BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF008O09

Length=717
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KDO63479.1|  hypothetical protein CISIN_1g013492mg                   307   8e-101   Citrus sinensis [apfelsine]
gb|KJB11770.1|  hypothetical protein B456_001G276400                    306   2e-100   Gossypium raimondii
gb|AEH04452.1|  glyceraldehyde-3-phosphate dehydrogenase                308   8e-100   Arachis hypogaea [goober]
ref|XP_010425376.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    304   3e-99    Camelina sativa [gold-of-pleasure]
ref|XP_006446865.1|  hypothetical protein CICLE_v10015476mg             306   4e-99    Citrus clementina [clementine]
gb|KJB70724.1|  hypothetical protein B456_011G088800                    303   4e-99    Gossypium raimondii
ref|XP_006468948.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    306   4e-99    Citrus sinensis [apfelsine]
ref|XP_010502598.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    303   6e-99    Camelina sativa [gold-of-pleasure]
ref|XP_008449974.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    306   7e-99    Cucumis melo [Oriental melon]
ref|XP_008449975.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    306   7e-99    Cucumis melo [Oriental melon]
gb|ADX97321.1|  glyceraldehyde-3-phosphate dehydrogenase                305   1e-98    Mangifera indica
ref|XP_011033706.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    305   2e-98    Populus euphratica
ref|XP_010090946.1|  Glyceraldehyde-3-phosphate dehydrogenase A         304   3e-98    Morus notabilis
ref|XP_002321065.2|  hypothetical protein POPTR_0014s13660g             304   3e-98    Populus trichocarpa [western balsam poplar]
ref|XP_010528120.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    300   3e-98    Tarenaya hassleriana [spider flower]
gb|KFK33590.1|  hypothetical protein AALP_AA5G033500                    304   4e-98    Arabis alpina [alpine rockcress]
ref|XP_011003600.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    304   4e-98    Populus euphratica
gb|KJB11771.1|  hypothetical protein B456_001G276400                    304   5e-98    Gossypium raimondii
emb|CDX83635.1|  BnaC07g23750D                                          303   5e-98    
ref|XP_009800449.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    303   6e-98    Nicotiana sylvestris
ref|XP_006652372.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    303   7e-98    
ref|XP_006652373.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    303   7e-98    Oryza brachyantha
ref|XP_007032095.1|  Glyceraldehyde 3-phosphate dehydrogenase A s...    303   8e-98    Theobroma cacao [chocolate]
ref|XP_009152035.1|  PREDICTED: LOW QUALITY PROTEIN: glyceraldehy...    303   1e-97    Brassica rapa
ref|XP_004231523.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    303   1e-97    Solanum lycopersicum
ref|XP_008231212.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    303   1e-97    Prunus mume [ume]
ref|XP_008797069.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    304   1e-97    
ref|XP_007217883.1|  hypothetical protein PRUPE_ppa006610mg             302   1e-97    Prunus persica
ref|XP_009420999.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    302   2e-97    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009631078.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    302   2e-97    Nicotiana tomentosiformis
ref|XP_003548805.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    302   2e-97    
emb|CCF55355.1|  Glyceraldehyde-3-phosphate dehydrogenase A             302   2e-97    Cucumis sativus [cucumbers]
gb|KDP41897.1|  hypothetical protein JCGZ_26915                         302   2e-97    Jatropha curcas
gb|KHN46819.1|  Glyceraldehyde-3-phosphate dehydrogenase A, chlor...    302   2e-97    Glycine soja [wild soybean]
gb|KHN46369.1|  Glyceraldehyde-3-phosphate dehydrogenase A, chlor...    302   2e-97    Glycine soja [wild soybean]
ref|NP_001238484.1|  glyceraldehyde-3-phosphate dehydrogenase A s...    302   2e-97    
gb|ABK96233.1|  unknown                                                 302   3e-97    Populus trichocarpa x Populus deltoides
ref|XP_008379036.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    302   3e-97    Malus domestica [apple tree]
ref|XP_009404713.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    301   3e-97    Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY13649.1|  BnaA06g32740D                                          301   3e-97    Brassica napus [oilseed rape]
gb|KJB70723.1|  hypothetical protein B456_011G088800                    301   4e-97    Gossypium raimondii
ref|XP_004161334.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    301   4e-97    
ref|XP_010514317.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    301   4e-97    
ref|XP_004145622.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    301   5e-97    
ref|XP_006395535.1|  hypothetical protein EUTSA_v10004349mg             301   5e-97    Eutrema salsugineum [saltwater cress]
emb|CDY28536.1|  BnaC02g36240D                                          300   5e-97    Brassica napus [oilseed rape]
ref|XP_010425375.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    301   5e-97    Camelina sativa [gold-of-pleasure]
ref|XP_010250427.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    301   6e-97    Nelumbo nucifera [Indian lotus]
gb|AAD10209.1|  glyceraldehyde 3-phosphate dehydrogenase A subunit      299   6e-97    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010249379.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    301   6e-97    Nelumbo nucifera [Indian lotus]
ref|XP_010502597.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    301   6e-97    Camelina sativa [gold-of-pleasure]
gb|ABW89099.1|  glyceraldehyde-3-phosphate dehydrogenase                294   7e-97    Helianthus annuus
ref|XP_009378072.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    299   7e-97    Pyrus x bretschneideri [bai li]
pdb|3K2B|A  Chain A, Crystal Structure Of Photosynthetic A4 Isofo...    298   7e-97    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002512790.1|  glyceraldehyde 3-phosphate dehydrogenase, pu...    301   8e-97    Ricinus communis
gb|AAA32793.1|  glyceraldehyde 3-phosphate dehydrogenase                300   8e-97    Arabidopsis thaliana [mouse-ear cress]
dbj|BAP91041.1|  glyceraldehyde 3-phosphate dehydrogenase-A             300   8e-97    Nicotiana benthamiana
ref|XP_006291258.1|  hypothetical protein CARUB_v10017390mg             300   9e-97    Capsella rubella
ref|XP_002875330.1|  gapa                                               300   9e-97    Arabidopsis lyrata subsp. lyrata
ref|XP_009378071.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    300   1e-96    Pyrus x bretschneideri [bai li]
ref|NP_566796.2|  glyceraldehyde-3-phosphate dehydrogenase A subunit    300   1e-96    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004236849.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    300   1e-96    Solanum lycopersicum
ref|XP_004493116.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    300   1e-96    Cicer arietinum [garbanzo]
gb|ACU21011.1|  unknown                                                 300   1e-96    Glycine max [soybeans]
ref|XP_011070460.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    300   1e-96    Sesamum indicum [beniseed]
ref|XP_006386825.1|  hypothetical protein POPTR_0002s22600g             300   1e-96    
ref|XP_008362077.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    300   1e-96    Malus domestica [apple tree]
gb|ABK96725.1|  unknown                                                 300   2e-96    Populus trichocarpa x Populus deltoides
gb|AHZ94971.1|  glyceraldehyde-3-phosphate dehydrogenase                298   2e-96    Lilium regale
ref|NP_001052984.1|  Os04g0459500                                       300   2e-96    
gb|ABG35250.1|  glyceraldehyde-3-phosphate dehydrogenase                293   2e-96    Helianthus annuus
ref|XP_006359279.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    299   3e-96    Solanum tuberosum [potatoes]
ref|XP_010528117.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    299   3e-96    Tarenaya hassleriana [spider flower]
gb|ABG35254.1|  glyceraldehyde-3-phosphate dehydrogenase                293   3e-96    Helianthus annuus
ref|XP_006844714.1|  hypothetical protein AMTR_s00016p00251680          298   4e-96    Amborella trichopoda
ref|NP_001289256.1|  glyceraldehyde-3-phosphate dehydrogenase A, ...    299   4e-96    Pyrus x bretschneideri [bai li]
gb|ABK94956.1|  unknown                                                 298   6e-96    Populus trichocarpa [western balsam poplar]
gb|AEO45783.1|  glyceraldehyde-3-phosphate dehydrogenase A              298   8e-96    Scoparia dulcis [escobilla]
gb|ABG35267.1|  glyceraldehyde-3-phosphate dehydrogenase                291   9e-96    Helianthus annuus
ref|XP_007161788.1|  hypothetical protein PHAVU_001G098100g             297   1e-95    Phaseolus vulgaris [French bean]
dbj|BAJ34149.1|  unnamed protein product                                296   3e-95    Eutrema halophilum
ref|XP_009118049.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    293   3e-95    Brassica rapa
gb|KDO63477.1|  hypothetical protein CISIN_1g013492mg                   297   3e-95    Citrus sinensis [apfelsine]
ref|XP_010028899.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    296   3e-95    Eucalyptus grandis [rose gum]
ref|XP_010942312.1|  PREDICTED: LOW QUALITY PROTEIN: glyceraldehy...    298   4e-95    
gb|AGJ50596.1|  GAPDH                                                   296   4e-95    Pericallis cruenta
emb|CDY48981.1|  BnaA02g28150D                                          295   5e-95    Brassica napus [oilseed rape]
ref|XP_004975847.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    295   7e-95    Setaria italica
ref|XP_009148557.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    292   9e-95    
ref|NP_001077529.1|  glyceraldehyde 3-phosphate dehydrogenase GAPA2     292   1e-94    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010476270.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    292   1e-94    Camelina sativa [gold-of-pleasure]
sp|P09672.1|G3PA_SINAL  RecName: Full=Glyceraldehyde-3-phosphate ...    289   1e-94    Sinapis alba [bai jie]
ref|XP_010494750.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    291   2e-94    Camelina sativa [gold-of-pleasure]
ref|XP_004304578.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    295   2e-94    Fragaria vesca subsp. vesca
tpg|DAA37469.1|  TPA: glyceraldehyde-3-phosphate dehydrogenase1         294   2e-94    
gb|ACT21568.1|  glyceraldehyde-3-phosphate dehydrogenase                295   2e-94    Bruguiera gymnorhiza [Burma mangrove]
ref|XP_010660642.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    294   2e-94    
ref|XP_002278352.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    294   2e-94    Vitis vinifera
ref|XP_010929533.1|  PREDICTED: LOW QUALITY PROTEIN: glyceraldehy...    289   2e-94    
ref|XP_003624553.1|  Glyceraldehyde-3-phosphate dehydrogenase A         294   3e-94    Medicago truncatula
emb|CAN78872.1|  hypothetical protein VITISV_021726                     294   3e-94    Vitis vinifera
emb|CAA30152.1|  GADPH (383 AA)                                         293   4e-94    Zea mays [maize]
emb|CAA33264.1|  unnamed protein product                                294   4e-94    Pisum sativum [garden pea]
ref|NP_001105414.1|  glyceraldehyde-3-phosphate dehydrogenase A, ...    294   4e-94    Zea mays [maize]
sp|P12858.2|G3PA_PEA  RecName: Full=Glyceraldehyde-3-phosphate de...    293   4e-94    Pisum sativum [garden pea]
gb|EPS59235.1|  hypothetical protein M569_15573                         293   6e-94    Genlisea aurea
ref|XP_003579898.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    293   6e-94    Brachypodium distachyon [annual false brome]
dbj|BAK02737.1|  predicted protein                                      290   7e-94    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ACV32597.1|  putative glyceraldehyde-3-phosphate dehydrogenase       293   7e-94    Medicago sativa [alfalfa]
ref|XP_002970103.1|  hypothetical protein SELMODRAFT_270825             292   1e-93    Selaginella moellendorffii
pdb|1RM3|O  Chain O, Crystal Structure Of Mutant T33a Of Photosyn...    290   2e-93    Spinacia oleracea
pdb|1RM5|O  Chain O, Crystal Structure Of Mutant S188a Of Photosy...    290   2e-93    Spinacia oleracea
pdb|1NBO|O  Chain O, The Dual Coenzyme Specificity Of Photosynthe...    290   2e-93    Spinacia oleracea
pir||DESPGA  glyceraldehyde-3-phosphate dehydrogenase (NADP)  (ph...    290   2e-93    Spinacia oleracea
emb|CDY26599.1|  BnaA09g46780D                                          291   2e-93    Brassica napus [oilseed rape]
emb|CDY16038.1|  BnaC08g40850D                                          291   2e-93    Brassica napus [oilseed rape]
gb|KFK43560.1|  hypothetical protein AALP_AA1G142100                    291   3e-93    Arabis alpina [alpine rockcress]
gb|AIU56856.1|  glyceraldehyde-3-phosphate dehydrogenase A              289   3e-93    Brassica rapa subsp. chinensis [bok-choy]
pdb|2PKR|O  Chain O, Crystal Structure Of (a+cte)4 Chimeric Form ...    290   3e-93    Spinacia oleracea
sp|P19866.2|G3PA_SPIOL  RecName: Full=Glyceraldehyde-3-phosphate ...    291   3e-93    Spinacia oleracea
ref|XP_002985183.1|  hypothetical protein SELMODRAFT_181561             291   4e-93    Selaginella moellendorffii
ref|XP_009118048.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    291   5e-93    Brassica rapa
dbj|BAG68209.1|  glyceraldehyde-3-phosphate dehydrogenase               288   8e-93    Brassica rapa subsp. chinensis [bok-choy]
pdb|1JN0|O  Chain O, Crystal Structure Of The Non-regulatory A4 I...    288   1e-92    Spinacia oleracea
ref|NP_001117276.1|  glyceraldehyde 3-phosphate dehydrogenase GAPA2     288   1e-92    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010694632.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    290   1e-92    Beta vulgaris subsp. vulgaris [field beet]
gb|AFC88822.1|  glyceraldehyde-3-phosphate dehydrogenase-like pro...    287   1e-92    Miscanthus sinensis
ref|NP_172750.1|  glyceraldehyde 3-phosphate dehydrogenase GAPA2        290   1e-92    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009148556.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    289   2e-92    Brassica rapa
ref|XP_002892719.1|  GAPA-2                                             289   2e-92    Arabidopsis lyrata subsp. lyrata
ref|XP_010476269.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    289   2e-92    Camelina sativa [gold-of-pleasure]
dbj|BAJ10475.1|  glyceraldehyde-3-phosphate dehydrogenase               289   2e-92    Brassica rapa subsp. chinensis [bok-choy]
ref|XP_010494747.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    289   2e-92    Camelina sativa [gold-of-pleasure]
dbj|BAJ90530.1|  predicted protein                                      289   2e-92    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ABW89104.1|  glyceraldehyde-3-phosphate dehydrogenase                282   2e-92    Helianthus annuus
dbj|BAJ90885.1|  predicted protein                                      289   2e-92    Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDY19412.1|  BnaC05g09210D                                          289   2e-92    Brassica napus [oilseed rape]
gb|EMT31124.1|  Glyceraldehyde-3-phosphate dehydrogenase A, chlor...    289   2e-92    
gb|ACN39951.1|  unknown                                                 286   3e-92    Picea sitchensis
gb|ACN40537.1|  unknown                                                 289   3e-92    Picea sitchensis
gb|ABK25233.1|  unknown                                                 289   3e-92    Picea sitchensis
gb|EYU35565.1|  hypothetical protein MIMGU_mgv1a005886mg                291   3e-92    Erythranthe guttata [common monkey flower]
ref|XP_006304985.1|  hypothetical protein CARUB_v10009349mg             288   6e-92    
ref|XP_006417176.1|  hypothetical protein EUTSA_v10007809mg             286   7e-92    
ref|XP_006417177.1|  hypothetical protein EUTSA_v10007809mg             287   9e-92    Eutrema salsugineum [saltwater cress]
gb|AAA33780.1|  glyceraldehyde-phosphate dehydrogenase                  287   1e-91    Pinus sylvestris [Scotch pine]
dbj|BAH57068.1|  AT1G12900                                              285   2e-91    Arabidopsis thaliana [mouse-ear cress]
gb|KDO63476.1|  hypothetical protein CISIN_1g013492mg                   288   2e-91    Citrus sinensis [apfelsine]
gb|ACN40000.1|  unknown                                                 287   2e-91    Picea sitchensis
gb|ABK24313.1|  unknown                                                 287   2e-91    Picea sitchensis
gb|AHA84230.1|  glyceraldehyde-3-phosphate dehydrogenase A              285   7e-91    Phaseolus vulgaris [French bean]
gb|ABK00067.1|  chloroplast glyceraldehyde-3-phosphate dehydrogenase    278   4e-89    Chlorokybus atmophyticus
sp|P09043.1|G3PA_TOBAC  RecName: Full=Glyceraldehyde-3-phosphate ...    280   8e-89    Nicotiana tabacum [American tobacco]
gb|ABK00052.1|  chloroplast glyceraldehyde-3-phosphate dehydrogenase    278   9e-89    Marchantia polymorpha
emb|CAC80388.1|  glyceraldehyde-3-phosphate dehydrogenase               279   2e-88    Marchantia polymorpha
gb|ABD37959.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A      276   3e-88    Chlorokybus atmophyticus
ref|XP_008663258.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    273   3e-86    
dbj|BAA94304.1|  NADP-glyceraldehyde-3-phosphate dehydrogenase          272   3e-86    Chlamydomonas sp. W80
gb|ADU04755.1|  glyceraldehyde-3-phosphate dehydrogenase                269   4e-86    Mesostigma viride
ref|XP_008663264.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    271   2e-85    
gb|AFW58485.1|  hypothetical protein ZEAMMB73_956640                    270   3e-85    
gb|ADU04754.1|  glyceraldehyde-3-phosphate dehydrogenase                267   3e-85    Mesostigma viride
gb|ABK00056.1|  chloroplast glyceraldehyde-3-phosphate dehydrogenase    267   5e-85    Mesostigma viride
ref|XP_008664191.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    270   9e-85    Zea mays [maize]
gb|ABD37961.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A      267   1e-84    Mesostigma viride
emb|CAC80372.1|  glyceraldehyde-3-phosphate dehydrogenase               266   1e-84    Capsicum annuum
gb|ABD37956.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A      264   2e-84    Spermatozopsis similis
ref|XP_001771209.1|  predicted protein                                  268   3e-84    
ref|XP_001771246.1|  predicted protein                                  268   4e-84    
ref|XP_003548929.2|  PREDICTED: LOW QUALITY PROTEIN: glyceraldehy...    265   1e-83    
ref|XP_001779769.1|  predicted protein                                  266   2e-83    
gb|ABD37962.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A1     265   3e-83    Physcomitrella patens
ref|XP_001753934.1|  predicted protein                                  266   3e-83    
ref|XP_001779753.1|  predicted protein                                  265   4e-83    
emb|CAC80373.1|  glyceraldehyde-3-phosphate dehydrogenase               261   1e-82    Capsicum annuum
gb|AHZ58488.1|  glyceraldehyde-3-phosphate dehydrogenase                263   1e-82    Syntrichia caninervis
dbj|BAN09110.1|  glyceraldehyde-3-phosphate dehydrogenase               258   4e-82    Artemisia indica
gb|ABA01125.1|  chloroplast glyceraldehyde-3-phosphate dehydrogenase    261   4e-82    Chlamydomonas incerta
ref|XP_007510189.1|  glyceraldehyde-3-phosphate dehydrogenase           262   5e-82    Bathycoccus prasinos
ref|XP_001689871.1|  glyceraldehyde-3-phosphate dehydrogenase           261   6e-82    Chlamydomonas reinhardtii
ref|XP_002955293.1|  hypothetical protein VOLCADRAFT_76662              261   9e-82    Volvox carteri f. nagariensis
gb|ACX37507.1|  chloroplast glyceraldehyde 3-phosphate dehydrogenase    262   1e-81    Botryococcus braunii
gb|ACA35006.1|  glyceraldehyde-3-phosphate dehydrogenase                260   2e-81    Dunaliella salina
gb|ABD37963.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A2     258   3e-81    Physcomitrella patens
ref|XP_001766703.1|  predicted protein                                  259   6e-81    
gb|EMS61784.1|  Glyceraldehyde-3-phosphate dehydrogenase A, chlor...    258   2e-80    Triticum urartu
ref|XP_011399143.1|  Glyceraldehyde-3-phosphate dehydrogenase A, ...    258   5e-80    Auxenochlorella protothecoides
emb|CDP18560.1|  unnamed protein product                                256   1e-79    Coffea canephora [robusta coffee]
ref|XP_005644071.1|  glyceraldehyde-3-phosphate dehydrogenase           255   2e-79    Coccomyxa subellipsoidea C-169
gb|ABD37954.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A      256   2e-79    Cyanophora paradoxa
gb|ABC00187.1|  chloroplast glyceraldehyde-3-phosphate dehydrogenase    254   3e-79    Dunaliella viridis
ref|XP_001420043.1|  predicted protein                                  253   5e-79    Ostreococcus lucimarinus CCE9901
ref|XP_002503470.1|  glyceraldehyde-3-phosphate dehydrogenase a c...    254   6e-79    Micromonas commoda
gb|ABG85190.1|  chloroplast glyceraldehyde-3-phosphate dehydrogen...    254   6e-79    Ostreococcus sp. 'lucimarinus'
gb|ABD37953.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A      251   1e-78    Chlorella sp. JP-2005
ref|XP_003081785.1|  NADP-glyceraldehyde-3-phosphate dehydrogenas...    252   3e-78    
gb|ABG85189.1|  chloroplast glyceraldehyde-3-phosphate dehydrogen...    252   3e-78    Ostreococcus tauri
emb|CAC80392.1|  glyceraldehyde-3-phosphate dehydrogenase               250   4e-78    Spirogyra sp.
ref|XP_003055659.1|  hypothetical protein MICPUCDRAFT_49403             251   6e-78    Micromonas pusilla CCMP1545
gb|ABD37957.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A      251   1e-77    Cladophora rupestris
emb|CAC80394.1|  glyceraldehyde-3-phosphate dehydrogenase               247   1e-77    Sphagnum cuspidatum
emb|CAC80393.1|  glyceraldehyde-3-phosphate dehydrogenase               248   1e-77    Sphagnum cuspidatum
gb|ABD37955.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A      250   3e-77    Scherffelia dubia
gb|AES74101.2|  glyceraldehyde-3-phosphate dehydrogenase B              248   3e-77    Medicago truncatula
gb|KJB57938.1|  hypothetical protein B456_009G186400                    250   4e-77    Gossypium raimondii
emb|CBL43264.1|  glyceraldehyde-3-phosphate dehydrogenase               251   5e-77    Solanum tuberosum [potatoes]
ref|XP_006855683.1|  hypothetical protein AMTR_s00044p00131190          250   5e-77    
ref|XP_009786329.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    251   7e-77    Nicotiana sylvestris
ref|XP_009595874.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    251   7e-77    Nicotiana tomentosiformis
gb|ABD37965.1|  glyceraldehyde-3-phosphate dehydrogenase subunit B      249   7e-77    Mesostigma viride
sp|P09044.1|G3PB_TOBAC  RecName: Full=Glyceraldehyde-3-phosphate ...    250   1e-76    Nicotiana tabacum [American tobacco]
gb|AAG23799.1|  chloroplast NADP-dependent glyceraldehyde 3-phosp...    241   1e-76    Cucurbita pepo
gb|KJB57936.1|  hypothetical protein B456_009G186400                    249   2e-76    Gossypium raimondii
gb|KHG26323.1|  Glyceraldehyde-3-phosphate dehydrogenase B, chlor...    249   2e-76    Gossypium arboreum [tree cotton]
ref|XP_004253122.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    249   3e-76    Solanum lycopersicum
ref|XP_004500847.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    251   3e-76    Cicer arietinum [garbanzo]
ref|XP_003603851.1|  Glyceraldehyde-3-phosphate dehydrogenase           249   3e-76    Medicago truncatula
emb|CAC80389.2|  glyceraldehyde-3-phosphate dehydrogenase               249   3e-76    Marchantia polymorpha
ref|XP_006342537.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    249   3e-76    Solanum tuberosum [potatoes]
gb|KJB14201.1|  hypothetical protein B456_002G114000                    249   3e-76    Gossypium raimondii
gb|EPS70760.1|  hypothetical protein M569_03997                         248   3e-76    Genlisea aurea
ref|XP_010539030.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    249   4e-76    Tarenaya hassleriana [spider flower]
gb|ABF93789.1|  Glyceraldehyde-3-phosphate dehydrogenase B, chlor...    244   4e-76    Oryza sativa Japonica Group [Japonica rice]
gb|ABD37964.1|  glyceraldehyde-3-phosphate dehydrogenase subunit B      249   4e-76    Chlorokybus atmophyticus
ref|XP_008237955.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    249   5e-76    Prunus mume [ume]
ref|XP_009629570.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    248   5e-76    Nicotiana tomentosiformis
ref|XP_007211185.1|  hypothetical protein PRUPE_ppa005598mg             248   5e-76    Prunus persica
ref|XP_009384600.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    248   6e-76    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011074072.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    248   6e-76    Sesamum indicum [beniseed]
ref|XP_010918353.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    248   6e-76    Elaeis guineensis
ref|XP_009384599.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    248   7e-76    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010061201.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    248   7e-76    Eucalyptus grandis [rose gum]
ref|XP_009780936.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    248   8e-76    Nicotiana sylvestris
gb|KHG00663.1|  Glyceraldehyde-3-phosphate dehydrogenase B, chlor...    248   8e-76    Gossypium arboreum [tree cotton]
ref|XP_007018105.1|  Glyceraldehyde-3-phosphate dehydrogenase B s...    248   1e-75    
gb|ABK00057.1|  chloroplast glyceraldehyde-3-phosphate dehydrogenase    246   1e-75    Mesostigma viride
sp|P12859.2|G3PB_PEA  RecName: Full=Glyceraldehyde-3-phosphate de...    248   1e-75    Pisum sativum [garden pea]
gb|AFG28405.1|  glyceraldehyde-3-phosphate dehydrogenase B              248   1e-75    Pyrus x bretschneideri [bai li]
ref|XP_008346447.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    248   1e-75    Malus domestica [apple tree]
gb|KDP36765.1|  hypothetical protein JCGZ_08056                         248   1e-75    Jatropha curcas
ref|NP_001289237.1|  glyceraldehyde-3-phosphate dehydrogenase B, ...    248   1e-75    Pyrus x bretschneideri [bai li]
gb|AIU56855.1|  glyceraldehyde-3-phosphate dehydrogenase B              245   1e-75    Brassica rapa subsp. chinensis [bok-choy]
ref|XP_009362871.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    247   1e-75    Pyrus x bretschneideri [bai li]
ref|XP_003558903.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    247   2e-75    
emb|CEF96577.1|  Glyceraldehyde 3-phosphate dehydrogenase, NAD(P)...    246   2e-75    Ostreococcus tauri
ref|XP_010686856.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    247   2e-75    Beta vulgaris subsp. vulgaris [field beet]
emb|CDY69523.1|  BnaC08g46180D                                          245   3e-75    Brassica napus [oilseed rape]
gb|ABD37958.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A      242   3e-75    Chara vulgaris
ref|XP_009107645.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    246   3e-75    Brassica rapa
ref|XP_002507103.1|  glyceraldehyde-3-phosphate dehydrogenase B         245   3e-75    Micromonas commoda
ref|XP_006395998.1|  hypothetical protein EUTSA_v10004217mg             246   4e-75    Eutrema salsugineum [saltwater cress]
gb|ACJ84309.1|  unknown                                                 246   4e-75    Medicago truncatula
ref|XP_006342156.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    246   4e-75    
ref|NP_001048847.1|  Os03g0129300                                       246   5e-75    
ref|XP_006383783.1|  hypothetical protein POPTR_0005s27550g             245   5e-75    
ref|XP_007515295.1|  glyceraldehyde-3-phosphate dehydrogenase           244   6e-75    Bathycoccus prasinos
gb|ABG85191.1|  chloroplast glyceraldehyde-3-phosphate dehydrogen...    245   6e-75    Ostreococcus tauri
ref|XP_004238446.2|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    246   6e-75    
gb|ACU20783.1|  unknown                                                 246   7e-75    Glycine max [soybeans]
gb|KHN20097.1|  Glyceraldehyde-3-phosphate dehydrogenase B, chlor...    246   7e-75    Glycine soja [wild soybean]
ref|XP_002891244.1|  glyceraldehyde-3-phosphate dehydrogenase B s...    245   7e-75    
ref|XP_006581071.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    245   8e-75    
ref|XP_003074208.1|  NADP-glyceraldehyde-3-phosphate dehydrogenas...    245   8e-75    
ref|NP_001237135.1|  glyceraldehyde-3-phosphate dehydrogenase B s...    245   8e-75    
ref|XP_008786670.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    245   8e-75    Phoenix dactylifera
ref|XP_002307806.1|  glyceraldehyde-3-phosphate dehydrogenase fam...    245   8e-75    Populus trichocarpa [western balsam poplar]
emb|CDP07271.1|  unnamed protein product                                245   9e-75    Coffea canephora [robusta coffee]
ref|XP_006649326.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    245   9e-75    
ref|NP_001240080.1|  uncharacterized protein LOC100806482               245   1e-74    Glycine max [soybeans]
gb|AAD10210.1|  glyceraldehyde 3-phosphate dehydrogenase B subunit      243   1e-74    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006577850.1|  PREDICTED: uncharacterized protein LOC100806...    245   1e-74    Glycine max [soybeans]
gb|KFK29151.1|  hypothetical protein AALP_AA7G095400                    245   1e-74    Arabis alpina [alpine rockcress]
ref|XP_007135965.1|  hypothetical protein PHAVU_009G006600g             245   1e-74    Phaseolus vulgaris [French bean]
ref|XP_010478985.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    243   1e-74    Camelina sativa [gold-of-pleasure]
ref|XP_010270515.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    244   1e-74    Nelumbo nucifera [Indian lotus]
ref|XP_004300121.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    244   1e-74    Fragaria vesca subsp. vesca
dbj|BAJ86633.1|  predicted protein                                      244   2e-74    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003056194.1|  hypothetical protein MICPUCDRAFT_25339             243   2e-74    Micromonas pusilla CCMP1545
ref|XP_006307502.1|  hypothetical protein CARUB_v10009127mg             244   2e-74    Capsella rubella
pdb|2PKQ|O  Chain O, Crystal Structure Of The Photosynthetic A2b2...    242   2e-74    
ref|XP_010500213.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    244   2e-74    
gb|ADB81491.1|  glyceraldehyde-3-phosphate dehydrogenase                240   2e-74    
ref|XP_010478986.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    244   2e-74    
gb|AEO45784.1|  glyceraldehyde-3-phosphate dehydrogenase B              244   2e-74    
ref|NP_174996.1|  glyceraldehyde-3-phosphate dehydrogenase B            244   2e-74    
emb|CAA33262.1|  unnamed protein product                                244   2e-74    
gb|ACN40006.1|  unknown                                                 244   2e-74    
gb|ABK24645.1|  unknown                                                 244   2e-74    
ref|XP_011034836.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    244   3e-74    
dbj|BAJ87214.1|  predicted protein                                      243   3e-74    
gb|ADB81492.1|  glyceraldehyde-3-phosphate dehydrogenase                239   4e-74    
gb|ACN40526.1|  unknown                                                 244   4e-74    
ref|XP_009382077.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    244   4e-74    
emb|CAC80378.2|  glyceraldehyde-3-phosphate dehydrogenase               244   4e-74    
sp|P12860.1|G3PB_SPIOL  RecName: Full=Glyceraldehyde-3-phosphate ...    243   5e-74    
ref|XP_011041188.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    243   5e-74    
ref|XP_002982608.1|  hypothetical protein SELMODRAFT_179517             243   5e-74    
ref|XP_001415434.1|  predicted protein                                  242   6e-74    
ref|XP_004985859.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    243   8e-74    
ref|XP_002981126.1|  hypothetical protein SELMODRAFT_271457             242   9e-74    
gb|EMS49604.1|  Glyceraldehyde-3-phosphate dehydrogenase B, chlor...    242   1e-73    
gb|EMT30317.1|  Glyceraldehyde-3-phosphate dehydrogenase B, chlor...    242   1e-73    
emb|CAN69459.1|  hypothetical protein VITISV_021576                     242   1e-73    
ref|XP_002273754.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    242   1e-73    
ref|XP_002300632.2|  hypothetical protein POPTR_0002s00840g             242   3e-73    
ref|WP_015160704.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...    238   4e-73    
ref|XP_004145550.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    241   4e-73    
sp|Q8VXQ9.1|G3PA_SCEVA  RecName: Full=Glyceraldehyde-3-phosphate ...    236   5e-73    
ref|XP_006473831.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    241   5e-73    
ref|XP_008452998.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    241   6e-73    
ref|XP_008452997.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    241   6e-73    
ref|WP_015116915.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    237   7e-73    
ref|XP_002510706.1|  glyceraldehyde 3-phosphate dehydrogenase, pu...    240   9e-73    
gb|ADD54591.1|  putative glyceraldehyde-3-phosphate dehydrogenase       231   1e-72    
ref|WP_039900510.1|  glyceraldehyde-3-phosphate dehydrogenase           236   2e-72    
ref|XP_006435406.1|  hypothetical protein CICLE_v10001114mg             239   2e-72    
ref|WP_015189930.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    236   2e-72    
gb|ELS46726.1|  glyceraldehyde-3-phosphate dehydrogenase 2              233   3e-72    
emb|CCI33980.1|  Glyceraldehyde-3-phosphate dehydrogenase 2             236   3e-72    
emb|CAC80391.2|  glyceraldehyde-3-phosphate dehydrogenase               234   3e-72    
ref|XP_009362872.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    238   4e-72    
gb|ABK00053.1|  chloroplast glyceraldehyde-3-phosphate dehydrogenase    236   5e-72    
ref|WP_002799040.1|  glyceraldehyde-3-phosphate dehydrogenase           234   6e-72    
gb|ERT05629.1|  glyceraldehyde-3-phosphate dehydrogenase, type I        233   6e-72    
ref|WP_012265625.1|  glyceraldehyde-3-phosphate dehydrogenase           234   7e-72    
ref|XP_008650588.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    238   7e-72    
emb|CCH97953.1|  Glyceraldehyde-3-phosphate dehydrogenase 2             234   1e-71    
sp|P34919.1|G3PA_CHOCR  RecName: Full=Glyceraldehyde-3-phosphate ...    236   1e-71    
ref|XP_005715477.1|  glyceraldehyde-3-phosphate dehydrogenase           236   1e-71    
sp|P30724.1|G3PA_GRAGA  RecName: Full=Glyceraldehyde-3-phosphate ...    236   2e-71    
dbj|BAD72793.1|  glyceraldehyde-3-phosphate dehydrogenase               229   2e-71    
ref|WP_004268080.1|  glyceraldehyde-3-phosphate dehydrogenase           233   2e-71    
ref|WP_002780388.1|  Glyceraldehyde-3-phosphate dehydrogenase 2         233   2e-71    
dbj|GAL93645.1|  NADPH-dependent glyceraldehyde-3-phosphate dehyd...    233   2e-71    
ref|XP_010094540.1|  Glyceraldehyde-3-phosphate dehydrogenase B         248   2e-71    
ref|WP_040484381.1|  glyceraldehyde-3-phosphate dehydrogenase           233   2e-71    
ref|WP_002731954.1|  glyceraldehyde-3-phosphate dehydrogenase           233   2e-71    
gb|ABA01156.1|  chloroplast glyceraldehyde-3-phosphate dehydrogenase    233   3e-71    
ref|WP_015156647.1|  MULTISPECIES: glyceraldehyde 3-phosphate deh...    233   4e-71    
ref|WP_042151414.1|  glyceraldehyde-3-phosphate dehydrogenase           233   4e-71    
emb|CCH91489.1|  Glyceraldehyde-3-phosphate dehydrogenase 2             233   4e-71    
ref|WP_026787014.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...    232   4e-71    
emb|CCI19184.1|  Glyceraldehyde-3-phosphate dehydrogenase 2             233   4e-71    
gb|KHG29734.1|  Glyceraldehyde-3-phosphate dehydrogenase A, chlor...    233   4e-71    
ref|XP_011034837.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    235   7e-71    
ref|WP_015172689.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    231   1e-70    
gb|ABD37960.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A      231   1e-70    
ref|WP_015199557.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    231   1e-70    
ref|WP_009343864.1|  glyceraldehyde-3-phosphate dehydrogenase           231   1e-70    
gb|KHG21941.1|  Glyceraldehyde-3-phosphate dehydrogenase A, chlor...    232   1e-70    
gb|KIY93372.1|  NADP-dependent glyceraldehydephosphatedehydrogena...    225   2e-70    
gb|AGW80488.1|  glyceraldehyde 3 phosphate dehydrogenase                231   2e-70    
ref|WP_044492436.1|  glyceraldehyde-3-phosphate dehydrogenase           231   2e-70    
gb|EGJ33840.1|  glyceraldehyde 3-phosphate dehydrogenase, NADP+         231   2e-70    
ref|WP_024545764.1|  glyceraldehyde-3-phosphate dehydrogenase           231   2e-70    
ref|WP_015109880.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...    231   2e-70    
ref|WP_041226596.1|  glyceraldehyde-3-phosphate dehydrogenase           230   2e-70    
ref|WP_035830661.1|  glyceraldehyde-3-phosphate dehydrogenase           230   3e-70    
ref|WP_017320834.1|  glyceraldehyde-3-phosphate dehydrogenase           230   3e-70    
ref|XP_005704189.1|  glyceraldehyde-3-phosphate dehydrogenase (NA...    232   3e-70    
gb|AFZ13204.1|  glyceraldehyde 3-phosphate dehydrogenase (NADP+)        231   3e-70    
ref|WP_028954384.1|  glyceraldehyde-3-phosphate dehydrogenase           230   4e-70    
ref|WP_027840812.1|  glyceraldehyde-3-phosphate dehydrogenase           229   5e-70    
ref|WP_028949102.1|  glyceraldehyde-3-phosphate dehydrogenase           229   5e-70    
ref|WP_023075014.1|  glyceraldehyde 3-phosphate dehydrogenase (na...    229   6e-70    
ref|WP_015220848.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    229   6e-70    
ref|WP_007307714.1|  glyceraldehyde-3-phosphate dehydrogenase           229   8e-70    
ref|WP_006279110.1|  glyceraldehyde-3-phosphate dehydrogenase           229   9e-70    
dbj|BAI88897.1|  glyceraldehyde-3-phosphate dehydrogenase               229   9e-70    
ref|WP_012305745.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...    229   1e-69    
ref|WP_006619928.1|  glyceraldehyde-3-phosphate dehydrogenase           229   1e-69    
sp|P80505.3|G3P2_SYNY3  RecName: Full=Glyceraldehyde-3-phosphate ...    228   1e-69    
emb|CAA58550.1|  glyceraldehyde-3-phosphate dehydrogenase (NADP+)...    228   1e-69    
ref|WP_039933175.1|  glyceraldehyde-3-phosphate dehydrogenase           228   1e-69    
ref|WP_008050956.1|  glyceraldehyde-3-phosphate dehydrogenase           228   1e-69    
gb|EDZ94203.1|  glyceraldehyde-3-phosphate dehydrogenase, type I        228   2e-69    
ref|WP_019493013.1|  glyceraldehyde-3-phosphate dehydrogenase           228   3e-69    
emb|CBI29293.3|  unnamed protein product                                228   3e-69    
ref|WP_036481597.1|  glyceraldehyde-3-phosphate dehydrogenase           227   4e-69    
ref|WP_010874115.1|  glyceraldehyde-3-phosphate dehydrogenase           227   5e-69    
ref|WP_015954248.1|  glyceraldehyde-3-phosphate dehydrogenase           227   5e-69    
ref|WP_016865320.1|  glyceraldehyde-3-phosphate dehydrogenase           227   6e-69    
ref|WP_015191528.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    227   6e-69    
ref|WP_009459769.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...    226   7e-69    
ref|WP_009544928.1|  glyceraldehyde-3-phosphate dehydrogenase           226   9e-69    
gb|ABD37966.1|  glyceraldehyde-3-phosphate dehydrogenase subunit B      226   9e-69    
ref|WP_006515538.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    226   1e-68    
ref|WP_015178398.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    226   1e-68    
ref|WP_039753495.1|  glyceraldehyde-3-phosphate dehydrogenase           226   1e-68    
ref|WP_006172746.1|  glyceraldehyde-3-phosphate dehydrogenase           226   1e-68    
ref|WP_039200023.1|  glyceraldehyde-3-phosphate dehydrogenase           226   2e-68    
gb|EDX77136.1|  glyceraldehyde-3-phosphate dehydrogenase, type I        226   2e-68    
ref|WP_029637377.1|  glyceraldehyde-3-phosphate dehydrogenase [         225   2e-68    
ref|WP_009787048.1|  glyceraldehyde-3-phosphate dehydrogenase           225   2e-68    
ref|WP_044205566.1|  glyceraldehyde-3-phosphate dehydrogenase           226   2e-68    
ref|WP_015132368.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    225   3e-68    
ref|WP_025965118.1|  glyceraldehyde-3-phosphate dehydrogenase           221   3e-68    
ref|WP_035157424.1|  glyceraldehyde-3-phosphate dehydrogenase           225   3e-68    
ref|WP_017293448.1|  glyceraldehyde-3-phosphate dehydrogenase           225   3e-68    
ref|WP_006625490.1|  glyceraldehyde-3-phosphate dehydrogenase           225   3e-68    
ref|WP_015222961.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    225   4e-68    
gb|EDX87031.1|  glyceraldehyde-3-phosphate dehydrogenase, type I        224   4e-68    
ref|WP_026731665.1|  glyceraldehyde-3-phosphate dehydrogenase           224   4e-68    
ref|WP_006510998.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...    224   4e-68    
gb|KIE07728.1|  glyceraldehyde-3-phosphate dehydrogenase                224   5e-68    
ref|WP_015080375.1|  type I glyceraldehyde-3-phosphate dehydrogenase    224   5e-68    
ref|WP_013324586.1|  glyceraldehyde-3-phosphate dehydrogenase           224   5e-68    
ref|WP_006634268.1|  glyceraldehyde-3-phosphate dehydrogenase           224   6e-68    
ref|WP_025944290.1|  glyceraldehyde-3-phosphate dehydrogenase           222   7e-68    
ref|WP_015141410.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...    224   8e-68    
ref|WP_006528243.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...    224   8e-68    
ref|WP_012595832.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...    224   9e-68    
ref|WP_027404344.1|  glyceraldehyde-3-phosphate dehydrogenase           224   9e-68    
ref|WP_017742837.1|  glyceraldehyde-3-phosphate dehydrogenase           224   1e-67    
ref|WP_007358062.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...    224   1e-67    
emb|CAC80390.1|  glyceraldehyde-3-phosphate dehydrogenase               223   1e-67    
ref|WP_008276272.1|  glyceraldehyde-3-phosphate dehydrogenase           223   1e-67    
ref|WP_038015315.1|  glyceraldehyde-3-phosphate dehydrogenase           223   1e-67    
ref|WP_015146993.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    223   1e-67    
ref|WP_017659782.1|  glyceraldehyde-3-phosphate dehydrogenase           223   2e-67    
dbj|BAD93961.1|  glyceraldehyde 3-phosphate dehydrogenase A subunit     217   2e-67    
ref|WP_015145817.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...    223   2e-67    
ref|WP_017291296.1|  glyceraldehyde-3-phosphate dehydrogenase           223   2e-67    
ref|XP_009362873.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    225   2e-67    
ref|WP_008231341.1|  NADPH-dependent glyceraldehyde-3-phosphate d...    223   3e-67    
ref|WP_019504971.1|  glyceraldehyde-3-phosphate dehydrogenase           223   3e-67    
ref|WP_010313976.1|  glyceraldehyde-3-phosphate dehydrogenase           223   3e-67    
ref|WP_028085442.1|  glyceraldehyde-3-phosphate dehydrogenase           222   3e-67    
gb|AIQ96116.1|  NADPH-dependent glyceraldehyde-3-phosphate dehydr...    222   3e-67    
ref|WP_015182060.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...    222   4e-67    
ref|WP_026719817.1|  glyceraldehyde-3-phosphate dehydrogenase           222   4e-67    
ref|WP_025938864.1|  glyceraldehyde-3-phosphate dehydrogenase           222   4e-67    
ref|WP_036906091.1|  glyceraldehyde-3-phosphate dehydrogenase           222   5e-67    
ref|WP_013190254.1|  glyceraldehyde-3-phosphate dehydrogenase           222   5e-67    
gb|KIJ84331.1|  glyceraldehyde-3-phosphate dehydrogenase                222   5e-67    
ref|WP_009626155.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    222   5e-67    
ref|XP_003603850.1|  Glyceraldehyde-3-phosphate dehydrogenase           226   5e-67    
ref|WP_025951324.1|  glyceraldehyde-3-phosphate dehydrogenase           222   5e-67    
gb|AES74103.2|  glyceraldehyde-3-phosphate dehydrogenase B              224   6e-67    
ref|WP_016860363.1|  glyceraldehyde-3-phosphate dehydrogenase           222   6e-67    
gb|AHJ31016.1|  NADPH-dependent glyceraldehyde-3-phosphate dehydr...    219   6e-67    
ref|WP_025895306.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...    222   6e-67    
ref|WP_025921298.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...    222   6e-67    
ref|WP_025887309.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...    222   6e-67    
ref|WP_017312563.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...    221   6e-67    
ref|WP_036001291.1|  glyceraldehyde-3-phosphate dehydrogenase           221   7e-67    
ref|WP_038650443.1|  glyceraldehyde-3-phosphate dehydrogenase           221   7e-67    
gb|ADB81494.1|  glyceraldehyde-3-phosphate dehydrogenase                221   7e-67    
ref|WP_025900197.1|  glyceraldehyde-3-phosphate dehydrogenase           219   7e-67    
ref|WP_041036790.1|  glyceraldehyde-3-phosphate dehydrogenase           221   7e-67    
ref|WP_026079517.1|  glyceraldehyde-3-phosphate dehydrogenase           221   9e-67    
ref|WP_015168952.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...    221   9e-67    
ref|WP_011613378.1|  glyceraldehyde-3-phosphate dehydrogenase           221   1e-66    
ref|WP_025970551.1|  glyceraldehyde-3-phosphate dehydrogenase           221   1e-66    
ref|WP_025935563.1|  glyceraldehyde-3-phosphate dehydrogenase           221   1e-66    
ref|WP_025924004.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...    221   1e-66    
ref|WP_011817500.1|  glyceraldehyde-3-phosphate dehydrogenase           221   1e-66    
ref|WP_022607378.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...    221   1e-66    
gb|AAP32469.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A      223   2e-66    
ref|WP_025781786.1|  glyceraldehyde-3-phosphate dehydrogenase           221   2e-66    
ref|WP_025941106.1|  glyceraldehyde-3-phosphate dehydrogenase           221   2e-66    
ref|WP_025923775.1|  glyceraldehyde-3-phosphate dehydrogenase           221   2e-66    
ref|WP_012626430.1|  glyceraldehyde-3-phosphate dehydrogenase           220   2e-66    
ref|WP_025932858.1|  glyceraldehyde-3-phosphate dehydrogenase           221   2e-66    
ref|WP_032523814.1|  glyceraldehyde-3-phosphate dehydrogenase           220   2e-66    
ref|WP_015212526.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    220   2e-66    
ref|WP_025925726.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...    220   2e-66    
ref|WP_032519865.1|  glyceraldehyde-3-phosphate dehydrogenase           220   2e-66    
ref|WP_011822824.1|  glyceraldehyde-3-phosphate dehydrogenase           220   2e-66    
ref|WP_026082358.1|  glyceraldehyde-3-phosphate dehydrogenase           220   2e-66    
ref|WP_025947080.1|  glyceraldehyde-3-phosphate dehydrogenase           220   3e-66    
ref|WP_011293983.1|  glyceraldehyde-3-phosphate dehydrogenase           220   3e-66    
ref|WP_025970042.1|  glyceraldehyde-3-phosphate dehydrogenase           220   3e-66    
ref|WP_006911098.1|  glyceraldehyde-3-phosphate dehydrogenase           220   3e-66    
ref|WP_011375588.1|  glyceraldehyde-3-phosphate dehydrogenase           220   3e-66    
ref|WP_011819348.1|  glyceraldehyde-3-phosphate dehydrogenase           220   3e-66    
ref|WP_032515148.1|  glyceraldehyde-3-phosphate dehydrogenase           220   3e-66    
ref|WP_035985041.1|  glyceraldehyde-3-phosphate dehydrogenase           220   3e-66    
ref|WP_032525730.1|  glyceraldehyde-3-phosphate dehydrogenase           220   3e-66    
ref|WP_019477913.1|  glyceraldehyde-3-phosphate dehydrogenase           220   3e-66    
ref|WP_032514080.1|  glyceraldehyde-3-phosphate dehydrogenase           220   3e-66    
ref|WP_026103380.1|  glyceraldehyde-3-phosphate dehydrogenase           219   4e-66    
ref|WP_026098586.1|  glyceraldehyde-3-phosphate dehydrogenase           219   4e-66    
ref|WP_025905712.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...    219   5e-66    
ref|WP_025880015.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...    219   5e-66    
ref|WP_032518091.1|  glyceraldehyde-3-phosphate dehydrogenase           219   5e-66    
ref|WP_032523054.1|  glyceraldehyde-3-phosphate dehydrogenase           219   5e-66    
gb|ADB81490.1|  glyceraldehyde-3-phosphate dehydrogenase                213   6e-66    
ref|WP_042849500.1|  glyceraldehyde-3-phosphate dehydrogenase           219   6e-66    
ref|WP_012407249.1|  glyceraldehyde-3-phosphate dehydrogenase           219   7e-66    
ref|WP_025929031.1|  glyceraldehyde-3-phosphate dehydrogenase           219   8e-66    
ref|WP_015210633.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    219   8e-66    
ref|WP_025937822.1|  glyceraldehyde-3-phosphate dehydrogenase           219   8e-66    
ref|WP_011862050.1|  glyceraldehyde-3-phosphate dehydrogenase           219   9e-66    
ref|WP_025943135.1|  glyceraldehyde-3-phosphate dehydrogenase           219   1e-65    
ref|WP_028089468.1|  glyceraldehyde-3-phosphate dehydrogenase           218   1e-65    
ref|WP_025952189.1|  glyceraldehyde-3-phosphate dehydrogenase           218   1e-65    
emb|CAC80374.1|  glyceraldehyde-3-phosphate dehydrogenase               218   1e-65    
ref|WP_011131661.1|  glyceraldehyde-3-phosphate dehydrogenase           218   1e-65    
ref|WP_006197155.1|  glyceraldehyde-3-phosphate dehydrogenase           218   1e-65    



