BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF008O02

Length=753
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009767497.1|  PREDICTED: uncharacterized protein LOC104218651    264   4e-81   Nicotiana sylvestris
ref|XP_009603587.1|  PREDICTED: uncharacterized protein LOC104098539    262   2e-80   Nicotiana tomentosiformis
ref|XP_010325043.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    254   1e-78   Solanum lycopersicum
ref|XP_006354642.1|  PREDICTED: suppressor protein SRP40-like           256   4e-78   Solanum tuberosum [potatoes]
ref|XP_004229712.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    255   7e-78   Solanum lycopersicum
emb|CDP09386.1|  unnamed protein product                                229   1e-67   Coffea canephora [robusta coffee]
ref|XP_002266433.1|  PREDICTED: E3 ubiquitin-protein ligase RLIM-...    229   2e-67   Vitis vinifera
emb|CAN78871.1|  hypothetical protein VITISV_024970                     229   3e-67   Vitis vinifera
ref|XP_006372137.1|  hypothetical protein POPTR_0018s12260g             222   4e-67   
ref|XP_006372132.1|  hypothetical protein POPTR_0018s12260g             224   6e-66   
ref|XP_002325167.2|  hypothetical protein POPTR_0018s12260g             224   1e-65   Populus trichocarpa [western balsam poplar]
ref|XP_007013683.1|  RING/U-box superfamily protein isoform 2           221   5e-65   
ref|XP_007013682.1|  RING/U-box superfamily protein isoform 1           223   6e-65   
ref|XP_006372138.1|  hypothetical protein POPTR_0018s12260g             223   8e-65   
ref|XP_011017941.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    221   3e-64   Populus euphratica
ref|XP_006372136.1|  hypothetical protein POPTR_0018s12260g             219   8e-64   Populus trichocarpa [western balsam poplar]
ref|XP_002532498.1|  ring finger protein, putative                      219   1e-63   Ricinus communis
ref|XP_006453712.1|  hypothetical protein CICLE_v10007967mg             216   4e-63   
gb|KDP30182.1|  hypothetical protein JCGZ_16964                         218   4e-63   Jatropha curcas
ref|XP_006473940.1|  PREDICTED: uncharacterized protein LOC102616381    217   5e-63   Citrus sinensis [apfelsine]
gb|KDO59332.1|  hypothetical protein CISIN_1g043444mg                   217   6e-63   Citrus sinensis [apfelsine]
ref|XP_006453713.1|  hypothetical protein CICLE_v10007967mg             217   6e-63   Citrus clementina [clementine]
ref|XP_011017942.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    216   1e-62   Populus euphratica
ref|XP_011017940.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    216   2e-62   Populus euphratica
gb|KHG26588.1|  RING-H2 finger ATL11 -like protein                      214   7e-62   Gossypium arboreum [tree cotton]
ref|XP_003549707.1|  PREDICTED: uncharacterized protein DDB_G0271...    213   2e-61   Glycine max [soybeans]
gb|KJB27057.1|  hypothetical protein B456_004G275100                    212   3e-61   Gossypium raimondii
ref|XP_010244797.1|  PREDICTED: uncharacterized protein LOC104588534    211   6e-61   Nelumbo nucifera [Indian lotus]
ref|XP_011093487.1|  PREDICTED: uncharacterized RING finger prote...    210   1e-60   Sesamum indicum [beniseed]
ref|XP_003542670.1|  PREDICTED: uncharacterized protein DDB_G0271...    211   2e-60   Glycine max [soybeans]
gb|KJB27058.1|  hypothetical protein B456_004G275100                    211   2e-60   Gossypium raimondii
gb|KHN47137.1|  RING-H2 finger protein ATL65                            211   2e-60   Glycine soja [wild soybean]
ref|XP_009338413.1|  PREDICTED: uncharacterized protein LOC103930767    207   3e-59   Pyrus x bretschneideri [bai li]
ref|XP_009358516.1|  PREDICTED: uncharacterized protein LOC103949139    206   9e-59   Pyrus x bretschneideri [bai li]
ref|XP_007203806.1|  hypothetical protein PRUPE_ppa003827mg             205   2e-58   Prunus persica
ref|XP_008242903.1|  PREDICTED: probable GPI-anchored adhesin-lik...    204   4e-58   Prunus mume [ume]
ref|XP_002308375.2|  hypothetical protein POPTR_0006s20490g             204   1e-57   
gb|KDP28901.1|  hypothetical protein JCGZ_14672                         201   2e-57   Jatropha curcas
ref|XP_010244858.1|  PREDICTED: uncharacterized protein LOC104588...    202   3e-57   Nelumbo nucifera [Indian lotus]
ref|XP_008784815.1|  PREDICTED: E3 ubiquitin-protein ligase RLIM-...    201   9e-57   Phoenix dactylifera
ref|XP_010942169.1|  PREDICTED: uncharacterized protein LOC105060...    199   3e-56   Elaeis guineensis
ref|XP_008336935.1|  PREDICTED: uncharacterized protein LOC103400032    199   5e-56   
ref|XP_007155111.1|  hypothetical protein PHAVU_003G174300g             195   1e-54   Phaseolus vulgaris [French bean]
ref|XP_004287233.1|  PREDICTED: uncharacterized protein LOC101295849    193   4e-54   Fragaria vesca subsp. vesca
emb|CDP10509.1|  unnamed protein product                                192   1e-53   Coffea canephora [robusta coffee]
emb|CBI25594.3|  unnamed protein product                                181   4e-53   Vitis vinifera
ref|XP_006386552.1|  hypothetical protein POPTR_0002s14140g             190   6e-53   
gb|KJB64603.1|  hypothetical protein B456_010G056600                    188   2e-52   Gossypium raimondii
gb|KEH32158.1|  zinc finger, C3HC4 type (RING finger) protein           188   2e-52   Medicago truncatula
ref|XP_003609509.1|  RING finger protein                                189   3e-52   Medicago truncatula
gb|KJB64604.1|  hypothetical protein B456_010G056600                    188   4e-52   Gossypium raimondii
ref|XP_002526496.1|  ring finger protein, putative                      186   2e-51   Ricinus communis
ref|XP_004146706.1|  PREDICTED: uncharacterized protein LOC101215855    186   2e-51   Cucumis sativus [cucumbers]
ref|XP_008443909.1|  PREDICTED: uncharacterized protein LOC103487...    185   5e-51   Cucumis melo [Oriental melon]
ref|XP_009341793.1|  PREDICTED: uncharacterized protein LOC103933...    181   7e-51   
ref|XP_009401073.1|  PREDICTED: uncharacterized protein LOC103985168    184   8e-51   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006375202.1|  hypothetical protein POPTR_0014s05240g             182   3e-50   Populus trichocarpa [western balsam poplar]
ref|XP_009341792.1|  PREDICTED: E3 ubiquitin-protein ligase RNF6-...    182   3e-50   Pyrus x bretschneideri [bai li]
ref|XP_008443908.1|  PREDICTED: E3 ubiquitin-protein ligase RNF12...    181   2e-49   
ref|XP_008384717.1|  PREDICTED: uncharacterized protein DDB_G0271...    181   3e-49   
gb|ADE76258.1|  unknown                                                 181   3e-49   Picea sitchensis
gb|KJB64605.1|  hypothetical protein B456_010G056600                    180   4e-49   Gossypium raimondii
ref|XP_009783355.1|  PREDICTED: E3 ubiquitin-protein ligase RLIM-...    177   3e-48   Nicotiana sylvestris
ref|XP_010101179.1|  E3 ubiquitin-protein ligase                        175   4e-47   
ref|XP_011078564.1|  PREDICTED: uncharacterized protein LOC105162267    174   1e-46   Sesamum indicum [beniseed]
ref|XP_004508616.1|  PREDICTED: uncharacterized protein LOC101493889    172   2e-46   Cicer arietinum [garbanzo]
ref|XP_011032832.1|  PREDICTED: uncharacterized protein LOC105131519    170   1e-45   Populus euphratica
ref|XP_009406595.1|  PREDICTED: E3 ubiquitin-protein ligase RLIM-...    169   2e-45   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009613894.1|  PREDICTED: E3 ubiquitin-protein ligase RLIM-...    168   8e-45   Nicotiana tomentosiformis
ref|XP_010323264.1|  PREDICTED: E3 ubiquitin-protein ligase RLIM-...    166   4e-44   
ref|XP_006359526.1|  PREDICTED: E3 ubiquitin-protein ligase RLIM-...    166   4e-44   
ref|XP_004242710.1|  PREDICTED: E3 ubiquitin-protein ligase RLIM-...    166   5e-44   Solanum lycopersicum
ref|XP_006359525.1|  PREDICTED: E3 ubiquitin-protein ligase RLIM-...    166   6e-44   Solanum tuberosum [potatoes]
ref|XP_010687757.1|  PREDICTED: uncharacterized protein LOC104901...    162   9e-43   
ref|XP_010687756.1|  PREDICTED: uncharacterized protein LOC104901...    162   1e-42   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008343916.1|  PREDICTED: E3 ubiquitin-protein ligase RNF13...    141   3e-38   
ref|XP_010542078.1|  PREDICTED: E3 ubiquitin-protein ligase RLIM-...    147   3e-37   Tarenaya hassleriana [spider flower]
ref|XP_010049886.1|  PREDICTED: uncharacterized RING finger prote...    144   2e-36   
ref|XP_010049885.1|  PREDICTED: uncharacterized RING finger prote...    144   3e-36   Eucalyptus grandis [rose gum]
ref|XP_010235925.1|  PREDICTED: uncharacterized protein LOC100833...    143   8e-36   
ref|XP_003570316.1|  PREDICTED: uncharacterized protein LOC100833...    143   1e-35   Brachypodium distachyon [annual false brome]
ref|XP_008677723.1|  PREDICTED: uncharacterized protein LOC100501...    142   1e-35   Zea mays [maize]
gb|ACG25313.1|  zinc finger, C3HC4 type family protein                  142   3e-35   Zea mays [maize]
ref|XP_007218486.1|  hypothetical protein PRUPE_ppa012075mg             134   6e-35   Prunus persica
ref|NP_001183423.1|  uncharacterized protein LOC100501846               139   2e-34   Zea mays [maize]
ref|XP_008681417.1|  PREDICTED: LOC100273142 isoform X2                 139   2e-34   Zea mays [maize]
ref|NP_001141061.1|  LOC100273142                                       139   2e-34   Zea mays [maize]
ref|XP_004954239.1|  PREDICTED: uncharacterized protein DDB_G0271...    139   2e-34   Setaria italica
ref|XP_011033495.1|  PREDICTED: E3 ubiquitin-protein ligase RLIM-...    139   3e-34   Populus euphratica
ref|XP_011033498.1|  PREDICTED: E3 ubiquitin-protein ligase RLIM-...    138   3e-34   Populus euphratica
ref|XP_011033497.1|  PREDICTED: E3 ubiquitin-protein ligase RLIM-...    138   3e-34   Populus euphratica
ref|XP_004954238.1|  PREDICTED: uncharacterized protein DDB_G0271...    138   5e-34   
ref|NP_001048403.1|  Os02g0798600                                       137   5e-34   
ref|XP_010542076.1|  PREDICTED: uncharacterized protein LOC104815...    138   6e-34   Tarenaya hassleriana [spider flower]
ref|XP_010542075.1|  PREDICTED: uncharacterized protein LOC104815...    138   6e-34   Tarenaya hassleriana [spider flower]
gb|EEC74180.1|  hypothetical protein OsI_09301                          136   2e-33   Oryza sativa Indica Group [Indian rice]
ref|XP_008681416.1|  PREDICTED: LOC100273142 isoform X1                 136   3e-33   Zea mays [maize]
ref|XP_006648059.1|  PREDICTED: uncharacterized protein LOC102702...    135   4e-33   Oryza brachyantha
ref|XP_008245341.1|  PREDICTED: protein goliath-like                    127   4e-32   Prunus mume [ume]
gb|EMS64581.1|  E3 ubiquitin-protein ligase RNF12-B                     133   4e-32   Triticum urartu
ref|XP_010942170.1|  PREDICTED: uncharacterized protein LOC105060...    132   5e-32   
ref|XP_006648058.1|  PREDICTED: uncharacterized protein LOC102702...    132   5e-32   
ref|XP_004164172.1|  PREDICTED: uncharacterized LOC101213468            130   3e-31   
ref|XP_004150547.1|  PREDICTED: uncharacterized protein LOC101213468    130   4e-31   Cucumis sativus [cucumbers]
ref|XP_008681419.1|  PREDICTED: LOC100273142 isoform X4                 129   6e-31   Zea mays [maize]
ref|XP_008681418.1|  PREDICTED: LOC100273142 isoform X3                 129   6e-31   Zea mays [maize]
ref|XP_007156334.1|  hypothetical protein PHAVU_003G2777000g            127   2e-30   Phaseolus vulgaris [French bean]
gb|KCW78408.1|  hypothetical protein EUGRSUZ_D02574                     127   2e-30   Eucalyptus grandis [rose gum]
ref|XP_008451863.1|  PREDICTED: uncharacterized protein LOC103493...    128   2e-30   Cucumis melo [Oriental melon]
ref|XP_010054024.1|  PREDICTED: uncharacterized protein LOC104442...    127   2e-30   Eucalyptus grandis [rose gum]
dbj|BAJ97192.1|  predicted protein                                      127   5e-30   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_011027973.1|  PREDICTED: uncharacterized protein LOC105128143    127   8e-30   Populus euphratica
ref|XP_003548587.1|  PREDICTED: uncharacterized protein LOC100812272    126   9e-30   Glycine max [soybeans]
gb|KHN27508.1|  E3 ubiquitin-protein ligase RING1-like                  126   9e-30   Glycine soja [wild soybean]
ref|XP_010231451.1|  PREDICTED: uncharacterized protein LOC100838775    125   1e-29   Brachypodium distachyon [annual false brome]
ref|XP_010676682.1|  PREDICTED: uncharacterized RING finger prote...    126   1e-29   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008373442.1|  PREDICTED: uncharacterized protein DDB_G0271...    126   1e-29   
ref|XP_009365723.1|  PREDICTED: uncharacterized protein LOC103955...    125   2e-29   Pyrus x bretschneideri [bai li]
ref|XP_006368244.1|  hypothetical protein POPTR_0001s00920g             125   2e-29   Populus trichocarpa [western balsam poplar]
ref|XP_007158096.1|  hypothetical protein PHAVU_002G123800g             125   2e-29   Phaseolus vulgaris [French bean]
ref|XP_011018359.1|  PREDICTED: uncharacterized protein LOC105121...    125   2e-29   Populus euphratica
ref|XP_011018360.1|  PREDICTED: uncharacterized protein LOC105121...    125   3e-29   Populus euphratica
gb|KDP28062.1|  hypothetical protein JCGZ_19470                         125   3e-29   Jatropha curcas
emb|CAN68374.1|  hypothetical protein VITISV_033239                     122   3e-29   Vitis vinifera
ref|XP_006878661.1|  hypothetical protein AMTR_s00011p00266440          125   3e-29   
ref|XP_011082154.1|  PREDICTED: uncharacterized protein LOC105164987    125   4e-29   Sesamum indicum [beniseed]
ref|XP_002519918.1|  ring finger protein, putative                      123   6e-29   
ref|XP_006432887.1|  hypothetical protein CICLE_v10000893mg             124   6e-29   Citrus clementina [clementine]
gb|KDO43649.1|  hypothetical protein CISIN_1g010258mg                   123   6e-29   Citrus sinensis [apfelsine]
emb|CBI29217.3|  unnamed protein product                                123   6e-29   Vitis vinifera
ref|XP_006432888.1|  hypothetical protein CICLE_v10000893mg             123   6e-29   Citrus clementina [clementine]
gb|KDO43648.1|  hypothetical protein CISIN_1g010258mg                   123   7e-29   Citrus sinensis [apfelsine]
ref|XP_010644636.1|  PREDICTED: E3 ubiquitin-protein ligase RLIM ...    124   9e-29   Vitis vinifera
ref|XP_002270708.1|  PREDICTED: uncharacterized protein LOC100249...    124   9e-29   Vitis vinifera
ref|XP_009382631.1|  PREDICTED: uncharacterized RING finger prote...    123   9e-29   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003612544.1|  RING finger protein                                123   1e-28   Medicago truncatula
ref|XP_003516501.1|  PREDICTED: uncharacterized protein LOC100815...    123   1e-28   Glycine max [soybeans]
ref|XP_004512347.1|  PREDICTED: uncharacterized protein LOC101497...    123   1e-28   
ref|XP_004509520.1|  PREDICTED: uncharacterized protein LOC101492...    123   1e-28   Cicer arietinum [garbanzo]
ref|XP_008797986.1|  PREDICTED: uncharacterized RING finger prote...    122   1e-28   
emb|CDP15688.1|  unnamed protein product                                123   1e-28   Coffea canephora [robusta coffee]
ref|XP_004512348.1|  PREDICTED: uncharacterized protein LOC101497...    123   1e-28   Cicer arietinum [garbanzo]
gb|KHN41757.1|  E3 ubiquitin-protein ligase ATL9                        123   2e-28   Glycine soja [wild soybean]
ref|XP_003533473.1|  PREDICTED: uncharacterized protein LOC100786...    123   2e-28   Glycine max [soybeans]
ref|XP_004301769.1|  PREDICTED: uncharacterized protein LOC101314...    122   2e-28   Fragaria vesca subsp. vesca
gb|KHN11800.1|  RING finger protein 44                                  122   2e-28   Glycine soja [wild soybean]
ref|XP_010266395.1|  PREDICTED: uncharacterized RING finger prote...    122   2e-28   
ref|XP_008797985.1|  PREDICTED: uncharacterized RING finger prote...    122   2e-28   Phoenix dactylifera
ref|XP_003548701.1|  PREDICTED: uncharacterized protein LOC100800...    123   2e-28   Glycine max [soybeans]
ref|XP_010275184.1|  PREDICTED: uncharacterized protein LOC104610...    122   2e-28   Nelumbo nucifera [Indian lotus]
ref|XP_006359939.1|  PREDICTED: uncharacterized protein DDB_G0271...    122   3e-28   Solanum tuberosum [potatoes]
ref|XP_004246031.1|  PREDICTED: uncharacterized protein LOC101258...    122   4e-28   Solanum lycopersicum
gb|EYU37447.1|  hypothetical protein MIMGU_mgv1a023483mg                121   4e-28   Erythranthe guttata [common monkey flower]
ref|XP_009413209.1|  PREDICTED: uncharacterized protein LOC103994565    121   4e-28   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010942980.1|  PREDICTED: uncharacterized protein LOC105060...    121   4e-28   
ref|XP_007210254.1|  hypothetical protein PRUPE_ppa003419mg             122   4e-28   Prunus persica
ref|XP_010266389.1|  PREDICTED: uncharacterized protein LOC104603...    122   4e-28   Nelumbo nucifera [Indian lotus]
ref|XP_008238020.1|  PREDICTED: uncharacterized protein LOC103336702    122   4e-28   Prunus mume [ume]
gb|KFK31579.1|  hypothetical protein AALP_AA6G130400                    121   4e-28   Arabis alpina [alpine rockcress]
ref|XP_010942981.1|  PREDICTED: uncharacterized protein LOC105060...    121   5e-28   Elaeis guineensis
gb|EMT17820.1|  RING finger protein 13                                  122   5e-28   
ref|XP_002304401.2|  hypothetical protein POPTR_0003s10580g             121   7e-28   
ref|XP_007040898.1|  RING/U-box superfamily protein, putative           120   8e-28   
ref|XP_008656336.1|  PREDICTED: E3 ubiquitin-protein ligase RLIM        120   1e-27   
ref|XP_004962197.1|  PREDICTED: E3 ubiquitin-protein ligase RLIM-...    120   1e-27   Setaria italica
ref|XP_009610445.1|  PREDICTED: uncharacterized protein LOC104104...    121   1e-27   Nicotiana tomentosiformis
ref|XP_009761903.1|  PREDICTED: uncharacterized protein LOC104214...    120   1e-27   Nicotiana sylvestris
emb|CDY66374.1|  BnaCnng50560D                                          119   1e-27   Brassica napus [oilseed rape]
ref|XP_002439736.1|  hypothetical protein SORBIDRAFT_09g019240          120   1e-27   Sorghum bicolor [broomcorn]
ref|XP_006398197.1|  hypothetical protein EUTSA_v10000852mg             119   2e-27   Eutrema salsugineum [saltwater cress]
ref|XP_009101610.1|  PREDICTED: uncharacterized protein LOC103827808    119   2e-27   Brassica rapa
ref|XP_006398196.1|  hypothetical protein EUTSA_v10000852mg             119   2e-27   
emb|CDY39419.1|  BnaAnng05500D                                          119   2e-27   Brassica napus [oilseed rape]
ref|XP_008649595.1|  PREDICTED: uncharacterized protein DDB_G0271...    119   2e-27   Zea mays [maize]
gb|EEE63593.1|  hypothetical protein OsJ_18410                          118   4e-27   Oryza sativa Japonica Group [Japonica rice]
gb|EAY97905.1|  hypothetical protein OsI_19822                          118   4e-27   Oryza sativa Indica Group [Indian rice]
ref|XP_006654355.1|  PREDICTED: uncharacterized protein LOC102715390    118   5e-27   Oryza brachyantha
ref|NP_001055435.1|  Os05g0389600                                       118   6e-27   
ref|XP_010538594.1|  PREDICTED: uncharacterized protein LOC104812893    118   9e-27   Tarenaya hassleriana [spider flower]
gb|KEH20328.1|  zinc finger, C3HC4 type (RING finger) protein           117   1e-26   Medicago truncatula
ref|XP_003628997.1|  RING finger protein                                117   1e-26   
gb|AET03473.2|  zinc finger, C3HC4 type (RING finger) protein           117   1e-26   Medicago truncatula
gb|KHG06875.1|  RING finger 38                                          117   1e-26   Gossypium arboreum [tree cotton]
gb|KHG17348.1|  E3 ubiquitin-protein ligase                             115   2e-26   Gossypium arboreum [tree cotton]
gb|KJB25088.1|  hypothetical protein B456_004G176400                    116   2e-26   Gossypium raimondii
dbj|BAB10250.1|  unnamed protein product                                117   2e-26   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002863492.1|  zinc finger family protein                         116   3e-26   
ref|XP_002517219.1|  ring finger protein, putative                      116   3e-26   
ref|XP_011027972.1|  PREDICTED: uncharacterized protein LOC105128142    117   3e-26   Populus euphratica
ref|NP_001119377.1|  RING/U-box domain-containing protein               116   4e-26   Arabidopsis thaliana [mouse-ear cress]
ref|NP_199342.2|  RING/U-box domain-containing protein                  116   4e-26   Arabidopsis thaliana [mouse-ear cress]
gb|AAL47429.1|  AT5g45290/K9E15_7                                       116   4e-26   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010529275.1|  PREDICTED: E3 ubiquitin-protein ligase RLIM ...    114   2e-25   Tarenaya hassleriana [spider flower]
ref|XP_006279608.1|  hypothetical protein CARUB_v10026185mg             114   2e-25   Capsella rubella
ref|XP_010441759.1|  PREDICTED: uncharacterized protein LOC104724892    112   7e-25   Camelina sativa [gold-of-pleasure]
ref|XP_010481610.1|  PREDICTED: uncharacterized protein LOC104760389    112   8e-25   Camelina sativa [gold-of-pleasure]
ref|XP_010494621.1|  PREDICTED: uncharacterized protein LOC104771743    112   8e-25   Camelina sativa [gold-of-pleasure]
ref|XP_010054025.1|  PREDICTED: uncharacterized protein LOC104442...    111   1e-24   Eucalyptus grandis [rose gum]
gb|EYU42322.1|  hypothetical protein MIMGU_mgv1a0068871mg               110   1e-24   Erythranthe guttata [common monkey flower]
ref|XP_008451865.1|  PREDICTED: uncharacterized protein LOC103493...    110   5e-24   Cucumis melo [Oriental melon]
ref|XP_010676683.1|  PREDICTED: uncharacterized protein LOC104892...    110   6e-24   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008373443.1|  PREDICTED: uncharacterized protein DDB_G0271...    110   7e-24   
ref|XP_009365724.1|  PREDICTED: uncharacterized protein LOC103955...    110   7e-24   Pyrus x bretschneideri [bai li]
ref|XP_009761905.1|  PREDICTED: uncharacterized protein LOC104214...    110   8e-24   Nicotiana sylvestris
ref|XP_007158097.1|  hypothetical protein PHAVU_002G123800g             109   9e-24   Phaseolus vulgaris [French bean]
ref|XP_006359940.1|  PREDICTED: uncharacterized protein DDB_G0271...    108   4e-23   Solanum tuberosum [potatoes]
ref|XP_010325629.1|  PREDICTED: uncharacterized protein LOC101258...    107   4e-23   Solanum lycopersicum
ref|XP_006573493.1|  PREDICTED: uncharacterized protein LOC100815...    107   7e-23   Glycine max [soybeans]
ref|XP_006587658.1|  PREDICTED: uncharacterized protein LOC100786...    107   7e-23   Glycine max [soybeans]
ref|XP_009610446.1|  PREDICTED: uncharacterized protein LOC104104...    107   9e-23   Nicotiana tomentosiformis
ref|XP_010275185.1|  PREDICTED: uncharacterized protein LOC104610...    107   1e-22   Nelumbo nucifera [Indian lotus]
ref|XP_011465298.1|  PREDICTED: uncharacterized protein LOC101314...    106   1e-22   Fragaria vesca subsp. vesca
ref|XP_010266394.1|  PREDICTED: uncharacterized protein LOC104603...    105   2e-22   Nelumbo nucifera [Indian lotus]
ref|XP_006372133.1|  hypothetical protein POPTR_0018s12260g             102   1e-21   
gb|AFW70578.1|  putative homeodomain-like transcription factor su...    103   4e-21   
ref|XP_006372134.1|  hypothetical protein POPTR_0018s12260g           99.8    1e-20   
ref|XP_006372135.1|  hypothetical protein POPTR_0018s12260g           99.8    2e-20   
ref|XP_006599202.1|  PREDICTED: uncharacterized protein LOC100800...  97.4    1e-19   Glycine max [soybeans]
ref|XP_009338815.1|  PREDICTED: receptor homology region, transme...  84.3    4e-17   Pyrus x bretschneideri [bai li]
gb|EPS57989.1|  hypothetical protein M569_16829                       83.6    8e-17   Genlisea aurea
ref|XP_008646805.1|  PREDICTED: uncharacterized protein LOC103628370  85.1    8e-16   
ref|XP_010244859.1|  PREDICTED: uncharacterized protein LOC104588...  85.9    9e-16   Nelumbo nucifera [Indian lotus]
ref|XP_002454715.1|  hypothetical protein SORBIDRAFT_04g036100        82.8    1e-14   
gb|AAT68478.1|  unknown                                               70.9    1e-12   Zea mays [maize]
gb|EYU42321.1|  hypothetical protein MIMGU_mgv1a0068872mg             67.8    2e-11   Erythranthe guttata [common monkey flower]
ref|XP_002973809.1|  hypothetical protein SELMODRAFT_100003           67.4    2e-11   
ref|XP_002983588.1|  hypothetical protein SELMODRAFT_118474           67.4    2e-11   
ref|XP_010096419.1|  E3 ubiquitin-protein ligase                      67.4    3e-11   
