bean]
gb|ADI45844.1|  sex-linked protein 9                                    186   8e-57   Silene vulgaris [maiden's-tears]
ref|XP_006481510.1|  PREDICTED: uncharacterized protein LOC102626023    184   9e-56   Citrus sinensis [apfelsine]
ref|XP_003579709.1|  PREDICTED: photosystem I subunit O                 182   3e-55   Brachypodium distachyon [annual false brome]
gb|ABK25454.1|  unknown                                                 180   2e-54   Picea sitchensis
gb|KHN21168.1|  hypothetical protein glysoja_006647                     180   2e-54   Glycine soja [wild soybean]
gb|ABG75753.1|  salt stress-responsive protein                          179   4e-54   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006592347.1|  PREDICTED: uncharacterized protein LOC100809697    179   4e-54   Glycine max [soybeans]
gb|ABB90549.1|  putative membrane protein                               179   5e-54   Triticum aestivum [Canadian hard winter wheat]
dbj|BAJ90625.1|  predicted protein                                      179   6e-54   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMT23727.1|  hypothetical protein F775_30776                         179   7e-54   
ref|XP_011004353.1|  PREDICTED: photosystem I subunit O-like            178   2e-53   Populus euphratica
emb|CDY68716.1|  BnaAnng28120D                                          176   3e-53   Brassica napus [oilseed rape]
dbj|BAJ85402.1|  predicted protein                                      177   4e-53   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KHN08815.1|  hypothetical protein glysoja_046343                     176   8e-53   Glycine soja [wild soybean]
gb|ABK21270.1|  unknown                                                 176   1e-52   Picea sitchensis
gb|ACU20009.1|  unknown                                                 175   1e-52   Glycine max [soybeans]
ref|NP_001236146.1|  uncharacterized protein LOC100305746               174   2e-52   
emb|CAH66420.1|  H0622F05.3                                             174   2e-52   Oryza sativa [red rice]
ref|XP_004975583.1|  PREDICTED: uncharacterized protein LOC101771677    174   4e-52   Setaria italica
ref|NP_001150218.1|  LOC100283848                                       174   6e-52   Zea mays [maize]
gb|ABK26506.1|  unknown                                                 174   8e-52   Picea sitchensis
gb|AHB79078.1|  16 kDa membrane protein                                 173   8e-52   Saccharum hybrid cultivar [sugarcane]
gb|ABK21819.1|  unknown                                                 173   1e-51   Picea sitchensis
ref|NP_001052755.1|  Os04g0414700                                       173   1e-51   
ref|XP_006652269.1|  PREDICTED: uncharacterized protein LOC102704139    172   2e-51   
ref|XP_001778960.1|  PsaO subunit of photosystem I                      171   8e-51   
ref|XP_002446437.1|  hypothetical protein SORBIDRAFT_06g016090          170   1e-50   Sorghum bicolor [broomcorn]
gb|ACG27280.1|  16kDa membrane protein                                  163   6e-48   Zea mays [maize]
gb|EMS65275.1|  hypothetical protein TRIUR3_34121                       162   1e-47   Triticum urartu
gb|ADI45889.1|  sex-linked protein 9                                    159   1e-46   Silene latifolia
gb|ADI45881.1|  sex-linked protein 9                                    158   5e-46   Silene latifolia
gb|KJB09105.1|  hypothetical protein B456_001G123200                    154   1e-44   Gossypium raimondii
ref|XP_002976132.1|  hypothetical protein SELMODRAFT_104218             145   2e-41   
gb|KCW87339.1|  hypothetical protein EUGRSUZ_B03824                     145   5e-41   Eucalyptus grandis [rose gum]
ref|XP_006854748.1|  hypothetical protein AMTR_s00030p00247800          142   7e-40   
gb|KDO37001.1|  hypothetical protein CISIN_1g032156mg                   142   8e-40   Citrus sinensis [apfelsine]
gb|KDO58276.1|  hypothetical protein CISIN_1g032153mg                   142   1e-39   Citrus sinensis [apfelsine]
ref|XP_009340870.1|  PREDICTED: photosystem I subunit O-like            139   1e-38   Pyrus x bretschneideri [bai li]
ref|XP_006384771.1|  hypothetical protein POPTR_0004s20960g             137   3e-38   
gb|ADI45848.1|  sex-linked protein 9                                    135   2e-37   Silene latifolia
gb|ADI45849.1|  sex-linked protein 9                                    133   2e-36   Silene latifolia
gb|ADI45869.1|  sex-linked protein 9                                    130   1e-35   Silene latifolia
gb|ADI45879.1|  sex-linked protein 9                                    130   2e-35   Silene latifolia
gb|ADI45882.1|  sex-linked protein 9                                    127   2e-34   Silene latifolia
gb|ADI45877.1|  sex-linked protein 9                                    126   4e-34   Silene latifolia
gb|ADI45826.1|  sex-linked protein 9                                    120   8e-32   Silene dioica [morning campion]
gb|ADI45857.1|  sex-linked protein 9                                    120   1e-31   Silene latifolia
gb|ADI45880.1|  sex-linked protein 9                                    120   1e-31   Silene latifolia
gb|ADI45862.1|  sex-linked protein 9                                    120   1e-31   Silene latifolia
gb|ADI45847.1|  sex-linked protein 9                                    118   5e-31   Silene latifolia
ref|XP_006417696.1|  hypothetical protein EUTSA_v10009047mg             118   7e-31   
gb|ADI45845.1|  sex-linked protein 9                                    116   3e-30   Silene latifolia
gb|ADI45883.1|  sex-linked protein 9                                    115   6e-30   Silene latifolia
ref|XP_011398024.1|  hypothetical protein F751_0065                     107   4e-26   Auxenochlorella protothecoides
gb|KIZ07152.1|  hypothetical protein MNEG_0799                          103   1e-24   Monoraphidium neglectum
ref|XP_002950988.1|  photosystem I reaction center subunit O          99.8    2e-23   Volvox carteri f. nagariensis
ref|XP_001700109.1|  photosystem I subunit O                          95.1    1e-21   Chlamydomonas reinhardtii
gb|ABA01097.1|  chloroplast putative 16 kDa membrane protein          94.0    4e-21   Chlamydomonas incerta
ref|XP_002507508.1|  photosystem I subunit O                          92.8    1e-20   Micromonas commoda
ref|XP_007509339.1|  sex-linked protein 9                             90.1    2e-19   Bathycoccus prasinos
ref|XP_005845862.1|  hypothetical protein CHLNCDRAFT_14460            88.2    2e-19   Chlorella variabilis
ref|XP_003056041.1|  photosystem I subunit O                          86.3    5e-18   Micromonas pusilla CCMP1545
ref|XP_001416278.1|  possible psaO, PSI-O, photosystem I polypeptide  85.5    6e-18   Ostreococcus lucimarinus CCE9901
emb|CEG01290.1|  unnamed product                                      84.7    2e-17   Ostreococcus tauri
ref|XP_003075355.1|  unnamed protein product                          84.3    1e-16   
ref|XP_005647319.1|  photosystem I PsaO                               82.0    2e-16   Coccomyxa subellipsoidea C-169
ref|XP_005704648.1|  photosystem I subunit O precursor                76.3    3e-14   Galdieria sulphuraria
ref|XP_005711818.1|  unnamed protein product                          75.9    4e-14   Chondrus crispus [carageen]
ref|XP_005537773.1|  hypothetical protein, conserved                  74.7    1e-13   Cyanidioschyzon merolae strain 10D
emb|CAH04628.1|  photosystem I subunit O precursor                    67.4    4e-11   Guillardia theta
gb|ADI45888.1|  sex-linked protein 9                                  48.1    5e-05   Silene latifolia



>ref|XP_004241330.1| PREDICTED: photosystem I subunit O [Solanum lycopersicum]
Length=145

 Score =   232 bits (592),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 114/146 (78%), Positives = 128/146 (88%), Gaps = 3/146 (2%)
 Frame = -3

Query  465  MAATLCAASTVVGLATSSLPRLSSPNKLFLTSDFLKPAVSARNPLKLPRACMGKFTCFER  286
            MAAT+   S+VVGLA SSL   SS  K  L+SDF++  V+ARNPL++ +A  G+ TCF+R
Sbjct  1    MAATM---SSVVGLANSSLSGFSSAKKTSLSSDFMRSPVTARNPLRVAKASGGRVTCFQR  57

Query  285  DWLRRDLNVIGFGLIGWIAPSSVPLINGKSLTGLFFDSIGTELSHWPTGPALTSQFWLWL  106
            DWLRRDLNVIGFGLIGW+APSSVP INGKSLTGLFF+SIGTELSH+PTGPALTSQFWLWL
Sbjct  58   DWLRRDLNVIGFGLIGWLAPSSVPAINGKSLTGLFFESIGTELSHFPTGPALTSQFWLWL  117

Query  105  VCWHLGLFLCLTFGQIGFKGRTEDYF  28
            VCWHLGLFLCLTFGQIGFKGRTEDYF
Sbjct  118  VCWHLGLFLCLTFGQIGFKGRTEDYF  143



>ref|XP_006361086.1| PREDICTED: uncharacterized protein LOC102602224 [Solanum tuberosum]
Length=145

 Score =   231 bits (590),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 112/146 (77%), Positives = 129/146 (88%), Gaps = 3/146 (2%)
 Frame = -3

Query  465  MAATLCAASTVVGLATSSLPRLSSPNKLFLTSDFLKPAVSARNPLKLPRACMGKFTCFER  286
            MAAT+   S+VVGLA SSL   SS  K  L+SDF++  V+ARNPL++ +A  G+ TCF+R
Sbjct  1    MAATM---SSVVGLANSSLSGFSSAKKTSLSSDFVRSPVTARNPLRVAKASGGRVTCFQR  57

Query  285  DWLRRDLNVIGFGLIGWIAPSSVPLINGKSLTGLFFDSIGTELSHWPTGPALTSQFWLWL  106
            DWLRRDLNVIGFGLIGW+APSSVP+INGKSLTGLFF+SIGTEL+H+PTGPALTSQFWLW+
Sbjct  58   DWLRRDLNVIGFGLIGWLAPSSVPVINGKSLTGLFFESIGTELAHFPTGPALTSQFWLWM  117

Query  105  VCWHLGLFLCLTFGQIGFKGRTEDYF  28
            VCWHLGLFLCLTFGQIGFKGRTEDYF
Sbjct  118  VCWHLGLFLCLTFGQIGFKGRTEDYF  143



>ref|XP_009587811.1| PREDICTED: photosystem I subunit O-like [Nicotiana tomentosiformis]
Length=143

 Score =   229 bits (585),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 112/146 (77%), Positives = 124/146 (85%), Gaps = 3/146 (2%)
 Frame = -3

Query  465  MAATLCAASTVVGLATSSLPRLSSPNKLFLTSDFLKPAVSARNPLKLPRACMGKFTCFER  286
            MAA +   STVVGL  SSL   SSP +  L S FLK  V+ARNPLK+ +A  GKFTCFER
Sbjct  1    MAARMATTSTVVGLVNSSL---SSPKRTSLNSGFLKSQVTARNPLKIAQASGGKFTCFER  57

Query  285  DWLRRDLNVIGFGLIGWIAPSSVPLINGKSLTGLFFDSIGTELSHWPTGPALTSQFWLWL  106
            DWLRRDLNVIGFGLIGW+APSS+P INGKSL+GLFF+SIGTELSH+PTGP +TSQFWLW+
Sbjct  58   DWLRRDLNVIGFGLIGWLAPSSIPAINGKSLSGLFFESIGTELSHFPTGPGVTSQFWLWM  117

Query  105  VCWHLGLFLCLTFGQIGFKGRTEDYF  28
            VCWHLGLFLCLTFGQIGFKGRTE YF
Sbjct  118  VCWHLGLFLCLTFGQIGFKGRTEKYF  143



>ref|XP_009609016.1| PREDICTED: photosystem I subunit O-like [Nicotiana tomentosiformis]
Length=145

 Score =   220 bits (560),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 116/146 (79%), Positives = 132/146 (90%), Gaps = 3/146 (2%)
 Frame = -3

Query  465  MAATLCAASTVVGLATSSLPRLSSPNKLFLTSDFLKPAVSARNPLKLPRACMGKFTCFER  286
            MAAT+  ASTV+GL +SSL   SSP K+ L+S FLK  V+ARNPL++ +A  GKFTCFER
Sbjct  1    MAATMSTASTVLGLVSSSL---SSPKKVCLSSGFLKSPVTARNPLRVAQASGGKFTCFER  57

Query  285  DWLRRDLNVIGFGLIGWIAPSSVPLINGKSLTGLFFDSIGTELSHWPTGPALTSQFWLWL  106
            DWLRRDLNVIGFGLIGW+APSS+P+INGKSL+GLFFDSIGTELSH+PTGP+LTSQFWLWL
Sbjct  58   DWLRRDLNVIGFGLIGWLAPSSIPVINGKSLSGLFFDSIGTELSHFPTGPSLTSQFWLWL  117

Query  105  VCWHLGLFLCLTFGQIGFKGRTEDYF  28
            VCWHLGLF+CLTFGQIGFKGRTEDYF
Sbjct  118  VCWHLGLFICLTFGQIGFKGRTEDYF  143



>gb|KFK43159.1| hypothetical protein AALP_AA1G087600 [Arabis alpina]
Length=145

 Score =   217 bits (552),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 109/147 (74%), Positives = 123/147 (84%), Gaps = 5/147 (3%)
 Frame = -3

Query  465  MAATLCAASTVVGLATSSL-PRLSSPNKLFLTSDFLKPAVSARNPLKLPRACMGKFTCFE  289
            MAAT    STV+GLA SS+ P  + P     +S FLKP +SA+NPL+L  A  G+ TCFE
Sbjct  1    MAATFATPSTVIGLAGSSVSPITTKP----FSSSFLKPTLSAKNPLRLAGASGGRVTCFE  56

Query  288  RDWLRRDLNVIGFGLIGWIAPSSVPLINGKSLTGLFFDSIGTELSHWPTGPALTSQFWLW  109
            R+WLRRDLNV+GFGLIGW+APSS+P INGKSLTGLFFDSIGTEL+H+PT PALTSQFWLW
Sbjct  57   RNWLRRDLNVVGFGLIGWLAPSSIPAINGKSLTGLFFDSIGTELAHFPTPPALTSQFWLW  116

Query  108  LVCWHLGLFLCLTFGQIGFKGRTEDYF  28
            LV WHLGLFLCLTFGQIGFKGRTEDYF
Sbjct  117  LVTWHLGLFLCLTFGQIGFKGRTEDYF  143



>gb|KJB55588.1| hypothetical protein B456_009G083700 [Gossypium raimondii]
Length=148

 Score =   217 bits (552),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 107/146 (73%), Positives = 119/146 (82%), Gaps = 0/146 (0%)
 Frame = -3

Query  465  MAATLCAASTVVGLATSSLPRLSSPNKLFLTSDFLKPAVSARNPLKLPRACMGKFTCFER  286
            MAAT  + STVVGL  ++    S P K  L+S FLK  V+ARNPL+L  AC GKFTCFER
Sbjct  1    MAATFASPSTVVGLGGTATSMSSPPMKTRLSSGFLKSGVTARNPLRLAGACGGKFTCFER  60

Query  285  DWLRRDLNVIGFGLIGWIAPSSVPLINGKSLTGLFFDSIGTELSHWPTGPALTSQFWLWL  106
            DWLRRD NVIGFGLIGWIAPSS+P I+GKSLTGLFF+SIGTEL+H+PT P L SQFWLWL
Sbjct  61   DWLRRDFNVIGFGLIGWIAPSSIPAIDGKSLTGLFFESIGTELAHFPTPPPLASQFWLWL  120

Query  105  VCWHLGLFLCLTFGQIGFKGRTEDYF  28
            V WHLGLF+ LTFGQIGFKGR EDYF
Sbjct  121  VLWHLGLFITLTFGQIGFKGRNEDYF  146



>ref|XP_009118377.1| PREDICTED: uncharacterized protein LOC103843400 [Brassica rapa]
 emb|CDY06311.1| BnaA09g48920D [Brassica napus]
Length=145

 Score =   216 bits (551),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 104/146 (71%), Positives = 123/146 (84%), Gaps = 3/146 (2%)
 Frame = -3

Query  465  MAATLCAASTVVGLATSSLPRLSSPNKLFLTSDFLKPAVSARNPLKLPRACMGKFTCFER  286
            MAAT  A STV+GL  SS+  + +     L+S FLKP + A+NPLK+  A  G+FTCFER
Sbjct  1    MAATFAAPSTVIGLGGSSVSPIKAKA---LSSSFLKPTLRAKNPLKVAGASGGRFTCFER  57

Query  285  DWLRRDLNVIGFGLIGWIAPSSVPLINGKSLTGLFFDSIGTELSHWPTGPALTSQFWLWL  106
            +WLRRDLNV+GFGL+GW+APSS+P INGKSLTGLFF+SIGTEL+H+PT PALTSQFWLWL
Sbjct  58   NWLRRDLNVVGFGLVGWLAPSSIPAINGKSLTGLFFESIGTELAHFPTPPALTSQFWLWL  117

Query  105  VCWHLGLFLCLTFGQIGFKGRTEDYF  28
            + WHLGLF+CLTFGQIGFKGRTEDYF
Sbjct  118  ITWHLGLFICLTFGQIGFKGRTEDYF  143



>ref|XP_010262927.1| PREDICTED: photosystem I subunit O [Nelumbo nucifera]
Length=150

 Score =   215 bits (548),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 104/138 (75%), Positives = 118/138 (86%), Gaps = 2/138 (1%)
 Frame = -3

Query  435  VVGLATSSLP--RLSSPNKLFLTSDFLKPAVSARNPLKLPRACMGKFTCFERDWLRRDLN  262
            V GL +S+L   R++SP +  L SDF++  V+ RNPLK   +  G+FTCFERDWLRRD N
Sbjct  13   VTGLGSSTLSPSRITSPKRTSLRSDFVRSPVATRNPLKQTLSSGGRFTCFERDWLRRDFN  72

Query  261  VIGFGLIGWIAPSSVPLINGKSLTGLFFDSIGTELSHWPTGPALTSQFWLWLVCWHLGLF  82
            VIGFGLIGWIAPSSVPLINGKSLTGLFF+SIGTEL+HWPTGPAL SQFWLWL+ WHLGLF
Sbjct  73   VIGFGLIGWIAPSSVPLINGKSLTGLFFESIGTELAHWPTGPALNSQFWLWLITWHLGLF  132

Query  81   LCLTFGQIGFKGRTEDYF  28
            LCLTFGQIGFKGRTE+YF
Sbjct  133  LCLTFGQIGFKGRTENYF  150



>ref|XP_010102022.1| hypothetical protein L484_016312 [Morus notabilis]
 gb|EXB91242.1| hypothetical protein L484_016312 [Morus notabilis]
Length=143

 Score =   215 bits (547),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 106/146 (73%), Positives = 120/146 (82%), Gaps = 3/146 (2%)
 Frame = -3

Query  465  MAATLCAASTVVGLATSSLPRLSSPNKLFLTSDFLKPAVSARNPLKLPRACMGKFTCFER  286
            MA T+  ASTV GL +SSL    S  +  L+S FLK +V+ RNPLK   A  GKFTCFER
Sbjct  1    MATTIATASTVAGLGSSSL---CSTKRTSLSSGFLKSSVAVRNPLKQVSASGGKFTCFER  57

Query  285  DWLRRDLNVIGFGLIGWIAPSSVPLINGKSLTGLFFDSIGTELSHWPTGPALTSQFWLWL  106
            DWLRRD NVIGFGLIGW+APSS+P+INGKSLTGLFF+SIG EL+H+PT PALTSQFWLWL
Sbjct  58   DWLRRDFNVIGFGLIGWLAPSSIPVINGKSLTGLFFESIGAELAHFPTPPALTSQFWLWL  117

Query  105  VCWHLGLFLCLTFGQIGFKGRTEDYF  28
            + WHLGLF+ LTFGQIGFKGRTEDYF
Sbjct  118  ITWHLGLFIVLTFGQIGFKGRTEDYF  143



>ref|XP_006305762.1| hypothetical protein CARUB_v10010597mg [Capsella rubella]
 gb|EOA38660.1| hypothetical protein CARUB_v10010597mg [Capsella rubella]
Length=140

 Score =   214 bits (546),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 108/146 (74%), Positives = 121/146 (83%), Gaps = 6/146 (4%)
 Frame = -3

Query  465  MAATLCAASTVVGLATSSLPRLSSPNKLFLTSDFLKPAVSARNPLKLPRACMGKFTCFER  286
            MAAT    STV+GL  SS+   + P     +S FLKP +SA+NPLKL  A  G+ TCFER
Sbjct  1    MAATFATPSTVIGLGGSSI--TTKP----FSSSFLKPTLSAKNPLKLAGASGGRVTCFER  54

Query  285  DWLRRDLNVIGFGLIGWIAPSSVPLINGKSLTGLFFDSIGTELSHWPTGPALTSQFWLWL  106
            +WLRRDLNV+GFGLIGW+APSS+P INGKSLTGLFFDSIGTEL+H+PT PALTSQFWLWL
Sbjct  55   NWLRRDLNVVGFGLIGWLAPSSIPAINGKSLTGLFFDSIGTELAHFPTPPALTSQFWLWL  114

Query  105  VCWHLGLFLCLTFGQIGFKGRTEDYF  28
            V WHLGLFLCLTFGQIGFKGRTEDYF
Sbjct  115  VTWHLGLFLCLTFGQIGFKGRTEDYF  140



>ref|XP_006417699.1| hypothetical protein EUTSA_v10009047mg [Eutrema salsugineum]
 dbj|BAJ33638.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ36052.1| hypothetical protein EUTSA_v10009047mg [Eutrema salsugineum]
Length=142

 Score =   214 bits (545),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 108/146 (74%), Positives = 121/146 (83%), Gaps = 6/146 (4%)
 Frame = -3

Query  465  MAATLCAASTVVGLATSSLPRLSSPNKLFLTSDFLKPAVSARNPLKLPRACMGKFTCFER  286
            MAAT    STV+GL  SS+    SP     +S FLKP + A+NPL+L  A  G+FTCFER
Sbjct  1    MAATFTTPSTVIGLGGSSV----SPRPF--SSSFLKPTLRAKNPLRLAGASGGRFTCFER  54

Query  285  DWLRRDLNVIGFGLIGWIAPSSVPLINGKSLTGLFFDSIGTELSHWPTGPALTSQFWLWL  106
            +WLRRDLNV+GFGLIGW+APSS+P INGKSLTGLFFDSIGTEL+H+PT PALTSQFWLWL
Sbjct  55   NWLRRDLNVVGFGLIGWLAPSSIPAINGKSLTGLFFDSIGTELAHFPTPPALTSQFWLWL  114

Query  105  VCWHLGLFLCLTFGQIGFKGRTEDYF  28
            V WHLGLFLCLTFGQIGFKGRTEDYF
Sbjct  115  VTWHLGLFLCLTFGQIGFKGRTEDYF  140



>ref|XP_007015746.1| Photosystem I subunit O [Theobroma cacao]
 gb|EOY33365.1| Photosystem I subunit O [Theobroma cacao]
Length=145

 Score =   214 bits (545),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 109/147 (74%), Positives = 123/147 (84%), Gaps = 3/147 (2%)
 Frame = -3

Query  465  MAATLCAASTVVGLATSSLPRLSSP-NKLFLTSDFLKPAVSARNPLKLPRACMGKFTCFE  289
            MAAT  + STVVGL +++L  LS+P  K FL+S FLK  V+ARNPL L  A  GKFTCFE
Sbjct  1    MAATFASPSTVVGLRSTTL--LSTPAKKAFLSSGFLKSRVAARNPLMLAGASGGKFTCFE  58

Query  288  RDWLRRDLNVIGFGLIGWIAPSSVPLINGKSLTGLFFDSIGTELSHWPTGPALTSQFWLW  109
            RDWLR D NVIGFGLIGW+APSS+P INGKSLTGLFF+SIG EL+H+P+ P LTSQFWLW
Sbjct  59   RDWLRTDFNVIGFGLIGWLAPSSIPAINGKSLTGLFFESIGNELAHFPSPPPLTSQFWLW  118