>gb|KDO63479.1| hypothetical protein CISIN_1g013492mg [Citrus sinensis]
Length=293

 Score =   307 bits (786),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 197/203 (97%), Positives = 199/203 (98%), Gaps = 0/203 (0%)
 Frame = -1

Query  717  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldash  538
            VGVNADAY PDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH
Sbjct  91   VGVNADAYKPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH  150

Query  537  rdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKT  358
            RDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKT
Sbjct  151  RDLRRARAAALNIVPTSTGAAKAVALVLPALKGKLNGIALRVPTPNVSVVDLVVQVSKKT  210

Query  357  FAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAW  178
            FAEEVNAAFRESA NEL GILSVCDEPLVSVDFRCSDVSSTVDSSLT+VMGDDMVKVIAW
Sbjct  211  FAEEVNAAFRESADNELKGILSVCDEPLVSVDFRCSDVSSTVDSSLTLVMGDDMVKVIAW  270

Query  177  YDNEWGYSQRVVDLADIVANQWK  109
            YDNEWGYSQRVVDLADIVAN WK
Sbjct  271  YDNEWGYSQRVVDLADIVANNWK  293



>gb|KJB11770.1| hypothetical protein B456_001G276400 [Gossypium raimondii]
Length=305

 Score =   306 bits (785),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 195/203 (96%), Positives = 198/203 (98%), Gaps = 0/203 (0%)
 Frame = -1

Query  717  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldash  538
            VGVNAD Y+PDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH
Sbjct  103  VGVNADIYNPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH  162

Query  537  rdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKT  358
            RDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKT
Sbjct  163  RDLRRARAAALNIVPTSTGAAKAVALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKT  222

Query  357  FAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAW  178
            FAEEVNAAFRESA  EL GILSVCDEPLVSVDFRCSDVSSTVD+SLTMVMGDDMVKVIAW
Sbjct  223  FAEEVNAAFRESAEKELKGILSVCDEPLVSVDFRCSDVSSTVDASLTMVMGDDMVKVIAW  282

Query  177  YDNEWGYSQRVVDLADIVANQWK  109
            YDNEWGYSQRVVDLADIVAN WK
Sbjct  283  YDNEWGYSQRVVDLADIVANNWK  305



>gb|AEH04452.1| glyceraldehyde-3-phosphate dehydrogenase [Arachis hypogaea]
Length=405

 Score =   308 bits (789),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 197/203 (97%), Positives = 200/203 (99%), Gaps = 0/203 (0%)
 Frame = -1

Query  717  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldash  538
            VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH
Sbjct  203  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH  262

Query  537  rdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKT  358
            RDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKT
Sbjct  263  RDLRRARAAALNIVPTSTGAAKAVALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKT  322

Query  357  FAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAW  178
            FAEEVNAAFRESA  EL+GILSVCDEPLVSVDFRC+DVSSTVDSSLTMVMGDDMVKVIAW
Sbjct  323  FAEEVNAAFRESAEKELNGILSVCDEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVIAW  382

Query  177  YDNEWGYSQRVVDLADIVANQWK  109
            YDNEWGYSQRVVDLADIVAN WK
Sbjct  383  YDNEWGYSQRVVDLADIVANSWK  405



>ref|XP_010425376.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
isoform X2 [Camelina sativa]
Length=317

 Score =   304 bits (778),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 192/203 (95%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -1

Query  717  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldash  538
            VGVNADAYS DEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH
Sbjct  115  VGVNADAYSHDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH  174

Query  537  rdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKT  358
            RDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKT
Sbjct  175  RDLRRARAAALNIVPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKT  234

Query  357  FAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAW  178
            FAEEVNAAFR+SA  EL GIL VCDEPLVSVDFRCSD S+T+DSSLTMVMGDDMVKVIAW
Sbjct  235  FAEEVNAAFRDSAEKELKGILDVCDEPLVSVDFRCSDYSTTIDSSLTMVMGDDMVKVIAW  294

Query  177  YDNEWGYSQRVVDLADIVANQWK  109
            YDNEWGYSQRVVDLADIVAN+WK
Sbjct  295  YDNEWGYSQRVVDLADIVANKWK  317



>ref|XP_006446865.1| hypothetical protein CICLE_v10015476mg [Citrus clementina]
 gb|ESR60105.1| hypothetical protein CICLE_v10015476mg [Citrus clementina]
Length=403

 Score =   306 bits (785),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 197/203 (97%), Positives = 199/203 (98%), Gaps = 0/203 (0%)
 Frame = -1

Query  717  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldash  538
            VGVNADAY PDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH
Sbjct  201  VGVNADAYKPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH  260

Query  537  rdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKT  358
            RDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKT
Sbjct  261  RDLRRARAAALNIVPTSTGAAKAVALVLPALKGKLNGIALRVPTPNVSVVDLVVQVSKKT  320

Query  357  FAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAW  178
            FAEEVNAAFRESA NEL GILSVCDEPLVSVDFRCSDVSSTVDSSLT+VMGDDMVKVIAW
Sbjct  321  FAEEVNAAFRESADNELKGILSVCDEPLVSVDFRCSDVSSTVDSSLTLVMGDDMVKVIAW  380

Query  177  YDNEWGYSQRVVDLADIVANQWK  109
            YDNEWGYSQRVVDLADIVAN WK
Sbjct  381  YDNEWGYSQRVVDLADIVANNWK  403



>gb|KJB70724.1| hypothetical protein B456_011G088800 [Gossypium raimondii]
Length=303

 Score =   303 bits (776),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 193/203 (95%), Positives = 198/203 (98%), Gaps = 0/203 (0%)
 Frame = -1

Query  717  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldash  538
            VGVNAD Y+PDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH
Sbjct  101  VGVNADTYNPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH  160

Query  537  rdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKT  358
            RDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKT
Sbjct  161  RDLRRARAAALNIVPTSTGAAKAVALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKT  220

Query  357  FAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAW  178
            FAEEVNAAF+ESA  EL GILSVC+EPLVSVDFRCSDVSSTVD+SLTMVMGDDMVKVIAW
Sbjct  221  FAEEVNAAFKESAEKELQGILSVCEEPLVSVDFRCSDVSSTVDASLTMVMGDDMVKVIAW  280

Query  177  YDNEWGYSQRVVDLADIVANQWK  109
            YDNEWGYSQRVVDLADIVAN WK
Sbjct  281  YDNEWGYSQRVVDLADIVANSWK  303



>ref|XP_006468948.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
[Citrus sinensis]
 gb|KDO63478.1| hypothetical protein CISIN_1g013492mg [Citrus sinensis]
Length=403

 Score =   306 bits (784),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 197/203 (97%), Positives = 199/203 (98%), Gaps = 0/203 (0%)
 Frame = -1

Query  717  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldash  538
            VGVNADAY PDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH
Sbjct  201  VGVNADAYKPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH  260

Query  537  rdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKT  358
            RDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKT
Sbjct  261  RDLRRARAAALNIVPTSTGAAKAVALVLPALKGKLNGIALRVPTPNVSVVDLVVQVSKKT  320

Query  357  FAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAW  178
            FAEEVNAAFRESA NEL GILSVCDEPLVSVDFRCSDVSSTVDSSLT+VMGDDMVKVIAW
Sbjct  321  FAEEVNAAFRESADNELKGILSVCDEPLVSVDFRCSDVSSTVDSSLTLVMGDDMVKVIAW  380

Query  177  YDNEWGYSQRVVDLADIVANQWK  109
            YDNEWGYSQRVVDLADIVAN WK
Sbjct  381  YDNEWGYSQRVVDLADIVANNWK  403



>ref|XP_010502598.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
isoform X2 [Camelina sativa]
Length=317

 Score =   303 bits (776),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 192/203 (95%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -1

Query  717  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldash  538
            VGVNADAYS DEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH
Sbjct  115  VGVNADAYSHDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH  174

Query  537  rdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKT  358
            RDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKT
Sbjct  175  RDLRRARAAALNIVPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKT  234

Query  357  FAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAW  178
            FAEEVNAAFR+SA  EL GIL VCDEPLVSVDFRCSD S+T+DSSLTMVMGDDMVKVIAW
Sbjct  235  FAEEVNAAFRDSAEKELKGILDVCDEPLVSVDFRCSDYSTTIDSSLTMVMGDDMVKVIAW  294

Query  177  YDNEWGYSQRVVDLADIVANQWK  109
            YDNEWGYSQRVVDLADIVAN+WK
Sbjct  295  YDNEWGYSQRVVDLADIVANKWK  317



>ref|XP_008449974.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
isoform X1 [Cucumis melo]
Length=404

 Score =   306 bits (783),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 198/203 (98%), Positives = 200/203 (99%), Gaps = 0/203 (0%)
 Frame = -1

Query  717  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldash  538
            VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH
Sbjct  202  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH  261

Query  537  rdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKT  358
            RDLRRARAAALNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVSKKT
Sbjct  262  RDLRRARAAALNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVSKKT  321

Query  357  FAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAW  178
            FAEEVNAAFRESA  EL+GILSVCDEPLVSVDFRCSDVSSTVDSSLTMVMGDD+VKVIAW
Sbjct  322  FAEEVNAAFRESAEKELNGILSVCDEPLVSVDFRCSDVSSTVDSSLTMVMGDDLVKVIAW  381

Query  177  YDNEWGYSQRVVDLADIVANQWK  109
            YDNEWGYSQRVVDLADIVAN WK
Sbjct  382  YDNEWGYSQRVVDLADIVANNWK  404



>ref|XP_008449975.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
isoform X2 [Cucumis melo]
Length=403

 Score =   306 bits (783),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 198/203 (98%), Positives = 200/203 (99%), Gaps = 0/203 (0%)
 Frame = -1

Query  717  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldash  538
            VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH
Sbjct  201  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH  260

Query  537  rdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKT  358
            RDLRRARAAALNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVSKKT
Sbjct  261  RDLRRARAAALNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVSKKT  320

Query  357  FAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAW  178
            FAEEVNAAFRESA  EL+GILSVCDEPLVSVDFRCSDVSSTVDSSLTMVMGDD+VKVIAW
Sbjct  321  FAEEVNAAFRESAEKELNGILSVCDEPLVSVDFRCSDVSSTVDSSLTMVMGDDLVKVIAW  380

Query  177  YDNEWGYSQRVVDLADIVANQWK  109
            YDNEWGYSQRVVDLADIVAN WK
Sbjct  381  YDNEWGYSQRVVDLADIVANNWK  403



>gb|ADX97321.1| glyceraldehyde-3-phosphate dehydrogenase [Mangifera indica]
Length=401

 Score =   305 bits (781),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 197/203 (97%), Positives = 200/203 (99%), Gaps = 0/203 (0%)
 Frame = -1

Query  717  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldash  538
            VGVNADAY+PDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH
Sbjct  199  VGVNADAYNPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH  258

Query  537  rdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKT  358
            RDLRRARAAALNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVSKKT
Sbjct  259  RDLRRARAAALNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVSKKT  318

Query  357  FAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAW  178
            FAEEVNAAFRESA  EL GILSVCDEPLVSVDFRCSDVSSTVDSSLT+VMGDDMVKVIAW
Sbjct  319  FAEEVNAAFRESADKELKGILSVCDEPLVSVDFRCSDVSSTVDSSLTLVMGDDMVKVIAW  378

Query  177  YDNEWGYSQRVVDLADIVANQWK  109
            YDNEWGYSQRVVDLADIVAN+WK
Sbjct  379  YDNEWGYSQRVVDLADIVANKWK  401



>ref|XP_011033706.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Populus euphratica]
Length=404

 Score =   305 bits (780),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 197/203 (97%), Positives = 199/203 (98%), Gaps = 0/203 (0%)
 Frame = -1

Query  717  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldash  538
            VGVNADAYS DEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH
Sbjct  202  VGVNADAYSSDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH  261

Query  537  rdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKT  358
            RDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKT
Sbjct  262  RDLRRARAAALNIVPTSTGAAKAVALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKT  321

Query  357  FAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAW  178
            FAEEVNAAFRESA  EL+GILSVCDEPLVSVDFRCSDVSSTVDSSLTMVMGDDMVKVIAW
Sbjct  322  FAEEVNAAFRESAEKELNGILSVCDEPLVSVDFRCSDVSSTVDSSLTMVMGDDMVKVIAW  381

Query  177  YDNEWGYSQRVVDLADIVANQWK  109
            YDNEWGYSQRVVDLADIVAN WK
Sbjct  382  YDNEWGYSQRVVDLADIVANNWK  404



>ref|XP_010090946.1| Glyceraldehyde-3-phosphate dehydrogenase A [Morus notabilis]
 gb|EXB41431.1| Glyceraldehyde-3-phosphate dehydrogenase A [Morus notabilis]
Length=404

 Score =   304 bits (779),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 194/203 (96%), Positives = 199/203 (98%), Gaps = 0/203 (0%)
 Frame = -1

Query  717  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldash  538
            VGVNADAY+PDEPIISNASCTTNCLAPFVKVLDQKF IIKGTMTTTHSYTGDQRLLDASH
Sbjct  202  VGVNADAYNPDEPIISNASCTTNCLAPFVKVLDQKFSIIKGTMTTTHSYTGDQRLLDASH  261

Query  537  rdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKT  358
            RDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKT
Sbjct  262  RDLRRARAAALNIVPTSTGAAKAVALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKT  321

Query  357  FAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAW  178
            FAEEVNAAFRESA  EL+GILSVCDEPLVSVDFRC+DVSSTVD+SLTMVMGDDMVKVIAW
Sbjct  322  FAEEVNAAFRESAEKELNGILSVCDEPLVSVDFRCTDVSSTVDASLTMVMGDDMVKVIAW  381

Query  177  YDNEWGYSQRVVDLADIVANQWK  109
            YDNEWGYSQRVVDLADIVAN WK
Sbjct  382  YDNEWGYSQRVVDLADIVANNWK  404



>ref|XP_002321065.2| hypothetical protein POPTR_0014s13660g [Populus trichocarpa]
 gb|ABK96062.1| unknown [Populus trichocarpa]
 gb|ABK96120.1| unknown [Populus trichocarpa]
 gb|EEE99380.2| hypothetical protein POPTR_0014s13660g [Populus trichocarpa]
Length=404

 Score =   304 bits (779),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 197/203 (97%), Positives = 199/203 (98%), Gaps = 0/203 (0%)
 Frame = -1

Query  717  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldash  538
            VGVNADAYS DEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH
Sbjct  202  VGVNADAYSSDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH  261

Query  537  rdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKT  358
            RDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKT
Sbjct  262  RDLRRARAAALNIVPTSTGAAKAVALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKT  321

Query  357  FAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAW  178
            FAEEVNAAFRESA  EL+GILSVCDEPLVSVDFRCSDVSSTVDSSLTMVMGDDMVKVIAW
Sbjct  322  FAEEVNAAFRESAEKELNGILSVCDEPLVSVDFRCSDVSSTVDSSLTMVMGDDMVKVIAW  381

Query  177  YDNEWGYSQRVVDLADIVANQWK  109
            YDNEWGYSQRVVDLADIVAN WK
Sbjct  382  YDNEWGYSQRVVDLADIVANNWK  404



>ref|XP_010528120.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
isoform X2 [Tarenaya hassleriana]
Length=280

 Score =   300 bits (768),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 194/203 (96%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -1

Query  717  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldash  538
            VGVNADAY P EPIISNASCTTNCLAPFVK+LDQKFGIIKGTMTTTHSYTGDQRLLDASH
Sbjct  78   VGVNADAYDPAEPIISNASCTTNCLAPFVKILDQKFGIIKGTMTTTHSYTGDQRLLDASH  137

Query  537  rdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKT  358
            RDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKT
Sbjct  138  RDLRRARAAALNIVPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKT  197

Query  357  FAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAW  178
            FAEEVNAAFRE+A NEL GIL VCDEPLVSVDFRCSDVSSTVDSSLTMVMGDDMVKVIAW
Sbjct  198  FAEEVNAAFREAADNELKGILEVCDEPLVSVDFRCSDVSSTVDSSLTMVMGDDMVKVIAW  257

Query  177  YDNEWGYSQRVVDLADIVANQWK  109
            YDNEWGYSQRVVDLADIVAN WK
Sbjct  258  YDNEWGYSQRVVDLADIVANNWK  280



>gb|KFK33590.1| hypothetical protein AALP_AA5G033500 [Arabis alpina]
Length=400

 Score =   304 bits (778),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 195/203 (96%), Positives = 198/203 (98%), Gaps = 0/203 (0%)
 Frame = -1

Query  717  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldash  538
            VGVNADAY+PDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH
Sbjct  198  VGVNADAYNPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH  257

Query  537  rdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKT  358
            RDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKT
Sbjct  258  RDLRRARAAALNIVPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKT  317

Query  357  FAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAW  178
            FAEEVNAAFRESA  EL GIL VCDEPLVSVDFRCSDVSST+DSSLTMVMGDDMVKVIAW
Sbjct  318  FAEEVNAAFRESAEKELKGILEVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAW  377

Query  177  YDNEWGYSQRVVDLADIVANQWK  109
            YDNEWGYSQRVVDLADIVAN WK
Sbjct  378  YDNEWGYSQRVVDLADIVANNWK  400



>ref|XP_011003600.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
[Populus euphratica]
Length=404

 Score =   304 bits (778),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 196/203 (97%), Positives = 198/203 (98%), Gaps = 0/203 (0%)
 Frame = -1

Query  717  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldash  538
            VGVNADAY+PDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH
Sbjct  202  VGVNADAYNPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH  261

Query  537  rdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKT  358
            RDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKT
Sbjct  262  RDLRRARAAALNIVPTSTGAAKAVALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKT  321

Query  357  FAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAW  178
            FAEEVN  FRESA  EL GILSVCDEPLVSVDFRCSDVSSTVDSSLTMVMGDDMVKVIAW
Sbjct  322  FAEEVNEGFRESAEKELKGILSVCDEPLVSVDFRCSDVSSTVDSSLTMVMGDDMVKVIAW  381

Query  177  YDNEWGYSQRVVDLADIVANQWK  109
            YDNEWGYSQRVVDLADIVANQWK
Sbjct  382  YDNEWGYSQRVVDLADIVANQWK  404



>gb|KJB11771.1| hypothetical protein B456_001G276400 [Gossypium raimondii]
Length=403

 Score =   304 bits (778),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 195/203 (96%), Positives = 198/203 (98%), Gaps = 0/203 (0%)
 Frame = -1

Query  717  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldash  538
            VGVNAD Y+PDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH
Sbjct  201  VGVNADIYNPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH  260

Query  537  rdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKT  358
            RDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKT
Sbjct  261  RDLRRARAAALNIVPTSTGAAKAVALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKT  320

Query  357  FAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAW  178
            FAEEVNAAFRESA  EL GILSVCDEPLVSVDFRCSDVSSTVD+SLTMVMGDDMVKVIAW
Sbjct  321  FAEEVNAAFRESAEKELKGILSVCDEPLVSVDFRCSDVSSTVDASLTMVMGDDMVKVIAW  380

Query  177  YDNEWGYSQRVVDLADIVANQWK  109
            YDNEWGYSQRVVDLADIVAN WK
Sbjct  381  YDNEWGYSQRVVDLADIVANNWK  403



>emb|CDX83635.1| BnaC07g23750D [Brassica napus]
Length=380

 Score =   303 bits (775),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 194/203 (96%), Positives = 198/203 (98%), Gaps = 0/203 (0%)
 Frame = -1

Query  717  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldash  538
            VGVNADAY+PDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH
Sbjct  178  VGVNADAYNPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH  237

Query  537  rdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKT  358
            RDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQV+KKT
Sbjct  238  RDLRRARAAALNIVPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVTKKT  297

Query  357  FAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAW  178
            FAEEVNAAFRESA  EL GIL VCDEPLVSVDFRCSDVSST+DSSLTMVMGDDMVKVIAW
Sbjct  298  FAEEVNAAFRESAEKELKGILEVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAW  357

Query  177  YDNEWGYSQRVVDLADIVANQWK  109
            YDNEWGYSQRVVDLADIVAN WK
Sbjct  358  YDNEWGYSQRVVDLADIVANNWK  380



>ref|XP_009800449.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Nicotiana sylvestris]
Length=401

 Score =   303 bits (777),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 195/203 (96%), Positives = 198/203 (98%), Gaps = 0/203 (0%)
 Frame = -1

Query  717  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldash  538
            VGVNAD Y+PDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH
Sbjct  199  VGVNADLYNPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH  258

Query  537  rdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKT  358
            RDLRRARAAALNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVSKKT
Sbjct  259  RDLRRARAAALNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVSKKT  318

Query  357  FAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAW  178
            FAEEVNAAFRE+A  EL GIL VCDEPLVSVDFRCSDVSSTVD+SLTMVMGDDMVKVIAW
Sbjct  319  FAEEVNAAFREAADKELKGILDVCDEPLVSVDFRCSDVSSTVDASLTMVMGDDMVKVIAW  378

Query  177  YDNEWGYSQRVVDLADIVANQWK  109
            YDNEWGYSQRVVDLADIVANQWK
Sbjct  379  YDNEWGYSQRVVDLADIVANQWK  401



>ref|XP_006652372.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
isoform X1 [Oryza brachyantha]
Length=403

 Score =   303 bits (777),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 194/203 (96%), Positives = 198/203 (98%), Gaps = 0/203 (0%)
 Frame = -1

Query  717  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldash  538
            VGVNAD YSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH
Sbjct  201  VGVNADQYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH  260

Query  537  rdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKT  358
            RDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKT
Sbjct  261  RDLRRARAAALNIVPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKT  320

Query  357  FAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAW  178
             AEEVNAAFR+SAANEL GIL VCD PLVSVDFRCSDVSST+D+SLTMVMGDDMVKVIAW
Sbjct  321  LAEEVNAAFRDSAANELQGILEVCDVPLVSVDFRCSDVSSTIDASLTMVMGDDMVKVIAW  380

Query  177  YDNEWGYSQRVVDLADIVANQWK  109
            YDNEWGYSQRVVDLADIVANQWK
Sbjct  381  YDNEWGYSQRVVDLADIVANQWK  403



>ref|XP_006652373.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
isoform X2 [Oryza brachyantha]
Length=401

 Score =   303 bits (776),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 194/203 (96%), Positives = 198/203 (98%), Gaps = 0/203 (0%)
 Frame = -1

Query  717  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldash  538
            VGVNAD YSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH
Sbjct  199  VGVNADQYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH  258

Query  537  rdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKT  358
            RDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKT
Sbjct  259  RDLRRARAAALNIVPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKT  318

Query  357  FAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAW  178
             AEEVNAAFR+SAANEL GIL VCD PLVSVDFRCSDVSST+D+SLTMVMGDDMVKVIAW
Sbjct  319  LAEEVNAAFRDSAANELQGILEVCDVPLVSVDFRCSDVSSTIDASLTMVMGDDMVKVIAW  378

Query  177  YDNEWGYSQRVVDLADIVANQWK  109
            YDNEWGYSQRVVDLADIVANQWK
Sbjct  379  YDNEWGYSQRVVDLADIVANQWK  401



>ref|XP_007032095.1| Glyceraldehyde 3-phosphate dehydrogenase A subunit 2 [Theobroma 
cacao]
 gb|EOY03021.1| Glyceraldehyde 3-phosphate dehydrogenase A subunit 2 [Theobroma 
cacao]
Length=404

 Score =   303 bits (776),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 194/203 (96%), Positives = 200/203 (99%), Gaps = 0/203 (0%)
 Frame = -1

Query  717  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldash  538
            VGVNAD+Y+PDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH
Sbjct  202  VGVNADSYNPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH  261

Query  537  rdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKT  358
            RDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKT
Sbjct  262  RDLRRARAAALNIVPTSTGAAKAVALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKT  321

Query  357  FAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAW  178
            FAEEVNAAFR+SA  EL+GILSVCDEPLVSVDFRCSDVSSTVD+SLTMVMGDDMVKVIAW
Sbjct  322  FAEEVNAAFRDSAEKELNGILSVCDEPLVSVDFRCSDVSSTVDASLTMVMGDDMVKVIAW  381

Query  177  YDNEWGYSQRVVDLADIVANQWK  109
            YDNEWGYSQRVVDLADIVAN WK
Sbjct  382  YDNEWGYSQRVVDLADIVANNWK  404



>ref|XP_009152035.1| PREDICTED: LOW QUALITY PROTEIN: glyceraldehyde-3-phosphate dehydrogenase 
GAPA1, chloroplastic [Brassica rapa]
Length=400

 Score =   303 bits (775),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 194/203 (96%), Positives = 198/203 (98%), Gaps = 0/203 (0%)
 Frame = -1

Query  717  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldash  538
            VGVNADAY+PDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH
Sbjct  198  VGVNADAYNPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH  257

Query  537  rdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKT  358
            RDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQV+KKT
Sbjct  258  RDLRRARAAALNIVPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVTKKT  317

Query  357  FAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAW  178
            FAEEVNAAFRESA  EL GIL VCDEPLVSVDFRCSDVSST+DSSLTMVMGDDMVKVIAW
Sbjct  318  FAEEVNAAFRESAEKELKGILEVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAW  377

Query  177  YDNEWGYSQRVVDLADIVANQWK  109
            YDNEWGYSQRVVDLADIVAN WK
Sbjct  378  YDNEWGYSQRVVDLADIVANNWK  400



>ref|XP_004231523.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
[Solanum lycopersicum]
Length=409

 Score =   303 bits (776),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 196/202 (97%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = -1

Query  717  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldash  538
            VGVNAD YSPDE IISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH
Sbjct  207  VGVNADLYSPDESIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH  266

Query  537  rdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKT  358
            RDLRRARAAALNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVSKKT
Sbjct  267  RDLRRARAAALNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVSKKT  326

Query  357  FAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAW  178
            FAEEVNAAFRESA NEL GILSVCDEPLVSVDFRCSDVSSTVD+SLTMVMGDDMVKVIAW
Sbjct  327  FAEEVNAAFRESADNELAGILSVCDEPLVSVDFRCSDVSSTVDASLTMVMGDDMVKVIAW  386

Query  177  YDNEWGYSQRVVDLADIVANQW  112
            YDNEWGYSQRVVDLA+IVANQW
Sbjct  387  YDNEWGYSQRVVDLANIVANQW  408



>ref|XP_008231212.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Prunus mume]
Length=403

 Score =   303 bits (775),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 195/203 (96%), Positives = 199/203 (98%), Gaps = 0/203 (0%)
 Frame = -1

Query  717  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldash  538
            VGVNADAYSPDE IISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH
Sbjct  201  VGVNADAYSPDETIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH  260

Query  537  rdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKT  358
            RDLRRARAAALNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQV+KKT
Sbjct  261  RDLRRARAAALNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVTKKT  320

Query  357  FAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAW  178
            FAEEVNAAFR+S+A EL GILSVCDEPLVSVDFRC+DVSSTVDSSLTMVMGDDMVKVIAW
Sbjct  321  FAEEVNAAFRDSSAKELAGILSVCDEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVIAW  380

Query  177  YDNEWGYSQRVVDLADIVANQWK  109
            YDNEWGYSQRVVDLADIVAN WK
Sbjct  381  YDNEWGYSQRVVDLADIVANNWK  403



>ref|XP_008797069.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Phoenix dactylifera]
 ref|XP_008797070.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Phoenix dactylifera]
Length=445

 Score =   304 bits (778),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 194/203 (96%), Positives = 199/203 (98%), Gaps = 0/203 (0%)
 Frame = -1

Query  717  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldash  538
            VGVNADAY+PDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH
Sbjct  243  VGVNADAYNPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH  302

Query  537  rdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKT  358
            RDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKT
Sbjct  303  RDLRRARAAALNIVPTSTGAAKAVALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKT  362

Query  357  FAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAW  178
            FAEEVNAAFR++A  EL GILSVCDEPLVSVDFRC+DVSSTVDSSLTMVMGDDMVKVIAW
Sbjct  363  FAEEVNAAFRDTAEKELKGILSVCDEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVIAW  422

Query  177  YDNEWGYSQRVVDLADIVANQWK  109
            YDNEWGYSQRVVDLADIVAN WK
Sbjct  423  YDNEWGYSQRVVDLADIVANNWK  445



>ref|XP_007217883.1| hypothetical protein PRUPE_ppa006610mg [Prunus persica]
 gb|EMJ19082.1| hypothetical protein PRUPE_ppa006610mg [Prunus persica]
Length=403

 Score =   302 bits (774),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 195/203 (96%), Positives = 199/203 (98%), Gaps = 0/203 (0%)
 Frame = -1

Query  717  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldash  538
            VGVNADAYSPDE IISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH
Sbjct  201  VGVNADAYSPDETIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH  260

Query  537  rdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKT  358
            RDLRRARAAALNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQV+KKT
Sbjct  261  RDLRRARAAALNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVTKKT  320

Query  357  FAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAW  178
            FAEEVNAAFR+S+A EL GILSVCDEPLVSVDFRC+DVSSTVDSSLTMVMGDDMVKVIAW
Sbjct  321  FAEEVNAAFRDSSAKELAGILSVCDEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVIAW  380

Query  177  YDNEWGYSQRVVDLADIVANQWK  109
            YDNEWGYSQRVVDLADIVAN WK
Sbjct  381  YDNEWGYSQRVVDLADIVANNWK  403



>ref|XP_009420999.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Musa acuminata subsp. malaccensis]
Length=402

 Score =   302 bits (774),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 195/203 (96%), Positives = 199/203 (98%), Gaps = 0/203 (0%)
 Frame = -1

Query  717  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldash  538
            VGVN DAY+PDEPIISNASCTTNCLAPFVK+LDQKFGIIKGTMTTTHSYTGDQRLLDASH
Sbjct  200  VGVNEDAYNPDEPIISNASCTTNCLAPFVKILDQKFGIIKGTMTTTHSYTGDQRLLDASH  259

Query  537  rdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKT  358
            RDLRRARAAALNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVSKKT
Sbjct  260  RDLRRARAAALNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVSKKT  319

Query  357  FAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAW  178
            FAEEVNAAFR++A  EL GILSVCDEPLVSVDFRCSDVSSTVDSSLTMVMGDDMVKVIAW
Sbjct  320  FAEEVNAAFRDAADKELKGILSVCDEPLVSVDFRCSDVSSTVDSSLTMVMGDDMVKVIAW  379

Query  177  YDNEWGYSQRVVDLADIVANQWK  109
            YDNEWGYSQRVVDLADIVANQWK
Sbjct  380  YDNEWGYSQRVVDLADIVANQWK  402



>ref|XP_009631078.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Nicotiana tomentosiformis]
Length=401

 Score =   302 bits (773),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 194/203 (96%), Positives = 198/203 (98%), Gaps = 0/203 (0%)
 Frame = -1

Query  717  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldash  538
            VGVNAD Y+PDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH
Sbjct  199  VGVNADLYNPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH  258

Query  537  rdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKT  358
            RDLRRARAAALNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQV+KKT
Sbjct  259  RDLRRARAAALNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVTKKT  318

Query  357  FAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAW  178
            FAEEVNAAFRE+A  EL GIL VCDEPLVSVDFRCSDVSSTVD+SLTMVMGDDMVKVIAW
Sbjct  319  FAEEVNAAFREAADKELKGILDVCDEPLVSVDFRCSDVSSTVDASLTMVMGDDMVKVIAW  378

Query  177  YDNEWGYSQRVVDLADIVANQWK  109
            YDNEWGYSQRVVDLADIVANQWK
Sbjct  379  YDNEWGYSQRVVDLADIVANQWK  401



>ref|XP_003548805.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
[Glycine max]
Length=403

 Score =   302 bits (774),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 195/203 (96%), Positives = 198/203 (98%), Gaps = 0/203 (0%)
 Frame = -1

Query  717  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldash  538
            VGVN   YSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH
Sbjct  201  VGVNEYDYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH  260

Query  537  rdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKT  358
            RDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKT
Sbjct  261  RDLRRARAAALNIVPTSTGAAKAVALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKT  320

Query  357  FAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAW  178
            FAEEVNAAFRESA NEL GILSVCDEPLVSVDFRC+DVSSTVDSSLTMVMGDDMVKVIAW
Sbjct  321  FAEEVNAAFRESADNELQGILSVCDEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVIAW  380

Query  177  YDNEWGYSQRVVDLADIVANQWK  109
            YDNEWGYSQRVVDLADIVAN+WK
Sbjct  381  YDNEWGYSQRVVDLADIVANKWK  403



>emb|CCF55355.1| Glyceraldehyde-3-phosphate dehydrogenase A [Cucumis sativus]
Length=403

 Score =   302 bits (773),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 195/203 (96%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -1

Query  717  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldash  538
            VGVNADAYS DE IISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH
Sbjct  201  VGVNADAYSHDESIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH  260

Query  537  rdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKT  358
            RDLRRARAAALNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPN SVVDLVVQVSKKT
Sbjct  261  RDLRRARAAALNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNASVVDLVVQVSKKT  320

Query  357  FAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAW  178
            FAEEVNAAFRESA  EL+GILSVCDEPLVSVDFRCSDVSSTVDSSLTMVMGDD+VKVIAW
Sbjct  321  FAEEVNAAFRESAEKELNGILSVCDEPLVSVDFRCSDVSSTVDSSLTMVMGDDLVKVIAW  380

Query  177  YDNEWGYSQRVVDLADIVANQWK  109
            YDNEWGYSQRVVDLADIVAN WK
Sbjct  381  YDNEWGYSQRVVDLADIVANNWK  403



>gb|KDP41897.1| hypothetical protein JCGZ_26915 [Jatropha curcas]
Length=411

 Score =   302 bits (774),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 195/203 (96%), Positives = 198/203 (98%), Gaps = 0/203 (0%)
 Frame = -1

Query  717  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldash  538
            VGVNADAY+P EPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH
Sbjct  209  VGVNADAYNPAEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH  268

Query  537  rdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKT  358
            RDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKT
Sbjct  269  RDLRRARAAALNIVPTSTGAAKAVALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKT  328

Query  357  FAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAW  178
            FAEEVNAAFRESA  EL GILSVCDEPLVSVDFRC+DVSSTVDSSLTMVMGDDMVKVIAW
Sbjct  329  FAEEVNAAFRESADKELKGILSVCDEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVIAW  388

Query  177  YDNEWGYSQRVVDLADIVANQWK  109
            YDNEWGYSQRVVDLADIVAN WK
Sbjct  389  YDNEWGYSQRVVDLADIVANNWK  411



>gb|KHN46819.1| Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic [Glycine 
soja]
Length=403

 Score =   302 bits (773),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 195/203 (96%), Positives = 198/203 (98%), Gaps = 0/203 (0%)
 Frame = -1

Query  717  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldash  538
            VGVN   YSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH
Sbjct  201  VGVNEYDYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH  260

Query  537  rdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKT  358
            RDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKT
Sbjct  261  RDLRRARAAALNIVPTSTGAAKAVALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKT  320

Query  357  FAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAW  178
            FAEEVNAAFRESA NEL GILSVCDEPLVSVDFRC+DVSSTVDSSLTMVMGDDMVKVIAW
Sbjct  321  FAEEVNAAFRESADNELKGILSVCDEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVIAW  380

Query  177  YDNEWGYSQRVVDLADIVANQWK  109
            YDNEWGYSQRVVDLADIVAN+WK
Sbjct  381  YDNEWGYSQRVVDLADIVANKWK  403



>gb|KHN46369.1| Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic [Glycine 
soja]
Length=403

 Score =   302 bits (773),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 195/203 (96%), Positives = 198/203 (98%), Gaps = 0/203 (0%)
 Frame = -1

Query  717  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldash  538
            VGVN   YSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH
Sbjct  201  VGVNEYDYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH  260

Query  537  rdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKT  358
            RDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKT
Sbjct  261  RDLRRARAAALNIVPTSTGAAKAVALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKT  320

Query  357  FAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAW  178
            FAEEVNAAFRESA NEL GILSVCDEPLVSVDFRC+DVSSTVDSSLTMVMGDDMVKVIAW
Sbjct  321  FAEEVNAAFRESADNELKGILSVCDEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVIAW  380

Query  177  YDNEWGYSQRVVDLADIVANQWK  109
            YDNEWGYSQRVVDLADIVAN+WK
Sbjct  381  YDNEWGYSQRVVDLADIVANKWK  403



>ref|NP_001238484.1| glyceraldehyde-3-phosphate dehydrogenase A subunit [Glycine max]
 gb|ABA86963.1| glyceraldehyde-3-phosphate dehydrogenase A subunit [Glycine max]
Length=403

 Score =   302 bits (773),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 195/203 (96%), Positives = 198/203 (98%), Gaps = 0/203 (0%)
 Frame = -1

Query  717  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldash  538
            VGVN   YSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH
Sbjct  201  VGVNEYDYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH  260

Query  537  rdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKT  358
            RDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKT
Sbjct  261  RDLRRARAAALNIVPTSTGAAKAVALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKT  320

Query  357  FAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAW  178
            FAEEVNAAFRESA NEL GILSVCDEPLVSVDFRC+DVSSTVDSSLTMVMGDDMVKVIAW
Sbjct  321  FAEEVNAAFRESADNELKGILSVCDEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVIAW  380

Query  177  YDNEWGYSQRVVDLADIVANQWK  109
            YDNEWGYSQRVVDLADIVAN+WK
Sbjct  381  YDNEWGYSQRVVDLADIVANKWK  403



>gb|ABK96233.1| unknown [Populus trichocarpa x Populus deltoides]
Length=404

 Score =   302 bits (773),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 195/203 (96%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -1

Query  717  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldash  538
            VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH
Sbjct  202  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH  261

Query  537  rdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKT  358
            RDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKT
Sbjct  262  RDLRRARAAALNIVPTSTGAAKAVALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKT  321

Query  357  FAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAW  178
            FAEEVN  FRESA  EL GILSVCDEPLVSVDFRCSDVSSTVDSSLTMVMGDDMVKVIAW
Sbjct  322  FAEEVNEGFRESAEKELKGILSVCDEPLVSVDFRCSDVSSTVDSSLTMVMGDDMVKVIAW  381

Query  177  YDNEWGYSQRVVDLADIVANQWK  109
            YDNEWGYSQRVVDLA IVA+QWK
Sbjct  382  YDNEWGYSQRVVDLAHIVADQWK  404



>ref|XP_008379036.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Malus domestica]
Length=403

 Score =   302 bits (773),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 195/203 (96%), Positives = 198/203 (98%), Gaps = 0/203 (0%)
 Frame = -1

Query  717  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldash  538
            VGVNADAYSPDE IISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH
Sbjct  201  VGVNADAYSPDETIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH  260

Query  537  rdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKT  358
            RDLRRARAAALNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQV+KKT
Sbjct  261  RDLRRARAAALNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVTKKT  320

Query  357  FAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAW  178
            FAEEVNAAFR+SA  EL GILSVCDEPLVSVDFRC+DVSSTVDSSLTMVMGDDMVKVIAW
Sbjct  321  FAEEVNAAFRDSAEKELAGILSVCDEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVIAW  380