gb|AFW73880.1|  putative RING zinc finger domain superfamily protein  70.5    1e-10   
dbj|BAK00814.1|  predicted protein                                    69.3    4e-10   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_001770745.1|  predicted protein                                63.9    4e-10   
gb|KJB63216.1|  hypothetical protein B456_010G0001003                 63.5    5e-10   Gossypium raimondii
ref|XP_008309585.1|  PREDICTED: uncharacterized protein DDB_G0271...  67.8    1e-09   Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_008309586.1|  PREDICTED: uncharacterized protein DDB_G0271...  67.8    1e-09   Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_002980346.1|  hypothetical protein SELMODRAFT_112690           62.8    3e-09   
gb|KFH67898.1|  hypothetical protein MVEG_06629                       66.6    3e-09   Mortierella verticillata NRRL 6337
ref|XP_005098689.1|  PREDICTED: E3 ubiquitin-protein ligase RNF6-...  66.2    3e-09   
ref|XP_005098687.1|  PREDICTED: E3 ubiquitin-protein ligase RNF6-...  66.2    4e-09   Aplysia californica
ref|XP_005098690.1|  PREDICTED: E3 ubiquitin-protein ligase RNF6-...  65.9    4e-09   
ref|XP_005937012.1|  PREDICTED: trichohyalin-like isoform X1          65.5    5e-09   Haplochromis burtoni
ref|XP_005368578.1|  PREDICTED: E3 ubiquitin-protein ligase RLIM-...  65.9    6e-09   
gb|KJB84438.1|  hypothetical protein B456_N0257002                    61.2    7e-09   Gossypium raimondii
ref|XP_005832378.1|  hypothetical protein GUITHDRAFT_163270           63.2    9e-09   Guillardia theta CCMP2712
ref|XP_002962565.1|  hypothetical protein SELMODRAFT_67002            64.3    9e-09   
ref|XP_005745220.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...  64.7    1e-08   Pundamilia nyererei
ref|XP_008296350.1|  PREDICTED: E3 ubiquitin-protein ligase RLIM-...  64.7    1e-08   Stegastes partitus
ref|XP_008296351.1|  PREDICTED: E3 ubiquitin-protein ligase RLIM-...  64.7    1e-08   Stegastes partitus
ref|XP_001923015.2|  PREDICTED: uncharacterized protein wu:fb39e10    64.3    2e-08   
ref|XP_007907222.1|  PREDICTED: topoisomerase I damage affected p...  64.3    2e-08   Callorhinchus milii [Australian ghost shark]
gb|ABI35905.1|  ring finger protein 13                                58.9    2e-08   Bubalus bubalis [domestic water buffalo]
ref|XP_005745172.1|  PREDICTED: uncharacterized protein LOC102212002  63.9    2e-08   Pundamilia nyererei
emb|CDQ63220.1|  unnamed protein product                              63.5    2e-08   Oncorhynchus mykiss
ref|XP_002500708.1|  predicted protein                                61.6    2e-08   Micromonas commoda
ref|XP_004571533.1|  PREDICTED: uncharacterized protein LOC101465249  63.9    2e-08   
ref|XP_006163845.1|  PREDICTED: E3 ubiquitin-protein ligase RLIM-...  63.9    2e-08   Tupaia chinensis
ref|XP_002992777.1|  hypothetical protein SELMODRAFT_47510            62.8    2e-08   
ref|XP_006217268.1|  PREDICTED: E3 ubiquitin-protein ligase RLIM-...  63.9    3e-08   Vicugna pacos
ref|YP_009120414.1|  RING-finger E3 ubiquitin-protein ligase          63.5    3e-08   Pandoravirus inopinatum
ref|XP_007567553.1|  PREDICTED: RING finger protein 44-like           60.1    3e-08   Poecilia formosa
ref|XP_002501879.1|  predicted protein                                63.2    3e-08   Micromonas commoda
ref|XP_007907223.1|  PREDICTED: uncharacterized protein LOC103188...  63.5    4e-08   Callorhinchus milii [Australian ghost shark]
ref|XP_005449197.1|  PREDICTED: uncharacterized abhydrolase domai...  62.8    5e-08   Oreochromis niloticus
ref|XP_011403142.1|  PREDICTED: RING finger protein 44-like           60.5    5e-08   
ref|XP_005369585.1|  PREDICTED: E3 ubiquitin-protein ligase RLIM-...  62.8    5e-08   
ref|XP_001766111.1|  predicted protein                                62.0    5e-08   
gb|ABK25681.1|  unknown                                               62.8    5e-08   Picea sitchensis
gb|EFB18530.1|  hypothetical protein PANDA_013950                     62.4    5e-08   Ailuropoda melanoleuca
ref|XP_005449198.1|  PREDICTED: uncharacterized abhydrolase domai...  62.8    6e-08   Oreochromis niloticus
ref|XP_006036709.1|  PREDICTED: E3 ubiquitin-protein ligase RNF13...  59.7    6e-08   
ref|XP_005937022.1|  PREDICTED: uncharacterized protein LOC102301173  62.4    6e-08   Haplochromis burtoni
ref|XP_009973709.1|  PREDICTED: E3 ubiquitin-protein ligase RNF13     59.7    7e-08   Tyto alba [Schleiereule]
ref|XP_009512532.1|  PREDICTED: E3 ubiquitin-protein ligase RNF13...  59.7    7e-08   Phalacrocorax carbo [common cormorant]
ref|XP_010194280.1|  PREDICTED: E3 ubiquitin-protein ligase RNF13     59.7    8e-08   Colius striatus
ref|XP_004716190.1|  PREDICTED: E3 ubiquitin-protein ligase RNF167    62.0    8e-08   Echinops telfairi [lesser hedgehog tenrec]
ref|XP_007238141.1|  PREDICTED: uncharacterized protein LOC103042...  62.4    8e-08   Astyanax mexicanus [blind cave fish]
ref|XP_002706238.3|  PREDICTED: E3 ubiquitin-protein ligase RLIM-...  62.4    9e-08   
gb|EFB18913.1|  hypothetical protein PANDA_019185                     62.0    9e-08   Ailuropoda melanoleuca
ref|XP_010751472.1|  PREDICTED: E3 ubiquitin-protein ligase MBR2-...  62.0    1e-07   
ref|XP_007109239.1|  PREDICTED: E3 ubiquitin-protein ligase RNF16...  61.6    1e-07   
ref|XP_004376148.1|  PREDICTED: E3 ubiquitin-protein ligase RNF167    61.6    1e-07   
ref|XP_004760491.1|  PREDICTED: E3 ubiquitin-protein ligase RNF16...  61.6    1e-07   
ref|XP_011235331.1|  PREDICTED: E3 ubiquitin-protein ligase RNF16...  61.6    1e-07   
ref|XP_010853696.1|  PREDICTED: E3 ubiquitin-protein ligase RLIM-...  60.5    1e-07   
ref|XP_004760488.1|  PREDICTED: E3 ubiquitin-protein ligase RNF16...  61.6    1e-07   
ref|XP_008591128.1|  PREDICTED: E3 ubiquitin-protein ligase RNF13...  59.3    1e-07   
ref|XP_004760490.1|  PREDICTED: E3 ubiquitin-protein ligase RNF16...  61.6    1e-07   
ref|XP_004000492.1|  PREDICTED: E3 ubiquitin-protein ligase RLIM-...  62.0    1e-07   
ref|XP_010126234.1|  PREDICTED: E3 ubiquitin-protein ligase RNF13     59.7    1e-07   
ref|XP_006922313.1|  PREDICTED: E3 ubiquitin-protein ligase RNF167    61.6    1e-07   
ref|XP_006163841.1|  PREDICTED: E3 ubiquitin-protein ligase RLIM-...  62.0    1e-07   
ref|XP_007935726.1|  PREDICTED: E3 ubiquitin-protein ligase RNF167    61.6    1e-07   
gb|KFH67524.1|  hypothetical protein MVEG_06256                       62.0    1e-07   
ref|XP_011358022.1|  PREDICTED: E3 ubiquitin-protein ligase RNF16...  61.6    1e-07   
ref|XP_006743196.1|  PREDICTED: E3 ubiquitin-protein ligase RNF167    61.6    1e-07   
gb|ELK03761.1|  E3 ubiquitin-protein ligase RNF167                    61.6    1e-07   
ref|XP_008410835.1|  PREDICTED: E3 ubiquitin-protein ligase RLIM-...  61.6    1e-07   
ref|XP_004069828.1|  PREDICTED: uncharacterized protein LOC101160...  61.6    1e-07   
ref|XP_011070991.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  60.5    1e-07   
ref|XP_011474715.1|  PREDICTED: uncharacterized protein LOC101160...  61.6    1e-07   
ref|XP_008410837.1|  PREDICTED: uncharacterized protein LOC103466...  61.6    1e-07   
ref|XP_009766983.1|  PREDICTED: RING-H2 finger protein ATL67-like     60.1    1e-07   
ref|XP_004326844.1|  PREDICTED: E3 ubiquitin-protein ligase RNF13...  59.3    1e-07   
ref|XP_002929081.1|  PREDICTED: E3 ubiquitin-protein ligase RNF16...  61.6    1e-07   
ref|XP_007090691.1|  PREDICTED: E3 ubiquitin-protein ligase RLIM-...  61.6    1e-07   
ref|XP_007109238.1|  PREDICTED: E3 ubiquitin-protein ligase RNF16...  61.2    1e-07   
ref|XP_007166565.1|  PREDICTED: E3 ubiquitin-protein ligase RNF16...  61.2    1e-07   
dbj|BAK02242.1|  predicted protein                                    59.7    1e-07   
ref|XP_009918397.1|  PREDICTED: E3 ubiquitin-protein ligase RLIM ...  61.6    1e-07   
ref|XP_008536850.1|  PREDICTED: E3 ubiquitin-protein ligase RNF13...  60.8    1e-07   
ref|XP_009610438.1|  PREDICTED: RING-H2 finger protein ATL66-like     59.3    1e-07   
ref|XP_005994980.1|  PREDICTED: E3 ubiquitin-protein ligase RLIM ...  61.6    1e-07   
ref|XP_009958894.1|  PREDICTED: E3 ubiquitin-protein ligase RNF13...  59.3    1e-07   
gb|AAD34209.1|AF069992_1  LIM domain interacting RING finger protein  61.6    1e-07   
ref|XP_008410836.1|  PREDICTED: uncharacterized protein LOC103466...  61.2    1e-07   
ref|XP_004398637.1|  PREDICTED: E3 ubiquitin-protein ligase RNF167    61.2    1e-07   
ref|XP_003802274.1|  PREDICTED: E3 ubiquitin-protein ligase RLIM      61.6    1e-07   
ref|XP_011358025.1|  PREDICTED: E3 ubiquitin-protein ligase RNF16...  61.2    1e-07   
ref|XP_005512895.1|  PREDICTED: E3 ubiquitin-protein ligase RLIM ...  61.6    1e-07   
ref|XP_007567560.1|  PREDICTED: uncharacterized protein LOC103148640  61.2    1e-07   
ref|XP_008410834.1|  PREDICTED: E3 ubiquitin-protein ligase RLIM-...  61.6    1e-07   
ref|XP_005911293.1|  PREDICTED: E3 ubiquitin-protein ligase RLIM-...  61.6    1e-07   
dbj|BAC81441.1|  XRnf12                                               61.6    2e-07   
gb|AAD42875.1|AF155109_1  putative ring zinc finger protein NY-RE...  61.6    2e-07   
ref|XP_009967112.1|  PREDICTED: E3 ubiquitin-protein ligase RLIM      61.6    2e-07   
ref|XP_010629520.1|  PREDICTED: E3 ubiquitin-protein ligase RLIM ...  61.6    2e-07   
gb|AAP34453.1|  LP2254                                                60.1    2e-07   
ref|XP_010020677.1|  PREDICTED: E3 ubiquitin-protein ligase RLIM      61.6    2e-07   
ref|XP_005512894.1|  PREDICTED: E3 ubiquitin-protein ligase RLIM ...  61.6    2e-07   
ref|XP_008686160.1|  PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin...  61.2    2e-07   
ref|XP_007089273.1|  PREDICTED: E3 ubiquitin-protein ligase RLIM      61.6    2e-07   
gb|EXX70132.1|  hypothetical protein RirG_090200                      60.8    2e-07   
gb|KFQ79958.1|  E3 ubiquitin-protein ligase RNF12-A                   61.6    2e-07   
ref|XP_010845701.1|  PREDICTED: E3 ubiquitin-protein ligase RNF16...  60.8    2e-07   
ref|XP_004592818.1|  PREDICTED: E3 ubiquitin-protein ligase RLIM      61.6    2e-07   
ref|XP_005493360.1|  PREDICTED: E3 ubiquitin-protein ligase RLIM ...  61.6    2e-07   
ref|XP_010629528.1|  PREDICTED: E3 ubiquitin-protein ligase RLIM ...  61.6    2e-07   
ref|XP_004000691.1|  PREDICTED: E3 ubiquitin-protein ligase RLIM      61.6    2e-07   
ref|XP_010345676.1|  PREDICTED: E3 ubiquitin-protein ligase RLIM      61.6    2e-07   
ref|XP_004667046.1|  PREDICTED: E3 ubiquitin-protein ligase RLIM-...  61.6    2e-07   
ref|XP_010352559.1|  PREDICTED: E3 ubiquitin-protein ligase RLIM      61.6    2e-07   
gb|KFZ67951.1|  E3 ubiquitin-protein ligase RNF12-A                   61.6    2e-07   
ref|XP_009898687.1|  PREDICTED: E3 ubiquitin-protein ligase RLIM      61.6    2e-07   
ref|XP_009481103.1|  PREDICTED: E3 ubiquitin-protein ligase RLIM      61.6    2e-07   
gb|ELK33762.1|  E3 ubiquitin-protein ligase RNF13                     59.7    2e-07   
ref|XP_010604099.1|  PREDICTED: E3 ubiquitin-protein ligase RNF167    61.2    2e-07   
ref|XP_009990512.1|  PREDICTED: E3 ubiquitin-protein ligase RLIM      61.6    2e-07   
gb|KFO22925.1|  E3 ubiquitin-protein ligase RNF167                    61.2    2e-07   
ref|XP_005086598.1|  PREDICTED: E3 ubiquitin-protein ligase RLIM-...  61.6    2e-07   
ref|XP_009807286.1|  PREDICTED: E3 ubiquitin-protein ligase RLIM      61.6    2e-07   
ref|XP_005413139.1|  PREDICTED: E3 ubiquitin-protein ligase RLIM ...  61.6    2e-07   
ref|XP_005413141.1|  PREDICTED: E3 ubiquitin-protein ligase RLIM ...  61.6    2e-07   
ref|XP_004380221.1|  PREDICTED: E3 ubiquitin-protein ligase RLIM      61.6    2e-07   
ref|XP_010203020.1|  PREDICTED: E3 ubiquitin-protein ligase RLIM      61.2    2e-07   
dbj|BAK62619.1|  RING finger protein 13                               59.3    2e-07   
ref|XP_006060132.1|  PREDICTED: E3 ubiquitin-protein ligase RNF167    61.2    2e-07   
ref|XP_009942864.1|  PREDICTED: E3 ubiquitin-protein ligase RLIM      61.2    2e-07   
ref|XP_009475221.1|  PREDICTED: E3 ubiquitin-protein ligase RLIM      61.2    2e-07   
gb|KFP51604.1|  E3 ubiquitin-protein ligase RNF12-A                   61.2    2e-07   
gb|ELV12009.1|  E3 ubiquitin-protein ligase RLIM                      61.2    2e-07   
ref|XP_007166562.1|  PREDICTED: E3 ubiquitin-protein ligase RNF16...  61.2    2e-07   
ref|XP_009271711.1|  PREDICTED: E3 ubiquitin-protein ligase RLIM ...  61.2    2e-07   
gb|EMT28530.1|  hypothetical protein F775_42736                       60.1    2e-07   
ref|XP_005337539.1|  PREDICTED: E3 ubiquitin-protein ligase RLIM      61.2    2e-07   
ref|XP_009918395.1|  PREDICTED: E3 ubiquitin-protein ligase RLIM ...  61.2    2e-07   
ref|XP_009597583.1|  PREDICTED: RING-H2 finger protein ATL67-like     59.7    2e-07   
ref|XP_005009063.1|  PREDICTED: E3 ubiquitin-protein ligase RLIM ...  61.2    2e-07   
ref|XP_009507743.1|  PREDICTED: E3 ubiquitin-protein ligase RLIM      61.2    2e-07   
ref|XP_006165712.1|  PREDICTED: E3 ubiquitin-protein ligase RLIM-...  61.2    2e-07   
ref|XP_010150947.1|  PREDICTED: E3 ubiquitin-protein ligase RLIM      61.2    2e-07   
ref|XP_009704495.1|  PREDICTED: E3 ubiquitin-protein ligase RLIM      61.2    2e-07   
ref|XP_009636864.1|  PREDICTED: E3 ubiquitin-protein ligase RLIM      61.2    2e-07   
gb|KFQ72571.1|  E3 ubiquitin-protein ligase RNF12-A                   61.2    2e-07   
ref|XP_007631006.1|  PREDICTED: E3 ubiquitin-protein ligase RLIM      61.2    2e-07   
ref|XP_005067538.1|  PREDICTED: E3 ubiquitin-protein ligase RNF167    60.8    2e-07   
ref|XP_009088539.1|  PREDICTED: E3 ubiquitin-protein ligase RLIM      61.2    2e-07   
ref|XP_010169408.1|  PREDICTED: E3 ubiquitin-protein ligase RLIM      61.2    2e-07   
ref|XP_010120603.1|  PREDICTED: E3 ubiquitin-protein ligase RLIM      61.2    2e-07   
ref|XP_005235736.1|  PREDICTED: E3 ubiquitin-protein ligase RLIM      61.2    2e-07   
ref|XP_006032756.1|  PREDICTED: E3 ubiquitin-protein ligase RLIM      61.2    2e-07   
gb|KFK41865.1|  hypothetical protein AALP_AA2G180900                  60.1    2e-07   
ref|NP_001288167.1|  ring finger protein, LIM domain interacting      61.2    2e-07   
ref|XP_003466241.1|  PREDICTED: E3 ubiquitin-protein ligase RNF16...  60.8    2e-07   
ref|XP_007450397.1|  PREDICTED: E3 ubiquitin-protein ligase RLIM      61.2    2e-07   
ref|XP_011377807.1|  PREDICTED: E3 ubiquitin-protein ligase RLIM      61.2    2e-07   
ref|XP_010211143.1|  PREDICTED: E3 ubiquitin-protein ligase RLIM      61.2    2e-07   
ref|XP_010301056.1|  PREDICTED: E3 ubiquitin-protein ligase RLIM      61.2    2e-07   
ref|XP_005144912.1|  PREDICTED: E3 ubiquitin-protein ligase RLIM      61.2    2e-07   
gb|ERZ96321.1|  hypothetical protein GLOINDRAFT_303068                60.8    2e-07   
ref|XP_003506433.1|  PREDICTED: E3 ubiquitin-protein ligase RLIM      61.2    2e-07   
ref|XP_010282891.1|  PREDICTED: E3 ubiquitin-protein ligase RLIM      61.2    2e-07   
ref|XP_009884807.1|  PREDICTED: E3 ubiquitin-protein ligase RLIM      61.2    2e-07   
ref|XP_009918394.1|  PREDICTED: E3 ubiquitin-protein ligase RLIM ...  61.2    2e-07   
ref|XP_010140433.1|  PREDICTED: E3 ubiquitin-protein ligase RLIM      61.2    2e-07   
ref|XP_008928014.1|  PREDICTED: E3 ubiquitin-protein ligase RLIM      61.2    2e-07   
ref|XP_010072853.1|  PREDICTED: E3 ubiquitin-protein ligase RLIM      61.2    2e-07   
dbj|BAC26379.1|  unnamed protein product                              61.2    2e-07   
ref|XP_009954773.1|  PREDICTED: E3 ubiquitin-protein ligase RLIM      61.2    2e-07   
ref|XP_004648071.1|  PREDICTED: E3 ubiquitin-protein ligase RLIM-...  61.2    2e-07   
ref|XP_004475828.1|  PREDICTED: E3 ubiquitin-protein ligase RLIM-...  61.2    2e-07   
ref|XP_005994977.1|  PREDICTED: E3 ubiquitin-protein ligase RLIM ...  61.2    2e-07   
ref|XP_001142065.1|  PREDICTED: E3 ubiquitin-protein ligase RLIM      61.2    2e-07   
gb|EXX70134.1|  hypothetical protein RirG_090200                      60.8    2e-07   
dbj|BAB28712.1|  unnamed protein product                              61.2    2e-07   
ref|XP_004442241.1|  PREDICTED: E3 ubiquitin-protein ligase RLIM      61.2    2e-07   
ref|XP_009683730.1|  PREDICTED: E3 ubiquitin-protein ligase RLIM      61.2    2e-07   
ref|XP_005493359.1|  PREDICTED: E3 ubiquitin-protein ligase RLIM ...  61.2    2e-07   
ref|XP_002763060.1|  PREDICTED: E3 ubiquitin-protein ligase RLIM      61.2    2e-07   
ref|XP_006917100.1|  PREDICTED: E3 ubiquitin-protein ligase RLIM      61.2    2e-07   
ref|XP_005582663.1|  PREDICTED: E3 ubiquitin-protein ligase RNF16...  60.8    2e-07   
ref|XP_006901834.1|  PREDICTED: E3 ubiquitin-protein ligase RLIM-...  61.2    2e-07   
ref|XP_005428781.1|  PREDICTED: E3 ubiquitin-protein ligase RLIM      61.2    2e-07   
ref|XP_008507073.1|  PREDICTED: E3 ubiquitin-protein ligase RLIM      61.2    2e-07   
ref|NP_035406.3|  E3 ubiquitin-protein ligase RLIM                    61.2    2e-07   
ref|XP_005009062.1|  PREDICTED: E3 ubiquitin-protein ligase RLIM ...  61.2    2e-07   
ref|XP_006083002.1|  PREDICTED: E3 ubiquitin-protein ligase RLIM ...  61.2    2e-07   
ref|XP_006752686.1|  PREDICTED: E3 ubiquitin-protein ligase RLIM-...  61.2    2e-07   
ref|XP_005291838.1|  PREDICTED: E3 ubiquitin-protein ligase RLIM      61.2    2e-07   
ref|XP_008121282.1|  PREDICTED: E3 ubiquitin-protein ligase RLIM      61.2    2e-07   
ref|XP_004594911.1|  PREDICTED: E3 ubiquitin-protein ligase RNF167    60.8    2e-07   
ref|XP_010713655.1|  PREDICTED: E3 ubiquitin-protein ligase RLIM ...  61.2    2e-07   
gb|AIC56144.1|  RNF167                                                60.8    2e-07   
ref|XP_004529322.1|  PREDICTED: uncharacterized protein LOC101460...  61.2    2e-07   
ref|XP_009863853.1|  PREDICTED: E3 ubiquitin-protein ligase RLIM      61.2    2e-07   
emb|CAD38958.1|  hypothetical protein                                 60.8    2e-07   
ref|XP_008585453.1|  PREDICTED: E3 ubiquitin-protein ligase RLIM      61.2    2e-07   
ref|XP_005906129.1|  PREDICTED: E3 ubiquitin-protein ligase RNF16...  60.8    2e-07   
ref|XP_005858517.1|  PREDICTED: E3 ubiquitin-protein ligase RLIM ...  61.2    2e-07   
ref|XP_004012654.1|  PREDICTED: E3 ubiquitin-protein ligase RNF167    60.8    2e-07   
ref|XP_010713656.1|  PREDICTED: E3 ubiquitin-protein ligase RLIM ...  61.2    2e-07   
ref|XP_008498304.1|  PREDICTED: E3 ubiquitin-protein ligase RLIM      61.2    2e-07   
ref|XP_004867555.1|  PREDICTED: E3 ubiquitin-protein ligase RLIM ...  61.2    2e-07   
ref|NP_001267345.1|  E3 ubiquitin-protein ligase RNF167 precursor     60.8    2e-07   
ref|XP_010515011.1|  PREDICTED: RING-H2 finger protein ATL44          59.3    2e-07   
ref|XP_005582666.1|  PREDICTED: E3 ubiquitin-protein ligase RNF16...  60.8    2e-07   
ref|XP_009578145.1|  PREDICTED: E3 ubiquitin-protein ligase RLIM      61.2    2e-07   
ref|XP_009557943.1|  PREDICTED: E3 ubiquitin-protein ligase RLIM      61.2    2e-07   
ref|XP_005046031.1|  PREDICTED: E3 ubiquitin-protein ligase RLIM ...  61.2    2e-07   
ref|XP_009429913.1|  PREDICTED: E3 ubiquitin-protein ligase RNF16...  60.8    2e-07   
ref|XP_003810232.1|  PREDICTED: E3 ubiquitin-protein ligase RNF16...  60.8    2e-07   
ref|XP_005256654.1|  PREDICTED: E3 ubiquitin-protein ligase RNF16...  60.8    2e-07   
ref|NP_001069873.2|  E3 ubiquitin-protein ligase RNF167               60.8    2e-07   
ref|XP_005994976.1|  PREDICTED: E3 ubiquitin-protein ligase RLIM ...  61.2    2e-07   
ref|NP_001020063.1|  E3 ubiquitin-protein ligase RLIM                 61.2    2e-07   
dbj|BAE00771.1|  unnamed protein product                              61.2    2e-07   
ref|XP_004022246.1|  PREDICTED: E3 ubiquitin-protein ligase RLIM      61.2    2e-07   
ref|NP_056343.1|  E3 ubiquitin-protein ligase RNF167 precursor        60.8    2e-07   
ref|XP_010362511.1|  PREDICTED: E3 ubiquitin-protein ligase RNF16...  60.8    2e-07   
ref|XP_005399668.1|  PREDICTED: E3 ubiquitin-protein ligase RNF16...  60.8    2e-07   
ref|XP_004715945.1|  PREDICTED: E3 ubiquitin-protein ligase RLIM      61.2    2e-07   
ref|XP_010182578.1|  PREDICTED: E3 ubiquitin-protein ligase RLIM      61.2    2e-07   
ref|XP_009069260.1|  PREDICTED: E3 ubiquitin-protein ligase RLIM      61.2    2e-07   
ref|XP_005890596.1|  PREDICTED: E3 ubiquitin-protein ligase RLIM      61.2    2e-07   
ref|XP_007526130.1|  PREDICTED: E3 ubiquitin-protein ligase RLIM      61.2    2e-07   
ref|XP_005977486.1|  PREDICTED: E3 ubiquitin-protein ligase RLIM      61.2    2e-07   
ref|XP_009997953.1|  PREDICTED: E3 ubiquitin-protein ligase RLIM      61.2    2e-07   
ref|NP_001179251.1|  E3 ubiquitin-protein ligase RLIM                 61.2    2e-07   
ref|XP_006043161.1|  PREDICTED: E3 ubiquitin-protein ligase RLIM ...  61.2    2e-07   
ref|XP_008064115.1|  PREDICTED: E3 ubiquitin-protein ligase RNF167    60.8    2e-07   
emb|CAB43253.1|  hypothetical protein                                 60.8    2e-07   
ref|XP_003412765.1|  PREDICTED: E3 ubiquitin-protein ligase RLIM      61.2    2e-07   
gb|KDP28554.1|  hypothetical protein JCGZ_14325                       59.3    2e-07   
ref|XP_004529326.1|  PREDICTED: uncharacterized protein LOC101460...  61.2    2e-07   
gb|EDL12592.1|  ring finger protein 167, isoform CRA_b                58.5    2e-07   
ref|XP_006807968.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...  60.1    2e-07   
ref|XP_003775089.1|  PREDICTED: E3 ubiquitin-protein ligase RLIM      61.2    2e-07   
ref|XP_004620969.1|  PREDICTED: E3 ubiquitin-protein ligase RLIM      61.2    2e-07   
ref|XP_005694241.1|  PREDICTED: E3 ubiquitin-protein ligase RNF167    60.8    2e-07   
ref|XP_005899805.1|  PREDICTED: E3 ubiquitin-protein ligase RLIM-...  61.2    2e-07   
ref|XP_006732120.1|  PREDICTED: E3 ubiquitin-protein ligase RLIM-...  61.2    2e-07   
ref|XP_010845700.1|  PREDICTED: E3 ubiquitin-protein ligase RNF16...  60.5    2e-07   
ref|XP_005967998.1|  PREDICTED: E3 ubiquitin-protein ligase RNF16...  60.5    2e-07   
ref|XP_005967997.1|  PREDICTED: E3 ubiquitin-protein ligase RNF16...  60.8    2e-07   
ref|XP_006991632.1|  PREDICTED: E3 ubiquitin-protein ligase RLIM ...  61.2    2e-07   
ref|XP_009429910.1|  PREDICTED: E3 ubiquitin-protein ligase RNF16...  60.8    2e-07   
ref|XP_007457762.1|  PREDICTED: E3 ubiquitin-protein ligase RNF16...  60.8    2e-07   
ref|XP_005582664.1|  PREDICTED: E3 ubiquitin-protein ligase RNF16...  60.8    2e-07   
ref|XP_010713654.1|  PREDICTED: E3 ubiquitin-protein ligase RLIM ...  61.2    2e-07   
ref|XP_007457763.1|  PREDICTED: E3 ubiquitin-protein ligase RNF16...  60.8    2e-07   
ref|XP_002721870.1|  PREDICTED: E3 ubiquitin-protein ligase RLIM      61.2    2e-07   
ref|XP_599349.4|  PREDICTED: E3 ubiquitin-protein ligase RLIM         61.2    2e-07   
ref|XP_005527452.1|  PREDICTED: E3 ubiquitin-protein ligase RLIM      61.2    2e-07   
ref|XP_005046029.1|  PREDICTED: E3 ubiquitin-protein ligase RLIM ...  61.2    2e-07   
ref|XP_008157095.1|  PREDICTED: E3 ubiquitin-protein ligase RLIM      61.2    2e-07   
ref|XP_008854143.1|  PREDICTED: E3 ubiquitin-protein ligase RNF16...  60.8    2e-07   
ref|XP_001099111.2|  PREDICTED: e3 ubiquitin-protein ligase RNF16...  60.8    2e-07   
gb|ELR53511.1|  hypothetical protein M91_16323                        61.2    2e-07   
ref|XP_005582667.1|  PREDICTED: E3 ubiquitin-protein ligase RNF16...  60.8    2e-07   
ref|NP_001181030.1|  E3 ubiquitin-protein ligase RNF167               60.8    2e-07   
ref|XP_004666928.1|  PREDICTED: E3 ubiquitin-protein ligase RNF167    60.8    2e-07   
ref|XP_005046028.1|  PREDICTED: E3 ubiquitin-protein ligase RLIM ...  61.2    2e-07   
ref|XP_006136241.1|  PREDICTED: E3 ubiquitin-protein ligase RLIM ...  61.2    2e-07   
ref|XP_007424003.1|  PREDICTED: E3 ubiquitin-protein ligase RLIM      61.2    2e-07   
ref|XP_002199379.1|  PREDICTED: E3 ubiquitin-protein ligase RNF12...  60.8    2e-07   
gb|EFN82691.1|  RING finger protein 165                               61.2    2e-07   
ref|XP_008809167.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...  60.8    2e-07   
ref|XP_007956923.1|  PREDICTED: E3 ubiquitin-protein ligase RLIM      60.8    2e-07   
ref|XP_006136243.1|  PREDICTED: E3 ubiquitin-protein ligase RLIM ...  60.8    2e-07   
ref|XP_007483314.1|  PREDICTED: E3 ubiquitin-protein ligase RNF16...  60.1    2e-07   
ref|XP_005256660.1|  PREDICTED: E3 ubiquitin-protein ligase RNF16...  60.5    2e-07   
ref|XP_011142321.1|  PREDICTED: E3 ubiquitin-protein ligase Arkadia   61.2    2e-07   