Query  108  LVCWHLGLFLCLTFGQIGFKGRTEDYF  28
            LV WH+GLFLCLTFGQIGFKGRTEDYF
Sbjct  119  LVLWHIGLFLCLTFGQIGFKGRTEDYF  145



>emb|CDX95064.1| BnaC05g06070D [Brassica napus]
Length=145

 Score =   214 bits (544),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 106/146 (73%), Positives = 120/146 (82%), Gaps = 3/146 (2%)
 Frame = -3

Query  465  MAATLCAASTVVGLATSSLPRLSSPNKLFLTSDFLKPAVSARNPLKLPRACMGKFTCFER  286
            MAAT    STVVGL  SS+   S  N   L+S FLKP   A+NPL++  A  G+FTCFE 
Sbjct  1    MAATFATPSTVVGLGGSSV---SPINTKALSSSFLKPTTRAKNPLRVAGASGGRFTCFES  57

Query  285  DWLRRDLNVIGFGLIGWIAPSSVPLINGKSLTGLFFDSIGTELSHWPTGPALTSQFWLWL  106
            +WLRRDLNV+GFGLIGW+APSS+P INGKSLTGLFF+SIGTEL+H+PT PALTSQFWLWL
Sbjct  58   NWLRRDLNVVGFGLIGWLAPSSIPAINGKSLTGLFFESIGTELAHFPTPPALTSQFWLWL  117

Query  105  VCWHLGLFLCLTFGQIGFKGRTEDYF  28
            V WHLGLF+CLTFGQIGFKGRTEDYF
Sbjct  118  VTWHLGLFICLTFGQIGFKGRTEDYF  143



>ref|XP_009789385.1| PREDICTED: photosystem I subunit O-like isoform X2 [Nicotiana 
sylvestris]
Length=142

 Score =   214 bits (544),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 100/122 (82%), Positives = 112/122 (92%), Gaps = 0/122 (0%)
 Frame = -3

Query  393  PNKLFLTSDFLKPAVSARNPLKLPRACMGKFTCFERDWLRRDLNVIGFGLIGWIAPSSVP  214
            P K  L+S  LK  V+ARNPL++ +A  GKFTCF+RDWLRRDLNVIGFGLIGW+APSS+P
Sbjct  19   PKKACLSSGLLKSPVTARNPLRVAQASGGKFTCFQRDWLRRDLNVIGFGLIGWLAPSSIP  78

Query  213  LINGKSLTGLFFDSIGTELSHWPTGPALTSQFWLWLVCWHLGLFLCLTFGQIGFKGRTED  34
            +INGKSL+GLFFDSIGTELSH+PTGPALTSQFWLWLVCWHLGLF+CLTFGQIGFKGRTED
Sbjct  79   VINGKSLSGLFFDSIGTELSHFPTGPALTSQFWLWLVCWHLGLFICLTFGQIGFKGRTED  138

Query  33   YF  28
            YF
Sbjct  139  YF  140



>ref|NP_563815.1| photosystem I subunit O [Arabidopsis thaliana]
 sp|Q949Q5.1|PSAO_ARATH RecName: Full=Photosystem I subunit O; Short=PSI-O; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAK93637.1| unknown protein [Arabidopsis thaliana]
 gb|AAM14284.1| unknown protein [Arabidopsis thaliana]
 gb|AAM64918.1| putative 16kDa membrane protein [Arabidopsis thaliana]
 emb|CAD37939.1| photosystem I subunit O [Arabidopsis thaliana]
 gb|AEE28283.1| photosystem I subunit O [Arabidopsis thaliana]
Length=140

 Score =   213 bits (542),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 107/146 (73%), Positives = 121/146 (83%), Gaps = 6/146 (4%)
 Frame = -3

Query  465  MAATLCAASTVVGLATSSLPRLSSPNKLFLTSDFLKPAVSARNPLKLPRACMGKFTCFER  286
            MAAT    STV+GL  SS+   + P     +S FLKP +SA+NPL+L  A  G+ TCFER
Sbjct  1    MAATFATPSTVIGLGGSSI--TTKP----FSSSFLKPTLSAKNPLRLAGASGGRVTCFER  54

Query  285  DWLRRDLNVIGFGLIGWIAPSSVPLINGKSLTGLFFDSIGTELSHWPTGPALTSQFWLWL  106
            +WLRRDLNV+GFGLIGW+APSS+P INGKSLTGLFFDSIGTEL+H+PT PALTSQFWLWL
Sbjct  55   NWLRRDLNVVGFGLIGWLAPSSIPAINGKSLTGLFFDSIGTELAHFPTPPALTSQFWLWL  114

Query  105  VCWHLGLFLCLTFGQIGFKGRTEDYF  28
            V WHLGLFLCLTFGQIGFKGRTEDYF
Sbjct  115  VTWHLGLFLCLTFGQIGFKGRTEDYF  140



>ref|XP_011088934.1| PREDICTED: photosystem I subunit O [Sesamum indicum]
Length=147

 Score =   213 bits (541),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 108/137 (79%), Positives = 118/137 (86%), Gaps = 3/137 (2%)
 Frame = -3

Query  435  VVGLATSSLPRLSSPNK-LFLTSDFLKPAVSARNPLKLPRACMGKFTCFERDWLRRDLNV  259
            VVGL TS+    +SPNK L L+S FLK  V+ RNPL++ +A  GKFTCFERDWLRRDLNV
Sbjct  13   VVGLGTSTFS--NSPNKPLNLSSGFLKSPVTTRNPLRVAQASGGKFTCFERDWLRRDLNV  70

Query  258  IGFGLIGWIAPSSVPLINGKSLTGLFFDSIGTELSHWPTGPALTSQFWLWLVCWHLGLFL  79
            IGFGLIGWIAPSS+P ING SLTGLFF SIGTEL+H+PTGPALTS FWLWLVCWHLGLFL
Sbjct  71   IGFGLIGWIAPSSIPAINGNSLTGLFFSSIGTELAHFPTGPALTSPFWLWLVCWHLGLFL  130

Query  78   CLTFGQIGFKGRTEDYF  28
             LTFGQIGFKGRTEDYF
Sbjct  131  TLTFGQIGFKGRTEDYF  147



>ref|XP_009148097.1| PREDICTED: uncharacterized protein LOC103871585 [Brassica rapa]
Length=145

 Score =   212 bits (540),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 105/146 (72%), Positives = 119/146 (82%), Gaps = 3/146 (2%)
 Frame = -3

Query  465  MAATLCAASTVVGLATSSLPRLSSPNKLFLTSDFLKPAVSARNPLKLPRACMGKFTCFER  286
            MAAT    STVVGL  SS+   S  N   L+S FLKP   A+NPL++  A  G+FTCFE 
Sbjct  1    MAATFATPSTVVGLGGSSV---SPINTKALSSSFLKPTTRAKNPLRVAGASGGRFTCFES  57

Query  285  DWLRRDLNVIGFGLIGWIAPSSVPLINGKSLTGLFFDSIGTELSHWPTGPALTSQFWLWL  106
            +WLRRDLNV+GFGLIGW+APSS+P INGKSLTGLFF+SIG EL+H+PT PALTSQFWLWL
Sbjct  58   NWLRRDLNVVGFGLIGWLAPSSIPAINGKSLTGLFFESIGNELAHFPTPPALTSQFWLWL  117

Query  105  VCWHLGLFLCLTFGQIGFKGRTEDYF  28
            V WHLGLF+CLTFGQIGFKGRTEDYF
Sbjct  118  VTWHLGLFICLTFGQIGFKGRTEDYF  143



>ref|XP_010488808.1| PREDICTED: photosystem I subunit O-like [Camelina sativa]
Length=140

 Score =   212 bits (539),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 105/146 (72%), Positives = 122/146 (84%), Gaps = 6/146 (4%)
 Frame = -3

Query  465  MAATLCAASTVVGLATSSLPRLSSPNKLFLTSDFLKPAVSARNPLKLPRACMGKFTCFER  286
            MAAT    STV+GL  SS+   + P     +S FLKP +SA+NPL+L  A  G+FTCFER
Sbjct  1    MAATFATPSTVIGLGGSSI--TTKP----FSSSFLKPTLSAKNPLRLAGASGGRFTCFER  54

Query  285  DWLRRDLNVIGFGLIGWIAPSSVPLINGKSLTGLFFDSIGTELSHWPTGPALTSQFWLWL  106
            +WLRRDLNV+GFGLIGW+APSS+P INGKSLTGLFFDSIGTEL+H+PT PALTSQFWLWL
Sbjct  55   NWLRRDLNVVGFGLIGWLAPSSIPAINGKSLTGLFFDSIGTELAHFPTPPALTSQFWLWL  114

Query  105  VCWHLGLFLCLTFGQIGFKGRTEDYF  28
            + WHLGLFLCLTFGQIGFKGRT++YF
Sbjct  115  ITWHLGLFLCLTFGQIGFKGRTDNYF  140



>ref|XP_008361123.1| PREDICTED: uncharacterized protein LOC103424798 isoform X2 [Malus 
domestica]
Length=143

 Score =   212 bits (540),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 105/146 (72%), Positives = 123/146 (84%), Gaps = 5/146 (3%)
 Frame = -3

Query  465  MAATLCAASTVVGLATSSLPRLSSPNKLFLTSDFLKPAVSARNPLKLPRACMGKFTCFER  286
            MA ++  ASTV+GL +SSL    SPN+  LTS F+KP V   NPL+  RA  G+FTCF+R
Sbjct  1    MAVSMATASTVIGLGSSSL----SPNRTCLTSGFVKPIVVG-NPLRQVRASGGRFTCFQR  55

Query  285  DWLRRDLNVIGFGLIGWIAPSSVPLINGKSLTGLFFDSIGTELSHWPTGPALTSQFWLWL  106
            DWLRRDLNVIGFGLIGW+APSS+PLI+GKSLTGLFF+SIG EL+H+P+ PALTSQFWLWL
Sbjct  56   DWLRRDLNVIGFGLIGWLAPSSIPLIDGKSLTGLFFESIGAELAHFPSPPALTSQFWLWL  115

Query  105  VCWHLGLFLCLTFGQIGFKGRTEDYF  28
            + WHLGLF+ LTFGQIGFKGRTEDYF
Sbjct  116  ITWHLGLFITLTFGQIGFKGRTEDYF  141



>ref|XP_010475635.1| PREDICTED: photosystem I subunit O-like [Camelina sativa]
Length=140

 Score =   212 bits (539),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 105/146 (72%), Positives = 120/146 (82%), Gaps = 6/146 (4%)
 Frame = -3

Query  465  MAATLCAASTVVGLATSSLPRLSSPNKLFLTSDFLKPAVSARNPLKLPRACMGKFTCFER  286
            MAAT    STV+GL  SS+   S       +S FLKP +SA+NPL+L  A  G+ TCFER
Sbjct  1    MAATFATPSTVIGLGGSSITTKS------FSSSFLKPTLSAKNPLRLAGASGGRVTCFER  54

Query  285  DWLRRDLNVIGFGLIGWIAPSSVPLINGKSLTGLFFDSIGTELSHWPTGPALTSQFWLWL  106
            +WLRRDLNV+GFGLIGW+APSS+P INGKSLTGLFFDSIGTEL+H+PT PALTSQFWLWL
Sbjct  55   NWLRRDLNVVGFGLIGWLAPSSIPAINGKSLTGLFFDSIGTELAHFPTPPALTSQFWLWL  114

Query  105  VCWHLGLFLCLTFGQIGFKGRTEDYF  28
            V WHLGLFLCLTFGQIGFKGRT++YF
Sbjct  115  VTWHLGLFLCLTFGQIGFKGRTDNYF  140



>ref|XP_002523852.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF38578.1| conserved hypothetical protein [Ricinus communis]
Length=143

 Score =   212 bits (539),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 105/146 (72%), Positives = 123/146 (84%), Gaps = 3/146 (2%)
 Frame = -3

Query  465  MAATLCAASTVVGLATSSLPRLSSPNKLFLTSDFLKPAVSARNPLKLPRACMGKFTCFER  286
            MAAT   +STV+GL +SSL   SSP K+ L S F+K  V ARNPL+   A  GKF CFER
Sbjct  1    MAATFATSSTVIGLCSSSL---SSPKKICLGSGFVKSPVPARNPLRQTGANGGKFVCFER  57

Query  285  DWLRRDLNVIGFGLIGWIAPSSVPLINGKSLTGLFFDSIGTELSHWPTGPALTSQFWLWL  106
            +WLR+DLNVIGFGLIGW+APS++P I+GKSLTGLFF+SIG+EL+H+P+ PALTSQFWLWL
Sbjct  58   NWLRKDLNVIGFGLIGWLAPSTIPAIDGKSLTGLFFESIGSELAHFPSPPALTSQFWLWL  117

Query  105  VCWHLGLFLCLTFGQIGFKGRTEDYF  28
            + WHLGLFLCLTFGQIGFKGRTEDYF
Sbjct  118  ITWHLGLFLCLTFGQIGFKGRTEDYF  143



>ref|XP_002892455.1| hypothetical protein ARALYDRAFT_470899 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68714.1| hypothetical protein ARALYDRAFT_470899 [Arabidopsis lyrata subsp. 
lyrata]
Length=140

 Score =   211 bits (538),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 106/146 (73%), Positives = 121/146 (83%), Gaps = 6/146 (4%)
 Frame = -3

Query  465  MAATLCAASTVVGLATSSLPRLSSPNKLFLTSDFLKPAVSARNPLKLPRACMGKFTCFER  286
            MAAT    STV+GL  SS+   + P     +S FLKP +SA+NPL+L  A  G+ TCFER
Sbjct  1    MAATFATPSTVIGLGGSSI--TTKP----FSSPFLKPTLSAKNPLRLAGASGGRVTCFER  54

Query  285  DWLRRDLNVIGFGLIGWIAPSSVPLINGKSLTGLFFDSIGTELSHWPTGPALTSQFWLWL  106
            +WLRRDLNV+GFGLIGW+APSS+P INGKSLTGLFFDSIGTEL+H+PT PA+TSQFWLWL
Sbjct  55   NWLRRDLNVVGFGLIGWLAPSSIPAINGKSLTGLFFDSIGTELAHFPTPPAVTSQFWLWL  114

Query  105  VCWHLGLFLCLTFGQIGFKGRTEDYF  28
            V WHLGLFLCLTFGQIGFKGRTEDYF
Sbjct  115  VTWHLGLFLCLTFGQIGFKGRTEDYF  140



>gb|AAM97011.1| expressed protein [Arabidopsis thaliana]
 gb|AAN15510.1| expressed protein [Arabidopsis thaliana]
Length=140

 Score =   211 bits (538),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 106/146 (73%), Positives = 120/146 (82%), Gaps = 6/146 (4%)
 Frame = -3

Query  465  MAATLCAASTVVGLATSSLPRLSSPNKLFLTSDFLKPAVSARNPLKLPRACMGKFTCFER  286
            M AT    STV+GL  SS+   + P     +S FLKP +SA+NPL+L  A  G+ TCFER
Sbjct  1    MVATFATPSTVIGLGGSSI--TTKP----FSSSFLKPTLSAKNPLRLAGASGGRVTCFER  54

Query  285  DWLRRDLNVIGFGLIGWIAPSSVPLINGKSLTGLFFDSIGTELSHWPTGPALTSQFWLWL  106
            +WLRRDLNV+GFGLIGW+APSS+P INGKSLTGLFFDSIGTEL+H+PT PALTSQFWLWL
Sbjct  55   NWLRRDLNVVGFGLIGWLAPSSIPAINGKSLTGLFFDSIGTELAHFPTPPALTSQFWLWL  114

Query  105  VCWHLGLFLCLTFGQIGFKGRTEDYF  28
            V WHLGLFLCLTFGQIGFKGRTEDYF
Sbjct  115  VTWHLGLFLCLTFGQIGFKGRTEDYF  140



>ref|XP_009344568.1| PREDICTED: photosystem I subunit O-like isoform X2 [Pyrus x bretschneideri]
Length=143

 Score =   211 bits (538),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 105/146 (72%), Positives = 124/146 (85%), Gaps = 5/146 (3%)
 Frame = -3

Query  465  MAATLCAASTVVGLATSSLPRLSSPNKLFLTSDFLKPAVSARNPLKLPRACMGKFTCFER  286
            MAA++  ASTV+GL +SSL    SPN+  L+S F+KP V   NPL+  RA  G+FTCF+R
Sbjct  1    MAASMATASTVMGLGSSSL----SPNRTCLSSGFVKPIVVG-NPLRQVRASGGRFTCFQR  55

Query  285  DWLRRDLNVIGFGLIGWIAPSSVPLINGKSLTGLFFDSIGTELSHWPTGPALTSQFWLWL  106
            DWLRRDLNVIGFGLIGW+APSS+PLI+GKSLTGLFF+SIG EL+H+P+ PALTSQFWLWL
Sbjct  56   DWLRRDLNVIGFGLIGWLAPSSIPLIDGKSLTGLFFESIGAELAHFPSPPALTSQFWLWL  115

Query  105  VCWHLGLFLCLTFGQIGFKGRTEDYF  28
            + WHLGLF+ LTFGQIGFKGRTEDYF
Sbjct  116  ITWHLGLFITLTFGQIGFKGRTEDYF  141



>emb|CDY22686.1| BnaC08g43200D [Brassica napus]
Length=145

 Score =   211 bits (537),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 102/146 (70%), Positives = 121/146 (83%), Gaps = 3/146 (2%)
 Frame = -3

Query  465  MAATLCAASTVVGLATSSLPRLSSPNKLFLTSDFLKPAVSARNPLKLPRACMGKFTCFER  286
            MAAT    STV+GL  SS+  + +     L+S FLKP + A+N LK+  A  G+FTCFER
Sbjct  1    MAATFGTPSTVIGLGGSSVSPIKAKA---LSSSFLKPTLRAKNALKVAGASGGRFTCFER  57

Query  285  DWLRRDLNVIGFGLIGWIAPSSVPLINGKSLTGLFFDSIGTELSHWPTGPALTSQFWLWL  106
            +WLRRDLNV+GFGL+GW+APSS+P INGKSLTGLFF+SIGTEL+H+PT PALTSQFWLWL
Sbjct  58   NWLRRDLNVVGFGLVGWLAPSSIPAINGKSLTGLFFESIGTELAHFPTPPALTSQFWLWL  117

Query  105  VCWHLGLFLCLTFGQIGFKGRTEDYF  28
            + WHLGLF+CLTFGQIGFKGRTEDYF
Sbjct  118  ITWHLGLFICLTFGQIGFKGRTEDYF  143



>ref|XP_010458074.1| PREDICTED: photosystem I subunit O [Camelina sativa]
Length=140

 Score =   210 bits (534),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 105/146 (72%), Positives = 121/146 (83%), Gaps = 6/146 (4%)
 Frame = -3

Query  465  MAATLCAASTVVGLATSSLPRLSSPNKLFLTSDFLKPAVSARNPLKLPRACMGKFTCFER  286
            MAAT    STV+GL  SS+   + P     +S FLKP +SA+NPL+L  A  G+ TCFER
Sbjct  1    MAATFATPSTVIGLGGSSI--TTKP----FSSSFLKPTLSAKNPLRLAGASGGRVTCFER  54

Query  285  DWLRRDLNVIGFGLIGWIAPSSVPLINGKSLTGLFFDSIGTELSHWPTGPALTSQFWLWL  106
            +WLRRDLNV+GFGLIGW+APSS+P INGKSLTGLFFDSIGTEL+H+PT PALTSQFWLWL
Sbjct  55   NWLRRDLNVVGFGLIGWLAPSSIPAINGKSLTGLFFDSIGTELAHFPTPPALTSQFWLWL  114

Query  105  VCWHLGLFLCLTFGQIGFKGRTEDYF  28
            V WHLGLFLCLTFGQIGFKGRT++YF
Sbjct  115  VTWHLGLFLCLTFGQIGFKGRTDNYF  140



>ref|XP_009789384.1| PREDICTED: photosystem I subunit O-like isoform X1 [Nicotiana 
sylvestris]
 emb|CAB75430.1| putative 16kDa membrane protein [Nicotiana tabacum]
Length=143

 Score =   209 bits (531),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 100/123 (81%), Positives = 112/123 (91%), Gaps = 1/123 (1%)
 Frame = -3

Query  393  PNKLFLTSDFLKPAVSARNPLKLPRACMGKFTC-FERDWLRRDLNVIGFGLIGWIAPSSV  217
            P K  L+S  LK  V+ARNPL++ +A  GKFTC F+RDWLRRDLNVIGFGLIGW+APSS+
Sbjct  19   PKKACLSSGLLKSPVTARNPLRVAQASGGKFTCNFQRDWLRRDLNVIGFGLIGWLAPSSI  78

Query  216  PLINGKSLTGLFFDSIGTELSHWPTGPALTSQFWLWLVCWHLGLFLCLTFGQIGFKGRTE  37
            P+INGKSL+GLFFDSIGTELSH+PTGPALTSQFWLWLVCWHLGLF+CLTFGQIGFKGRTE
Sbjct  79   PVINGKSLSGLFFDSIGTELSHFPTGPALTSQFWLWLVCWHLGLFICLTFGQIGFKGRTE  138

Query  36   DYF  28
            DYF
Sbjct  139  DYF  141



>ref|XP_010912341.1| PREDICTED: photosystem I subunit O [Elaeis guineensis]
Length=145

 Score =   209 bits (531),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 100/144 (69%), Positives = 116/144 (81%), Gaps = 0/144 (0%)
 Frame = -3

Query  459  ATLCAASTVVGLATSSLPRLSSPNKLFLTSDFLKPAVSARNPLKLPRACMGKFTCFERDW  280
            AT+   S+V     S LP +   +K  LTS F +P V++R+PL L  A  G+FTCFERDW
Sbjct  2    ATMATTSSVAAGLASPLPLVRRSSKPTLTSGFTRPQVASRSPLNLKLASGGRFTCFERDW  61

Query  279  LRRDLNVIGFGLIGWIAPSSVPLINGKSLTGLFFDSIGTELSHWPTGPALTSQFWLWLVC  100
            LR DLNVIGFGLIGW+APSSVP+ING SLTGLFF SIG EL+HWPTGPALTSQFWLW+V 
Sbjct  62   LRTDLNVIGFGLIGWLAPSSVPVINGNSLTGLFFQSIGAELAHWPTGPALTSQFWLWMVL  121

Query  99   WHLGLFLCLTFGQIGFKGRTEDYF  28
            WH+GLFLCLTFGQIGFKGR+E+YF
Sbjct  122  WHVGLFLCLTFGQIGFKGRSEEYF  145



>ref|XP_009793460.1| PREDICTED: photosystem I subunit O-like [Nicotiana sylvestris]
Length=143

 Score =   207 bits (528),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 106/146 (73%), Positives = 120/146 (82%), Gaps = 3/146 (2%)
 Frame = -3

Query  465  MAATLCAASTVVGLATSSLPRLSSPNKLFLTSDFLKPAVSARNPLKLPRACMGKFTCFER  286
            MAA +   STVVGL +SSL      +     S FLK  V+ARNPL++ +A  GKFTCFER
Sbjct  1    MAARMATTSTVVGLVSSSLSSSKKTSL---NSGFLKSPVTARNPLRIAQASGGKFTCFER  57

Query  285  DWLRRDLNVIGFGLIGWIAPSSVPLINGKSLTGLFFDSIGTELSHWPTGPALTSQFWLWL  106
            DWLRRDLNVIGFGLIGW+APSS+P INGKSL+GLFF+SIGTELSH+PTGP +TSQFWLW+
Sbjct  58   DWLRRDLNVIGFGLIGWLAPSSIPAINGKSLSGLFFESIGTELSHFPTGPGVTSQFWLWM  117

Query  105  VCWHLGLFLCLTFGQIGFKGRTEDYF  28
            VCWHLGLFLCLTF QIGFKGRTE YF
Sbjct  118  VCWHLGLFLCLTFWQIGFKGRTEKYF  143