Query  177  YDNEWGYSQRVVDLADIVANQWK  109
            YDNEWGYSQRVVDLADIVAN WK
Sbjct  381  YDNEWGYSQRVVDLADIVANNWK  403



>ref|XP_009404713.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=404

 Score =   301 bits (772),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 195/203 (96%), Positives = 198/203 (98%), Gaps = 0/203 (0%)
 Frame = -1

Query  717  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldash  538
            VGVNAD Y+PDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH
Sbjct  202  VGVNADTYNPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH  261

Query  537  rdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKT  358
            RDLRRARAAALNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVSKKT
Sbjct  262  RDLRRARAAALNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVSKKT  321

Query  357  FAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAW  178
             AEEVNAAFR +A  EL+GILSVCDEPLVSVDFRCSDVSSTVDSSLTMVMGDDMVKVIAW
Sbjct  322  LAEEVNAAFRNAAEKELNGILSVCDEPLVSVDFRCSDVSSTVDSSLTMVMGDDMVKVIAW  381

Query  177  YDNEWGYSQRVVDLADIVANQWK  109
            YDNEWGYSQRVVDLADIVANQWK
Sbjct  382  YDNEWGYSQRVVDLADIVANQWK  404



>emb|CDY13649.1| BnaA06g32740D [Brassica napus]
Length=380

 Score =   301 bits (770),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 193/203 (95%), Positives = 198/203 (98%), Gaps = 0/203 (0%)
 Frame = -1

Query  717  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldash  538
            VGVNADAY+PDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH
Sbjct  178  VGVNADAYNPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH  237

Query  537  rdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKT  358
            RDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQV+KKT
Sbjct  238  RDLRRARAAALNIVPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVTKKT  297

Query  357  FAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAW  178
            FAEEVNAAFR+SA  EL GIL VCDEPLVSVDFRCSDVSST+DSSLTMVMGDDMVKVIAW
Sbjct  298  FAEEVNAAFRDSAEKELKGILEVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAW  357

Query  177  YDNEWGYSQRVVDLADIVANQWK  109
            YDNEWGYSQRVVDLADIVAN WK
Sbjct  358  YDNEWGYSQRVVDLADIVANNWK  380



>gb|KJB70723.1| hypothetical protein B456_011G088800 [Gossypium raimondii]
Length=408

 Score =   301 bits (772),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 193/203 (95%), Positives = 198/203 (98%), Gaps = 0/203 (0%)
 Frame = -1

Query  717  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldash  538
            VGVNAD Y+PDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH
Sbjct  206  VGVNADTYNPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH  265

Query  537  rdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKT  358
            RDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKT
Sbjct  266  RDLRRARAAALNIVPTSTGAAKAVALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKT  325

Query  357  FAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAW  178
            FAEEVNAAF+ESA  EL GILSVC+EPLVSVDFRCSDVSSTVD+SLTMVMGDDMVKVIAW
Sbjct  326  FAEEVNAAFKESAEKELQGILSVCEEPLVSVDFRCSDVSSTVDASLTMVMGDDMVKVIAW  385

Query  177  YDNEWGYSQRVVDLADIVANQWK  109
            YDNEWGYSQRVVDLADIVAN WK
Sbjct  386  YDNEWGYSQRVVDLADIVANSWK  408



>ref|XP_004161334.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
[Cucumis sativus]
Length=403

 Score =   301 bits (771),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 196/203 (97%), Positives = 198/203 (98%), Gaps = 0/203 (0%)
 Frame = -1

Query  717  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldash  538
            VGVNADAYS DE IISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH
Sbjct  201  VGVNADAYSHDESIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH  260

Query  537  rdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKT  358
            RDLRRARAAALNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVSKKT
Sbjct  261  RDLRRARAAALNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVSKKT  320

Query  357  FAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAW  178
            FAEEVNAAFRESA  EL+GILSVCDEPLVSVDFRCSDVSSTVDSSLTMVMGDD+VKVIAW
Sbjct  321  FAEEVNAAFRESAEKELNGILSVCDEPLVSVDFRCSDVSSTVDSSLTMVMGDDLVKVIAW  380

Query  177  YDNEWGYSQRVVDLADIVANQWK  109
            YDNEWGYSQRVVDLADIVAN WK
Sbjct  381  YDNEWGYSQRVVDLADIVANNWK  403



>ref|XP_010514317.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPA1, chloroplastic-like 
isoform X1 [Camelina sativa]
 ref|XP_010514318.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPA1, chloroplastic-like 
isoform X2 [Camelina sativa]
 ref|XP_010514319.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPA1, chloroplastic-like 
isoform X3 [Camelina sativa]
Length=400

 Score =   301 bits (771),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 192/203 (95%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -1

Query  717  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldash  538
            VGVNADAYS DEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH
Sbjct  198  VGVNADAYSHDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH  257

Query  537  rdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKT  358
            RDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKT
Sbjct  258  RDLRRARAAALNIVPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKT  317

Query  357  FAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAW  178
            FAEEVNAAFR+SA  EL GIL VCDEPLVSVDFRCSD S+T+DSSLTMVMGDDMVKVIAW
Sbjct  318  FAEEVNAAFRDSAEKELKGILEVCDEPLVSVDFRCSDYSTTIDSSLTMVMGDDMVKVIAW  377

Query  177  YDNEWGYSQRVVDLADIVANQWK  109
            YDNEWGYSQRVVDLADIVAN+WK
Sbjct  378  YDNEWGYSQRVVDLADIVANKWK  400



>ref|XP_004145622.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
[Cucumis sativus]
 gb|KGN57690.1| hypothetical protein Csa_3G252490 [Cucumis sativus]
Length=403

 Score =   301 bits (771),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 196/203 (97%), Positives = 198/203 (98%), Gaps = 0/203 (0%)
 Frame = -1

Query  717  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldash  538
            VGVNADAYS DE IISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH
Sbjct  201  VGVNADAYSHDESIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH  260

Query  537  rdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKT  358
            RDLRRARAAALNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVSKKT
Sbjct  261  RDLRRARAAALNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVSKKT  320

Query  357  FAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAW  178
            FAEEVNAAFRESA  EL+GILSVCDEPLVSVDFRCSDVSSTVDSSLTMVMGDD+VKVIAW
Sbjct  321  FAEEVNAAFRESAEKELNGILSVCDEPLVSVDFRCSDVSSTVDSSLTMVMGDDLVKVIAW  380

Query  177  YDNEWGYSQRVVDLADIVANQWK  109
            YDNEWGYSQRVVDLADIVAN WK
Sbjct  381  YDNEWGYSQRVVDLADIVANNWK  403



>ref|XP_006395535.1| hypothetical protein EUTSA_v10004349mg [Eutrema salsugineum]
 gb|ESQ32821.1| hypothetical protein EUTSA_v10004349mg [Eutrema salsugineum]
Length=400

 Score =   301 bits (770),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 193/203 (95%), Positives = 198/203 (98%), Gaps = 0/203 (0%)
 Frame = -1

Query  717  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldash  538
            VGVNADAY+PDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH
Sbjct  198  VGVNADAYNPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH  257

Query  537  rdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKT  358
            RDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKT
Sbjct  258  RDLRRARAAALNIVPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKT  317

Query  357  FAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAW  178
            FAEEVNAAFR++A  EL GIL VCDEPLVSVDFRCSDVSST+DSSLTMVMGDDMVKVIAW
Sbjct  318  FAEEVNAAFRDAAEKELKGILEVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAW  377

Query  177  YDNEWGYSQRVVDLADIVANQWK  109
            YDNEWGYSQRVVDLADIVAN WK
Sbjct  378  YDNEWGYSQRVVDLADIVANNWK  400



>emb|CDY28536.1| BnaC02g36240D [Brassica napus]
Length=380

 Score =   300 bits (769),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 192/203 (95%), Positives = 198/203 (98%), Gaps = 0/203 (0%)
 Frame = -1

Query  717  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldash  538
            VGVNADAY+PDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH
Sbjct  178  VGVNADAYNPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH  237

Query  537  rdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKT  358
            RDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQV+KKT
Sbjct  238  RDLRRARAAALNIVPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVTKKT  297

Query  357  FAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAW  178
            FAEE+NAAFR+SA  EL GIL VCDEPLVSVDFRCSDVSST+DSSLTMVMGDDMVKVIAW
Sbjct  298  FAEEINAAFRDSAEKELKGILEVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAW  357

Query  177  YDNEWGYSQRVVDLADIVANQWK  109
            YDNEWGYSQRVVDLADIVAN WK
Sbjct  358  YDNEWGYSQRVVDLADIVANNWK  380



>ref|XP_010425375.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPA1, chloroplastic 
isoform X1 [Camelina sativa]
Length=400

 Score =   301 bits (770),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 192/203 (95%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -1

Query  717  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldash  538
            VGVNADAYS DEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH
Sbjct  198  VGVNADAYSHDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH  257

Query  537  rdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKT  358
            RDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKT
Sbjct  258  RDLRRARAAALNIVPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKT  317

Query  357  FAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAW  178
            FAEEVNAAFR+SA  EL GIL VCDEPLVSVDFRCSD S+T+DSSLTMVMGDDMVKVIAW
Sbjct  318  FAEEVNAAFRDSAEKELKGILDVCDEPLVSVDFRCSDYSTTIDSSLTMVMGDDMVKVIAW  377

Query  177  YDNEWGYSQRVVDLADIVANQWK  109
            YDNEWGYSQRVVDLADIVAN+WK
Sbjct  378  YDNEWGYSQRVVDLADIVANKWK  400



>ref|XP_010250427.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Nelumbo nucifera]
Length=402

 Score =   301 bits (770),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 194/203 (96%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -1

Query  717  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldash  538
            VGVNAD Y+PDE IISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH
Sbjct  200  VGVNADTYNPDETIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH  259

Query  537  rdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKT  358
            RDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKT
Sbjct  260  RDLRRARAAALNIVPTSTGAAKAVALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKT  319

Query  357  FAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAW  178
            FAEEVNAAFRESA  EL GILSVCDEPLVSVDFRCSDVSSTVD+SLTMVMGDDMVKVIAW
Sbjct  320  FAEEVNAAFRESADKELKGILSVCDEPLVSVDFRCSDVSSTVDASLTMVMGDDMVKVIAW  379

Query  177  YDNEWGYSQRVVDLADIVANQWK  109
            YDNEWGYSQRVVDLADIVAN WK
Sbjct  380  YDNEWGYSQRVVDLADIVANNWK  402



>gb|AAD10209.1| glyceraldehyde 3-phosphate dehydrogenase A subunit [Arabidopsis 
thaliana]
Length=350

 Score =   299 bits (766),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 192/203 (95%), Positives = 196/203 (97%), Gaps = 0/203 (0%)
 Frame = -1

Query  717  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldash  538
            VGVNADAYS DEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH
Sbjct  148  VGVNADAYSHDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH  207

Query  537  rdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKT  358
            RDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKT
Sbjct  208  RDLRRARAAALNIVPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKT  267

Query  357  FAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAW  178
            FAEEVNAAFR+SA  EL GIL VCDEPLVSVDFRCSD S+T+DSSLTMVMGDDMVKVIAW
Sbjct  268  FAEEVNAAFRDSAEKELKGILDVCDEPLVSVDFRCSDFSTTIDSSLTMVMGDDMVKVIAW  327

Query  177  YDNEWGYSQRVVDLADIVANQWK  109
            YDNEWGYSQRVVDLADIVAN WK
Sbjct  328  YDNEWGYSQRVVDLADIVANNWK  350



>ref|XP_010249379.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
[Nelumbo nucifera]
Length=402

 Score =   301 bits (770),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 194/203 (96%), Positives = 200/203 (99%), Gaps = 0/203 (0%)
 Frame = -1

Query  717  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldash  538
            VGVNAD+Y+P+EPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH
Sbjct  200  VGVNADSYNPEEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH  259

Query  537  rdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKT  358
            RDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKT
Sbjct  260  RDLRRARAAALNIVPTSTGAAKAVALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKT  319

Query  357  FAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAW  178
            FAEEVNAAFRE+A  EL+GILSVCDEPLVSVDFRCSDVSSTVDSSLTMVMGDDMVKVIAW
Sbjct  320  FAEEVNAAFREAADKELNGILSVCDEPLVSVDFRCSDVSSTVDSSLTMVMGDDMVKVIAW  379

Query  177  YDNEWGYSQRVVDLADIVANQWK  109
            YDNEWGYSQRVVDLADIVAN WK
Sbjct  380  YDNEWGYSQRVVDLADIVANNWK  402



>ref|XP_010502597.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPA1, chloroplastic-like 
isoform X1 [Camelina sativa]
Length=400

 Score =   301 bits (770),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 192/203 (95%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -1

Query  717  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldash  538
            VGVNADAYS DEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH
Sbjct  198  VGVNADAYSHDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH  257

Query  537  rdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKT  358
            RDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKT
Sbjct  258  RDLRRARAAALNIVPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKT  317

Query  357  FAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAW  178
            FAEEVNAAFR+SA  EL GIL VCDEPLVSVDFRCSD S+T+DSSLTMVMGDDMVKVIAW
Sbjct  318  FAEEVNAAFRDSAEKELKGILDVCDEPLVSVDFRCSDYSTTIDSSLTMVMGDDMVKVIAW  377

Query  177  YDNEWGYSQRVVDLADIVANQWK  109
            YDNEWGYSQRVVDLADIVAN+WK
Sbjct  378  YDNEWGYSQRVVDLADIVANKWK  400



>gb|ABW89099.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABW89100.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABW89101.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABW89102.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABW89103.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABW89105.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABW89106.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABW89107.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABW89108.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABW89109.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABW89110.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABW89111.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABW89112.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABW89113.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABW89114.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABW89115.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABW89116.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABW89117.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
Length=206

 Score =   294 bits (752),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 192/203 (95%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -1

Query  717  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldash  538
            VGVNA+ Y+  E IISNASCTTNCLAPFVKV+DQKFGIIKGTMTTTHSYTGDQRLLDASH
Sbjct  4    VGVNAELYNHSEAIISNASCTTNCLAPFVKVIDQKFGIIKGTMTTTHSYTGDQRLLDASH  63

Query  537  rdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKT  358
            RDLRRARAAALNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVSKKT
Sbjct  64   RDLRRARAAALNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVSKKT  123

Query  357  FAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAW  178
            FAEEVNAAFRE+A NEL+GILSVCDEPLVSVDFRCSDVSSTVDSSLTMVMGDDMVKVIAW
Sbjct  124  FAEEVNAAFREAADNELNGILSVCDEPLVSVDFRCSDVSSTVDSSLTMVMGDDMVKVIAW  183

Query  177  YDNEWGYSQRVVDLADIVANQWK  109
            YDNEWGYSQRVVDLADIVAN WK
Sbjct  184  YDNEWGYSQRVVDLADIVANNWK  206



>ref|XP_009378072.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
isoform X2 [Pyrus x bretschneideri]
Length=355

 Score =   299 bits (765),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 194/203 (96%), Positives = 198/203 (98%), Gaps = 0/203 (0%)
 Frame = -1

Query  717  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldash  538
            VGVNADAY+PDE IISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH
Sbjct  153  VGVNADAYNPDETIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH  212

Query  537  rdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKT  358
            RDLRRARAAALNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQV+KKT
Sbjct  213  RDLRRARAAALNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVTKKT  272

Query  357  FAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAW  178
            FAEEVNAAFR+SA  EL GILSVCDEPLVSVDFRC+DVSSTVDSSLTMVMGDDMVKVIAW
Sbjct  273  FAEEVNAAFRDSAEKELAGILSVCDEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVIAW  332

Query  177  YDNEWGYSQRVVDLADIVANQWK  109
            YDNEWGYSQRVVDLADIVAN WK
Sbjct  333  YDNEWGYSQRVVDLADIVANNWK  355



>pdb|3K2B|A Chain A, Crystal Structure Of Photosynthetic A4 Isoform Glyceraldehyde-3- 
Phosphate Dehydrogenase Complexed With Nad, From 
Arabidopsis Thaliana
 pdb|3K2B|B Chain B, Crystal Structure Of Photosynthetic A4 Isoform Glyceraldehyde-3- 
Phosphate Dehydrogenase Complexed With Nad, From 
Arabidopsis Thaliana
 pdb|3K2B|C Chain C, Crystal Structure Of Photosynthetic A4 Isoform Glyceraldehyde-3- 
Phosphate Dehydrogenase Complexed With Nad, From 
Arabidopsis Thaliana
 pdb|3K2B|D Chain D, Crystal Structure Of Photosynthetic A4 Isoform Glyceraldehyde-3- 
Phosphate Dehydrogenase Complexed With Nad, From 
Arabidopsis Thaliana
 pdb|3K2B|E Chain E, Crystal Structure Of Photosynthetic A4 Isoform Glyceraldehyde-3- 
Phosphate Dehydrogenase Complexed With Nad, From 
Arabidopsis Thaliana
 pdb|3K2B|F Chain F, Crystal Structure Of Photosynthetic A4 Isoform Glyceraldehyde-3- 
Phosphate Dehydrogenase Complexed With Nad, From 
Arabidopsis Thaliana
 pdb|3K2B|G Chain G, Crystal Structure Of Photosynthetic A4 Isoform Glyceraldehyde-3- 
Phosphate Dehydrogenase Complexed With Nad, From 
Arabidopsis Thaliana
 pdb|3K2B|H Chain H, Crystal Structure Of Photosynthetic A4 Isoform Glyceraldehyde-3- 
Phosphate Dehydrogenase Complexed With Nad, From 
Arabidopsis Thaliana
 pdb|3K2B|O Chain O, Crystal Structure Of Photosynthetic A4 Isoform Glyceraldehyde-3- 
Phosphate Dehydrogenase Complexed With Nad, From 
Arabidopsis Thaliana
 pdb|3K2B|Q Chain Q, Crystal Structure Of Photosynthetic A4 Isoform Glyceraldehyde-3- 
Phosphate Dehydrogenase Complexed With Nad, From 
Arabidopsis Thaliana
 pdb|3QV1|A Chain A, Crystal Structure Of The Binary Complex Of Photosyntetic 
A4 Glyceraldehyde 3-phosphate Dehydrogenase (gapdh) With 
Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3QV1|B Chain B, Crystal Structure Of The Binary Complex Of Photosyntetic 
A4 Glyceraldehyde 3-phosphate Dehydrogenase (gapdh) With 
Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3QV1|C Chain C, Crystal Structure Of The Binary Complex Of Photosyntetic 
A4 Glyceraldehyde 3-phosphate Dehydrogenase (gapdh) With 
Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3QV1|D Chain D, Crystal Structure Of The Binary Complex Of Photosyntetic 
A4 Glyceraldehyde 3-phosphate Dehydrogenase (gapdh) With 
Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3QV1|E Chain E, Crystal Structure Of The Binary Complex Of Photosyntetic 
A4 Glyceraldehyde 3-phosphate Dehydrogenase (gapdh) With 
Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3QV1|F Chain F, Crystal Structure Of The Binary Complex Of Photosyntetic 
A4 Glyceraldehyde 3-phosphate Dehydrogenase (gapdh) With 
Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3RVD|A Chain A, Crystal Structure Of The Binary Complex, Obtained By 
Soaking, Of Photosyntetic A4 Glyceraldehyde 3-phosphate Dehydrogenase 
(gapdh) With Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3RVD|B Chain B, Crystal Structure Of The Binary Complex, Obtained By 
Soaking, Of Photosyntetic A4 Glyceraldehyde 3-phosphate Dehydrogenase 
(gapdh) With Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3RVD|C Chain C, Crystal Structure Of The Binary Complex, Obtained By 
Soaking, Of Photosyntetic A4 Glyceraldehyde 3-phosphate Dehydrogenase 
(gapdh) With Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3RVD|D Chain D, Crystal Structure Of The Binary Complex, Obtained By 
Soaking, Of Photosyntetic A4 Glyceraldehyde 3-phosphate Dehydrogenase 
(gapdh) With Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3RVD|E Chain E, Crystal Structure Of The Binary Complex, Obtained By 
Soaking, Of Photosyntetic A4 Glyceraldehyde 3-phosphate Dehydrogenase 
(gapdh) With Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3RVD|F Chain F, Crystal Structure Of The Binary Complex, Obtained By 
Soaking, Of Photosyntetic A4 Glyceraldehyde 3-phosphate Dehydrogenase 
(gapdh) With Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3RVD|G Chain G, Crystal Structure Of The Binary Complex, Obtained By 
Soaking, Of Photosyntetic A4 Glyceraldehyde 3-phosphate Dehydrogenase 
(gapdh) With Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3RVD|H Chain H, Crystal Structure Of The Binary Complex, Obtained By 
Soaking, Of Photosyntetic A4 Glyceraldehyde 3-phosphate Dehydrogenase 
(gapdh) With Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3RVD|O Chain O, Crystal Structure Of The Binary Complex, Obtained By 
Soaking, Of Photosyntetic A4 Glyceraldehyde 3-phosphate Dehydrogenase 
(gapdh) With Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3RVD|Q Chain Q, Crystal Structure Of The Binary Complex, Obtained By 
Soaking, Of Photosyntetic A4 Glyceraldehyde 3-phosphate Dehydrogenase 
(gapdh) With Cp12-2, Both From Arabidopsis Thaliana.
Length=337

 Score =   298 bits (764),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 192/203 (95%), Positives = 196/203 (97%), Gaps = 0/203 (0%)
 Frame = -1

Query  717  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldash  538
            VGVNADAYS DEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH
Sbjct  135  VGVNADAYSHDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH  194

Query  537  rdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKT  358
            RDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKT
Sbjct  195  RDLRRARAAALNIVPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKT  254

Query  357  FAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAW  178
            FAEEVNAAFR+SA  EL GIL VCDEPLVSVDFRCSD S+T+DSSLTMVMGDDMVKVIAW
Sbjct  255  FAEEVNAAFRDSAEKELKGILDVCDEPLVSVDFRCSDFSTTIDSSLTMVMGDDMVKVIAW  314

Query  177  YDNEWGYSQRVVDLADIVANQWK  109
            YDNEWGYSQRVVDLADIVAN WK
Sbjct  315  YDNEWGYSQRVVDLADIVANNWK  337



>ref|XP_002512790.1| glyceraldehyde 3-phosphate dehydrogenase, putative [Ricinus communis]
 gb|EEF49293.1| glyceraldehyde 3-phosphate dehydrogenase, putative [Ricinus communis]
Length=404

 Score =   301 bits (770),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 194/203 (96%), Positives = 196/203 (97%), Gaps = 0/203 (0%)
 Frame = -1

Query  717  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldash  538
            VGVNAD YS DEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH
Sbjct  202  VGVNADGYSADEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH  261

Query  537  rdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKT  358
            RDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQV KKT
Sbjct  262  RDLRRARAAALNIVPTSTGAAKAVALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVEKKT  321

Query  357  FAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAW  178
            FAEEVNAAFRESA  EL GILSVCDEPLVSVDFRC+DVSSTVDSSLTMVMGDDMVKVIAW
Sbjct  322  FAEEVNAAFRESADKELKGILSVCDEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVIAW  381

Query  177  YDNEWGYSQRVVDLADIVANQWK  109
            YDNEWGYSQRVVDLADIVAN WK
Sbjct  382  YDNEWGYSQRVVDLADIVANNWK  404



>gb|AAA32793.1| glyceraldehyde 3-phosphate dehydrogenase [Arabidopsis thaliana]
 emb|CAA66816.1| glyceraldehyde-3-phosphate dehydrogenase (NADP+) (phosphorylating) 
[Arabidopsis thaliana]
Length=396

 Score =   300 bits (769),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 192/203 (95%), Positives = 196/203 (97%), Gaps = 0/203 (0%)
 Frame = -1

Query  717  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldash  538
            VGVNADAYS DEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH
Sbjct  194  VGVNADAYSHDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH  253

Query  537  rdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKT  358
            RDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKT
Sbjct  254  RDLRRARAAALNIVPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKT  313

Query  357  FAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAW  178
            FAEEVNAAFR+SA  EL GIL VCDEPLVSVDFRCSD S+T+DSSLTMVMGDDMVKVIAW
Sbjct  314  FAEEVNAAFRDSAEKELKGILDVCDEPLVSVDFRCSDFSTTIDSSLTMVMGDDMVKVIAW  373

Query  177  YDNEWGYSQRVVDLADIVANQWK  109
            YDNEWGYSQRVVDLADIVAN WK
Sbjct  374  YDNEWGYSQRVVDLADIVANNWK  396



>dbj|BAP91041.1| glyceraldehyde 3-phosphate dehydrogenase-A [Nicotiana benthamiana]
Length=401

 Score =   300 bits (769),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 194/203 (96%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -1

Query  717  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldash  538
            VGVNAD Y+PDE IISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH
Sbjct  199  VGVNADLYNPDESIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH  258

Query  537  rdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKT  358
            RDLRRARAAALNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVSKKT
Sbjct  259  RDLRRARAAALNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVSKKT  318

Query  357  FAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAW  178
            FAEEVNAAFRE+A  EL GIL VCDEPLVSVDFRCSDVSSTVD+SLTMVMGDDMVKVIAW
Sbjct  319  FAEEVNAAFREAADKELKGILDVCDEPLVSVDFRCSDVSSTVDASLTMVMGDDMVKVIAW  378

Query  177  YDNEWGYSQRVVDLADIVANQWK  109
            YDNEWGYSQRVVDLADIVANQWK
Sbjct  379  YDNEWGYSQRVVDLADIVANQWK  401



>ref|XP_006291258.1| hypothetical protein CARUB_v10017390mg [Capsella rubella]
 gb|EOA24156.1| hypothetical protein CARUB_v10017390mg [Capsella rubella]
Length=400

 Score =   300 bits (769),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 192/203 (95%), Positives = 196/203 (97%), Gaps = 0/203 (0%)
 Frame = -1

Query  717  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldash  538
            VGVNADAYS DEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH
Sbjct  198  VGVNADAYSHDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH  257

Query  537  rdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKT  358
            RDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKT
Sbjct  258  RDLRRARAAALNIVPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKT  317

Query  357  FAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAW  178
            FAEEVNAAFR+SA  EL GIL VCDEPLVSVDFRCSD S+T+DSSLTMVMGDDMVKVIAW
Sbjct  318  FAEEVNAAFRDSAEKELKGILEVCDEPLVSVDFRCSDFSTTIDSSLTMVMGDDMVKVIAW  377

Query  177  YDNEWGYSQRVVDLADIVANQWK  109
            YDNEWGYSQRVVDLADIVAN WK
Sbjct  378  YDNEWGYSQRVVDLADIVANNWK  400



>ref|XP_002875330.1| gapa [Arabidopsis lyrata subsp. lyrata]
 gb|EFH51589.1| gapa [Arabidopsis lyrata subsp. lyrata]
Length=396

 Score =   300 bits (768),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 192/203 (95%), Positives = 196/203 (97%), Gaps = 0/203 (0%)
 Frame = -1

Query  717  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldash  538
            VGVNADAYS DEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH
Sbjct  194  VGVNADAYSHDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH  253

Query  537  rdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKT  358
            RDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKT
Sbjct  254  RDLRRARAAALNIVPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKT  313

Query  357  FAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAW  178
            FAEEVNAAFR+SA  EL GIL VCDEPLVSVDFRCSD S+T+DSSLTMVMGDDMVKVIAW
Sbjct  314  FAEEVNAAFRDSAEKELKGILDVCDEPLVSVDFRCSDYSTTIDSSLTMVMGDDMVKVIAW  373

Query  177  YDNEWGYSQRVVDLADIVANQWK  109
            YDNEWGYSQRVVDLADIVAN WK
Sbjct  374  YDNEWGYSQRVVDLADIVANNWK  396



>ref|XP_009378071.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
isoform X1 [Pyrus x bretschneideri]
Length=403

 Score =   300 bits (769),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 194/203 (96%), Positives = 198/203 (98%), Gaps = 0/203 (0%)
 Frame = -1

Query  717  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldash  538
            VGVNADAY+PDE IISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH
Sbjct  201  VGVNADAYNPDETIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH  260

Query  537  rdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKT  358
            RDLRRARAAALNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQV+KKT
Sbjct  261  RDLRRARAAALNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVTKKT  320

Query  357  FAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAW  178
            FAEEVNAAFR+SA  EL GILSVCDEPLVSVDFRC+DVSSTVDSSLTMVMGDDMVKVIAW
Sbjct  321  FAEEVNAAFRDSAEKELAGILSVCDEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVIAW  380

Query  177  YDNEWGYSQRVVDLADIVANQWK  109
            YDNEWGYSQRVVDLADIVAN WK
Sbjct  381  YDNEWGYSQRVVDLADIVANNWK  403



>ref|NP_566796.2| glyceraldehyde-3-phosphate dehydrogenase A subunit [Arabidopsis 
thaliana]
 sp|P25856.3|G3PA1_ARATH RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase GAPA1, 
chloroplastic; AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase A subunit 1; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAL16200.1|AF428431_1 AT3g26650/MLJ15_5 [Arabidopsis thaliana]
 dbj|BAB01730.1| glyceralehyde-3-phosphate dehydrogenase subunit [Arabidopsis 
thaliana]
 gb|AAL24215.1| AT3g26650/MLJ15_5 [Arabidopsis thaliana]
 gb|AAL25556.1| AT3g26650/MLJ15_5 [Arabidopsis thaliana]
 gb|AAL91645.1| AT3g26650/MLJ15_5 [Arabidopsis thaliana]
 gb|AAM98317.1| At3g26650/MLJ15_5 [Arabidopsis thaliana]
 gb|AEE77191.1| glyceraldehyde-3-phosphate dehydrogenase A subunit [Arabidopsis 
thaliana]
Length=396

 Score =   300 bits (768),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 192/203 (95%), Positives = 196/203 (97%), Gaps = 0/203 (0%)
 Frame = -1

Query  717  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldash  538
            VGVNADAYS DEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH
Sbjct  194  VGVNADAYSHDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH  253

Query  537  rdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKT  358
            RDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKT
Sbjct  254  RDLRRARAAALNIVPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKT  313

Query  357  FAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAW  178
            FAEEVNAAFR+SA  EL GIL VCDEPLVSVDFRCSD S+T+DSSLTMVMGDDMVKVIAW
Sbjct  314  FAEEVNAAFRDSAEKELKGILDVCDEPLVSVDFRCSDFSTTIDSSLTMVMGDDMVKVIAW  373

Query  177  YDNEWGYSQRVVDLADIVANQWK  109
            YDNEWGYSQRVVDLADIVAN WK
Sbjct  374  YDNEWGYSQRVVDLADIVANNWK  396



>ref|XP_004236849.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Solanum lycopersicum]
Length=399

 Score =   300 bits (768),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 195/203 (96%), Positives = 199/203 (98%), Gaps = 0/203 (0%)
 Frame = -1

Query  717  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldash  538
            VGVNA+ YS DEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH
Sbjct  197  VGVNAELYSHDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH  256

Query  537  rdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKT  358
            RDLRRARAAALNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQV+KKT
Sbjct  257  RDLRRARAAALNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVTKKT  316

Query  357  FAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAW  178
            FAEEVNAAFRE+A  EL+GILSVCDEPLVSVDFRCSDVSSTVDSSLTMVMGDDMVKVIAW
Sbjct  317  FAEEVNAAFREAADKELNGILSVCDEPLVSVDFRCSDVSSTVDSSLTMVMGDDMVKVIAW  376

Query  177  YDNEWGYSQRVVDLADIVANQWK  109
            YDNEWGYSQRVVDLADIVANQWK
Sbjct  377  YDNEWGYSQRVVDLADIVANQWK  399



>ref|XP_004493116.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
[Cicer arietinum]
Length=405

 Score =   300 bits (769),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 193/203 (95%), Positives = 199/203 (98%), Gaps = 0/203 (0%)
 Frame = -1

Query  717  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldash  538
            VGVNADAY+ DE IISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH
Sbjct  203  VGVNADAYTHDEAIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH  262

Query  537  rdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKT  358
            RDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQV+KKT
Sbjct  263  RDLRRARAAALNIVPTSTGAAKAVALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVTKKT  322

Query  357  FAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAW  178
            FAEEVN AFRESAANEL+GILSVCDEPLVSVDFRC+DVSSTVDSSLTMVMGDD+VKVIAW
Sbjct  323  FAEEVNEAFRESAANELNGILSVCDEPLVSVDFRCTDVSSTVDSSLTMVMGDDLVKVIAW  382

Query  177  YDNEWGYSQRVVDLADIVANQWK  109
            YDNEWGYSQRVVDLADIVAN WK
Sbjct  383  YDNEWGYSQRVVDLADIVANNWK  405



>gb|ACU21011.1| unknown [Glycine max]
Length=403

 Score =   300 bits (769),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 194/203 (96%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -1

Query  717  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldash  538
            VGVN   YSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH
Sbjct  201  VGVNEYDYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH  260

Query  537  rdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKT  358
            RDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKT
Sbjct  261  RDLRRARAAALNIVPTSTGAAKAVALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKT  320

Query  357  FAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAW  178
            FAEEVNAAFRESA NEL GILSVCDEPLVSVDFRC+DVSSTVDSSLTMVMGDDMVKVIAW
Sbjct  321  FAEEVNAAFRESADNELKGILSVCDEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVIAW  380

Query  177  YDNEWGYSQRVVDLADIVANQWK  109
            YDNEWGYSQR VDLADIVAN+WK
Sbjct  381  YDNEWGYSQRAVDLADIVANKWK  403



>ref|XP_011070460.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Sesamum indicum]
Length=399

 Score =   300 bits (768),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 195/203 (96%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -1

Query  717  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldash  538
            VGVNAD YSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH
Sbjct  197  VGVNADDYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH  256

Query  537  rdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKT  358
            RDLRRARAAALNIVPTSTGAAKAVALVLP LKGKLNGIALRVPTPNVSVVDLVVQV KKT
Sbjct  257  RDLRRARAAALNIVPTSTGAAKAVALVLPQLKGKLNGIALRVPTPNVSVVDLVVQVEKKT  316

Query  357  FAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAW  178
            FAEEVNAAFRE+A  EL+GILSVCDEPLVSVDFRCSDVSSTVDSSLTMVMGDDMVKVIAW
Sbjct  317  FAEEVNAAFREAADKELNGILSVCDEPLVSVDFRCSDVSSTVDSSLTMVMGDDMVKVIAW  376

Query  177  YDNEWGYSQRVVDLADIVANQWK  109
            YDNEWGYSQRVVDLADIVAN WK
Sbjct  377  YDNEWGYSQRVVDLADIVANNWK  399



>ref|XP_006386825.1| hypothetical protein POPTR_0002s22600g [Populus trichocarpa]
 gb|ERP64622.1| hypothetical protein POPTR_0002s22600g [Populus trichocarpa]
Length=403

 Score =   300 bits (768),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 194/203 (96%), Positives = 196/203 (97%), Gaps = 0/203 (0%)
 Frame = -1

Query  717  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldash  538
            VGVNADAY PDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH
Sbjct  201  VGVNADAYKPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH  260

Query  537  rdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKT  358
            RDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKT
Sbjct  261  RDLRRARAAALNIVPTSTGAAKAVALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKT  320

Query  357  FAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAW  178
            FAEEVN  FRESA  EL GILSVCDEPLVSVDFRCSDVSSTVDSSLTMVMGDDMVKVIAW
Sbjct  321  FAEEVNEGFRESAEKELKGILSVCDEPLVSVDFRCSDVSSTVDSSLTMVMGDDMVKVIAW  380

Query  177  YDNEWGYSQRVVDLADIVANQWK  109
            YDNEWGYSQRVVDLA IVA+QWK
Sbjct  381  YDNEWGYSQRVVDLAHIVADQWK  403



>ref|XP_008362077.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Malus domestica]
Length=403

 Score =   300 bits (768),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 194/203 (96%), Positives = 198/203 (98%), Gaps = 0/203 (0%)
 Frame = -1

Query  717  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldash  538
            VGVNADAY+PDE IISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH
Sbjct  201  VGVNADAYNPDETIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH  260

Query  537  rdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKT  358
            RDLRRARAAALNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQV+KKT
Sbjct  261  RDLRRARAAALNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVTKKT  320

Query  357  FAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAW  178
            FAEEVNAAFR+SA  EL GILSVCDEPLVSVDFRC+DVSSTVDSSLTMVMGDDMVKVIAW
Sbjct  321  FAEEVNAAFRDSAEKELAGILSVCDEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVIAW  380

Query  177  YDNEWGYSQRVVDLADIVANQWK  109
            YDNEWGYSQRVVDLADIVAN WK
Sbjct  381  YDNEWGYSQRVVDLADIVANNWK  403



>gb|ABK96725.1| unknown [Populus trichocarpa x Populus deltoides]
Length=404

 Score =   300 bits (768),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 194/203 (96%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -1

Query  717  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldash  538
            VGVNADAY+PDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH
Sbjct  202  VGVNADAYNPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH  261

Query  537  rdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKT  358
            RDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKT
Sbjct  262  RDLRRARAAALNIVPTSTGAAKAVALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKT  321

Query  357  FAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAW  178
            FAEEVN  FRESA  EL GILSVCDEPLVSVDFRCSDVSSTVDSSLTMVMGDDMVKVIAW
Sbjct  322  FAEEVNLGFRESAEKELKGILSVCDEPLVSVDFRCSDVSSTVDSSLTMVMGDDMVKVIAW  381

Query  177  YDNEWGYSQRVVDLADIVANQWK  109
            YDNEWGYSQRVVDLA IVA+QWK
Sbjct  382  YDNEWGYSQRVVDLAHIVADQWK  404



>gb|AHZ94971.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Lilium regale]
Length=344

 Score =   298 bits (762),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 195/203 (96%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -1

Query  717  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldash  538
            VGVNAD YSPD+ IISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH
Sbjct  142  VGVNADQYSPDDTIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH  201

Query  537  rdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKT  358
            RDLRRARAAALNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVSKKT
Sbjct  202  RDLRRARAAALNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVSKKT  261

Query  357  FAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAW  178
            FAEEVNAAFRESA  EL GILSVCDEPLVSVDFRCSDVSSTVDSSLT+VMGDDMVKVIAW
Sbjct  262  FAEEVNAAFRESADGELKGILSVCDEPLVSVDFRCSDVSSTVDSSLTLVMGDDMVKVIAW  321

Query  177  YDNEWGYSQRVVDLADIVANQWK  109
            YDNEWGYSQRVVDLADIVAN WK
Sbjct  322  YDNEWGYSQRVVDLADIVANNWK  344



>ref|NP_001052984.1| Os04g0459500 [Oryza sativa Japonica Group]
 emb|CAD40906.1| OSJNBa0036B21.24 [Oryza sativa Japonica Group]
 emb|CAE01532.1| OSJNBa0072F16.1 [Oryza sativa Japonica Group]
 dbj|BAF14898.1| Os04g0459500 [Oryza sativa Japonica Group]
 emb|CAH67076.1| OSIGBa0097P08.6 [Oryza sativa Indica Group]
 emb|CAH67444.1| H0219H12.1 [Oryza sativa Indica Group]
 gb|EAY94393.1| hypothetical protein OsI_16160 [Oryza sativa Indica Group]
 gb|EAZ30968.1| hypothetical protein OsJ_15048 [Oryza sativa Japonica Group]
 dbj|BAG92628.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96321.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96327.1| unnamed protein product [Oryza sativa Japonica Group]
 emb|CBW45779.1| ORW1943Ba0077G13.7 [Oryza rufipogon]
Length=402

 Score =   300 bits (767),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 190/203 (94%), Positives = 196/203 (97%), Gaps = 0/203 (0%)
 Frame = -1

Query  717  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldash  538
            VGVNAD YSPDEPIISNASCTTNCLAPFVK+LDQKFGIIKGTMTTTHSYTGDQRLLDASH
Sbjct  200  VGVNADQYSPDEPIISNASCTTNCLAPFVKILDQKFGIIKGTMTTTHSYTGDQRLLDASH  259

Query  537  rdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKT  358
            RDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKT
Sbjct  260  RDLRRARAAALNIVPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKT  319

Query  357  FAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAW  178
             AEEVN AFR+SAANEL GIL VCD PLVSVDFRCSDVS T+D+SL+MVMGDDMVKVIAW
Sbjct  320  LAEEVNQAFRDSAANELKGILEVCDVPLVSVDFRCSDVSCTIDASLSMVMGDDMVKVIAW  379

Query  177  YDNEWGYSQRVVDLADIVANQWK  109
            YDNEWGYSQRVVDLADIVANQWK
Sbjct  380  YDNEWGYSQRVVDLADIVANQWK  402



>gb|ABG35250.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35251.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35252.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35253.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35256.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35257.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35258.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35259.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35260.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35261.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35262.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35263.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35264.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35265.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35266.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35268.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35269.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35270.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35271.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35272.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35273.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35274.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35275.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35276.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35277.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35278.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35279.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35280.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35281.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35282.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35283.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35284.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35285.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35286.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35287.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35288.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35289.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35290.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35291.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35292.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35293.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35294.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35295.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35296.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35297.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35298.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35299.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35300.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35301.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35302.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35303.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35304.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35305.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35306.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35307.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35308.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35309.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35310.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35311.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35312.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35313.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
Length=224

 Score =   293 bits (750),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 192/203 (95%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -1

Query  717  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldash  538
            VGVNA+ Y+  E IISNASCTTNCLAPFVKV+DQKFGIIKGTMTTTHSYTGDQRLLDASH
Sbjct  22   VGVNAELYNHSEAIISNASCTTNCLAPFVKVIDQKFGIIKGTMTTTHSYTGDQRLLDASH  81

Query  537  rdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKT  358
            RDLRRARAAALNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVSKKT
Sbjct  82   RDLRRARAAALNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVSKKT  141

Query  357  FAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAW  178
            FAEEVNAAFRE+A NEL+GILSVCDEPLVSVDFRCSDVSSTVDSSLTMVMGDDMVKVIAW
Sbjct  142  FAEEVNAAFREAADNELNGILSVCDEPLVSVDFRCSDVSSTVDSSLTMVMGDDMVKVIAW  201

Query  177  YDNEWGYSQRVVDLADIVANQWK  109
            YDNEWGYSQRVVDLADIVAN WK
Sbjct  202  YDNEWGYSQRVVDLADIVANNWK  224



>ref|XP_006359279.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
[Solanum tuberosum]
Length=399

 Score =   299 bits (766),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 192/203 (95%), Positives = 199/203 (98%), Gaps = 0/203 (0%)
 Frame = -1

Query  717  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldash  538
            VGVNA+ Y+ DEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH
Sbjct  197  VGVNAELYNHDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH  256

Query  537  rdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKT  358
            RDLRRARAAALNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQV+KKT
Sbjct  257  RDLRRARAAALNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVTKKT  316

Query  357  FAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAW  178
            FAEEVNAAFRE+A  EL+GIL+VCDEPLVSVDFRCSDVSST+DSSLTMVMGDDMVKVIAW
Sbjct  317  FAEEVNAAFREAADKELNGILAVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAW  376

Query  177  YDNEWGYSQRVVDLADIVANQWK  109
            YDNEWGYSQRVVDLADIVANQWK
Sbjct  377  YDNEWGYSQRVVDLADIVANQWK  399



>ref|XP_010528117.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
isoform X1 [Tarenaya hassleriana]
Length=402

 Score =   299 bits (766),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 194/203 (96%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -1

Query  717  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldash  538
            VGVNADAY P EPIISNASCTTNCLAPFVK+LDQKFGIIKGTMTTTHSYTGDQRLLDASH
Sbjct  200  VGVNADAYDPAEPIISNASCTTNCLAPFVKILDQKFGIIKGTMTTTHSYTGDQRLLDASH  259

Query  537  rdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKT  358
            RDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKT
Sbjct  260  RDLRRARAAALNIVPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKT  319

Query  357  FAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAW  178
            FAEEVNAAFRE+A NEL GIL VCDEPLVSVDFRCSDVSSTVDSSLTMVMGDDMVKVIAW
Sbjct  320  FAEEVNAAFREAADNELKGILEVCDEPLVSVDFRCSDVSSTVDSSLTMVMGDDMVKVIAW  379

Query  177  YDNEWGYSQRVVDLADIVANQWK  109
            YDNEWGYSQRVVDLADIVAN WK
Sbjct  380  YDNEWGYSQRVVDLADIVANNWK  402



>gb|ABG35254.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35255.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
Length=224

 Score =   293 bits (749),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 192/203 (95%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -1

Query  717  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldash  538
            VGVNA+ Y+  E IISNASCTTNCLAPFVKV+DQKFGIIKGTMTTTHSYTGDQRLLDASH
Sbjct  22   VGVNAELYNHSEAIISNASCTTNCLAPFVKVIDQKFGIIKGTMTTTHSYTGDQRLLDASH  81

Query  537  rdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKT  358
            RDLRRARAAALNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVSKKT
Sbjct  82   RDLRRARAAALNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVSKKT  141