>ref|XP_009767497.1| PREDICTED: uncharacterized protein LOC104218651 [Nicotiana sylvestris]
Length=514

 Score =   264 bits (675),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 157/216 (73%), Positives = 179/216 (83%), Gaps = 2/216 (1%)
 Frame = -1

Query  753  TGNADDLGSHDRWLIDLNGDLHYDGVGYGSSYLGETGHHRNERRLPSRSEISERVHRGHR  574
            TG+ADDLGSHDRWLIDL+GDLHYDGVG+ S Y     H R+E+R P+RSE+SERV  G  
Sbjct  297  TGHADDLGSHDRWLIDLSGDLHYDGVGFDSGYGTGRNHSRSEQRQPTRSEVSERVLEGLG  356

Query  573  NRVSQPSFCPSGLHPDGtcscesfftseefsTLASISRIIMLAEALFEVIDEIHRQSF--  400
            +RV + + C SGLHPDGTCSCE   T+EEFSTLASISRIIMLAEALFEV+DEIHRQSF  
Sbjct  357  SRVPRQNLCSSGLHPDGTCSCEPLLTTEEFSTLASISRIIMLAEALFEVLDEIHRQSFTL  416

Query  399  SLSTFSLPAPEATVDAFPLKYHKTLDPVENALGDTQQCYICLAEYEDGDKLRVLPCHHEY  220
            SLST SLPAP++ VD+FPLK HK L  V+NA  D QQC+ICLAEYE+GDKLRVLPC HEY
Sbjct  417  SLSTLSLPAPDSVVDSFPLKSHKMLGAVDNAPTDIQQCHICLAEYEEGDKLRVLPCRHEY  476

Query  219  HMICIDKWLKEvnrvcpvcrcnvcNGPGQSSISTTE  112
            HM+CIDKWLKEVNRVCPVCRCNVC   G +S+S +E
Sbjct  477  HMLCIDKWLKEVNRVCPVCRCNVCESSGVASVSNSE  512



>ref|XP_009603587.1| PREDICTED: uncharacterized protein LOC104098539 [Nicotiana tomentosiformis]
Length=510

 Score =   262 bits (669),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 155/216 (72%), Positives = 176/216 (81%), Gaps = 2/216 (1%)
 Frame = -1

Query  753  TGNADDLGSHDRWLIDLNGDLHYDGVGYGSSYLGETGHHRNERRLPSRSEISERVHRGHR  574
            TG+ADDLGS DRWLI+L+GDLHYDGVG+ S Y     H R+E+R P+RSE+SERV  G  
Sbjct  293  TGHADDLGSRDRWLINLSGDLHYDGVGFDSGYGTGRNHSRSEQRQPTRSEVSERVLEGLG  352

Query  573  NRVSQPSFCPSGLHPDGtcscesfftseefsTLASISRIIMLAEALFEVIDEIHRQSF--  400
            +RV Q + C SGLHPDGTCSCE   T+EEFSTLASISRIIMLAEALFEV+DEIHRQSF  
Sbjct  353  SRVPQQNLCSSGLHPDGTCSCEPLLTTEEFSTLASISRIIMLAEALFEVMDEIHRQSFTL  412

Query  399  SLSTFSLPAPEATVDAFPLKYHKTLDPVENALGDTQQCYICLAEYEDGDKLRVLPCHHEY  220
            SLST SLPAP++ VD+FPLK HK L  V+NA  D QQC+ICLAEYE+GDKLRVLPC HEY
Sbjct  413  SLSTLSLPAPDSVVDSFPLKSHKKLGAVDNAPTDIQQCHICLAEYEEGDKLRVLPCRHEY  472

Query  219  HMICIDKWLKEvnrvcpvcrcnvcNGPGQSSISTTE  112
            HM+CIDKWLKEVNRVCPVCR +VC  PG  S S +E
Sbjct  473  HMLCIDKWLKEVNRVCPVCRFDVCENPGIDSASNSE  508



>ref|XP_010325043.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like isoform 
X2 [Solanum lycopersicum]
Length=414

 Score =   254 bits (650),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 154/216 (71%), Positives = 175/216 (81%), Gaps = 2/216 (1%)
 Frame = -1

Query  753  TGNADDLGSHDRWLIDLNGDLHYDGVGYGSSYLGETGHHRNERRLPSRSEISERVHRGHR  574
            TG+ADD+GS DRWLIDLNGDLHYDGVG+ S Y     + R+E+R  +RSEISERV  G  
Sbjct  197  TGHADDVGSRDRWLIDLNGDLHYDGVGFDSGYGAGRNYRRSEQRQTTRSEISERVLEGLG  256

Query  573  NRVSQPSFCPSGLHPDGtcscesfftseefsTLASISRIIMLAEALFEVIDEIHRQSF--  400
            NRV Q + C SGLHPDGTCSCE   T+EEFSTLASISRII+LAEALFEV+DEIH+QSF  
Sbjct  257  NRVPQQNLCSSGLHPDGTCSCEPLLTTEEFSTLASISRIIILAEALFEVLDEIHQQSFTL  316

Query  399  SLSTFSLPAPEATVDAFPLKYHKTLDPVENALGDTQQCYICLAEYEDGDKLRVLPCHHEY  220
            SLST SLPAP++ VD+FP+K HK L  V+NA  D QQC+ICLAEYE+GDKLRVLPC HEY
Sbjct  317  SLSTLSLPAPDSVVDSFPVKSHKKLGAVDNAPTDIQQCHICLAEYEEGDKLRVLPCRHEY  376

Query  219  HMICIDKWLKEvnrvcpvcrcnvcNGPGQSSISTTE  112
            HM CIDKWLKEVNRVCPVCRCNVC  P   S+S +E
Sbjct  377  HMHCIDKWLKEVNRVCPVCRCNVCENPAIGSVSNSE  412



>ref|XP_006354642.1| PREDICTED: suppressor protein SRP40-like [Solanum tuberosum]
Length=501

 Score =   256 bits (653),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 154/216 (71%), Positives = 174/216 (81%), Gaps = 2/216 (1%)
 Frame = -1

Query  753  TGNADDLGSHDRWLIDLNGDLHYDGVGYGSSYLGETGHHRNERRLPSRSEISERVHRGHR  574
            TG+ADDLGS DRWLIDLNGDLHYDGVG+ S Y     H R+E+R  +RSE SERV  G  
Sbjct  284  TGHADDLGSRDRWLIDLNGDLHYDGVGFDSGYGAGRNHRRSEQRQTTRSETSERVLEGLG  343

Query  573  NRVSQPSFCPSGLHPDGtcscesfftseefsTLASISRIIMLAEALFEVIDEIHRQSF--  400
            NRV Q + C SGLHPDG+CSCE   T+EEFSTLASISRII+LAEALFEV+DEIH+QSF  
Sbjct  344  NRVPQQNLCSSGLHPDGSCSCEPLLTTEEFSTLASISRIIILAEALFEVLDEIHQQSFTL  403

Query  399  SLSTFSLPAPEATVDAFPLKYHKTLDPVENALGDTQQCYICLAEYEDGDKLRVLPCHHEY  220
            SLST SLPAP++ VD+FPLK HK L  ++NA  D QQC+ICLAEYE+GDKLRVLPC HEY
Sbjct  404  SLSTLSLPAPDSVVDSFPLKSHKKLGAIDNAPTDIQQCHICLAEYEEGDKLRVLPCRHEY  463

Query  219  HMICIDKWLKEvnrvcpvcrcnvcNGPGQSSISTTE  112
            HM CIDKWLKEVNRVCPVCRCNVC  P   S+S +E
Sbjct  464  HMHCIDKWLKEVNRVCPVCRCNVCENPAIGSVSNSE  499



>ref|XP_004229712.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like isoform 
X1 [Solanum lycopersicum]
Length=492

 Score =   255 bits (651),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 154/216 (71%), Positives = 175/216 (81%), Gaps = 2/216 (1%)
 Frame = -1

Query  753  TGNADDLGSHDRWLIDLNGDLHYDGVGYGSSYLGETGHHRNERRLPSRSEISERVHRGHR  574
            TG+ADD+GS DRWLIDLNGDLHYDGVG+ S Y     + R+E+R  +RSEISERV  G  
Sbjct  275  TGHADDVGSRDRWLIDLNGDLHYDGVGFDSGYGAGRNYRRSEQRQTTRSEISERVLEGLG  334

Query  573  NRVSQPSFCPSGLHPDGtcscesfftseefsTLASISRIIMLAEALFEVIDEIHRQSF--  400
            NRV Q + C SGLHPDGTCSCE   T+EEFSTLASISRII+LAEALFEV+DEIH+QSF  
Sbjct  335  NRVPQQNLCSSGLHPDGTCSCEPLLTTEEFSTLASISRIIILAEALFEVLDEIHQQSFTL  394

Query  399  SLSTFSLPAPEATVDAFPLKYHKTLDPVENALGDTQQCYICLAEYEDGDKLRVLPCHHEY  220
            SLST SLPAP++ VD+FP+K HK L  V+NA  D QQC+ICLAEYE+GDKLRVLPC HEY
Sbjct  395  SLSTLSLPAPDSVVDSFPVKSHKKLGAVDNAPTDIQQCHICLAEYEEGDKLRVLPCRHEY  454