>emb|CDX93566.1| BnaA06g04820D [Brassica napus]
Length=144

 Score =   207 bits (528),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 105/146 (72%), Positives = 120/146 (82%), Gaps = 4/146 (3%)
 Frame = -3

Query  465  MAATLCAASTVVGLATSSLPRLSSPNKLFLTSDFLKPAVSARNPLKLPRACMGKFTCFER  286
            MAAT  A  +VVGL  SS+   S  N   L+S FLKP   A+NPL++  A  G+FTCFE 
Sbjct  1    MAATF-ATPSVVGLGGSSV---SPINTKALSSSFLKPTTRAKNPLRVAGASGGRFTCFES  56

Query  285  DWLRRDLNVIGFGLIGWIAPSSVPLINGKSLTGLFFDSIGTELSHWPTGPALTSQFWLWL  106
            +WLRRDLNV+GFGLIGW+APSS+P INGKSLTGLFF+SIGTEL+H+PT PALTSQFWLWL
Sbjct  57   NWLRRDLNVVGFGLIGWLAPSSIPAINGKSLTGLFFESIGTELAHFPTPPALTSQFWLWL  116

Query  105  VCWHLGLFLCLTFGQIGFKGRTEDYF  28
            V WHLGLF+CLTFGQIGFKGRTEDYF
Sbjct  117  VTWHLGLFICLTFGQIGFKGRTEDYF  142



>ref|XP_010694990.1| PREDICTED: photosystem I subunit O [Beta vulgaris subsp. vulgaris]
Length=147

 Score =   207 bits (528),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 109/146 (75%), Positives = 118/146 (81%), Gaps = 2/146 (1%)
 Frame = -3

Query  462  AATLCAASTVVGLATSSLPRLSSPNKLFLTSDFLKPAVSARNPLKLPRACMG-KFTCFER  286
            A +  A+STVVGL TS L R S      LTS FLK  V+ARNPL+L  A  G KFTCFER
Sbjct  3    ANSFAASSTVVGLGTSHLHR-SLSKSTNLTSGFLKSTVAARNPLRLACASSGGKFTCFER  61

Query  285  DWLRRDLNVIGFGLIGWIAPSSVPLINGKSLTGLFFDSIGTELSHWPTGPALTSQFWLWL  106
            +WLR DLNVIGFGLIGW+APSSVP ING SL+GLFF SIG ELSH+PT PALTSQFWLWL
Sbjct  62   NWLRTDLNVIGFGLIGWLAPSSVPAINGNSLSGLFFSSIGEELSHFPTPPALTSQFWLWL  121

Query  105  VCWHLGLFLCLTFGQIGFKGRTEDYF  28
            V WHLGLFLCLTFGQIGFKGRTE+YF
Sbjct  122  VLWHLGLFLCLTFGQIGFKGRTEEYF  147



>ref|XP_008361116.1| PREDICTED: uncharacterized protein LOC103424798 isoform X1 [Malus 
domestica]
Length=144

 Score =   207 bits (528),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 105/147 (71%), Positives = 123/147 (84%), Gaps = 6/147 (4%)
 Frame = -3

Query  465  MAATLCAASTVVGLATSSLPRLSSPNKLFLTSDFLKPAVSARNPLKLPRACMGKFTC-FE  289
            MA ++  ASTV+GL +SSL    SPN+  LTS F+KP V   NPL+  RA  G+FTC F+
Sbjct  1    MAVSMATASTVIGLGSSSL----SPNRTCLTSGFVKPIVVG-NPLRQVRASGGRFTCSFQ  55

Query  288  RDWLRRDLNVIGFGLIGWIAPSSVPLINGKSLTGLFFDSIGTELSHWPTGPALTSQFWLW  109
            RDWLRRDLNVIGFGLIGW+APSS+PLI+GKSLTGLFF+SIG EL+H+P+ PALTSQFWLW
Sbjct  56   RDWLRRDLNVIGFGLIGWLAPSSIPLIDGKSLTGLFFESIGAELAHFPSPPALTSQFWLW  115

Query  108  LVCWHLGLFLCLTFGQIGFKGRTEDYF  28
            L+ WHLGLF+ LTFGQIGFKGRTEDYF
Sbjct  116  LITWHLGLFITLTFGQIGFKGRTEDYF  142



>ref|XP_009344567.1| PREDICTED: photosystem I subunit O-like isoform X1 [Pyrus x bretschneideri]
Length=144

 Score =   207 bits (527),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 105/147 (71%), Positives = 124/147 (84%), Gaps = 6/147 (4%)
 Frame = -3

Query  465  MAATLCAASTVVGLATSSLPRLSSPNKLFLTSDFLKPAVSARNPLKLPRACMGKFTC-FE  289
            MAA++  ASTV+GL +SSL    SPN+  L+S F+KP V   NPL+  RA  G+FTC F+
Sbjct  1    MAASMATASTVMGLGSSSL----SPNRTCLSSGFVKPIVVG-NPLRQVRASGGRFTCSFQ  55

Query  288  RDWLRRDLNVIGFGLIGWIAPSSVPLINGKSLTGLFFDSIGTELSHWPTGPALTSQFWLW  109
            RDWLRRDLNVIGFGLIGW+APSS+PLI+GKSLTGLFF+SIG EL+H+P+ PALTSQFWLW
Sbjct  56   RDWLRRDLNVIGFGLIGWLAPSSIPLIDGKSLTGLFFESIGAELAHFPSPPALTSQFWLW  115

Query  108  LVCWHLGLFLCLTFGQIGFKGRTEDYF  28
            L+ WHLGLF+ LTFGQIGFKGRTEDYF
Sbjct  116  LITWHLGLFITLTFGQIGFKGRTEDYF  142



>ref|XP_010557432.1| PREDICTED: photosystem I subunit O [Tarenaya hassleriana]
Length=144

 Score =   207 bits (526),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 104/146 (71%), Positives = 120/146 (82%), Gaps = 2/146 (1%)
 Frame = -3

Query  465  MAATLCAASTVVGLATSSLPRLSSPNKLFLTSDFLKPAVSARNPLKLPRACMGKFTCFER  286
            MAA +   STV+GL  SSL     PN  F +S FLKP + A+NP K+  +  G+ TCFER
Sbjct  1    MAAAISNPSTVLGLRGSSLSP-KRPNDGF-SSSFLKPTMRAKNPFKVAGSSGGRVTCFER  58

Query  285  DWLRRDLNVIGFGLIGWIAPSSVPLINGKSLTGLFFDSIGTELSHWPTGPALTSQFWLWL  106
            +WLRRDLNV+GFGLIGWIAPSS+P INGKSLTGLFF+SIG+EL+H+PT PALTSQFWLWL
Sbjct  59   NWLRRDLNVVGFGLIGWIAPSSIPAINGKSLTGLFFESIGSELAHFPTPPALTSQFWLWL  118

Query  105  VCWHLGLFLCLTFGQIGFKGRTEDYF  28
            V WHLGLFLCLTFGQIGFKGRT+DYF
Sbjct  119  VLWHLGLFLCLTFGQIGFKGRTDDYF  144



>ref|XP_007206116.1| hypothetical protein PRUPE_ppa013064mg [Prunus persica]
 gb|EMJ07315.1| hypothetical protein PRUPE_ppa013064mg [Prunus persica]
Length=142

 Score =   206 bits (525),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 104/147 (71%), Positives = 124/147 (84%), Gaps = 6/147 (4%)
 Frame = -3

Query  465  MAATLCAASTVVGLATSSLPRLSSPNKLFLTSDFLKPAVSARNPLKLPRACMGKFTC-FE  289
            MAA +  ASTV+GL++SSL    SP +  L+S F+KP ++  NPL+  RA  G+FTC F+
Sbjct  1    MAANMATASTVIGLSSSSL----SPKRTCLSSGFVKP-IAVGNPLRQARASGGRFTCNFQ  55

Query  288  RDWLRRDLNVIGFGLIGWIAPSSVPLINGKSLTGLFFDSIGTELSHWPTGPALTSQFWLW  109
            RDWLRRDLNVIGFGLIGW+APSS+P I+GKSLTGLFF+SIGTEL+H+P+ PALTSQFWLW
Sbjct  56   RDWLRRDLNVIGFGLIGWLAPSSIPAIDGKSLTGLFFESIGTELAHFPSPPALTSQFWLW  115

Query  108  LVCWHLGLFLCLTFGQIGFKGRTEDYF  28
            LV WHLGLF+ LTFGQIGFKGRTEDYF
Sbjct  116  LVTWHLGLFITLTFGQIGFKGRTEDYF  142



>emb|CDP06878.1| unnamed protein product [Coffea canephora]
Length=151

 Score =   206 bits (525),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 109/149 (73%), Positives = 118/149 (79%), Gaps = 3/149 (2%)
 Frame = -3

Query  465  MAATLCAASTVVGLATSSLPRLSS---PNKLFLTSDFLKPAVSARNPLKLPRACMGKFTC  295
            MA T   ASTVVGL TSSL   S    P K+ L S FLK  V+ RNPL L +   GKFTC
Sbjct  1    MATTFATASTVVGLGTSSLSSPSRASSPKKVCLNSGFLKSPVTTRNPLSLAQISGGKFTC  60

Query  294  FERDWLRRDLNVIGFGLIGWIAPSSVPLINGKSLTGLFFDSIGTELSHWPTGPALTSQFW  115
            FERDWLR D NVIGFGLIGWIAPSS+P+INGKSLTGLFF+SIGTEL+H+PTGP LTS FW
Sbjct  61   FERDWLRTDFNVIGFGLIGWIAPSSIPVINGKSLTGLFFESIGTELAHFPTGPPLTSPFW  120

Query  114  LWLVCWHLGLFLCLTFGQIGFKGRTEDYF  28
            LW+V WHLGLFL LTFGQIGFKGRTE YF
Sbjct  121  LWMVTWHLGLFLILTFGQIGFKGRTEGYF  149



>gb|KJB09104.1| hypothetical protein B456_001G123200 [Gossypium raimondii]
Length=145

 Score =   206 bits (524),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 106/146 (73%), Positives = 116/146 (79%), Gaps = 1/146 (1%)
 Frame = -3

Query  465  MAATLCAASTVVGLATSSLPRLSSPNKLFLTSDFLKPAVSARNPLKLPRACMGKFTCFER  286
            MAAT  + STVV L  S+    S PN   L+S FLK +V  RNPL+L  AC GKFTCFER
Sbjct  1    MAATFSSPSTVVRLG-SATSFSSPPNNTCLSSGFLKSSVRGRNPLRLAGACGGKFTCFER  59

Query  285  DWLRRDLNVIGFGLIGWIAPSSVPLINGKSLTGLFFDSIGTELSHWPTGPALTSQFWLWL  106
            DWLRRD NVIGFGLIGWIAPSS+P INGKSLTGL F+SIGTEL+H+PT P  TSQFWLWL
Sbjct  60   DWLRRDFNVIGFGLIGWIAPSSIPAINGKSLTGLLFESIGTELAHFPTPPPPTSQFWLWL  119

Query  105  VCWHLGLFLCLTFGQIGFKGRTEDYF  28
            V WHLGLF+ LT GQIGFKGRTEDYF
Sbjct  120  VLWHLGLFITLTLGQIGFKGRTEDYF  145



>ref|XP_002273037.1| PREDICTED: photosystem I subunit O [Vitis vinifera]
 emb|CBI28282.3| unnamed protein product [Vitis vinifera]
Length=148

 Score =   206 bits (524),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 107/148 (72%), Positives = 119/148 (80%), Gaps = 2/148 (1%)
 Frame = -3

Query  465  MAATLCAASTVVGLATSSLPRLSSP--NKLFLTSDFLKPAVSARNPLKLPRACMGKFTCF  292
            MA T+ AASTV+GL +SSL    S    +  L S F+K  V+ RNPL   +AC GKFTCF
Sbjct  1    MATTMAAASTVIGLGSSSLSPTRSSSSKRTHLASGFVKAPVAPRNPLMQAKACGGKFTCF  60

Query  291  ERDWLRRDLNVIGFGLIGWIAPSSVPLINGKSLTGLFFDSIGTELSHWPTGPALTSQFWL  112
            ERDWLR DLNVIGFGLI W+APSS+P I+G SLTGLFF SIGTELSH+PTGPALTS FWL
Sbjct  61   ERDWLRTDLNVIGFGLIAWLAPSSIPAIDGNSLTGLFFSSIGTELSHFPTGPALTSPFWL  120

Query  111  WLVCWHLGLFLCLTFGQIGFKGRTEDYF  28
            W+V WHLGLFLCLTFGQIGFKGRTEDYF
Sbjct  121  WMVTWHLGLFLCLTFGQIGFKGRTEDYF  148



>ref|XP_008784066.1| PREDICTED: uncharacterized protein LOC103703121 [Phoenix dactylifera]
Length=147

 Score =   206 bits (524),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 101/147 (69%), Positives = 114/147 (78%), Gaps = 1/147 (1%)
 Frame = -3

Query  465  MAATLCAASTVVGLATS-SLPRLSSPNKLFLTSDFLKPAVSARNPLKLPRACMGKFTCFE  289
            MAA    +S   GL +   L R  S     +TS F++P V+++NPL L  A  G+FTCFE
Sbjct  1    MAAMATTSSVAAGLGSPLPLVRRRSSKPTLITSGFIRPQVASKNPLNLNLASGGRFTCFE  60

Query  288  RDWLRRDLNVIGFGLIGWIAPSSVPLINGKSLTGLFFDSIGTELSHWPTGPALTSQFWLW  109
            RDWLR DLNVIGFGLIGW+APSSVP ING SLTGLFF SIG EL+HWPTGPALTSQFWLW
Sbjct  61   RDWLRTDLNVIGFGLIGWLAPSSVPAINGNSLTGLFFQSIGAELAHWPTGPALTSQFWLW  120

Query  108  LVCWHLGLFLCLTFGQIGFKGRTEDYF  28
            +V WHLGLFLCLTFGQIGFKGRT+ YF
Sbjct  121  MVLWHLGLFLCLTFGQIGFKGRTDQYF  147



>ref|XP_008463649.1| PREDICTED: uncharacterized protein LOC103501744 [Cucumis melo]
Length=146

 Score =   205 bits (521),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 105/144 (73%), Positives = 121/144 (84%), Gaps = 1/144 (1%)
 Frame = -3

Query  459  ATLCAASTVVGLATSSLPRLSSPNKLFLTSDFLKPAVSARNPLKLPRACMGKFTCFERDW  280
            AT  A S+V GL T+SL   SS +   + S F+K  V+ARNPL + RA  G+FTCFERDW
Sbjct  2    ATAFATSSVAGLGTASLSSPSSRSPRLV-SGFIKSPVAARNPLNVGRASRGRFTCFERDW  60

Query  279  LRRDLNVIGFGLIGWIAPSSVPLINGKSLTGLFFDSIGTELSHWPTGPALTSQFWLWLVC  100
            LRRDLNVIGFGLIGWIAPSS+P+INGKSLTGLFF+SIGTEL+H+P+ PALTSQFWLWL+ 
Sbjct  61   LRRDLNVIGFGLIGWIAPSSIPVINGKSLTGLFFESIGTELAHFPSPPALTSQFWLWLIT  120

Query  99   WHLGLFLCLTFGQIGFKGRTEDYF  28
            WHLGLF+ LTFGQIGFKGRTEDYF
Sbjct  121  WHLGLFITLTFGQIGFKGRTEDYF  144



>ref|XP_008229763.1| PREDICTED: uncharacterized protein LOC103329109 [Prunus mume]
Length=142

 Score =   203 bits (516),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 102/147 (69%), Positives = 122/147 (83%), Gaps = 6/147 (4%)
 Frame = -3

Query  465  MAATLCAASTVVGLATSSLPRLSSPNKLFLTSDFLKPAVSARNPLKLPRACMGKFTC-FE  289
            MAA +  ASTV+GL++SSL    SP +  L+S F+KP  +  NPL+  RA  G+FTC F+
Sbjct  1    MAANMATASTVIGLSSSSL----SPKRTCLSSGFVKP-TAVGNPLRQARASGGRFTCNFQ  55

Query  288  RDWLRRDLNVIGFGLIGWIAPSSVPLINGKSLTGLFFDSIGTELSHWPTGPALTSQFWLW  109
            RDWLRRDLNVIGFGLIGW+ PSS+P I+GKSLTGLFF+SIGTEL+H+P+ PALTSQFWLW
Sbjct  56   RDWLRRDLNVIGFGLIGWLVPSSIPAIDGKSLTGLFFESIGTELAHFPSPPALTSQFWLW  115

Query  108  LVCWHLGLFLCLTFGQIGFKGRTEDYF  28
            L+ WHLGLF+ LTFGQIGFKGRTEDYF
Sbjct  116  LITWHLGLFITLTFGQIGFKGRTEDYF  142



>ref|XP_009403671.1| PREDICTED: photosystem I subunit O isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=142

 Score =   203 bits (516),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 108/147 (73%), Positives = 118/147 (80%), Gaps = 7/147 (5%)
 Frame = -3

Query  465  MAATLCAASTVVGLATS-SLPRLSSPNKLFLTSDFLKPAVSARNPLKLPRACMGKFTCFE  289
            MAAT C    V GL +  SL R SS  K  L S F+    +ARNPLKL  A  G+FTCFE
Sbjct  1    MAATSC----VAGLGSPLSLARPSS--KPSLASGFIGTRGAARNPLKLKLASGGRFTCFE  54

Query  288  RDWLRRDLNVIGFGLIGWIAPSSVPLINGKSLTGLFFDSIGTELSHWPTGPALTSQFWLW  109
            R+WLR DLNVIGFGLIGW+APSS+P I GKSLTGLFF+SIGTEL+HWPTGPALTSQFWLW
Sbjct  55   RNWLRTDLNVIGFGLIGWLAPSSIPAIGGKSLTGLFFESIGTELAHWPTGPALTSQFWLW  114

Query  108  LVCWHLGLFLCLTFGQIGFKGRTEDYF  28
            +V WHLGLFLCLTFGQIGFKGRTEDYF
Sbjct  115  MVTWHLGLFLCLTFGQIGFKGRTEDYF  141



>ref|XP_010045182.1| PREDICTED: photosystem I subunit O [Eucalyptus grandis]
 gb|KCW87338.1| hypothetical protein EUGRSUZ_B03824 [Eucalyptus grandis]
Length=142

 Score =   203 bits (516),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 101/146 (69%), Positives = 120/146 (82%), Gaps = 4/146 (3%)
 Frame = -3

Query  465  MAATLCAASTVVGLATSSLPRLSSPNKLFLTSDFLKPAVSARNPLKLPRACMGKFTCFER  286
            MAA++ A S+V+GL +S+L   +SP K  L SDF++  V ARNP+K  RA  G+FTCF+R
Sbjct  1    MAASM-ATSSVIGLGSSAL---TSPKKASLVSDFVRSPVRARNPMKPVRASGGRFTCFQR  56

Query  285  DWLRRDLNVIGFGLIGWIAPSSVPLINGKSLTGLFFDSIGTELSHWPTGPALTSQFWLWL  106
            DWLR D +VIGFGLIGW+APSSVP I+GKSLTGLFF+SIG EL+H+PT P L S FWLWL
Sbjct  57   DWLRADYSVIGFGLIGWLAPSSVPAIDGKSLTGLFFESIGNELAHFPTPPPLASPFWLWL  116

Query  105  VCWHLGLFLCLTFGQIGFKGRTEDYF  28
            + WHLGLFLCLTFGQIGFKGRTEDYF
Sbjct  117  ITWHLGLFLCLTFGQIGFKGRTEDYF  142



>gb|KHG06613.1| DNA mismatch repair mutL [Gossypium arboreum]
Length=145

 Score =   202 bits (515),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 104/146 (71%), Positives = 116/146 (79%), Gaps = 3/146 (2%)
 Frame = -3

Query  465  MAATLCAASTVVGLATSSLPRLSSPNKLFLTSDFLKPAVSARNPLKLPRACMGKFTCFER  286
            MAAT  + STVVGL  ++    S P K  L+S FLK  V+ARNPL+L  AC G F   ER
Sbjct  1    MAATFVSPSTVVGLGGTATCMSSPPMKTRLSSGFLKSGVTARNPLRLAGACGGNF---ER  57

Query  285  DWLRRDLNVIGFGLIGWIAPSSVPLINGKSLTGLFFDSIGTELSHWPTGPALTSQFWLWL  106
            DWLRRD NVIGFGLIGWIAPSS+P I+GKSLTGLFF+SIGTEL+H+PT P LTSQFWLWL
Sbjct  58   DWLRRDFNVIGFGLIGWIAPSSIPAIDGKSLTGLFFESIGTELAHFPTPPPLTSQFWLWL  117

Query  105  VCWHLGLFLCLTFGQIGFKGRTEDYF  28
            V WHLGLF+ LTFGQIGFKGR EDYF
Sbjct  118  VLWHLGLFITLTFGQIGFKGRNEDYF  143



>ref|XP_004139499.1| PREDICTED: uncharacterized protein LOC101209111 [Cucumis sativus]
 gb|KGN64958.1| hypothetical protein Csa_1G168350 [Cucumis sativus]
Length=146

 Score =   202 bits (514),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 104/144 (72%), Positives = 120/144 (83%), Gaps = 1/144 (1%)
 Frame = -3

Query  459  ATLCAASTVVGLATSSLPRLSSPNKLFLTSDFLKPAVSARNPLKLPRACMGKFTCFERDW  280
            AT  A S+V GL T+SL   SS +   + S F+KP V+ARNPL +  A  GKFTCFERDW
Sbjct  2    ATAFATSSVAGLGTASLSSPSSRSPRLV-SGFIKPPVAARNPLSVAGASGGKFTCFERDW  60

Query  279  LRRDLNVIGFGLIGWIAPSSVPLINGKSLTGLFFDSIGTELSHWPTGPALTSQFWLWLVC  100
            LRRDLNVIGFGLIGWIAPSS+P+I+GKSLTGLFF+SIG EL+H+P+ PALTSQFWLWL+ 
Sbjct  61   LRRDLNVIGFGLIGWIAPSSIPVISGKSLTGLFFESIGAELAHFPSPPALTSQFWLWLIT  120

Query  99   WHLGLFLCLTFGQIGFKGRTEDYF  28
            WHLGLF+ LTFGQIGFKGRTEDYF
Sbjct  121  WHLGLFITLTFGQIGFKGRTEDYF  144



>emb|CDY31154.1| BnaA08g27040D [Brassica napus]
Length=134

 Score =   201 bits (512),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 97/135 (72%), Positives = 113/135 (84%), Gaps = 3/135 (2%)
 Frame = -3

Query  432  VGLATSSLPRLSSPNKLFLTSDFLKPAVSARNPLKLPRACMGKFTCFERDWLRRDLNVIG  253
            +GL  SS+ R+   N    +S FLKP + A NPL++  A  G+FTCFER+WLRRDLNV+G
Sbjct  1    MGLGGSSVSRI---NTKAFSSSFLKPTLRANNPLRVAGASGGRFTCFERNWLRRDLNVVG  57

Query  252  FGLIGWIAPSSVPLINGKSLTGLFFDSIGTELSHWPTGPALTSQFWLWLVCWHLGLFLCL  73
            FGLIGW+APSS+P INGKSLTGLFF+SIG EL+H+PT PALTSQFWLWLV WHLGLF+CL
Sbjct  58   FGLIGWLAPSSIPAINGKSLTGLFFESIGNELAHFPTPPALTSQFWLWLVTWHLGLFICL  117

Query  72   TFGQIGFKGRTEDYF  28
            TFGQIGFKGRTEDYF
Sbjct  118  TFGQIGFKGRTEDYF  132



>emb|CAN83522.1| hypothetical protein VITISV_019056 [Vitis vinifera]
Length=144

 Score =   201 bits (512),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 104/144 (72%), Positives = 117/144 (81%), Gaps = 2/144 (1%)
 Frame = -3