Query  357  FAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAW  178
            FAEEVNAAFRE+A NEL+GILSVCDEPLVSVDFRCSDVSSTVDSSLTMVMGDDMVKVIAW
Sbjct  142  FAEEVNAAFREAADNELNGILSVCDEPLVSVDFRCSDVSSTVDSSLTMVMGDDMVKVIAW  201

Query  177  YDNEWGYSQRVVDLADIVANQWK  109
            YDNEWGYSQRVVDLADIVAN WK
Sbjct  202  YDNEWGYSQRVVDLADIVANNWK  224



>ref|XP_006844714.1| hypothetical protein AMTR_s00016p00251680 [Amborella trichopoda]
 gb|ERN06389.1| hypothetical protein AMTR_s00016p00251680 [Amborella trichopoda]
Length=398

 Score =   298 bits (764),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 194/202 (96%), Positives = 196/202 (97%), Gaps = 0/202 (0%)
 Frame = -1

Query  717  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldash  538
            VGVNADAY+P EPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH
Sbjct  196  VGVNADAYNPSEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH  255

Query  537  rdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKT  358
            RDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQV KKT
Sbjct  256  RDLRRARAAALNIVPTSTGAAKAVALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVEKKT  315

Query  357  FAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAW  178
            FAEEVNAAFRESA  EL GILSVCDEPLVSVDFRCSDVSSTVDSSLTMVMGDDMVKVIAW
Sbjct  316  FAEEVNAAFRESADKELQGILSVCDEPLVSVDFRCSDVSSTVDSSLTMVMGDDMVKVIAW  375

Query  177  YDNEWGYSQRVVDLADIVANQW  112
            YDNEWGYSQRVVDLA IVANQW
Sbjct  376  YDNEWGYSQRVVDLAHIVANQW  397



>ref|NP_001289256.1| glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic [Pyrus 
x bretschneideri]
 gb|AFG28404.1| glyceraldehyde-3-phosphate dehydrogenase A [Pyrus x bretschneideri]
Length=403

 Score =   299 bits (765),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 194/203 (96%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -1

Query  717  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldash  538
            VGVNADAYSPDE IISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH
Sbjct  201  VGVNADAYSPDETIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH  260

Query  537  rdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKT  358
            RDLRRARAAALNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQV+KKT
Sbjct  261  RDLRRARAAALNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVTKKT  320

Query  357  FAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAW  178
            FAEEVNAAFR+SA  EL GILSVCDE LVSVDFRC+DVSSTVDSSLTMVMGDDMVKVIAW
Sbjct  321  FAEEVNAAFRDSAEKELAGILSVCDESLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVIAW  380

Query  177  YDNEWGYSQRVVDLADIVANQWK  109
            YDNEWGYSQRVVDLADIVAN WK
Sbjct  381  YDNEWGYSQRVVDLADIVANNWK  403



>gb|ABK94956.1| unknown [Populus trichocarpa]
Length=403

 Score =   298 bits (764),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 193/203 (95%), Positives = 196/203 (97%), Gaps = 0/203 (0%)
 Frame = -1

Query  717  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldash  538
            VGVNADAY+PDEPIISNASCTTNCLAPFVKVLD KFGIIKGTMTTTHSYTGDQRLLDASH
Sbjct  201  VGVNADAYNPDEPIISNASCTTNCLAPFVKVLDHKFGIIKGTMTTTHSYTGDQRLLDASH  260

Query  537  rdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKT  358
            RDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKT
Sbjct  261  RDLRRARAAALNIVPTSTGAAKAVALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKT  320

Query  357  FAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAW  178
            FAEEVN  FRESA  EL GILSVCDEPLVSVDFRCSDVSSTVDSSLTMVMGDDMVKVIAW
Sbjct  321  FAEEVNEGFRESAEKELKGILSVCDEPLVSVDFRCSDVSSTVDSSLTMVMGDDMVKVIAW  380

Query  177  YDNEWGYSQRVVDLADIVANQWK  109
            YDNEWGYSQRVVDLA IVA+QWK
Sbjct  381  YDNEWGYSQRVVDLAHIVADQWK  403



>gb|AEO45783.1| glyceraldehyde-3-phosphate dehydrogenase A [Scoparia dulcis]
Length=398

 Score =   298 bits (762),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 194/203 (96%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -1

Query  717  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldash  538
            VGVNAD YS DEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH
Sbjct  196  VGVNADDYSADEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH  255

Query  537  rdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKT  358
            RDLRRARAAALNIVPTSTGAAKAVALVLP LKGKLNGIALRVPTPNVSVVDLVVQV KKT
Sbjct  256  RDLRRARAAALNIVPTSTGAAKAVALVLPQLKGKLNGIALRVPTPNVSVVDLVVQVEKKT  315

Query  357  FAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAW  178
            FAEEVNAAFRE+A  EL+GILSVCDEPLVSVDFRCSDVSSTVDSSLTMVMGDDMVKVIAW
Sbjct  316  FAEEVNAAFRETADKELNGILSVCDEPLVSVDFRCSDVSSTVDSSLTMVMGDDMVKVIAW  375

Query  177  YDNEWGYSQRVVDLADIVANQWK  109
            YDNEWGYSQRVVDLADIVAN+WK
Sbjct  376  YDNEWGYSQRVVDLADIVANKWK  398



>gb|ABG35267.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
Length=224

 Score =   291 bits (746),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 191/203 (94%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -1

Query  717  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldash  538
            VGVNA+ Y+  E IISNASCTTNCLAPFVKV+DQKFGIIKGTMTTTHSYTGDQRLLDASH
Sbjct  22   VGVNAELYNHSEAIISNASCTTNCLAPFVKVIDQKFGIIKGTMTTTHSYTGDQRLLDASH  81

Query  537  rdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKT  358
            RDLRRARAAALNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVSKKT
Sbjct  82   RDLRRARAAALNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVSKKT  141

Query  357  FAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAW  178
            FAEEVNAAFRE+A NEL+GILSVCDEPLVSVDFRCSDVSSTVDSSLTMVMGDDMVKVIAW
Sbjct  142  FAEEVNAAFREAADNELNGILSVCDEPLVSVDFRCSDVSSTVDSSLTMVMGDDMVKVIAW  201

Query  177  YDNEWGYSQRVVDLADIVANQWK  109
            YD+EWGYSQRVVDLADIVAN WK
Sbjct  202  YDHEWGYSQRVVDLADIVANNWK  224



>ref|XP_007161788.1| hypothetical protein PHAVU_001G098100g [Phaseolus vulgaris]
 gb|ESW33782.1| hypothetical protein PHAVU_001G098100g [Phaseolus vulgaris]
Length=403

 Score =   297 bits (761),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 193/203 (95%), Positives = 196/203 (97%), Gaps = 0/203 (0%)
 Frame = -1

Query  717  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldash  538
            VGVN   YS DEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH
Sbjct  201  VGVNEYDYSGDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH  260

Query  537  rdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKT  358
            RDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKT
Sbjct  261  RDLRRARAAALNIVPTSTGAAKAVALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKT  320

Query  357  FAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAW  178
            FAEEVNAAFRESA  EL GILSVCDEPLVSVDFRC+DVSSTVDSSLTMVMGDDMVKVIAW
Sbjct  321  FAEEVNAAFRESAEKELKGILSVCDEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVIAW  380

Query  177  YDNEWGYSQRVVDLADIVANQWK  109
            YDNEWGYSQRVVDLADIVAN+WK
Sbjct  381  YDNEWGYSQRVVDLADIVANKWK  403



>dbj|BAJ34149.1| unnamed protein product [Thellungiella halophila]
Length=400

 Score =   296 bits (759),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 192/203 (95%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -1

Query  717  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldash  538
            VGVNADAY+PDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTT SYTGDQRLLDASH
Sbjct  198  VGVNADAYNPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTPSYTGDQRLLDASH  257

Query  537  rdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKT  358
            RDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKT
Sbjct  258  RDLRRARAAALNIVPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKT  317

Query  357  FAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAW  178
            FAEEVNAAFR++A  EL GIL VCDEPLVSVDFRCSDVSST+DSSLTMVMGDDMVKVIAW
Sbjct  318  FAEEVNAAFRDAAEKELKGILEVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAW  377

Query  177  YDNEWGYSQRVVDLADIVANQWK  109
            YDNEWGYSQRVVDLADIVAN WK
Sbjct  378  YDNEWGYSQRVVDLADIVANNWK  400



>ref|XP_009118049.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
isoform X2 [Brassica rapa]
Length=317

 Score =   293 bits (751),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 188/202 (93%), Positives = 196/202 (97%), Gaps = 0/202 (0%)
 Frame = -1

Query  714  GVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashr  535
            GVNA+ YS ++ IISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHR
Sbjct  116  GVNAELYSHEDTIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHR  175

Query  534  dlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTF  355
            DLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKTF
Sbjct  176  DLRRARAAALNIVPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF  235

Query  354  AEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWY  175
            AEEVNAAFR++AANEL GIL VCDEPLVSVDFRCSDVSST+DSSLTMVMGDDMVKVIAWY
Sbjct  236  AEEVNAAFRDAAANELKGILDVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWY  295

Query  174  DNEWGYSQRVVDLADIVANQWK  109
            DNEWGYSQRVVDL+DIVAN WK
Sbjct  296  DNEWGYSQRVVDLSDIVANNWK  317



>gb|KDO63477.1| hypothetical protein CISIN_1g013492mg [Citrus sinensis]
Length=416

 Score =   297 bits (760),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 197/216 (91%), Positives = 199/216 (92%), Gaps = 13/216 (6%)
 Frame = -1

Query  717  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKF-------------GIIKGTMTTTH  577
            VGVNADAY PDEPIISNASCTTNCLAPFVKVLDQKF             GIIKGTMTTTH
Sbjct  201  VGVNADAYKPDEPIISNASCTTNCLAPFVKVLDQKFVTQLNDRIFPMCAGIIKGTMTTTH  260

Query  576  SYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNv  397
            SYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIALRVPTPNV
Sbjct  261  SYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPALKGKLNGIALRVPTPNV  320

Query  396  svvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdsslt  217
            SVVDLVVQVSKKTFAEEVNAAFRESA NEL GILSVCDEPLVSVDFRCSDVSSTVDSSLT
Sbjct  321  SVVDLVVQVSKKTFAEEVNAAFRESADNELKGILSVCDEPLVSVDFRCSDVSSTVDSSLT  380

Query  216  mvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  109
            +VMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN WK
Sbjct  381  LVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNWK  416



>ref|XP_010028899.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Eucalyptus grandis]
 gb|KCW55732.1| hypothetical protein EUGRSUZ_I01564 [Eucalyptus grandis]
Length=402

 Score =   296 bits (759),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 192/203 (95%), Positives = 196/203 (97%), Gaps = 0/203 (0%)
 Frame = -1

Query  717  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldash  538
            VGVNAD Y+P EPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH
Sbjct  200  VGVNADLYNPAEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH  259

Query  537  rdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKT  358
            RDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKT
Sbjct  260  RDLRRARAAALNIVPTSTGAAKAVALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKT  319

Query  357  FAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAW  178
            FAEEVNA FRESA NEL GILSVCDEPLVSVDFRCSDVSSTVD+SLTMVMGDDMVKVIAW
Sbjct  320  FAEEVNAGFRESADNELKGILSVCDEPLVSVDFRCSDVSSTVDASLTMVMGDDMVKVIAW  379

Query  177  YDNEWGYSQRVVDLADIVANQWK  109
            YDNEWGYSQRVVDLA IVA+ WK
Sbjct  380  YDNEWGYSQRVVDLAHIVADNWK  402



>ref|XP_010942312.1| PREDICTED: LOW QUALITY PROTEIN: glyceraldehyde-3-phosphate dehydrogenase 
A, chloroplastic-like [Elaeis guineensis]
Length=445

 Score =   298 bits (762),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 192/203 (95%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -1

Query  717  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldash  538
            VGVN + Y+PDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH
Sbjct  243  VGVNVETYNPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH  302

Query  537  rdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKT  358
            RDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKT
Sbjct  303  RDLRRARAAALNIVPTSTGAAKAVALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKT  362

Query  357  FAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAW  178
            FAEEVNAAFR++A  EL GILSVCDEPLVSVDFRCSDVSSTVDSSLTMVMGDDMVKVIAW
Sbjct  363  FAEEVNAAFRDTAEKELKGILSVCDEPLVSVDFRCSDVSSTVDSSLTMVMGDDMVKVIAW  422

Query  177  YDNEWGYSQRVVDLADIVANQWK  109
            YDNEWGYSQRVVDLADIVAN WK
Sbjct  423  YDNEWGYSQRVVDLADIVANNWK  445



>gb|AGJ50596.1| GAPDH [Pericallis cruenta]
Length=399

 Score =   296 bits (758),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 193/203 (95%), Positives = 198/203 (98%), Gaps = 0/203 (0%)
 Frame = -1

Query  717  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldash  538
            VGVNAD Y+  E IISNASCTTNCLAPFVKV+DQKFGIIKGTMTTTHSYTGDQRLLDASH
Sbjct  196  VGVNADLYNHSENIISNASCTTNCLAPFVKVIDQKFGIIKGTMTTTHSYTGDQRLLDASH  255

Query  537  rdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKT  358
            RDLRRARAAALNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVSKKT
Sbjct  256  RDLRRARAAALNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVSKKT  315

Query  357  FAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAW  178
            FAEEVNAAFRE+AANEL+GILSVCDEPLVSVDFRCSDVSSTVDSSLTMVMGDDM+KVIAW
Sbjct  316  FAEEVNAAFREAAANELNGILSVCDEPLVSVDFRCSDVSSTVDSSLTMVMGDDMLKVIAW  375

Query  177  YDNEWGYSQRVVDLADIVANQWK  109
            YDNEWGYSQRVVDLADIVAN WK
Sbjct  376  YDNEWGYSQRVVDLADIVANNWK  398



>emb|CDY48981.1| BnaA02g28150D [Brassica napus]
Length=368

 Score =   295 bits (755),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 190/203 (94%), Positives = 196/203 (97%), Gaps = 0/203 (0%)
 Frame = -1

Query  717  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldash  538
            VGVNADAY+PD+PIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH
Sbjct  166  VGVNADAYNPDKPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH  225

Query  537  rdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKT  358
            RDLRRARAAALNIVPTSTGAAKAVALVLP+LKGK NGIALRVPTPNVSVVDLVVQV+KKT
Sbjct  226  RDLRRARAAALNIVPTSTGAAKAVALVLPNLKGKHNGIALRVPTPNVSVVDLVVQVTKKT  285

Query  357  FAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAW  178
            FAEEVNAAFR SA  EL GIL VCDEPLVSVDF+CSDVSST+DSSLTMVMGDDMVKVIAW
Sbjct  286  FAEEVNAAFRNSAEKELKGILKVCDEPLVSVDFKCSDVSSTIDSSLTMVMGDDMVKVIAW  345

Query  177  YDNEWGYSQRVVDLADIVANQWK  109
            YDNEWGYSQRVVDLADIVAN WK
Sbjct  346  YDNEWGYSQRVVDLADIVANNWK  368



>ref|XP_004975847.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
[Setaria italica]
Length=401

 Score =   295 bits (756),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 191/202 (95%), Positives = 195/202 (97%), Gaps = 0/202 (0%)
 Frame = -1

Query  714  GVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashr  535
            GVNAD Y+PDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHR
Sbjct  200  GVNADQYNPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHR  259

Query  534  dlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTF  355
            DLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKT 
Sbjct  260  DLRRARAAALNIVPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTL  319

Query  354  AEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWY  175
            AEEVN AFR+SAANEL GIL VCD PLVSVDFRCSDVSSTVD+SLTMVMGDDMVKVIAWY
Sbjct  320  AEEVNQAFRDSAANELAGILEVCDAPLVSVDFRCSDVSSTVDASLTMVMGDDMVKVIAWY  379

Query  174  DNEWGYSQRVVDLADIVANQWK  109
            DNEWGYSQRVVDLADIVAN WK
Sbjct  380  DNEWGYSQRVVDLADIVANNWK  401



>ref|XP_009148557.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
isoform X2 [Brassica rapa]
Length=317

 Score =   292 bits (748),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 188/203 (93%), Positives = 195/203 (96%), Gaps = 0/203 (0%)
 Frame = -1

Query  717  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldash  538
            VGVNA+ YS ++ IISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH
Sbjct  115  VGVNAELYSHEDTIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH  174

Query  537  rdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKT  358
            RDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKT
Sbjct  175  RDLRRARAAALNIVPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKT  234

Query  357  FAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAW  178
            FAEEVNAAFR++A  EL GIL VCDEPLVSVDFRCSDVSST+DSSLTMVMGDDMVKVIAW
Sbjct  235  FAEEVNAAFRDAAEKELKGILDVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAW  294

Query  177  YDNEWGYSQRVVDLADIVANQWK  109
            YDNEWGYSQRVVDLADIVAN WK
Sbjct  295  YDNEWGYSQRVVDLADIVANNWK  317



>ref|NP_001077529.1| glyceraldehyde 3-phosphate dehydrogenase GAPA2 [Arabidopsis thaliana]
 gb|AEE28945.1| glyceraldehyde-3-phosphate dehydrogenase (NADP+) (phosphorylating) 
[Arabidopsis thaliana]
Length=317

 Score =   292 bits (748),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 188/203 (93%), Positives = 195/203 (96%), Gaps = 0/203 (0%)
 Frame = -1

Query  717  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldash  538
            VGVNA+ YS ++ IISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH
Sbjct  115  VGVNAELYSHEDTIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH  174

Query  537  rdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKT  358
            RDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKT
Sbjct  175  RDLRRARAAALNIVPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKT  234

Query  357  FAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAW  178
            FAEEVNAAFR++A  EL GIL VCDEPLVSVDFRCSDVSST+DSSLTMVMGDDMVKVIAW
Sbjct  235  FAEEVNAAFRDAAEKELKGILDVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAW  294

Query  177  YDNEWGYSQRVVDLADIVANQWK  109
            YDNEWGYSQRVVDLADIVAN WK
Sbjct  295  YDNEWGYSQRVVDLADIVANNWK  317



>ref|XP_010476270.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
isoform X2 [Camelina sativa]
Length=317

 Score =   292 bits (748),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 188/203 (93%), Positives = 195/203 (96%), Gaps = 0/203 (0%)
 Frame = -1

Query  717  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldash  538
            VGVNA+ YS ++ IISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH
Sbjct  115  VGVNAELYSHEDTIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH  174

Query  537  rdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKT  358
            RDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKT
Sbjct  175  RDLRRARAAALNIVPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKT  234

Query  357  FAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAW  178
            FAEEVNAAFR++A  EL GIL VCDEPLVSVDFRCSDVSST+DSSLTMVMGDDMVKVIAW
Sbjct  235  FAEEVNAAFRDAAEKELKGILDVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAW  294

Query  177  YDNEWGYSQRVVDLADIVANQWK  109
            YDNEWGYSQRVVDLADIVAN WK
Sbjct  295  YDNEWGYSQRVVDLADIVANNWK  317



>sp|P09672.1|G3PA_SINAL RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic; 
AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase subunit A, partial [Sinapis alba]
 emb|CAA27845.1| chloroplast GAPDH (233aa) [Sinapis alba]
Length=233

 Score =   289 bits (739),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 188/203 (93%), Positives = 195/203 (96%), Gaps = 0/203 (0%)
 Frame = -1

Query  717  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldash  538
            VGVNA+ YS ++ IISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH
Sbjct  31   VGVNAELYSHEDTIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH  90

Query  537  rdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKT  358
            RDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKT
Sbjct  91   RDLRRARAAALNIVPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKT  150

Query  357  FAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAW  178
            FAEEVNAAFR++A  EL GIL VCDEPLVSVDFRCSDVSST+DSSLTMVMGDDMVKVIAW
Sbjct  151  FAEEVNAAFRDAAEKELKGILDVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAW  210

Query  177  YDNEWGYSQRVVDLADIVANQWK  109
            YDNEWGYSQRVVDLADIVAN WK
Sbjct  211  YDNEWGYSQRVVDLADIVANNWK  233



>ref|XP_010494750.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
isoform X2 [Camelina sativa]
Length=317

 Score =   291 bits (746),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 188/203 (93%), Positives = 195/203 (96%), Gaps = 0/203 (0%)
 Frame = -1

Query  717  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldash  538
            VGVNA+ YS ++ IISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH
Sbjct  115  VGVNAELYSHEDTIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH  174

Query  537  rdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKT  358
            RDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKT
Sbjct  175  RDLRRARAAALNIVPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKT  234

Query  357  FAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAW  178
            FAEEVNAAFR++A  EL GIL VCDEPLVSVDFRCSDVSST+DSSLTMVMGDDMVKVIAW
Sbjct  235  FAEEVNAAFRDAAEKELKGILDVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAW  294

Query  177  YDNEWGYSQRVVDLADIVANQWK  109
            YDNEWGYSQRVVDLADIVAN WK
Sbjct  295  YDNEWGYSQRVVDLADIVANNWK  317



>ref|XP_004304578.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Fragaria vesca subsp. vesca]
Length=404

 Score =   295 bits (754),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 192/203 (95%), Positives = 196/203 (97%), Gaps = 0/203 (0%)
 Frame = -1

Query  717  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldash  538
            VGVNA+ YS D+ IISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH
Sbjct  202  VGVNAELYSHDDTIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH  261

Query  537  rdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKT  358
            RDLRRARAAALNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQV+KKT
Sbjct  262  RDLRRARAAALNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVTKKT  321

Query  357  FAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAW  178
            FAEEVNAAFRESA  EL GILSVCDEPLVSVDFRC+DVSSTVDSSLTMVMGDDMVKVIAW
Sbjct  322  FAEEVNAAFRESADKELAGILSVCDEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVIAW  381

Query  177  YDNEWGYSQRVVDLADIVANQWK  109
            YDNEWGYSQRVVDLADIVAN WK
Sbjct  382  YDNEWGYSQRVVDLADIVANNWK  404



>tpg|DAA37469.1| TPA: glyceraldehyde-3-phosphate dehydrogenase1 [Zea mays]
Length=403

 Score =   294 bits (753),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 188/203 (93%), Positives = 196/203 (97%), Gaps = 0/203 (0%)
 Frame = -1

Query  717  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldash  538
            VGVNAD Y+PDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH
Sbjct  201  VGVNADQYNPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH  260

Query  537  rdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKT  358
            RDLRRARAAALNIVPTSTGAAKAV+LVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKT
Sbjct  261  RDLRRARAAALNIVPTSTGAAKAVSLVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKT  320

Query  357  FAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAW  178
             AEEVN AFR++AANEL GIL VCD PLVSVDFRCSDVSST+D+SLTMVMGDDMVKVI+W
Sbjct  321  LAEEVNQAFRDAAANELTGILEVCDVPLVSVDFRCSDVSSTIDASLTMVMGDDMVKVISW  380

Query  177  YDNEWGYSQRVVDLADIVANQWK  109
            YDNEWGYSQRVVDLADI ANQWK
Sbjct  381  YDNEWGYSQRVVDLADICANQWK  403



>gb|ACT21568.1| glyceraldehyde-3-phosphate dehydrogenase [Bruguiera gymnorhiza]
Length=405

 Score =   295 bits (754),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 190/203 (94%), Positives = 195/203 (96%), Gaps = 0/203 (0%)
 Frame = -1

Query  717  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldash  538
            VGVNADAY+PDEPIISNASCTTNCLAPFVKVLDQK GIIKGTMTTTHSYTGDQRLLDASH
Sbjct  203  VGVNADAYNPDEPIISNASCTTNCLAPFVKVLDQKSGIIKGTMTTTHSYTGDQRLLDASH  262

Query  537  rdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKT  358
            RDLRRARAAALNIVPTSTGAAK VALVLP+L+GKLNGIALRVPTPNVSVVDLVVQVSKKT
Sbjct  263  RDLRRARAAALNIVPTSTGAAKPVALVLPTLRGKLNGIALRVPTPNVSVVDLVVQVSKKT  322

Query  357  FAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAW  178
            FAEEVNAAFRESA  EL GILSVCDEPLVSVDFRC DVSSTVDSSLTMVMGDDMVKVIAW
Sbjct  323  FAEEVNAAFRESADKELKGILSVCDEPLVSVDFRCRDVSSTVDSSLTMVMGDDMVKVIAW  382

Query  177  YDNEWGYSQRVVDLADIVANQWK  109
            YDNEWGY QRVVDLAD+VA +WK
Sbjct  383  YDNEWGYFQRVVDLADVVAEKWK  405



>ref|XP_010660642.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
isoform X2 [Vitis vinifera]
Length=403

 Score =   294 bits (753),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 192/203 (95%), Positives = 196/203 (97%), Gaps = 0/203 (0%)
 Frame = -1

Query  717  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldash  538
            VGVNAD Y+ DE IISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH
Sbjct  201  VGVNADEYNHDESIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH  260

Query  537  rdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKT  358
            RDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKT
Sbjct  261  RDLRRARAAALNIVPTSTGAAKAVALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKT  320

Query  357  FAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAW  178
            FAEEVNA FR+SA  EL GILSVCDEPLVSVDFRCSDVSSTVDSSLTMVMGDDMVKVIAW
Sbjct  321  FAEEVNAGFRDSAEKELQGILSVCDEPLVSVDFRCSDVSSTVDSSLTMVMGDDMVKVIAW  380

Query  177  YDNEWGYSQRVVDLADIVANQWK  109
            YDNEWGYSQRVVDLADIVAN+WK
Sbjct  381  YDNEWGYSQRVVDLADIVANKWK  403



>ref|XP_002278352.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
isoform X1 [Vitis vinifera]
Length=404

 Score =   294 bits (753),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 192/203 (95%), Positives = 196/203 (97%), Gaps = 0/203 (0%)
 Frame = -1

Query  717  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldash  538
            VGVNAD Y+ DE IISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH
Sbjct  202  VGVNADEYNHDESIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH  261

Query  537  rdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKT  358
            RDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKT
Sbjct  262  RDLRRARAAALNIVPTSTGAAKAVALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKT  321

Query  357  FAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAW  178
            FAEEVNA FR+SA  EL GILSVCDEPLVSVDFRCSDVSSTVDSSLTMVMGDDMVKVIAW
Sbjct  322  FAEEVNAGFRDSAEKELQGILSVCDEPLVSVDFRCSDVSSTVDSSLTMVMGDDMVKVIAW  381

Query  177  YDNEWGYSQRVVDLADIVANQWK  109
            YDNEWGYSQRVVDLADIVAN+WK
Sbjct  382  YDNEWGYSQRVVDLADIVANKWK  404



>ref|XP_010929533.1| PREDICTED: LOW QUALITY PROTEIN: glyceraldehyde-3-phosphate dehydrogenase 
A, chloroplastic [Elaeis guineensis]
Length=261

 Score =   289 bits (740),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 189/203 (93%), Positives = 195/203 (96%), Gaps = 0/203 (0%)
 Frame = -1

Query  717  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldash  538
            VGVNA+ Y+PDEPIISNASCTTNCL+PFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH
Sbjct  59   VGVNAETYNPDEPIISNASCTTNCLSPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH  118

Query  537  rdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKT  358
            RDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLN IALRVPTPNVSVVDLVVQVSKK 
Sbjct  119  RDLRRARAAALNIVPTSTGAAKAVALVLPTLKGKLNEIALRVPTPNVSVVDLVVQVSKKI  178

Query  357  FAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAW  178
             AEE+NAAFR+SA  EL GILSVCDEPLVSVDFRCSDVSSTVDSSLTMVMGDDMVKVIAW
Sbjct  179  LAEEINAAFRDSAEKELRGILSVCDEPLVSVDFRCSDVSSTVDSSLTMVMGDDMVKVIAW  238

Query  177  YDNEWGYSQRVVDLADIVANQWK  109
            YDNEWGYSQRVVDLADIVAN WK
Sbjct  239  YDNEWGYSQRVVDLADIVANNWK  261



>ref|XP_003624553.1| Glyceraldehyde-3-phosphate dehydrogenase A [Medicago truncatula]
 gb|AES80771.1| glyceraldehyde-3-phosphate dehydrogenase [Medicago truncatula]
Length=404

 Score =   294 bits (753),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 192/203 (95%), Positives = 195/203 (96%), Gaps = 0/203 (0%)
 Frame = -1

Query  717  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldash  538
            VGVNAD YS  + IISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH
Sbjct  202  VGVNADGYSHADDIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH  261

Query  537  rdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKT  358
            RDLRRARAAALNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVSKKT
Sbjct  262  RDLRRARAAALNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVSKKT  321

Query  357  FAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAW  178
            FAEEVN AFR+SAA EL GILSVCDEPLVSVDFRC+DVSSTVDSSLTMVMGDDMVKVIAW
Sbjct  322  FAEEVNEAFRDSAAKELSGILSVCDEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVIAW  381

Query  177  YDNEWGYSQRVVDLADIVANQWK  109
            YDNEWGYSQRVVDLADIVAN WK
Sbjct  382  YDNEWGYSQRVVDLADIVANNWK  404



>emb|CAN78872.1| hypothetical protein VITISV_021726 [Vitis vinifera]
Length=404

 Score =   294 bits (752),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 192/203 (95%), Positives = 196/203 (97%), Gaps = 0/203 (0%)
 Frame = -1

Query  717  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldash  538
            VGVNAD Y+ DE IISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH
Sbjct  202  VGVNADEYNHDEXIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH  261

Query  537  rdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKT  358
            RDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKT
Sbjct  262  RDLRRARAAALNIVPTSTGAAKAVALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKT  321

Query  357  FAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAW  178
            FAEEVNA FR+SA  EL GILSVCDEPLVSVDFRCSDVSSTVDSSLTMVMGDDMVKVIAW
Sbjct  322  FAEEVNAGFRDSAEKELQGILSVCDEPLVSVDFRCSDVSSTVDSSLTMVMGDDMVKVIAW  381

Query  177  YDNEWGYSQRVVDLADIVANQWK  109
            YDNEWGYSQRVVDLADIVAN+WK
Sbjct  382  YDNEWGYSQRVVDLADIVANKWK  404



>emb|CAA30152.1| GADPH (383 AA) [Zea mays]
Length=383

 Score =   293 bits (750),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 188/203 (93%), Positives = 196/203 (97%), Gaps = 0/203 (0%)
 Frame = -1

Query  717  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldash  538
            VGVNAD Y+PDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH
Sbjct  181  VGVNADQYNPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH  240

Query  537  rdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKT  358
            RDLRRARAAALNIVPTSTGAAKAV+LVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKT
Sbjct  241  RDLRRARAAALNIVPTSTGAAKAVSLVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKT  300

Query  357  FAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAW  178
             AEEVN AFR++AANEL GIL VCD PLVSVDFRCSDVSST+D+SLTMVMGDDMVKVI+W
Sbjct  301  LAEEVNQAFRDAAANELTGILEVCDVPLVSVDFRCSDVSSTIDASLTMVMGDDMVKVISW  360

Query  177  YDNEWGYSQRVVDLADIVANQWK  109
            YDNEWGYSQRVVDLADI ANQWK
Sbjct  361  YDNEWGYSQRVVDLADICANQWK  383



>emb|CAA33264.1| unnamed protein product [Pisum sativum]
Length=405

 Score =   294 bits (752),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 191/203 (94%), Positives = 196/203 (97%), Gaps = 0/203 (0%)
 Frame = -1

Query  717  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldash  538
            VGVNADAY+  + IISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH
Sbjct  203  VGVNADAYTHADDIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH  262

Query  537  rdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKT  358
            RDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKT
Sbjct  263  RDLRRARAAALNIVPTSTGAAKAVALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKT  322

Query  357  FAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAW  178
            FAEEVN AFRESAA EL GILSVCDEPLVSVDFRC+DVSSTVDSSLTMVMGDD+VKVIAW
Sbjct  323  FAEEVNEAFRESAAKELTGILSVCDEPLVSVDFRCTDVSSTVDSSLTMVMGDDLVKVIAW  382

Query  177  YDNEWGYSQRVVDLADIVANQWK  109
            YDNEWGYSQRVVDLADIVAN WK
Sbjct  383  YDNEWGYSQRVVDLADIVANNWK  405



>ref|NP_001105414.1| glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic precursor 
[Zea mays]
 sp|P09315.1|G3PA_MAIZE RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic; 
AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase subunit A; Flags: Precursor [Zea mays]
 gb|AAA33464.1| glyceraldehyde-3-phosphate dehydrogenase [Zea mays]
 emb|CAA33455.1| glyceraldehyde-3-phosphate dehydrogenase [Zea mays]
Length=403

 Score =   294 bits (752),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 188/203 (93%), Positives = 196/203 (97%), Gaps = 0/203 (0%)
 Frame = -1

Query  717  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldash  538
            VGVNAD Y+PDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH
Sbjct  201  VGVNADQYNPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH  260

Query  537  rdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKT  358
            RDLRRARAAALNIVPTSTGAAKAV+LVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKT
Sbjct  261  RDLRRARAAALNIVPTSTGAAKAVSLVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKT  320

Query  357  FAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAW  178
             AEEVN AFR++AANEL GIL VCD PLVSVDFRCSDVSST+D+SLTMVMGDDMVKVI+W
Sbjct  321  LAEEVNQAFRDAAANELTGILEVCDVPLVSVDFRCSDVSSTIDASLTMVMGDDMVKVISW  380

Query  177  YDNEWGYSQRVVDLADIVANQWK  109
            YDNEWGYSQRVVDLADI ANQWK
Sbjct  381  YDNEWGYSQRVVDLADICANQWK  403



>sp|P12858.2|G3PA_PEA RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic; 
AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase subunit A; Flags: Precursor [Pisum sativum]
 emb|CAA36396.1| glyceraldehyde-3-phosphate dehydrogenase [Pisum sativum]
Length=405

 Score =   293 bits (751),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 191/203 (94%), Positives = 196/203 (97%), Gaps = 0/203 (0%)
 Frame = -1

Query  717  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldash  538
            VGVNADAY+  + IISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH
Sbjct  203  VGVNADAYTHADDIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH  262

Query  537  rdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKT  358
            RDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKT
Sbjct  263  RDLRRARAAALNIVPTSTGAAKAVALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKT  322

Query  357  FAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAW  178
            FAEEVN AFRESAA EL GILSVCDEPLVSVDFRC+DVSSTVDSSLTMVMGDD+VKVIAW
Sbjct  323  FAEEVNEAFRESAAKELTGILSVCDEPLVSVDFRCTDVSSTVDSSLTMVMGDDLVKVIAW  382

Query  177  YDNEWGYSQRVVDLADIVANQWK  109
            YDNEWGYSQRVVDLADIVAN WK
Sbjct  383  YDNEWGYSQRVVDLADIVANNWK  405



>gb|EPS59235.1| hypothetical protein M569_15573, partial [Genlisea aurea]
Length=395

 Score =   293 bits (750),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 191/203 (94%), Positives = 194/203 (96%), Gaps = 0/203 (0%)
 Frame = -1

Query  717  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldash  538
            VGVNAD Y PDE IISNASCTTNCLAPFVKVLD+KF IIKGTMTTTHSYTGDQRLLDASH
Sbjct  193  VGVNADDYKPDETIISNASCTTNCLAPFVKVLDEKFSIIKGTMTTTHSYTGDQRLLDASH  252

Query  537  rdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKT  358
            RDLRRARAAALNIVPTSTGAAKAVALVLP LKGKLNGIALRVPTPNVSVVDLVVQV KKT
Sbjct  253  RDLRRARAAALNIVPTSTGAAKAVALVLPQLKGKLNGIALRVPTPNVSVVDLVVQVEKKT  312

Query  357  FAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAW  178
            FAEEVNAAFRESA  EL GILSVCDEPLVSVDFRC+DVSSTVDSSLTMVMGDDMVKVIAW
Sbjct  313  FAEEVNAAFRESADKELKGILSVCDEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVIAW  372

Query  177  YDNEWGYSQRVVDLADIVANQWK  109
            YDNEWGYSQRVVDLADIVAN+WK
Sbjct  373  YDNEWGYSQRVVDLADIVANKWK  395



>ref|XP_003579898.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Brachypodium distachyon]
Length=403

 Score =   293 bits (750),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 188/203 (93%), Positives = 196/203 (97%), Gaps = 0/203 (0%)
 Frame = -1

Query  717  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldash  538
            VGVNA+ YS  + IISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH
Sbjct  201  VGVNAELYSHSDTIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH  260

Query  537  rdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKT  358
            RDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKT
Sbjct  261  RDLRRARAAALNIVPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKT  320

Query  357  FAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAW  178
             AEEVNAAFR++AANEL GIL VCDEPLVSVDFRCSDVSST+D+SL+MVMGDDMVKVIAW
Sbjct  321  LAEEVNAAFRDAAANELKGILDVCDEPLVSVDFRCSDVSSTIDASLSMVMGDDMVKVIAW  380

Query  177  YDNEWGYSQRVVDLADIVANQWK  109
            YDNEWGYSQRVVDLADIVANQWK
Sbjct  381  YDNEWGYSQRVVDLADIVANQWK  403



>dbj|BAK02737.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=306

 Score =   290 bits (741),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 186/202 (92%), Positives = 194/202 (96%), Gaps = 0/202 (0%)
 Frame = -1

Query  714  GVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashr  535
            GVNAD Y+  + IISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHR
Sbjct  105  GVNADLYTHADTIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHR  164

Query  534  dlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTF  355
            DLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKT 
Sbjct  165  DLRRARAAALNIVPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTL  224

Query  354  AEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWY  175
            AEEVN AFR++AANEL GIL VCDEPLVSVDFRCSDVSST+D+SL+MVMGDDMVKVIAWY
Sbjct  225  AEEVNQAFRDAAANELKGILDVCDEPLVSVDFRCSDVSSTIDASLSMVMGDDMVKVIAWY  284

Query  174  DNEWGYSQRVVDLADIVANQWK  109
            DNEWGYSQRVVDLADIVANQWK
Sbjct  285  DNEWGYSQRVVDLADIVANQWK  306



>gb|ACV32597.1| putative glyceraldehyde-3-phosphate dehydrogenase [Medicago sativa]
Length=404

 Score =   293 bits (750),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 191/203 (94%), Positives = 195/203 (96%), Gaps = 0/203 (0%)
 Frame = -1

Query  717  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldash  538
            VGVNAD Y+  + IISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH
Sbjct  202  VGVNADGYNHADDIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH  261

Query  537  rdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKT  358
            RDLRRARAAALNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVSKKT
Sbjct  262  RDLRRARAAALNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVSKKT  321

Query  357  FAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAW  178
            FAEEVN AFR+SAA EL GILSVCDEPLVSVDFRC+DVSSTVDSSLTMVMGDDMVKVIAW
Sbjct  322  FAEEVNEAFRDSAAKELSGILSVCDEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVIAW  381

Query  177  YDNEWGYSQRVVDLADIVANQWK  109
            YDNEWGYSQRVVDLADIVAN WK
Sbjct  382  YDNEWGYSQRVVDLADIVANNWK  404



>ref|XP_002970103.1| hypothetical protein SELMODRAFT_270825 [Selaginella moellendorffii]
 gb|EFJ29227.1| hypothetical protein SELMODRAFT_270825 [Selaginella moellendorffii]
Length=402

 Score =   292 bits (748),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 188/203 (93%), Positives = 195/203 (96%), Gaps = 0/203 (0%)
 Frame = -1

Query  717  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldash  538
            VGVNA+ YSP EPIISNASCTTNCLAPFVKVLD+KFGIIKGTMTTTHSYTGDQRLLDASH
Sbjct  200  VGVNAEQYSPTEPIISNASCTTNCLAPFVKVLDEKFGIIKGTMTTTHSYTGDQRLLDASH  259

Query  537  rdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKT  358
            RDLRRARAAALNIVPTSTGAAKAVALVLP LKGKLNGIALRVPTPNVSVVDLVVQV KKT
Sbjct  260  RDLRRARAAALNIVPTSTGAAKAVALVLPKLKGKLNGIALRVPTPNVSVVDLVVQVEKKT  319

Query  357  FAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAW  178
            FAEEVNAAFRESA   L+GIL+VCDEPLVSVDFRCSDVSST+DSSLTMVMGDDMVKV+AW
Sbjct  320  FAEEVNAAFRESADKALNGILAVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAW  379

Query  177  YDNEWGYSQRVVDLADIVANQWK  109
            YDNEWGYSQRVVDLA+IVA QWK
Sbjct  380  YDNEWGYSQRVVDLANIVAEQWK  402



>pdb|1RM3|O Chain O, Crystal Structure Of Mutant T33a Of Photosynthetic Glyceraldehyde-3- 
Phosphate Dehydrogenase A4 Isoform, Complexed 
With Nadp
 pdb|1RM3|A Chain A, Crystal Structure Of Mutant T33a Of Photosynthetic Glyceraldehyde-3- 
Phosphate Dehydrogenase A4 Isoform, Complexed 
With Nadp
 pdb|1RM3|B Chain B, Crystal Structure Of Mutant T33a Of Photosynthetic Glyceraldehyde-3- 
Phosphate Dehydrogenase A4 Isoform, Complexed 
With Nadp
Length=337

 Score =   290 bits (742),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 186/203 (92%), Positives = 195/203 (96%), Gaps = 0/203 (0%)
 Frame = -1

Query  717  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldash  538
            VGVN + Y+  + IISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH
Sbjct  134  VGVNEEGYTHADTIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH  193

Query  537  rdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKT  358
            RDLRRARAA LNIVPTSTGAAKAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKT
Sbjct  194  RDLRRARAACLNIVPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKT  253

Query  357  FAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAW  178
            FAEEVNAAFRESA NEL GILSVCDEPLVS+DFRC+DVSST+DSSLTMVMGDDMVKVIAW
Sbjct  254  FAEEVNAAFRESADNELKGILSVCDEPLVSIDFRCTDVSSTIDSSLTMVMGDDMVKVIAW  313

Query  177  YDNEWGYSQRVVDLADIVANQWK  109
            YDNEWGYSQRVVDLADIVAN+W+
Sbjct  314  YDNEWGYSQRVVDLADIVANKWQ  336



>pdb|1RM5|O Chain O, Crystal Structure Of Mutant S188a Of Photosynthetic 
Glyceraldehyde-3- Phosphate Dehydrogenase A4 Isoform, Complexed 
With Nadp
 pdb|1RM5|A Chain A, Crystal Structure Of Mutant S188a Of Photosynthetic 
Glyceraldehyde-3- Phosphate Dehydrogenase A4 Isoform, Complexed 
With Nadp
 pdb|1RM5|B Chain B, Crystal Structure Of Mutant S188a Of Photosynthetic 
Glyceraldehyde-3- Phosphate Dehydrogenase A4 Isoform, Complexed 
With Nadp
Length=337

 Score =   290 bits (741),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 185/203 (91%), Positives = 195/203 (96%), Gaps = 0/203 (0%)
 Frame = -1

Query  717  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldash  538
            VGVN + Y+  + IISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDA+H
Sbjct  134  VGVNEEGYTHADTIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDAAH  193

Query  537  rdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKT  358
            RDLRRARAA LNIVPTSTGAAKAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKT
Sbjct  194  RDLRRARAACLNIVPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKT  253

Query  357  FAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAW  178
            FAEEVNAAFRESA NEL GILSVCDEPLVS+DFRC+DVSST+DSSLTMVMGDDMVKVIAW
Sbjct  254  FAEEVNAAFRESADNELKGILSVCDEPLVSIDFRCTDVSSTIDSSLTMVMGDDMVKVIAW  313

Query  177  YDNEWGYSQRVVDLADIVANQWK  109
            YDNEWGYSQRVVDLADIVAN+W+
Sbjct  314  YDNEWGYSQRVVDLADIVANKWQ  336



>pdb|1NBO|O Chain O, The Dual Coenzyme Specificity Of Photosynthetic Glyceraldehyde-3- 
Phosphate Dehydrogenase Interpreted By The Crystal 
Structure Of A4 Isoform Complexed With Nad
 pdb|1NBO|A Chain A, The Dual Coenzyme Specificity Of Photosynthetic Glyceraldehyde-3- 
Phosphate Dehydrogenase Interpreted By The Crystal 
Structure Of A4 Isoform Complexed With Nad
 pdb|1NBO|B Chain B, The Dual Coenzyme Specificity Of Photosynthetic Glyceraldehyde-3- 
Phosphate Dehydrogenase Interpreted By The Crystal 
Structure Of A4 Isoform Complexed With Nad
 pdb|1RM4|O Chain O, Crystal Structure Of Recombinant Photosynthetic Glyceraldehyde-3- 
Phosphate Dehydrogenase A4 Isoform, Complexed 
With Nadp
 pdb|1RM4|A Chain A, Crystal Structure Of Recombinant Photosynthetic Glyceraldehyde-3- 
Phosphate Dehydrogenase A4 Isoform, Complexed 
With Nadp
 pdb|1RM4|B Chain B, Crystal Structure Of Recombinant Photosynthetic Glyceraldehyde-3- 
Phosphate Dehydrogenase A4 Isoform, Complexed 
With Nadp
 pdb|2HKI|A Chain A, Crystal Structure Of Photosynthetic Glyceraldehyde-3-Phosphate 
Dehydrogenase A4 Isoform
 pdb|2PKQ|P Chain P, Crystal Structure Of The Photosynthetic A2b2-glyceraldehyde-3- 
Phosphate Dehydrogenase, Complexed With Nadp
 pdb|2PKQ|R Chain R, Crystal Structure Of The Photosynthetic A2b2-glyceraldehyde-3- 
Phosphate Dehydrogenase, Complexed With Nadp
 pdb|2PKQ|S Chain S, Crystal Structure Of The Photosynthetic A2b2-glyceraldehyde-3- 
Phosphate Dehydrogenase, Complexed With Nadp
Length=337