Query  219  HMICIDKWLKEvnrvcpvcrcnvcNGPGQSSISTTE  112
            HM CIDKWLKEVNRVCPVCRCNVC  P   S+S +E
Sbjct  455  HMHCIDKWLKEVNRVCPVCRCNVCENPAIGSVSNSE  490



>emb|CDP09386.1| unnamed protein product [Coffea canephora]
Length=506

 Score =   229 bits (583),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 150/220 (68%), Positives = 170/220 (77%), Gaps = 3/220 (1%)
 Frame = -1

Query  753  TGNADDLGSHDRWLIDLNGDLHYDGVGYGSSYLGETGHHRNERRLPSRSEISERVHRGHR  574
            TG ADDLGS DRWL++L+GDLHYDGV + S YLG   + R+ RR   RSEISERV  GH 
Sbjct  288  TGPADDLGSEDRWLLNLSGDLHYDGVFHDSVYLGARSNFRSGRRWLLRSEISERV-LGHG  346

Query  573  NRVSQPSFCPSGLHPDGtcscesfftseefsTLASISRIIMLAEALFEVIDEIHRQ--SF  400
                +  FC SGLHPDGTCSC+SFF++EE STLASISRIIMLAEALFEV+DEIHRQ  S 
Sbjct  347  EGGRRTDFCASGLHPDGTCSCDSFFSAEESSTLASISRIIMLAEALFEVLDEIHRQPLSL  406

Query  399  SLSTFSLPAPEATVDAFPLKYHKTLDPVENALGDTQQCYICLAEYEDGDKLRVLPCHHEY  220
            SLS  +LPAPE+ VD+FPLKYH  +D      GDT QCYICLAEYE+GDKLRVLPC HEY
Sbjct  407  SLSMLTLPAPESVVDSFPLKYHTKVDATATRPGDTPQCYICLAEYEEGDKLRVLPCKHEY  466

Query  219  HMICIDKWLKEvnrvcpvcrcnvcNGPGQSSISTTETPLQ  100
            HM CIDKWLKE+NRVCP+CRCNVC  P Q S++    P Q
Sbjct  467  HMPCIDKWLKEINRVCPLCRCNVCEDPEQDSVTNNGIPSQ  506



>ref|XP_002266433.1| PREDICTED: E3 ubiquitin-protein ligase RLIM-like [Vitis vinifera]
Length=542

 Score =   229 bits (583),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 135/218 (62%), Positives = 159/218 (73%), Gaps = 3/218 (1%)
 Frame = -1

Query  753  TGNADDLGSHDRWLIDLNGDLHYDGVGYGSSYLGETGHHRNERRLPSRSEISERVHRGHR  574
            T + DDLGSHDRWL+D +GD   DGVG  S YLG   H  NERR  SRSEI ER+  G  
Sbjct  324  TDDTDDLGSHDRWLLDFSGDFFEDGVGGDSGYLGSRIHSMNERRWHSRSEIWERLRGGLD  383

Query  573  NRVSQPSFCPSGLHPDGtcscesfftseefsTLASISRIIMLAEALFEVIDEIHRQ--SF  400
                + + CP+GLHPDG CSC+SF  +EE ST ASISRI+MLAEALFEV+DEIHRQ  S 
Sbjct  384  ESSRRTTTCPTGLHPDGMCSCDSFLMAEESSTRASISRIVMLAEALFEVLDEIHRQPVSL  443

Query  399  SLSTFSLPAPEATVDAFPLKYHKTLDPVENALGDTQQCYICLAEYEDGDKLRVLPCHHEY  220
            +LS  SLPAPE+ VD+FPLK HK  D  ++   D  QCYICLAEYE+GDK+RVLPCHHEY
Sbjct  444  ALSMVSLPAPESVVDSFPLKNHKKADTAQSG-EDVAQCYICLAEYEEGDKIRVLPCHHEY  502

Query  219  HMICIDKWLKEvnrvcpvcrcnvcNGPGQSSISTTETP  106
            HM C+DKWLKE++ VCP+CR +V  G    S+S  ETP
Sbjct  503  HMSCVDKWLKEIHGVCPLCRGDVREGLTGGSVSNGETP  540



>emb|CAN78871.1| hypothetical protein VITISV_024970 [Vitis vinifera]
Length=542

 Score =   229 bits (583),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 135/218 (62%), Positives = 159/218 (73%), Gaps = 3/218 (1%)
 Frame = -1

Query  753  TGNADDLGSHDRWLIDLNGDLHYDGVGYGSSYLGETGHHRNERRLPSRSEISERVHRGHR  574
            T + DDLGSHDRWL+D +GD   DGVG  S YLG   H  NERR  SRSEI ER+  G  
Sbjct  324  TDDTDDLGSHDRWLLDFSGDFFEDGVGGDSGYLGSRIHSMNERRWHSRSEIWERLRGGLD  383

Query  573  NRVSQPSFCPSGLHPDGtcscesfftseefsTLASISRIIMLAEALFEVIDEIHRQ--SF  400
                + + CP+GLHPDG CSC+SF  +EE ST ASISRI+MLAEALFEV+DEIHRQ  S 
Sbjct  384  ESSRRTTTCPTGLHPDGMCSCDSFLMAEESSTRASISRIVMLAEALFEVLDEIHRQPVSL  443

Query  399  SLSTFSLPAPEATVDAFPLKYHKTLDPVENALGDTQQCYICLAEYEDGDKLRVLPCHHEY  220
            +LS  SLPAPE+ VD+FPLK HK  D  ++   D  QCYICLAEYE+GDK+RVLPCHHEY
Sbjct  444  ALSMVSLPAPESVVDSFPLKNHKKADTAQSG-EDVAQCYICLAEYEEGDKIRVLPCHHEY  502

Query  219  HMICIDKWLKEvnrvcpvcrcnvcNGPGQSSISTTETP  106
            HM C+DKWLKE++ VCP+CR +V  G    S+S  ETP
Sbjct  503  HMSCVDKWLKEIHGVCPLCRGDVREGLTGGSVSNGETP  540



>ref|XP_006372137.1| hypothetical protein POPTR_0018s12260g [Populus trichocarpa]
 gb|ERP49934.1| hypothetical protein POPTR_0018s12260g [Populus trichocarpa]
Length=331

 Score =   222 bits (566),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 124/191 (65%), Positives = 142/191 (74%), Gaps = 3/191 (2%)
 Frame = -1

Query  753  TGNADDLGSHDRWLIDLNGDLHYDGVGYGSSYLGETGHHRNERRLPSRSEISERVHRGHR  574
            T N DDL SHDRWL+D +GD   DG+G  S Y+    H  NERR  SRSEI ER+  G  
Sbjct  112  TDNTDDLESHDRWLLDFSGDFFDDGIGSDSGYMSRRIHRLNERRRHSRSEIWERLRGGLD  171

Query  573  NRVSQPSFCPSGLHPDGtcscesfftseefsTLASISRIIMLAEALFEVIDEIHRQ--SF  400
                + + CPSGLHPDGTCSCESF  +EE S   SISRI+MLAEALFEV+DEIHRQ  S 
Sbjct  172  ENGRRTTSCPSGLHPDGTCSCESFLMAEESSARGSISRIVMLAEALFEVLDEIHRQPVSL  231

Query  399  SLSTFSLPAPEATVDAFPLKYHKTLDPVENALGDTQQCYICLAEYEDGDKLRVLPCHHEY  220
            SLS  SLPAPE+ VD+FPLK HK LD V+    D +QCYICLAEYE+GDK+RVLPCHHEY
Sbjct  232  SLSMMSLPAPESVVDSFPLKNHKKLDRVKGNDED-EQCYICLAEYEEGDKIRVLPCHHEY  290

Query  219  HMICIDKWLKE  187
            HM+C+DKWLKE
Sbjct  291  HMVCVDKWLKE  301



>ref|XP_006372132.1| hypothetical protein POPTR_0018s12260g [Populus trichocarpa]
 gb|ERP49929.1| hypothetical protein POPTR_0018s12260g [Populus trichocarpa]
Length=503

 Score =   224 bits (571),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 124/191 (65%), Positives = 142/191 (74%), Gaps = 3/191 (2%)
 Frame = -1

Query  753  TGNADDLGSHDRWLIDLNGDLHYDGVGYGSSYLGETGHHRNERRLPSRSEISERVHRGHR  574
            T N DDL SHDRWL+D +GD   DG+G  S Y+    H  NERR  SRSEI ER+  G  
Sbjct  284  TDNTDDLESHDRWLLDFSGDFFDDGIGSDSGYMSRRIHRLNERRRHSRSEIWERLRGGLD  343

Query  573  NRVSQPSFCPSGLHPDGtcscesfftseefsTLASISRIIMLAEALFEVIDEIHRQ--SF  400
                + + CPSGLHPDGTCSCESF  +EE S   SISRI+MLAEALFEV+DEIHRQ  S 
Sbjct  344  ENGRRTTSCPSGLHPDGTCSCESFLMAEESSARGSISRIVMLAEALFEVLDEIHRQPVSL  403

Query  399  SLSTFSLPAPEATVDAFPLKYHKTLDPVENALGDTQQCYICLAEYEDGDKLRVLPCHHEY  220
            SLS  SLPAPE+ VD+FPLK HK LD V+    D +QCYICLAEYE+GDK+RVLPCHHEY
Sbjct  404  SLSMMSLPAPESVVDSFPLKNHKKLDRVKGNDED-EQCYICLAEYEEGDKIRVLPCHHEY  462

Query  219  HMICIDKWLKE  187
            HM+C+DKWLKE
Sbjct  463  HMVCVDKWLKE  473



>ref|XP_002325167.2| hypothetical protein POPTR_0018s12260g [Populus trichocarpa]
 gb|EEF03732.2| hypothetical protein POPTR_0018s12260g [Populus trichocarpa]
Length=545

 Score =   224 bits (571),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 124/191 (65%), Positives = 142/191 (74%), Gaps = 3/191 (2%)
 Frame = -1

Query  753  TGNADDLGSHDRWLIDLNGDLHYDGVGYGSSYLGETGHHRNERRLPSRSEISERVHRGHR  574
            T N DDL SHDRWL+D +GD   DG+G  S Y+    H  NERR  SRSEI ER+  G  
Sbjct  326  TDNTDDLESHDRWLLDFSGDFFDDGIGSDSGYMSRRIHRLNERRRHSRSEIWERLRGGLD  385

Query  573  NRVSQPSFCPSGLHPDGtcscesfftseefsTLASISRIIMLAEALFEVIDEIHRQ--SF  400
                + + CPSGLHPDGTCSCESF  +EE S   SISRI+MLAEALFEV+DEIHRQ  S 
Sbjct  386  ENGRRTTSCPSGLHPDGTCSCESFLMAEESSARGSISRIVMLAEALFEVLDEIHRQPVSL  445

Query  399  SLSTFSLPAPEATVDAFPLKYHKTLDPVENALGDTQQCYICLAEYEDGDKLRVLPCHHEY  220
            SLS  SLPAPE+ VD+FPLK HK LD V+    D +QCYICLAEYE+GDK+RVLPCHHEY
Sbjct  446  SLSMMSLPAPESVVDSFPLKNHKKLDRVKGNDED-EQCYICLAEYEEGDKIRVLPCHHEY  504

Query  219  HMICIDKWLKE  187
            HM+C+DKWLKE
Sbjct  505  HMVCVDKWLKE  515



>ref|XP_007013683.1| RING/U-box superfamily protein isoform 2, partial [Theobroma 
cacao]
 gb|EOY31302.1| RING/U-box superfamily protein isoform 2, partial [Theobroma 
cacao]
Length=470

 Score =   221 bits (562),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 120/192 (63%), Positives = 140/192 (73%), Gaps = 5/192 (3%)
 Frame = -1

Query  753  TGNADDLGSHDRWLIDLNGDLHYDGVGYGSSYLGETGHHRNERRLPSRSEISERVHRGHR  574
            T ++DD G HDRWL+D +GD  YDG G  S YL    H  NERR  SRSEI ER+  GH 
Sbjct  280  TDDSDDTGFHDRWLLDFSGDFFYDGAGGDSGYLSSRIHSLNERRRHSRSEIWERLRGGHD  339

Query  573  NRVSQPSFCPSGLHPDGtcscesfftseefsTLASISRIIMLAEALFEVIDEIHRQ--SF  400
                + +FCPSGLHPDGTCSC+S   ++E S  ASISRI+MLAEALFEV+DEIHRQ  S 
Sbjct  340  ENSRRTTFCPSGLHPDGTCSCDSLLMTDESSARASISRIVMLAEALFEVLDEIHRQPVSL  399

Query  399  SLSTFSLPAPEATVDAFPLKYHKTLDPVENALGD-TQQCYICLAEYEDGDKLRVLPCHHE  223
            SLS  SLPAPE+ VD+FPL+ HK LD  E   GD  +QCYICLAEYE+ DK+R LPC HE
Sbjct  400  SLSMVSLPAPESVVDSFPLRSHKKLDAAEG--GDAVEQCYICLAEYEEEDKIRALPCQHE  457

Query  222  YHMICIDKWLKE  187
            +HM C+DKWLKE
Sbjct  458  FHMSCVDKWLKE  469



>ref|XP_007013682.1| RING/U-box superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY31301.1| RING/U-box superfamily protein isoform 1 [Theobroma cacao]
Length=540

 Score =   223 bits (567),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 132/219 (60%), Positives = 159/219 (73%), Gaps = 6/219 (3%)
 Frame = -1

Query  753  TGNADDLGSHDRWLIDLNGDLHYDGVGYGSSYLGETGHHRNERRLPSRSEISERVHRGHR  574
            T ++DD G HDRWL+D +GD  YDG G  S YL    H  NERR  SRSEI ER+  GH 
Sbjct  323  TDDSDDTGFHDRWLLDFSGDFFYDGAGGDSGYLSSRIHSLNERRRHSRSEIWERLRGGHD  382

Query  573  NRVSQPSFCPSGLHPDGtcscesfftseefsTLASISRIIMLAEALFEVIDEIHRQ--SF  400
                + +FCPSGLHPDGTCSC+S   ++E S  ASISRI+MLAEALFEV+DEIHRQ  S 
Sbjct  383  ENSRRTTFCPSGLHPDGTCSCDSLLMTDESSARASISRIVMLAEALFEVLDEIHRQPVSL  442

Query  399  SLSTFSLPAPEATVDAFPLKYHKTLDPVENALGD-TQQCYICLAEYEDGDKLRVLPCHHE  223
            SLS  SLPAPE+ VD+FPL+ HK LD  E   GD  +QCYICLAEYE+ DK+R LPC HE
Sbjct  443  SLSMVSLPAPESVVDSFPLRSHKKLDAAEG--GDAVEQCYICLAEYEEEDKIRALPCQHE  500

Query  222  YHMICIDKWLKEvnrvcpvcrcnvcNGPGQSSISTTETP  106
            +HM C+DKWLKE++ VCP+CR +V  G  +SS+S +E P
Sbjct  501  FHMSCVDKWLKEIHGVCPLCRGDVRQGV-ESSVSNSEIP  538



>ref|XP_006372138.1| hypothetical protein POPTR_0018s12260g [Populus trichocarpa]
 gb|ERP49935.1| hypothetical protein POPTR_0018s12260g [Populus trichocarpa]
Length=595

 Score =   223 bits (569),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 124/191 (65%), Positives = 142/191 (74%), Gaps = 3/191 (2%)
 Frame = -1

Query  753  TGNADDLGSHDRWLIDLNGDLHYDGVGYGSSYLGETGHHRNERRLPSRSEISERVHRGHR  574
            T N DDL SHDRWL+D +GD   DG+G  S Y+    H  NERR  SRSEI ER+  G  
Sbjct  326  TDNTDDLESHDRWLLDFSGDFFDDGIGSDSGYMSRRIHRLNERRRHSRSEIWERLRGGLD  385

Query  573  NRVSQPSFCPSGLHPDGtcscesfftseefsTLASISRIIMLAEALFEVIDEIHRQ--SF  400
                + + CPSGLHPDGTCSCESF  +EE S   SISRI+MLAEALFEV+DEIHRQ  S 
Sbjct  386  ENGRRTTSCPSGLHPDGTCSCESFLMAEESSARGSISRIVMLAEALFEVLDEIHRQPVSL  445

Query  399  SLSTFSLPAPEATVDAFPLKYHKTLDPVENALGDTQQCYICLAEYEDGDKLRVLPCHHEY  220
            SLS  SLPAPE+ VD+FPLK HK LD V+    D +QCYICLAEYE+GDK+RVLPCHHEY
Sbjct  446  SLSMMSLPAPESVVDSFPLKNHKKLDRVKGNDED-EQCYICLAEYEEGDKIRVLPCHHEY  504

Query  219  HMICIDKWLKE  187
            HM+C+DKWLKE
Sbjct  505  HMVCVDKWLKE  515



>ref|XP_011017941.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like isoform 
X2 [Populus euphratica]
Length=545

 Score =   221 bits (562),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 123/191 (64%), Positives = 141/191 (74%), Gaps = 3/191 (2%)
 Frame = -1

Query  753  TGNADDLGSHDRWLIDLNGDLHYDGVGYGSSYLGETGHHRNERRLPSRSEISERVHRGHR  574
            T N DDL SHDRWL+D +GD   DG+G  S Y+    H  NERR  SRSEI ER+  G  
Sbjct  326  TDNTDDLESHDRWLLDFSGDFFDDGIGSDSGYMSRRIHRLNERRQHSRSEIWERLRGGLD  385

Query  573  NRVSQPSFCPSGLHPDGtcscesfftseefsTLASISRIIMLAEALFEVIDEIHRQ--SF  400
                + + CPSGLHPDGTCSCESF  +EE S   SISRI+MLAEALFEV+DEIHRQ  S 
Sbjct  386  ENGRRTTSCPSGLHPDGTCSCESFLMAEESSARGSISRIVMLAEALFEVLDEIHRQPVSL  445

Query  399  SLSTFSLPAPEATVDAFPLKYHKTLDPVENALGDTQQCYICLAEYEDGDKLRVLPCHHEY  220
            SLS  SLPAPE+ VD+ PLK HK LD V+    D +QCYICLAEYE+GDK+RVLPCHHEY
Sbjct  446  SLSMMSLPAPESVVDSCPLKNHKKLDRVKGNDED-EQCYICLAEYEEGDKIRVLPCHHEY  504

Query  219  HMICIDKWLKE  187
            HM+C+DKWLKE
Sbjct  505  HMVCVDKWLKE  515



>ref|XP_006372136.1| hypothetical protein POPTR_0018s12260g [Populus trichocarpa]
 gb|ERP49933.1| hypothetical protein POPTR_0018s12260g [Populus trichocarpa]
Length=547

 Score =   219 bits (559),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 124/193 (64%), Positives = 142/193 (74%), Gaps = 5/193 (3%)
 Frame = -1

Query  753  TGNADDLGSHDRWLIDLNGDLHYDGVGYGSSYLGETGHHRNERRLPSRSEISERVHRGHR  574
            T N DDL SHDRWL+D +GD   DG+G  S Y+    H  NERR  SRSEI ER+  G  
Sbjct  326  TDNTDDLESHDRWLLDFSGDFFDDGIGSDSGYMSRRIHRLNERRRHSRSEIWERLRGGLD  385

Query  573  NRVSQPSFCPSGLHPDGtcscesfftseefsTLASISRIIMLAEALFE--VIDEIHRQ--  406
                + + CPSGLHPDGTCSCESF  +EE S   SISRI+MLAEALFE  V+DEIHRQ  
Sbjct  386  ENGRRTTSCPSGLHPDGTCSCESFLMAEESSARGSISRIVMLAEALFELQVLDEIHRQPV  445

Query  405  SFSLSTFSLPAPEATVDAFPLKYHKTLDPVENALGDTQQCYICLAEYEDGDKLRVLPCHH  226
            S SLS  SLPAPE+ VD+FPLK HK LD V+    D +QCYICLAEYE+GDK+RVLPCHH
Sbjct  446  SLSLSMMSLPAPESVVDSFPLKNHKKLDRVKGNDED-EQCYICLAEYEEGDKIRVLPCHH  504

Query  225  EYHMICIDKWLKE  187
            EYHM+C+DKWLKE
Sbjct  505  EYHMVCVDKWLKE  517



>ref|XP_002532498.1| ring finger protein, putative [Ricinus communis]
 gb|EEF29874.1| ring finger protein, putative [Ricinus communis]
Length=550

 Score =   219 bits (558),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 123/191 (64%), Positives = 142/191 (74%), Gaps = 3/191 (2%)
 Frame = -1

Query  753  TGNADDLGSHDRWLIDLNGDLHYDGVGYGSSYLGETGHHRNERRLPSRSEISERVHRGHR  574
            T N DDL SH+RWL+D +GD+  DG+G  S YLG   H  N RR  SRSEI ER+  G  
Sbjct  325  TDNNDDLLSHERWLLDFSGDMFDDGIGGDSGYLGSRIHSLNGRRRHSRSEIWERLRGGLD  384

Query  573  NRVSQPSFCPSGLHPDGtcscesfftseefsTLASISRIIMLAEALFEVIDEIHRQ--SF  400
                + + CPSGLHP G CSCESF T+EE ST ASISRI+MLAEALFEV+DEIHRQ  S 
Sbjct  385  EHGRRTTLCPSGLHPYGICSCESFSTTEETSTRASISRIVMLAEALFEVLDEIHRQPVSL  444

Query  399  SLSTFSLPAPEATVDAFPLKYHKTLDPVENALGDTQQCYICLAEYEDGDKLRVLPCHHEY  220
            SLS  SLPAPE+ VDAFP++ HK  D V  +  D +QCYICLAEYE+GDK+RVLPCHHEY
Sbjct  445  SLSMMSLPAPESVVDAFPIRNHKKEDKVVGS-DDVEQCYICLAEYEEGDKIRVLPCHHEY  503

Query  219  HMICIDKWLKE  187
            HM C+DKWLKE
Sbjct  504  HMACVDKWLKE  514



>ref|XP_006453712.1| hypothetical protein CICLE_v10007967mg [Citrus clementina]
 gb|ESR66952.1| hypothetical protein CICLE_v10007967mg [Citrus clementina]
Length=494

 Score =   216 bits (551),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 122/191 (64%), Positives = 141/191 (74%), Gaps = 4/191 (2%)
 Frame = -1