Query  453  LCAASTVVGLATSSLPRLSSP--NKLFLTSDFLKPAVSARNPLKLPRACMGKFTCFERDW  280
            + AASTV+GL +SSL    S    +  L S F+K  V+ RNPL+  +AC GKFTCFERDW
Sbjct  1    MAAASTVIGLGSSSLSPARSSSSKRTHLASGFVKAPVAPRNPLRQAKACGGKFTCFERDW  60

Query  279  LRRDLNVIGFGLIGWIAPSSVPLINGKSLTGLFFDSIGTELSHWPTGPALTSQFWLWLVC  100
            LR DLNVIGFGLI W+APSS+P I+G SLTGLFF SIGTELSH+PTGPALTS FWLW+V 
Sbjct  61   LRTDLNVIGFGLIAWLAPSSIPAIDGNSLTGLFFSSIGTELSHFPTGPALTSPFWLWMVT  120

Query  99   WHLGLFLCLTFGQIGFKGRTEDYF  28
            WHLGLFLCLTFGQIGFKGRTEDYF
Sbjct  121  WHLGLFLCLTFGQIGFKGRTEDYF  144



>ref|XP_006417697.1| hypothetical protein EUTSA_v10009047mg [Eutrema salsugineum]
 ref|XP_006417698.1| hypothetical protein EUTSA_v10009047mg [Eutrema salsugineum]
 gb|ESQ36050.1| hypothetical protein EUTSA_v10009047mg [Eutrema salsugineum]
 gb|ESQ36051.1| hypothetical protein EUTSA_v10009047mg [Eutrema salsugineum]
Length=119

 Score =   199 bits (506),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 94/113 (83%), Positives = 104/113 (92%), Gaps = 0/113 (0%)
 Frame = -3

Query  366  FLKPAVSARNPLKLPRACMGKFTCFERDWLRRDLNVIGFGLIGWIAPSSVPLINGKSLTG  187
            FLKP + A+NPL+L  A  G+FTCFER+WLRRDLNV+GFGLIGW+APSS+P INGKSLTG
Sbjct  5    FLKPTLRAKNPLRLAGASGGRFTCFERNWLRRDLNVVGFGLIGWLAPSSIPAINGKSLTG  64

Query  186  LFFDSIGTELSHWPTGPALTSQFWLWLVCWHLGLFLCLTFGQIGFKGRTEDYF  28
            LFFDSIGTEL+H+PT PALTSQFWLWLV WHLGLFLCLTFGQIGFKGRTEDYF
Sbjct  65   LFFDSIGTELAHFPTPPALTSQFWLWLVTWHLGLFLCLTFGQIGFKGRTEDYF  117



>gb|AGU28452.1| photosystem I subunit O (chloroplast) [Sinapis alba]
Length=144

 Score =   200 bits (508),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 98/146 (67%), Positives = 119/146 (82%), Gaps = 4/146 (3%)
 Frame = -3

Query  465  MAATLCAASTVVGLATSSLPRLSSPNKLFLTSDFLKPAVSARNPLKLPRACMGKFTCFER  286
            MAAT  A STV+GL  SS+  + +     L+S F+KP + A+NPL++  A  G+FTCFER
Sbjct  1    MAATFAAPSTVIGLGGSSVSPIKAKA---LSSSFIKPTLRAKNPLRVAGASGGRFTCFER  57

Query  285  DWLRRDLNVIGFGLIGWIAPSSVPLINGKSLTGLFFDSIGTELSHWPTGPALTSQFWLWL  106
            +WLRRDLNV+    IGW+APSS+P I+GKSLTGLFF+SIGTEL+H+PT PALTSQFWLWL
Sbjct  58   NWLRRDLNVVVLA-IGWLAPSSIPAIDGKSLTGLFFESIGTELAHFPTPPALTSQFWLWL  116

Query  105  VCWHLGLFLCLTFGQIGFKGRTEDYF  28
            + WHLGLF+CLTFGQIGFKGRTEDYF
Sbjct  117  ITWHLGLFICLTFGQIGFKGRTEDYF  142



>gb|AEQ39072.1| putative chloroplast photosystem I subunit O [Wolffia arrhiza]
Length=143

 Score =   200 bits (508),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 96/144 (67%), Positives = 113/144 (78%), Gaps = 2/144 (1%)
 Frame = -3

Query  459  ATLCAASTVVGLATSSLPRLSSPNKLFLTSDFLKPAVSARNPLKLPRACMGKFTCFERDW  280
            A +  ++TV GL  + L R  S  KL L+S F+K   SARNPL    +  G+FTCFER+W
Sbjct  2    AAMATSATVAGLGAAPLSR--SSGKLLLSSGFVKSQSSARNPLSQRLSSGGRFTCFERNW  59

Query  279  LRRDLNVIGFGLIGWIAPSSVPLINGKSLTGLFFDSIGTELSHWPTGPALTSQFWLWLVC  100
            LRRD NVIGFGLIGWIAPSS+P ING SLTGLFFDSIG EL+H+PTGPAL+S FWLW++ 
Sbjct  60   LRRDFNVIGFGLIGWIAPSSIPAINGNSLTGLFFDSIGKELAHFPTGPALSSPFWLWMIT  119

Query  99   WHLGLFLCLTFGQIGFKGRTEDYF  28
            WHLGLFL LTFGQIGF+GR E+YF
Sbjct  120  WHLGLFLALTFGQIGFQGRKEEYF  143



>gb|ADB77878.1| chloroplast photosystem I subunit O [Wolffia arrhiza]
Length=143

 Score =   199 bits (506),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 96/144 (67%), Positives = 112/144 (78%), Gaps = 2/144 (1%)
 Frame = -3

Query  459  ATLCAASTVVGLATSSLPRLSSPNKLFLTSDFLKPAVSARNPLKLPRACMGKFTCFERDW  280
            A +  ++TV GL  + L R S   KL L+S F KP  SARNP     +  G+FTCFER+W
Sbjct  2    AAMATSATVAGLGAAPLSRPS--GKLLLSSGFAKPQSSARNPFSQRLSSGGRFTCFERNW  59

Query  279  LRRDLNVIGFGLIGWIAPSSVPLINGKSLTGLFFDSIGTELSHWPTGPALTSQFWLWLVC  100
            LRRD NVIGFGLIGWIAPSS+P ING SLTGLFFDSIG EL+H+PTGPAL+S FWLW++ 
Sbjct  60   LRRDFNVIGFGLIGWIAPSSIPAINGNSLTGLFFDSIGKELAHFPTGPALSSPFWLWMIT  119

Query  99   WHLGLFLCLTFGQIGFKGRTEDYF  28
            WHLGLFL LTFGQIGF+GR E+YF
Sbjct  120  WHLGLFLALTFGQIGFQGRKEEYF  143



>gb|ACZ54009.1| PsaO [Wolffia arrhiza]
Length=143

 Score =   198 bits (504),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 96/144 (67%), Positives = 113/144 (78%), Gaps = 2/144 (1%)
 Frame = -3

Query  459  ATLCAASTVVGLATSSLPRLSSPNKLFLTSDFLKPAVSARNPLKLPRACMGKFTCFERDW  280
            A +  ++TV GL  + L R S   KL L+S F+K   SARNPL    +  G+FTCFER+W
Sbjct  2    AAMATSATVAGLGAAPLSRPS--GKLLLSSGFVKSQSSARNPLSQRLSSGGRFTCFERNW  59

Query  279  LRRDLNVIGFGLIGWIAPSSVPLINGKSLTGLFFDSIGTELSHWPTGPALTSQFWLWLVC  100
            LRRD NVIGFGLIGWIAPSS+P ING SLTGLFFDSIG EL+H+PTGPAL+S FWLW++ 
Sbjct  60   LRRDFNVIGFGLIGWIAPSSIPAINGNSLTGLFFDSIGKELAHFPTGPALSSPFWLWMIT  119

Query  99   WHLGLFLCLTFGQIGFKGRTEDYF  28
            WHLGLFL LTFGQIGF+GR E+YF
Sbjct  120  WHLGLFLALTFGQIGFQGRKEEYF  143



>ref|XP_006424153.1| hypothetical protein CICLE_v10029515mg [Citrus clementina]
 gb|ESR37393.1| hypothetical protein CICLE_v10029515mg [Citrus clementina]
 gb|KDO37000.1| hypothetical protein CISIN_1g032156mg [Citrus sinensis]
 gb|KDO58275.1| hypothetical protein CISIN_1g032153mg [Citrus sinensis]
Length=146

 Score =   198 bits (504),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 95/122 (78%), Positives = 105/122 (86%), Gaps = 0/122 (0%)
 Frame = -3

Query  393  PNKLFLTSDFLKPAVSARNPLKLPRACMGKFTCFERDWLRRDLNVIGFGLIGWIAPSSVP  214
            P +  L S F+K  V+ARNPL++  AC GK TCFERDWLR DLNVIGFGLIGW+APSS+P
Sbjct  23   PKRTALGSSFVKSPVAARNPLRVAGACGGKVTCFERDWLRTDLNVIGFGLIGWLAPSSIP  82

Query  213  LINGKSLTGLFFDSIGTELSHWPTGPALTSQFWLWLVCWHLGLFLCLTFGQIGFKGRTED  34
             INGKSLTGLFF+SIGTEL+H+PT P LTSQFWLWLV WH GLFLCLTFGQIGFKGRTED
Sbjct  83   AINGKSLTGLFFESIGTELAHFPTPPPLTSQFWLWLVTWHFGLFLCLTFGQIGFKGRTED  142

Query  33   YF  28
            YF
Sbjct  143  YF  144



>gb|KDP24032.1| hypothetical protein JCGZ_26726 [Jatropha curcas]
Length=148

 Score =   198 bits (503),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 105/148 (71%), Positives = 119/148 (80%), Gaps = 2/148 (1%)
 Frame = -3

Query  465  MAATLCAASTVVGLATSSLPRLSSP--NKLFLTSDFLKPAVSARNPLKLPRACMGKFTCF  292
            MAA    +STV+GL +SSL    S    +  L+S F+K   +ARNPL+   +  GKF CF
Sbjct  1    MAAAFATSSTVIGLGSSSLSSPRSCSCRRTCLSSGFVKSVATARNPLRQAGSNGGKFMCF  60

Query  291  ERDWLRRDLNVIGFGLIGWIAPSSVPLINGKSLTGLFFDSIGTELSHWPTGPALTSQFWL  112
            ERDWLRRDLNVIGFGLIGW+APSS+P INGKSLTGLFF+SIG EL+H+PT PALTSQFWL
Sbjct  61   ERDWLRRDLNVIGFGLIGWLAPSSIPAINGKSLTGLFFESIGAELAHFPTPPALTSQFWL  120

Query  111  WLVCWHLGLFLCLTFGQIGFKGRTEDYF  28
            WLV WHLGLFLCLTFGQIGFKGRTEDYF
Sbjct  121  WLVTWHLGLFLCLTFGQIGFKGRTEDYF  148



>ref|XP_009403670.1| PREDICTED: photosystem I subunit O isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=162

 Score =   197 bits (501),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 107/161 (66%), Positives = 119/161 (74%), Gaps = 15/161 (9%)
 Frame = -3

Query  465  MAATLCAASTVVGLAT---SSLPRLSSPNK---------LFLTSD---FLKPAVSARNPL  331
            MAAT C A     L+    SS P L+S            + LT D   F+    +ARNPL
Sbjct  1    MAATSCVAGLGSPLSLARPSSKPSLASGTTTAHGLSLSWIDLTMDSTGFIGTRGAARNPL  60

Query  330  KLPRACMGKFTCFERDWLRRDLNVIGFGLIGWIAPSSVPLINGKSLTGLFFDSIGTELSH  151
            KL  A  G+FTCFER+WLR DLNVIGFGLIGW+APSS+P I GKSLTGLFF+SIGTEL+H
Sbjct  61   KLKLASGGRFTCFERNWLRTDLNVIGFGLIGWLAPSSIPAIGGKSLTGLFFESIGTELAH  120

Query  150  WPTGPALTSQFWLWLVCWHLGLFLCLTFGQIGFKGRTEDYF  28
            WPTGPALTSQFWLW+V WHLGLFLCLTFGQIGFKGRTEDYF
Sbjct  121  WPTGPALTSQFWLWMVTWHLGLFLCLTFGQIGFKGRTEDYF  161



>ref|XP_002313603.1| hypothetical protein POPTR_0009s16240g [Populus trichocarpa]
 gb|EEE87558.1| hypothetical protein POPTR_0009s16240g [Populus trichocarpa]
Length=149

 Score =   196 bits (497),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 101/149 (68%), Positives = 120/149 (81%), Gaps = 3/149 (2%)
 Frame = -3

Query  465  MAATLCAASTVVGLATSSLPRLSS---PNKLFLTSDFLKPAVSARNPLKLPRACMGKFTC  295
            MAAT  ++S V GL +SSL   S    P K+ L+S F+K  V+AR+PL+L     GKF C
Sbjct  1    MAATFASSSAVTGLGSSSLSSPSRASSPKKICLSSGFVKSPVAARSPLRLAGTHGGKFMC  60

Query  294  FERDWLRRDLNVIGFGLIGWIAPSSVPLINGKSLTGLFFDSIGTELSHWPTGPALTSQFW  115
            FERDWLR+DLNVIGFGLIGW+APSS+P I GKSL+GLFF+SIGTEL+H+PT P LTSQFW
Sbjct  61   FERDWLRKDLNVIGFGLIGWLAPSSIPAIGGKSLSGLFFESIGTELAHFPTPPPLTSQFW  120

Query  114  LWLVCWHLGLFLCLTFGQIGFKGRTEDYF  28
            LWLV WHLGLF+CLT GQIGFKGRT++YF
Sbjct  121  LWLVTWHLGLFICLTLGQIGFKGRTDEYF  149



>ref|XP_006384772.1| hypothetical protein POPTR_0004s20960g [Populus trichocarpa]
 gb|ERP62569.1| hypothetical protein POPTR_0004s20960g [Populus trichocarpa]
Length=151

 Score =   195 bits (495),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 105/149 (70%), Positives = 118/149 (79%), Gaps = 3/149 (2%)
 Frame = -3

Query  465  MAATLCAASTVVGLATSSLPRLSS---PNKLFLTSDFLKPAVSARNPLKLPRACMGKFTC  295
            MAAT  + S VVGL + SL   S    P K+ L+S F+K  V+ARNPL L     GKF C
Sbjct  1    MAATFASPSAVVGLGSGSLSSPSRISSPKKICLSSGFVKSPVTARNPLGLAGTGGGKFMC  60

Query  294  FERDWLRRDLNVIGFGLIGWIAPSSVPLINGKSLTGLFFDSIGTELSHWPTGPALTSQFW  115
            F+ DWLR+DLNVIGFGLIGW+APSSVP I GKSLTGLFF+SIGTEL+H+PT P LTSQFW
Sbjct  61   FQGDWLRKDLNVIGFGLIGWLAPSSVPAIGGKSLTGLFFESIGTELAHFPTPPPLTSQFW  120

Query  114  LWLVCWHLGLFLCLTFGQIGFKGRTEDYF  28
            LWLV WHLGLF+CLTFGQIGFKGRTEDYF
Sbjct  121  LWLVTWHLGLFICLTFGQIGFKGRTEDYF  149



>ref|XP_011006585.1| PREDICTED: photosystem I subunit O-like [Populus euphratica]
Length=151

 Score =   195 bits (495),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 105/149 (70%), Positives = 117/149 (79%), Gaps = 3/149 (2%)
 Frame = -3

Query  465  MAATLCAASTVVGLATSSLPRLSS---PNKLFLTSDFLKPAVSARNPLKLPRACMGKFTC  295
            MAAT  + S VVGL + SL   S    P K+ L S F+K  V+ARNPL L     GKF C
Sbjct  1    MAATFASPSAVVGLGSGSLSSPSRISSPKKICLGSGFVKSPVTARNPLGLAGTGGGKFMC  60

Query  294  FERDWLRRDLNVIGFGLIGWIAPSSVPLINGKSLTGLFFDSIGTELSHWPTGPALTSQFW  115
            F+ DWLR+DLNVIGFGLIGWIAPSS+P I GKSLTGLFF+SIGTEL+H+PT P LTSQFW
Sbjct  61   FQGDWLRKDLNVIGFGLIGWIAPSSIPAIGGKSLTGLFFESIGTELAHFPTPPPLTSQFW  120

Query  114  LWLVCWHLGLFLCLTFGQIGFKGRTEDYF  28
            LWLV WHLGLF+CLTFGQIGFKGRTEDYF
Sbjct  121  LWLVTWHLGLFICLTFGQIGFKGRTEDYF  149



>ref|XP_011459420.1| PREDICTED: photosystem I subunit O [Fragaria vesca subsp. vesca]
Length=141

 Score =   194 bits (492),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 102/148 (69%), Positives = 118/148 (80%), Gaps = 9/148 (6%)
 Frame = -3

Query  465  MAATLCAASTVVGLATSSLPRLSSPNKLFLTSDFLKPAVSARNPLKLPRACMGKFTC--F  292
            MA +   ASTVVGL  SSL + +      L+SDF+KP V  R+PL+  +A   KFTC  F
Sbjct  1    MATSFATASTVVGLG-SSLSKTAC-----LSSDFVKP-VMVRSPLRQAQASRRKFTCMSF  53

Query  291  ERDWLRRDLNVIGFGLIGWIAPSSVPLINGKSLTGLFFDSIGTELSHWPTGPALTSQFWL  112
            + DWLRRDLNVIGFGLIGW+ PSSVP I+GKSLTGLFFDSIGTEL+H+PT PALTSQFWL
Sbjct  54   QSDWLRRDLNVIGFGLIGWLVPSSVPAIDGKSLTGLFFDSIGTELAHFPTPPALTSQFWL  113

Query  111  WLVCWHLGLFLCLTFGQIGFKGRTEDYF  28
            WL+CWHLGLF+ LTFGQIGFKGRT+ YF
Sbjct  114  WLICWHLGLFITLTFGQIGFKGRTDKYF  141



>ref|XP_006846460.1| hypothetical protein AMTR_s00018p00092490 [Amborella trichopoda]
 gb|ERN08135.1| hypothetical protein AMTR_s00018p00092490 [Amborella trichopoda]
Length=143

 Score =   193 bits (491),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 96/143 (67%), Positives = 110/143 (77%), Gaps = 1/143 (1%)
 Frame = -3

Query  459  ATLCAASTVVGLATSSLPRLSSPNKLFLTSDFLKPAVSARNPLKLPRACMGKFTCFERDW  280
            AT    + V GL TSS     +P KL L+S FL    +A NP        G+F+CF+ DW
Sbjct  2    ATNSLITPVAGLGTSSFSPSRNPTKLNLSSGFLSSRATA-NPFSRATRSKGRFSCFKGDW  60

Query  279  LRRDLNVIGFGLIGWIAPSSVPLINGKSLTGLFFDSIGTELSHWPTGPALTSQFWLWLVC  100
            LR DLNVIGFGLIGWIAPSSVP+INGKSLTGLFF+SIG+EL+HWPTGPALTSQFWLW++C
Sbjct  61   LRTDLNVIGFGLIGWIAPSSVPVINGKSLTGLFFESIGSELAHWPTGPALTSQFWLWMIC  120

Query  99   WHLGLFLCLTFGQIGFKGRTEDY  31
            WH GLFLCLTFGQIGFKGR E +
Sbjct  121  WHFGLFLCLTFGQIGFKGRNEYF  143



>gb|ACJ86143.1| unknown [Medicago truncatula]
 gb|AFK39295.1| unknown [Medicago truncatula]
 gb|KEH29824.1| photosystem I subunit O [Medicago truncatula]
Length=138

 Score =   192 bits (489),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 102/148 (69%), Positives = 115/148 (78%), Gaps = 14/148 (9%)
 Frame = -3

Query  465  MAATLCAASTVVGLATSSLPRLSSPNKLFLTSDFLKPAVSARNPLKLPRACM--GKFTCF  292
            MAAT     TV+G+A +S           LTS F+KP V ARNPLK   A    G+ TCF
Sbjct  1    MAAT--TFPTVLGMAGASR----------LTSGFVKPQVIARNPLKQAMALGNGGRVTCF  48

Query  291  ERDWLRRDLNVIGFGLIGWIAPSSVPLINGKSLTGLFFDSIGTELSHWPTGPALTSQFWL  112
            +RDWLRRD NVIGFGLIGW+APSS+P I+GKSLTGLFFDSIGTEL+H+PT PALTS FWL
Sbjct  49   QRDWLRRDFNVIGFGLIGWLAPSSIPAIDGKSLTGLFFDSIGTELAHFPTPPALTSPFWL  108

Query  111  WLVCWHLGLFLCLTFGQIGFKGRTEDYF  28
            WL+CWHLGLF+ LTFGQIGFKGRTEDYF
Sbjct  109  WLICWHLGLFISLTFGQIGFKGRTEDYF  136



>ref|XP_009340874.1| PREDICTED: photosystem I subunit O-like [Pyrus x bretschneideri]
Length=144

 Score =   192 bits (488),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 104/147 (71%), Positives = 121/147 (82%), Gaps = 6/147 (4%)
 Frame = -3

Query  465  MAATLCAASTVVGLATSSLPRLSSPNKLFLTSDFLKPAVSARNPLKLPRACMGKFTC-FE  289
            MAAT+  ASTV+GL +SSL    +     L+S F+KP V   NPL+  RA  G+FTC F+
Sbjct  1    MAATMATASTVMGLRSSSLSPSRTC----LSSAFVKPIVVG-NPLRQVRASGGRFTCSFQ  55

Query  288  RDWLRRDLNVIGFGLIGWIAPSSVPLINGKSLTGLFFDSIGTELSHWPTGPALTSQFWLW  109
            RDWLRRDLNVIGFGLIGW+APSS+PLI+GKSLTGLFF+SIG EL+H+P+ PALTSQFWLW
Sbjct  56   RDWLRRDLNVIGFGLIGWLAPSSIPLIDGKSLTGLFFESIGAELAHFPSPPALTSQFWLW  115

Query  108  LVCWHLGLFLCLTFGQIGFKGRTEDYF  28
            LV WHLGLF+ LTFGQIGFKGRTEDYF
Sbjct  116  LVTWHLGLFITLTFGQIGFKGRTEDYF  142



>ref|XP_004506203.1| PREDICTED: uncharacterized protein LOC101500027 [Cicer arietinum]
Length=136

 Score =   192 bits (487),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 99/148 (67%), Positives = 114/148 (77%), Gaps = 14/148 (9%)
 Frame = -3

Query  465  MAATLCAASTVVGLATSSLPRLSSPNKLFLTSDFLKPAVSARNPLK--LPRACMGKFTCF  292
            MA T  A  TVVG+  +S           L S F+KP V ARN L+  + R   G+ TCF
Sbjct  1    MATTTFA--TVVGMGGASR----------LASGFVKPQVMARNRLRQAMARGNGGRVTCF  48

Query  291  ERDWLRRDLNVIGFGLIGWIAPSSVPLINGKSLTGLFFDSIGTELSHWPTGPALTSQFWL  112
            +RDWLRRD NVIGFGLIGW+APSS+P I+GKSLTGLFFDSIGTEL+H+PT PALTSQFWL
Sbjct  49   QRDWLRRDFNVIGFGLIGWLAPSSIPAIDGKSLTGLFFDSIGTELAHFPTPPALTSQFWL  108

Query  111  WLVCWHLGLFLCLTFGQIGFKGRTEDYF  28
            WL+CWHLGLF+ LTFGQIGFKGRTE+YF
Sbjct  109  WLICWHLGLFISLTFGQIGFKGRTEEYF  136



>ref|XP_009374967.1| PREDICTED: photosystem I subunit O-like [Pyrus x bretschneideri]
Length=144

 Score =   191 bits (485),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 102/147 (69%), Positives = 121/147 (82%), Gaps = 6/147 (4%)
 Frame = -3