 Score =   290 bits (741),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 186/203 (92%), Positives = 195/203 (96%), Gaps = 0/203 (0%)
 Frame = -1

Query  717  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldash  538
            VGVN + Y+  + IISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH
Sbjct  134  VGVNEEGYTHADTIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH  193

Query  537  rdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKT  358
            RDLRRARAA LNIVPTSTGAAKAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKT
Sbjct  194  RDLRRARAACLNIVPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKT  253

Query  357  FAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAW  178
            FAEEVNAAFRESA NEL GILSVCDEPLVS+DFRC+DVSST+DSSLTMVMGDDMVKVIAW
Sbjct  254  FAEEVNAAFRESADNELKGILSVCDEPLVSIDFRCTDVSSTIDSSLTMVMGDDMVKVIAW  313

Query  177  YDNEWGYSQRVVDLADIVANQWK  109
            YDNEWGYSQRVVDLADIVAN+W+
Sbjct  314  YDNEWGYSQRVVDLADIVANKWQ  336



>pir||DESPGA glyceraldehyde-3-phosphate dehydrogenase (NADP)  (phosphorylating) 
(EC 1.2.1.13) A, chloroplast - spinach
Length=337

 Score =   290 bits (741),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 186/203 (92%), Positives = 194/203 (96%), Gaps = 0/203 (0%)
 Frame = -1

Query  717  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldash  538
            VGVN + Y+  + IISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH
Sbjct  134  VGVNEEGYTHADTIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH  193

Query  537  rdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKT  358
            RDLRRARAA LNIVPTSTGAAKAVALVLP LKGKLNGIALRVPTPNVSVVDLVVQVSKKT
Sbjct  194  RDLRRARAACLNIVPTSTGAAKAVALVLPQLKGKLNGIALRVPTPNVSVVDLVVQVSKKT  253

Query  357  FAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAW  178
            FAEEVNAAFRESA NEL GILSVCDEPLVS+DFRC+DVSST+DSSLTMVMGDDMVKVIAW
Sbjct  254  FAEEVNAAFRESADNELKGILSVCDEPLVSIDFRCTDVSSTIDSSLTMVMGDDMVKVIAW  313

Query  177  YDNEWGYSQRVVDLADIVANQWK  109
            YDNEWGYSQRVVDLADIVAN+W+
Sbjct  314  YDNEWGYSQRVVDLADIVANKWQ  336



>emb|CDY26599.1| BnaA09g46780D [Brassica napus]
Length=399

 Score =   291 bits (746),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 189/202 (94%), Positives = 196/202 (97%), Gaps = 0/202 (0%)
 Frame = -1

Query  714  GVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashr  535
            GVNA+ YS ++ IISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHR
Sbjct  198  GVNAELYSHEDTIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHR  257

Query  534  dlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTF  355
            DLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKTF
Sbjct  258  DLRRARAAALNIVPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF  317

Query  354  AEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWY  175
            AEEVNAAFR++AANEL GIL VCDEPLVSVDFRCSDVSST+DSSLTMVMGDDMVKVIAWY
Sbjct  318  AEEVNAAFRDAAANELKGILDVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWY  377

Query  174  DNEWGYSQRVVDLADIVANQWK  109
            DNEWGYSQRVVDLADIVAN WK
Sbjct  378  DNEWGYSQRVVDLADIVANNWK  399



>emb|CDY16038.1| BnaC08g40850D [Brassica napus]
Length=399

 Score =   291 bits (746),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 189/202 (94%), Positives = 196/202 (97%), Gaps = 0/202 (0%)
 Frame = -1

Query  714  GVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashr  535
            GVNA+ YS ++ IISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHR
Sbjct  198  GVNAELYSHEDTIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHR  257

Query  534  dlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTF  355
            DLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKTF
Sbjct  258  DLRRARAAALNIVPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF  317

Query  354  AEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWY  175
            AEEVNAAFR++AANEL GIL VCDEPLVSVDFRCSDVSST+DSSLTMVMGDDMVKVIAWY
Sbjct  318  AEEVNAAFRDAAANELKGILDVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWY  377

Query  174  DNEWGYSQRVVDLADIVANQWK  109
            DNEWGYSQRVVDLADIVAN WK
Sbjct  378  DNEWGYSQRVVDLADIVANNWK  399



>gb|KFK43560.1| hypothetical protein AALP_AA1G142100 [Arabis alpina]
Length=399

 Score =   291 bits (746),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 189/203 (93%), Positives = 196/203 (97%), Gaps = 0/203 (0%)
 Frame = -1

Query  717  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldash  538
            VGVNA+ YS  + IISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH
Sbjct  197  VGVNAELYSHADTIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH  256

Query  537  rdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKT  358
            RDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKT
Sbjct  257  RDLRRARAAALNIVPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKT  316

Query  357  FAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAW  178
            FAEEVNAAFR++AANE+ GIL VCDEPLVSVDFRCSDVSST+DSSLTMVMGDDMVKVIAW
Sbjct  317  FAEEVNAAFRDAAANEMKGILDVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAW  376

Query  177  YDNEWGYSQRVVDLADIVANQWK  109
            YDNEWGYSQRVVDLADIVAN WK
Sbjct  377  YDNEWGYSQRVVDLADIVANNWK  399



>gb|AIU56856.1| glyceraldehyde-3-phosphate dehydrogenase A, partial [Brassica 
rapa subsp. chinensis]
Length=336

 Score =   289 bits (740),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 188/202 (93%), Positives = 196/202 (97%), Gaps = 0/202 (0%)
 Frame = -1

Query  714  GVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashr  535
            GVNA+ YS ++ I+SNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHR
Sbjct  135  GVNAELYSHEDTIVSNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHR  194

Query  534  dlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTF  355
            DLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKTF
Sbjct  195  DLRRARAAALNIVPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF  254

Query  354  AEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWY  175
            AEEVNAAFR++AANEL GIL VCDEPLVSVDFRCSDVSST+DSSLTMVMGDDMVKVIAWY
Sbjct  255  AEEVNAAFRDAAANELKGILDVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWY  314

Query  174  DNEWGYSQRVVDLADIVANQWK  109
            DNEWGYSQRVVDLADIVAN WK
Sbjct  315  DNEWGYSQRVVDLADIVANNWK  336



>pdb|2PKR|O Chain O, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
 pdb|2PKR|R Chain R, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
 pdb|2PKR|P Chain P, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
 pdb|2PKR|Q Chain Q, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
 pdb|2PKR|A Chain A, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
 pdb|2PKR|B Chain B, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
 pdb|2PKR|C Chain C, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
 pdb|2PKR|D Chain D, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
 pdb|2PKR|H Chain H, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
 pdb|2PKR|I Chain I, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
 pdb|2PKR|L Chain L, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
 pdb|2PKR|M Chain M, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
Length=365

 Score =   290 bits (742),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 187/208 (90%), Positives = 197/208 (95%), Gaps = 0/208 (0%)
 Frame = -1

Query  717  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldash  538
            VGVN + Y+  + IISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH
Sbjct  134  VGVNEEGYTHADTIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH  193

Query  537  rdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKT  358
            RDLRRARAA LNIVPTSTGAAKAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKT
Sbjct  194  RDLRRARAACLNIVPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKT  253

Query  357  FAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAW  178
            FAEEVNAAFRESA NEL GILSVCDEPLVS+DFRC+DVSST+DSSLTMVMGDDMVKVIAW
Sbjct  254  FAEEVNAAFRESADNELKGILSVCDEPLVSIDFRCTDVSSTIDSSLTMVMGDDMVKVIAW  313

Query  177  YDNEWGYSQRVVDLADIVANQWK*MPAS  94
            YDNEWGYSQRVVDLADIVAN+W+ +  S
Sbjct  314  YDNEWGYSQRVVDLADIVANKWQGLEGS  341



>sp|P19866.2|G3PA_SPIOL RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic; 
AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase subunit A; Flags: Precursor [Spinacia oleracea]
 gb|AAD10217.1| NADP-dependent glyceraldehydephosphate dehydrogenase subunit 
A [Spinacia oleracea]
Length=401

 Score =   291 bits (745),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 186/203 (92%), Positives = 195/203 (96%), Gaps = 0/203 (0%)
 Frame = -1

Query  717  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldash  538
            VGVN + Y+  + IISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH
Sbjct  199  VGVNEEGYTHADTIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH  258

Query  537  rdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKT  358
            RDLRRARAA LNIVPTSTGAAKAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKT
Sbjct  259  RDLRRARAACLNIVPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKT  318

Query  357  FAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAW  178
            FAEEVNAAFRESA NEL GILSVCDEPLVS+DFRC+DVSST+DSSLTMVMGDDMVKVIAW
Sbjct  319  FAEEVNAAFRESADNELKGILSVCDEPLVSIDFRCTDVSSTIDSSLTMVMGDDMVKVIAW  378

Query  177  YDNEWGYSQRVVDLADIVANQWK  109
            YDNEWGYSQRVVDLADIVAN+W+
Sbjct  379  YDNEWGYSQRVVDLADIVANKWQ  401



>ref|XP_002985183.1| hypothetical protein SELMODRAFT_181561 [Selaginella moellendorffii]
 gb|EFJ13677.1| hypothetical protein SELMODRAFT_181561 [Selaginella moellendorffii]
Length=402

 Score =   291 bits (744),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 187/203 (92%), Positives = 195/203 (96%), Gaps = 0/203 (0%)
 Frame = -1

Query  717  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldash  538
            VGVNA+ YSP EPIISNASCTTNCLAPFVKVLD+KFGIIKGTMTTTHSYTGDQRLLDASH
Sbjct  200  VGVNAEQYSPTEPIISNASCTTNCLAPFVKVLDEKFGIIKGTMTTTHSYTGDQRLLDASH  259

Query  537  rdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKT  358
            RDLRRARAAALNIVPTSTGAAKAVALVLP LKGKLNGIALRVPTPNVSVVDLVVQV KKT
Sbjct  260  RDLRRARAAALNIVPTSTGAAKAVALVLPKLKGKLNGIALRVPTPNVSVVDLVVQVEKKT  319

Query  357  FAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAW  178
            FAEEVNAAFRE+A   L+GIL+VCDEPLVSVDFRCSDVSST+DSSLTMVMGDDMVKV+AW
Sbjct  320  FAEEVNAAFREAADKALNGILAVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAW  379

Query  177  YDNEWGYSQRVVDLADIVANQWK  109
            YDNEWGYSQRVVDLA+IVA QWK
Sbjct  380  YDNEWGYSQRVVDLANIVAEQWK  402



>ref|XP_009118048.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPA2, chloroplastic 
isoform X1 [Brassica rapa]
Length=399

 Score =   291 bits (744),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 188/202 (93%), Positives = 196/202 (97%), Gaps = 0/202 (0%)
 Frame = -1

Query  714  GVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashr  535
            GVNA+ YS ++ IISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHR
Sbjct  198  GVNAELYSHEDTIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHR  257

Query  534  dlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTF  355
            DLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKTF
Sbjct  258  DLRRARAAALNIVPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF  317

Query  354  AEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWY  175
            AEEVNAAFR++AANEL GIL VCDEPLVSVDFRCSDVSST+DSSLTMVMGDDMVKVIAWY
Sbjct  318  AEEVNAAFRDAAANELKGILDVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWY  377

Query  174  DNEWGYSQRVVDLADIVANQWK  109
            DNEWGYSQRVVDL+DIVAN WK
Sbjct  378  DNEWGYSQRVVDLSDIVANNWK  399



>dbj|BAG68209.1| glyceraldehyde-3-phosphate dehydrogenase [Brassica rapa subsp. 
chinensis]
Length=328

 Score =   288 bits (736),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 189/203 (93%), Positives = 195/203 (96%), Gaps = 0/203 (0%)
 Frame = -1

Query  717  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldash  538
            VGVNA+ YS ++ IISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH
Sbjct  126  VGVNAELYSHEDTIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH  185

Query  537  rdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKT  358
            RDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKT
Sbjct  186  RDLRRARAAALNIVPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKT  245

Query  357  FAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAW  178
            FAEEVNAAFR +AANEL GIL VCDEPLVSV FRCSDVSST+DSSLTMVMGDDMVKVIAW
Sbjct  246  FAEEVNAAFRGAAANELKGILDVCDEPLVSVGFRCSDVSSTIDSSLTMVMGDDMVKVIAW  305

Query  177  YDNEWGYSQRVVDLADIVANQWK  109
            YDNEWGYSQRVVDLADIVAN WK
Sbjct  306  YDNEWGYSQRVVDLADIVANNWK  328



>pdb|1JN0|O Chain O, Crystal Structure Of The Non-regulatory A4 Isoform Of 
Spinach Chloroplast Glyceraldehyde-3-phosphate Dehydrogenase 
Complexed With Nadp
 pdb|1JN0|A Chain A, Crystal Structure Of The Non-regulatory A4 Isoform Of 
Spinach Chloroplast Glyceraldehyde-3-phosphate Dehydrogenase 
Complexed With Nadp
 pdb|1JN0|B Chain B, Crystal Structure Of The Non-regulatory A4 Isoform Of 
Spinach Chloroplast Glyceraldehyde-3-phosphate Dehydrogenase 
Complexed With Nadp
Length=335

 Score =   288 bits (736),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 185/203 (91%), Positives = 193/203 (95%), Gaps = 0/203 (0%)
 Frame = -1

Query  717  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldash  538
            VGVN + Y+  + IISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH
Sbjct  132  VGVNEEGYTHADTIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH  191

Query  537  rdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKT  358
            RDLRRARAA LNIVPTSTGAAKAVALVLP LKGKLNGIALRVPTPNVSVVDLVVQVSKKT
Sbjct  192  RDLRRARAACLNIVPTSTGAAKAVALVLPQLKGKLNGIALRVPTPNVSVVDLVVQVSKKT  251

Query  357  FAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAW  178
            FAEEVNAAFRESA  EL GILSVCDEPLVS+DFRC+DVSST+DSSLTMVMGDDMVKVIAW
Sbjct  252  FAEEVNAAFRESADQELKGILSVCDEPLVSIDFRCTDVSSTIDSSLTMVMGDDMVKVIAW  311

Query  177  YDNEWGYSQRVVDLADIVANQWK  109
            YDNEWGYSQRVVDLADIVAN+W+
Sbjct  312  YDNEWGYSQRVVDLADIVANKWQ  334



>ref|NP_001117276.1| glyceraldehyde 3-phosphate dehydrogenase GAPA2 [Arabidopsis thaliana]
 ref|NP_001184977.1| glyceraldehyde 3-phosphate dehydrogenase GAPA2 [Arabidopsis thaliana]
 gb|AEE28946.1| glyceraldehyde-3-phosphate dehydrogenase (NADP+) (phosphorylating) 
[Arabidopsis thaliana]
 gb|AEE28947.1| glyceraldehyde-3-phosphate dehydrogenase (NADP+) (phosphorylating) 
[Arabidopsis thaliana]
Length=350

 Score =   288 bits (737),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 188/203 (93%), Positives = 195/203 (96%), Gaps = 0/203 (0%)
 Frame = -1

Query  717  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldash  538
            VGVNA+ YS ++ IISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH
Sbjct  148  VGVNAELYSHEDTIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH  207

Query  537  rdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKT  358
            RDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKT
Sbjct  208  RDLRRARAAALNIVPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKT  267

Query  357  FAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAW  178
            FAEEVNAAFR++A  EL GIL VCDEPLVSVDFRCSDVSST+DSSLTMVMGDDMVKVIAW
Sbjct  268  FAEEVNAAFRDAAEKELKGILDVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAW  327

Query  177  YDNEWGYSQRVVDLADIVANQWK  109
            YDNEWGYSQRVVDLADIVAN WK
Sbjct  328  YDNEWGYSQRVVDLADIVANNWK  350



>ref|XP_010694632.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Beta vulgaris subsp. vulgaris]
Length=401

 Score =   290 bits (741),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 188/203 (93%), Positives = 196/203 (97%), Gaps = 0/203 (0%)
 Frame = -1

Query  717  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldash  538
            VGVN + Y+  + IISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH
Sbjct  199  VGVNEEGYTHADTIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH  258

Query  537  rdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKT  358
            RDLRRARAAALNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQV+KKT
Sbjct  259  RDLRRARAAALNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVTKKT  318

Query  357  FAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAW  178
            FAEEVNAAFRESA NEL GILSVCDEPLVSVDFRC+DVSSTVDSSLTMVMGDDMVKVIAW
Sbjct  319  FAEEVNAAFRESADNELKGILSVCDEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVIAW  378

Query  177  YDNEWGYSQRVVDLADIVANQWK  109
            YDNEWGYSQRVVDLADIVA++W+
Sbjct  379  YDNEWGYSQRVVDLADIVADKWQ  401



>gb|AFC88822.1| glyceraldehyde-3-phosphate dehydrogenase-like protein, partial 
[Miscanthus sinensis]
Length=316

 Score =   287 bits (734),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 186/203 (92%), Positives = 195/203 (96%), Gaps = 0/203 (0%)
 Frame = -1

Query  717  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldash  538
            VGVNAD Y+PDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH
Sbjct  114  VGVNADQYNPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH  173

Query  537  rdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKT  358
            RDLRRARAAALNIVPTSTGAAKAV+LVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKT
Sbjct  174  RDLRRARAAALNIVPTSTGAAKAVSLVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKT  233

Query  357  FAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAW  178
             AEEVN AFR++AANEL GIL VCD PLVSVDFRCSDVSST+D+SLTMVMGDDMVKVI+W
Sbjct  234  LAEEVNQAFRDAAANELIGILEVCDVPLVSVDFRCSDVSSTIDASLTMVMGDDMVKVISW  293

Query  177  YDNEWGYSQRVVDLADIVANQWK  109
            YDNEWGYSQRVVDLADI A +WK
Sbjct  294  YDNEWGYSQRVVDLADICAIKWK  316



>ref|NP_172750.1| glyceraldehyde 3-phosphate dehydrogenase GAPA2 [Arabidopsis thaliana]
 sp|Q9LPW0.1|G3PA2_ARATH RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase GAPA2, 
chloroplastic; AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase A subunit 2; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAF78494.1|AC012187_14 Strong similarity to GAPDH subunit A from Pisum sativum gb|X15190 
and contains a GAPDH PF|00044 domain. ESTs gb|T42920, gb|T43410, 
gb|T46101, gb|T04006, gb|T20630, gb|Z34677, gb|T46805, 
gb|N37754, gb|N37754, gb|Z26072, gb|H37169, gb|H76419, 
gb|T20834, gb|T21557, gb|AA713258, gb|T04005, gb|AI099909, gb|Z34793 
come from this gene [Arabidopsis thaliana]
 gb|AAP40454.1| putative calcium-binding protein, calreticulin [Arabidopsis thaliana]
 gb|AAU94430.1| At1g12900 [Arabidopsis thaliana]
 gb|AEE28944.1| glyceraldehyde-3-phosphate dehydrogenase (NADP+) (phosphorylating) 
[Arabidopsis thaliana]
Length=399

 Score =   290 bits (741),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 188/203 (93%), Positives = 195/203 (96%), Gaps = 0/203 (0%)
 Frame = -1

Query  717  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldash  538
            VGVNA+ YS ++ IISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH
Sbjct  197  VGVNAELYSHEDTIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH  256

Query  537  rdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKT  358
            RDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKT
Sbjct  257  RDLRRARAAALNIVPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKT  316

Query  357  FAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAW  178
            FAEEVNAAFR++A  EL GIL VCDEPLVSVDFRCSDVSST+DSSLTMVMGDDMVKVIAW
Sbjct  317  FAEEVNAAFRDAAEKELKGILDVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAW  376

Query  177  YDNEWGYSQRVVDLADIVANQWK  109
            YDNEWGYSQRVVDLADIVAN WK
Sbjct  377  YDNEWGYSQRVVDLADIVANNWK  399



>ref|XP_009148556.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPA2, chloroplastic 
isoform X1 [Brassica rapa]
Length=399

 Score =   289 bits (740),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 188/203 (93%), Positives = 195/203 (96%), Gaps = 0/203 (0%)
 Frame = -1

Query  717  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldash  538
            VGVNA+ YS ++ IISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH
Sbjct  197  VGVNAELYSHEDTIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH  256

Query  537  rdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKT  358
            RDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKT
Sbjct  257  RDLRRARAAALNIVPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKT  316

Query  357  FAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAW  178
            FAEEVNAAFR++A  EL GIL VCDEPLVSVDFRCSDVSST+DSSLTMVMGDDMVKVIAW
Sbjct  317  FAEEVNAAFRDAAEKELKGILDVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAW  376

Query  177  YDNEWGYSQRVVDLADIVANQWK  109
            YDNEWGYSQRVVDLADIVAN WK
Sbjct  377  YDNEWGYSQRVVDLADIVANNWK  399



>ref|XP_002892719.1| GAPA-2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH68978.1| GAPA-2 [Arabidopsis lyrata subsp. lyrata]
Length=399

 Score =   289 bits (740),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 188/203 (93%), Positives = 195/203 (96%), Gaps = 0/203 (0%)
 Frame = -1

Query  717  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldash  538
            VGVNA+ YS ++ IISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH
Sbjct  197  VGVNAELYSHEDTIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH  256

Query  537  rdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKT  358
            RDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKT
Sbjct  257  RDLRRARAAALNIVPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKT  316

Query  357  FAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAW  178
            FAEEVNAAFR++A  EL GIL VCDEPLVSVDFRCSDVSST+DSSLTMVMGDDMVKVIAW
Sbjct  317  FAEEVNAAFRDAAEKELKGILDVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAW  376

Query  177  YDNEWGYSQRVVDLADIVANQWK  109
            YDNEWGYSQRVVDLADIVAN WK
Sbjct  377  YDNEWGYSQRVVDLADIVANNWK  399



>ref|XP_010476269.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPA2, chloroplastic 
isoform X1 [Camelina sativa]
Length=399

 Score =   289 bits (740),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 188/203 (93%), Positives = 195/203 (96%), Gaps = 0/203 (0%)
 Frame = -1

Query  717  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldash  538
            VGVNA+ YS ++ IISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH
Sbjct  197  VGVNAELYSHEDTIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH  256

Query  537  rdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKT  358
            RDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKT
Sbjct  257  RDLRRARAAALNIVPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKT  316

Query  357  FAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAW  178
            FAEEVNAAFR++A  EL GIL VCDEPLVSVDFRCSDVSST+DSSLTMVMGDDMVKVIAW
Sbjct  317  FAEEVNAAFRDAAEKELKGILDVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAW  376

Query  177  YDNEWGYSQRVVDLADIVANQWK  109
            YDNEWGYSQRVVDLADIVAN WK
Sbjct  377  YDNEWGYSQRVVDLADIVANNWK  399



>dbj|BAJ10475.1| glyceraldehyde-3-phosphate dehydrogenase [Brassica rapa subsp. 
chinensis]
Length=399

 Score =   289 bits (740),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 189/203 (93%), Positives = 195/203 (96%), Gaps = 0/203 (0%)
 Frame = -1

Query  717  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldash  538
            VGVNA+ YS ++ IISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH
Sbjct  197  VGVNAELYSHEDTIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH  256

Query  537  rdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKT  358
            RDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKT
Sbjct  257  RDLRRARAAALNIVPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKT  316

Query  357  FAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAW  178
            FAEEVNAAFR +AANEL GIL VCDEPLVSV FRCSDVSST+DSSLTMVMGDDMVKVIAW
Sbjct  317  FAEEVNAAFRGAAANELKGILDVCDEPLVSVGFRCSDVSSTIDSSLTMVMGDDMVKVIAW  376

Query  177  YDNEWGYSQRVVDLADIVANQWK  109
            YDNEWGYSQRVVDLADIVAN WK
Sbjct  377  YDNEWGYSQRVVDLADIVANNWK  399



>ref|XP_010494747.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPA2, chloroplastic 
isoform X1 [Camelina sativa]
Length=399

 Score =   289 bits (740),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 188/203 (93%), Positives = 195/203 (96%), Gaps = 0/203 (0%)
 Frame = -1

Query  717  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldash  538
            VGVNA+ YS ++ IISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH
Sbjct  197  VGVNAELYSHEDTIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH  256

Query  537  rdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKT  358
            RDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKT
Sbjct  257  RDLRRARAAALNIVPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKT  316

Query  357  FAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAW  178
            FAEEVNAAFR++A  EL GIL VCDEPLVSVDFRCSDVSST+DSSLTMVMGDDMVKVIAW
Sbjct  317  FAEEVNAAFRDAAEKELKGILDVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAW  376

Query  177  YDNEWGYSQRVVDLADIVANQWK  109
            YDNEWGYSQRVVDLADIVAN WK
Sbjct  377  YDNEWGYSQRVVDLADIVANNWK  399



>dbj|BAJ90530.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=401

 Score =   289 bits (740),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 186/202 (92%), Positives = 194/202 (96%), Gaps = 0/202 (0%)
 Frame = -1

Query  714  GVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashr  535
            GVNAD Y+  + IISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHR
Sbjct  200  GVNADLYTHADTIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHR  259

Query  534  dlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTF  355
            DLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKT 
Sbjct  260  DLRRARAAALNIVPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTL  319

Query  354  AEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWY  175
            AEEVN AFR++AANEL GIL VCDEPLVSVDFRCSDVSST+D+SL+MVMGDDMVKVIAWY
Sbjct  320  AEEVNQAFRDAAANELKGILDVCDEPLVSVDFRCSDVSSTIDASLSMVMGDDMVKVIAWY  379

Query  174  DNEWGYSQRVVDLADIVANQWK  109
            DNEWGYSQRVVDLADIVANQWK
Sbjct  380  DNEWGYSQRVVDLADIVANQWK  401



>gb|ABW89104.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
Length=195

 Score =   282 bits (721),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 186/192 (97%), Positives = 189/192 (98%), Gaps = 0/192 (0%)
 Frame = -1

Query  684  EPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaL  505
            E IISNASCTTNCLAPFVKV+DQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAAL
Sbjct  4    EAIISNASCTTNCLAPFVKVIDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAAL  63

Query  504  NIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRE  325
            NIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRE
Sbjct  64   NIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRE  123

Query  324  SAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRV  145
            +A NEL+GILSVCDEPLVSVDFRCSDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRV
Sbjct  124  AADNELNGILSVCDEPLVSVDFRCSDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRV  183

Query  144  VDLADIVANQWK  109
            VDLADIVAN WK
Sbjct  184  VDLADIVANNWK  195



>dbj|BAJ90885.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK08149.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=401

 Score =   289 bits (740),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 186/202 (92%), Positives = 194/202 (96%), Gaps = 0/202 (0%)
 Frame = -1

Query  714  GVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashr  535
            GVNAD Y+  + IISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHR
Sbjct  200  GVNADLYTHADTIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHR  259

Query  534  dlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTF  355
            DLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKT 
Sbjct  260  DLRRARAAALNIVPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTL  319

Query  354  AEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWY  175
            AEEVN AFR++AANEL GIL VCDEPLVSVDFRCSDVSST+D+SL+MVMGDDMVKVIAWY
Sbjct  320  AEEVNQAFRDAAANELKGILDVCDEPLVSVDFRCSDVSSTIDASLSMVMGDDMVKVIAWY  379

Query  174  DNEWGYSQRVVDLADIVANQWK  109
            DNEWGYSQRVVDLADIVANQWK
Sbjct  380  DNEWGYSQRVVDLADIVANQWK  401



>emb|CDY19412.1| BnaC05g09210D [Brassica napus]
 emb|CDX98028.1| BnaA06g07790D [Brassica napus]
Length=399

 Score =   289 bits (739),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 188/203 (93%), Positives = 195/203 (96%), Gaps = 0/203 (0%)
 Frame = -1

Query  717  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldash  538
            VGVNA+ YS ++ IISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH
Sbjct  197  VGVNAELYSHEDTIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH  256

Query  537  rdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKT  358
            RDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKT
Sbjct  257  RDLRRARAAALNIVPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKT  316

Query  357  FAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAW  178
            FAEEVNAAFR++A  EL GIL VCDEPLVSVDFRCSDVSST+DSSLTMVMGDDMVKVIAW
Sbjct  317  FAEEVNAAFRDAAEKELKGILDVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAW  376

Query  177  YDNEWGYSQRVVDLADIVANQWK  109
            YDNEWGYSQRVVDLADIVAN WK
Sbjct  377  YDNEWGYSQRVVDLADIVANNWK  399



>gb|EMT31124.1| Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic [Aegilops 
tauschii]
Length=402

 Score =   289 bits (739),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 186/202 (92%), Positives = 194/202 (96%), Gaps = 0/202 (0%)
 Frame = -1

Query  714  GVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashr  535
            GVNAD Y+  + IISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHR
Sbjct  201  GVNADLYTHADTIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHR  260

Query  534  dlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTF  355
            DLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKT 
Sbjct  261  DLRRARAAALNIVPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTL  320

Query  354  AEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWY  175
            AEEVN AFR++AANEL GIL VCDEPLVSVDFRCSDVSST+D+SL+MVMGDDMVKVIAWY
Sbjct  321  AEEVNQAFRDAAANELKGILDVCDEPLVSVDFRCSDVSSTIDASLSMVMGDDMVKVIAWY  380

Query  174  DNEWGYSQRVVDLADIVANQWK  109
            DNEWGYSQRVVDLADIVANQWK
Sbjct  381  DNEWGYSQRVVDLADIVANQWK  402



>gb|ACN39951.1| unknown [Picea sitchensis]
Length=330

 Score =   286 bits (733),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 188/203 (93%), Positives = 194/203 (96%), Gaps = 0/203 (0%)
 Frame = -1

Query  717  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldash  538
            VGVN   YSP + IISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH
Sbjct  127  VGVNEGKYSPTDDIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH  186

Query  537  rdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKT  358
            RDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQV KKT
Sbjct  187  RDLRRARAAALNIVPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVEKKT  246

Query  357  FAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAW  178
            FAEEVNAAFRESA  EL+GIL+VCDEPLVS+DFRCSDVSSTVDSSLTMVMGDDMVKV+AW
Sbjct  247  FAEEVNAAFRESADKELNGILAVCDEPLVSIDFRCSDVSSTVDSSLTMVMGDDMVKVVAW  306

Query  177  YDNEWGYSQRVVDLADIVANQWK  109
            YDNEWGYSQRVVDLADIVAN WK
Sbjct  307  YDNEWGYSQRVVDLADIVANNWK  329



>gb|ACN40537.1| unknown [Picea sitchensis]
Length=410

 Score =   289 bits (739),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 188/203 (93%), Positives = 194/203 (96%), Gaps = 0/203 (0%)
 Frame = -1

Query  717  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldash  538
            VGVN   YSP + IISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH
Sbjct  207  VGVNEGKYSPTDDIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH  266

Query  537  rdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKT  358
            RDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQV KKT
Sbjct  267  RDLRRARAAALNIVPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVEKKT  326

Query  357  FAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAW  178
            FAEEVNAAFRESA  EL+GIL+VCDEPLVS+DFRCSDVSSTVDSSLTMVMGDDMVKV+AW
Sbjct  327  FAEEVNAAFRESADKELNGILAVCDEPLVSIDFRCSDVSSTVDSSLTMVMGDDMVKVVAW  386

Query  177  YDNEWGYSQRVVDLADIVANQWK  109
            YDNEWGYSQRVVDLADIVAN WK
Sbjct  387  YDNEWGYSQRVVDLADIVANNWK  409



>gb|ABK25233.1| unknown [Picea sitchensis]
 gb|ABK26169.1| unknown [Picea sitchensis]
 gb|ACN40026.1| unknown [Picea sitchensis]
 gb|ACN40459.1| unknown [Picea sitchensis]
Length=410

 Score =   289 bits (739),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 188/203 (93%), Positives = 194/203 (96%), Gaps = 0/203 (0%)
 Frame = -1

Query  717  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldash  538
            VGVN   YSP + IISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH
Sbjct  207  VGVNEGKYSPTDDIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH  266

Query  537  rdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKT  358
            RDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQV KKT
Sbjct  267  RDLRRARAAALNIVPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVEKKT  326

Query  357  FAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAW  178
            FAEEVNAAFRESA  EL+GIL+VCDEPLVS+DFRCSDVSSTVDSSLTMVMGDDMVKV+AW
Sbjct  327  FAEEVNAAFRESADKELNGILAVCDEPLVSIDFRCSDVSSTVDSSLTMVMGDDMVKVVAW  386

Query  177  YDNEWGYSQRVVDLADIVANQWK  109
            YDNEWGYSQRVVDLADIVAN WK
Sbjct  387  YDNEWGYSQRVVDLADIVANNWK  409



>gb|EYU35565.1| hypothetical protein MIMGU_mgv1a005886mg [Erythranthe guttata]
Length=466

 Score =   291 bits (744),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 191/203 (94%), Positives = 195/203 (96%), Gaps = 0/203 (0%)
 Frame = -1

Query  717  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldash  538
            VGVNADAY+  + IISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH
Sbjct  264  VGVNADAYTHADDIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH  323

Query  537  rdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKT  358
            RDLRRARAAALNIVPTSTGAAKAVALVLP LKGKLNGIALRVPTPNVSVVDLVVQV KKT
Sbjct  324  RDLRRARAAALNIVPTSTGAAKAVALVLPQLKGKLNGIALRVPTPNVSVVDLVVQVEKKT  383

Query  357  FAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAW  178
            FAEEVNAAFRE+A NEL GIL+VCDEPLVSVDFRCSDVSSTVDSSLTMVMGDDMVKVIAW
Sbjct  384  FAEEVNAAFREAADNELSGILAVCDEPLVSVDFRCSDVSSTVDSSLTMVMGDDMVKVIAW  443

Query  177  YDNEWGYSQRVVDLADIVANQWK  109
            YDNEWGYSQRVVDLADIVAN WK
Sbjct  444  YDNEWGYSQRVVDLADIVANNWK  466



>ref|XP_006304985.1| hypothetical protein CARUB_v10009349mg [Capsella rubella]
 gb|EOA37883.1| hypothetical protein CARUB_v10009349mg [Capsella rubella]
Length=399

 Score =   288 bits (736),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 188/203 (93%), Positives = 194/203 (96%), Gaps = 0/203 (0%)
 Frame = -1

Query  717  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldash  538
            VGVNA+ YS  + IISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH
Sbjct  197  VGVNAELYSHADTIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH  256

Query  537  rdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKT  358
            RDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKT
Sbjct  257  RDLRRARAAALNIVPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKT  316

Query  357  FAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAW  178
            FAEEVNAAFR++A  EL GIL VCDEPLVSVDFRCSDVSST+DSSLTMVMGDDMVKVIAW
Sbjct  317  FAEEVNAAFRDAAEKELKGILDVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAW  376

Query  177  YDNEWGYSQRVVDLADIVANQWK  109
            YDNEWGYSQRVVDLADIVAN WK
Sbjct  377  YDNEWGYSQRVVDLADIVANNWK  399



>ref|XP_006417176.1| hypothetical protein EUTSA_v10007809mg [Eutrema salsugineum]
 ref|XP_006417178.1| hypothetical protein EUTSA_v10007809mg [Eutrema salsugineum]
 gb|ESQ35529.1| hypothetical protein EUTSA_v10007809mg [Eutrema salsugineum]
 gb|ESQ35531.1| hypothetical protein EUTSA_v10007809mg [Eutrema salsugineum]
Length=350

 Score =   286 bits (732),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 187/202 (93%), Positives = 194/202 (96%), Gaps = 0/202 (0%)
 Frame = -1

Query  714  GVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashr  535
            GVNA+ YS ++ IISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHR
Sbjct  149  GVNAELYSHEDTIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHR  208

Query  534  dlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTF  355
            DLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKTF
Sbjct  209  DLRRARAAALNIVPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF  268

Query  354  AEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWY  175
            AEEVNAAFR++A  EL GIL VCDEPLVSVDFRCSDVSST+DSSLTMVMGDDMVKVIAWY
Sbjct  269  AEEVNAAFRDAAEKELKGILDVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWY  328

Query  174  DNEWGYSQRVVDLADIVANQWK  109
            DNEWGYSQRVVDLADIVAN WK
Sbjct  329  DNEWGYSQRVVDLADIVANNWK  350



>ref|XP_006417177.1| hypothetical protein EUTSA_v10007809mg [Eutrema salsugineum]
 gb|ESQ35530.1| hypothetical protein EUTSA_v10007809mg [Eutrema salsugineum]
Length=399

 Score =   287 bits (735),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 187/202 (93%), Positives = 194/202 (96%), Gaps = 0/202 (0%)
 Frame = -1

Query  714  GVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashr  535
            GVNA+ YS ++ IISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHR
Sbjct  198  GVNAELYSHEDTIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHR  257

Query  534  dlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTF  355
            DLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKTF
Sbjct  258  DLRRARAAALNIVPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF  317

Query  354  AEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWY  175
            AEEVNAAFR++A  EL GIL VCDEPLVSVDFRCSDVSST+DSSLTMVMGDDMVKVIAWY
Sbjct  318  AEEVNAAFRDAAEKELKGILDVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWY  377

Query  174  DNEWGYSQRVVDLADIVANQWK  109
            DNEWGYSQRVVDLADIVAN WK
Sbjct  378  DNEWGYSQRVVDLADIVANNWK  399



>gb|AAA33780.1| glyceraldehyde-phosphate dehydrogenase [Pinus sylvestris]
Length=411

 Score =   287 bits (735),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 188/202 (93%), Positives = 192/202 (95%), Gaps = 0/202 (0%)
 Frame = -1

Query  714  GVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashr  535
            GVN D Y P E IISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHR
Sbjct  209  GVNEDKYYPAEEIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHR  268

Query  534  dlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTF  355
            DLRRARAAALNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQV KKTF
Sbjct  269  DLRRARAAALNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVEKKTF  328

Query  354  AEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWY  175
            AEEVNAAFRE+A  EL GIL+VCDEPLVS+DFRCSDVSSTVDSSLTMVMGDDMVKV+AWY
Sbjct  329  AEEVNAAFRETADKELKGILAVCDEPLVSIDFRCSDVSSTVDSSLTMVMGDDMVKVVAWY  388

Query  174  DNEWGYSQRVVDLADIVANQWK  109
            DNEWGYSQRVVDLADIVAN WK
Sbjct  389  DNEWGYSQRVVDLADIVANNWK  410



>dbj|BAH57068.1| AT1G12900 [Arabidopsis thaliana]
Length=350

 Score =   285 bits (729),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 187/203 (92%), Positives = 194/203 (96%), Gaps = 0/203 (0%)
 Frame = -1

Query  717  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldash  538
            VGVNA+ YS ++ IISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH
Sbjct  148  VGVNAELYSHEDTIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH  207

Query  537  rdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKT  358
            RDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKT
Sbjct  208  RDLRRARAAALNIVPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKT  267

Query  357  FAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAW  178
            FAEEVNAAFR++A  EL GIL VCDEPLVSVDFRCSDVSST+DSSLTMVMGDDMVKVIAW
Sbjct  268  FAEEVNAAFRDAAEKELKGILDVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAW  327

Query  177  YDNEWGYSQRVVDLADIVANQWK  109
            YDNEWGYSQR VDLADIVAN WK
Sbjct  328  YDNEWGYSQRDVDLADIVANNWK  350



>gb|KDO63476.1| hypothetical protein CISIN_1g013492mg [Citrus sinensis]
Length=442

 Score =   288 bits (736),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 197/242 (81%), Positives = 199/242 (82%), Gaps = 39/242 (16%)
 Frame = -1

Query  717  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFG-----------------------  607
            VGVNADAY PDEPIISNASCTTNCLAPFVKVLDQKFG                       
Sbjct  201  VGVNADAYKPDEPIISNASCTTNCLAPFVKVLDQKFGKYQKHLQKSSLSLCSDIIQLRKT  260

Query  606  ----------------IIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAA  475
                            IIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA
Sbjct  261  QKVTQLNDRIFPMCAGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA  320

Query  474  KAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGIL  295
            KAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESA NEL GIL
Sbjct  321  KAVALVLPALKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESADNELKGIL  380

Query  294  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  115
            SVCDEPLVSVDFRCSDVSSTVDSSLT+VMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN 
Sbjct  381  SVCDEPLVSVDFRCSDVSSTVDSSLTLVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANN  440

Query  114  WK  109
            WK
Sbjct  441  WK  442



>gb|ACN40000.1| unknown [Picea sitchensis]
Length=410

 Score =   287 bits (734),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 187/203 (92%), Positives = 193/203 (95%), Gaps = 0/203 (0%)
 Frame = -1

Query  717  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldash  538
            VGVN   YSP + IISNASCTTNCLAPFVKVLDQKFGII GTMTTTHSYTGDQRLLDASH
Sbjct  207  VGVNEGKYSPTDDIISNASCTTNCLAPFVKVLDQKFGIINGTMTTTHSYTGDQRLLDASH  266

Query  537  rdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKT  358
            RDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQV KKT
Sbjct  267  RDLRRARAAALNIVPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVEKKT  326

Query  357  FAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAW  178
            FAEEVNAAFRESA  EL+GIL+VCDEPLVS+DFRCSDVSSTVDSSLTMVMGDDMVKV+AW
Sbjct  327  FAEEVNAAFRESADKELNGILAVCDEPLVSIDFRCSDVSSTVDSSLTMVMGDDMVKVVAW  386

Query  177  YDNEWGYSQRVVDLADIVANQWK  109
            YDNEWGYSQRVVDLADIVAN WK
Sbjct  387  YDNEWGYSQRVVDLADIVANNWK  409



>gb|ABK24313.1| unknown [Picea sitchensis]
Length=410

 Score =   287 bits (734),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 187/203 (92%), Positives = 193/203 (95%), Gaps = 0/203 (0%)
 Frame = -1

Query  717  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldash  538
            VGVN   YSP + IISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH
Sbjct  207  VGVNEGKYSPTDDIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH  266

Query  537  rdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKT  358
            RDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQV KKT
Sbjct  267  RDLRRARAAALNIVPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVEKKT  326

Query  357  FAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAW  178
            FAEEVNAAFRESA  EL+GIL+VCDEPLVS+DFRCSDVSSTVDSSLTMVMGDDMV V+AW
Sbjct  327  FAEEVNAAFRESADKELNGILAVCDEPLVSIDFRCSDVSSTVDSSLTMVMGDDMVNVVAW  386

Query  177  YDNEWGYSQRVVDLADIVANQWK  109
            YDNEWGYSQRVVDLADIVAN WK
Sbjct  387  YDNEWGYSQRVVDLADIVANNWK  409



>gb|AHA84230.1| glyceraldehyde-3-phosphate dehydrogenase A [Phaseolus vulgaris]
Length=402

 Score =   285 bits (730),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 176/203 (87%), Positives = 181/203 (89%), Gaps = 1/203 (0%)
 Frame = -1

Query  717  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldash  538
            VGVN   YS DEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTT SYTGD+ L  +  
Sbjct  201  VGVNEYDYSGDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTPSYTGDRALDASHR  260

Query  537  rdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKT  358
               R   AA  NIVPTSTGAAKAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKT
Sbjct  261  DLRRARAAAL-NIVPTSTGAAKAVALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKT  319

Query  357  FAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAW  178
            FAEEVNAAFRESA  EL GILSVCDEP VSVDFRC+DVSSTVDSSLTMVMGDDMVKVIAW
Sbjct  320  FAEEVNAAFRESAEKELKGILSVCDEPFVSVDFRCTDVSSTVDSSLTMVMGDDMVKVIAW  379