Query  753  TGNADDLGSHDRWLIDLNGDLHYDGVGYGSSYLGETGHHRNERRLPSRSEISERVHRGHR  574
            T +  DLGSHDRWL+D +GD   DGVG  S YLG   H  NERR  SRSEI ER+  G  
Sbjct  279  TDDTGDLGSHDRWLLDFSGDYFDDGVGGDSGYLGRRVHSLNERRRHSRSEIWERLRAGLD  338

Query  573  NRVSQPSFCPSGLHPDGtcscesfftseefsTLASISRIIMLAEALFEVIDEIHRQ--SF  400
                + +FCPSGLHPDGTCSCESF  SE+  T A ISRI+MLAEALFEV+DEIHRQ  S 
Sbjct  339  ENSRRTTFCPSGLHPDGTCSCESFVMSEDSGTRA-ISRIVMLAEALFEVLDEIHRQPVSL  397

Query  399  SLSTFSLPAPEATVDAFPLKYHKTLDPVENALGDTQQCYICLAEYEDGDKLRVLPCHHEY  220
            SLS  SLPAPE+ VD+FP+K HK  D  E  + +  QCYICLAEYE+GD++R+LPCHHEY
Sbjct  398  SLSMVSLPAPESVVDSFPIKSHKKGDKAEGGV-EPDQCYICLAEYEEGDRIRLLPCHHEY  456

Query  219  HMICIDKWLKE  187
            HM C+DKWLKE
Sbjct  457  HMSCVDKWLKE  467



>gb|KDP30182.1| hypothetical protein JCGZ_16964 [Jatropha curcas]
Length=545

 Score =   218 bits (554),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 122/191 (64%), Positives = 142/191 (74%), Gaps = 3/191 (2%)
 Frame = -1

Query  753  TGNADDLGSHDRWLIDLNGDLHYDGVGYGSSYLGETGHHRNERRLPSRSEISERVHRGHR  574
            T N +DL SHDRWL+D +GDL  D +G  S YLG   H+ N RR  SRSEI ER+  G  
Sbjct  323  TDNTEDLLSHDRWLLDFSGDLFDDEIGSDSGYLGSRIHNMNARRRHSRSEIWERLRGGLD  382

Query  573  NRVSQPSFCPSGLHPDGtcscesfftseefsTLASISRIIMLAEALFEVIDEIHRQ--SF  400
                + + CPSGLHP+G CSCESF T+EE S  ASISRI+MLAEALFEV+DEIHRQ  S 
Sbjct  383  VHNRRTTLCPSGLHPEGRCSCESFSTTEETSNRASISRIVMLAEALFEVLDEIHRQPVSL  442

Query  399  SLSTFSLPAPEATVDAFPLKYHKTLDPVENALGDTQQCYICLAEYEDGDKLRVLPCHHEY  220
            SLS  SLPAPE+ VD+FPLK HK    V+ +  D +QCYICLAEYE+GDK+RVLPCHHEY
Sbjct  443  SLSMMSLPAPESVVDSFPLKNHKKQKKVDGS-DDVEQCYICLAEYEEGDKIRVLPCHHEY  501

Query  219  HMICIDKWLKE  187
            HM C+DKWLKE
Sbjct  502  HMSCVDKWLKE  512



>ref|XP_006473940.1| PREDICTED: uncharacterized protein LOC102616381 [Citrus sinensis]
Length=534

 Score =   217 bits (553),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 122/191 (64%), Positives = 141/191 (74%), Gaps = 4/191 (2%)
 Frame = -1

Query  753  TGNADDLGSHDRWLIDLNGDLHYDGVGYGSSYLGETGHHRNERRLPSRSEISERVHRGHR  574
            T +  DLGSHDRWL+D +GD   DGVG  S YLG   H  NERR  SRSEI ER+  G  
Sbjct  319  TDDTGDLGSHDRWLLDFSGDYFDDGVGGDSGYLGRRVHSLNERRRHSRSEIWERLRAGLD  378

Query  573  NRVSQPSFCPSGLHPDGtcscesfftseefsTLASISRIIMLAEALFEVIDEIHRQ--SF  400
                + +FCPSGLHPDGTCSCESF  SE+  T A ISRI+MLAEALFEV+DEIHRQ  S 
Sbjct  379  ENSRRTTFCPSGLHPDGTCSCESFVMSEDSGTRA-ISRIVMLAEALFEVLDEIHRQPVSL  437

Query  399  SLSTFSLPAPEATVDAFPLKYHKTLDPVENALGDTQQCYICLAEYEDGDKLRVLPCHHEY  220
            SLS  SLPAPE+ VD+FP+K HK  D  E  + +  QCYICLAEYE+GD++R+LPCHHEY
Sbjct  438  SLSMVSLPAPESVVDSFPIKSHKKGDKAEGGV-EPDQCYICLAEYEEGDRIRLLPCHHEY  496

Query  219  HMICIDKWLKE  187
            HM C+DKWLKE
Sbjct  497  HMSCVDKWLKE  507



>gb|KDO59332.1| hypothetical protein CISIN_1g043444mg [Citrus sinensis]
Length=534

 Score =   217 bits (553),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 122/191 (64%), Positives = 141/191 (74%), Gaps = 4/191 (2%)
 Frame = -1

Query  753  TGNADDLGSHDRWLIDLNGDLHYDGVGYGSSYLGETGHHRNERRLPSRSEISERVHRGHR  574
            T +  DLGSHDRWL+D +GD   DGVG  S YLG   H  NERR  SRSEI ER+  G  
Sbjct  319  TDDTGDLGSHDRWLLDFSGDYFDDGVGGDSGYLGRRVHSLNERRRHSRSEIWERLRAGLD  378

Query  573  NRVSQPSFCPSGLHPDGtcscesfftseefsTLASISRIIMLAEALFEVIDEIHRQ--SF  400
                + +FCPSGLHPDGTCSCESF  SE+  T A ISRI+MLAEALFEV+DEIHRQ  S 
Sbjct  379  ENSRRTTFCPSGLHPDGTCSCESFVMSEDSGTRA-ISRIVMLAEALFEVLDEIHRQPVSL  437

Query  399  SLSTFSLPAPEATVDAFPLKYHKTLDPVENALGDTQQCYICLAEYEDGDKLRVLPCHHEY  220
            SLS  SLPAPE+ VD+FP+K HK  D  E  + +  QCYICLAEYE+GD++R+LPCHHEY
Sbjct  438  SLSMVSLPAPESVVDSFPIKSHKKGDKAEGGV-EPDQCYICLAEYEEGDRIRLLPCHHEY  496

Query  219  HMICIDKWLKE  187
            HM C+DKWLKE
Sbjct  497  HMSCVDKWLKE  507



>ref|XP_006453713.1| hypothetical protein CICLE_v10007967mg [Citrus clementina]
 gb|ESR66953.1| hypothetical protein CICLE_v10007967mg [Citrus clementina]
Length=534

 Score =   217 bits (552),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 122/191 (64%), Positives = 141/191 (74%), Gaps = 4/191 (2%)
 Frame = -1

Query  753  TGNADDLGSHDRWLIDLNGDLHYDGVGYGSSYLGETGHHRNERRLPSRSEISERVHRGHR  574
            T +  DLGSHDRWL+D +GD   DGVG  S YLG   H  NERR  SRSEI ER+  G  
Sbjct  319  TDDTGDLGSHDRWLLDFSGDYFDDGVGGDSGYLGRRVHSLNERRRHSRSEIWERLRAGLD  378

Query  573  NRVSQPSFCPSGLHPDGtcscesfftseefsTLASISRIIMLAEALFEVIDEIHRQ--SF  400
                + +FCPSGLHPDGTCSCESF  SE+  T A ISRI+MLAEALFEV+DEIHRQ  S 
Sbjct  379  ENSRRTTFCPSGLHPDGTCSCESFVMSEDSGTRA-ISRIVMLAEALFEVLDEIHRQPVSL  437

Query  399  SLSTFSLPAPEATVDAFPLKYHKTLDPVENALGDTQQCYICLAEYEDGDKLRVLPCHHEY  220
            SLS  SLPAPE+ VD+FP+K HK  D  E  + +  QCYICLAEYE+GD++R+LPCHHEY
Sbjct  438  SLSMVSLPAPESVVDSFPIKSHKKGDKAEGGV-EPDQCYICLAEYEEGDRIRLLPCHHEY  496

Query  219  HMICIDKWLKE  187
            HM C+DKWLKE
Sbjct  497  HMSCVDKWLKE  507



>ref|XP_011017942.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like isoform 
X3 [Populus euphratica]
Length=505

 Score =   216 bits (549),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 123/193 (64%), Positives = 141/193 (73%), Gaps = 5/193 (3%)
 Frame = -1

Query  753  TGNADDLGSHDRWLIDLNGDLHYDGVGYGSSYLGETGHHRNERRLPSRSEISERVHRGHR  574
            T N DDL SHDRWL+D +GD   DG+G  S Y+    H  NERR  SRSEI ER+  G  
Sbjct  284  TDNTDDLESHDRWLLDFSGDFFDDGIGSDSGYMSRRIHRLNERRQHSRSEIWERLRGGLD  343

Query  573  NRVSQPSFCPSGLHPDGtcscesfftseefsTLASISRIIMLAEALFE--VIDEIHRQ--  406
                + + CPSGLHPDGTCSCESF  +EE S   SISRI+MLAEALFE  V+DEIHRQ  
Sbjct  344  ENGRRTTSCPSGLHPDGTCSCESFLMAEESSARGSISRIVMLAEALFELQVLDEIHRQPV  403

Query  405  SFSLSTFSLPAPEATVDAFPLKYHKTLDPVENALGDTQQCYICLAEYEDGDKLRVLPCHH  226
            S SLS  SLPAPE+ VD+ PLK HK LD V+    D +QCYICLAEYE+GDK+RVLPCHH
Sbjct  404  SLSLSMMSLPAPESVVDSCPLKNHKKLDRVKGNDED-EQCYICLAEYEEGDKIRVLPCHH  462

Query  225  EYHMICIDKWLKE  187
            EYHM+C+DKWLKE
Sbjct  463  EYHMVCVDKWLKE  475



>ref|XP_011017940.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like isoform 
X1 [Populus euphratica]
Length=547

 Score =   216 bits (549),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 123/193 (64%), Positives = 141/193 (73%), Gaps = 5/193 (3%)
 Frame = -1

Query  753  TGNADDLGSHDRWLIDLNGDLHYDGVGYGSSYLGETGHHRNERRLPSRSEISERVHRGHR  574
            T N DDL SHDRWL+D +GD   DG+G  S Y+    H  NERR  SRSEI ER+  G  
Sbjct  326  TDNTDDLESHDRWLLDFSGDFFDDGIGSDSGYMSRRIHRLNERRQHSRSEIWERLRGGLD  385

Query  573  NRVSQPSFCPSGLHPDGtcscesfftseefsTLASISRIIMLAEALFE--VIDEIHRQ--  406
                + + CPSGLHPDGTCSCESF  +EE S   SISRI+MLAEALFE  V+DEIHRQ  
Sbjct  386  ENGRRTTSCPSGLHPDGTCSCESFLMAEESSARGSISRIVMLAEALFELQVLDEIHRQPV  445

Query  405  SFSLSTFSLPAPEATVDAFPLKYHKTLDPVENALGDTQQCYICLAEYEDGDKLRVLPCHH  226
            S SLS  SLPAPE+ VD+ PLK HK LD V+    D +QCYICLAEYE+GDK+RVLPCHH
Sbjct  446  SLSLSMMSLPAPESVVDSCPLKNHKKLDRVKGNDED-EQCYICLAEYEEGDKIRVLPCHH  504

Query  225  EYHMICIDKWLKE  187
            EYHM+C+DKWLKE
Sbjct  505  EYHMVCVDKWLKE  517



>gb|KHG26588.1| RING-H2 finger ATL11 -like protein [Gossypium arboreum]
Length=525

 Score =   214 bits (545),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 116/193 (60%), Positives = 143/193 (74%), Gaps = 6/193 (3%)
 Frame = -1

Query  753  TGNADDLGSHDRWLIDLNGDLHYDGVGYGSSYLGETG-HHRNERRLPSRSEISERVHRGH  577
            + + +D+ S DRWL+D +GD  YDG G  S YL  +  H  NERR  SRSEI ER+  GH
Sbjct  307  SNDRNDVASQDRWLLDFSGDFFYDGAGGDSGYLSTSRIHSLNERRQHSRSEIWERLLGGH  366

Query  576  RNRVSQPSFCPSGLHPDGtcscesfftseefsTLASISRIIMLAEALFEVIDEIHRQ--S  403
                 Q +FCPSGLHPDGTCSC+S   ++E S  ASISRI+MLAEALFEV+DEIHRQ  S
Sbjct  367  DENSQQTTFCPSGLHPDGTCSCDSLLLTDESSARASISRIVMLAEALFEVLDEIHRQPVS  426

Query  402  FSLSTFSLPAPEATVDAFPLKYHKTLDPVENALGDT-QQCYICLAEYEDGDKLRVLPCHH  226
             SLS  SLPAPE+ VD+FPL+ HK +D   + +GDT +QC+ICLAEYE+ +K+RVLPC H
Sbjct  427  LSLSMVSLPAPESVVDSFPLRNHKKVDA--SKIGDTVEQCHICLAEYEEEEKIRVLPCQH  484

Query  225  EYHMICIDKWLKE  187
            E+HM C+DKWLKE
Sbjct  485  EFHMSCVDKWLKE  497



>ref|XP_003549707.1| PREDICTED: uncharacterized protein DDB_G0271670-like [Glycine 
max]
 gb|KHN18599.1| E3 ubiquitin-protein ligase RNF12-B [Glycine soja]
Length=541

 Score =   213 bits (543),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 121/191 (63%), Positives = 140/191 (73%), Gaps = 5/191 (3%)
 Frame = -1

Query  750  GNADDLGSHDRWLIDLNGDLHYDGVGYGSSYLGETGHHRNERRLP-SRSEISERVHRGHR  574
            G ADD GS DRWL+D  GDL  DGVG  S Y G   H  NERR+  SRSEI ER+ RG  
Sbjct  325  GGADDSGSQDRWLVDFGGDLSNDGVGGASGYTGSRIHRLNERRMQHSRSEIWERL-RGGF  383

Query  573  NRVSQPSFCPSGLHPDGtcscesfftseefsTLASISRIIMLAEALFEVIDEIHRQ--SF  400
            + + + + CP GLH DG CSCES   +EE ST ASISRIIMLAEALFEV+DEIHRQ  S 
Sbjct  384  DEIGRWNSCPLGLHADGMCSCESSPMAEESSTQASISRIIMLAEALFEVLDEIHRQPGSL  443

Query  399  SLSTFSLPAPEATVDAFPLKYHKTLDPVENALGDTQQCYICLAEYEDGDKLRVLPCHHEY  220
            SLS  SLPAPE+ VD+ PLK HK +D V +   D +QCYICLA+YE+GD++RVLPC HEY
Sbjct  444  SLSMVSLPAPESVVDSLPLKSHKKVD-VAHGGNDAEQCYICLADYEEGDQIRVLPCFHEY  502

Query  219  HMICIDKWLKE  187
            HM C+DKWLKE
Sbjct  503  HMSCVDKWLKE  513



>gb|KJB27057.1| hypothetical protein B456_004G275100 [Gossypium raimondii]
Length=525

 Score =   212 bits (540),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 116/189 (61%), Positives = 140/189 (74%), Gaps = 6/189 (3%)
 Frame = -1

Query  741  DDLGSHDRWLIDLNGDLHYDGVGYGSSYLGETG-HHRNERRLPSRSEISERVHRGHRNRV  565
            +D+ S DRWL+D +GD  YDG G  S YL  +  H  NERR  SRSEI ER+  GH    
Sbjct  311  NDVASQDRWLLDFSGDFFYDGAGGDSGYLSTSRIHSLNERRRHSRSEIWERLLGGHDENS  370

Query  564  SQPSFCPSGLHPDGtcscesfftseefsTLASISRIIMLAEALFEVIDEIHRQ--SFSLS  391
             Q +FCPSGLHPDGTCSC+S   ++E S  ASISRI+MLAEALFEV+DEIHRQ  S SLS
Sbjct  371  QQTTFCPSGLHPDGTCSCDSLLLTDESSARASISRIVMLAEALFEVLDEIHRQPVSLSLS  430

Query  390  TFSLPAPEATVDAFPLKYHKTLDPVENALGDT-QQCYICLAEYEDGDKLRVLPCHHEYHM  214
              SLPAPE+ VD+FPL+ HK +D   + +GDT  QC+ICLAEYE+ +K+RVLPC HE+HM
Sbjct  431  MVSLPAPESVVDSFPLRNHKKVDA--SKVGDTVDQCHICLAEYEEEEKIRVLPCQHEFHM  488

Query  213  ICIDKWLKE  187
             C+DKWLKE
Sbjct  489  SCVDKWLKE  497



>ref|XP_010244797.1| PREDICTED: uncharacterized protein LOC104588534 [Nelumbo nucifera]
Length=520

 Score =   211 bits (538),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 121/191 (63%), Positives = 138/191 (72%), Gaps = 4/191 (2%)
 Frame = -1

Query  753  TGNADDLGSHDRWLIDLNGDLHYDGVGYGSSYLGETGHHRNERRLPSRSEISERVHRGHR  574
            T +ADDLGS DRWL+D +GDL  DG G  S YLG + H   ERR  S SEI ER+  G  
Sbjct  318  TEDADDLGSPDRWLLDFSGDLFEDGFGGESGYLGRS-HGIYERRWNSGSEIWERLRGGFD  376

Query  573  NRVSQPSFCPSGLHPDGtcscesfftseefsTLASISRIIMLAEALFEVIDEIHRQS--F  400
                + +FC SGLHPDGTCSC SF  +EE  T ASISRI+MLAEALFEV+DEIHRQ    
Sbjct  377  ENGRRTTFCASGLHPDGTCSCGSFLVAEESGTRASISRIVMLAEALFEVLDEIHRQPVPL  436

Query  399  SLSTFSLPAPEATVDAFPLKYHKTLDPVENALGDTQQCYICLAEYEDGDKLRVLPCHHEY  220
            SLS  S+PAPE+ V+A PLK HK  +  E    D +QCYICLAEYE+GDK+RVLPCHHEY
Sbjct  437  SLSMVSVPAPESVVNALPLKSHKKANTAETG-ADVEQCYICLAEYEEGDKIRVLPCHHEY  495

Query  219  HMICIDKWLKE  187
            HM CIDKWLKE
Sbjct  496  HMPCIDKWLKE  506



>ref|XP_011093487.1| PREDICTED: uncharacterized RING finger protein C4G3.12c-like 
[Sesamum indicum]
Length=515

 Score =   210 bits (535),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 138/220 (63%), Positives = 165/220 (75%), Gaps = 11/220 (5%)
 Frame = -1

Query  753  TGNADDLGSHDRWLIDLNGDLHYDGVGYGSSYLGETGHHRNERRLPSRSEISERVHRGHR  574
            TG ADDLGSHDRW +D +GDLHY+G G+          H NERR   RSE+SER+  G  
Sbjct  305  TGLADDLGSHDRWPLDFSGDLHYNGAGHD---------HINERRWLLRSEVSERLLGGLN  355

Query  573  NRVSQPSFCPSGLHPDGtcscesfftseefsTLASISRIIMLAEALFEVIDEIHRQSFSL  394
                Q +FC SGLH DGTCSC+SFFT+EE  +LASISRIIMLAEALFEV+DEIH QS SL
Sbjct  356  EGDRQTTFCASGLHLDGTCSCDSFFTAEESRSLASISRIIMLAEALFEVLDEIHHQSLSL  415

Query  393  STFSL--PAPEATVDAFPLKYHKTLDPVENALGDTQQCYICLAEYEDGDKLRVLPCHHEY  220
            S  +L  PAPE+ VDAFPLKYH+ +   ++   D QQCYICL++YE+GDKLRVLPC+HEY
Sbjct  416  SLSTLSLPAPESVVDAFPLKYHRKIKNADSDPNDVQQCYICLSDYEEGDKLRVLPCNHEY  475

Query  219  HMICIDKWLKEvnrvcpvcrcnvcNGPGQSSISTTETPLQ  100
            H+ CIDKWLKEVNRVCP+CR NVC GP + S++ T+   Q
Sbjct  476  HVPCIDKWLKEVNRVCPLCRHNVCEGPRECSVTNTQLSSQ  515



>ref|XP_003542670.1| PREDICTED: uncharacterized protein DDB_G0271670-like [Glycine 
max]
Length=540

 Score =   211 bits (536),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 117/192 (61%), Positives = 139/192 (72%), Gaps = 5/192 (3%)
 Frame = -1

Query  753  TGNADDLGSHDRWLIDLNGDLHYDGVGYGSSYLGETGHHRNERRLP-SRSEISERVHRGH  577
             G ADD GS DRWL+D  GDL  DGVG  S Y+G   H  NERR+  SRSEI ER+ RG 
Sbjct  323  AGGADDSGSQDRWLVDFGGDLSNDGVGAASGYMGSRIHRLNERRMRHSRSEIWERL-RGG  381

Query  576  RNRVSQPSFCPSGLHPDGtcscesfftseefsTLASISRIIMLAEALFEVIDEIHRQ--S  403
             + + + + CP G+H DG C CES   +EE ST ASISRI+MLAEALFEV+DEIHRQ  S
Sbjct  382  FDEIGRWNSCPLGIHADGMCFCESSPMAEESSTRASISRIVMLAEALFEVLDEIHRQPGS  441

Query  402  FSLSTFSLPAPEATVDAFPLKYHKTLDPVENALGDTQQCYICLAEYEDGDKLRVLPCHHE  223
             SLS  SLPAPE+ VD+ PLK HK +D  +    D +QCYICLA+YE+GD++RVLPC HE
Sbjct  442  LSLSMVSLPAPESIVDSLPLKSHKKVDGADVG-NDAEQCYICLADYEEGDQIRVLPCFHE  500

Query  222  YHMICIDKWLKE  187
            YHM C+DKWLKE
Sbjct  501  YHMSCVDKWLKE  512



>gb|KJB27058.1| hypothetical protein B456_004G275100 [Gossypium raimondii]
Length=549

 Score =   211 bits (536),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 116/189 (61%), Positives = 140/189 (74%), Gaps = 6/189 (3%)
 Frame = -1

Query  741  DDLGSHDRWLIDLNGDLHYDGVGYGSSYLGETG-HHRNERRLPSRSEISERVHRGHRNRV  565
            +D+ S DRWL+D +GD  YDG G  S YL  +  H  NERR  SRSEI ER+  GH    
Sbjct  311  NDVASQDRWLLDFSGDFFYDGAGGDSGYLSTSRIHSLNERRRHSRSEIWERLLGGHDENS  370