Query  465  MAATLCAASTVVGLATSSLPRLSSPNKLFLTSDFLKPAVSARNPLKLPRACMGKFTC-FE  289
            MAAT+  ASTV+GL +SSL    +     ++S F+KP V   NPL+  RA  G+FTC F+
Sbjct  1    MAATMATASTVMGLRSSSLSPSRTC----ISSAFVKPIVVG-NPLRQVRASGGRFTCSFQ  55

Query  288  RDWLRRDLNVIGFGLIGWIAPSSVPLINGKSLTGLFFDSIGTELSHWPTGPALTSQFWLW  109
            RDWLRRDLNVIGFGLIGW+APSS+PLI+GKSLTGLFF+SIG EL+H+P+ PALTSQFWLW
Sbjct  56   RDWLRRDLNVIGFGLIGWLAPSSIPLIDGKSLTGLFFESIGAELAHFPSPPALTSQFWLW  115

Query  108  LVCWHLGLFLCLTFGQIGFKGRTEDYF  28
            L+ WHLGLF+ LTFGQIGFKGRTEDYF
Sbjct  116  LITWHLGLFITLTFGQIGFKGRTEDYF  142



>gb|AFK44563.1| unknown [Lotus japonicus]
Length=141

 Score =   190 bits (482),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 97/140 (69%), Positives = 111/140 (79%), Gaps = 6/140 (4%)
 Frame = -3

Query  441  STVVGLATSSLPRLSSPNKLFLTSDFLKPAVSARNPLKLPRACM--GKFTCFERDWLRRD  268
            +TV GL  +SL    SP    LTSDF+K  VSARNPL+   A    G+  CFER+WLR D
Sbjct  6    ATVAGLGGASL----SPASSRLTSDFVKSPVSARNPLRQAVAMGNGGRVKCFERNWLRTD  61

Query  267  LNVIGFGLIGWIAPSSVPLINGKSLTGLFFDSIGTELSHWPTGPALTSQFWLWLVCWHLG  88
             NVIGFGLIGWIAPSS+P I+GKSLTGLFFDSIGTEL+H+P+ PAL SQFWLWLV WHLG
Sbjct  62   FNVIGFGLIGWIAPSSIPAIDGKSLTGLFFDSIGTELAHFPSPPALDSQFWLWLVTWHLG  121

Query  87   LFLCLTFGQIGFKGRTEDYF  28
            LF+ LTFGQIGFKGRT++YF
Sbjct  122  LFIVLTFGQIGFKGRTDEYF  141



>gb|AEC10974.1| 16kda membrane protein [Camellia sinensis]
Length=150

 Score =   189 bits (481),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 103/139 (74%), Positives = 107/139 (77%), Gaps = 3/139 (2%)
 Frame = -3

Query  435  VVGLATSSLPRLSS---PNKLFLTSDFLKPAVSARNPLKLPRACMGKFTCFERDWLRRDL  265
            VVGL TSSL   S    P    L S FLK  V  RNPL    A  GKFTCFERDWLR DL
Sbjct  12   VVGLGTSSLSLSSRVSSPKTTSLNSAFLKSPVRVRNPLVQAHASGGKFTCFERDWLRTDL  71

Query  264  NVIGFGLIGWIAPSSVPLINGKSLTGLFFDSIGTELSHWPTGPALTSQFWLWLVCWHLGL  85
            NVIGFGLIGW+APSSVP ING SLTGLFF SIGTELSH+PTGPAL S FWLW+VC HLGL
Sbjct  72   NVIGFGLIGWLAPSSVPAINGNSLTGLFFSSIGTELSHFPTGPALDSPFWLWMVCCHLGL  131

Query  84   FLCLTFGQIGFKGRTEDYF  28
            FLCLTFGQIG KGRTE+YF
Sbjct  132  FLCLTFGQIGIKGRTEEYF  150



>gb|ADH43621.1| sex-linked protein 9 [Silene latifolia]
Length=148

 Score =   189 bits (480),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 100/141 (71%), Positives = 115/141 (82%), Gaps = 7/141 (5%)
 Frame = -3

Query  438  TVVGLATSSLPRLSSPNKLFLTSDFLKPAVSARNPLKLPRACM---GKFTC-FERDWLRR  271
            TVVGL TS+L R S      L+S FLK  V+A NPL+  +AC    G+FTC F+RDWLRR
Sbjct  11   TVVGLGTSTLSR-SYAKSTTLSSGFLKLKVAAVNPLR--QACGTSGGRFTCSFQRDWLRR  67

Query  270  DLNVIGFGLIGWIAPSSVPLINGKSLTGLFFDSIGTELSHWPTGPALTSQFWLWLVCWHL  91
            DLNVIGFGLIGW+APSS+P I+G SL+GLFF SIG EL+H+PT PA+TSQFWLWLV WHL
Sbjct  68   DLNVIGFGLIGWLAPSSIPAIDGNSLSGLFFSSIGEELAHFPTPPAVTSQFWLWLVLWHL  127

Query  90   GLFLCLTFGQIGFKGRTEDYF  28
            GLFLCLTFGQIGFKGRTE+YF
Sbjct  128  GLFLCLTFGQIGFKGRTEEYF  148



>gb|EYU28533.1| hypothetical protein MIMGU_mgv1a023828mg, partial [Erythranthe 
guttata]
Length=113

 Score =   187 bits (475),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 90/113 (80%), Positives = 100/113 (88%), Gaps = 0/113 (0%)
 Frame = -3

Query  366  FLKPAVSARNPLKLPRACMGKFTCFERDWLRRDLNVIGFGLIGWIAPSSVPLINGKSLTG  187
            FLK  V+ARNPLKL +A  GK TCF+RDWLRRDLNVIGFGLIGWIAPSS+P I+G SL+G
Sbjct  1    FLKSPVAARNPLKLAQASGGKSTCFQRDWLRRDLNVIGFGLIGWIAPSSIPAIDGNSLSG  60

Query  186  LFFDSIGTELSHWPTGPALTSQFWLWLVCWHLGLFLCLTFGQIGFKGRTEDYF  28
            LFF SIGTEL+H+PT PALTS FWLWLV WHLGLF+ LTFGQIGFKGRTE+YF
Sbjct  61   LFFSSIGTELAHFPTPPALTSSFWLWLVLWHLGLFVTLTFGQIGFKGRTEEYF  113



>gb|AFK38505.1| unknown [Medicago truncatula]
 gb|KEH29825.1| photosystem I subunit O [Medicago truncatula]
Length=139

 Score =   188 bits (477),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 102/149 (68%), Positives = 115/149 (77%), Gaps = 15/149 (10%)
 Frame = -3

Query  465  MAATLCAASTVVGLATSSLPRLSSPNKLFLTSDFLKPAVSARNPLKLPRACM--GKFTC-  295
            MAAT     TV+G+A +S           LTS F+KP V ARNPLK   A    G+ TC 
Sbjct  1    MAAT--TFPTVLGMAGASR----------LTSGFVKPQVIARNPLKQAMALGNGGRVTCS  48

Query  294  FERDWLRRDLNVIGFGLIGWIAPSSVPLINGKSLTGLFFDSIGTELSHWPTGPALTSQFW  115
            F+RDWLRRD NVIGFGLIGW+APSS+P I+GKSLTGLFFDSIGTEL+H+PT PALTS FW
Sbjct  49   FQRDWLRRDFNVIGFGLIGWLAPSSIPAIDGKSLTGLFFDSIGTELAHFPTPPALTSPFW  108

Query  114  LWLVCWHLGLFLCLTFGQIGFKGRTEDYF  28
            LWL+CWHLGLF+ LTFGQIGFKGRTEDYF
Sbjct  109  LWLICWHLGLFISLTFGQIGFKGRTEDYF  137



>ref|XP_007132467.1| hypothetical protein PHAVU_011G096400g [Phaseolus vulgaris]
 gb|ESW04461.1| hypothetical protein PHAVU_011G096400g [Phaseolus vulgaris]
Length=141

 Score =   186 bits (473),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 94/140 (67%), Positives = 111/140 (79%), Gaps = 6/140 (4%)
 Frame = -3

Query  441  STVVGLATSSLPRLSSPNKLFLTSDFLKPAVSARNPLK--LPRACMGKFTCFERDWLRRD  268
            +TV GL  +SL   +S     LTS F++  VSARNPL+  +     G+ TCF+R+WLR D
Sbjct  6    ATVAGLGGASLGSTASR----LTSGFVRSPVSARNPLRQGVAMGNGGRVTCFQRNWLRAD  61

Query  267  LNVIGFGLIGWIAPSSVPLINGKSLTGLFFDSIGTELSHWPTGPALTSQFWLWLVCWHLG  88
             +VIGFGLIGW+APSS+P I GKSLTGLFF+SIG EL+H+PT PA+TSQFWLWLV WHLG
Sbjct  62   YSVIGFGLIGWLAPSSIPAIGGKSLTGLFFESIGAELAHFPTPPAVTSQFWLWLVTWHLG  121

Query  87   LFLCLTFGQIGFKGRTEDYF  28
            LFLCLTFGQIGFKGRTEDYF
Sbjct  122  LFLCLTFGQIGFKGRTEDYF  141



>gb|ADI45844.1| sex-linked protein 9 [Silene vulgaris]
Length=143

 Score =   186 bits (472),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 97/144 (67%), Positives = 115/144 (80%), Gaps = 3/144 (2%)
 Frame = -3

Query  462  AATLCAASTVVGLATSSLPRLSSPNKLFLTSDFLKPAVSARNPLKLPRACMG-KFTC-FE  289
            A++  A++TVVGL TS++ R S      L+S FLK  V+A NPL+      G +FTC F+
Sbjct  1    ASSFAASATVVGLGTSTISR-SYAKSTPLSSGFLKSKVAAVNPLRQAWGTSGGRFTCSFQ  59

Query  288  RDWLRRDLNVIGFGLIGWIAPSSVPLINGKSLTGLFFDSIGTELSHWPTGPALTSQFWLW  109
            RDWLRRDLNVIGFGLIGW+APSS+P I+G SL+GLFF SIG EL+H+PT PA+TSQFWLW
Sbjct  60   RDWLRRDLNVIGFGLIGWLAPSSIPAIDGNSLSGLFFSSIGEELAHFPTPPAVTSQFWLW  119

Query  108  LVCWHLGLFLCLTFGQIGFKGRTE  37
            LV WHLGLFLCLTFGQIGFKGRTE
Sbjct  120  LVLWHLGLFLCLTFGQIGFKGRTE  143



>ref|XP_006481510.1| PREDICTED: uncharacterized protein LOC102626023 [Citrus sinensis]
Length=151

 Score =   184 bits (466),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 91/127 (72%), Positives = 101/127 (80%), Gaps = 5/127 (4%)
 Frame = -3

Query  393  PNKLFLTSDFLKPAVSARNPLKLPRACMGKFTCFERDWLRRDLNVIGFGLIGWIAPSSVP  214
            P +  L S F+K  V+ARNPL++  AC GK TCFERDWLR DLNVIGFGLIGW+APSS+P
Sbjct  23   PKRTALGSSFVKSPVAARNPLRVAGACGGKVTCFERDWLRTDLNVIGFGLIGWLAPSSIP  82

Query  213  LINGKSLTGLFFDSI-----GTELSHWPTGPALTSQFWLWLVCWHLGLFLCLTFGQIGFK  49
             INGKSLTGLFF+SI     G  +  +PT P LTSQFWLWLV WH GLFLCLTFGQIGFK
Sbjct  83   AINGKSLTGLFFESIGYGQGGCTVQQFPTPPPLTSQFWLWLVTWHFGLFLCLTFGQIGFK  142

Query  48   GRTEDYF  28
            GRTEDYF
Sbjct  143  GRTEDYF  149



>ref|XP_003579709.1| PREDICTED: photosystem I subunit O [Brachypodium distachyon]
Length=144

 Score =   182 bits (462),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 100/146 (68%), Positives = 111/146 (76%), Gaps = 11/146 (8%)
 Frame = -3

Query  450  CAASTVVGLATSSLPRLSSPNKLFLTSDFLKPAVSARNPL---KLPRACMGKFTC--FER  286
             AASTV GLA ++L R  + +  F T       VSARNPL    L R   G+ TC  F R
Sbjct  3    AAASTVSGLAGATLARRPAFSTNFTTGG----RVSARNPLMTRNLERN--GRITCMTFPR  56

Query  285  DWLRRDLNVIGFGLIGWIAPSSVPLINGKSLTGLFFDSIGTELSHWPTGPALTSQFWLWL  106
            DWLRRDLNVIGFGLIGW+APSS+PLING SLTGLFF SIG EL+H+P+ PALTSQFWLWL
Sbjct  57   DWLRRDLNVIGFGLIGWLAPSSIPLINGNSLTGLFFSSIGEELAHFPSPPALTSQFWLWL  116

Query  105  VCWHLGLFLCLTFGQIGFKGRTEDYF  28
            V WHLGLF+ LTFGQIGFKGRTEDYF
Sbjct  117  VTWHLGLFIALTFGQIGFKGRTEDYF  142



>gb|ABK25454.1| unknown [Picea sitchensis]
 gb|ABR17159.1| unknown [Picea sitchensis]
Length=152

 Score =   180 bits (457),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 91/145 (63%), Positives = 107/145 (74%), Gaps = 1/145 (1%)
 Frame = -3

Query  462  AATLCAASTVVGLATSSLPRLSSPNKLFLTSDFLK-PAVSARNPLKLPRACMGKFTCFER  286
            AA +  +S V GL TSSL       KL L+S F     V   NPL+       + TCF+R
Sbjct  8    AANVTLSSPVAGLGTSSLSPSKPNAKLQLSSGFTGCTTVRGNNPLRQKGLWASRITCFQR  67

Query  285  DWLRRDLNVIGFGLIGWIAPSSVPLINGKSLTGLFFDSIGTELSHWPTGPALTSQFWLWL  106
            +WLR D +VIGFGLIGWIAPSS+P+ING SLTGLFF SIG EL+HWPTGP+LTS FWLW+
Sbjct  68   NWLRTDYSVIGFGLIGWIAPSSLPVINGDSLTGLFFKSIGDELAHWPTGPSLTSSFWLWM  127

Query  105  VCWHLGLFLCLTFGQIGFKGRTEDY  31
            +CWHLGLFLCLTFGQIGFKGR+E +
Sbjct  128  ICWHLGLFLCLTFGQIGFKGRSEYF  152



>gb|KHN21168.1| hypothetical protein glysoja_006647 [Glycine soja]
Length=140

 Score =   180 bits (456),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 87/114 (76%), Positives = 98/114 (86%), Gaps = 1/114 (1%)
 Frame = -3

Query  366  FLKPAVSARNPLKLPRAC-MGKFTCFERDWLRRDLNVIGFGLIGWIAPSSVPLINGKSLT  190
            F+K  VSARNPL+   A   G+ TCFER+WLR D +VIGFGLIGW+APSSVP INGKSLT
Sbjct  27   FVKSPVSARNPLRQAVAMGNGRVTCFERNWLRADYSVIGFGLIGWLAPSSVPAINGKSLT  86

Query  189  GLFFDSIGTELSHWPTGPALTSQFWLWLVCWHLGLFLCLTFGQIGFKGRTEDYF  28
            GLFF+SIG EL+H+PT PALTS FWLWLV WHLGLF+CLTFGQIGFKGRTE+YF
Sbjct  87   GLFFESIGAELAHFPTPPALTSSFWLWLVTWHLGLFICLTFGQIGFKGRTEEYF  140



>gb|ABG75753.1| salt stress-responsive protein [Triticum aestivum]
Length=145

 Score =   179 bits (455),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 102/151 (68%), Positives = 113/151 (75%), Gaps = 13/151 (9%)
 Frame = -3

Query  465  MAATLCAASTVVGLATSSLPRLSSPNKLFLTSDFLKPAVSARNPL---KLPRACMGKFTC  295
            MAA   A+STV GLA ++L R  +    F TS      VSARNPL    L R   G+ TC
Sbjct  1    MAA--AASSTVSGLAGAALARRPA----FSTSFTSGGRVSARNPLMTRNLERN--GRITC  52

Query  294  --FERDWLRRDLNVIGFGLIGWIAPSSVPLINGKSLTGLFFDSIGTELSHWPTGPALTSQ  121
              F RDWLRRDLNVIGFGLIGW+APSS+PLING SLTGLFF SIG EL+H+P+ PAL SQ
Sbjct  53   MTFPRDWLRRDLNVIGFGLIGWLAPSSIPLINGNSLTGLFFSSIGEELAHFPSPPALQSQ  112

Query  120  FWLWLVCWHLGLFLCLTFGQIGFKGRTEDYF  28
            FWLWLV WHLGLF+ LTFGQIGFKGRTEDYF
Sbjct  113  FWLWLVTWHLGLFIALTFGQIGFKGRTEDYF  143



>ref|XP_006592347.1| PREDICTED: uncharacterized protein LOC100809697 [Glycine max]
Length=128

 Score =   179 bits (453),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 88/118 (75%), Positives = 100/118 (85%), Gaps = 1/118 (1%)
 Frame = -3

Query  378  LTSDFLKPAVSARNPLKLPRAC-MGKFTCFERDWLRRDLNVIGFGLIGWIAPSSVPLING  202
            L + F+K  VSARNPL+   A   G+ TCFER+WLR D +VIGFGLIGW+APSSVP ING
Sbjct  11   LFAGFVKSPVSARNPLRKAVAMGNGRVTCFERNWLRADYSVIGFGLIGWLAPSSVPAING  70

Query  201  KSLTGLFFDSIGTELSHWPTGPALTSQFWLWLVCWHLGLFLCLTFGQIGFKGRTEDYF  28
            KSLTGLFF+SIG EL+H+PT PALTS FWLWLV WHLGLF+CLTFGQIGFKGRTE+YF
Sbjct  71   KSLTGLFFESIGAELAHFPTPPALTSSFWLWLVTWHLGLFICLTFGQIGFKGRTEEYF  128



>gb|ABB90549.1| putative membrane protein [Triticum aestivum]
Length=144

 Score =   179 bits (454),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 99/146 (68%), Positives = 109/146 (75%), Gaps = 11/146 (8%)
 Frame = -3

Query  450  CAASTVVGLATSSLPRLSSPNKLFLTSDFLKPAVSARNPL---KLPRACMGKFTC--FER  286
             A STV GLA ++L R  +    F TS      VSARNPL    L R   G+ TC  F R
Sbjct  3    AATSTVSGLAGAALTRRPA----FSTSFTSGARVSARNPLMTRNLERN--GRITCMTFPR  56

Query  285  DWLRRDLNVIGFGLIGWIAPSSVPLINGKSLTGLFFDSIGTELSHWPTGPALTSQFWLWL  106
            DWLRRDLNVIGFGLIGW+APSS+PLING SLTGLFF SIG EL+H+P+ PAL SQFWLWL
Sbjct  57   DWLRRDLNVIGFGLIGWLAPSSIPLINGNSLTGLFFSSIGEELAHFPSPPALQSQFWLWL  116

Query  105  VCWHLGLFLCLTFGQIGFKGRTEDYF  28
            V WHLGLF+ LTFGQIGFKGRTEDYF
Sbjct  117  VTWHLGLFIALTFGQIGFKGRTEDYF  142



>dbj|BAJ90625.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=144

 Score =   179 bits (453),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 99/146 (68%), Positives = 109/146 (75%), Gaps = 11/146 (8%)
 Frame = -3

Query  450  CAASTVVGLATSSLPRLSSPNKLFLTSDFLKPAVSARNPL---KLPRACMGKFTC--FER  286
             A STV GLA ++L R  +    F TS      VSARNPL    L R   G+ TC  F R
Sbjct  3    TATSTVYGLAGAALARRPA----FSTSFTSGGQVSARNPLMTRNLERN--GRITCMTFPR  56

Query  285  DWLRRDLNVIGFGLIGWIAPSSVPLINGKSLTGLFFDSIGTELSHWPTGPALTSQFWLWL  106
            DWLRRDLNVIGFGLIGW+APSS+PLING SLTGLFF SIG EL+H+P+ PAL SQFWLWL
Sbjct  57   DWLRRDLNVIGFGLIGWLAPSSIPLINGNSLTGLFFSSIGEELAHFPSPPALQSQFWLWL  116

Query  105  VCWHLGLFLCLTFGQIGFKGRTEDYF  28
            V WHLGLF+ LTFGQIGFKGRTEDYF
Sbjct  117  VTWHLGLFIALTFGQIGFKGRTEDYF  142



>gb|EMT23727.1| hypothetical protein F775_30776 [Aegilops tauschii]
Length=144

 Score =   179 bits (453),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 99/146 (68%), Positives = 109/146 (75%), Gaps = 11/146 (8%)
 Frame = -3

Query  450  CAASTVVGLATSSLPRLSSPNKLFLTSDFLKPAVSARNPL---KLPRACMGKFTC--FER  286
             A STV GLA ++L R  +    F TS      VSARNPL    L R   G+ TC  F R
Sbjct  3    AATSTVSGLAGAALARRPA----FSTSFTSGGRVSARNPLMTRNLERN--GRITCMTFPR  56

Query  285  DWLRRDLNVIGFGLIGWIAPSSVPLINGKSLTGLFFDSIGTELSHWPTGPALTSQFWLWL  106
            DWLRRDLNVIGFGLIGW+APSS+PLING SLTGLFF SIG EL+H+P+ PAL SQFWLWL
Sbjct  57   DWLRRDLNVIGFGLIGWLAPSSIPLINGNSLTGLFFSSIGEELAHFPSPPALQSQFWLWL  116

Query  105  VCWHLGLFLCLTFGQIGFKGRTEDYF  28
            V WHLGLF+ LTFGQIGFKGRTEDYF
Sbjct  117  VTWHLGLFIALTFGQIGFKGRTEDYF  142



>ref|XP_011004353.1| PREDICTED: photosystem I subunit O-like, partial [Populus euphratica]
Length=159

 Score =   178 bits (452),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 84/116 (72%), Positives = 99/116 (85%), Gaps = 0/116 (0%)
 Frame = -3

Query  375  TSDFLKPAVSARNPLKLPRACMGKFTCFERDWLRRDLNVIGFGLIGWIAPSSVPLINGKS  196
            +S F+K  V+A +PL+L  A  GKF CFERDWLR+DLNVIGFGLIGW+APSS+P   GKS
Sbjct  44   SSGFVKSPVAAGSPLRLAGAHGGKFMCFERDWLRKDLNVIGFGLIGWLAPSSIPANGGKS  103

Query  195  LTGLFFDSIGTELSHWPTGPALTSQFWLWLVCWHLGLFLCLTFGQIGFKGRTEDYF  28
            L+GLFF+SIGTEL+H+PT P LTSQFWLWLV WHLGLF+CLT GQIGFKGR ++YF
Sbjct  104  LSGLFFESIGTELAHFPTPPPLTSQFWLWLVTWHLGLFICLTLGQIGFKGRADEYF  159



>emb|CDY68716.1| BnaAnng28120D [Brassica napus]
Length=120

 Score =   176 bits (446),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 84/113 (74%), Positives = 98/113 (87%), Gaps = 3/113 (3%)
 Frame = -3

Query  366  FLKPAVSARNPLKLPRACMGKFTCFERDWLRRDLNVIGFGLIGWIAPSSVPLINGKSLTG  187
            FLKP + A+NPL++  A  G+FT    +WLRRDLNV+GFGLIGW+APSS+P+INGKSLTG
Sbjct  9    FLKPTLRAKNPLRVAGASGGRFTW---NWLRRDLNVVGFGLIGWLAPSSIPVINGKSLTG  65

Query  186  LFFDSIGTELSHWPTGPALTSQFWLWLVCWHLGLFLCLTFGQIGFKGRTEDYF  28
            LFF SIG EL+H+PT PALTSQFWLWLV WHL LF+C+TFGQIGFKGRTEDYF
Sbjct  66   LFFKSIGNELAHFPTPPALTSQFWLWLVTWHLSLFICVTFGQIGFKGRTEDYF  118



>dbj|BAJ85402.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=144

 Score =   177 bits (448),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 98/146 (67%), Positives = 108/146 (74%), Gaps = 11/146 (8%)
 Frame = -3