Query  177  YDNEWGYSQRVVDLADIVANQWK  109
            YDNEWGYSQRVVDLADIVAN+WK
Sbjct  380  YDNEWGYSQRVVDLADIVANKWK  402



>gb|ABK00067.1| chloroplast glyceraldehyde-3-phosphate dehydrogenase, partial 
[Chlorokybus atmophyticus]
Length=325

 Score =   278 bits (711),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 177/202 (88%), Positives = 186/202 (92%), Gaps = 0/202 (0%)
 Frame = -1

Query  717  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldash  538
            VGVN   Y P  PIISNASCTTNCLAPFVK+L  KFGI+KGTMTTTHSYTGDQRLLDASH
Sbjct  111  VGVNDQDYDPSAPIISNASCTTNCLAPFVKILSDKFGIVKGTMTTTHSYTGDQRLLDASH  170

Query  537  rdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKT  358
            RDLRRARAAALNIVPTSTGAAKAVALVLP LKGKLNGIALRVPTPNVS+VDLV+Q  KKT
Sbjct  171  RDLRRARAAALNIVPTSTGAAKAVALVLPQLKGKLNGIALRVPTPNVSIVDLVIQTEKKT  230

Query  357  FAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAW  178
            FAEEVNAAFRE+A   L GIL+VCDEPLVSVDFRC+DVSST+DSSLTMVMGDDMVKV+AW
Sbjct  231  FAEEVNAAFREAANGPLKGILAVCDEPLVSVDFRCTDVSSTIDSSLTMVMGDDMVKVVAW  290

Query  177  YDNEWGYSQRVVDLADIVANQW  112
            YDNEWGYSQRVVDLADIVAN W
Sbjct  291  YDNEWGYSQRVVDLADIVANNW  312



>sp|P09043.1|G3PA_TOBAC RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic; 
AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase subunit A; Flags: Precursor, partial [Nicotiana 
tabacum]
 gb|AAA34075.1| glyceraldehyde-3-phosphate dehydrogenase A-subunit precursor, 
partial [Nicotiana tabacum]
Length=392

 Score =   280 bits (715),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 184/203 (91%), Positives = 190/203 (94%), Gaps = 0/203 (0%)
 Frame = -1

Query  717  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldash  538
            VGVNAD Y+PDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH
Sbjct  190  VGVNADLYNPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH  249

Query  537  rdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKT  358
            RDLRRARAAALNIVPTSTGAAKAVAL   +L+G    + LRVPTPNVSVVDLVVQVSKKT
Sbjct  250  RDLRRARAAALNIVPTSTGAAKAVALSSQALRGSSMALPLRVPTPNVSVVDLVVQVSKKT  309

Query  357  FAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAW  178
            FAEEVNAAFRE+A  EL GIL VCDEPLVSVDFRCSDVSSTVD+SLTMVMGDDMVKVIAW
Sbjct  310  FAEEVNAAFREAADKELKGILDVCDEPLVSVDFRCSDVSSTVDASLTMVMGDDMVKVIAW  369

Query  177  YDNEWGYSQRVVDLADIVANQWK  109
            YDNEWGYSQRVVDLADIVANQWK
Sbjct  370  YDNEWGYSQRVVDLADIVANQWK  392



>gb|ABK00052.1| chloroplast glyceraldehyde-3-phosphate dehydrogenase, partial 
[Marchantia polymorpha]
Length=359

 Score =   278 bits (712),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 179/202 (89%), Positives = 192/202 (95%), Gaps = 0/202 (0%)
 Frame = -1

Query  717  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldash  538
            +GVN + Y P E IISNASCTTNCLAPFVKVLD+KFGIIKGTMTTTHSYTGDQRLLDASH
Sbjct  155  IGVNEELYDPSEQIISNASCTTNCLAPFVKVLDEKFGIIKGTMTTTHSYTGDQRLLDASH  214

Query  537  rdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKT  358
            RDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQV KKT
Sbjct  215  RDLRRARAAALNIVPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVEKKT  274

Query  357  FAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAW  178
            FAEEVNAAFRE+A  ++ GIL+VCDEPLVSVDFRC+DVSSTVDSSLTMVMGDDMVKV+AW
Sbjct  275  FAEEVNAAFREAANGDMKGILAVCDEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVVAW  334

Query  177  YDNEWGYSQRVVDLADIVANQW  112
            YDNEWGYSQRVVDLA++VA +W
Sbjct  335  YDNEWGYSQRVVDLANLVAEKW  356



>emb|CAC80388.1| glyceraldehyde-3-phosphate dehydrogenase [Marchantia polymorpha]
Length=400

 Score =   279 bits (713),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 179/202 (89%), Positives = 192/202 (95%), Gaps = 0/202 (0%)
 Frame = -1

Query  717  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldash  538
            +GVN + Y P E IISNASCTTNCLAPFVKVLD+KFGIIKGTMTTTHSYTGDQRLLDASH
Sbjct  196  IGVNEELYDPSEQIISNASCTTNCLAPFVKVLDEKFGIIKGTMTTTHSYTGDQRLLDASH  255

Query  537  rdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKT  358
            RDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQV KKT
Sbjct  256  RDLRRARAAALNIVPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVEKKT  315

Query  357  FAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAW  178
            FAEEVNAAFRE+A  ++ GIL+VCDEPLVSVDFRC+DVSSTVDSSLTMVMGDDMVKV+AW
Sbjct  316  FAEEVNAAFREAANGDMKGILAVCDEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVVAW  375

Query  177  YDNEWGYSQRVVDLADIVANQW  112
            YDNEWGYSQRVVDLA++VA +W
Sbjct  376  YDNEWGYSQRVVDLANLVAEKW  397



>gb|ABD37959.1| glyceraldehyde-3-phosphate dehydrogenase subunit A, partial [Chlorokybus 
atmophyticus]
Length=347

 Score =   276 bits (707),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 177/202 (88%), Positives = 186/202 (92%), Gaps = 0/202 (0%)
 Frame = -1

Query  717  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldash  538
            VGVN   Y P  PIISNASCTTNCLAPFVK+L  KFGI+KGTMTTTHSYTGDQRLLDASH
Sbjct  133  VGVNDQDYDPSAPIISNASCTTNCLAPFVKILSDKFGIVKGTMTTTHSYTGDQRLLDASH  192

Query  537  rdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKT  358
            RDLRRARAAALNIVPTSTGAAKAVALVLP LKGKLNGIALRVPTPNVS+VDLV+Q  KKT
Sbjct  193  RDLRRARAAALNIVPTSTGAAKAVALVLPQLKGKLNGIALRVPTPNVSIVDLVIQTEKKT  252

Query  357  FAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAW  178
            FAEEVNAAFRE+A   L GIL+VCDEPLVSVDFRC+DVSST+DSSLTMVMGDDMVKV+AW
Sbjct  253  FAEEVNAAFREAANGPLKGILAVCDEPLVSVDFRCTDVSSTIDSSLTMVMGDDMVKVVAW  312

Query  177  YDNEWGYSQRVVDLADIVANQW  112
            YDNEWGYSQRVVDLADIVAN W
Sbjct  313  YDNEWGYSQRVVDLADIVANNW  334



>ref|XP_008663258.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
[Zea mays]
 gb|AFW58475.1| hypothetical protein ZEAMMB73_739238 [Zea mays]
Length=401

 Score =   273 bits (699),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 178/203 (88%), Positives = 187/203 (92%), Gaps = 0/203 (0%)
 Frame = -1

Query  717  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldash  538
            VGVNAD Y+PDEPIISNASCTTNC  PFVKVLDQKFGIIKGTMTTTH YT DQRLLDASH
Sbjct  199  VGVNADQYNPDEPIISNASCTTNCRVPFVKVLDQKFGIIKGTMTTTHFYTCDQRLLDASH  258

Query  537  rdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKT  358
            RDLRRARAAALNIVPTST AAKAVALVLP+LKGKLNGIAL VPTPNVSV+DLVVQVS+KT
Sbjct  259  RDLRRARAAALNIVPTSTSAAKAVALVLPNLKGKLNGIALWVPTPNVSVLDLVVQVSRKT  318

Query  357  FAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAW  178
             AEEVN AFR++AANEL GIL VCD PLVSVDFRCSD SST+D+SLTMVMGDDMVKVI+W
Sbjct  319  LAEEVNQAFRDAAANELQGILEVCDVPLVSVDFRCSDFSSTIDASLTMVMGDDMVKVISW  378

Query  177  YDNEWGYSQRVVDLADIVANQWK  109
            YD EWGYSQRVVDL DI ANQWK
Sbjct  379  YDKEWGYSQRVVDLDDICANQWK  401



>dbj|BAA94304.1| NADP-glyceraldehyde-3-phosphate dehydrogenase [Chlamydomonas 
sp. W80]
Length=369

 Score =   272 bits (696),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 173/202 (86%), Positives = 189/202 (94%), Gaps = 0/202 (0%)
 Frame = -1

Query  714  GVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashr  535
            GVNAD Y  + PIISNASCTTNC+APFVKVL++KFGIIKGTMTTTHSYTGDQRLLDASHR
Sbjct  168  GVNADDYKHEYPIISNASCTTNCMAPFVKVLEEKFGIIKGTMTTTHSYTGDQRLLDASHR  227

Query  534  dlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTF  355
            DLRRARAAA+NIVPTSTGAAKAVALVLPS+KGKLNGIALRVPTPNVS+VDLVVQV KKTF
Sbjct  228  DLRRARAAAMNIVPTSTGAAKAVALVLPSMKGKLNGIALRVPTPNVSIVDLVVQVEKKTF  287

Query  354  AEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWY  175
            AEEVNAAFRE+A     G+L+V DEPLVSVDFRCSDVSST+D+SLTMVMGDDMVKV+AWY
Sbjct  288  AEEVNAAFREAANGAQKGVLAVSDEPLVSVDFRCSDVSSTIDASLTMVMGDDMVKVVAWY  347

Query  174  DNEWGYSQRVVDLADIVANQWK  109
            DNEWGYSQRVVDLA+I A +W+
Sbjct  348  DNEWGYSQRVVDLAEITAQKWE  369



>gb|ADU04755.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Mesostigma 
viride]
 gb|ADU04760.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Mesostigma 
viride]
 gb|ADU04761.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Mesostigma 
viride]
 gb|ADU04762.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Mesostigma 
viride]
Length=284

 Score =   269 bits (688),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 174/201 (87%), Positives = 186/201 (93%), Gaps = 0/201 (0%)
 Frame = -1

Query  717  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldash  538
            VGVNAD Y   + I+SNASCTTNCLAPF KVLD KFGIIKGTMTTTHSYTGDQRLLDASH
Sbjct  84   VGVNADQYKSTDTIVSNASCTTNCLAPFAKVLDDKFGIIKGTMTTTHSYTGDQRLLDASH  143

Query  537  rdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKT  358
            RDLRRARAAALNIVPTSTGAAKAVALVLP LKGKLNGIALRVPTPNVSVVDLV+QV KKT
Sbjct  144  RDLRRARAAALNIVPTSTGAAKAVALVLPKLKGKLNGIALRVPTPNVSVVDLVIQVEKKT  203

Query  357  FAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAW  178
            FAEEVNAA RE+A   + G+L+VCDEPLVSVDF+CSDVSST+D+SLTMVMGDDMVKV+AW
Sbjct  204  FAEEVNAALREAANGPMKGVLAVCDEPLVSVDFKCSDVSSTIDASLTMVMGDDMVKVVAW  263

Query  177  YDNEWGYSQRVVDLADIVANQ  115
            YDNEWGYSQRVVDLA I+ANQ
Sbjct  264  YDNEWGYSQRVVDLAHIMANQ  284



>ref|XP_008663264.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
[Zea mays]
 gb|AFW58480.1| hypothetical protein ZEAMMB73_511551 [Zea mays]
Length=401

 Score =   271 bits (694),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 177/203 (87%), Positives = 187/203 (92%), Gaps = 0/203 (0%)
 Frame = -1

Query  717  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldash  538
            VGVNAD Y+PDEPII+NASCTTNC  PFVKVLDQKFGIIKGTMTTTH YT DQRLLDASH
Sbjct  199  VGVNADQYNPDEPIINNASCTTNCRVPFVKVLDQKFGIIKGTMTTTHFYTCDQRLLDASH  258

Query  537  rdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKT  358
            RDLRRARAAALNIVPTST AAKAVALVLP+LKGKLNGIAL VPTPNVSV+DLVVQVS+KT
Sbjct  259  RDLRRARAAALNIVPTSTSAAKAVALVLPNLKGKLNGIALWVPTPNVSVLDLVVQVSRKT  318

Query  357  FAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAW  178
             AEEVN AFR++AANEL GIL VCD PLVSVDFRCSD SST+D+SLTMVMGDDMVKVI+W
Sbjct  319  LAEEVNQAFRDAAANELQGILEVCDVPLVSVDFRCSDFSSTIDASLTMVMGDDMVKVISW  378

Query  177  YDNEWGYSQRVVDLADIVANQWK  109
            YD EWGYSQRVVDL DI ANQWK
Sbjct  379  YDKEWGYSQRVVDLDDICANQWK  401



>gb|AFW58485.1| hypothetical protein ZEAMMB73_956640 [Zea mays]
Length=372

 Score =   270 bits (689),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 176/203 (87%), Positives = 185/203 (91%), Gaps = 0/203 (0%)
 Frame = -1

Query  717  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldash  538
            VGVNAD Y+PDEPIISN SCTTNC  PFVKVLDQKFGIIKGTMTTTH YT DQRLLDASH
Sbjct  170  VGVNADQYNPDEPIISNTSCTTNCRVPFVKVLDQKFGIIKGTMTTTHFYTCDQRLLDASH  229

Query  537  rdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKT  358
            RDLRRARAAALNIVPTST AAKAV LVLP+LKGKLNGIAL VPTPNVSV+DLVVQVS+KT
Sbjct  230  RDLRRARAAALNIVPTSTSAAKAVVLVLPNLKGKLNGIALWVPTPNVSVLDLVVQVSRKT  289

Query  357  FAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAW  178
             AEEVN AFR++AANEL GIL VCD PLVSVDFRCSD SST+D+SLTMVMGDDMVKVI+W
Sbjct  290  LAEEVNQAFRDAAANELQGILEVCDVPLVSVDFRCSDFSSTIDASLTMVMGDDMVKVISW  349

Query  177  YDNEWGYSQRVVDLADIVANQWK  109
            YD EWGYSQRVVDL DI ANQWK
Sbjct  350  YDKEWGYSQRVVDLDDICANQWK  372



>gb|ADU04754.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Mesostigma 
viride]
Length=284

 Score =   267 bits (682),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 172/201 (86%), Positives = 186/201 (93%), Gaps = 0/201 (0%)
 Frame = -1

Query  717  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldash  538
            VGVNAD Y   + I+SNASCTTNCLAPF KVLD+KFGIIKGTMTTTHSYTGDQRLLDASH
Sbjct  84   VGVNADQYKSTDTIVSNASCTTNCLAPFAKVLDEKFGIIKGTMTTTHSYTGDQRLLDASH  143

Query  537  rdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKT  358
            RDLRRARAAALNIVPTSTGAAKAVALVLP LKGKLNGIALRVPTPNVSVVDLV+QV KKT
Sbjct  144  RDLRRARAAALNIVPTSTGAAKAVALVLPKLKGKLNGIALRVPTPNVSVVDLVIQVEKKT  203

Query  357  FAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAW  178
            FAEEVNAA RE+A   + G+L+VCDEPLVSVDF+CSDVSST+D+SLTMVMGDDMVKV+AW
Sbjct  204  FAEEVNAALREAANGPMKGVLAVCDEPLVSVDFKCSDVSSTIDASLTMVMGDDMVKVVAW  263

Query  177  YDNEWGYSQRVVDLADIVANQ  115
            YDNEWGYSQRVVDLA I+A +
Sbjct  264  YDNEWGYSQRVVDLAHIMAKE  284



>gb|ABK00056.1| chloroplast glyceraldehyde-3-phosphate dehydrogenase, partial 
[Mesostigma viride]
Length=310

 Score =   267 bits (683),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 172/201 (86%), Positives = 186/201 (93%), Gaps = 0/201 (0%)
 Frame = -1

Query  717  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldash  538
            VGVNAD Y   + I+SNASCTTNCLAPF KVLD+KFGIIKGTMTTTHSYTGDQRLLDASH
Sbjct  110  VGVNADQYKSTDTIVSNASCTTNCLAPFAKVLDEKFGIIKGTMTTTHSYTGDQRLLDASH  169

Query  537  rdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKT  358
            RDLRRARAAALNIVPTSTGAAKAVALVLP LKGKLNGIALRVPTPNVSVVDLV+QV KKT
Sbjct  170  RDLRRARAAALNIVPTSTGAAKAVALVLPKLKGKLNGIALRVPTPNVSVVDLVIQVEKKT  229

Query  357  FAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAW  178
            FAEEVNAA RE+A   + G+L+VCDEPLVSVDF+CSDVSST+D+SLTMVMGDDMVKV+AW
Sbjct  230  FAEEVNAALREAANGPMKGVLAVCDEPLVSVDFKCSDVSSTIDASLTMVMGDDMVKVVAW  289

Query  177  YDNEWGYSQRVVDLADIVANQ  115
            YDNEWGYSQRVVDLA I+A +
Sbjct  290  YDNEWGYSQRVVDLAHIMAKE  310



>ref|XP_008664191.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like, 
partial [Zea mays]
Length=420

 Score =   270 bits (690),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 176/203 (87%), Positives = 185/203 (91%), Gaps = 0/203 (0%)
 Frame = -1

Query  717  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldash  538
            VGVNAD Y+PDEPIISN SCTTNC  PFVKVLDQKFGIIKGTMTTTH YT DQRLLDASH
Sbjct  218  VGVNADQYNPDEPIISNTSCTTNCRVPFVKVLDQKFGIIKGTMTTTHFYTCDQRLLDASH  277

Query  537  rdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKT  358
            RDLRRARAAALNIVPTST AAKAV LVLP+LKGKLNGIAL VPTPNVSV+DLVVQVS+KT
Sbjct  278  RDLRRARAAALNIVPTSTSAAKAVVLVLPNLKGKLNGIALWVPTPNVSVLDLVVQVSRKT  337

Query  357  FAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAW  178
             AEEVN AFR++AANEL GIL VCD PLVSVDFRCSD SST+D+SLTMVMGDDMVKVI+W
Sbjct  338  LAEEVNQAFRDAAANELQGILEVCDVPLVSVDFRCSDFSSTIDASLTMVMGDDMVKVISW  397

Query  177  YDNEWGYSQRVVDLADIVANQWK  109
            YD EWGYSQRVVDL DI ANQWK
Sbjct  398  YDKEWGYSQRVVDLDDICANQWK  420



>gb|ABD37961.1| glyceraldehyde-3-phosphate dehydrogenase subunit A, partial [Mesostigma 
viride]
Length=333

 Score =   267 bits (683),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 173/203 (85%), Positives = 187/203 (92%), Gaps = 0/203 (0%)
 Frame = -1

Query  717  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldash  538
            VGVNAD Y   + I+SNASCTTNCLAPF KVLD+KFGIIKGTMTTTHSYTGDQRLLDASH
Sbjct  131  VGVNADQYKSTDTIVSNASCTTNCLAPFAKVLDEKFGIIKGTMTTTHSYTGDQRLLDASH  190

Query  537  rdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKT  358
            RDLRRARAAALNIVPTSTGAAKAVALVLP LKGKLNGIALRVPTPNVSVVDLV+QV KKT
Sbjct  191  RDLRRARAAALNIVPTSTGAAKAVALVLPKLKGKLNGIALRVPTPNVSVVDLVIQVEKKT  250

Query  357  FAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAW  178
            FAEEVNAA RE+A   + G+L+VCDEPLVSVDF+CSDVSST+D+SLTMVMGDDMVKV+AW
Sbjct  251  FAEEVNAALREAANGPMKGVLAVCDEPLVSVDFKCSDVSSTIDASLTMVMGDDMVKVVAW  310

Query  177  YDNEWGYSQRVVDLADIVANQWK  109
            YDNEWGYSQRVVDLA I+A + K
Sbjct  311  YDNEWGYSQRVVDLAHIMAKEMK  333



>emb|CAC80372.1| glyceraldehyde-3-phosphate dehydrogenase [Capsicum annuum]
Length=314

 Score =   266 bits (680),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 177/185 (96%), Positives = 182/185 (98%), Gaps = 0/185 (0%)
 Frame = -1

Query  717  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldash  538
            VGVNAD Y+PDEPIISNASCTTNCLAPFVK+LDQKFGIIKGTMTTTHSYTGDQRLLDASH
Sbjct  130  VGVNADLYNPDEPIISNASCTTNCLAPFVKILDQKFGIIKGTMTTTHSYTGDQRLLDASH  189

Query  537  rdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKT  358
            RDLRRARAAALNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVSKKT
Sbjct  190  RDLRRARAAALNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVSKKT  249

Query  357  FAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAW  178
            FAEEVNAAFRE+A  EL+GILSVCDEPLVSVDFRCSDVSSTVD+SLTMVMGDDMVKVIAW
Sbjct  250  FAEEVNAAFREAADKELNGILSVCDEPLVSVDFRCSDVSSTVDASLTMVMGDDMVKVIAW  309

Query  177  YDNEW  163
            YDNEW
Sbjct  310  YDNEW  314



>gb|ABD37956.1| glyceraldehyde-3-phosphate dehydrogenase subunit A [Spermatozopsis 
similis]
Length=263

 Score =   264 bits (674),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 164/202 (81%), Positives = 186/202 (92%), Gaps = 0/202 (0%)
 Frame = -1

Query  717  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldash  538
            +GVN   Y  + PI+SNASCTTNC+APF KVLD KFGI+KG MTTTHSYTGDQRLLDASH
Sbjct  61   IGVNDKDYKHEYPIVSNASCTTNCMAPFCKVLDAKFGIVKGVMTTTHSYTGDQRLLDASH  120

Query  537  rdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKT  358
            RDLRRARAAALNIVPT+TGAAKAVALVLP+LKGKLNG ALRVPTPNVS+VDLV+QV KKT
Sbjct  121  RDLRRARAAALNIVPTTTGAAKAVALVLPNLKGKLNGFALRVPTPNVSIVDLVIQVEKKT  180

Query  357  FAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAW  178
            FAEEVN AFRE+AA E+ G+L+VCDEPLVSVDFRC+DVS ++DSSLTMVMGDDMVK++AW
Sbjct  181  FAEEVNNAFREAAAGEMKGVLAVCDEPLVSVDFRCTDVSVSIDSSLTMVMGDDMVKIVAW  240

Query  177  YDNEWGYSQRVVDLADIVANQW  112
            YDNEWGYSQRVVDLA++ A++W
Sbjct  241  YDNEWGYSQRVVDLAELAASKW  262



>ref|XP_001771209.1| predicted protein [Physcomitrella patens]
 gb|EDQ63920.1| predicted protein [Physcomitrella patens]
Length=399

 Score =   268 bits (685),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 177/204 (87%), Positives = 189/204 (93%), Gaps = 1/204 (0%)
 Frame = -1

Query  717  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldash  538
            VGVN   Y   + IISNASCTTNCLAPFVKVLD+KFGIIKGTMTTTHSYTGDQRLLDASH
Sbjct  196  VGVNEKDYKHSDSIISNASCTTNCLAPFVKVLDEKFGIIKGTMTTTHSYTGDQRLLDASH  255

Query  537  rdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKT  358
            RDLRRARAAALNIVPTSTGAAKAVALVLP+LKGK+NGIALRVPTPNVSVVDLVVQV KKT
Sbjct  256  RDLRRARAAALNIVPTSTGAAKAVALVLPNLKGKINGIALRVPTPNVSVVDLVVQVEKKT  315

Query  357  FAEEVNAAFRES-AANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIA  181
            FAEEVN AFR++ A  EL G+L+VCDEPLVSVDFRC+DVSSTVDSSLTMVMGDDMVKV+A
Sbjct  316  FAEEVNQAFRDACATEELKGVLAVCDEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVVA  375

Query  180  WYDNEWGYSQRVVDLADIVANQWK  109
            WYDNEWGYSQRVVDLA IVA +W+
Sbjct  376  WYDNEWGYSQRVVDLAHIVAEKWQ  399



>ref|XP_001771246.1| predicted protein [Physcomitrella patens]
 gb|EDQ63957.1| predicted protein [Physcomitrella patens]
Length=406

 Score =   268 bits (685),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 177/204 (87%), Positives = 189/204 (93%), Gaps = 1/204 (0%)
 Frame = -1

Query  717  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldash  538
            VGVN   Y   + IISNASCTTNCLAPFVKVLD+KFGIIKGTMTTTHSYTGDQRLLDASH
Sbjct  203  VGVNEKDYKHSDSIISNASCTTNCLAPFVKVLDEKFGIIKGTMTTTHSYTGDQRLLDASH  262

Query  537  rdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKT  358
            RDLRRARAAALNIVPTSTGAAKAVALVLP+LKGK+NGIALRVPTPNVSVVDLVVQV KKT
Sbjct  263  RDLRRARAAALNIVPTSTGAAKAVALVLPNLKGKINGIALRVPTPNVSVVDLVVQVEKKT  322

Query  357  FAEEVNAAFRES-AANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIA  181
            FAEEVN AFR++ A  EL G+L+VCDEPLVSVDFRC+DVSSTVDSSLTMVMGDDMVKV+A
Sbjct  323  FAEEVNQAFRDACATEELKGVLAVCDEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVVA  382

Query  180  WYDNEWGYSQRVVDLADIVANQWK  109
            WYDNEWGYSQRVVDLA IVA +W+
Sbjct  383  WYDNEWGYSQRVVDLAHIVAEKWQ  406



>ref|XP_003548929.2| PREDICTED: LOW QUALITY PROTEIN: glyceraldehyde 3-phosphate dehydrogenase 
GAPA2, chloroplastic-like [Glycine max]
Length=346

 Score =   265 bits (676),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 169/204 (83%), Positives = 174/204 (85%), Gaps = 12/204 (6%)
 Frame = -1

Query  717  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldash  538
            VGVNAD Y+PDEPIISNASC      PFVKVLDQKFGIIKGTMTTTHSYTGDQR LD   
Sbjct  154  VGVNADIYNPDEPIISNASCX-----PFVKVLDQKFGIIKGTMTTTHSYTGDQRFLDXRA  208

Query  537  rdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKK-  361
            R          NIVPTSTGAAKAV LVLP+LKGKLNGIALRVPTPNVSVVDLVVQV+KK 
Sbjct  209  RAAAL------NIVPTSTGAAKAVVLVLPTLKGKLNGIALRVPTPNVSVVDLVVQVTKKX  262

Query  360  TFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIA  181
            TFAEEVNA FRES  NEL GILSVCDEPLVSVDFRCSDVSSTVDS LTMV+GDDMVKVIA
Sbjct  263  TFAEEVNAVFRESTENELKGILSVCDEPLVSVDFRCSDVSSTVDSXLTMVVGDDMVKVIA  322

Query  180  WYDNEWGYSQRVVDLADIVANQWK  109
            WYDNE GYSQRVVDLADIVA+ WK
Sbjct  323  WYDNEXGYSQRVVDLADIVAHNWK  346



>ref|XP_001779769.1| predicted protein [Physcomitrella patens]
 gb|EDQ55453.1| predicted protein [Physcomitrella patens]
Length=400

 Score =   266 bits (680),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 175/204 (86%), Positives = 189/204 (93%), Gaps = 1/204 (0%)
 Frame = -1

Query  717  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldash  538
            VGVN   Y   + IISNASCTTNCLAPFVKVLD+KFGIIKGTMTTTHSYTGDQRLLDASH
Sbjct  197  VGVNEQDYKHSDAIISNASCTTNCLAPFVKVLDEKFGIIKGTMTTTHSYTGDQRLLDASH  256

Query  537  rdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKT  358
            RDLRRARAAALNIVPTSTGAAKAVALVLP+LKGK+NGIALRVPTPNVSVVDLVVQV KKT
Sbjct  257  RDLRRARAAALNIVPTSTGAAKAVALVLPNLKGKINGIALRVPTPNVSVVDLVVQVEKKT  316

Query  357  FAEEVNAAFRESAANE-LDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIA  181
            FAEEVN AFR++   E L G+L+VCDEPLVSVDFRC+DVSSTVDSSLTMVMGDDMVKV+A
Sbjct  317  FAEEVNQAFRDACETEQLKGVLAVCDEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVVA  376

Query  180  WYDNEWGYSQRVVDLADIVANQWK  109
            WYDNEWGYSQRVVDLA++VA +W+
Sbjct  377  WYDNEWGYSQRVVDLANLVAEKWQ  400



>gb|ABD37962.1| glyceraldehyde-3-phosphate dehydrogenase subunit A1, partial 
[Physcomitrella patens]
Length=378

 Score =   265 bits (677),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 175/204 (86%), Positives = 189/204 (93%), Gaps = 1/204 (0%)
 Frame = -1

Query  717  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldash  538
            VGVN   Y   + IISNASCTTNCLAPFVKVLD+KFGIIKGTMTTTHSYTGDQRLLDASH
Sbjct  175  VGVNEQDYKHSDAIISNASCTTNCLAPFVKVLDEKFGIIKGTMTTTHSYTGDQRLLDASH  234

Query  537  rdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKT  358
            RDLRRARAAALNIVPTSTGAAKAVALVLP+LKGK+NGIALRVPTPNVSVVDLVVQV KKT
Sbjct  235  RDLRRARAAALNIVPTSTGAAKAVALVLPNLKGKINGIALRVPTPNVSVVDLVVQVEKKT  294

Query  357  FAEEVNAAFRESAANE-LDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIA  181
            FAEEVN AFR++   E L G+L+VCDEPLVSVDFRC+DVSSTVDSSLTMVMGDDMVKV+A
Sbjct  295  FAEEVNQAFRDACQTEQLKGVLAVCDEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVVA  354

Query  180  WYDNEWGYSQRVVDLADIVANQWK  109
            WYDNEWGYSQRVVDLA++VA +W+
Sbjct  355  WYDNEWGYSQRVVDLANLVAEKWE  378



>ref|XP_001753934.1| predicted protein [Physcomitrella patens]
 gb|EDQ81256.1| predicted protein [Physcomitrella patens]
Length=406

 Score =   266 bits (679),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 175/204 (86%), Positives = 189/204 (93%), Gaps = 1/204 (0%)
 Frame = -1

Query  717  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldash  538
            VGVN   Y   + IISNASCTTNCLAPFVKVLD+KFGIIKGTMTTTHSYTGDQRLLDASH
Sbjct  203  VGVNEQDYKHSDAIISNASCTTNCLAPFVKVLDEKFGIIKGTMTTTHSYTGDQRLLDASH  262

Query  537  rdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKT  358
            RDLRRARAAALNIVPTSTGAAKAVALVLP+LKGK+NGIALRVPTPNVSVVDLVVQV KKT
Sbjct  263  RDLRRARAAALNIVPTSTGAAKAVALVLPNLKGKINGIALRVPTPNVSVVDLVVQVEKKT  322

Query  357  FAEEVNAAFRESAANE-LDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIA  181
            FAEEVN AFR++   E L G+L+VCDEPLVSVDFRC+DVSSTVDSSLTMVMGDDMVKV+A
Sbjct  323  FAEEVNQAFRDACQTEQLKGVLAVCDEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVVA  382

Query  180  WYDNEWGYSQRVVDLADIVANQWK  109
            WYDNEWGYSQRVVDLA++VA +W+
Sbjct  383  WYDNEWGYSQRVVDLANLVAEKWE  406



>ref|XP_001779753.1| predicted protein [Physcomitrella patens]
 gb|EDQ55437.1| predicted protein [Physcomitrella patens]
Length=406

 Score =   265 bits (678),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 175/204 (86%), Positives = 189/204 (93%), Gaps = 1/204 (0%)
 Frame = -1

Query  717  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldash  538
            VGVN   Y   + IISNASCTTNCLAPFVKVLD+KFGIIKGTMTTTHSYTGDQRLLDASH
Sbjct  203  VGVNEQDYKHSDAIISNASCTTNCLAPFVKVLDEKFGIIKGTMTTTHSYTGDQRLLDASH  262

Query  537  rdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKT  358
            RDLRRARAAALNIVPTSTGAAKAVALVLP+LKGK+NGIALRVPTPNVSVVDLVVQV KKT
Sbjct  263  RDLRRARAAALNIVPTSTGAAKAVALVLPNLKGKINGIALRVPTPNVSVVDLVVQVEKKT  322

Query  357  FAEEVNAAFRESAANE-LDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIA  181
            FAEEVN AFR++   E L G+L+VCDEPLVSVDFRC+DVSSTVDSSLTMVMGDDMVKV+A
Sbjct  323  FAEEVNQAFRDACETEQLKGVLAVCDEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVVA  382

Query  180  WYDNEWGYSQRVVDLADIVANQWK  109
            WYDNEWGYSQRVVDLA++VA +W+
Sbjct  383  WYDNEWGYSQRVVDLANLVAEKWQ  406



>emb|CAC80373.1| glyceraldehyde-3-phosphate dehydrogenase [Capsicum annuum]
Length=312

 Score =   261 bits (667),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 177/183 (97%), Positives = 179/183 (98%), Gaps = 0/183 (0%)
 Frame = -1

Query  717  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldash  538
            VGVNAD YSPDEPIISNASCTTNCLAPFVKVLD+KFGIIKGTMTTTHSYTGDQRLLDASH
Sbjct  130  VGVNADLYSPDEPIISNASCTTNCLAPFVKVLDEKFGIIKGTMTTTHSYTGDQRLLDASH  189

Query  537  rdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKT  358
            RDLRRARAAALNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVSKKT
Sbjct  190  RDLRRARAAALNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVSKKT  249

Query  357  FAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAW  178
            FAEEVNAAFRESA  EL GILSVCDEPLVSVDFRCSDVSSTVD+SLTMVMGDDMVKVIAW
Sbjct  250  FAEEVNAAFRESADKELAGILSVCDEPLVSVDFRCSDVSSTVDASLTMVMGDDMVKVIAW  309

Query  177  YDN  169
            YDN
Sbjct  310  YDN  312



>gb|AHZ58488.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Syntrichia 
caninervis]
Length=377

 Score =   263 bits (672),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 174/204 (85%), Positives = 189/204 (93%), Gaps = 1/204 (0%)
 Frame = -1

Query  717  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldash  538
            +GVN   Y+  + IISNASCTTNCLAPFVKVLD+KFGIIKGTMTTTHSYTGDQRLLDASH
Sbjct  174  IGVNEQDYTHADKIISNASCTTNCLAPFVKVLDEKFGIIKGTMTTTHSYTGDQRLLDASH  233

Query  537  rdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKT  358
            RDLRRARAAALNIVPTSTGAAKAVALVLP LKGK+NGIALRVPTPNVSVVDLVVQV KKT
Sbjct  234  RDLRRARAAALNIVPTSTGAAKAVALVLPRLKGKINGIALRVPTPNVSVVDLVVQVEKKT  293

Query  357  FAEEVNAAFRESAAN-ELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIA  181
            FAEEVN AFR++    +L GIL+VCDEPLVSVDFRC+DVSSTVDSSLTMVMGDDMVKV+A
Sbjct  294  FAEEVNQAFRDACETPQLKGILAVCDEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVVA  353

Query  180  WYDNEWGYSQRVVDLADIVANQWK  109
            WYDNEWGYSQRVVDLA++VA +W+
Sbjct  354  WYDNEWGYSQRVVDLANLVAEKWQ  377



>dbj|BAN09110.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Artemisia 
indica]
Length=241

 Score =   258 bits (658),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 175/187 (94%), Positives = 180/187 (96%), Gaps = 0/187 (0%)
 Frame = -1

Query  717  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldash  538
            VGVNA+ Y+  E IISNASCTTNCLAPFVKV+DQKFGIIKGTMTTTHSYTGDQRLLDASH
Sbjct  55   VGVNAELYNHSEDIISNASCTTNCLAPFVKVIDQKFGIIKGTMTTTHSYTGDQRLLDASH  114

Query  537  rdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKT  358
            RDLRRARAAALNIVPTSTGAAKA ALVLPSLKGKLNGIALR PTPNVSVVDLVVQVSKKT
Sbjct  115  RDLRRARAAALNIVPTSTGAAKAAALVLPSLKGKLNGIALRAPTPNVSVVDLVVQVSKKT  174

Query  357  FAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAW  178
            FAEEVNAAFRE+A NEL+GILSVCDEPLVSVDFRCSDVSSTVDSSLTMVMGDDMVKVIAW
Sbjct  175  FAEEVNAAFREAADNELNGILSVCDEPLVSVDFRCSDVSSTVDSSLTMVMGDDMVKVIAW  234

Query  177  YDNEWGY  157
            YDNEWGY
Sbjct  235  YDNEWGY  241



>gb|ABA01125.1| chloroplast glyceraldehyde-3-phosphate dehydrogenase, partial 
[Chlamydomonas incerta]
Length=369

 Score =   261 bits (668),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 167/202 (83%), Positives = 184/202 (91%), Gaps = 0/202 (0%)
 Frame = -1

Query  717  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldash  538
            VGVN   Y  + PIISNASCTTNCLAPFVKVL+QKFGI+KGTMTTTHSYTGDQRLLDASH
Sbjct  166  VGVNDADYKHEYPIISNASCTTNCLAPFVKVLEQKFGIVKGTMTTTHSYTGDQRLLDASH  225

Query  537  rdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKT  358
            RDLRRARAAALNIVPT+TGAAKAVALVLPSLKGKLNGIALRVPTP VSVVDLVVQV KKT
Sbjct  226  RDLRRARAAALNIVPTTTGAAKAVALVLPSLKGKLNGIALRVPTPTVSVVDLVVQVEKKT  285

Query  357  FAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAW  178
            FAEEVNAAFRE+A   + G+L V D PLVS+DF+C+D S+++D+SLTMVMGDDMVKV+AW
Sbjct  286  FAEEVNAAFREAANGPMKGVLHVEDAPLVSIDFKCTDQSTSIDASLTMVMGDDMVKVVAW  345

Query  177  YDNEWGYSQRVVDLADIVANQW  112
            YDNEWGYSQRVVDLA+I A +W
Sbjct  346  YDNEWGYSQRVVDLAEITAKKW  367



>ref|XP_007510189.1| glyceraldehyde-3-phosphate dehydrogenase [Bathycoccus prasinos]
 emb|CCO18534.1| glyceraldehyde-3-phosphate dehydrogenase [Bathycoccus prasinos]
Length=379

 Score =   262 bits (669),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 165/203 (81%), Positives = 183/203 (90%), Gaps = 0/203 (0%)
 Frame = -1

Query  717  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldash  538
            +GVNAD Y   + IISNASCTTN LAPFVKVL+ KFG++KG MTTTHSYTGDQ++LDASH
Sbjct  177  LGVNADQYKNSDKIISNASCTTNGLAPFVKVLNDKFGLVKGLMTTTHSYTGDQKILDASH  236

Query  537  rdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKT  358
            RDLRRARAAALNIVPTSTGAAKAVALVLP LKGKLNGIALRVPTPNVSVVDLV+Q SKK 
Sbjct  237  RDLRRARAAALNIVPTSTGAAKAVALVLPELKGKLNGIALRVPTPNVSVVDLVIQTSKKV  296

Query  357  FAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAW  178
             AEEVN AFRESAA  L GILSVCDEPLVSVDFRC+D S+T+DS+LTMV+GDDM+KV+AW
Sbjct  297  TAEEVNNAFRESAAGPLKGILSVCDEPLVSVDFRCTDQSTTIDSALTMVIGDDMLKVVAW  356

Query  177  YDNEWGYSQRVVDLADIVANQWK  109
            YDNEWGYSQRVVDLA++ A  W+
Sbjct  357  YDNEWGYSQRVVDLAELTAANWE  379



>ref|XP_001689871.1| glyceraldehyde-3-phosphate dehydrogenase [Chlamydomonas reinhardtii]
 sp|P50362.1|G3PA_CHLRE RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic; 
AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase subunit A; Flags: Precursor [Chlamydomonas 
reinhardtii]
 gb|AAA86855.1| glyceraldehyde-3-phosphate dehydrogenase [Chlamydomonas reinhardtii]
 gb|EDP09609.1| glyceraldehyde-3-phosphate dehydrogenase [Chlamydomonas reinhardtii]
Length=374

 Score =   261 bits (668),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 165/202 (82%), Positives = 184/202 (91%), Gaps = 0/202 (0%)
 Frame = -1

Query  717  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldash  538
            VGVN   Y  + PIISNASCTTNCLAPFVKVL+QKFGI+KGTMTTTHSYTGDQRLLDASH
Sbjct  171  VGVNEGDYKHEYPIISNASCTTNCLAPFVKVLEQKFGIVKGTMTTTHSYTGDQRLLDASH  230

Query  537  rdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKT  358
            RDLRRARAAALNIVPT+TGAAKAV+LVLPSLKGKLNGIALRVPTP VSVVDLVVQV KKT
Sbjct  231  RDLRRARAAALNIVPTTTGAAKAVSLVLPSLKGKLNGIALRVPTPTVSVVDLVVQVEKKT  290

Query  357  FAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAW  178
            FAEEVNAAFRE+A   + G+L V D PLVS+DF+C+D S+++D+SLTMVMGDDMVKV+AW
Sbjct  291  FAEEVNAAFREAANGPMKGVLHVEDAPLVSIDFKCTDQSTSIDASLTMVMGDDMVKVVAW  350

Query  177  YDNEWGYSQRVVDLADIVANQW  112
            YDNEWGYSQRVVDLA++ A +W
Sbjct  351  YDNEWGYSQRVVDLAEVTAKKW  372



>ref|XP_002955293.1| hypothetical protein VOLCADRAFT_76662 [Volvox carteri f. nagariensis]
 gb|EFJ43593.1| hypothetical protein VOLCADRAFT_76662 [Volvox carteri f. nagariensis]
Length=374

 Score =   261 bits (667),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 166/202 (82%), Positives = 183/202 (91%), Gaps = 0/202 (0%)
 Frame = -1

Query  717  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldash  538
            VGVN   Y  + PIISNASCTTNCLAPFVKVL +KFGI+KGTMTTTHSYTGDQRLLDASH
Sbjct  171  VGVNEADYKHEYPIISNASCTTNCLAPFVKVLQEKFGIVKGTMTTTHSYTGDQRLLDASH  230

Query  537  rdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKT  358
            RDLRRARAAALNIVPT+TGAAKAVALVLP LKGKLNGIALRVPTP VSVVDLVVQV KKT
Sbjct  231  RDLRRARAAALNIVPTTTGAAKAVALVLPQLKGKLNGIALRVPTPTVSVVDLVVQVEKKT  290

Query  357  FAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAW  178
            FAEEVNAAFRE+AA  + G+L V D PLVS+DF+C+D S+++DSSLTMVMGDDMVKV+AW
Sbjct  291  FAEEVNAAFREAAAGPMKGVLHVEDAPLVSIDFKCTDQSTSIDSSLTMVMGDDMVKVVAW  350

Query  177  YDNEWGYSQRVVDLADIVANQW  112
            YDNEWGYSQRVVDLA++ A +W
Sbjct  351  YDNEWGYSQRVVDLAEVTAQKW  372



>gb|ACX37507.1| chloroplast glyceraldehyde 3-phosphate dehydrogenase [Botryococcus 
braunii]
Length=411

 Score =   262 bits (669),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 171/202 (85%), Positives = 184/202 (91%), Gaps = 0/202 (0%)
 Frame = -1

Query  717  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldash  538
            VGVNAD Y   + IISNASCTTNCLAPFVKVLD+K GI+KGT+TTTHSYTGDQRLLDASH
Sbjct  209  VGVNADQYKHSDNIISNASCTTNCLAPFVKVLDEKLGIVKGTVTTTHSYTGDQRLLDASH  268

Query  537  rdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKT  358
            RDLRRARAAALNIVPT+TGAAKAVALVLP+LKGKLNGIALRVPTPNVSVVDLV+QV KKT
Sbjct  269  RDLRRARAAALNIVPTTTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVIQVEKKT  328

Query  357  FAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAW  178
            FAEEVN AFRE+A   + GIL V DEPLVS DF CSD SST+DSSLTMVMGDDMVKV+AW
Sbjct  329  FAEEVNEAFREAANGPMKGILVVSDEPLVSKDFACSDQSSTIDSSLTMVMGDDMVKVVAW  388

Query  177  YDNEWGYSQRVVDLADIVANQW  112
            YDNEWGYSQRVVDLA+IVA +W
Sbjct  389  YDNEWGYSQRVVDLAEIVAKKW  410



>gb|ACA35006.1| glyceraldehyde-3-phosphate dehydrogenase [Dunaliella salina]
Length=376

 Score =   260 bits (664),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 163/202 (81%), Positives = 181/202 (90%), Gaps = 0/202 (0%)
 Frame = -1