Query  564  SQPSFCPSGLHPDGtcscesfftseefsTLASISRIIMLAEALFEVIDEIHRQ--SFSLS  391
             Q +FCPSGLHPDGTCSC+S   ++E S  ASISRI+MLAEALFEV+DEIHRQ  S SLS
Sbjct  371  QQTTFCPSGLHPDGTCSCDSLLLTDESSARASISRIVMLAEALFEVLDEIHRQPVSLSLS  430

Query  390  TFSLPAPEATVDAFPLKYHKTLDPVENALGDT-QQCYICLAEYEDGDKLRVLPCHHEYHM  214
              SLPAPE+ VD+FPL+ HK +D   + +GDT  QC+ICLAEYE+ +K+RVLPC HE+HM
Sbjct  431  MVSLPAPESVVDSFPLRNHKKVDA--SKVGDTVDQCHICLAEYEEEEKIRVLPCQHEFHM  488

Query  213  ICIDKWLKE  187
             C+DKWLKE
Sbjct  489  SCVDKWLKE  497



>gb|KHN47137.1| RING-H2 finger protein ATL65 [Glycine soja]
Length=562

 Score =   211 bits (536),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 117/192 (61%), Positives = 139/192 (72%), Gaps = 5/192 (3%)
 Frame = -1

Query  753  TGNADDLGSHDRWLIDLNGDLHYDGVGYGSSYLGETGHHRNERRLP-SRSEISERVHRGH  577
             G ADD GS DRWL+D  GDL  DGVG  S Y+G   H  NERR+  SRSEI ER+ RG 
Sbjct  345  AGGADDSGSQDRWLVDFGGDLSNDGVGAASGYMGSRIHRLNERRMRHSRSEIWERL-RGG  403

Query  576  RNRVSQPSFCPSGLHPDGtcscesfftseefsTLASISRIIMLAEALFEVIDEIHRQ--S  403
             + + + + CP G+H DG C CES   +EE ST ASISRI+MLAEALFEV+DEIHRQ  S
Sbjct  404  FDEIGRWNSCPLGIHADGMCFCESSPMAEESSTRASISRIVMLAEALFEVLDEIHRQPGS  463

Query  402  FSLSTFSLPAPEATVDAFPLKYHKTLDPVENALGDTQQCYICLAEYEDGDKLRVLPCHHE  223
             SLS  SLPAPE+ VD+ PLK HK +D  +    D +QCYICLA+YE+GD++RVLPC HE
Sbjct  464  LSLSMVSLPAPESIVDSLPLKSHKKVDGADVG-NDAEQCYICLADYEEGDQIRVLPCFHE  522

Query  222  YHMICIDKWLKE  187
            YHM C+DKWLKE
Sbjct  523  YHMSCVDKWLKE  534



>ref|XP_009338413.1| PREDICTED: uncharacterized protein LOC103930767 [Pyrus x bretschneideri]
Length=537

 Score =   207 bits (527),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 113/191 (59%), Positives = 139/191 (73%), Gaps = 3/191 (2%)
 Frame = -1

Query  753  TGNADDLGSHDRWLIDLNGDLHYDGVGYGSSYLGETGHHRNERRLPSRSEISERVHRGHR  574
            T + +D+GSHDRWL+ L+GDL  DG+G  S +      + NERR  SRSE+ ER+  G  
Sbjct  319  TDDTEDMGSHDRWLLGLSGDLFDDGIGADSGHRASRIPYSNERRRHSRSEVWERLRVGLD  378

Query  573  NRVSQPSFCPSGLHPDGtcscesfftseefsTLASISRIIMLAEALFEVIDEIHRQ--SF  400
            +   + + CP+G+HP G CSC SF T+EE ST ASISRI+MLAEALFEV+DEIHRQ  S 
Sbjct  379  DNGQRNTSCPTGIHPRGMCSCGSFSTTEESSTRASISRIVMLAEALFEVLDEIHRQPVSL  438

Query  399  SLSTFSLPAPEATVDAFPLKYHKTLDPVENALGDTQQCYICLAEYEDGDKLRVLPCHHEY  220
            SLS  S PAP + VD FPLK H  +D  ++   D +QCYICLAEYE+GDK+RVLPCHHEY
Sbjct  439  SLSMVSAPAPASVVDGFPLKSHTKVDKSKSG-DDAEQCYICLAEYEEGDKIRVLPCHHEY  497

Query  219  HMICIDKWLKE  187
            HM C+DKWLKE
Sbjct  498  HMSCVDKWLKE  508



>ref|XP_009358516.1| PREDICTED: uncharacterized protein LOC103949139 [Pyrus x bretschneideri]
Length=537

 Score =   206 bits (524),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 112/191 (59%), Positives = 139/191 (73%), Gaps = 3/191 (2%)
 Frame = -1

Query  753  TGNADDLGSHDRWLIDLNGDLHYDGVGYGSSYLGETGHHRNERRLPSRSEISERVHRGHR  574
            T + +D+GSHDRWL+ L+GDL  DG+G  S +      + NERR  SRSE+ ER+  G  
Sbjct  319  TDDTEDMGSHDRWLLGLSGDLFDDGIGADSGHRASRIPYSNERRRHSRSEVWERLRVGLD  378

Query  573  NRVSQPSFCPSGLHPDGtcscesfftseefsTLASISRIIMLAEALFEVIDEIHRQ--SF  400
            +   + + CP+G+HP G CSC SF T+EE ST ASISRI+MLAEALFEV+DEIHRQ  S 
Sbjct  379  DNGQRNTSCPTGIHPRGMCSCGSFLTTEESSTRASISRIVMLAEALFEVLDEIHRQPVSL  438

Query  399  SLSTFSLPAPEATVDAFPLKYHKTLDPVENALGDTQQCYICLAEYEDGDKLRVLPCHHEY  220
            SLS  S PAP + VD FPLK H  +D  ++   D +QC+ICLAEYE+GDK+RVLPCHHEY
Sbjct  439  SLSMVSAPAPASVVDGFPLKSHTKVDKSKSG-DDAEQCFICLAEYEEGDKIRVLPCHHEY  497

Query  219  HMICIDKWLKE  187
            HM C+DKWLKE
Sbjct  498  HMSCVDKWLKE  508



>ref|XP_007203806.1| hypothetical protein PRUPE_ppa003827mg [Prunus persica]
 gb|EMJ05005.1| hypothetical protein PRUPE_ppa003827mg [Prunus persica]
Length=546

 Score =   205 bits (521),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 111/191 (58%), Positives = 137/191 (72%), Gaps = 4/191 (2%)
 Frame = -1

Query  753  TGNADDLGSHDRWLIDLNGDLHYDGVGYGSSYLGETGHHRNERRLPSRSEISERVHRGHR  574
            T + +DLG HDRWL+ L+GD   DG+G  S Y G    + NERR  SRSE+ ER+  G  
Sbjct  328  TDDTEDLGFHDRWLLGLSGDFFDDGIGADSGYQGNRIPNSNERRRHSRSEVWERLRVGLD  387

Query  573  NRVSQPSFCPSGLHPDGtcscesfftseefsTLASISRIIMLAEALFEVIDEIHRQ--SF  400
            +   + + CP+G+HP G CSC SF T E  +  ASISRI+MLAEALFEV+DEIHRQ  S 
Sbjct  388  DNSQRNTSCPTGIHPRGMCSCGSFLTEESSTR-ASISRIVMLAEALFEVLDEIHRQPVSL  446

Query  399  SLSTFSLPAPEATVDAFPLKYHKTLDPVENALGDTQQCYICLAEYEDGDKLRVLPCHHEY  220
            SLS  S+PAP + VD+FPLK H  +D +++   D  QCYICLAEYE+GDK+RVLPCHHEY
Sbjct  447  SLSMVSVPAPASVVDSFPLKSHTEVDTLKSG-DDVAQCYICLAEYEEGDKIRVLPCHHEY  505

Query  219  HMICIDKWLKE  187
            HM C+DKWLKE
Sbjct  506  HMSCVDKWLKE  516



>ref|XP_008242903.1| PREDICTED: probable GPI-anchored adhesin-like protein PGA55 [Prunus 
mume]
Length=546

 Score =   204 bits (520),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 111/191 (58%), Positives = 137/191 (72%), Gaps = 4/191 (2%)
 Frame = -1

Query  753  TGNADDLGSHDRWLIDLNGDLHYDGVGYGSSYLGETGHHRNERRLPSRSEISERVHRGHR  574
            T + +DLG HDRWL+ L+GD   DG+G  S Y G    + NERR  SRSE+ ER+  G  
Sbjct  328  TDDTEDLGFHDRWLLGLSGDFFDDGIGADSGYQGNRIPNSNERRRHSRSEVWERLRVGLD  387

Query  573  NRVSQPSFCPSGLHPDGtcscesfftseefsTLASISRIIMLAEALFEVIDEIHRQ--SF  400
            +   + + CP+G+HP G CSC SF T E  +  ASISRI+MLAEALFEV+DEIHRQ  S 
Sbjct  388  DNGQRNTSCPTGIHPRGMCSCGSFLTEESSTR-ASISRIVMLAEALFEVLDEIHRQPVSL  446

Query  399  SLSTFSLPAPEATVDAFPLKYHKTLDPVENALGDTQQCYICLAEYEDGDKLRVLPCHHEY  220
            SLS  S+PAP + VD+FPLK H  +D +++   D  QCYICLAEYE+GDK+RVLPCHHEY
Sbjct  447  SLSMVSVPAPASVVDSFPLKSHTKVDTLKSG-DDVAQCYICLAEYEEGDKIRVLPCHHEY  505

Query  219  HMICIDKWLKE  187
            HM C+DKWLKE
Sbjct  506  HMSCVDKWLKE  516



>ref|XP_002308375.2| hypothetical protein POPTR_0006s20490g [Populus trichocarpa]
 gb|EEE91898.2| hypothetical protein POPTR_0006s20490g [Populus trichocarpa]
Length=576

 Score =   204 bits (519),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 132/248 (53%), Positives = 156/248 (63%), Gaps = 33/248 (13%)
 Frame = -1

Query  753  TGNADDLGSHDRWLIDLNGDLHYDGVGYGSSYLGETGHHRNERRLPSRSEISE-------  595
            T N DDL SHDRWL++ +GD   DG+   S YLG   H  NERR  SRSEI E       
Sbjct  328  TDNNDDLESHDRWLLNFSGDFLNDGIDNDSRYLGRRIHGLNERRRHSRSEILEIIRLYVD  387

Query  594  -----------------------RVHRGHRNRVSQPSFCPSGLHPDGtcscesfftseef  484
                                   R+H G      + + CPSGLHPDGTCSCES   +EE 
Sbjct  388  GVDCFLQSSTRPLYSYCSTEIWERLHGGLDENGRRTTSCPSGLHPDGTCSCESILMTEEL  447

Query  483  sTLASISRIIMLAEALFEVIDEIHRQ--SFSLSTFSLPAPEATVDAFPLKYHKTLDPVEN  310
            +    ISRI+MLAEALFEV+DEIHRQ  S SLS  SLPAPE+ VD+FPLK HK +D VE 
Sbjct  448  NAHRRISRIVMLAEALFEVLDEIHRQPVSLSLSMMSLPAPESIVDSFPLKNHKKVDKVEG  507

Query  309  ALGDTQQCYICLAEYEDGDKLRVLPCHHEYHMICIDKWLKEvnrvcpvcrcnvcNGPGQS  130
               + +QCYICLAEYE+GDK+RVLPCHHEYHM C+DKWLKE++ VCP+CR +V  G  + 
Sbjct  508  N-DEHEQCYICLAEYEEGDKIRVLPCHHEYHMACVDKWLKEIHGVCPLCRGDVREGANEP  566

Query  129  SISTTETP  106
            SI   E P
Sbjct  567  SIPNPEIP  574



>gb|KDP28901.1| hypothetical protein JCGZ_14672 [Jatropha curcas]
Length=473

 Score =   201 bits (511),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 124/218 (57%), Positives = 152/218 (70%), Gaps = 2/218 (1%)
 Frame = -1

Query  753  TGNADDLGSHDRWLIDLNGDLHYDGVGYGSSYLGETGHHRNERRLPSRSEISERVHRGHR  574
            T +ADDLGSHDRWL+D +GDLHYDG+G  S Y G    HR+ER   SR E+ ER    + 
Sbjct  254  TSHADDLGSHDRWLLDYSGDLHYDGIGRESRYSGTRSDHRSERLWQSRYEMLERFRDFYD  313

Query  573  NRVSQPSFCPSGLHPDGtcscesfftseefsTLASISRIIMLAEALFEVIDEIHR--QSF  400
             +  Q S C +G HP GTCSCES   +EE S  ASIS+IIMLA+ALFEV++E+HR   SF
Sbjct  314  EQGWQGSLCATGRHPRGTCSCESSSIAEESSRRASISQIIMLADALFEVLEEVHRHRMSF  373

Query  399  SLSTFSLPAPEATVDAFPLKYHKTLDPVENALGDTQQCYICLAEYEDGDKLRVLPCHHEY  220
            SLS  +LPAPEA V++F LK +K     E+   D QQC ICL +YE+GDK+R LPC HEY
Sbjct  374  SLSMLNLPAPEAVVNSFLLKDYKKSCGTESGTHDVQQCNICLVDYEEGDKIRALPCSHEY  433

Query  219  HMICIDKWLKEvnrvcpvcrcnvcNGPGQSSISTTETP  106
            HM C+DKWLKEV+ VCP+CR +VC G  + S S  E P
Sbjct  434  HMSCVDKWLKEVHGVCPLCRDDVCKGVAEGSASNPEIP  471



>ref|XP_010244858.1| PREDICTED: uncharacterized protein LOC104588570 isoform X1 [Nelumbo 
nucifera]
Length=539

 Score =   202 bits (513),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 119/192 (62%), Positives = 139/192 (72%), Gaps = 6/192 (3%)
 Frame = -1

Query  753  TGNADDLGSHDRWLIDLNGDLHYDGVGYGSSYLGETGHHRNERRLPSRSEISERVHRGHR  574
            T +ADDLGS +RWL+D +GDL  DG G    YLG + H   + R  S  EI ER HRG  
Sbjct  322  TEDADDLGSPNRWLLDFSGDLFEDGFGGDLGYLGRS-HGIYQHRWNSGPEIWER-HRGDL  379

Query  573  NRVSQ-PSFCPSGLHPDGtcscesfftseefsTLASISRIIMLAEALFEVIDEIHRQS--  403
            +   +  +FC SGLHPDGTCSC SF  +EE  T ASISRI+MLAEALFEV+DEIHRQ   
Sbjct  380  DESGRRTTFCASGLHPDGTCSCGSFLVTEESGTRASISRIVMLAEALFEVLDEIHRQPVP  439

Query  402  FSLSTFSLPAPEATVDAFPLKYHKTLDPVENALGDTQQCYICLAEYEDGDKLRVLPCHHE  223
             SLS  S+PAPE+ V++FPLK HK  +  EN   D +QCYICLAEYE+GDK+RVLPCHHE
Sbjct  440  LSLSMVSVPAPESVVNSFPLKNHKKANTAENG-ADVEQCYICLAEYEEGDKIRVLPCHHE  498

Query  222  YHMICIDKWLKE  187
            YHM CIDKWLKE
Sbjct  499  YHMQCIDKWLKE  510



>ref|XP_008784815.1| PREDICTED: E3 ubiquitin-protein ligase RLIM-like [Phoenix dactylifera]
Length=533

 Score =   201 bits (510),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 114/187 (61%), Positives = 135/187 (72%), Gaps = 3/187 (2%)
 Frame = -1

Query  741  DDLGSHDRWLIDLNGDLHYDGVGYGSSYLGETGHHRNERRLPSRSEISERVHRGHRNRVS  562
            DDLGS DRWL+D+  DL   GV   S Y+    +H +     SRSEI ER+  G  +   
Sbjct  325  DDLGSRDRWLLDIGDDLFGSGVEDDSIYMRRRRYHPSGLSWHSRSEIRERLRAGFDDSNR  384

Query  561  QPSFCPSGLHPDGtcscesfftseefsTLASISRIIMLAEALFEVIDEIHRQ--SFSLST  388
            Q SFCPSGLHPDGTCSC+S   +EE ST ASISRI+MLAEALFEV+DEIHRQ  S SLS 
Sbjct  385  QTSFCPSGLHPDGTCSCDSLLITEESSTRASISRIVMLAEALFEVLDEIHRQPVSLSLSM  444

Query  387  FSLPAPEATVDAFPLKYHKTLDPVENALGDTQQCYICLAEYEDGDKLRVLPCHHEYHMIC  208
             SLPAPE+ +++ P K ++ LD V  +  D +QCYICLAEYEDGDK+RVLPC HEYHM C
Sbjct  445  VSLPAPESVINSLPSKNYEKLD-VARSGDDVEQCYICLAEYEDGDKIRVLPCRHEYHMSC  503

Query  207  IDKWLKE  187
            +DKWLKE
Sbjct  504  VDKWLKE  510



>ref|XP_010942169.1| PREDICTED: uncharacterized protein LOC105060248 isoform X1 [Elaeis 
guineensis]
Length=533

 Score =   199 bits (506),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 112/187 (60%), Positives = 135/187 (72%), Gaps = 3/187 (2%)
 Frame = -1

Query  741  DDLGSHDRWLIDLNGDLHYDGVGYGSSYLGETGHHRNERRLPSRSEISERVHRGHRNRVS  562
            DDLGS DRWL+D+  D+  +GV   S Y+    +H +     SRSEI ER+  G  +   
Sbjct  325  DDLGSRDRWLLDIGDDIFGNGVEDDSIYMRRRRYHPSGLSWHSRSEIRERIRAGFDDSNR  384

Query  561  QPSFCPSGLHPDGtcscesfftseefsTLASISRIIMLAEALFEVIDEIHRQ--SFSLST  388
            Q SFCP+GLHPDGTCSC+S   +EE ST ASISRI+MLAEALFEV+DEIHRQ  S SLS 
Sbjct  385  QTSFCPTGLHPDGTCSCDSLLMTEESSTRASISRIVMLAEALFEVLDEIHRQPVSLSLSM  444

Query  387  FSLPAPEATVDAFPLKYHKTLDPVENALGDTQQCYICLAEYEDGDKLRVLPCHHEYHMIC  208
             SLPAPE+ V++ P K ++ LD   +   D +QCYICLAEYEDGDK+RVLPC HEYHM C
Sbjct  445  VSLPAPESVVNSLPSKNYEKLDGAGSG-DDVEQCYICLAEYEDGDKIRVLPCRHEYHMSC  503

Query  207  IDKWLKE  187
            +DKWLKE
Sbjct  504  VDKWLKE  510



>ref|XP_008336935.1| PREDICTED: uncharacterized protein LOC103400032 [Malus domestica]
Length=537

 Score =   199 bits (505),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 109/191 (57%), Positives = 135/191 (71%), Gaps = 3/191 (2%)
 Frame = -1

Query  753  TGNADDLGSHDRWLIDLNGDLHYDGVGYGSSYLGETGHHRNERRLPSRSEISERVHRGHR  574
            T + +D+G HDRWL+ L+GDL  DG+G  S +      + NERR  SRSE+ ER+  G  
Sbjct  319  TDDTEDMGFHDRWLLGLSGDLFDDGIGADSGHRASRIPYSNERRRHSRSEVWERLRVGLD  378

Query  573  NRVSQPSFCPSGLHPDGtcscesfftseefsTLASISRIIMLAEALFEVIDEIHRQ--SF  400
            +   + + CP+G+HP G CSC SF T+EE ST  SISRI+MLAEALFEV+DEIHRQ  S 
Sbjct  379  DNGQRNTSCPTGIHPRGMCSCGSFSTTEESSTRXSISRIVMLAEALFEVLDEIHRQPVSL  438

Query  399  SLSTFSLPAPEATVDAFPLKYHKTLDPVENALGDTQQCYICLAEYEDGDKLRVLPCHHEY  220
            SLS  S PAP + VD FPL  H  +D  ++   D +QCYICLAEYE+GD +RVLPCHHEY
Sbjct  439  SLSMVSAPAPASVVDGFPLXSHTKVDKSKSG-DDVEQCYICLAEYEEGDNIRVLPCHHEY  497

Query  219  HMICIDKWLKE  187
            HM C+DKWLKE
Sbjct  498  HMSCVDKWLKE  508



>ref|XP_007155111.1| hypothetical protein PHAVU_003G174300g [Phaseolus vulgaris]
 gb|ESW27105.1| hypothetical protein PHAVU_003G174300g [Phaseolus vulgaris]
Length=539

 Score =   195 bits (495),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 113/191 (59%), Positives = 133/191 (70%), Gaps = 3/191 (2%)
 Frame = -1

Query  753  TGNADDLGSHDRWLIDLNGDLHYDGVGYGSSYLGETGHHRNERRLPSRSEISERVHRGHR  574
            T  ADD GS DRWL+D  GDL  DGVG  S Y+G   H  NERR            RG  
Sbjct  322  TAVADDPGSQDRWLVDFGGDLSNDGVGGASGYMGSRIHRLNERRRRHSRSEIWDRLRGGF  381

Query  573  NRVSQPSFCPSGLHPDGtcscesfftseefsTLASISRIIMLAEALFEVIDEIHRQ--SF  400
            + + + + CP GLH DG CSCES   ++E ST ASISRI+MLAEALFEV+DEIHRQ  S 
Sbjct  382  DEIGRWNSCPLGLHADGMCSCESSPMADESSTRASISRIVMLAEALFEVLDEIHRQPGSL  441

Query  399  SLSTFSLPAPEATVDAFPLKYHKTLDPVENALGDTQQCYICLAEYEDGDKLRVLPCHHEY  220
            SLS  SLPAPE+ VD+FPLK HK ++ V +   D +QCYICLAEYE+GD++RVLPC HEY
Sbjct  442  SLSMVSLPAPESIVDSFPLKSHKKVE-VADGGNDVEQCYICLAEYEEGDQIRVLPCLHEY  500

Query  219  HMICIDKWLKE  187
            HM C+DKWLKE
Sbjct  501  HMSCVDKWLKE  511



>ref|XP_004287233.1| PREDICTED: uncharacterized protein LOC101295849 [Fragaria vesca 
subsp. vesca]
Length=537

 Score =   193 bits (491),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 111/196 (57%), Positives = 137/196 (70%), Gaps = 13/196 (7%)
 Frame = -1

Query  753  TGNADDLGSHDRWLIDLNGDLHYDGVGYGSSYLGETGHHRNERRLPSRSEISERVH----  586
            T + +DLG HDRWL+ L+GD   +  G  S +      + +ERR  SRSE+ ER+     
Sbjct  320  TDDTEDLGFHDRWLLGLSGDFLDERSGADSGHQVNRTPNLSERRRHSRSEVWERLRGGLD  379