Query  450  CAASTVVGLATSSLPRLSSPNKLFLTSDFLKPAVSARNPL---KLPRACMGKFTC--FER  286
             A STV GLA ++L R  +    F TS      VSARNPL    L R   G+ TC  F R
Sbjct  3    TATSTVYGLAGAALARRPA----FSTSFTSGGRVSARNPLMTRNLERN--GRITCMTFPR  56

Query  285  DWLRRDLNVIGFGLIGWIAPSSVPLINGKSLTGLFFDSIGTELSHWPTGPALTSQFWLWL  106
            DWLRRDLNVIGFGLIGW+APSS+PLING SLTGLFF SIG EL+H+P+ PAL SQFWLWL
Sbjct  57   DWLRRDLNVIGFGLIGWLAPSSIPLINGNSLTGLFFSSIGEELAHFPSPPALQSQFWLWL  116

Query  105  VCWHLGLFLCLTFGQIGFKGRTEDYF  28
            V WHLGLF+ LTFGQIGFKGR EDYF
Sbjct  117  VTWHLGLFIALTFGQIGFKGRAEDYF  142



>gb|KHN08815.1| hypothetical protein glysoja_046343 [Glycine soja]
Length=140

 Score =   176 bits (445),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 85/114 (75%), Positives = 96/114 (84%), Gaps = 1/114 (1%)
 Frame = -3

Query  366  FLKPAVSARNPLKLPRAC-MGKFTCFERDWLRRDLNVIGFGLIGWIAPSSVPLINGKSLT  190
            F+K  V ARNPL+   A   G+ TCFER+WLR D +VIGFGLIGW+APSS+P INGKSLT
Sbjct  27   FVKSPVIARNPLRQAVAMGNGRITCFERNWLRADYSVIGFGLIGWLAPSSIPAINGKSLT  86

Query  189  GLFFDSIGTELSHWPTGPALTSQFWLWLVCWHLGLFLCLTFGQIGFKGRTEDYF  28
            GLFF+SIG EL+H+PT PALTS FWLWLV WHLGLF+ LTFGQIGFKGRTEDYF
Sbjct  87   GLFFESIGAELAHFPTPPALTSSFWLWLVTWHLGLFIVLTFGQIGFKGRTEDYF  140



>gb|ABK21270.1| unknown [Picea sitchensis]
 gb|ABK25280.1| unknown [Picea sitchensis]
 gb|ABK25521.1| unknown [Picea sitchensis]
 gb|ABK27000.1| unknown [Picea sitchensis]
 gb|ABR18345.1| unknown [Picea sitchensis]
Length=152

 Score =   176 bits (446),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 91/145 (63%), Positives = 107/145 (74%), Gaps = 1/145 (1%)
 Frame = -3

Query  462  AATLCAASTVVGLATSSLPRLSSPNKLFLTSDFLK-PAVSARNPLKLPRACMGKFTCFER  286
            AA +  +S V GL TSSL       KL L+S F     V   NPL+       + TCF+R
Sbjct  8    AANVTLSSPVAGLGTSSLSSSKPNAKLQLSSGFTGCTTVRGNNPLRQKGLWASRITCFQR  67

Query  285  DWLRRDLNVIGFGLIGWIAPSSVPLINGKSLTGLFFDSIGTELSHWPTGPALTSQFWLWL  106
            +WLR D +VIGFGLIGWIAPSS+P+ING SLTGLFF SIG EL+HWPTGP+LTS FWLW+
Sbjct  68   NWLRTDYSVIGFGLIGWIAPSSLPVINGDSLTGLFFKSIGDELAHWPTGPSLTSSFWLWM  127

Query  105  VCWHLGLFLCLTFGQIGFKGRTEDY  31
            +CWHLGLFLCLTFGQIGFKGR+E +
Sbjct  128  ICWHLGLFLCLTFGQIGFKGRSEYF  152



>gb|ACU20009.1| unknown [Glycine max]
Length=140

 Score =   175 bits (444),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 86/114 (75%), Positives = 97/114 (85%), Gaps = 1/114 (1%)
 Frame = -3

Query  366  FLKPAVSARNPLKLPRAC-MGKFTCFERDWLRRDLNVIGFGLIGWIAPSSVPLINGKSLT  190
            F+K  VSARNPL+   A   G+ TCFER+WLR D +VIGFGLIGW+APSSVP INGKSLT
Sbjct  27   FVKSPVSARNPLRKAVAMGNGRVTCFERNWLRADYSVIGFGLIGWLAPSSVPAINGKSLT  86

Query  189  GLFFDSIGTELSHWPTGPALTSQFWLWLVCWHLGLFLCLTFGQIGFKGRTEDYF  28
            GLFF+SIG EL+H+PT PALTS FWLWLV W LGLF+CLTFGQIGFKGRTE+YF
Sbjct  87   GLFFESIGAELAHFPTPPALTSSFWLWLVTWPLGLFICLTFGQIGFKGRTEEYF  140



>ref|NP_001236146.1| uncharacterized protein LOC100305746 [Glycine max]
 gb|ACU13599.1| unknown [Glycine max]
Length=140

 Score =   174 bits (442),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 84/114 (74%), Positives = 96/114 (84%), Gaps = 1/114 (1%)
 Frame = -3

Query  366  FLKPAVSARNPLKLPRAC-MGKFTCFERDWLRRDLNVIGFGLIGWIAPSSVPLINGKSLT  190
            F+K  V ARNPL+   A   G+ TCFER+WLR D +VIGFGLIGW+APSS+P INGKSLT
Sbjct  27   FVKSPVIARNPLRQAVAMGNGRITCFERNWLRADYSVIGFGLIGWLAPSSIPAINGKSLT  86

Query  189  GLFFDSIGTELSHWPTGPALTSQFWLWLVCWHLGLFLCLTFGQIGFKGRTEDYF  28
            GLFF+SIG EL+H+P+ PALTS FWLWLV WHLGLF+ LTFGQIGFKGRTEDYF
Sbjct  87   GLFFESIGAELAHFPSPPALTSSFWLWLVTWHLGLFIVLTFGQIGFKGRTEDYF  140



>emb|CAH66420.1| H0622F05.3 [Oryza sativa Indica Group]
 emb|CAH66478.1| OSIGBa0137L20.7 [Oryza sativa Indica Group]
 gb|EAY94055.1| hypothetical protein OsI_15832 [Oryza sativa Indica Group]
Length=142

 Score =   174 bits (442),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 100/145 (69%), Positives = 107/145 (74%), Gaps = 11/145 (8%)
 Frame = -3

Query  447  AASTVVGLATSSLPRLSSPNKLFLTSDFLKPAVSARNPL---KLPRACMGKFTC--FERD  283
            AASTV GLA ++L R  + +  F T       VSARNPL    L R   G+ TC  F RD
Sbjct  2    AASTVSGLAGATLARRPAFSTGFTTG----ARVSARNPLMTRNLERN--GRITCMTFPRD  55

Query  282  WLRRDLNVIGFGLIGWIAPSSVPLINGKSLTGLFFDSIGTELSHWPTGPALTSQFWLWLV  103
            WLRRDLNVIGFGLIGWIAPSSVP ING SLTGLFF SIG ELSH+P+ PAL S FWLWLV
Sbjct  56   WLRRDLNVIGFGLIGWIAPSSVPAINGNSLTGLFFSSIGQELSHFPSPPALDSPFWLWLV  115

Query  102  CWHLGLFLCLTFGQIGFKGRTEDYF  28
             WHLGLFL LTFGQIGFKGRTE YF
Sbjct  116  TWHLGLFLALTFGQIGFKGRTEGYF  140



>ref|XP_004975583.1| PREDICTED: uncharacterized protein LOC101771677 [Setaria italica]
Length=144

 Score =   174 bits (441),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 97/151 (64%), Positives = 108/151 (72%), Gaps = 14/151 (9%)
 Frame = -3

Query  465  MAATLCAASTVVGLATSSLPRLSSPNKLFLTSDFLKPAVSARNPL---KLPRACMGKFTC  295
            MAA+  A S + G A +S P  S       TS      VSARNPL    L R   G+ TC
Sbjct  1    MAASSSAVSGLAGAALASRPAFS-------TSFVRGGRVSARNPLMTRNLERN--GRITC  51

Query  294  --FERDWLRRDLNVIGFGLIGWIAPSSVPLINGKSLTGLFFDSIGTELSHWPTGPALTSQ  121
              F RDWLRRDL+VIGFGLIGWI PSSVP+ING SLTGLFF SIG EL+H+PT P +TSQ
Sbjct  52   MTFPRDWLRRDLSVIGFGLIGWIGPSSVPVINGNSLTGLFFSSIGEELAHFPTPPPVTSQ  111

Query  120  FWLWLVCWHLGLFLCLTFGQIGFKGRTEDYF  28
            FWLW+V WHLGLF+ LTFGQIGFKGRTEDYF
Sbjct  112  FWLWMVTWHLGLFIVLTFGQIGFKGRTEDYF  142



>ref|NP_001150218.1| LOC100283848 [Zea mays]
 gb|ACG27302.1| 16kDa membrane protein [Zea mays]
 gb|ACG30703.1| 16kDa membrane protein [Zea mays]
 gb|ACG38282.1| 16kDa membrane protein [Zea mays]
 gb|ACN34681.1| unknown [Zea mays]
 tpg|DAA37888.1| TPA: membrane protein [Zea mays]
Length=144

 Score =   174 bits (440),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 97/146 (66%), Positives = 107/146 (73%), Gaps = 11/146 (8%)
 Frame = -3

Query  450  CAASTVVGLATSSLPRLSSPNKLFLTSDFLKPAVSARNPL---KLPRACMGKFTC--FER  286
             +ASTV GLA +SL    +    F TS      VSARNPL    L R   G+ TC  F R
Sbjct  3    ASASTVSGLAGASL----ASRPAFSTSFTRGSRVSARNPLMSRNLERN--GRITCMTFPR  56

Query  285  DWLRRDLNVIGFGLIGWIAPSSVPLINGKSLTGLFFDSIGTELSHWPTGPALTSQFWLWL  106
            DWLRRDL+VIGFGLIGW+ PSSVP ING SLTGLFF SIG EL+H+PT P +TSQFWLWL
Sbjct  57   DWLRRDLSVIGFGLIGWMGPSSVPAINGNSLTGLFFSSIGQELAHFPTPPPVTSQFWLWL  116

Query  105  VCWHLGLFLCLTFGQIGFKGRTEDYF  28
            V WHLGLF+ LTFGQIGFKGRTEDYF
Sbjct  117  VTWHLGLFIVLTFGQIGFKGRTEDYF  142



>gb|ABK26506.1| unknown [Picea sitchensis]
Length=152

 Score =   174 bits (440),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 92/146 (63%), Positives = 107/146 (73%), Gaps = 2/146 (1%)
 Frame = -3

Query  462  AATLCAASTVVGLATSSLPRLSSPNKLFLTSDFLK-PAVSARNPLKLPRACMGKFTCFER  286
            AA +  +S V GL TSSL       KL L+S       V   NPL+       + TCF+R
Sbjct  8    AANVTLSSPVAGLGTSSLSSSKPNAKLQLSSGVTGCTTVRGNNPLRQKGLWASRITCFQR  67

Query  285  DWLRRDLNVIGFGLIGWIAPSSVPLINGKSLTGLFFDSIGTELSHWPTGPALTSQFWLWL  106
            +WLR D +VIGFGLIGWIAPSS+P+ING SLTGLFF SIG EL+HWPTGP+LTS FWLW+
Sbjct  68   NWLRTDYSVIGFGLIGWIAPSSLPVINGDSLTGLFFKSIGDELAHWPTGPSLTSSFWLWM  127

Query  105  VCWHLGLFLCLTFGQIGFKGRTEDYF  28
            +CWHLGLFLCLTFGQIGFKGR+E YF
Sbjct  128  ICWHLGLFLCLTFGQIGFKGRSE-YF  152



>gb|AHB79078.1| 16 kDa membrane protein [Saccharum hybrid cultivar]
Length=144

 Score =   173 bits (439),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 96/146 (66%), Positives = 107/146 (73%), Gaps = 11/146 (8%)
 Frame = -3

Query  450  CAASTVVGLATSSLPRLSSPNKLFLTSDFLKPAVSARNPL---KLPRACMGKFTC--FER  286
             +ASTV GLA +SL    +    F TS      VSARNPL    L R   G+ TC  F R
Sbjct  3    ASASTVSGLAGASL----ATRPAFSTSFARGSRVSARNPLMTRNLERN--GRITCMTFPR  56

Query  285  DWLRRDLNVIGFGLIGWIAPSSVPLINGKSLTGLFFDSIGTELSHWPTGPALTSQFWLWL  106
            DWLRRDL++IG+GLIGWI PSSVP ING SLTGLFF SIG EL+H+PT P +TSQFWLWL
Sbjct  57   DWLRRDLSIIGYGLIGWIGPSSVPAINGNSLTGLFFSSIGEELAHFPTPPPVTSQFWLWL  116

Query  105  VCWHLGLFLCLTFGQIGFKGRTEDYF  28
            V WHLGLF+ LTFGQIGFKGRTEDYF
Sbjct  117  VTWHLGLFIVLTFGQIGFKGRTEDYF  142



>gb|ABK21819.1| unknown [Picea sitchensis]
Length=149

 Score =   173 bits (438),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 90/144 (63%), Positives = 106/144 (74%), Gaps = 2/144 (1%)
 Frame = -3

Query  462  AATLCAASTVVGLATSSLPRLSSPNKLFLTSDFLKPAVSARNPLKLPRACMGKFTCFERD  283
            AA +  +S V GL TSSL       KL L+S      V   NPL+       + TCF+R+
Sbjct  8    AANVTLSSPVAGLGTSSLSSSKPNAKLQLSSGC--TTVRGNNPLRQKGLWASRITCFQRN  65

Query  282  WLRRDLNVIGFGLIGWIAPSSVPLINGKSLTGLFFDSIGTELSHWPTGPALTSQFWLWLV  103
            WLR D +VIGFGLIGWIAPSS+P+ING SLTGLFF SIG EL+HWPTGP+LTS FWLW++
Sbjct  66   WLRTDYSVIGFGLIGWIAPSSLPVINGDSLTGLFFKSIGDELAHWPTGPSLTSSFWLWMI  125

Query  102  CWHLGLFLCLTFGQIGFKGRTEDY  31
            CWHLGLFLCLTFGQIGFKGR+E +
Sbjct  126  CWHLGLFLCLTFGQIGFKGRSEYF  149



>ref|NP_001052755.1| Os04g0414700 [Oryza sativa Japonica Group]
 emb|CAE01514.1| OJ991214_12.3 [Oryza sativa Japonica Group]
 dbj|BAF14669.1| Os04g0414700 [Oryza sativa Japonica Group]
 gb|EAZ30691.1| hypothetical protein OsJ_14748 [Oryza sativa Japonica Group]
 dbj|BAG86813.1| unnamed protein product [Oryza sativa Japonica Group]
Length=142

 Score =   173 bits (438),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 99/145 (68%), Positives = 107/145 (74%), Gaps = 11/145 (8%)
 Frame = -3

Query  447  AASTVVGLATSSLPRLSSPNKLFLTSDFLKPAVSARNPL---KLPRACMGKFTC--FERD  283
            AASTV GLA ++L R  + +  F T       VSARNPL    L R   G+ TC  F +D
Sbjct  2    AASTVSGLAGATLARRPAFSTGFTTG----ARVSARNPLLTRNLERN--GRITCMTFPQD  55

Query  282  WLRRDLNVIGFGLIGWIAPSSVPLINGKSLTGLFFDSIGTELSHWPTGPALTSQFWLWLV  103
            WLRRDLNVIGFGLIGWIAPSSVP ING SLTGLFF SIG ELSH+P+ PAL S FWLWLV
Sbjct  56   WLRRDLNVIGFGLIGWIAPSSVPAINGNSLTGLFFSSIGQELSHFPSPPALDSPFWLWLV  115

Query  102  CWHLGLFLCLTFGQIGFKGRTEDYF  28
             WHLGLFL LTFGQIGFKGRTE YF
Sbjct  116  TWHLGLFLALTFGQIGFKGRTEGYF  140



>ref|XP_006652269.1| PREDICTED: uncharacterized protein LOC102704139, partial [Oryza 
brachyantha]
Length=142

 Score =   172 bits (437),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 98/146 (67%), Positives = 106/146 (73%), Gaps = 11/146 (8%)
 Frame = -3

Query  450  CAASTVVGLATSSLPRLSSPNKLFLTSDFLKPAVSARNPL---KLPRACMGKFTC--FER  286
             AASTV GLA ++L    + +  F T       VSARNPL    L R   G+ TC  F R
Sbjct  1    AAASTVSGLAGAALAHRPAFSTGFTTG----ARVSARNPLMTRNLERN--GRITCMTFPR  54

Query  285  DWLRRDLNVIGFGLIGWIAPSSVPLINGKSLTGLFFDSIGTELSHWPTGPALTSQFWLWL  106
            DWLRRDLNVIGFGLIGW+APSSVP ING SLTGLFF SIG ELSH+P+ P L SQFWLWL
Sbjct  55   DWLRRDLNVIGFGLIGWLAPSSVPAINGNSLTGLFFSSIGQELSHFPSPPPLDSQFWLWL  114

Query  105  VCWHLGLFLCLTFGQIGFKGRTEDYF  28
            V WHLGLFL LTFGQIGFKGRTE YF
Sbjct  115  VTWHLGLFLALTFGQIGFKGRTEGYF  140



>ref|XP_001778960.1| PsaO subunit of photosystem I [Physcomitrella patens]
 gb|EDQ56215.1| PsaO subunit of photosystem I [Physcomitrella patens]
Length=144

 Score =   171 bits (433),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 86/148 (58%), Positives = 109/148 (74%), Gaps = 7/148 (5%)
 Frame = -3

Query  465  MAATLCAAST--VVGLATSSLPRLSSPNKLFLTSDFLKPAVSARNPLKLPRACMGKFTCF  292
            MAA + + +T  V GL  S+L    + +K+ LTS F+  AV    PL     C+ + TCF
Sbjct  1    MAAAMASMTTPVVAGLGGSALLANRTSSKVQLTSAFVPRAVQVNKPL-----CVSRVTCF  55

Query  291  ERDWLRRDLNVIGFGLIGWIAPSSVPLINGKSLTGLFFDSIGTELSHWPTGPALTSQFWL  112
             RDWLR+DL+VIGFGLIGW+APSS+P+ING SLTGLF  SIG EL+H+PTGPALTS FWL
Sbjct  56   NRDWLRKDLSVIGFGLIGWLAPSSLPVINGNSLTGLFLGSIGPELAHFPTGPALTSPFWL  115

Query  111  WLVCWHLGLFLCLTFGQIGFKGRTEDYF  28
            W++ WH+GLF+ LT GQIGFKGR + Y+
Sbjct  116  WMITWHVGLFIVLTLGQIGFKGRQDGYW  143



>ref|XP_002446437.1| hypothetical protein SORBIDRAFT_06g016090 [Sorghum bicolor]
 gb|EES10765.1| hypothetical protein SORBIDRAFT_06g016090 [Sorghum bicolor]
Length=143

 Score =   170 bits (431),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 96/145 (66%), Positives = 108/145 (74%), Gaps = 10/145 (7%)
 Frame = -3

Query  447  AASTVVGLATSSLPRLSSPNKLFLTSDFLKPAVSARNPL---KLPRACMGKFTC--FERD  283
            AASTV GLA +S   L+S    F TS      VSARNPL    L R   G+ TC  F RD
Sbjct  2    AASTVSGLAGAS--SLAS-RPAFSTSFTRGSRVSARNPLMTRNLERN--GRITCMTFPRD  56

Query  282  WLRRDLNVIGFGLIGWIAPSSVPLINGKSLTGLFFDSIGTELSHWPTGPALTSQFWLWLV  103
            WLRRDL++IG+GLIGW+ PSS+P ING SLTGLFF SIG EL+H+PT P +TSQFWLWLV
Sbjct  57   WLRRDLSIIGYGLIGWMGPSSIPAINGNSLTGLFFSSIGEELAHFPTPPPVTSQFWLWLV  116

Query  102  CWHLGLFLCLTFGQIGFKGRTEDYF  28
             WHLGLF+ LTFGQIGFKGRTEDYF
Sbjct  117  TWHLGLFIVLTFGQIGFKGRTEDYF  141



>gb|ACG27280.1| 16kDa membrane protein [Zea mays]
Length=127

 Score =   163 bits (412),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 85/113 (75%), Positives = 92/113 (81%), Gaps = 7/113 (6%)
 Frame = -3

Query  351  VSARNPL---KLPRACMGKFTC--FERDWLRRDLNVIGFGLIGWIAPSSVPLINGKSLTG  187
            VSARNPL    L R   G+ TC  F RDWLRRDL+VIGFGLIGW+ PSSVP ING SLTG
Sbjct  15   VSARNPLMSRNLERN--GRITCMTFPRDWLRRDLSVIGFGLIGWMGPSSVPAINGNSLTG  72

Query  186  LFFDSIGTELSHWPTGPALTSQFWLWLVCWHLGLFLCLTFGQIGFKGRTEDYF  28
            LFF SIG EL+H+PT P +TSQFWLWLV WHLGLF+ LTFGQIGFKGRTEDYF
Sbjct  73   LFFSSIGQELAHFPTPPPVTSQFWLWLVTWHLGLFIVLTFGQIGFKGRTEDYF  125



>gb|EMS65275.1| hypothetical protein TRIUR3_34121 [Triticum urartu]
Length=132

 Score =   162 bits (410),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 79/109 (72%), Positives = 88/109 (81%), Gaps = 1/109 (1%)
 Frame = -3

Query  354  AVSARNPLKLPRACMGKFTCFERDWLRRDLNVIGFGLIGWIAPSSVPLINGKSLTGLFFD  175
            A S    ++  R  +   T F RDWLRRDLNVIGFGLIGW+APSS+PLING SLTGLFF 
Sbjct  23   AGSTHQEIRASRPVLHTET-FPRDWLRRDLNVIGFGLIGWLAPSSIPLINGNSLTGLFFS  81

Query  174  SIGTELSHWPTGPALTSQFWLWLVCWHLGLFLCLTFGQIGFKGRTEDYF  28
            SIG EL+H+P+ PAL SQFWLWLV WHLGLF+ LTFGQIGFKGRTEDYF
Sbjct  82   SIGEELAHFPSPPALQSQFWLWLVTWHLGLFIALTFGQIGFKGRTEDYF  130