Query  717  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldash  538
            VGVN D Y  D PI+SNASCTTNCLAPFVKVL +KFG++KGTMTTTHSYTGDQRLLDASH
Sbjct  173  VGVNCDGYKHDYPIVSNASCTTNCLAPFVKVLHEKFGVVKGTMTTTHSYTGDQRLLDASH  232

Query  537  rdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKT  358
            RDLRRARAAALNIVPT+TGAAKAVALVLP LKGKLNG+ALRVPTPNVS+VDLVVQV KKT
Sbjct  233  RDLRRARAAALNIVPTTTGAAKAVALVLPELKGKLNGVALRVPTPNVSIVDLVVQVEKKT  292

Query  357  FAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAW  178
            FAEEVN AFRE+AA  +  +L+V DEPLVS DF+  D S+ +DS+LTMVMGDDMVKV+AW
Sbjct  293  FAEEVNNAFREAAAGPMKNVLAVADEPLVSADFKGMDQSTAIDSALTMVMGDDMVKVVAW  352

Query  177  YDNEWGYSQRVVDLADIVANQW  112
            YDNEWGYSQRVVDLA+I A +W
Sbjct  353  YDNEWGYSQRVVDLAEITAQRW  374



>gb|ABD37963.1| glyceraldehyde-3-phosphate dehydrogenase subunit A2 [Physcomitrella 
patens]
Length=323

 Score =   258 bits (658),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 172/204 (84%), Positives = 189/204 (93%), Gaps = 1/204 (0%)
 Frame = -1

Query  717  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldash  538
            VGVN   Y   + IISNASCTTNCLAPFVKVLD+KFGIIKGTMTTTHSYTGDQRLLDASH
Sbjct  120  VGVNEQDYKHSDTIISNASCTTNCLAPFVKVLDEKFGIIKGTMTTTHSYTGDQRLLDASH  179

Query  537  rdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKT  358
            RDLRRARAAALNIVPTSTGAAKAVALVLP+LKGK+NGIALRVPTPNVSVVDLVVQV KKT
Sbjct  180  RDLRRARAAALNIVPTSTGAAKAVALVLPNLKGKINGIALRVPTPNVSVVDLVVQVEKKT  239

Query  357  FAEEVNAAFRESA-ANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIA  181
             AEEVN AFR++   ++L G+L+VCDEPLVSVDFRC+DVSSTVDSSLTMVMG+DMVKV+A
Sbjct  240  SAEEVNQAFRDACNTDQLKGVLAVCDEPLVSVDFRCTDVSSTVDSSLTMVMGEDMVKVVA  299

Query  180  WYDNEWGYSQRVVDLADIVANQWK  109
            WYDNEWGYSQRVVDLA++VA +W+
Sbjct  300  WYDNEWGYSQRVVDLANLVAEKWQ  323



>ref|XP_001766703.1| predicted protein [Physcomitrella patens]
 gb|EDQ68556.1| predicted protein [Physcomitrella patens]
Length=376

 Score =   259 bits (661),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 172/204 (84%), Positives = 189/204 (93%), Gaps = 1/204 (0%)
 Frame = -1

Query  717  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldash  538
            VGVN   Y   + IISNASCTTNCLAPFVKVLD+KFGIIKGTMTTTHSYTGDQRLLDASH
Sbjct  173  VGVNEQDYKHSDTIISNASCTTNCLAPFVKVLDEKFGIIKGTMTTTHSYTGDQRLLDASH  232

Query  537  rdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKT  358
            RDLRRARAAALNIVPTSTGAAKAVALVLP+LKGK+NGIALRVPTPNVSVVDLVVQV KKT
Sbjct  233  RDLRRARAAALNIVPTSTGAAKAVALVLPNLKGKINGIALRVPTPNVSVVDLVVQVEKKT  292

Query  357  FAEEVNAAFRESA-ANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIA  181
             AEEVN AFR++   ++L G+L+VCDEPLVSVDFRC+DVSSTVDSSLTMVMG+DMVKV+A
Sbjct  293  SAEEVNQAFRDACNTDQLKGVLAVCDEPLVSVDFRCTDVSSTVDSSLTMVMGEDMVKVVA  352

Query  180  WYDNEWGYSQRVVDLADIVANQWK  109
            WYDNEWGYSQRVVDLA++VA +W+
Sbjct  353  WYDNEWGYSQRVVDLANLVAEKWQ  376



>gb|EMS61784.1| Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic [Triticum 
urartu]
Length=365

 Score =   258 bits (658),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 158/202 (78%), Positives = 167/202 (83%), Gaps = 27/202 (13%)
 Frame = -1

Query  714  GVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashr  535
            GVNAD Y+  + IISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRL      
Sbjct  191  GVNADLYTHADTIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRL------  244

Query  534  dlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTF  355
                                 AVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKT 
Sbjct  245  ---------------------AVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTL  283

Query  354  AEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWY  175
            AEEVN AFR++AANEL GIL VCDEPLVSVDFRCSDVSST+D+SL+MVMGDDMVKVIAWY
Sbjct  284  AEEVNQAFRDAAANELKGILDVCDEPLVSVDFRCSDVSSTIDASLSMVMGDDMVKVIAWY  343

Query  174  DNEWGYSQRVVDLADIVANQWK  109
            DNEWGYSQRVVDLADIVA+QWK
Sbjct  344  DNEWGYSQRVVDLADIVADQWK  365



>ref|XP_011399143.1| Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic [Auxenochlorella 
protothecoides]
 gb|KFM26247.1| Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic [Auxenochlorella 
protothecoides]
Length=412

 Score =   258 bits (658),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 164/203 (81%), Positives = 185/203 (91%), Gaps = 0/203 (0%)
 Frame = -1

Query  717  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldash  538
            +GVNAD YS  + IISNASCTTNCLAPFVKVL+ +FGI+KGTMTTTHSYTGDQRLLDASH
Sbjct  210  MGVNADQYSNSDDIISNASCTTNCLAPFVKVLNDRFGIVKGTMTTTHSYTGDQRLLDASH  269

Query  537  rdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKT  358
            RDLRRARAAALNIVPT+TGAAKAVALVLP LKGKLNG+ALRVPTP VSVVDLV+Q  KKT
Sbjct  270  RDLRRARAAALNIVPTTTGAAKAVALVLPQLKGKLNGVALRVPTPTVSVVDLVIQTEKKT  329

Query  357  FAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAW  178
            F EEVN+AFRE++   L GIL+V DEPLVS D+R +DVSST+D++LTMVMGDDMVKVIAW
Sbjct  330  FTEEVNSAFREASEGYLKGILAVSDEPLVSCDYRMTDVSSTIDAALTMVMGDDMVKVIAW  389

Query  177  YDNEWGYSQRVVDLADIVANQWK  109
            YDNEWGYSQRVVDLA++VA +W+
Sbjct  390  YDNEWGYSQRVVDLAELVAQKWE  412



>emb|CDP18560.1| unnamed protein product [Coffea canephora]
Length=386

 Score =   256 bits (653),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 176/203 (87%), Positives = 183/203 (90%), Gaps = 13/203 (6%)
 Frame = -1

Query  717  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldash  538
            +GVNA+ Y+PDE IISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH
Sbjct  197  IGVNAETYNPDETIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASH  256

Query  537  rdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKT  358
            RDLRRARAAALNIVPTSTGAAKAVALVLP LKGKLNGIALRVPTPNVSVVDLVVQV KKT
Sbjct  257  RDLRRARAAALNIVPTSTGAAKAVALVLPKLKGKLNGIALRVPTPNVSVVDLVVQVEKKT  316

Query  357  FAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAW  178
            FAEEVNAAFRE+A  EL+GILSVCDEPLVSVDFRC+DVSSTVD+SLTMVMGDDMVK    
Sbjct  317  FAEEVNAAFREAADKELNGILSVCDEPLVSVDFRCTDVSSTVDASLTMVMGDDMVK----  372

Query  177  YDNEWGYSQRVVDLADIVANQWK  109
                     RVVDLADIVAN WK
Sbjct  373  ---------RVVDLADIVANNWK  386



>ref|XP_005644071.1| glyceraldehyde-3-phosphate dehydrogenase [Coccomyxa subellipsoidea 
C-169]
 gb|EIE19527.1| glyceraldehyde-3-phosphate dehydrogenase [Coccomyxa subellipsoidea 
C-169]
Length=393

 Score =   255 bits (652),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 167/199 (84%), Positives = 181/199 (91%), Gaps = 0/199 (0%)
 Frame = -1

Query  717  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldash  538
            +GVN D + P  PIISNASCTTNCLAPF KVL +KFGI+KGTMTTTHSYTGDQRLLDASH
Sbjct  192  IGVNDDTFDPSAPIISNASCTTNCLAPFAKVLHEKFGIVKGTMTTTHSYTGDQRLLDASH  251

Query  537  rdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKT  358
            RDLRRARAAALNIVPT+TGAAKAVALVLP LKGKLNGIALRVPTPNVSVVDLV+QV KKT
Sbjct  252  RDLRRARAAALNIVPTTTGAAKAVALVLPELKGKLNGIALRVPTPNVSVVDLVIQVEKKT  311

Query  357  FAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAW  178
             AEEVN AFR +AANEL GIL+V D PLVS DF  +DVS+T+DSSLTMVMGDDMVKV+AW
Sbjct  312  LAEEVNEAFRNAAANELKGILAVSDVPLVSRDFALTDVSTTIDSSLTMVMGDDMVKVVAW  371

Query  177  YDNEWGYSQRVVDLADIVA  121
            YDNEWGYSQRVVDLA++VA
Sbjct  372  YDNEWGYSQRVVDLAELVA  390



>gb|ABD37954.1| glyceraldehyde-3-phosphate dehydrogenase subunit A [Cyanophora 
paradoxa]
Length=412

 Score =   256 bits (654),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 168/201 (84%), Positives = 184/201 (92%), Gaps = 1/201 (0%)
 Frame = -1

Query  717  VGVNADAYSPD-EPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldas  541
            VGVN   Y+P  + I+SNASCTTNCLAPFVKVLD+KF IIKGTMTTTHSYTGDQRLLDAS
Sbjct  210  VGVNHKDYNPSTDHIVSNASCTTNCLAPFVKVLDEKFKIIKGTMTTTHSYTGDQRLLDAS  269

Query  540  hrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKK  361
            HRDLRRARAAA+NIVPTSTGAAKAVALVLP+LKGKLNG+ALRVPTPNVS+VDLVVQV KK
Sbjct  270  HRDLRRARAAAMNIVPTSTGAAKAVALVLPNLKGKLNGLALRVPTPNVSIVDLVVQVEKK  329

Query  360  TFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIA  181
            TFA+EVNAA RE+A  +L G+L V DEPLVS DFRC+D SST+D+SLTMVMGDDMVKVIA
Sbjct  330  TFADEVNAALREAANTDLKGVLVVSDEPLVSCDFRCTDQSSTIDASLTMVMGDDMVKVIA  389

Query  180  WYDNEWGYSQRVVDLADIVAN  118
            WYDNEWGYSQRVVDLA+IVA 
Sbjct  390  WYDNEWGYSQRVVDLAEIVAQ  410



>gb|ABC00187.1| chloroplast glyceraldehyde-3-phosphate dehydrogenase [Dunaliella 
viridis]
 gb|ABC00188.1| chloroplast glyceraldehyde-3-phosphate dehydrogenase [Dunaliella 
viridis]
Length=376

 Score =   254 bits (650),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 162/202 (80%), Positives = 180/202 (89%), Gaps = 0/202 (0%)
 Frame = -1

Query  717  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldash  538
            VGVN D Y+   PIISNASCTTNCLAPFVKVL +KF I+KGTMTTTHSYTGDQRLLDASH
Sbjct  173  VGVNCDGYNHSYPIISNASCTTNCLAPFVKVLHEKFRIVKGTMTTTHSYTGDQRLLDASH  232

Query  537  rdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKT  358
            RDLRRARAAALNIVPT+TGAAKAVALVLP LKGKLNG+ALRVPTPNVS+VDLVVQV KKT
Sbjct  233  RDLRRARAAALNIVPTTTGAAKAVALVLPDLKGKLNGVALRVPTPNVSIVDLVVQVEKKT  292

Query  357  FAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAW  178
            FAEEVN AFRE+AA  +  +L+V DEPLVS DF+  D S+ +DS+LTMVMGDDMVKV+AW
Sbjct  293  FAEEVNNAFREAAAGPMSNVLAVADEPLVSADFKGMDQSTAIDSALTMVMGDDMVKVVAW  352

Query  177  YDNEWGYSQRVVDLADIVANQW  112
            YDNEWGYSQRVVDLA++ A +W
Sbjct  353  YDNEWGYSQRVVDLAELTAQRW  374



>ref|XP_001420043.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO98336.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=341

 Score =   253 bits (646),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 162/203 (80%), Positives = 183/203 (90%), Gaps = 0/203 (0%)
 Frame = -1

Query  717  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldash  538
            +GVNAD Y   + I+SNASCTTN LAPFVKVLD +FGI+KG MTTTHSYTGDQR+LDASH
Sbjct  139  LGVNADQYKNTDKIVSNASCTTNGLAPFVKVLDDRFGIVKGLMTTTHSYTGDQRILDASH  198

Query  537  rdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKT  358
            RDLRRARAAALNIVPTSTGAAKAVALVLP LKGKLNGIALRVPTPNVSVVDLV+Q SKK 
Sbjct  199  RDLRRARAAALNIVPTSTGAAKAVALVLPQLKGKLNGIALRVPTPNVSVVDLVIQTSKKV  258

Query  357  FAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAW  178
             A+EVNAAFRE AA +L GIL+V DEPLVS DF+CSDVS+++D++LTMVMGDDM+KV+AW
Sbjct  259  TADEVNAAFREEAAGKLKGILAVADEPLVSCDFKCSDVSTSIDAALTMVMGDDMLKVVAW  318

Query  177  YDNEWGYSQRVVDLADIVANQWK  109
            YDNEWGYSQRVVDLA++ A  W+
Sbjct  319  YDNEWGYSQRVVDLAELCAANWE  341



>ref|XP_002503470.1| glyceraldehyde-3-phosphate dehydrogenase a chloroplast precursor 
[Micromonas sp. RCC299]
 gb|ACO64728.1| glyceraldehyde-3-phosphate dehydrogenase a chloroplast precursor 
[Micromonas sp. RCC299]
Length=377

 Score =   254 bits (648),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 159/202 (79%), Positives = 181/202 (90%), Gaps = 0/202 (0%)
 Frame = -1

Query  717  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldash  538
            +GVNAD Y+  + IISNASCTTN LAPF KVLD KFGI+KG MTTTHSYTGDQR+LDASH
Sbjct  174  MGVNADQYTHADKIISNASCTTNGLAPFAKVLDDKFGIVKGLMTTTHSYTGDQRILDASH  233

Query  537  rdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKT  358
            RDLRRARAAALNIVPTSTGAAKAVALVLP LKGKLNGIALRVPTPNVSVVD+ +Q  KK 
Sbjct  234  RDLRRARAAALNIVPTSTGAAKAVALVLPQLKGKLNGIALRVPTPNVSVVDMCIQTEKKC  293

Query  357  FAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAW  178
             AEE+NAAFRE+A   + GIL+V DEPLVS+DFRCSDVS+T+D++LTMVMGDD++KV+AW
Sbjct  294  TAEEINAAFREAAEGPMKGILAVADEPLVSIDFRCSDVSTTIDAALTMVMGDDLIKVVAW  353

Query  177  YDNEWGYSQRVVDLADIVANQW  112
            YDNEWGYSQRVVDLA++ A +W
Sbjct  354  YDNEWGYSQRVVDLAELTATKW  375



>gb|ABG85190.1| chloroplast glyceraldehyde-3-phosphate dehydrogenase subunit 
A [Ostreococcus 'lucimarinus']
Length=380

 Score =   254 bits (648),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 162/203 (80%), Positives = 183/203 (90%), Gaps = 0/203 (0%)
 Frame = -1

Query  717  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldash  538
            +GVNAD Y   + I+SNASCTTN LAPFVKVLD +FGI+KG MTTTHSYTGDQR+LDASH
Sbjct  178  LGVNADQYKNTDKIVSNASCTTNGLAPFVKVLDDRFGIVKGLMTTTHSYTGDQRILDASH  237

Query  537  rdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKT  358
            RDLRRARAAALNIVPTSTGAAKAVALVLP LKGKLNGIALRVPTPNVSVVDLV+Q SKK 
Sbjct  238  RDLRRARAAALNIVPTSTGAAKAVALVLPQLKGKLNGIALRVPTPNVSVVDLVIQTSKKV  297

Query  357  FAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAW  178
             A+EVNAAFRE AA +L GIL+V DEPLVS DF+CSDVS+++D++LTMVMGDDM+KV+AW
Sbjct  298  TADEVNAAFREEAAGKLKGILAVADEPLVSCDFKCSDVSTSIDAALTMVMGDDMLKVVAW  357

Query  177  YDNEWGYSQRVVDLADIVANQWK  109
            YDNEWGYSQRVVDLA++ A  W+
Sbjct  358  YDNEWGYSQRVVDLAELCAANWE  380



>gb|ABD37953.1| glyceraldehyde-3-phosphate dehydrogenase subunit A, partial [Chlorella 
sp. JP-2005]
Length=316

 Score =   251 bits (641),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 167/203 (82%), Positives = 179/203 (88%), Gaps = 0/203 (0%)
 Frame = -1

Query  717  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldash  538
            VGVN   Y   + IISNASCTTNCLAPFVKVLD+KFGI+KGTMTTTHSYTGDQRLLDASH
Sbjct  114  VGVNEQDYKHSDAIISNASCTTNCLAPFVKVLDEKFGIVKGTMTTTHSYTGDQRLLDASH  173

Query  537  rdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKT  358
            RDLRRARAAALNIVPT+TGAAKAVALVLP LKGKLNG+ALRVPTP VSVVDLVVQV KKT
Sbjct  174  RDLRRARAAALNIVPTTTGAAKAVALVLPKLKGKLNGVALRVPTPTVSVVDLVVQVEKKT  233

Query  357  FAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAW  178
            FAEEVN AFRE+A   L GIL V DEPLVS DF+ ++VSST+DSSLTMVMGDDMVKV+AW
Sbjct  234  FAEEVNEAFREAANGPLKGILGVSDEPLVSCDFKMTNVSSTIDSSLTMVMGDDMVKVVAW  293

Query  177  YDNEWGYSQRVVDLADIVANQWK  109
            YDNEWGYSQRVVDLA   A  W+
Sbjct  294  YDNEWGYSQRVVDLAAYTAKHWE  316



>ref|XP_003081785.1| NADP-glyceraldehyde-3-phosphate dehydrogenase (IC), partial [Ostreococcus 
tauri]
Length=378

 Score =   252 bits (644),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 161/203 (79%), Positives = 181/203 (89%), Gaps = 0/203 (0%)
 Frame = -1

Query  717  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldash  538
            +GVNAD Y   + IISNASCTTN LAPFVKV+D+KFG++KG MTTTHSYTGDQR+LDASH
Sbjct  176  LGVNADGYKHSDKIISNASCTTNGLAPFVKVIDEKFGLVKGLMTTTHSYTGDQRILDASH  235

Query  537  rdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKT  358
            RDLRRARAA LNIVPTSTGAAKAVALVLP LKGKLNGIALRVPTPNVSVVDLVVQ SKK 
Sbjct  236  RDLRRARAACLNIVPTSTGAAKAVALVLPQLKGKLNGIALRVPTPNVSVVDLVVQTSKKC  295

Query  357  FAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAW  178
             A+EVNAAFRE+A   L GIL+V DEPLVS DFRC+DVS T+D++LTMVMGDDM+KV++W
Sbjct  296  TADEVNAAFREAANGPLKGILAVADEPLVSCDFRCTDVSCTIDAALTMVMGDDMLKVVSW  355

Query  177  YDNEWGYSQRVVDLADIVANQWK  109
            YDNEWGYSQRVVDLA++ A  W+
Sbjct  356  YDNEWGYSQRVVDLAELCAANWE  378



>gb|ABG85189.1| chloroplast glyceraldehyde-3-phosphate dehydrogenase subunit 
A [Ostreococcus tauri]
 emb|CEF99493.1| Glyceraldehyde 3-phosphate dehydrogenase, NAD(P) binding domain 
[Ostreococcus tauri]
Length=380

 Score =   252 bits (644),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 161/203 (79%), Positives = 181/203 (89%), Gaps = 0/203 (0%)
 Frame = -1

Query  717  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldash  538
            +GVNAD Y   + IISNASCTTN LAPFVKV+D+KFG++KG MTTTHSYTGDQR+LDASH
Sbjct  178  LGVNADGYKHSDKIISNASCTTNGLAPFVKVIDEKFGLVKGLMTTTHSYTGDQRILDASH  237

Query  537  rdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKT  358
            RDLRRARAA LNIVPTSTGAAKAVALVLP LKGKLNGIALRVPTPNVSVVDLVVQ SKK 
Sbjct  238  RDLRRARAACLNIVPTSTGAAKAVALVLPQLKGKLNGIALRVPTPNVSVVDLVVQTSKKC  297

Query  357  FAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAW  178
             A+EVNAAFRE+A   L GIL+V DEPLVS DFRC+DVS T+D++LTMVMGDDM+KV++W
Sbjct  298  TADEVNAAFREAANGPLKGILAVADEPLVSCDFRCTDVSCTIDAALTMVMGDDMLKVVSW  357

Query  177  YDNEWGYSQRVVDLADIVANQWK  109
            YDNEWGYSQRVVDLA++ A  W+
Sbjct  358  YDNEWGYSQRVVDLAELCAANWE  380



>emb|CAC80392.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Spirogyra 
sp.]
Length=318

 Score =   250 bits (638),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 164/187 (88%), Positives = 176/187 (94%), Gaps = 0/187 (0%)
 Frame = -1

Query  717  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldash  538
            VGVNAD Y   EPIISNASCTTNCLAPFVK+L++KFGIIKGTMTTTHSYTGDQRLLDASH
Sbjct  132  VGVNADKYVHSEPIISNASCTTNCLAPFVKILEEKFGIIKGTMTTTHSYTGDQRLLDASH  191

Query  537  rdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKT  358
            RDLRRARAAALNIVPTSTGAAKAV+LVLPSLKGKLNGIALRVPTPNVSVVDLV+Q  KKT
Sbjct  192  RDLRRARAAALNIVPTSTGAAKAVSLVLPSLKGKLNGIALRVPTPNVSVVDLVIQTEKKT  251

Query  357  FAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAW  178
            FAEEVNAAFRE+AA  + G+L+VCDEPLVS+DFRCSDVS T+DSSLTMVMGDDMVKV+AW
Sbjct  252  FAEEVNAAFREAAAGPMKGVLAVCDEPLVSIDFRCSDVSCTIDSSLTMVMGDDMVKVVAW  311

Query  177  YDNEWGY  157
            YDNE GY
Sbjct  312  YDNELGY  318



>ref|XP_003055659.1| hypothetical protein MICPUCDRAFT_49403 [Micromonas pusilla CCMP1545]
 gb|EEH60911.1| hypothetical protein MICPUCDRAFT_49403 [Micromonas pusilla CCMP1545]
Length=380

 Score =   251 bits (642),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 160/202 (79%), Positives = 182/202 (90%), Gaps = 0/202 (0%)
 Frame = -1

Query  717  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldash  538
            +GVNAD Y   + IISNASCTTN LAPF KVLD  FGIIKG MTTTHSYTGDQR+LDASH
Sbjct  176  MGVNADDYKDSDKIISNASCTTNGLAPFAKVLDDSFGIIKGLMTTTHSYTGDQRILDASH  235

Query  537  rdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKT  358
            RDLRRARAAALNIVPTSTGAAKAVALVLP LKGKLNGIALRVPTPNVSVVD+V+QV KK 
Sbjct  236  RDLRRARAAALNIVPTSTGAAKAVALVLPQLKGKLNGIALRVPTPNVSVVDMVIQVEKKC  295

Query  357  FAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAW  178
             AE+VNAAFRE+AA  + GIL V DEPLVS+DFRC+DVS+++DS+LTMVMG+D+VK++AW
Sbjct  296  TAEDVNAAFREAAAGPMKGILQVVDEPLVSIDFRCTDVSTSIDSALTMVMGEDLVKIVAW  355

Query  177  YDNEWGYSQRVVDLADIVANQW  112
            YDNEWGYSQRVVDLA++ A++W
Sbjct  356  YDNEWGYSQRVVDLAELTASKW  377



>gb|ABD37957.1| glyceraldehyde-3-phosphate dehydrogenase subunit A [Cladophora 
rupestris]
Length=376

 Score =   251 bits (640),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 163/203 (80%), Positives = 185/203 (91%), Gaps = 0/203 (0%)
 Frame = -1

Query  717  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldash  538
            +GVN+D Y  + PIISNASCTTNCLAPFVKV+ +KFG++KGTMTTTHSYTGDQRLLDASH
Sbjct  174  MGVNSDDYKHEYPIISNASCTTNCLAPFVKVIVEKFGVVKGTMTTTHSYTGDQRLLDASH  233

Query  537  rdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKT  358
            RDLRRARAAALNIVPT+TGAAKAVALVLP LKGKLNGIALRVPTPNVSVVDLVVQV KKT
Sbjct  234  RDLRRARAAALNIVPTTTGAAKAVALVLPQLKGKLNGIALRVPTPNVSVVDLVVQVEKKT  293

Query  357  FAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAW  178
             AEEVN AFR++AA  L G+L V D PLVS+DF+ SDVS+T+DS+LTMVMGDDMVKV+AW
Sbjct  294  LAEEVNQAFRDAAAGPLKGVLGVADIPLVSMDFKKSDVSTTIDSALTMVMGDDMVKVVAW  353

Query  177  YDNEWGYSQRVVDLADIVANQWK  109
            YDNEWGYSQRV+DLA++ A +W+
Sbjct  354  YDNEWGYSQRVLDLAELCAEKWE  376



>emb|CAC80394.1| glyceraldehyde-3-phosphate dehydrogenase [Sphagnum cuspidatum]
Length=283

 Score =   247 bits (631),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 168/187 (90%), Positives = 177/187 (95%), Gaps = 0/187 (0%)
 Frame = -1

Query  717  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldash  538
            VGVN + YS  + IISNASCTTNCLAPFVKVLD+KFGIIKGTMTTTHSYTGDQRLLDASH
Sbjct  97   VGVNEEQYSHRDEIISNASCTTNCLAPFVKVLDEKFGIIKGTMTTTHSYTGDQRLLDASH  156

Query  537  rdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKT  358
            RDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQV KKT
Sbjct  157  RDLRRARAAALNIVPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVEKKT  216

Query  357  FAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAW  178
            FAEEVNAAFR+++A  L GIL+VCDEPLVSVDFRCSDVSSTVDSSLTMVMGDDMVKV+AW
Sbjct  217  FAEEVNAAFRDASAGALKGILAVCDEPLVSVDFRCSDVSSTVDSSLTMVMGDDMVKVVAW  276

Query  177  YDNEWGY  157
            YD EWGY
Sbjct  277  YDXEWGY  283



>emb|CAC80393.1| glyceraldehyde-3-phosphate dehydrogenase [Sphagnum cuspidatum]
Length=318

 Score =   248 bits (634),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 168/187 (90%), Positives = 178/187 (95%), Gaps = 0/187 (0%)
 Frame = -1

Query  717  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldash  538
            VGVNAD Y+  + IISNASCTTNCLAPFVKVLD+KFGIIKGTMTTTHSYTGDQRLLDASH
Sbjct  132  VGVNADEYNHGDEIISNASCTTNCLAPFVKVLDEKFGIIKGTMTTTHSYTGDQRLLDASH  191

Query  537  rdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKT  358
            RDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQV KKT
Sbjct  192  RDLRRARAAALNIVPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVEKKT  251

Query  357  FAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAW  178
            FAEEVNAAFR+++A  L GIL+VCDEPLVSVDFRCSDVSST+DSSLTMVMGDDMVKV+AW
Sbjct  252  FAEEVNAAFRDASAGPLKGILAVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAW  311

Query  177  YDNEWGY  157
            Y NEWGY
Sbjct  312  YXNEWGY  318



>gb|ABD37955.1| glyceraldehyde-3-phosphate dehydrogenase subunit A [Scherffelia 
dubia]
Length=390

 Score =   250 bits (638),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 162/202 (80%), Positives = 185/202 (92%), Gaps = 1/202 (0%)
 Frame = -1

Query  717  VGVNADAYSPD-EPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldas  541
            +GVN   Y+P  + I+SNASCTTNCLAPFVKV+D+KFGI+KG MTTTHSYTGDQRLLDAS
Sbjct  188  IGVNDKDYNPKTDHIVSNASCTTNCLAPFVKVVDEKFGIVKGMMTTTHSYTGDQRLLDAS  247

Query  540  hrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKK  361
            HRDLRRARAAALNIVPT+TGAAKAVALVLP LKGKLNG ALRVPTPNVSVVDLVVQV KK
Sbjct  248  HRDLRRARAAALNIVPTTTGAAKAVALVLPGLKGKLNGFALRVPTPNVSVVDLVVQVEKK  307

Query  360  TFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIA  181
            TFAEEVN AFR++AA  + G+L++ D PLVSVDFRC+DVS+TVD++LTMVMGDDMVK++A
Sbjct  308  TFAEEVNQAFRDAAAGPMKGVLAITDIPLVSVDFRCTDVSTTVDAALTMVMGDDMVKIVA  367

Query  180  WYDNEWGYSQRVVDLADIVANQ  115
            WYDNEWGYSQRVVDLA++VA +
Sbjct  368  WYDNEWGYSQRVVDLAELVAKK  389



>gb|AES74101.2| glyceraldehyde-3-phosphate dehydrogenase B [Medicago truncatula]
Length=317

 Score =   248 bits (632),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 169/210 (80%), Positives = 186/210 (89%), Gaps = 2/210 (1%)
 Frame = -1

Query  717  VGVNADAYSPD-EPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldas  541
            VGVN   Y  +   IISNASCTTNCLAPFVK+LD++FGI+KGTMTTTHSYTGDQRLLDAS
Sbjct  85   VGVNEQDYGHEVADIISNASCTTNCLAPFVKILDEEFGIVKGTMTTTHSYTGDQRLLDAS  144

Query  540  hrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKK  361
            HRDLRRARAAALNIVPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V+KK
Sbjct  145  HRDLRRARAAALNIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVAKK  204

Query  360  TF-AEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVI  184
               AE+VNAAFR++A   L G+L VCD PLVSVDFRC+DVSST+DSSLTMVMGDDMVKV+
Sbjct  205  GISAEDVNAAFRKAAEGPLKGVLDVCDVPLVSVDFRCTDVSSTIDSSLTMVMGDDMVKVV  264

Query  183  AWYDNEWGYSQRVVDLADIVANQWK*MPAS  94
            AWYDNEWGYSQRVVDLA +VAN+W   P +
Sbjct  265  AWYDNEWGYSQRVVDLAHLVANKWPGTPQA  294



>gb|KJB57938.1| hypothetical protein B456_009G186400 [Gossypium raimondii]
Length=399

 Score =   250 bits (638),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 171/209 (82%), Positives = 186/209 (89%), Gaps = 2/209 (1%)
 Frame = -1

Query  717  VGVNADAYSPD-EPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldas  541
            VGVN   Y  +   IISNASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDAS
Sbjct  166  VGVNEGDYDHEVSNIISNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQRLLDAS  225

Query  540  hrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKK  361
            HRDLRRARAAALNIVPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK
Sbjct  226  HRDLRRARAAALNIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKK  285

Query  360  TF-AEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVI  184
               AE+VNAAFR++A   L G+L VCD PLVSVDFRCSDVSST+DSSLTMVMGDDMVKV+
Sbjct  286  GITAEDVNAAFRKAAKGPLKGVLDVCDVPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVV  345

Query  183  AWYDNEWGYSQRVVDLADIVANQWK*MPA  97
            AWYDNEWGYSQRVVDLA +VA++W  MPA
Sbjct  346  AWYDNEWGYSQRVVDLAHLVASKWPGMPA  374



>emb|CBL43264.1| glyceraldehyde-3-phosphate dehydrogenase [Solanum tuberosum]
Length=450

 Score =   251 bits (641),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 167/204 (82%), Positives = 186/204 (91%), Gaps = 2/204 (1%)
 Frame = -1

Query  717  VGVNADAYSPD-EPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldas  541
            VGVN   YS +   I+SNASCTTNCLAPF K+LD++FGI+KGTMTTTHSYTGDQRLLDAS
Sbjct  218  VGVNEQDYSHEVANIVSNASCTTNCLAPFAKILDEEFGIVKGTMTTTHSYTGDQRLLDAS  277

Query  540  hrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKK  361
            HRDLRRARAAALNIVPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLV+ V KK
Sbjct  278  HRDLRRARAAALNIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVINVEKK  337

Query  360  TF-AEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVI  184
               AE+VNAAFR++A   L+GIL+VCDEPLVSVDFRCSDVS+T+DSSLTMVMGDDMVK++
Sbjct  338  GLSAEDVNAAFRKAADGPLNGILAVCDEPLVSVDFRCSDVSTTIDSSLTMVMGDDMVKIV  397

Query  183  AWYDNEWGYSQRVVDLADIVANQW  112
            AWYDNEWGYSQRVVDLA +VAN+W
Sbjct  398  AWYDNEWGYSQRVVDLAHLVANKW  421



>ref|XP_006855683.1| hypothetical protein AMTR_s00044p00131190 [Amborella trichopoda]
 gb|ERN17150.1| hypothetical protein AMTR_s00044p00131190 [Amborella trichopoda]
Length=413

 Score =   250 bits (638),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 170/204 (83%), Positives = 185/204 (91%), Gaps = 2/204 (1%)
 Frame = -1

Query  717  VGVNADAYSPD-EPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldas  541
            VGVN   YS +   I+SNASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDAS
Sbjct  181  VGVNEGDYSDEVSNIVSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQRLLDAS  240

Query  540  hrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKK  361
            HRDLRRARAAALNIVPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK
Sbjct  241  HRDLRRARAAALNIVPTSTGAAKAVSLVLPKLKGKLNGIALRVPTPNVSVVDLVVNVEKK  300

Query  360  TF-AEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVI  184
               AE+VNAAFR+SA   L GIL+VCD PLVSVDFRCSDVSST+DSSLTMVMGDDMVKV+
Sbjct  301  GLTAEDVNAAFRKSAEGPLKGILAVCDVPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVV  360

Query  183  AWYDNEWGYSQRVVDLADIVANQW  112
            AWYDNEWGYSQRVVDLA +VA++W
Sbjct  361  AWYDNEWGYSQRVVDLAHLVASKW  384



>ref|XP_009786329.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Nicotiana sylvestris]
Length=449

 Score =   251 bits (640),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 170/204 (83%), Positives = 186/204 (91%), Gaps = 2/204 (1%)
 Frame = -1

Query  717  VGVNADAYSPD-EPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldas  541
            VGVN   YS +   IISNASCTTNCLAPFVKV+D++ GI+KGTMTTTHSYTGDQRLLDAS
Sbjct  217  VGVNEQDYSHEVADIISNASCTTNCLAPFVKVMDEELGIVKGTMTTTHSYTGDQRLLDAS  276

Query  540  hrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKK  361
            HRDLRRARAAALNIVPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V+KK
Sbjct  277  HRDLRRARAAALNIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVAKK  336

Query  360  TF-AEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVI  184
               AE+VNAAFR++A   L G+L+VCDEPLVSVDFRCSDVSST+DSSLTMVMGDDMVKV+
Sbjct  337  GITAEDVNAAFRKAADGPLKGVLAVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVV  396

Query  183  AWYDNEWGYSQRVVDLADIVANQW  112
            AWYDNEWGYSQRVVDLA +VAN+W
Sbjct  397  AWYDNEWGYSQRVVDLAHLVANKW  420



>ref|XP_009595874.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Nicotiana tomentosiformis]
Length=449

 Score =   251 bits (640),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 170/204 (83%), Positives = 186/204 (91%), Gaps = 2/204 (1%)
 Frame = -1

Query  717  VGVNADAYSPD-EPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldas  541
            VGVN   YS +   IISNASCTTNCLAPFVKV+D++ GI+KGTMTTTHSYTGDQRLLDAS
Sbjct  217  VGVNEQDYSHEVADIISNASCTTNCLAPFVKVMDEELGIVKGTMTTTHSYTGDQRLLDAS  276

Query  540  hrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKK  361
            HRDLRRARAAALNIVPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V+KK
Sbjct  277  HRDLRRARAAALNIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVAKK  336

Query  360  TF-AEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVI  184
               AE+VNAAFR++A   L G+L+VCDEPLVSVDFRCSDVSST+DSSLTMVMGDDMVKV+
Sbjct  337  GITAEDVNAAFRKAADGPLKGVLAVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVV  396

Query  183  AWYDNEWGYSQRVVDLADIVANQW  112
            AWYDNEWGYSQRVVDLA +VAN+W
Sbjct  397  AWYDNEWGYSQRVVDLAHLVANKW  420



>gb|ABD37965.1| glyceraldehyde-3-phosphate dehydrogenase subunit B [Mesostigma 
viride]
Length=415

 Score =   249 bits (637),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 169/207 (82%), Positives = 181/207 (87%), Gaps = 2/207 (1%)
 Frame = -1

Query  717  VGVNADAYSPD-EPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldas  541
            VGVN   Y+ D   IISNASCTTNCLAPF KVLD+ FGI+KGTMTTTHSYTGDQRLLDAS
Sbjct  182  VGVNEKDYTHDVSNIISNASCTTNCLAPFAKVLDENFGIVKGTMTTTHSYTGDQRLLDAS  241

Query  540  hrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKK  361
            HRDLRRARAAALNIVPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLV+  +KK
Sbjct  242  HRDLRRARAAALNIVPTSTGAAKAVSLVLPKLKGKLNGIALRVPTPNVSVVDLVINTTKK  301

Query  360  TF-AEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVI  184
               AEEVNAAFR+ A   + GIL+V D PLVS+DFRCSDVS T+DSSLTMVMGDDMVKV+
Sbjct  302  GMTAEEVNAAFRKEANGAMKGILAVSDLPLVSIDFRCSDVSCTIDSSLTMVMGDDMVKVV  361

Query  183  AWYDNEWGYSQRVVDLADIVANQWK*M  103
            AWYDNEWGYSQRVVDLADIVAN W  M
Sbjct  362  AWYDNEWGYSQRVVDLADIVANNWPGM  388



>sp|P09044.1|G3PB_TOBAC RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic; 
AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase subunit B; Flags: Precursor, partial [Nicotiana 
tabacum]
 gb|AAA34076.1| glyceraldehyde-3-phosphate dehydrogenase B-subunit precursor, 
partial [Nicotiana tabacum]
Length=438

 Score =   250 bits (638),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 170/204 (83%), Positives = 185/204 (91%), Gaps = 2/204 (1%)
 Frame = -1

Query  717  VGVNADAYSPD-EPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldas  541
            VGVN   YS +   IISNASCTTNCLAPFVKV+D++ GI+KGTMTTTHSYTGDQRLLDAS
Sbjct  188  VGVNEQDYSHEVADIISNASCTTNCLAPFVKVMDEELGIVKGTMTTTHSYTGDQRLLDAS  247

Query  540  hrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKK  361
            HRDLRRARAAALNIVPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V+KK
Sbjct  248  HRDLRRARAAALNIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVAKK  307

Query  360  TF-AEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVI  184
               AE+VNAAFR++A   L G+L+VCDEPLVSVDFRCSDVSST+DSSLTMVMGDDMVKV+
Sbjct  308  GITAEDVNAAFRKAADGPLKGVLAVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVV  367

Query  183  AWYDNEWGYSQRVVDLADIVANQW  112
            AWYDNEWGYSQRVVDLA +VAN W
Sbjct  368  AWYDNEWGYSQRVVDLAHLVANNW  391



>gb|AAG23799.1| chloroplast NADP-dependent glyceraldehyde 3-phosphate dehydrogenase 
A subunit [Cucurbita pepo]
Length=170

 Score =   241 bits (614),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 166/170 (98%), Positives = 168/170 (99%), Gaps = 0/170 (0%)
 Frame = -1

Query  669  NASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPT  490
            NASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPT
Sbjct  1    NASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPT  60

Query  489  STGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANE  310
            STGAAKAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESA  E
Sbjct  61   STGAAKAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESAEKE  120

Query  309  LDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWG  160
            L+GILSVCDEPLVSVDFRCSDVSSTVDSSLTMVMGDD+VKVIAWYDNEWG
Sbjct  121  LNGILSVCDEPLVSVDFRCSDVSSTVDSSLTMVMGDDLVKVIAWYDNEWG  170



>gb|KJB57936.1| hypothetical protein B456_009G186400 [Gossypium raimondii]
Length=455

 Score =   249 bits (637),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 171/209 (82%), Positives = 186/209 (89%), Gaps = 2/209 (1%)
 Frame = -1

Query  717  VGVNADAYSPD-EPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldas  541
            VGVN   Y  +   IISNASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDAS
Sbjct  222  VGVNEGDYDHEVSNIISNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQRLLDAS  281

Query  540  hrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKK  361
            HRDLRRARAAALNIVPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK
Sbjct  282  HRDLRRARAAALNIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKK  341

Query  360  TF-AEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVI  184
               AE+VNAAFR++A   L G+L VCD PLVSVDFRCSDVSST+DSSLTMVMGDDMVKV+
Sbjct  342  GITAEDVNAAFRKAAKGPLKGVLDVCDVPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVV  401

Query  183  AWYDNEWGYSQRVVDLADIVANQWK*MPA  97
            AWYDNEWGYSQRVVDLA +VA++W  MPA
Sbjct  402  AWYDNEWGYSQRVVDLAHLVASKWPGMPA  430



>gb|KHG26323.1| Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic [Gossypium 
arboreum]
Length=455

 Score =   249 bits (637),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 171/209 (82%), Positives = 186/209 (89%), Gaps = 2/209 (1%)
 Frame = -1

Query  717  VGVNADAYSPD-EPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldas  541
            VGVN   Y  +   IISNASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDAS
Sbjct  222  VGVNEGDYDHEVSNIISNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQRLLDAS  281

Query  540  hrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKK  361
            HRDLRRARAAALNIVPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK
Sbjct  282  HRDLRRARAAALNIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKK  341

Query  360  TF-AEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVI  184
               AE+VNAAFR++A   L G+L VCD PLVSVDFRCSDVSST+DSSLTMVMGDDMVKV+
Sbjct  342  GITAEDVNAAFRKAAEGPLKGVLDVCDVPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVV  401

Query  183  AWYDNEWGYSQRVVDLADIVANQWK*MPA  97
            AWYDNEWGYSQRVVDLA +VA++W  MPA
Sbjct  402  AWYDNEWGYSQRVVDLAHLVASKWPGMPA  430



>ref|XP_004253122.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Solanum lycopersicum]
Length=450

 Score =   249 bits (636),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 166/204 (81%), Positives = 186/204 (91%), Gaps = 2/204 (1%)
 Frame = -1

Query  717  VGVNADAYSPD-EPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldas  541
            VGVN   YS +   I+SNASCTTNCLAPF K+LD++FGI+KGTMTTTHSYTGDQRLLDAS
Sbjct  218  VGVNEQDYSHEVANIVSNASCTTNCLAPFAKILDEEFGIVKGTMTTTHSYTGDQRLLDAS  277

Query  540  hrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKK  361
            HRDLRRARAAALNIVPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLV+ V KK
Sbjct  278  HRDLRRARAAALNIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVINVEKK  337

Query  360  TF-AEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVI  184
               AE+VNAAFR++A   L+GIL+VCDEPLVSVDFRCSDVS+T+DSSLTMVMGDDMVK++
Sbjct  338  GISAEDVNAAFRKAADGPLNGILAVCDEPLVSVDFRCSDVSTTIDSSLTMVMGDDMVKIV  397

Query  183  AWYDNEWGYSQRVVDLADIVANQW  112
            AWYDNEWGYSQRVVDLA +VA++W
Sbjct  398  AWYDNEWGYSQRVVDLAHLVADKW  421



>ref|XP_004500847.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Cicer arietinum]
Length=525

 Score =   251 bits (641),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 169/208 (81%), Positives = 185/208 (89%), Gaps = 2/208 (1%)
 Frame = -1

Query  717  VGVNADAYSPD-EPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldas  541
            VGVN   Y  D   IISNASCTTNCLAPFVK+LD++FGI+KGTMTTTHSYTGDQRLLDAS
Sbjct  293  VGVNEQDYGHDVADIISNASCTTNCLAPFVKILDEEFGIVKGTMTTTHSYTGDQRLLDAS  352