Query  585  -RGHRNRVSQPSFCPSGLHPDGtcscesfftseefsTLASISRIIMLAEALFEVIDEIHR  409
              GHRN     + CP+G+HP G CSC SF  +EE S  ASISRI+MLAEALFEV+DEIHR
Sbjct  380  GNGHRN-----TTCPTGIHPRGMCSCGSFLMTEESSARASISRIVMLAEALFEVLDEIHR  434

Query  408  Q--SFSLSTFSLPAPEATVDAFPLKYHKTLDPVENALGDTQQCYICLAEYEDGDKLRVLP  235
            Q  S SLS  S+PAP + VD+FPLK H  LD +++   D +QCYICLAEYE+GDK+RVLP
Sbjct  435  QPVSLSLSMVSVPAPASVVDSFPLKSHSKLDKLKHG-DDVEQCYICLAEYEEGDKIRVLP  493

Query  234  CHHEYHMICIDKWLKE  187
            CHHEYHM C+DKWLKE
Sbjct  494  CHHEYHMSCVDKWLKE  509



>emb|CDP10509.1| unnamed protein product [Coffea canephora]
Length=545

 Score =   192 bits (488),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 104/190 (55%), Positives = 130/190 (68%), Gaps = 4/190 (2%)
 Frame = -1

Query  747  NADDLGSHDRWLIDLNGDLHYDGVGYGSSYLGETGHHRNERRLPSRSEISERVHR-GHRN  571
            ++D L SHDRWL+D NGD   DG+G  S     +  + NERR  S SEI ER H  G   
Sbjct  326  DSDGLESHDRWLLDFNGDFFEDGIGGDSRPHPSSDQNTNERRWHSSSEIWERFHDVGRSG  385

Query  570  RVSQPSFCPSGLHPDGtcscesfftseefsTLASISRIIMLAEALFEVIDEIHRQ--SFS  397
               + + CP+G+HPDG CSC     +EE    ASISRI+MLAEALFEV+DEIHRQ  S  
Sbjct  386  TDRRAATCPAGIHPDGACSCGLMLRAEESGARASISRIVMLAEALFEVLDEIHRQPMSLP  445

Query  396  LSTFSLPAPEATVDAFPLKYHKTLDPVENALGDTQQCYICLAEYEDGDKLRVLPCHHEYH  217
            LS  S+PAPE  VD+ P+K H+  + +E+   D  QCYICLAEYE+GD++R+LPCHHEYH
Sbjct  446  LSVVSVPAPETVVDSLPVKIHRKPERLESG-DDVIQCYICLAEYEEGDRIRILPCHHEYH  504

Query  216  MICIDKWLKE  187
            + C+DKWLKE
Sbjct  505  VACVDKWLKE  514



>emb|CBI25594.3| unnamed protein product [Vitis vinifera]
Length=180

 Score =   181 bits (460),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 112/178 (63%), Positives = 133/178 (75%), Gaps = 3/178 (2%)
 Frame = -1

Query  633  NERRLPSRSEISERVHRGHRNRVSQPSFCPSGLHPDGtcscesfftseefsTLASISRII  454
            NERR  SRSEI ER+  G      + + CP+GLHPDG CSC+SF  +EE ST ASISRI+
Sbjct  2    NERRWHSRSEIWERLRGGLDESSRRTTTCPTGLHPDGMCSCDSFLMAEESSTRASISRIV  61

Query  453  MLAEALFEVIDEIHRQ--SFSLSTFSLPAPEATVDAFPLKYHKTLDPVENALGDTQQCYI  280
            MLAEALFEV+DEIHRQ  S +LS  SLPAPE+ VD+FPLK HK  D  ++   D  QCYI
Sbjct  62   MLAEALFEVLDEIHRQPVSLALSMVSLPAPESVVDSFPLKNHKKADTAQSG-EDVAQCYI  120

Query  279  CLAEYEDGDKLRVLPCHHEYHMICIDKWLKEvnrvcpvcrcnvcNGPGQSSISTTETP  106
            CLAEYE+GDK+RVLPCHHEYHM C+DKWLKE++ VCP+CR +V  G    S+S  ETP
Sbjct  121  CLAEYEEGDKIRVLPCHHEYHMSCVDKWLKEIHGVCPLCRGDVREGLTGGSVSNGETP  178



>ref|XP_006386552.1| hypothetical protein POPTR_0002s14140g [Populus trichocarpa]
 gb|ERP64349.1| hypothetical protein POPTR_0002s14140g [Populus trichocarpa]
Length=522

 Score =   190 bits (483),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 113/192 (59%), Positives = 137/192 (71%), Gaps = 7/192 (4%)
 Frame = -1

Query  753  TGNADDLGSHDRWLIDLNGDLHYDGVGYGSSYLGETGHHRNERRLPSRSEISERVHRGHR  574
            + +ADDLGSHDRWL+D  GDLH DGVG  S Y G   HHR+ERR  SR E    V    R
Sbjct  306  SSHADDLGSHDRWLLDFGGDLHLDGVGRESRYPGTRSHHRSERRWQSRRETFHDV----R  361

Query  573  NRVS-QPSFCPSGLHPDGtcscesfftseefsTLASISRIIMLAEALFEVIDEIH--RQS  403
            + +  + S CP+GLHP+GTCSCES   + E S+ ASIS+II+LA+ALFEV++EIH  R S
Sbjct  362  DELGWETSLCPAGLHPNGTCSCESSSVAVESSSHASISQIILLADALFEVLEEIHHHRLS  421

Query  402  FSLSTFSLPAPEATVDAFPLKYHKTLDPVENALGDTQQCYICLAEYEDGDKLRVLPCHHE  223
             S S  SLPAPEA V++FPLK +K     EN     QQC+ICL +YE+GDK+RVLPC HE
Sbjct  422  LSPSMLSLPAPEAVVNSFPLKNYKKFQGTENVAQHEQQCHICLVDYEEGDKIRVLPCSHE  481

Query  222  YHMICIDKWLKE  187
            YHM C+DKWLKE
Sbjct  482  YHMSCVDKWLKE  493



>gb|KJB64603.1| hypothetical protein B456_010G056600 [Gossypium raimondii]
Length=495

 Score =   188 bits (478),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 114/218 (52%), Positives = 147/218 (67%), Gaps = 5/218 (2%)
 Frame = -1

Query  753  TGNADDLGSHDRWLIDLNGDLHYDGVGYGSSYLGETGHHRNERRLPSRSEISERVHRGHR  574
            T + +D G  +RWL+D +GD  YDG    S YL    H  NERR  SR E   R+H GH 
Sbjct  279  TDDNNDPGFDNRWLLDFDGDFFYDGAAGDSGYLSSRIHRLNERRRHSRLENWLRLHGGHD  338

Query  573  NRVSQPSFCPSGLHPDGtcscesfftseefsTLASISRIIMLAEALFEVIDEIHRQ--SF  400
                + +FCPSG+HPDGTCSC+S   ++E S   SISRI+MLAEALFEV+   HRQ  S 
Sbjct  339  ENHRRTTFCPSGIHPDGTCSCDSSLMTDEPSARVSISRIVMLAEALFEVL---HRQPVSL  395

Query  399  SLSTFSLPAPEATVDAFPLKYHKTLDPVENALGDTQQCYICLAEYEDGDKLRVLPCHHEY  220
            SLS  S PAPE+ VD+FPL+ H     V       +QC+ICL EYE+GD++R+LPC HE+
Sbjct  396  SLSMVSPPAPESVVDSFPLRSHNRKANVAEDGDAVEQCHICLGEYEEGDQIRILPCQHEF  455

Query  219  HMICIDKWLKEvnrvcpvcrcnvcNGPGQSSISTTETP  106
            HM C+DKWLKE++ VCP+CR +V +G G+SS+S +E P
Sbjct  456  HMSCVDKWLKEIHGVCPLCRGDVRHGGGESSVSNSEIP  493



>gb|KEH32158.1| zinc finger, C3HC4 type (RING finger) protein [Medicago truncatula]
Length=502

 Score =   188 bits (478),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 118/191 (62%), Positives = 136/191 (71%), Gaps = 4/191 (2%)
 Frame = -1

Query  753  TGNADDLGSHDRWLIDLNGDLHYDGVGYGSSYLGETGHHRNERRLPSRSEISERVHRGHR  574
            +G  DDLGSHDRW +D + DL   GVG  S + G   H  NER   SRSEI ER+  G  
Sbjct  286  SGGTDDLGSHDRWHVDFDEDLSNYGVGGASGHRGSRIHRLNERVRNSRSEIWERLRGGLD  345

Query  573  NRVSQPSFCPSGLHPDGtcscesfftseefsTLASISRIIMLAEALFEVIDEIHRQ--SF  400
                  + CP GLH DG CSCESF  +EE ST +SISRI+MLAEALFEV+DEIHRQ  S 
Sbjct  346  EIGRLNTSCPLGLHADGMCSCESFPMAEESSTRSSISRIVMLAEALFEVLDEIHRQPGSQ  405

Query  399  SLSTFSLPAPEATVDAFPLKYHKTLDPVENALGDTQQCYICLAEYEDGDKLRVLPCHHEY  220
            SLST SLPAPE+ VD+FPLK HK +D  +    D +QCYICLAEYEDGD++RVLPC HEY
Sbjct  406  SLST-SLPAPESVVDSFPLKSHKKVDAADGG-NDAEQCYICLAEYEDGDQIRVLPCKHEY  463

Query  219  HMICIDKWLKE  187
            HM C+DKWLKE
Sbjct  464  HMSCVDKWLKE  474



>ref|XP_003609509.1| RING finger protein [Medicago truncatula]
 gb|AES91706.1| zinc finger, C3HC4 type (RING finger) protein [Medicago truncatula]
Length=545

 Score =   189 bits (479),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 118/191 (62%), Positives = 136/191 (71%), Gaps = 4/191 (2%)
 Frame = -1

Query  753  TGNADDLGSHDRWLIDLNGDLHYDGVGYGSSYLGETGHHRNERRLPSRSEISERVHRGHR  574
            +G  DDLGSHDRW +D + DL   GVG  S + G   H  NER   SRSEI ER+  G  
Sbjct  329  SGGTDDLGSHDRWHVDFDEDLSNYGVGGASGHRGSRIHRLNERVRNSRSEIWERLRGGLD  388

Query  573  NRVSQPSFCPSGLHPDGtcscesfftseefsTLASISRIIMLAEALFEVIDEIHRQ--SF  400
                  + CP GLH DG CSCESF  +EE ST +SISRI+MLAEALFEV+DEIHRQ  S 
Sbjct  389  EIGRLNTSCPLGLHADGMCSCESFPMAEESSTRSSISRIVMLAEALFEVLDEIHRQPGSQ  448

Query  399  SLSTFSLPAPEATVDAFPLKYHKTLDPVENALGDTQQCYICLAEYEDGDKLRVLPCHHEY  220
            SLST SLPAPE+ VD+FPLK HK +D  +    D +QCYICLAEYEDGD++RVLPC HEY
Sbjct  449  SLST-SLPAPESVVDSFPLKSHKKVDAADGG-NDAEQCYICLAEYEDGDQIRVLPCKHEY  506

Query  219  HMICIDKWLKE  187
            HM C+DKWLKE
Sbjct  507  HMSCVDKWLKE  517



>gb|KJB64604.1| hypothetical protein B456_010G056600 [Gossypium raimondii]
Length=538

 Score =   188 bits (478),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 114/218 (52%), Positives = 147/218 (67%), Gaps = 5/218 (2%)
 Frame = -1

Query  753  TGNADDLGSHDRWLIDLNGDLHYDGVGYGSSYLGETGHHRNERRLPSRSEISERVHRGHR  574
            T + +D G  +RWL+D +GD  YDG    S YL    H  NERR  SR E   R+H GH 
Sbjct  322  TDDNNDPGFDNRWLLDFDGDFFYDGAAGDSGYLSSRIHRLNERRRHSRLENWLRLHGGHD  381

Query  573  NRVSQPSFCPSGLHPDGtcscesfftseefsTLASISRIIMLAEALFEVIDEIHRQ--SF  400
                + +FCPSG+HPDGTCSC+S   ++E S   SISRI+MLAEALFEV+   HRQ  S 
Sbjct  382  ENHRRTTFCPSGIHPDGTCSCDSSLMTDEPSARVSISRIVMLAEALFEVL---HRQPVSL  438

Query  399  SLSTFSLPAPEATVDAFPLKYHKTLDPVENALGDTQQCYICLAEYEDGDKLRVLPCHHEY  220
            SLS  S PAPE+ VD+FPL+ H     V       +QC+ICL EYE+GD++R+LPC HE+
Sbjct  439  SLSMVSPPAPESVVDSFPLRSHNRKANVAEDGDAVEQCHICLGEYEEGDQIRILPCQHEF  498

Query  219  HMICIDKWLKEvnrvcpvcrcnvcNGPGQSSISTTETP  106
            HM C+DKWLKE++ VCP+CR +V +G G+SS+S +E P
Sbjct  499  HMSCVDKWLKEIHGVCPLCRGDVRHGGGESSVSNSEIP  536



>ref|XP_002526496.1| ring finger protein, putative [Ricinus communis]
 gb|EEF35887.1| ring finger protein, putative [Ricinus communis]
Length=484

 Score =   186 bits (471),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 107/198 (54%), Positives = 135/198 (68%), Gaps = 9/198 (5%)
 Frame = -1

Query  753  TGNADDLGSHDRWLIDLNGDLHYDGVGYGSSYLGETGHHRNERRLPSRSEISERVHRGHR  574
            T +ADDL SH RWL+D +GDLHYDG  + S Y       R+ RR  SR E+SER H  + 
Sbjct  258  TSHADDLASHGRWLLDNSGDLHYDGATHESRYSSIRSTRRSGRRWQSRYEMSERFHDVND  317

Query  573  NRVSQPSFCPSGLHPDGtcscesfftseefsTLASISRIIMLAEALFEVIDEIHRQSFSL  394
             +  Q S C  GLHP GTCSCE  +T+EE ST  +IS+I+ML+++LFEV++EIHR   SL
Sbjct  318  EQGWQSSLCTIGLHPRGTCSCEPSYTAEESSTHENISQIVMLSDSLFEVLEEIHRHRMSL  377

Query  393  S---------TFSLPAPEATVDAFPLKYHKTLDPVENALGDTQQCYICLAEYEDGDKLRV  241
            S         T  LPAPEA V++FPLK HK     E A+ D QQC+ICL +YE+GD++RV
Sbjct  378  SPSTVIXFTSTVILPAPEAVVNSFPLKNHKKSCGTEIAVCDAQQCHICLVDYEEGDEIRV  437

Query  240  LPCHHEYHMICIDKWLKE  187
            LPC HEYH+ C+DKWLKE
Sbjct  438  LPCSHEYHVSCVDKWLKE  455



>ref|XP_004146706.1| PREDICTED: uncharacterized protein LOC101215855 [Cucumis sativus]
 ref|XP_004162456.1| PREDICTED: uncharacterized protein LOC101226984 [Cucumis sativus]
 gb|KGN65208.1| hypothetical protein Csa_1G265080 [Cucumis sativus]
Length=541

 Score =   186 bits (473),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 106/191 (55%), Positives = 129/191 (68%), Gaps = 5/191 (3%)
 Frame = -1

Query  753  TGNADDLGSHDRWLIDLNGDLHYDGVGYGSSYLGETGHHRNERRLPSRSEISERVHRGHR  574
            + N  + G  DRWL+D++GD   D V   S +     H  NE++  SRS+I ER+     
Sbjct  323  SNNFSNTGDTDRWLLDISGDFIDDEVSGDSRHFSSRIHILNEQQRNSRSQIWERLRSSLT  382

Query  573  NRVSQPSFCPSGLHPDGtcscesfftseefsTLASISRIIMLAEALFEVIDEIHRQ--SF  400
                Q   CPSG+HP+G CSC+SF   E  ST ASISRIIMLAEALFEV+DEIH Q  S 
Sbjct  383  ETSQQNVSCPSGIHPNGPCSCDSFSRIEHSSTRASISRIIMLAEALFEVLDEIHGQPVSL  442

Query  399  SLSTFSLPAPEATVDAFPLKYHKTLDPVENALGDTQQCYICLAEYEDGDKLRVLPCHHEY  220
            +LS  SLPAPEA VD+FPLK H+      N   + +QCYICLAEYE+GDK+RVLPC HEY
Sbjct  443  ALSMVSLPAPEAVVDSFPLKNHEK---TTNGGDEIEQCYICLAEYEEGDKIRVLPCRHEY  499

Query  219  HMICIDKWLKE  187
            HM+C+DKWLKE
Sbjct  500  HMLCVDKWLKE  510



>ref|XP_008443909.1| PREDICTED: uncharacterized protein LOC103487388 isoform X2 [Cucumis 
melo]
Length=539

 Score =   185 bits (470),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 105/191 (55%), Positives = 129/191 (68%), Gaps = 5/191 (3%)
 Frame = -1

Query  753  TGNADDLGSHDRWLIDLNGDLHYDGVGYGSSYLGETGHHRNERRLPSRSEISERVHRGHR  574
            + N  + G  DRWL+D++GD   D V   S +     H  NE++  SRS+I ER+     
Sbjct  322  SNNFSNTGDTDRWLLDISGDFIDDEVSGDSRHFSSRIHILNEQQRNSRSQIWERLRSSLT  381

Query  573  NRVSQPSFCPSGLHPDGtcscesfftseefsTLASISRIIMLAEALFEVIDEIHRQ--SF  400
                Q   CPSG+HP+G CSC+SF   E  ST ASISRIIMLAEALFEV+DEIH Q  S 
Sbjct  382  ETSQQNVSCPSGIHPNGPCSCDSFSRIEHSSTRASISRIIMLAEALFEVLDEIHGQPVSL  441

Query  399  SLSTFSLPAPEATVDAFPLKYHKTLDPVENALGDTQQCYICLAEYEDGDKLRVLPCHHEY  220
            +LS  SLPAPE+ VD+FPLK H+      N   + +QCYICLAEYE+GDK+RVLPC HEY
Sbjct  442  ALSMVSLPAPESVVDSFPLKNHEK---TTNGGDEIEQCYICLAEYEEGDKIRVLPCRHEY  498

Query  219  HMICIDKWLKE  187
            HM+C+DKWLKE
Sbjct  499  HMLCVDKWLKE  509



>ref|XP_009341793.1| PREDICTED: uncharacterized protein LOC103933831 isoform X2 [Pyrus 
x bretschneideri]
 ref|XP_009341795.1| PREDICTED: uncharacterized protein LOC103933831 isoform X2 [Pyrus 
x bretschneideri]
Length=355

 Score =   181 bits (459),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 108/191 (57%), Positives = 135/191 (71%), Gaps = 3/191 (2%)
 Frame = -1

Query  753  TGNADDLGSHDRWLIDLNGDLHYDGVGYGSSYLGETGHHRNERRLPSRSEISERVHRGHR  574
            T + +D+G HDRWL+ L+GD   D +G  S +      + +ERR  SRSE+ ER+  G  
Sbjct  137  TDDTEDMGFHDRWLLGLSGDFFDDEIGVDSGHRANRIPNSSERRRHSRSEVWERLRVGLD  196

Query  573  NRVSQPSFCPSGLHPDGtcscesfftseefsTLASISRIIMLAEALFEVIDEIHRQ--SF  400
            +   + + CP+G+HP G CSC SF  +EE ST ASISRI+MLAEALFEV+DEIHRQ  S 
Sbjct  197  DNGQRNTSCPTGIHPRGMCSCGSFLMAEESSTRASISRIVMLAEALFEVLDEIHRQPVSL  256

Query  399  SLSTFSLPAPEATVDAFPLKYHKTLDPVENALGDTQQCYICLAEYEDGDKLRVLPCHHEY  220
            SLS  S PAP + VD FPLK H  +D  ++   D +QCYICLAEYE+GDK+RVLPCHHEY
Sbjct  257  SLSMVSAPAPASLVDGFPLKSHTKVDKSKSG-DDVEQCYICLAEYEEGDKIRVLPCHHEY  315

Query  219  HMICIDKWLKE  187
            HM C+DKWLKE
Sbjct  316  HMSCVDKWLKE  326



>ref|XP_009401073.1| PREDICTED: uncharacterized protein LOC103985168 [Musa acuminata 
subsp. malaccensis]
Length=502

 Score =   184 bits (467),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 103/185 (56%), Positives = 123/185 (66%), Gaps = 4/185 (2%)
 Frame = -1

Query  735  LGSHDRWLIDLNGDLHYDGVGYGSSYLGETGHHRNERRLPSRSEISERVHRGHRNRVSQP  556
            LG  DRWL+D++G    DGV   S YL +  H  N     +RSEI ER+H G  N   Q 
Sbjct  296  LGYQDRWLLDIDGHAFRDGVEDDSLYLRQRHHGLNGVSWHTRSEIRERLHSGSNNNDGQA  355

Query  555  SFCPSGLHPDGtcscesfftseefsTLASISRIIMLAEALFEVIDEIHRQ--SFSLSTFS  382
            S CPSGLH DGTCSC    T    +  ASI+RI +LAEALFEV+DEIH Q  S SLS  S
Sbjct  356  SSCPSGLHQDGTCSCTLLMTEVSSTR-ASIARIFVLAEALFEVLDEIHHQPGSLSLSVVS  414

Query  381  LPAPEATVDAFPLKYHKTLDPVENALGDTQQCYICLAEYEDGDKLRVLPCHHEYHMICID  202
            +PA E+ V++ P K HK LD   +   D +QCYICLA+YEDGD +R+LPCHHEYHM C+D
Sbjct  415  VPALESVVNSLPSKIHKKLDTALSK-NDVEQCYICLADYEDGDAVRILPCHHEYHMACVD  473

Query  201  KWLKE  187
            KWLKE
Sbjct  474  KWLKE  478



>ref|XP_006375202.1| hypothetical protein POPTR_0014s05240g [Populus trichocarpa]
 gb|ERP52999.1| hypothetical protein POPTR_0014s05240g [Populus trichocarpa]
Length=479

 Score =   182 bits (462),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 116/217 (53%), Positives = 151/217 (70%), Gaps = 3/217 (1%)
 Frame = -1

Query  753  TGNADDLGSHDRWLIDLNGDLHYDGVGYGSSYLGETGHHRNERRLPSRSEISERVHRGHR  574
            T +ADDLGSHDRWL+D +GDLH+DGVG GS Y       R+ER   SR E  ER H  H 
Sbjct  261  TSHADDLGSHDRWLLDFSGDLHFDGVGRGSRYPNTRNRRRSERPWQSRYE-RERFHDVHD  319

Query  573  NRVSQPSFCPSGLHPDGtcscesfftseefsTLASISRIIMLAEALFEVIDEIHR--QSF  400
             +  + S CP+GLH +GTC CE    +EE ++ A+IS+II+L +ALFEV++EIHR   S 
Sbjct  320  EQGWEASLCPAGLHRNGTCLCEPSSVAEESNSHANISQIILLTDALFEVLEEIHRHHLSL  379