>gb|ADI45889.1| sex-linked protein 9, partial [Silene latifolia]
 gb|ADI45890.1| sex-linked protein 9, partial [Silene latifolia]
 gb|ADI45891.1| sex-linked protein 9, partial [Silene latifolia]
 gb|ADI45892.1| sex-linked protein 9, partial [Silene latifolia]
 gb|ADI45893.1| sex-linked protein 9, partial [Silene latifolia]
 gb|ADI45894.1| sex-linked protein 9, partial [Silene latifolia]
 gb|ADI45895.1| sex-linked protein 9, partial [Silene latifolia]
 gb|ADI45896.1| sex-linked protein 9, partial [Silene latifolia]
 gb|ADI45897.1| sex-linked protein 9, partial [Silene latifolia]
 gb|ADI45898.1| sex-linked protein 9, partial [Silene latifolia]
 gb|ADI45899.1| sex-linked protein 9, partial [Silene latifolia]
 gb|ADI45900.1| sex-linked protein 9, partial [Silene latifolia]
 gb|ADI45901.1| sex-linked protein 9, partial [Silene latifolia]
 gb|ADI45902.1| sex-linked protein 9, partial [Silene latifolia]
 gb|ADI45903.1| sex-linked protein 9, partial [Silene latifolia]
 gb|ADI45904.1| sex-linked protein 9, partial [Silene latifolia]
 gb|ADI45905.1| sex-linked protein 9, partial [Silene latifolia]
 gb|ADI45906.1| sex-linked protein 9, partial [Silene latifolia]
 gb|ADI45907.1| sex-linked protein 9, partial [Silene latifolia]
 gb|ADI45908.1| sex-linked protein 9, partial [Silene latifolia]
 gb|ADI45909.1| sex-linked protein 9, partial [Silene latifolia]
 gb|ADI45910.1| sex-linked protein 9, partial [Silene latifolia]
 gb|ADI45911.1| sex-linked protein 9, partial [Silene latifolia]
 gb|ADI45912.1| sex-linked protein 9, partial [Silene latifolia]
 gb|ADI45913.1| sex-linked protein 9, partial [Silene latifolia]
 gb|ADI45914.1| sex-linked protein 9, partial [Silene latifolia]
 gb|ADI45915.1| sex-linked protein 9, partial [Silene latifolia]
 gb|ADI45916.1| sex-linked protein 9, partial [Silene latifolia]
 gb|ADI45917.1| sex-linked protein 9, partial [Silene latifolia]
 gb|ADI45918.1| sex-linked protein 9, partial [Silene latifolia]
 gb|ADI45919.1| sex-linked protein 9, partial [Silene latifolia]
 gb|ADI45920.1| sex-linked protein 9, partial [Silene latifolia]
 gb|ADI45921.1| sex-linked protein 9, partial [Silene latifolia]
 gb|ADI45922.1| sex-linked protein 9, partial [Silene latifolia]
 gb|ADI45923.1| sex-linked protein 9, partial [Silene latifolia]
 gb|ADI45924.1| sex-linked protein 9, partial [Silene latifolia]
 gb|ADI45925.1| sex-linked protein 9, partial [Silene latifolia]
 gb|ADI45926.1| sex-linked protein 9, partial [Silene latifolia]
 gb|ADI45927.1| sex-linked protein 9, partial [Silene latifolia]
 gb|ADI45928.1| sex-linked protein 9, partial [Silene latifolia]
 gb|ADI45929.1| sex-linked protein 9, partial [Silene latifolia]
 gb|ADI45930.1| sex-linked protein 9, partial [Silene latifolia]
 gb|ADI45931.1| sex-linked protein 9, partial [Silene latifolia]
 gb|ADI45932.1| sex-linked protein 9, partial [Silene latifolia]
 gb|ADI45933.1| sex-linked protein 9, partial [Silene latifolia]
 gb|ADI45934.1| sex-linked protein 9, partial [Silene latifolia]
Length=90

 Score =   159 bits (401),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 74/89 (83%), Positives = 83/89 (93%), Gaps = 0/89 (0%)
 Frame = -3

Query  294  FERDWLRRDLNVIGFGLIGWIAPSSVPLINGKSLTGLFFDSIGTELSHWPTGPALTSQFW  115
            F+RDWLRRDLNVIGFGLIGW+APSS+P I+G SL+GLFF SIG EL+H+PT PA+TSQFW
Sbjct  2    FQRDWLRRDLNVIGFGLIGWLAPSSIPAIDGNSLSGLFFSSIGEELAHFPTPPAVTSQFW  61

Query  114  LWLVCWHLGLFLCLTFGQIGFKGRTEDYF  28
            LWLV WHLGLFLCLTFGQIGFKGRTE+YF
Sbjct  62   LWLVLWHLGLFLCLTFGQIGFKGRTEEYF  90



>gb|ADI45881.1| sex-linked protein 9 [Silene latifolia]
Length=127

 Score =   158 bits (399),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 85/130 (65%), Positives = 102/130 (78%), Gaps = 7/130 (5%)
 Frame = -3

Query  462  AATLCAASTVVGLATSSLPRLSSPNKLFLTSDFLKPAVSARNPLKLPRACM---GKFTC-  295
            A++  A+STVVGL TS+L R S      L+S FLK  V+A NPL+  +AC    G+FTC 
Sbjct  1    ASSFAASSTVVGLGTSTLSR-SYAKSTTLSSGFLKSKVAAVNPLR--QACGTSGGRFTCS  57

Query  294  FERDWLRRDLNVIGFGLIGWIAPSSVPLINGKSLTGLFFDSIGTELSHWPTGPALTSQFW  115
            F+RDWLRRDLNVIGFGLIGW+APSS+P I+G SL+GLFF SIG EL+H+PT PA+TSQFW
Sbjct  58   FQRDWLRRDLNVIGFGLIGWLAPSSIPAIDGNSLSGLFFSSIGEELAHFPTPPAVTSQFW  117

Query  114  LWLVCWHLGL  85
            LWLV WHLGL
Sbjct  118  LWLVLWHLGL  127



>gb|KJB09105.1| hypothetical protein B456_001G123200 [Gossypium raimondii]
Length=116

 Score =   154 bits (389),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 81/117 (69%), Positives = 90/117 (77%), Gaps = 1/117 (1%)
 Frame = -3

Query  465  MAATLCAASTVVGLATSSLPRLSSPNKLFLTSDFLKPAVSARNPLKLPRACMGKFTCFER  286
            MAAT  + STVV L  S+    S PN   L+S FLK +V  RNPL+L  AC GKFTCFER
Sbjct  1    MAATFSSPSTVVRLG-SATSFSSPPNNTCLSSGFLKSSVRGRNPLRLAGACGGKFTCFER  59

Query  285  DWLRRDLNVIGFGLIGWIAPSSVPLINGKSLTGLFFDSIGTELSHWPTGPALTSQFW  115
            DWLRRD NVIGFGLIGWIAPSS+P INGKSLTGL F+SIGTEL+H+PT P  TSQFW
Sbjct  60   DWLRRDFNVIGFGLIGWIAPSSIPAINGKSLTGLLFESIGTELAHFPTPPPPTSQFW  116



>ref|XP_002976132.1| hypothetical protein SELMODRAFT_104218, partial [Selaginella 
moellendorffii]
 gb|EFJ23037.1| hypothetical protein SELMODRAFT_104218, partial [Selaginella 
moellendorffii]
Length=90

 Score =   145 bits (366),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 68/90 (76%), Positives = 77/90 (86%), Gaps = 0/90 (0%)
 Frame = -3

Query  297  CFERDWLRRDLNVIGFGLIGWIAPSSVPLINGKSLTGLFFDSIGTELSHWPTGPALTSQF  118
             F  DWLR DL+VIGFGLIGW+APSS+P ING SLTGLFF SIG EL+HWPTGPALTS F
Sbjct  1    SFRGDWLRTDLSVIGFGLIGWLAPSSIPAINGDSLTGLFFGSIGPELAHWPTGPALTSPF  60

Query  117  WLWLVCWHLGLFLCLTFGQIGFKGRTEDYF  28
            WLW++ WHLGLF+ LTFGQIGFKGR + Y+
Sbjct  61   WLWMILWHLGLFITLTFGQIGFKGRADGYW  90



>gb|KCW87339.1| hypothetical protein EUGRSUZ_B03824 [Eucalyptus grandis]
Length=113

 Score =   145 bits (365),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 74/117 (63%), Positives = 92/117 (79%), Gaps = 4/117 (3%)
 Frame = -3

Query  465  MAATLCAASTVVGLATSSLPRLSSPNKLFLTSDFLKPAVSARNPLKLPRACMGKFTCFER  286
            MAA++ A S+V+GL +S+L   +SP K  L SDF++  V ARNP+K  RA  G+FTCF+R
Sbjct  1    MAASM-ATSSVIGLGSSAL---TSPKKASLVSDFVRSPVRARNPMKPVRASGGRFTCFQR  56

Query  285  DWLRRDLNVIGFGLIGWIAPSSVPLINGKSLTGLFFDSIGTELSHWPTGPALTSQFW  115
            DWLR D +VIGFGLIGW+APSSVP I+GKSLTGLFF+SIG EL+H+PT P L S FW
Sbjct  57   DWLRADYSVIGFGLIGWLAPSSVPAIDGKSLTGLFFESIGNELAHFPTPPPLASPFW  113



>ref|XP_006854748.1| hypothetical protein AMTR_s00030p00247800 [Amborella trichopoda]
 gb|ERN16215.1| hypothetical protein AMTR_s00030p00247800 [Amborella trichopoda]
Length=123

 Score =   142 bits (358),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 74/120 (62%), Positives = 87/120 (73%), Gaps = 1/120 (1%)
 Frame = -3

Query  459  ATLCAASTVVGLATSSLPRLSSPNKLFLTSDFLKPAVSARNPLKLPRACMGKFTCFERDW  280
            AT    + V GL T SL    SP KL L+S FL  +  A NP    ++  G+F+C++ DW
Sbjct  2    ATNSLITPVAGLGTPSLSPSRSPTKLNLSSGFLSSSAIA-NPFSRAKSSKGRFSCYKGDW  60

Query  279  LRRDLNVIGFGLIGWIAPSSVPLINGKSLTGLFFDSIGTELSHWPTGPALTSQFWLWLVC  100
            LR DLNVIGFGLIGW+APSS+P INGKSLTGLFF+SIG+EL HWPTGPALTSQFWL L  
Sbjct  61   LRTDLNVIGFGLIGWLAPSSIPAINGKSLTGLFFESIGSELVHWPTGPALTSQFWLVLTS  120



>gb|KDO37001.1| hypothetical protein CISIN_1g032156mg [Citrus sinensis]
Length=121

 Score =   142 bits (357),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 68/93 (73%), Positives = 78/93 (84%), Gaps = 0/93 (0%)
 Frame = -3

Query  393  PNKLFLTSDFLKPAVSARNPLKLPRACMGKFTCFERDWLRRDLNVIGFGLIGWIAPSSVP  214
            P +  L S F+K  V+ARNPL++  AC GK TCFERDWLR DLNVIGFGLIGW+APSS+P
Sbjct  23   PKRTALGSSFVKSPVAARNPLRVAGACGGKVTCFERDWLRTDLNVIGFGLIGWLAPSSIP  82

Query  213  LINGKSLTGLFFDSIGTELSHWPTGPALTSQFW  115
             INGKSLTGLFF+SIGTEL+H+PT P LTSQFW
Sbjct  83   AINGKSLTGLFFESIGTELAHFPTPPPLTSQFW  115



>gb|KDO58276.1| hypothetical protein CISIN_1g032153mg [Citrus sinensis]
Length=141

 Score =   142 bits (358),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 69/99 (70%), Positives = 81/99 (82%), Gaps = 0/99 (0%)
 Frame = -3

Query  393  PNKLFLTSDFLKPAVSARNPLKLPRACMGKFTCFERDWLRRDLNVIGFGLIGWIAPSSVP  214
            P +  L S F+K  V+ARNPL++  AC GK TCFERDWLR DLNVIGFGLIGW+APSS+P
Sbjct  23   PKRTALGSSFVKSPVAARNPLRVAGACGGKVTCFERDWLRTDLNVIGFGLIGWLAPSSIP  82

Query  213  LINGKSLTGLFFDSIGTELSHWPTGPALTSQFWLWLVCW  97
             INGKSLTGLFF+SIGTEL+H+PT P LTSQFW  +V +
Sbjct  83   AINGKSLTGLFFESIGTELAHFPTPPPLTSQFWSVVVGY  121



>ref|XP_009340870.1| PREDICTED: photosystem I subunit O-like [Pyrus x bretschneideri]
Length=129

 Score =   139 bits (350),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 79/119 (66%), Positives = 95/119 (80%), Gaps = 6/119 (5%)
 Frame = -3

Query  465  MAATLCAASTVVGLATSSLPRLSSPNKLFLTSDFLKPAVSARNPLKLPRACMGKFTC-FE  289
            MAAT+  ASTV+GL +SSL    +     L+S F+KP V   NPL+  RA  G+FTC F+
Sbjct  1    MAATMATASTVMGLRSSSLSPSRT----CLSSAFVKPIVVG-NPLRQVRASGGRFTCSFQ  55

Query  288  RDWLRRDLNVIGFGLIGWIAPSSVPLINGKSLTGLFFDSIGTELSHWPTGPALTSQFWL  112
            RDWLRRDLNVIGFGLIGW+APSS+PLI+GKSLTGLFF+SIG EL+H+P+ PALTSQFWL
Sbjct  56   RDWLRRDLNVIGFGLIGWLAPSSIPLIDGKSLTGLFFESIGAELAHFPSPPALTSQFWL  114



>ref|XP_006384771.1| hypothetical protein POPTR_0004s20960g [Populus trichocarpa]
 gb|ERP62568.1| hypothetical protein POPTR_0004s20960g [Populus trichocarpa]
Length=120

 Score =   137 bits (346),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 78/120 (65%), Positives = 90/120 (75%), Gaps = 3/120 (3%)
 Frame = -3

Query  465  MAATLCAASTVVGLATSSLPRLSS---PNKLFLTSDFLKPAVSARNPLKLPRACMGKFTC  295
            MAAT  + S VVGL + SL   S    P K+ L+S F+K  V+ARNPL L     GKF C
Sbjct  1    MAATFASPSAVVGLGSGSLSSPSRISSPKKICLSSGFVKSPVTARNPLGLAGTGGGKFMC  60

Query  294  FERDWLRRDLNVIGFGLIGWIAPSSVPLINGKSLTGLFFDSIGTELSHWPTGPALTSQFW  115
            F+ DWLR+DLNVIGFGLIGW+APSSVP I GKSLTGLFF+SIGTEL+H+PT P LTSQFW
Sbjct  61   FQGDWLRKDLNVIGFGLIGWLAPSSVPAIGGKSLTGLFFESIGTELAHFPTPPPLTSQFW  120



>gb|ADI45848.1| sex-linked protein 9 [Silene latifolia]
Length=101

 Score =   135 bits (340),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 69/99 (70%), Positives = 82/99 (83%), Gaps = 6/99 (6%)
 Frame = -3

Query  378  LTSDFLKPAVSARNPLKLPRACM---GKFTC-FERDWLRRDLNVIGFGLIGWIAPSSVPL  211
            L+S FLK  V+A NPL+  +AC    G+FTC F+RDWLRRDLNVIGFGLIGW+APSS+P 
Sbjct  5    LSSGFLKSKVAAVNPLR--QACGTSGGRFTCSFQRDWLRRDLNVIGFGLIGWLAPSSIPA  62

Query  210  INGKSLTGLFFDSIGTELSHWPTGPALTSQFWLWLVCWH  94
            I+G SL+GLFF SIG EL+H+PT PA+TSQFWLWLV WH
Sbjct  63   IDGNSLSGLFFSSIGEELAHFPTPPAVTSQFWLWLVLWH  101



>gb|ADI45849.1| sex-linked protein 9 [Silene latifolia]
Length=106

 Score =   133 bits (334),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 68/98 (69%), Positives = 81/98 (83%), Gaps = 6/98 (6%)
 Frame = -3

Query  378  LTSDFLKPAVSARNPLKLPRACM---GKFTC-FERDWLRRDLNVIGFGLIGWIAPSSVPL  211
            L+S FLK  V+A NPL+  +AC    G+FTC F+RDWLRRDLNVIGFGLIGW+APSS+P 
Sbjct  11   LSSGFLKSKVAAVNPLR--QACGTSGGRFTCSFQRDWLRRDLNVIGFGLIGWLAPSSIPA  68

Query  210  INGKSLTGLFFDSIGTELSHWPTGPALTSQFWLWLVCW  97
            I+G SL+GLFF SIG EL+H+PT PA+TSQFWLWLV W
Sbjct  69   IDGNSLSGLFFSSIGEELAHFPTPPAVTSQFWLWLVLW  106



>gb|ADI45869.1| sex-linked protein 9 [Silene latifolia]
Length=104

 Score =   130 bits (328),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 67/96 (70%), Positives = 80/96 (83%), Gaps = 6/96 (6%)
 Frame = -3

Query  378  LTSDFLKPAVSARNPLKLPRACM---GKFTC-FERDWLRRDLNVIGFGLIGWIAPSSVPL  211
            L+S FLK  V+A NPL+  +AC    G+FTC F+RDWLRRDLNVIGFGLIGW+APSS+P 
Sbjct  11   LSSGFLKSKVAAVNPLR--QACGTSGGRFTCSFQRDWLRRDLNVIGFGLIGWLAPSSIPA  68

Query  210  INGKSLTGLFFDSIGTELSHWPTGPALTSQFWLWLV  103
            I+G SL+GLFF SIG EL+H+PT PA+TSQFWLWLV
Sbjct  69   IDGNSLSGLFFSSIGEELAHFPTPPAVTSQFWLWLV  104



>gb|ADI45879.1| sex-linked protein 9 [Silene latifolia]
Length=98

 Score =   130 bits (326),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 67/96 (70%), Positives = 80/96 (83%), Gaps = 6/96 (6%)
 Frame = -3

Query  378  LTSDFLKPAVSARNPLKLPRACM---GKFTC-FERDWLRRDLNVIGFGLIGWIAPSSVPL  211
            L+S FLK  V+A NPL+  +AC    G+FTC F+RDWLRRDLNVIGFGLIGW+APSS+P 
Sbjct  5    LSSGFLKSKVAAVNPLR--QACGTSGGRFTCSFQRDWLRRDLNVIGFGLIGWLAPSSIPA  62

Query  210  INGKSLTGLFFDSIGTELSHWPTGPALTSQFWLWLV  103
            I+G SL+GLFF SIG EL+H+PT PA+TSQFWLWLV
Sbjct  63   IDGNSLSGLFFSSIGEELAHFPTPPAVTSQFWLWLV  98



>gb|ADI45882.1| sex-linked protein 9 [Silene latifolia]
Length=102

 Score =   127 bits (320),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 66/95 (69%), Positives = 79/95 (83%), Gaps = 6/95 (6%)
 Frame = -3

Query  378  LTSDFLKPAVSARNPLKLPRACM---GKFTC-FERDWLRRDLNVIGFGLIGWIAPSSVPL  211
            L+S FLK  V+A NPL+  +AC    G+FTC F+RDWLRRDLNVIGFGLIGW+APSS+P 
Sbjct  10   LSSGFLKLKVAAVNPLR--QACGTSGGRFTCSFQRDWLRRDLNVIGFGLIGWLAPSSIPA  67

Query  210  INGKSLTGLFFDSIGTELSHWPTGPALTSQFWLWL  106
            I+G SL+GLFF SIG EL+H+PT PA+TSQFWLWL
Sbjct  68   IDGNSLSGLFFSSIGEELAHFPTPPAVTSQFWLWL  102



>gb|ADI45877.1| sex-linked protein 9 [Silene latifolia]
Length=96

 Score =   126 bits (317),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 65/94 (69%), Positives = 78/94 (83%), Gaps = 6/94 (6%)
 Frame = -3

Query  378  LTSDFLKPAVSARNPLKLPRACM---GKFTC-FERDWLRRDLNVIGFGLIGWIAPSSVPL  211
            L+S FLK  V+A NPL+  +AC    G+FTC F+RDWLRRDLNVIGFGLIGW+APSS+P 
Sbjct  5    LSSGFLKSKVAAVNPLR--QACGTSGGRFTCSFQRDWLRRDLNVIGFGLIGWLAPSSIPA  62

Query  210  INGKSLTGLFFDSIGTELSHWPTGPALTSQFWLW  109
            I+G SL+GLFF SIG EL+H+PT PA+TSQFWLW
Sbjct  63   IDGNSLSGLFFSSIGEELAHFPTPPAVTSQFWLW  96



>gb|ADI45826.1| sex-linked protein 9, partial [Silene dioica]
 gb|ADI45842.1| sex-linked protein 9, partial [Silene dioica]
 gb|ADI45846.1| sex-linked protein 9 [Silene latifolia]
 gb|ADI45861.1| sex-linked protein 9 [Silene latifolia]
 gb|ADI45866.1| sex-linked protein 9 [Silene latifolia]
 gb|ADI45871.1| sex-linked protein 9 [Silene latifolia]
 gb|ADI45873.1| sex-linked protein 9 [Silene latifolia]
Length=99

 Score =   120 bits (302),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 62/91 (68%), Positives = 75/91 (82%), Gaps = 6/91 (7%)
 Frame = -3

Query  378  LTSDFLKPAVSARNPLKLPRACM---GKFTC-FERDWLRRDLNVIGFGLIGWIAPSSVPL  211
            L+S FLK  V+A NPL+  +AC    G+FTC F+RDWLRRDLNVIGFGLIGW+APSS+P 
Sbjct  11   LSSGFLKSKVAAVNPLR--QACGTSGGRFTCSFQRDWLRRDLNVIGFGLIGWLAPSSIPA  68

Query  210  INGKSLTGLFFDSIGTELSHWPTGPALTSQF  118
            I+G SL+GLFF SIG EL+H+PT PA+TSQF
Sbjct  69   IDGNSLSGLFFSSIGEELAHFPTPPAVTSQF  99



>gb|ADI45857.1| sex-linked protein 9 [Silene latifolia]
 gb|ADI45859.1| sex-linked protein 9 [Silene latifolia]
Length=98

 Score =   120 bits (301),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 62/91 (68%), Positives = 75/91 (82%), Gaps = 6/91 (7%)
 Frame = -3

Query  378  LTSDFLKPAVSARNPLKLPRACM---GKFTC-FERDWLRRDLNVIGFGLIGWIAPSSVPL  211
            L+S FLK  V+A NPL+  +AC    G+FTC F+RDWLRRDLNVIGFGLIGW+APSS+P 
Sbjct  10   LSSGFLKSKVAAVNPLR--QACGTSGGRFTCSFQRDWLRRDLNVIGFGLIGWLAPSSIPA  67

Query  210  INGKSLTGLFFDSIGTELSHWPTGPALTSQF  118
            I+G SL+GLFF SIG EL+H+PT PA+TSQF
Sbjct  68   IDGNSLSGLFFSSIGEELAHFPTPPAVTSQF  98



>gb|ADI45880.1| sex-linked protein 9 [Silene latifolia]
Length=93

 Score =   120 bits (301),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 62/91 (68%), Positives = 75/91 (82%), Gaps = 6/91 (7%)
 Frame = -3

Query  378  LTSDFLKPAVSARNPLKLPRACM---GKFTC-FERDWLRRDLNVIGFGLIGWIAPSSVPL  211
            L+S FLK  V+A NPL+  +AC    G+FTC F+RDWLRRDLNVIGFGLIGW+APSS+P 
Sbjct  5    LSSGFLKSKVAAVNPLR--QACGTSGGRFTCSFQRDWLRRDLNVIGFGLIGWLAPSSIPA  62

Query  210  INGKSLTGLFFDSIGTELSHWPTGPALTSQF  118
            I+G SL+GLFF SIG EL+H+PT PA+TSQF
Sbjct  63   IDGNSLSGLFFSSIGEELAHFPTPPAVTSQF  93



>gb|ADI45862.1| sex-linked protein 9 [Silene latifolia]
 gb|ADI45885.1| sex-linked protein 9 [Silene latifolia]
Length=92

 Score =   120 bits (300),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 62/91 (68%), Positives = 75/91 (82%), Gaps = 6/91 (7%)
 Frame = -3

Query  378  LTSDFLKPAVSARNPLKLPRACM---GKFTC-FERDWLRRDLNVIGFGLIGWIAPSSVPL  211
            L+S FLK  V+A NPL+  +AC    G+FTC F+RDWLRRDLNVIGFGLIGW+APSS+P 
Sbjct  4    LSSGFLKSKVAAVNPLR--QACGTSGGRFTCSFQRDWLRRDLNVIGFGLIGWLAPSSIPA  61

Query  210  INGKSLTGLFFDSIGTELSHWPTGPALTSQF  118
            I+G SL+GLFF SIG EL+H+PT PA+TSQF
Sbjct  62   IDGNSLSGLFFSSIGEELAHFPTPPAVTSQF  92



>gb|ADI45847.1| sex-linked protein 9 [Silene latifolia]
Length=88

 Score =   118 bits (296),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 61/90 (68%), Positives = 74/90 (82%), Gaps = 6/90 (7%)
 Frame = -3

Query  375  TSDFLKPAVSARNPLKLPRACM---GKFTC-FERDWLRRDLNVIGFGLIGWIAPSSVPLI  208
            +S FLK  V+A NPL+  +AC    G+FTC F+RDWLRRDLNVIGFGLIGW+APSS+P I
Sbjct  1    SSGFLKSKVAAVNPLR--QACGTSGGRFTCSFQRDWLRRDLNVIGFGLIGWLAPSSIPAI  58