Query  540  hrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKK  361
            HRDLRRARAAALNIVPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLV+ V+KK
Sbjct  353  HRDLRRARAAALNIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVINVAKK  412

Query  360  TF-AEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVI  184
               AE+VNAAFR++A   L G+L VCD PLVSVDFRC+DVSST+DSSLTMVMGDDMVKV+
Sbjct  413  GISAEDVNAAFRKAAEGPLKGVLDVCDLPLVSVDFRCTDVSSTIDSSLTMVMGDDMVKVV  472

Query  183  AWYDNEWGYSQRVVDLADIVANQWK*MP  100
            AWYDNEWGYSQRVVDLA +VAN+W   P
Sbjct  473  AWYDNEWGYSQRVVDLAHLVANKWPGTP  500



>ref|XP_003603851.1| Glyceraldehyde-3-phosphate dehydrogenase [Medicago truncatula]
 gb|AES74102.1| glyceraldehyde-3-phosphate dehydrogenase B [Medicago truncatula]
Length=451

 Score =   249 bits (636),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 169/208 (81%), Positives = 185/208 (89%), Gaps = 2/208 (1%)
 Frame = -1

Query  717  VGVNADAYSPD-EPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldas  541
            VGVN   Y  +   IISNASCTTNCLAPFVK+LD++FGI+KGTMTTTHSYTGDQRLLDAS
Sbjct  219  VGVNEQDYGHEVADIISNASCTTNCLAPFVKILDEEFGIVKGTMTTTHSYTGDQRLLDAS  278

Query  540  hrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKK  361
            HRDLRRARAAALNIVPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V+KK
Sbjct  279  HRDLRRARAAALNIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVAKK  338

Query  360  TF-AEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVI  184
               AE+VNAAFR++A   L G+L VCD PLVSVDFRC+DVSST+DSSLTMVMGDDMVKV+
Sbjct  339  GISAEDVNAAFRKAAEGPLKGVLDVCDVPLVSVDFRCTDVSSTIDSSLTMVMGDDMVKVV  398

Query  183  AWYDNEWGYSQRVVDLADIVANQWK*MP  100
            AWYDNEWGYSQRVVDLA +VAN+W   P
Sbjct  399  AWYDNEWGYSQRVVDLAHLVANKWPGTP  426



>emb|CAC80389.2| glyceraldehyde-3-phosphate dehydrogenase [Marchantia polymorpha]
Length=457

 Score =   249 bits (636),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 170/204 (83%), Positives = 182/204 (89%), Gaps = 2/204 (1%)
 Frame = -1

Query  717  VGVNADAYSPD-EPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldas  541
            +GVN   YS +   IISNASCTTNCLAPFVKVLD+KFGI+KGTMTTTHSYTGDQRLLDAS
Sbjct  225  MGVNEGDYSHEVANIISNASCTTNCLAPFVKVLDEKFGIVKGTMTTTHSYTGDQRLLDAS  284

Query  540  hrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKK  361
            HRDLRRARAAALNIVPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLV+   KK
Sbjct  285  HRDLRRARAAALNIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVINTEKK  344

Query  360  TF-AEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVI  184
               AE+VN AFRE+A   L GIL+VCD PLVS+DFRCSDVSSTVDSSLTMVMGDDMVKV+
Sbjct  345  GLTAEDVNNAFREAANGPLKGILAVCDIPLVSIDFRCSDVSSTVDSSLTMVMGDDMVKVV  404

Query  183  AWYDNEWGYSQRVVDLADIVANQW  112
            AWYDNEWGYSQRVVDLA +VA QW
Sbjct  405  AWYDNEWGYSQRVVDLAHLVAAQW  428



>ref|XP_006342537.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Solanum tuberosum]
Length=450

 Score =   249 bits (635),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 165/204 (81%), Positives = 187/204 (92%), Gaps = 2/204 (1%)
 Frame = -1

Query  717  VGVNADAYSPD-EPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldas  541
            +GVN   YS +   I+SNASCTTNCLAPF K+LD++FGI+KGTMTTTHSYTGDQRLLDAS
Sbjct  218  IGVNEQDYSHEVANIVSNASCTTNCLAPFAKILDEEFGIVKGTMTTTHSYTGDQRLLDAS  277

Query  540  hrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKK  361
            HRDLRRARAAALNIVPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLV+ V+KK
Sbjct  278  HRDLRRARAAALNIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVINVAKK  337

Query  360  TF-AEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVI  184
               AE+VNAAFR++A   L+GIL+VCDEPLVSVDFRCSDVS+T+DSSLTMVMGDDMVK++
Sbjct  338  GISAEDVNAAFRKAADGPLNGILAVCDEPLVSVDFRCSDVSTTIDSSLTMVMGDDMVKIV  397

Query  183  AWYDNEWGYSQRVVDLADIVANQW  112
            AWYDNEWGYSQRVVDLA +VA++W
Sbjct  398  AWYDNEWGYSQRVVDLAHLVASKW  421



>gb|KJB14201.1| hypothetical protein B456_002G114000 [Gossypium raimondii]
Length=454

 Score =   249 bits (636),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 171/210 (81%), Positives = 186/210 (89%), Gaps = 2/210 (1%)
 Frame = -1

Query  717  VGVNADAYSPD-EPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldas  541
            VGVN   Y  +   IISNASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDAS
Sbjct  221  VGVNEGDYDHEVSNIISNASCTTNCLAPFVKVIDEEFGIVKGTMTTTHSYTGDQRLLDAS  280

Query  540  hrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKK  361
            HRDLRRARAAALNIVPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK
Sbjct  281  HRDLRRARAAALNIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKK  340

Query  360  TF-AEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVI  184
               AE+VNAAFR+SA   L G+L VCD PLVSVDFRCSDVSST+DSSLTMVMGDDMVKV+
Sbjct  341  GITAEDVNAAFRKSAEGPLKGVLEVCDIPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVV  400

Query  183  AWYDNEWGYSQRVVDLADIVANQWK*MPAS  94
            AWYDNEWGYSQRVVDLA +VA++W  MP +
Sbjct  401  AWYDNEWGYSQRVVDLAHLVASKWPGMPVA  430



>gb|EPS70760.1| hypothetical protein M569_03997, partial [Genlisea aurea]
Length=440

 Score =   248 bits (634),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 169/204 (83%), Positives = 183/204 (90%), Gaps = 2/204 (1%)
 Frame = -1

Query  717  VGVNADAYSPD-EPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldas  541
            VGVN   YS D   IISNASCTTNCLAPFVKVLD++FGI KGTMTTTHSYTGDQRLLDAS
Sbjct  207  VGVNEQDYSHDVSDIISNASCTTNCLAPFVKVLDEEFGIEKGTMTTTHSYTGDQRLLDAS  266

Query  540  hrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKK  361
            HRDLRRARAAALNIVPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK
Sbjct  267  HRDLRRARAAALNIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKK  326

Query  360  TFA-EEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVI  184
              A E++N+AFR++A   L G+L VCD PLVSVDFRC+DVSST+DSSLTMVMGDDMVKV+
Sbjct  327  GIAAEDINSAFRKAAEGPLKGVLDVCDAPLVSVDFRCTDVSSTIDSSLTMVMGDDMVKVV  386

Query  183  AWYDNEWGYSQRVVDLADIVANQW  112
            AWYDNEWGYSQRVVDLA +VAN+W
Sbjct  387  AWYDNEWGYSQRVVDLAHLVANKW  410



>ref|XP_010539030.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPB, chloroplastic 
[Tarenaya hassleriana]
Length=453

 Score =   249 bits (635),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 169/204 (83%), Positives = 186/204 (91%), Gaps = 2/204 (1%)
 Frame = -1

Query  717  VGVNADAYSPD-EPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldas  541
            VGVN   YS +   I+SNASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDAS
Sbjct  220  VGVNEKDYSHEVANIVSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQRLLDAS  279

Query  540  hrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKK  361
            HRDLRRARAAALNIVPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK
Sbjct  280  HRDLRRARAAALNIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKK  339

Query  360  TF-AEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVI  184
               AE+VNAAFR++A+  L+GIL VCD PLVSVDFRCSDVSST+DSSLTMVMGDDMVKV+
Sbjct  340  GLTAEDVNAAFRKAASGPLNGILDVCDVPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVV  399

Query  183  AWYDNEWGYSQRVVDLADIVANQW  112
            AWYDNEWGYSQRVVDLA +VA++W
Sbjct  400  AWYDNEWGYSQRVVDLAHLVASKW  423



>gb|ABF93789.1| Glyceraldehyde-3-phosphate dehydrogenase B, chloroplast precursor, 
putative, expressed [Oryza sativa Japonica Group]
 dbj|BAG90581.1| unnamed protein product [Oryza sativa Japonica Group]
Length=318

 Score =   244 bits (624),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 166/204 (81%), Positives = 183/204 (90%), Gaps = 2/204 (1%)
 Frame = -1

Query  717  VGVNADAYSPD-EPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldas  541
            +GVN   YS +   IISNASCTTNCLAPFVK+LD++FGI+KGTMTTTHSYTGDQRLLDAS
Sbjct  85   LGVNEGDYSHEVANIISNASCTTNCLAPFVKILDEEFGIVKGTMTTTHSYTGDQRLLDAS  144

Query  540  hrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKK  361
            HRDLRRARAAALNIVPTSTGAAKAVALVLP LKGKLNGIALRVPTPNVSVVDLV+   K 
Sbjct  145  HRDLRRARAAALNIVPTSTGAAKAVALVLPQLKGKLNGIALRVPTPNVSVVDLVINTVKT  204

Query  360  TF-AEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVI  184
               A++VNAAFR++AA  L GIL VCD PLVSVDFRCSDVSST+D+SLTMVMGDDMVKV+
Sbjct  205  GITADDVNAAFRKAAAGPLSGILDVCDVPLVSVDFRCSDVSSTIDASLTMVMGDDMVKVV  264

Query  183  AWYDNEWGYSQRVVDLADIVANQW  112
            AWYDNEWGYSQRVVDLA +VA++W
Sbjct  265  AWYDNEWGYSQRVVDLAHLVASKW  288



>gb|ABD37964.1| glyceraldehyde-3-phosphate dehydrogenase subunit B [Chlorokybus 
atmophyticus]
Length=458

 Score =   249 bits (635),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 167/204 (82%), Positives = 183/204 (90%), Gaps = 2/204 (1%)
 Frame = -1

Query  717  VGVNADAYSPD-EPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldas  541
            VGVN D Y  D   IISNASCTTNCLAPFVKVLD++FGI+KGTMTTTHSYTGDQRLLDAS
Sbjct  222  VGVNEDQYDHDASAIISNASCTTNCLAPFVKVLDEEFGIVKGTMTTTHSYTGDQRLLDAS  281

Query  540  hrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKK  361
            HRDLRRARAAALNIVPT+TGAAKAVALVLP LKGKLNGIALRVPTPNVSVVDLV+   KK
Sbjct  282  HRDLRRARAAALNIVPTTTGAAKAVALVLPQLKGKLNGIALRVPTPNVSVVDLVINTEKK  341

Query  360  TF-AEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVI  184
               A++VNAAFR++A   L+G+L+V D PLVS+DFRCSDVSST+DSSLTMVMGDDM+KV+
Sbjct  342  GITADQVNAAFRKAAEGPLNGVLAVSDLPLVSIDFRCSDVSSTIDSSLTMVMGDDMLKVV  401

Query  183  AWYDNEWGYSQRVVDLADIVANQW  112
            AWYDNEWGYSQRVVDLA IVAN W
Sbjct  402  AWYDNEWGYSQRVVDLAHIVANNW  425



>ref|XP_008237955.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Prunus mume]
Length=452

 Score =   249 bits (635),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 185/204 (91%), Gaps = 2/204 (1%)
 Frame = -1

Query  717  VGVNADAYSPD-EPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldas  541
            VGVN   YS +   I+SNASCTTNCLAPFVKVLD++FGI+KGTMTTTHSYTGDQRLLDAS
Sbjct  219  VGVNEQDYSHEVANIVSNASCTTNCLAPFVKVLDEEFGIVKGTMTTTHSYTGDQRLLDAS  278

Query  540  hrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKK  361
            HRDLRRARAAALNIVPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLV+ V KK
Sbjct  279  HRDLRRARAAALNIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVINVEKK  338

Query  360  TF-AEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVI  184
               AE+VNAAFR++A   L GIL+VCD PLVSVDFRC+DVSST+DSSLTMVMGDDMVKV+
Sbjct  339  GISAEDVNAAFRKAAEGPLQGILAVCDVPLVSVDFRCTDVSSTIDSSLTMVMGDDMVKVV  398

Query  183  AWYDNEWGYSQRVVDLADIVANQW  112
            AWYDNEWGYSQRVVDLA +VA++W
Sbjct  399  AWYDNEWGYSQRVVDLAHLVASKW  422



>ref|XP_009629570.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Nicotiana tomentosiformis]
Length=449

 Score =   248 bits (634),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 169/204 (83%), Positives = 186/204 (91%), Gaps = 2/204 (1%)
 Frame = -1

Query  717  VGVNADAYSPD-EPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldas  541
            VGVN   YS +   I+SNASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDAS
Sbjct  217  VGVNEQDYSHEVANIVSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQRLLDAS  276

Query  540  hrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKK  361
            HRDLRRARAAALNIVPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK
Sbjct  277  HRDLRRARAAALNIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKK  336

Query  360  TF-AEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVI  184
               AE+VNAAFR++A   L+GIL+VCD PLVSVDFRCSDVSST+DSSLTMVMGDDMVKV+
Sbjct  337  GISAEDVNAAFRKAADGPLNGILAVCDVPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVV  396

Query  183  AWYDNEWGYSQRVVDLADIVANQW  112
            AWYDNEWGYSQRVVDLA +VA++W
Sbjct  397  AWYDNEWGYSQRVVDLAHLVASKW  420



>ref|XP_007211185.1| hypothetical protein PRUPE_ppa005598mg [Prunus persica]
 gb|EMJ12384.1| hypothetical protein PRUPE_ppa005598mg [Prunus persica]
Length=452

 Score =   248 bits (634),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 169/208 (81%), Positives = 186/208 (89%), Gaps = 2/208 (1%)
 Frame = -1

Query  717  VGVNADAYSPD-EPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldas  541
            VGVN   YS +   I+SNASCTTNCLAPFVKVLD++FGI+KGTMTTTHSYTGDQRLLDAS
Sbjct  219  VGVNEQDYSHEVANIVSNASCTTNCLAPFVKVLDEEFGIVKGTMTTTHSYTGDQRLLDAS  278

Query  540  hrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKK  361
            HRDLRRARAAALNIVPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLV+ V KK
Sbjct  279  HRDLRRARAAALNIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVINVEKK  338

Query  360  TF-AEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVI  184
               AE+VNAAFR++A   L GIL+VCD PLVSVDFRC+DVSST+DSSLTMVMGDDMVKV+
Sbjct  339  GISAEDVNAAFRKAAEGPLQGILAVCDIPLVSVDFRCTDVSSTIDSSLTMVMGDDMVKVV  398

Query  183  AWYDNEWGYSQRVVDLADIVANQWK*MP  100
            AWYDNEWGYSQRVVDLA +VA++W   P
Sbjct  399  AWYDNEWGYSQRVVDLAHLVASKWPGTP  426



>ref|XP_009384600.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=447

 Score =   248 bits (633),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 169/209 (81%), Positives = 187/209 (89%), Gaps = 2/209 (1%)
 Frame = -1

Query  717  VGVN-ADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldas  541
            VGVN  D +     I+SNASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDAS
Sbjct  214  VGVNEGDYHHEASNIVSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQRLLDAS  273

Query  540  hrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKK  361
            HRDLRRARAAALNIVPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V+KK
Sbjct  274  HRDLRRARAAALNIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVAKK  333

Query  360  TF-AEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVI  184
               AE+VN AFR++A   L GIL+VCD PLVSVDFRCSDVSST+DSSLTMVMGDDMVKV+
Sbjct  334  GMTAEDVNNAFRKAAQGPLKGILAVCDVPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVV  393

Query  183  AWYDNEWGYSQRVVDLADIVANQWK*MPA  97
            AWYDNEWGYSQRVVDLA +VA++W  +PA
Sbjct  394  AWYDNEWGYSQRVVDLAHLVASKWPGVPA  422



>ref|XP_011074072.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Sesamum indicum]
Length=452

 Score =   248 bits (634),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 184/204 (90%), Gaps = 2/204 (1%)
 Frame = -1

Query  717  VGVNADAYSPD-EPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldas  541
            VGVN   YS +   IISNASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDAS
Sbjct  219  VGVNEQGYSHEVSDIISNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQRLLDAS  278

Query  540  hrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKK  361
            HRDLRRARAAALNIVPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK
Sbjct  279  HRDLRRARAAALNIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKK  338

Query  360  TF-AEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVI  184
               AE+VNAAFR++A   L G+L VCD PLVSVDFRC+DVSST+DSSLTMVMGDDMVKV+
Sbjct  339  GITAEDVNAAFRKAAEGPLAGVLDVCDVPLVSVDFRCTDVSSTIDSSLTMVMGDDMVKVV  398

Query  183  AWYDNEWGYSQRVVDLADIVANQW  112
            AWYDNEWGYSQRVVDLA +VA++W
Sbjct  399  AWYDNEWGYSQRVVDLAHLVADKW  422



>ref|XP_010918353.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Elaeis guineensis]
Length=452

 Score =   248 bits (634),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 168/208 (81%), Positives = 185/208 (89%), Gaps = 2/208 (1%)
 Frame = -1

Query  717  VGVNADAYSPD-EPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldas  541
            VGVN   YS +   I+SNASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDAS
Sbjct  219  VGVNEGDYSHEVSNIVSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQRLLDAS  278

Query  540  hrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKK  361
            HRDLRRARAAALNIVPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK
Sbjct  279  HRDLRRARAAALNIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKK  338

Query  360  TF-AEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVI  184
               AE+VN AFR++A   L GIL VCD PLVSVDFRC+DVSST+D+SLTMVMGDDMVKV+
Sbjct  339  GITAEDVNQAFRKAANGPLKGILDVCDVPLVSVDFRCTDVSSTIDASLTMVMGDDMVKVV  398

Query  183  AWYDNEWGYSQRVVDLADIVANQWK*MP  100
            AWYDNEWGYSQRVVDLA +VA++W  MP
Sbjct  399  AWYDNEWGYSQRVVDLAHLVASKWPGMP  426



>ref|XP_009384599.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=449

 Score =   248 bits (633),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 169/209 (81%), Positives = 187/209 (89%), Gaps = 2/209 (1%)
 Frame = -1

Query  717  VGVN-ADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldas  541
            VGVN  D +     I+SNASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDAS
Sbjct  216  VGVNEGDYHHEASNIVSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQRLLDAS  275

Query  540  hrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKK  361
            HRDLRRARAAALNIVPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V+KK
Sbjct  276  HRDLRRARAAALNIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVAKK  335

Query  360  TF-AEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVI  184
               AE+VN AFR++A   L GIL+VCD PLVSVDFRCSDVSST+DSSLTMVMGDDMVKV+
Sbjct  336  GMTAEDVNNAFRKAAQGPLKGILAVCDVPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVV  395

Query  183  AWYDNEWGYSQRVVDLADIVANQWK*MPA  97
            AWYDNEWGYSQRVVDLA +VA++W  +PA
Sbjct  396  AWYDNEWGYSQRVVDLAHLVASKWPGVPA  424



>ref|XP_010061201.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPB, chloroplastic 
[Eucalyptus grandis]
 gb|KCW68119.1| hypothetical protein EUGRSUZ_F01793 [Eucalyptus grandis]
Length=454

 Score =   248 bits (634),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 170/203 (84%), Positives = 184/203 (91%), Gaps = 2/203 (1%)
 Frame = -1

Query  714  GVNADAYSPD-EPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldash  538
            GVN   YS +   IISNASCTTNCLAPFVKVLD+KFGI+KGTMTTTHSYTGDQRLLDASH
Sbjct  221  GVNETDYSHEVANIISNASCTTNCLAPFVKVLDEKFGIVKGTMTTTHSYTGDQRLLDASH  280

Query  537  rdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKT  358
            RDLRRARAAALNIVPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK 
Sbjct  281  RDLRRARAAALNIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKG  340

Query  357  F-AEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIA  181
              AE+VNAAFR++A   L GIL+VCD+PLVSVDFRCSDVSST+DSSL+MVMGDDMVKV+A
Sbjct  341  LTAEDVNAAFRDAAEGPLKGILAVCDDPLVSVDFRCSDVSSTIDSSLSMVMGDDMVKVVA  400

Query  180  WYDNEWGYSQRVVDLADIVANQW  112
            WYDNEWGYSQRVVDLA +VA +W
Sbjct  401  WYDNEWGYSQRVVDLAHLVAVKW  423



>ref|XP_009780936.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Nicotiana sylvestris]
Length=449

 Score =   248 bits (633),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 186/204 (91%), Gaps = 2/204 (1%)
 Frame = -1

Query  717  VGVNADAYSPD-EPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldas  541
            VGVN   YS +   I+SNASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDAS
Sbjct  217  VGVNEQDYSHEVANIVSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQRLLDAS  276

Query  540  hrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKK  361
            HRDLRRARAAALNIVPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV + KK
Sbjct  277  HRDLRRARAAALNIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNIEKK  336

Query  360  TF-AEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVI  184
               AE+VNAAFR++A   L+GIL+VCD PLVSVDFRCSDVSST+DSSLTMVMGDDMVKV+
Sbjct  337  GISAEDVNAAFRKAADGPLNGILAVCDVPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVV  396

Query  183  AWYDNEWGYSQRVVDLADIVANQW  112
            AWYDNEWGYSQRVVDLA +VA++W
Sbjct  397  AWYDNEWGYSQRVVDLAHLVASKW  420



>gb|KHG00663.1| Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic [Gossypium 
arboreum]
Length=454

 Score =   248 bits (633),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 170/210 (81%), Positives = 186/210 (89%), Gaps = 2/210 (1%)
 Frame = -1

Query  717  VGVNADAYSPD-EPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldas  541
            VGVN   Y  +   IISNASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDAS
Sbjct  221  VGVNEGDYDHEVSNIISNASCTTNCLAPFVKVIDEEFGIVKGTMTTTHSYTGDQRLLDAS  280

Query  540  hrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKK  361
            HRDLRRARAAALNIVPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK
Sbjct  281  HRDLRRARAAALNIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKK  340

Query  360  TF-AEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVI  184
               AE+VNAAFR++A   L G+L VCD PLVSVDFRCSDVSST+DSSLTMVMGDDMVKV+
Sbjct  341  GITAEDVNAAFRKAAEGPLKGVLEVCDIPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVV  400

Query  183  AWYDNEWGYSQRVVDLADIVANQWK*MPAS  94
            AWYDNEWGYSQRVVDLA +VA++W  MP +
Sbjct  401  AWYDNEWGYSQRVVDLAHLVASKWPGMPVA  430



>ref|XP_007018105.1| Glyceraldehyde-3-phosphate dehydrogenase B subunit [Theobroma 
cacao]
 gb|EOY15330.1| Glyceraldehyde-3-phosphate dehydrogenase B subunit [Theobroma 
cacao]
Length=452

 Score =   248 bits (632),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 169/210 (80%), Positives = 187/210 (89%), Gaps = 2/210 (1%)
 Frame = -1

Query  717  VGVNADAYSPD-EPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldas  541
            VGVN   Y  +   I+SNASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDAS
Sbjct  219  VGVNEGDYDHEVSNIVSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQRLLDAS  278

Query  540  hrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKK  361
            HRDLRRARAAALNIVPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK
Sbjct  279  HRDLRRARAAALNIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKK  338

Query  360  TF-AEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVI  184
               AE+VNAAFR++A   L G+L VCD PLVSVDFRCSDVSST+DSSLTMVMGDDMVKV+
Sbjct  339  GITAEDVNAAFRKAAEGPLKGVLDVCDVPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVV  398

Query  183  AWYDNEWGYSQRVVDLADIVANQWK*MPAS  94
            AWYDNEWGYSQRVVDLA +VA++W  +PA+
Sbjct  399  AWYDNEWGYSQRVVDLAHLVASKWPGVPAA  428



>gb|ABK00057.1| chloroplast glyceraldehyde-3-phosphate dehydrogenase [Mesostigma 
viride]
Length=384

 Score =   246 bits (627),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 167/207 (81%), Positives = 179/207 (86%), Gaps = 2/207 (1%)
 Frame = -1

Query  717  VGVNADAYSPD-EPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldas  541
            VGVN   Y+ D   IISNASCTTNCLAPF KVLD+ FGI+KGTMTTTHSYTGDQRLLDAS
Sbjct  154  VGVNEKDYTHDVSNIISNASCTTNCLAPFAKVLDENFGIVKGTMTTTHSYTGDQRLLDAS  213

Query  540  hrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKK  361
            HRDLRRARAAA NIVPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLV+  +KK
Sbjct  214  HRDLRRARAAAFNIVPTSTGAAKAVSLVLPKLKGKLNGIALRVPTPNVSVVDLVINTTKK  273

Query  360  TF-AEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVI  184
               AEEVNAAFR+ A   + GIL+V D PLVS+DFRCSDVS T+DSSLTMVMGDDMVKV+
Sbjct  274  GMTAEEVNAAFRKEANGAMKGILAVSDLPLVSIDFRCSDVSCTIDSSLTMVMGDDMVKVV  333

Query  183  AWYDNEWGYSQRVVDLADIVANQWK*M  103
            AWY NEWGYSQRVVDLADIVAN W  M
Sbjct  334  AWYGNEWGYSQRVVDLADIVANNWPGM  360



>sp|P12859.2|G3PB_PEA RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic; 
AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase subunit B; Flags: Precursor [Pisum sativum]
 gb|AAA84543.1| glyceraldehyde-3-phosphate dehydrogenase B subunit [Pisum sativum]
Length=451

 Score =   248 bits (632),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 169/208 (81%), Positives = 184/208 (88%), Gaps = 2/208 (1%)
 Frame = -1

Query  717  VGVNADAYSPD-EPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldas  541
            +GVN   Y  +   IISNASCTTNCLAPF KVLD++FGI+KGTMTTTHSYTGDQRLLDAS
Sbjct  219  IGVNEQDYGHEVADIISNASCTTNCLAPFAKVLDEEFGIVKGTMTTTHSYTGDQRLLDAS  278

Query  540  hrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKK  361
            HRDLRRARAAALNIVPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V+KK
Sbjct  279  HRDLRRARAAALNIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVAKK  338

Query  360  TF-AEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVI  184
               AE+VNAAFR++A   L GIL VCD PLVSVDFRCSDVS+T+DSSLTMVMGDDMVKV+
Sbjct  339  GISAEDVNAAFRKAAEGPLKGILDVCDVPLVSVDFRCSDVSTTIDSSLTMVMGDDMVKVV  398

Query  183  AWYDNEWGYSQRVVDLADIVANQWK*MP  100
            AWYDNEWGYSQRVVDLA +VAN+W   P
Sbjct  399  AWYDNEWGYSQRVVDLAHLVANKWPGTP  426



>gb|AFG28405.1| glyceraldehyde-3-phosphate dehydrogenase B [Pyrus x bretschneideri]
Length=452

 Score =   248 bits (632),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 167/204 (82%), Positives = 185/204 (91%), Gaps = 2/204 (1%)
 Frame = -1

Query  717  VGVNADAYSPD-EPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldas  541
            VGVN   Y  D   I+SNASCTTNCLAPFVK+LD++FGI+KGTMTTTHSYTGDQRLLDAS
Sbjct  219  VGVNEKDYGHDVANIVSNASCTTNCLAPFVKILDEEFGIVKGTMTTTHSYTGDQRLLDAS  278

Query  540  hrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKK  361
            HRDLRRARAAALNIVPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLV+ V+KK
Sbjct  279  HRDLRRARAAALNIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVINVAKK  338

Query  360  TF-AEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVI  184
               AE+VNAAFR++A   L GIL+VCD PLVSVDFRC+DVSST+DSSLTMVMGDDMVKV+
Sbjct  339  GISAEDVNAAFRKAADGPLKGILAVCDVPLVSVDFRCTDVSSTIDSSLTMVMGDDMVKVV  398

Query  183  AWYDNEWGYSQRVVDLADIVANQW  112
            AWYDNEWGYSQRVVDLA +VA++W
Sbjct  399  AWYDNEWGYSQRVVDLAHLVASKW  422



>ref|XP_008346447.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Malus domestica]
Length=452

 Score =   248 bits (632),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 167/204 (82%), Positives = 185/204 (91%), Gaps = 2/204 (1%)
 Frame = -1

Query  717  VGVNADAYSPD-EPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldas  541
            VGVN   Y  D   I+SNASCTTNCLAPFVK+LD++FGI+KGTMTTTHSYTGDQRLLDAS
Sbjct  219  VGVNEKDYGHDVANIVSNASCTTNCLAPFVKILDEEFGIVKGTMTTTHSYTGDQRLLDAS  278

Query  540  hrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKK  361
            HRDLRRARAAALNIVPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLV+ V+KK
Sbjct  279  HRDLRRARAAALNIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVINVAKK  338

Query  360  TF-AEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVI  184
               AE+VNAAFR++A   L GIL+VCD PLVSVDFRC+DVSST+DSSLTMVMGDDMVKV+
Sbjct  339  GISAEDVNAAFRKAADGPLKGILAVCDVPLVSVDFRCTDVSSTIDSSLTMVMGDDMVKVV  398

Query  183  AWYDNEWGYSQRVVDLADIVANQW  112
            AWYDNEWGYSQRVVDLA +VA++W
Sbjct  399  AWYDNEWGYSQRVVDLAHLVASKW  422



>gb|KDP36765.1| hypothetical protein JCGZ_08056 [Jatropha curcas]
Length=452

 Score =   248 bits (632),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 183/204 (90%), Gaps = 2/204 (1%)
 Frame = -1

Query  717  VGVNADAYSPD-EPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldas  541
            VGVN   YS     I+SNASCTTNCLAPFVK++D++FGI+KGTMTTTHSYTGDQRLLDAS
Sbjct  219  VGVNEKDYSHQVANIVSNASCTTNCLAPFVKIIDEEFGIVKGTMTTTHSYTGDQRLLDAS  278

Query  540  hrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKK  361
            HRDLRRARAAALNIVPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK
Sbjct  279  HRDLRRARAAALNIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKK  338

Query  360  TF-AEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVI  184
               AE+VNAAFR++A   L GIL VCD PLVSVDFRC+DVSST+DSSLTMVMGDDMVKV+
Sbjct  339  GITAEDVNAAFRKAADGPLKGILDVCDVPLVSVDFRCTDVSSTIDSSLTMVMGDDMVKVV  398

Query  183  AWYDNEWGYSQRVVDLADIVANQW  112
            AWYDNEWGYSQRVVDLA +VAN+W
Sbjct  399  AWYDNEWGYSQRVVDLAHLVANEW  422



>ref|NP_001289237.1| glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic [Pyrus 
x bretschneideri]
 gb|AHM26621.1| glyceraldehyde-3-phosphate dehydrogenase B [Pyrus x bretschneideri]
Length=452

 Score =   248 bits (632),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 167/204 (82%), Positives = 185/204 (91%), Gaps = 2/204 (1%)
 Frame = -1

Query  717  VGVNADAYSPD-EPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldas  541
            VGVN   Y  D   I+SNASCTTNCLAPFVK+LD++FGI+KGTMTTTHSYTGDQRLLDAS
Sbjct  219  VGVNEKDYGHDVANIVSNASCTTNCLAPFVKILDEEFGIVKGTMTTTHSYTGDQRLLDAS  278

Query  540  hrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKK  361
            HRDLRRARAAALNIVPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLV+ V+KK
Sbjct  279  HRDLRRARAAALNIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVINVAKK  338

Query  360  TF-AEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVI  184
               AE+VNAAFR++A   L GIL+VCD PLVSVDFRC+DVSST+DSSLTMVMGDDMVKV+
Sbjct  339  GISAEDVNAAFRKAADGPLKGILAVCDVPLVSVDFRCTDVSSTIDSSLTMVMGDDMVKVV  398

Query  183  AWYDNEWGYSQRVVDLADIVANQW  112
            AWYDNEWGYSQRVVDLA +VA++W
Sbjct  399  AWYDNEWGYSQRVVDLAHLVASKW  422



>gb|AIU56855.1| glyceraldehyde-3-phosphate dehydrogenase B, partial [Brassica 
rapa subsp. chinensis]
Length=367

 Score =   245 bits (625),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 167/204 (82%), Positives = 181/204 (89%), Gaps = 2/204 (1%)
 Frame = -1

Query  717  VGVNADAYSPD-EPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldas  541
            VGVN   YS D   IISNASCTTNCLAPF KVLD++FGI+KGTMTTTHSYTGDQRLLDAS
Sbjct  135  VGVNEQDYSHDVANIISNASCTTNCLAPFAKVLDEEFGIVKGTMTTTHSYTGDQRLLDAS  194

Query  540  hrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKK  361
            HRDLRRARAAALNIVPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLV+ V KK
Sbjct  195  HRDLRRARAAALNIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVINVEKK  254

Query  360  TF-AEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVI  184
               AE+VN AFR++AA  L G+L VCD PLVS DFRCSDVS+T+DSSLTMVMGDDMVKV+
Sbjct  255  GLTAEDVNEAFRKAAAGPLKGVLEVCDTPLVSCDFRCSDVSTTIDSSLTMVMGDDMVKVV  314

Query  183  AWYDNEWGYSQRVVDLADIVANQW  112
            AWYDNEWGYSQRVVDLA +VA +W
Sbjct  315  AWYDNEWGYSQRVVDLAHLVAAKW  338



>ref|XP_009362871.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
isoform X1 [Pyrus x bretschneideri]
Length=452

 Score =   247 bits (631),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 185/204 (91%), Gaps = 2/204 (1%)
 Frame = -1

Query  717  VGVNADAYSPD-EPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldas  541
            VGVN   Y  D   I+SNASCTTNCLAPFVKVLD++FGI+KGTMTTTHSYTGDQRLLDAS
Sbjct  219  VGVNEKDYDHDVANIVSNASCTTNCLAPFVKVLDEEFGIVKGTMTTTHSYTGDQRLLDAS  278

Query  540  hrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKK  361
            HRDLRRARAAALNIVPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLV+ V+KK
Sbjct  279  HRDLRRARAAALNIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVINVAKK  338

Query  360  TF-AEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVI  184
               AE+VNAAFR++A   L GIL+VCD PLVSVDFRC+DVSST+DSSLTMVMGDDMVKV+
Sbjct  339  GISAEDVNAAFRKAADGPLKGILAVCDVPLVSVDFRCTDVSSTIDSSLTMVMGDDMVKVV  398

Query  183  AWYDNEWGYSQRVVDLADIVANQW  112
            AWYDNEWGYSQRVVDLA +VA++W
Sbjct  399  AWYDNEWGYSQRVVDLAHLVASKW  422



>ref|XP_003558903.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Brachypodium distachyon]
Length=446

 Score =   247 bits (630),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 166/204 (81%), Positives = 185/204 (91%), Gaps = 2/204 (1%)
 Frame = -1

Query  717  VGVNADAYSPD-EPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldas  541
            +GVN + Y  D   I+SNAS TTNCLAPFVKVLD++FGI+KGTMTTTHSYTGDQRLLDAS
Sbjct  214  LGVNEEGYDHDVANIVSNASWTTNCLAPFVKVLDEEFGIVKGTMTTTHSYTGDQRLLDAS  273

Query  540  hrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKK  361
            HRDLRRARAAALNIVPTSTGAAKAVALVLP LKGKLNGIALRVPTPNVSVVDLV+  +K 
Sbjct  274  HRDLRRARAAALNIVPTSTGAAKAVALVLPQLKGKLNGIALRVPTPNVSVVDLVINTAKT  333

Query  360  TF-AEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVI  184
               A++VNAAFR++AA  L+GIL VCDEPLVSVDFRCSDVSST+D+SLTMVMGDDMVKV+
Sbjct  334  GITADDVNAAFRKAAAGPLNGILDVCDEPLVSVDFRCSDVSSTIDASLTMVMGDDMVKVV  393

Query  183  AWYDNEWGYSQRVVDLADIVANQW  112
            AWYDNEWGYSQRVVDLA +VA++W
Sbjct  394  AWYDNEWGYSQRVVDLAHLVASKW  417



>emb|CEF96577.1| Glyceraldehyde 3-phosphate dehydrogenase, NAD(P) binding domain 
[Ostreococcus tauri]
Length=407

 Score =   246 bits (627),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 161/202 (80%), Positives = 179/202 (89%), Gaps = 1/202 (0%)
 Frame = -1

Query  717  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldash  538
            VGVNAD + P   I+SNASCTTNCLAPF KV+D KFGI+KGTMTTTHSYTGDQR+LDASH
Sbjct  176  VGVNADQFDPSANIVSNASCTTNCLAPFAKVIDDKFGIVKGTMTTTHSYTGDQRILDASH  235

Query  537  rdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKT  358
            RDLRRARAAALNIVPTSTGAAKAVALVLP LKGKLNGIALRVPTPNVS+VDLVV V KK 
Sbjct  236  RDLRRARAAALNIVPTSTGAAKAVALVLPQLKGKLNGIALRVPTPNVSIVDLVVNVEKKG  295

Query  357  F-AEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIA  181
              AEEVNAAF+E A   + G+L++ D PLVSVDFRC+DVS+T+D++LTMVMGDDMVKV+A
Sbjct  296  VTAEEVNAAFKEYADGPMKGVLAITDTPLVSVDFRCTDVSTTIDAALTMVMGDDMVKVVA  355

Query  180  WYDNEWGYSQRVVDLADIVANQ  115
            WYDNEWGY+QRVVDL  IVAN 
Sbjct  356  WYDNEWGYTQRVVDLTLIVANS  377



>ref|XP_010686856.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Beta vulgaris subsp. vulgaris]
Length=451

 Score =   247 bits (630),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 168/207 (81%), Positives = 184/207 (89%), Gaps = 2/207 (1%)
 Frame = -1

Query  717  VGVNADAYSPD-EPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldas  541
            VGVN   YS D   IISNASCTTNCLAPFVK++D++FGI+KGTMTTTHSYTGDQRLLDAS
Sbjct  218  VGVNEGDYSHDVANIISNASCTTNCLAPFVKIMDEEFGIVKGTMTTTHSYTGDQRLLDAS  277

Query  540  hrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKK  361
            HRDLRRARAAALNIVPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV + KK
Sbjct  278  HRDLRRARAAALNIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNIEKK  337

Query  360  TF-AEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVI  184
               AE+VN AFR++AA    G+L VCD PLVSVDFRC+DVSST+DSSLTMVMGDDMVKV+
Sbjct  338  GITAEDVNNAFRKAAAGPSKGVLEVCDIPLVSVDFRCTDVSSTIDSSLTMVMGDDMVKVV  397

Query  183  AWYDNEWGYSQRVVDLADIVANQWK*M  103
            AWYDNEWGYSQRVVDLA +VAN+W  M
Sbjct  398  AWYDNEWGYSQRVVDLAHLVANKWPGM  424



>emb|CDY69523.1| BnaC08g46180D, partial [Brassica napus]
Length=402

 Score =   245 bits (626),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 167/204 (82%), Positives = 181/204 (89%), Gaps = 2/204 (1%)
 Frame = -1

Query  717  VGVNADAYSPD-EPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldas  541
            VGVN   YS D   IISNASCTTNCLAPF KVLD++FGI+KGTMTTTHSYTGDQRLLDAS
Sbjct  169  VGVNEQDYSHDVANIISNASCTTNCLAPFAKVLDEEFGIVKGTMTTTHSYTGDQRLLDAS  228

Query  540  hrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKK  361
            HRDLRRARAAALNIVPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLV+ V KK
Sbjct  229  HRDLRRARAAALNIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVINVEKK  288

Query  360  TF-AEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVI  184
               AE+VN AFR++AA  L G+L VCD PLVS DFRCSDVS+T+DSSLTMVMGDDMVKV+
Sbjct  289  GLTAEDVNEAFRKAAAGPLKGVLEVCDTPLVSCDFRCSDVSTTIDSSLTMVMGDDMVKVV  348

Query  183  AWYDNEWGYSQRVVDLADIVANQW  112
            AWYDNEWGYSQRVVDLA +VA +W
Sbjct  349  AWYDNEWGYSQRVVDLAHLVAAKW  372



>gb|ABD37958.1| glyceraldehyde-3-phosphate dehydrogenase subunit A [Chara vulgaris]
Length=318

 Score =   242 bits (618),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 166/187 (89%), Positives = 171/187 (91%), Gaps = 0/187 (0%)
 Frame = -1

Query  717  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldash  538
            VGVN   Y P E IISNASCTTNCLAPFVKVLD KF I+KGTMTTTHSYTGDQRLLDASH
Sbjct  132  VGVNDADYDPSETIISNASCTTNCLAPFVKVLDNKFTIVKGTMTTTHSYTGDQRLLDASH  191

Query  537  rdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKT  358
            RDLRRARAAALNIVPTSTGAAKAVALVLP LKGKLNGIALRVPTPNVSVVDLVVQ +KKT
Sbjct  192  RDLRRARAAALNIVPTSTGAAKAVALVLPQLKGKLNGIALRVPTPNVSVVDLVVQTAKKT  251

Query  357  FAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAW  178
            FAEEVN AFRESA   L GIL+VCDEPLVSVDFRC+DVSSTVDSSLTMVMGDDMVKV+AW
Sbjct  252  FAEEVNNAFRESADGPLKGILAVCDEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVVAW  311

Query  177  YDNEWGY  157
            YDNE GY
Sbjct  312  YDNELGY  318



>ref|XP_009107645.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPB, chloroplastic 
[Brassica rapa]
 emb|CDY35800.1| BnaA08g04610D [Brassica napus]
Length=448

 Score =   246 bits (629),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 167/204 (82%), Positives = 181/204 (89%), Gaps = 2/204 (1%)
 Frame = -1

Query  717  VGVNADAYSPD-EPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldas  541
            VGVN   YS D   IISNASCTTNCLAPF KVLD++FGI+KGTMTTTHSYTGDQRLLDAS
Sbjct  215  VGVNEQDYSHDVANIISNASCTTNCLAPFAKVLDEEFGIVKGTMTTTHSYTGDQRLLDAS  274

Query  540  hrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKK  361
            HRDLRRARAAALNIVPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLV+ V KK
Sbjct  275  HRDLRRARAAALNIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVINVEKK  334

Query  360  TF-AEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVI  184
               AE+VN AFR++AA  L G+L VCD PLVS DFRCSDVS+T+DSSLTMVMGDDMVKV+
Sbjct  335  GLTAEDVNEAFRKAAAGPLKGVLEVCDTPLVSCDFRCSDVSTTIDSSLTMVMGDDMVKVV  394

Query  183  AWYDNEWGYSQRVVDLADIVANQW  112
            AWYDNEWGYSQRVVDLA +VA +W
Sbjct  395  AWYDNEWGYSQRVVDLAHLVAAKW  418



>ref|XP_002507103.1| glyceraldehyde-3-phosphate dehydrogenase B [Micromonas sp. RCC299]
 gb|ACO68361.1| glyceraldehyde-3-phosphate dehydrogenase B [Micromonas sp. RCC299]
Length=405

 Score =   245 bits (625),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 161/200 (81%), Positives = 178/200 (89%), Gaps = 1/200 (1%)
 Frame = -1

Query  717  VGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldash  538
            VGVNAD Y P   I+SNASCTTNCLAPF KVLD+KFGIIKGTMTT HSYTGDQR+LDASH
Sbjct  175  VGVNADQYDPSANIVSNASCTTNCLAPFAKVLDEKFGIIKGTMTTCHSYTGDQRILDASH  234

Query  537  rdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKT  358
            RDLRRARAAALNIVPTSTGAAKAVALVLP LKGKLNGIALRVPTPNVS+VDLV  V KK 
Sbjct  235  RDLRRARAAALNIVPTSTGAAKAVALVLPQLKGKLNGIALRVPTPNVSIVDLVCNVEKKG  294

Query  357  F-AEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIA  181
              AEEVNAAF+E+A   + G+L++ + PLVSVDFRCSDVS+T+D++LTMVMGDDMVKV+A
Sbjct  295  VTAEEVNAAFKEAADGPMKGVLAITETPLVSVDFRCSDVSTTIDAALTMVMGDDMVKVVA  354

Query  180  WYDNEWGYSQRVVDLADIVA  121
            WYDNEWGY+QRVVDL  IVA
Sbjct  355  WYDNEWGYTQRVVDLTHIVA  374



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1260188911410