Query  207  NGKSLTGLFFDSIGTELSHWPTGPALTSQF  118
            +G SL+GLFF SIG EL+H+PT PA+TSQF
Sbjct  59   DGNSLSGLFFSSIGEELAHFPTPPAVTSQF  88



>ref|XP_006417696.1| hypothetical protein EUTSA_v10009047mg [Eutrema salsugineum]
 gb|ESQ36049.1| hypothetical protein EUTSA_v10009047mg [Eutrema salsugineum]
Length=101

 Score =   118 bits (296),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 72/146 (49%), Positives = 81/146 (55%), Gaps = 47/146 (32%)
 Frame = -3

Query  465  MAATLCAASTVVGLATSSLPRLSSPNKLFLTSDFLKPAVSARNPLKLPRACMGKFTCFER  286
            MAAT    STV+GL  SS+    SP     +S FLKP + A+NPL+L  A  G+FTC   
Sbjct  1    MAATFTTPSTVIGLGGSSV----SPRPF--SSSFLKPTLRAKNPLRLAGASGGRFTC---  51

Query  285  DWLRRDLNVIGFGLIGWIAPSSVPLINGKSLTGLFFDSIGTELSHWPTGPALTSQFWLWL  106
                                                  IGTEL+H+PT PALTSQFWLWL
Sbjct  52   --------------------------------------IGTELAHFPTPPALTSQFWLWL  73

Query  105  VCWHLGLFLCLTFGQIGFKGRTEDYF  28
            V WHLGLFLCLTFGQIGFKGRTEDYF
Sbjct  74   VTWHLGLFLCLTFGQIGFKGRTEDYF  99



>gb|ADI45845.1| sex-linked protein 9 [Silene latifolia]
 gb|ADI45850.1| sex-linked protein 9 [Silene latifolia]
 gb|ADI45851.1| sex-linked protein 9 [Silene latifolia]
 gb|ADI45852.1| sex-linked protein 9 [Silene latifolia]
 gb|ADI45853.1| sex-linked protein 9 [Silene latifolia]
 gb|ADI45854.1| sex-linked protein 9 [Silene latifolia]
 gb|ADI45855.1| sex-linked protein 9 [Silene latifolia]
 gb|ADI45856.1| sex-linked protein 9 [Silene latifolia]
 gb|ADI45858.1| sex-linked protein 9 [Silene latifolia]
 gb|ADI45860.1| sex-linked protein 9 [Silene latifolia]
 gb|ADI45863.1| sex-linked protein 9 [Silene latifolia]
 gb|ADI45864.1| sex-linked protein 9 [Silene latifolia]
 gb|ADI45865.1| sex-linked protein 9 [Silene latifolia]
 gb|ADI45867.1| sex-linked protein 9 [Silene latifolia]
 gb|ADI45868.1| sex-linked protein 9 [Silene latifolia]
 gb|ADI45870.1| sex-linked protein 9 [Silene latifolia]
 gb|ADI45872.1| sex-linked protein 9 [Silene latifolia]
 gb|ADI45874.1| sex-linked protein 9 [Silene latifolia]
 gb|ADI45875.1| sex-linked protein 9 [Silene latifolia]
 gb|ADI45876.1| sex-linked protein 9 [Silene latifolia]
 gb|ADI45878.1| sex-linked protein 9 [Silene latifolia]
 gb|ADI45886.1| sex-linked protein 9 [Silene latifolia]
 gb|ADI45887.1| sex-linked protein 9 [Silene latifolia]
Length=85

 Score =   116 bits (291),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 60/87 (69%), Positives = 72/87 (83%), Gaps = 6/87 (7%)
 Frame = -3

Query  366  FLKPAVSARNPLKLPRACM---GKFTC-FERDWLRRDLNVIGFGLIGWIAPSSVPLINGK  199
            FLK  V+A NPL+  +AC    G+FTC F+RDWLRRDLNVIGFGLIGW+APSS+P I+G 
Sbjct  1    FLKSKVAAVNPLR--QACGTSGGRFTCSFQRDWLRRDLNVIGFGLIGWLAPSSIPAIDGN  58

Query  198  SLTGLFFDSIGTELSHWPTGPALTSQF  118
            SL+GLFF SIG EL+H+PT PA+TSQF
Sbjct  59   SLSGLFFSSIGEELAHFPTPPAVTSQF  85



>gb|ADI45883.1| sex-linked protein 9 [Silene latifolia]
Length=85

 Score =   115 bits (288),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 60/87 (69%), Positives = 72/87 (83%), Gaps = 6/87 (7%)
 Frame = -3

Query  366  FLKPAVSARNPLKLPRACM---GKFTC-FERDWLRRDLNVIGFGLIGWIAPSSVPLINGK  199
            FLK  V+A NPL+  +AC    G+FTC F+RDWLRRDLNVIGFGLIGW+APSS+P I+G 
Sbjct  1    FLKLKVAAVNPLR--QACGTSGGRFTCSFQRDWLRRDLNVIGFGLIGWLAPSSIPAIDGN  58

Query  198  SLTGLFFDSIGTELSHWPTGPALTSQF  118
            SL+GLFF SIG EL+H+PT PA+TSQF
Sbjct  59   SLSGLFFSSIGEELAHFPTPPAVTSQF  85



>ref|XP_011398024.1| hypothetical protein F751_0065 [Auxenochlorella protothecoides]
 gb|KFM22391.1| hypothetical protein F751_0065 [Auxenochlorella protothecoides]
Length=130

 Score =   107 bits (266),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 52/88 (59%), Positives = 64/88 (73%), Gaps = 2/88 (2%)
 Frame = -3

Query  285  DWLRRDLNVIGFGLIGWIAPSS--VPLINGKSLTGLFFDSIGTELSHWPTGPALTSQFWL  112
             WL+++  VI  G +GW APS+  VP + GKSL GLF +SIG ELSH+P GPALT  FWL
Sbjct  42   QWLKKEPIVILAGFLGWFAPSNIGVPALGGKSLFGLFSESIGQELSHFPVGPALTDNFWL  101

Query  111  WLVCWHLGLFLCLTFGQIGFKGRTEDYF  28
            +LV WH+GLFL L  GQIG +GR + YF
Sbjct  102  YLVTWHVGLFLTLFLGQIGVRGRAQGYF  129



>gb|KIZ07152.1| hypothetical protein MNEG_0799 [Monoraphidium neglectum]
Length=127

 Score =   103 bits (256),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 49/88 (56%), Positives = 61/88 (69%), Gaps = 2/88 (2%)
 Frame = -3

Query  285  DWLRRDLNVIGFGLIGWIAPSS--VPLINGKSLTGLFFDSIGTELSHWPTGPALTSQFWL  112
            +WL++D  VIG   +GW  PS+   P   G SL GLF  SI   L+H+PTGPALT +FWL
Sbjct  40   EWLKKDPLVIGASFLGWTIPSASPAPAFGGDSLFGLFTASISENLAHFPTGPALTDKFWL  99

Query  111  WLVCWHLGLFLCLTFGQIGFKGRTEDYF  28
            +L+ WHLGLFL LT GQIG +GR + YF
Sbjct  100  YLITWHLGLFLALTLGQIGVQGRKQGYF  127



>ref|XP_002950988.1| photosystem I reaction center subunit O [Volvox carteri f. nagariensis]
 gb|EFJ47882.1| photosystem I reaction center subunit O [Volvox carteri f. nagariensis]
Length=126

 Score = 99.8 bits (247),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 50/112 (45%), Positives = 69/112 (62%), Gaps = 5/112 (4%)
 Frame = -3

Query  360  KPAVSARNPLKLPRACMGKFTCFERDWLRRDLNVIGFGLIGWIAPSSVPL--INGKSLTG  187
            +P VS R  +    A       F RDW++ D  V   G  GW  PS++ +    G+SL G
Sbjct  17   RPRVSRRAVIVRAEASN---KAFPRDWIKSDPLVPVLGFAGWTIPSNIGVSGFGGQSLFG  73

Query  186  LFFDSIGTELSHWPTGPALTSQFWLWLVCWHLGLFLCLTFGQIGFKGRTEDY  31
            LF  SIG +L+H+PTGPAL  +FWL+++ WH+GLFL +T GQIG +GR + Y
Sbjct  74   LFTQSIGEQLAHFPTGPALDDKFWLYMITWHVGLFLTITLGQIGVQGRKQGY  125



>ref|XP_001700109.1| photosystem I subunit O [Chlamydomonas reinhardtii]
 gb|EDO98403.1| photosystem I subunit O [Chlamydomonas reinhardtii]
Length=126

 Score = 95.1 bits (235),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 45/91 (49%), Positives = 61/91 (67%), Gaps = 2/91 (2%)
 Frame = -3

Query  297  CFERDWLRRDLNVIGFGLIGWIAPSSVPL--INGKSLTGLFFDSIGTELSHWPTGPALTS  124
             F RDW++ D  V   G  GW  P+++ +    G+SL GLF  SIG  L+H+PTGPAL  
Sbjct  35   SFPRDWVKTDPLVPVLGFAGWTIPANIGVSAFGGQSLFGLFTQSIGENLAHFPTGPALDD  94

Query  123  QFWLWLVCWHLGLFLCLTFGQIGFKGRTEDY  31
            +FWL+L+ +HLGLFL +T GQIG +GR + Y
Sbjct  95   KFWLYLITYHLGLFLTITLGQIGVQGRKQGY  125



>gb|ABA01097.1| chloroplast putative 16 kDa membrane protein [Chlamydomonas incerta]
Length=126

 Score = 94.0 bits (232),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 44/91 (48%), Positives = 61/91 (67%), Gaps = 2/91 (2%)
 Frame = -3

Query  297  CFERDWLRRDLNVIGFGLIGWIAPSSVPL--INGKSLTGLFFDSIGTELSHWPTGPALTS  124
             F RDW++ D  V   G  GW  P+++ +    G+SL GLF  SIG  L+H+PTGPAL  
Sbjct  35   SFPRDWVKTDPLVPVLGFAGWTIPANIGVSGFGGQSLFGLFTQSIGENLAHFPTGPALDD  94

Query  123  QFWLWLVCWHLGLFLCLTFGQIGFKGRTEDY  31
            +FWL+L+ +H+GLFL +T GQIG +GR + Y
Sbjct  95   KFWLYLITYHVGLFLTITLGQIGVQGRKQGY  125



>ref|XP_002507508.1| photosystem I subunit O [Micromonas sp. RCC299]
 gb|ACO68766.1| photosystem I subunit O [Micromonas sp. RCC299]
Length=143

 Score = 92.8 bits (229),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 57/153 (37%), Positives = 78/153 (51%), Gaps = 18/153 (12%)
 Frame = -3

Query  465  MAATLCAASTVVGLATSSLPRLSSPNKLFLTSDFLKPAVSARNPLKLPR-----ACMGKF  301
            MAAT C +S           R  +P +L      L+  VS   P K PR     A   + 
Sbjct  1    MAATSCISSI----------RAPAPVRLATRRSGLR-GVSRVTPQKKPRGRATLAVASES  49

Query  300  TCFERDWLRRDLNVIGFGLIGWIAPSSVPL--INGKSLTGLFFDSIGTELSHWPTGPALT  127
              F+ DWL+ D  V    L GW  PS + +      SL   F DSIG+ L+++P GP L 
Sbjct  50   KTFDDDWLKADTTVHLLTLFGWSIPSGIAIKAYGDTSLLAAFADSIGSNLANFPQGPGLD  109

Query  126  SQFWLWLVCWHLGLFLCLTFGQIGFKGRTEDYF  28
             +FWL+L+ WH+GLF  +  GQIG++GR + YF
Sbjct  110  DKFWLYLITWHIGLFSTMLLGQIGWQGRKQGYF  142



>ref|XP_007509339.1| sex-linked protein 9 [Bathycoccus prasinos]
 emb|CCO19796.1| sex-linked protein 9 [Bathycoccus prasinos]
Length=147

 Score = 90.1 bits (222),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 54/150 (36%), Positives = 81/150 (54%), Gaps = 7/150 (5%)
 Frame = -3

Query  465  MAATLCAASTVVGLATSSLPRLSSPNKLFLTSDFLKPAV-SARNPLKLPRACMGKFTCFE  289
            M ++   A+  V   T++L   S  + + +T    K ++ S R    + RA     T F+
Sbjct  1    MLSSASCATVAVRARTANLN--SRRSGVLVTKGLKKTSIRSPRGKYGILRAASNNNT-FD  57

Query  288  RDWLRRDLNVIGFGLIGWIAPSSVP---LINGKSLTGLFFDSIGTELSHWPTGPALTSQF  118
             DWL+ ++ V    L GW  PS+ P     N  SL  +   S+   LSH+PTGPAL  +F
Sbjct  58   DDWLKAEVPVHLLTLFGWTIPSASPCPAFENNNSLFFMLCQSVSENLSHFPTGPALDDKF  117

Query  117  WLWLVCWHLGLFLCLTFGQIGFKGRTEDYF  28
            WL+L+ WH+GLF  +  GQIG++GR + YF
Sbjct  118  WLYLITWHVGLFTTMLLGQIGYQGRKQGYF  147



>ref|XP_005845862.1| hypothetical protein CHLNCDRAFT_14460, partial [Chlorella variabilis]
 gb|EFN53760.1| hypothetical protein CHLNCDRAFT_14460, partial [Chlorella variabilis]
Length=84

 Score = 88.2 bits (217),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 44/84 (52%), Positives = 55/84 (65%), Gaps = 2/84 (2%)
 Frame = -3

Query  282  WLRRDLNVIGFGLIGWIAPS--SVPLINGKSLTGLFFDSIGTELSHWPTGPALTSQFWLW  109
            WL +D      G +GW APS  +VP    +SL G F  SIG EL+H+PTGPALT  FWL 
Sbjct  1    WLNKDPVAFMAGFLGWFAPSNIAVPAFGNQSLFGAFTKSIGEELAHFPTGPALTDDFWLL  60

Query  108  LVCWHLGLFLCLTFGQIGFKGRTE  37
            +V WH+GLF CL +GQIG + R +
Sbjct  61   MVTWHMGLFACLFWGQIGVQARKQ  84



>ref|XP_003056041.1| photosystem I subunit O [Micromonas pusilla CCMP1545]
 gb|EEH59417.1| photosystem I subunit O [Micromonas pusilla CCMP1545]
Length=147

 Score = 86.3 bits (212),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 50/148 (34%), Positives = 73/148 (49%), Gaps = 4/148 (3%)
 Frame = -3

Query  465  MAATLCAASTVVGLATSSLPRLSSPNKLFLTSDFLKPAVSARNPLKLPRACMGKFTCFER  286
            MAA +C +   +GL   S       N L       +     R    +    + +   F+ 
Sbjct  1    MAALICVSG--LGLNRPSEIASQRSNILARQGFLSRGGARTRTYRAVLPTTVAESKTFDD  58

Query  285  DWLRRDLNVIGFGLIGWIAPSSVPL--INGKSLTGLFFDSIGTELSHWPTGPALTSQFWL  112
            DWL+ +  V    L GW  PS V +      SL   F DSIG  L+++P GPA+  +FWL
Sbjct  59   DWLKAESTVHLLTLFGWTVPSGVAIKAYGDTSLLAAFADSIGNNLANFPQGPAIDDKFWL  118

Query  111  WLVCWHLGLFLCLTFGQIGFKGRTEDYF  28
            +L+ WH+GLF  +  GQIG++GR + YF
Sbjct  119  YLITWHIGLFSTMLLGQIGWQGRKQGYF  146



>ref|XP_001416278.1| possible psaO, PSI-O, photosystem I polypeptide [Ostreococcus 
lucimarinus CCE9901]
 gb|ABO94571.1| possible psaO, PSI-O, photosystem I polypeptide [Ostreococcus 
lucimarinus CCE9901]
Length=135

 Score = 85.5 bits (210),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 38/92 (41%), Positives = 55/92 (60%), Gaps = 3/92 (3%)
 Frame = -3

Query  294  FERDWLRRDLNVIGFGLIGWIAPSSVP---LINGKSLTGLFFDSIGTELSHWPTGPALTS  124
            F+ DW +  + V    L GW+ PS+ P     N  SL  +F D IG  L+++P GPA   
Sbjct  43   FDDDWKKSSVPVHLASLFGWVVPSASPCPAFENNASLFQVFSDRIGANLANFPQGPAADD  102

Query  123  QFWLWLVCWHLGLFLCLTFGQIGFKGRTEDYF  28
            + WL+++ WH+GLF C+ FGQIG + R + YF
Sbjct  103  KIWLYMLTWHMGLFACMMFGQIGVQARKQGYF  134



>emb|CEG01290.1| unnamed product [Ostreococcus tauri]
Length=136

 Score = 84.7 bits (208),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 37/92 (40%), Positives = 55/92 (60%), Gaps = 3/92 (3%)
 Frame = -3

Query  294  FERDWLRRDLNVIGFGLIGWIAPSSVP---LINGKSLTGLFFDSIGTELSHWPTGPALTS  124
            F+ DW + ++ V    L GW+ PS+ P     +  SL  +F D I   L+H+PTGP+   
Sbjct  43   FDDDWKKSNVAVHLASLFGWVIPSASPCPAFPDNASLFKVFSDRISENLAHFPTGPSADD  102

Query  123  QFWLWLVCWHLGLFLCLTFGQIGFKGRTEDYF  28
              WL+++ WH+GLF C+ FGQIG + R + YF
Sbjct  103  PIWLYMLTWHMGLFACMMFGQIGVQARKQGYF  134



>ref|XP_003075355.1| unnamed protein product [Ostreococcus tauri]
Length=259

 Score = 84.3 bits (207),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/92 (40%), Positives = 55/92 (60%), Gaps = 3/92 (3%)
 Frame = -3

Query  294  FERDWLRRDLNVIGFGLIGWIAPSSVP---LINGKSLTGLFFDSIGTELSHWPTGPALTS  124
            F+ DW + ++ V    L GW+ PS+ P     +  SL  +F D I   L+H+PTGP+   
Sbjct  166  FDDDWKKSNVAVHLASLFGWVIPSASPCPAFPDNASLFKVFSDRISENLAHFPTGPSADD  225

Query  123  QFWLWLVCWHLGLFLCLTFGQIGFKGRTEDYF  28
              WL+++ WH+GLF C+ FGQIG + R + YF
Sbjct  226  PIWLYMLTWHMGLFACMMFGQIGVQARKQGYF  257



>ref|XP_005647319.1| photosystem I PsaO [Coccomyxa subellipsoidea C-169]
 gb|EIE22775.1| photosystem I PsaO [Coccomyxa subellipsoidea C-169]
Length=142

 Score = 82.0 bits (201),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 42/113 (37%), Positives = 63/113 (56%), Gaps = 4/113 (4%)
 Frame = -3

Query  363  LKPAVSARNPLKLPRACMGKFTCFERDWLRRDLNVIGFGLIGWIAPSSVPL--INGKSLT  190
            + P + +  P +    C G+   +  +WL +D  V   G +GW  P+++ +    G SL 
Sbjct  31   VAPRIRSAAPARNVTICAGQ--EYPSNWLNKDPLVFVLGFLGWTIPANIGVSAFGGNSLF  88

Query  189  GLFFDSIGTELSHWPTGPALTSQFWLWLVCWHLGLFLCLTFGQIGFKGRTEDY  31
            G F  SIG  L+ +P GP +  +FWL LV +H+GLFL L  GQIG +GR + Y
Sbjct  89   GSFTQSIGENLARFPQGPPIQDKFWLLLVTYHVGLFLTLLLGQIGVQGRKQGY  141



>ref|XP_005704648.1| photosystem I subunit O precursor [Galdieria sulphuraria]
 gb|EME28128.1| photosystem I subunit O precursor [Galdieria sulphuraria]
Length=149

 Score = 76.3 bits (186),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 36/74 (49%), Positives = 49/74 (66%), Gaps = 4/74 (5%)
 Frame = -3

Query  261  VIGFGLIGWI----APSSVPLINGKSLTGLFFDSIGTELSHWPTGPALTSQFWLWLVCWH  94
            VI   L+GW      PS++P+++G  LT  FF SI + L+ WP GPAL   FWL++V WH
Sbjct  69   VIIVALLGWTLPASIPSNIPILHGTGLTQAFFTSIQSNLAEWPKGPALDDPFWLYMVLWH  128

Query  93   LGLFLCLTFGQIGF  52
            +GLF+ L FG IG+
Sbjct  129  VGLFIVLFFGTIGY  142



>ref|XP_005711818.1| unnamed protein product [Chondrus crispus]
 emb|CDF32153.1| unnamed protein product [Chondrus crispus]
Length=146

 Score = 75.9 bits (185),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 36/91 (40%), Positives = 49/91 (54%), Gaps = 4/91 (4%)
 Frame = -3

Query  303  FTCFERDWLRRDLNVIGFGLIGWIAPSSVP----LINGKSLTGLFFDSIGTELSHWPTGP  136
            F   E    + DL ++   ++GW+ PSS+P    L  G  LT  FF S+   L+++P GP
Sbjct  52   FEISEGVEFKLDLTILILAIVGWVVPSSIPAGIPLTEGSGLTQAFFASMNANLANFPKGP  111

Query  135  ALTSQFWLWLVCWHLGLFLCLTFGQIGFKGR  43
            A    FW  L  WH GLF C+ FG IG+  R
Sbjct  112  AGDDPFWTLLFLWHTGLFACMIFGTIGYNSR  142



>ref|XP_005537773.1| hypothetical protein, conserved [Cyanidioschyzon merolae strain 
10D]
 dbj|BAM81737.1| hypothetical protein, conserved [Cyanidioschyzon merolae strain 
10D]
Length=155

 Score = 74.7 bits (182),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 49/82 (60%), Gaps = 4/82 (5%)
 Frame = -3

Query  261  VIGFGLIGWIA----PSSVPLINGKSLTGLFFDSIGTELSHWPTGPALTSQFWLWLVCWH  94
            VI   LIGW A    PS++P++ G  LT  F  SI   L+ +PTGP L   FW +L+ +H
Sbjct  70   VIFIALIGWSAVAAIPSNIPVLGGTGLTQAFLASIQRLLAQYPTGPKLDDPFWFYLIVYH  129

Query  93   LGLFLCLTFGQIGFKGRTEDYF  28
            +GLF  L FGQIG+ G  +  +
Sbjct  130  VGLFALLIFGQIGYAGYAKGTY  151



>emb|CAH04628.1| photosystem I subunit O precursor [Guillardia theta]
Length=145

 Score = 67.4 bits (163),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 39/109 (36%), Positives = 52/109 (48%), Gaps = 13/109 (12%)
 Frame = -3

Query  333  LKLPRACMGKFTCFERDWLRRD--------LNVIGFGLIGWI-----APSSVPLINGKSL  193
            L+  RA  G  +   +++   D          V   G +GW+      PS++PL  GK L
Sbjct  31   LRSGRAAQGALSLKAKEFEMSDGTPYKISVAPVAAIGFVGWVLPTVLIPSNIPLYGGKGL  90

Query  192  TGLFFDSIGTELSHWPTGPALTSQFWLWLVCWHLGLFLCLTFGQIGFKG  46
            T  F  SI   L+ +P  PALT  FWL    WH GLF  + FG IG+ G
Sbjct  91   TAAFASSIAENLAKFPAPPALTDPFWLLCFIWHSGLFAVMMFGSIGWNG  139



>gb|ADI45888.1| sex-linked protein 9, partial [Silene latifolia]
Length=52

 Score = 48.1 bits (113),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 33/44 (75%), Gaps = 6/44 (14%)
 Frame = -3

Query  378  LTSDFLKPAVSARNPLKLPRACM---GKFTC-FERDWLRRDLNV  259
            L+S FLK  V+A NPL+  +AC    G+FTC F+RDWLRRDLNV
Sbjct  11   LSSGFLKSKVAAVNPLR--QACGTSGGRFTCSFQRDWLRRDLNV  52



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 564765596140