Query  399  SLSTFSLPAPEATVDAFPLKYHKTLDPVENALGDTQQCYICLAEYEDGDKLRVLPCHHEY  220
            S S  SLPAPEA V++ PLK ++     EN     QQC+ICL +YE+GDK+RVLPC HE+
Sbjct  380  SPSMLSLPAPEAVVNSLPLKNYQKSPGTENVAQHEQQCHICLVDYEEGDKIRVLPCSHEF  439

Query  219  HMICIDKWLKEvnrvcpvcrcnvcNGPGQSSISTTET  109
            HM C+DKWLK+++ VCP+CR +VC G  +SS S  E+
Sbjct  440  HMACVDKWLKDIHGVCPLCRDDVCKGTAESSASNPES  476



>ref|XP_009341792.1| PREDICTED: E3 ubiquitin-protein ligase RNF6-like isoform X1 [Pyrus 
x bretschneideri]
Length=496

 Score =   182 bits (462),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 107/199 (54%), Positives = 135/199 (68%), Gaps = 19/199 (10%)
 Frame = -1

Query  753  TGNADDLGSHDRWLIDLNGDLHYDGVGYGSSYLGETGHHRNERRLPSRSE--------IS  598
            T + +D+G HDRWL+ L+GD   D +G       ++GH  N  R+P+ SE        + 
Sbjct  278  TDDTEDMGFHDRWLLGLSGDFFDDEIGV------DSGHRAN--RIPNSSERRRHSRSEVW  329

Query  597  ERVHRGHRNRVSQPSFCPSGLHPDGtcscesfftseefsTLASISRIIMLAEALFEVIDE  418
            ER+  G  +   + + CP+G+HP G CSC SF  +EE ST ASISRI+MLAEALFEV+DE
Sbjct  330  ERLRVGLDDNGQRNTSCPTGIHPRGMCSCGSFLMAEESSTRASISRIVMLAEALFEVLDE  389

Query  417  IHRQ--SFSLSTFSLPAPEATVDAFPLKYHKTLDPVENALGDTQQCYICLAEYEDGDKLR  244
            IHRQ  S SLS  S PAP + VD FPLK H  +D  ++   D +QCYICLAEYE+GDK+R
Sbjct  390  IHRQPVSLSLSMVSAPAPASLVDGFPLKSHTKVDKSKSG-DDVEQCYICLAEYEEGDKIR  448

Query  243  VLPCHHEYHMICIDKWLKE  187
            VLPCHHEYHM C+DKWLKE
Sbjct  449  VLPCHHEYHMSCVDKWLKE  467



>ref|XP_008443908.1| PREDICTED: E3 ubiquitin-protein ligase RNF12-A-like isoform X1 
[Cucumis melo]
Length=541

 Score =   181 bits (459),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 104/193 (54%), Positives = 129/193 (67%), Gaps = 7/193 (4%)
 Frame = -1

Query  753  TGNADDLGSHDRWLIDLNGDLHYDGVGYGSSYLGETGHHRNERRLPSRSEIS--ERVHRG  580
            + N  + G  DRWL+D++GD   D V   S +     H  NE++  SRS++   ER+   
Sbjct  322  SNNFSNTGDTDRWLLDISGDFIDDEVSGDSRHFSSRIHILNEQQRNSRSQVQIWERLRSS  381

Query  579  HRNRVSQPSFCPSGLHPDGtcscesfftseefsTLASISRIIMLAEALFEVIDEIHRQ--  406
                  Q   CPSG+HP+G CSC+SF   E  ST ASISRIIMLAEALFEV+DEIH Q  
Sbjct  382  LTETSQQNVSCPSGIHPNGPCSCDSFSRIEHSSTRASISRIIMLAEALFEVLDEIHGQPV  441

Query  405  SFSLSTFSLPAPEATVDAFPLKYHKTLDPVENALGDTQQCYICLAEYEDGDKLRVLPCHH  226
            S +LS  SLPAPE+ VD+FPLK H+      N   + +QCYICLAEYE+GDK+RVLPC H
Sbjct  442  SLALSMVSLPAPESVVDSFPLKNHEK---TTNGGDEIEQCYICLAEYEEGDKIRVLPCRH  498

Query  225  EYHMICIDKWLKE  187
            EYHM+C+DKWLKE
Sbjct  499  EYHMLCVDKWLKE  511



>ref|XP_008384717.1| PREDICTED: uncharacterized protein DDB_G0271670-like [Malus domestica]
Length=537

 Score =   181 bits (458),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 107/199 (54%), Positives = 135/199 (68%), Gaps = 19/199 (10%)
 Frame = -1

Query  753  TGNADDLGSHDRWLIDLNGDLHYDGVGYGSSYLGETGHHRNERRLPSRSE--------IS  598
            T + +D+G HDRWL+ L+GD   D +G       ++GH  N  R+P+ SE        + 
Sbjct  319  TDDTEDMGFHDRWLLGLSGDFFDDEIGV------DSGHRAN--RIPNSSERRRHSRSEVW  370

Query  597  ERVHRGHRNRVSQPSFCPSGLHPDGtcscesfftseefsTLASISRIIMLAEALFEVIDE  418
            ER+  G  +   + + CP+G+HP G CSC SF  +EE ST ASISRI+MLAEALFEV+DE
Sbjct  371  ERLRVGLDDNGQRNTSCPTGIHPRGMCSCGSFLMAEESSTRASISRIVMLAEALFEVLDE  430

Query  417  IHRQ--SFSLSTFSLPAPEATVDAFPLKYHKTLDPVENALGDTQQCYICLAEYEDGDKLR  244
            IHRQ  S SLS  S PAP + VD FPLK H  +D  ++   D +QCYICLAEYE+GDK+R
Sbjct  431  IHRQPVSLSLSMVSAPAPASLVDGFPLKSHTKVDKPKSG-DDVEQCYICLAEYEEGDKIR  489

Query  243  VLPCHHEYHMICIDKWLKE  187
            VLPCHHEYHM C+DKWLKE
Sbjct  490  VLPCHHEYHMSCVDKWLKE  508



>gb|ADE76258.1| unknown [Picea sitchensis]
Length=541

 Score =   181 bits (458),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 111/202 (55%), Positives = 138/202 (68%), Gaps = 17/202 (8%)
 Frame = -1

Query  753  TGNADDLGS-HDRWLIDLNGDLHYDGV---GYGSSYLGETGHHRNERRLPSRSEI--SER  592
            T + DDLGS +DRWL+D +G L+ D +   G  +S   ++     ERR   RS++   +R
Sbjct  319  TDDIDDLGSSNDRWLLDFSGVLYDDALEDDGLNNSRSSDS----EERRWRFRSQVWALQR  374

Query  591  VHRGHRNRVSQPS-FCPSGLHPDGtcscesfftseefsTLASISRIIMLAEALFEVIDEI  415
            + RG     S  S FC SG H DG CSCE++  +EE ST ASISRI+MLAEALFEV+DEI
Sbjct  375  LRRGSDGASSGHSRFCASGTHADGHCSCEAYVMTEETSTHASISRIVMLAEALFEVLDEI  434

Query  414  HRQSF------SLSTFSLPAPEATVDAFPLKYHKTLDPVENALGDTQQCYICLAEYEDGD  253
            HRQS       SLS  SLPAPE+ VD+FP++ HK  +  EN   +  QCYICLAEYE+GD
Sbjct  435  HRQSVALSQSTSLSLVSLPAPESVVDSFPIRNHKNPEKNENVNDEAAQCYICLAEYEEGD  494

Query  252  KLRVLPCHHEYHMICIDKWLKE  187
            K+RVLPCHHEYHM C+DKWLKE
Sbjct  495  KIRVLPCHHEYHMACVDKWLKE  516



>gb|KJB64605.1| hypothetical protein B456_010G056600 [Gossypium raimondii]
Length=528

 Score =   180 bits (456),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 101/191 (53%), Positives = 126/191 (66%), Gaps = 5/191 (3%)
 Frame = -1

Query  753  TGNADDLGSHDRWLIDLNGDLHYDGVGYGSSYLGETGHHRNERRLPSRSEISERVHRGHR  574
            T + +D G  +RWL+D +GD  YDG    S YL    H  NERR  SR E   R+H GH 
Sbjct  279  TDDNNDPGFDNRWLLDFDGDFFYDGAAGDSGYLSSRIHRLNERRRHSRLENWLRLHGGHD  338

Query  573  NRVSQPSFCPSGLHPDGtcscesfftseefsTLASISRIIMLAEALFEVIDEIHRQ--SF  400
                + +FCPSG+HPDGTCSC+S   ++E S   SISRI+MLAEALFEV+   HRQ  S 
Sbjct  339  ENHRRTTFCPSGIHPDGTCSCDSSLMTDEPSARVSISRIVMLAEALFEVL---HRQPVSL  395

Query  399  SLSTFSLPAPEATVDAFPLKYHKTLDPVENALGDTQQCYICLAEYEDGDKLRVLPCHHEY  220
            SLS  S PAPE+ VD+FPL+ H     V       +QC+ICL EYE+GD++R+LPC HE+
Sbjct  396  SLSMVSPPAPESVVDSFPLRSHNRKANVAEDGDAVEQCHICLGEYEEGDQIRILPCQHEF  455

Query  219  HMICIDKWLKE  187
            HM C+DKWLKE
Sbjct  456  HMSCVDKWLKE  466



>ref|XP_009783355.1| PREDICTED: E3 ubiquitin-protein ligase RLIM-like [Nicotiana sylvestris]
Length=523

 Score =   177 bits (450),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 99/188 (53%), Positives = 129/188 (69%), Gaps = 3/188 (2%)
 Frame = -1

Query  744  ADDLGSHDRWLIDLNGDLHYDGVGYGSSYLGETGHHRNERRLPSRSEISERVHRGHRNRV  565
            +D++ SHDR L+D + +  ++G G      G      NERR  SRSE+ ER+  G     
Sbjct  308  SDNVASHDRLLLDFSDNSLHEGAGGNFPSNGSRTSGSNERRRHSRSEMWERLPGGLIAGD  367

Query  564  SQPSFCPSGLHPDGtcscesfftseefsTLASISRIIMLAEALFEVIDEIHRQ--SFSLS  391
             + + CP+G+H DG CSCE+   S E  + ASISRI+MLAEALFEV+DEIHRQ  S SLS
Sbjct  368  HRSATCPTGIHADGPCSCETILMSRETGSRASISRIVMLAEALFEVLDEIHRQPMSVSLS  427

Query  390  TFSLPAPEATVDAFPLKYHKTLDPVENALGDTQQCYICLAEYEDGDKLRVLPCHHEYHMI  211
              SLPAPE+ VD+FP+K +   + V+    +  QC+ICLAEYEDGDK+RVLPCHHE+H+ 
Sbjct  428  VLSLPAPESVVDSFPVKSYSKSEEVDTG-NNVPQCHICLAEYEDGDKIRVLPCHHEFHVS  486

Query  210  CIDKWLKE  187
            C+DKWLKE
Sbjct  487  CVDKWLKE  494



>ref|XP_010101179.1| E3 ubiquitin-protein ligase [Morus notabilis]
 gb|EXB87675.1| E3 ubiquitin-protein ligase [Morus notabilis]
Length=551

 Score =   175 bits (443),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 112/187 (60%), Positives = 134/187 (72%), Gaps = 3/187 (2%)
 Frame = -1

Query  741  DDLGSHDRWLIDLNGDLHYDGVGYGSSYLGETGHHRNERRLPSRSEISERVHRGHRNRVS  562
            ++LGSHDRWL+  +GD   +G G  S YLG    + +ERR  SRSE+ ER+  G      
Sbjct  306  EELGSHDRWLLGFSGDFFDEGNGIDSRYLGSRIPYSSERRRHSRSEVWERLRGGLDEYGR  365

Query  561  QPSFCPSGLHPDGtcscesfftseefsTLASISRIIMLAEALFEVIDEIHRQ--SFSLST  388
            +  FCPSG HPDGTCSCES   +EE +T ASISRI+MLAEALFEV+DEIHRQ  S SLS 
Sbjct  366  RSMFCPSGHHPDGTCSCESLLMNEESTTRASISRIVMLAEALFEVLDEIHRQPVSLSLSM  425

Query  387  FSLPAPEATVDAFPLKYHKTLDPVENALGDTQQCYICLAEYEDGDKLRVLPCHHEYHMIC  208
             S PAP + VD+FPLK H  LD  + A  +  +CYICLAEYE+GDK+RVLPC HEYHM C
Sbjct  426  VSSPAPASVVDSFPLKSHSRLDKAD-ARDEVSECYICLAEYEEGDKIRVLPCQHEYHMSC  484

Query  207  IDKWLKE  187
            +DKWLKE
Sbjct  485  VDKWLKE  491



>ref|XP_011078564.1| PREDICTED: uncharacterized protein LOC105162267 [Sesamum indicum]
Length=562

 Score =   174 bits (440),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 108/223 (48%), Positives = 136/223 (61%), Gaps = 37/223 (17%)
 Frame = -1

Query  750  GNADDLGSHDRWLIDLNGDLHYDGVGY----------GSSYLGETGHHR-----------  634
            G+++ L SHDRWL+D  G  + D VG           GS  L   G +            
Sbjct  319  GDSESLRSHDRWLLDFTGSFYNDEVGGDLRSHGSRTPGSHELQTPGRNEQQTPSSNGERT  378

Query  633  -----------NERRLPSRSEISERVHRGHRNRVSQP-SFCPSGLHPDGtcscesfftse  490
                       NE+R  SR EI ER+ RG+ +    P S CP G+H DG+CSC+S  + E
Sbjct  379  PGSNEQDTPGSNEQRWNSRFEIWERL-RGNLDSTDHPTSVCPRGIHADGSCSCQSSSSVE  437

Query  489  efsTLASISRIIMLAEALFEVIDEIHRQ--SFSLSTFSLPAPEATVDAFPLKYHKTLDPV  316
            E  T A ISRI+MLAEALFE++D+IH+Q  S SLS  SLPAPE+ V++FP+K H+    +
Sbjct  438  ESGTRAGISRIVMLAEALFEILDQIHQQPMSLSLSMVSLPAPESVVESFPVKIHRKTGKL  497

Query  315  ENALGDTQQCYICLAEYEDGDKLRVLPCHHEYHMICIDKWLKE  187
            E A  D  QCYICLAEYE+GDK+RVLPC HEYHM C+DKWLKE
Sbjct  498  ECA-DDVLQCYICLAEYEEGDKIRVLPCQHEYHMACVDKWLKE  539



>ref|XP_004508616.1| PREDICTED: uncharacterized protein LOC101493889 [Cicer arietinum]
Length=515

 Score =   172 bits (437),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 107/189 (57%), Positives = 118/189 (62%), Gaps = 21/189 (11%)
 Frame = -1

Query  753  TGNADDLGSHDRWLIDLNGDLHYDGVGYGSSYLGETGHHRNERRLPSRSEISERVHRGHR  574
            TG ADD GS DRWL+D   DL  DGVG  S Y G   H  NER   SRSEI ER+  G  
Sbjct  320  TGGADDSGSQDRWLVDFGEDLSNDGVGTPSGYRGSRIHRLNERMRHSRSEIWERLRGGLD  379

Query  573  NRVSQPSFCPSGLHPDGtcscesfftseefsTLASISRIIMLAEALFEVIDEIHRQSFSL  394
                  + CP GLH DG CSCESF  +EE S  ASISRI+MLAEALFEV+DEIHRQ  SL
Sbjct  380  EIGRLNTSCPLGLHADGMCSCESFPMAEESSARASISRIVMLAEALFEVLDEIHRQPVSL  439

Query  393  STFSLPAPEATVDAFPLKYHKTLDPVENALGDTQQCYICLAEYEDGDKLRVLPCHHEYHM  214
            S          VDA             +   D +QCYICLAEYEDGD++RVLPC HEYHM
Sbjct  440  SL---------VDAA------------DGGNDAEQCYICLAEYEDGDQIRVLPCRHEYHM  478

Query  213  ICIDKWLKE  187
             C+DKWLKE
Sbjct  479  SCVDKWLKE  487



>ref|XP_011032832.1| PREDICTED: uncharacterized protein LOC105131519 [Populus euphratica]
Length=479

 Score =   170 bits (430),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 117/217 (54%), Positives = 150/217 (69%), Gaps = 3/217 (1%)
 Frame = -1

Query  753  TGNADDLGSHDRWLIDLNGDLHYDGVGYGSSYLGETGHHRNERRLPSRSEISERVHRGHR  574
            T +ADDLGSHDRWL+D +GDLH+DGVG GS Y       R ER   SR E  ER H  H 
Sbjct  261  TSHADDLGSHDRWLLDFSGDLHFDGVGRGSRYPSTRSRRRRERPWQSRYE-RERFHDVHD  319

Query  573  NRVSQPSFCPSGLHPDGtcscesfftseefsTLASISRIIMLAEALFEVIDEIHR--QSF  400
             +  + S CP+GLH +GTC CE    +EE S+ A+IS+II+L +ALFEV++EIHR   S 
Sbjct  320  EQGWEASLCPAGLHRNGTCLCEPSSVAEESSSHANISQIILLTDALFEVLEEIHRHHLSL  379

Query  399  SLSTFSLPAPEATVDAFPLKYHKTLDPVENALGDTQQCYICLAEYEDGDKLRVLPCHHEY  220
            S S  SLPAPEA V++ PLK ++     EN     QQC+ICL +YE+GDK+RVLPC HE+
Sbjct  380  SPSMLSLPAPEAVVNSLPLKNYQKSHGTENVAQHEQQCHICLVDYEEGDKIRVLPCSHEF  439

Query  219  HMICIDKWLKEvnrvcpvcrcnvcNGPGQSSISTTET  109
            HM C+DKWLK+++ VCP+CR +VC G  +SS S  E+
Sbjct  440  HMACVDKWLKDIHGVCPLCRDDVCKGTAESSTSNPES  476



>ref|XP_009406595.1| PREDICTED: E3 ubiquitin-protein ligase RLIM-like [Musa acuminata 
subsp. malaccensis]
Length=503

 Score =   169 bits (429),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 100/193 (52%), Positives = 122/193 (63%), Gaps = 8/193 (4%)
 Frame = -1

Query  753  TGNADDLGSHDRWLIDLNGDLHYDGVGYGSSYLGETGHHRNERRLPSRSEISERVHRGHR  574
            + + + LG  DRWL+D+      DG    S Y  +  H  N     SRSEI ER+H G  
Sbjct  291  SADNNGLGYQDRWLLDIGDHTFGDGAEDDSFYSRQRRHGLNGVSWHSRSEIRERLHAGFN  350

Query  573  NRVSQPSFCPSGLHPDGtcscesfftseefsTLASISRIIMLAEALFEVIDEIHRQ--SF  400
            N   Q S CPSG+H DGTCSC    T    +  ASI+RI +LAEALFEV+DEIH Q  S 
Sbjct  351  NNDGQASSCPSGIHQDGTCSCTLLMTDVSSTR-ASIARIFVLAEALFEVLDEIHHQPGSL  409

Query  399  SLSTFSLPAPEATVDAFPLKYHKTLDPVENALG--DTQQCYICLAEYEDGDKLRVLPCHH  226
            SLS  S+PAPE+ V++ P K H+  D    ALG    +QCYICLA+Y+DGD +RVLPCHH
Sbjct  410  SLSVVSVPAPESIVNSLPSKIHRKPD---TALGIDGVEQCYICLADYDDGDIIRVLPCHH  466

Query  225  EYHMICIDKWLKE  187
            EYH  C+DKWLKE
Sbjct  467  EYHKSCVDKWLKE  479



>ref|XP_009613894.1| PREDICTED: E3 ubiquitin-protein ligase RLIM-like [Nicotiana tomentosiformis]
Length=523

 Score =   168 bits (426),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 102/193 (53%), Positives = 129/193 (67%), Gaps = 13/193 (7%)
 Frame = -1

Query  744  ADDLGSHDRWLIDLNGDLHYDGVGYGSSYLGETGHHRNERRLPSRSEISERVHRG-----  580
            +DD+ SHDR L+D + +  ++G G      G      NERR  SRSE+ ER+  G     
Sbjct  308  SDDVVSHDRLLLDFSDNSLHEGAGGNFPSNGSRTSGSNERRRHSRSEMWERLPGGLIASD  367

Query  579  HRNRVSQPSFCPSGLHPDGtcscesfftseefsTLASISRIIMLAEALFEVIDEIHRQSF  400
            HRN     + CP+G+H DG CSCE+   S E  + ASISRI+MLAEALFEV+DEIHRQ  
Sbjct  368  HRN-----ATCPTGIHADGPCSCETILMSRETGSRASISRIVMLAEALFEVLDEIHRQPM  422

Query  399  SLSTFSL--PAPEATVDAFPLKYHKTLDPVENALGDTQQCYICLAEYEDGDKLRVLPCHH  226
            SLS   L  PAPE+ VD+FP+K +   D V+    +  QC+ICLAEYEDGDK+RVLPCHH
Sbjct  423  SLSLSVLSLPAPESVVDSFPVKSYSKSDEVDTG-NNVPQCHICLAEYEDGDKIRVLPCHH  481

Query  225  EYHMICIDKWLKE  187
            E+H+ C+DKWLKE
Sbjct  482  EFHVSCVDKWLKE  494



>ref|XP_010323264.1| PREDICTED: E3 ubiquitin-protein ligase RLIM-like isoform X2 [Solanum 
lycopersicum]
Length=481

 Score =   166 bits (419),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 99/190 (52%), Positives = 129/190 (68%), Gaps = 9/190 (5%)
 Frame = -1

Query  747  NADDLGSHDRWLIDLNGDLHYDGVGYGSSYLGETGHHRNERRLPSRSEISERVHRGHRNR  568
            N+DD+ +HDR L+D + +  ++G G      G     RNERR  SRSE+ ER+  G    
Sbjct  269  NSDDIAAHDRLLLDFSDNSFHEGSGGNFPSNGS----RNERRRHSRSEMWERLPAGLIAS  324

Query  567  VSQPSFCPSGLHPDGtcscesfftseefsTLASISRIIMLAEALFEVIDEIHRQSFSLST  388
              +   CPSG+H DG C+CE+   S E  + ASISRI+MLAEALFEV+DEIHRQ  SLS 
Sbjct  325  DHRSVTCPSGIHTDGPCTCETILMSRESGSRASISRIVMLAEALFEVLDEIHRQPMSLSL  384

Query  387  FSL--PAPEATVDAFPLKYHKTLDPVE-NALGDTQQCYICLAEYEDGDKLRVLPCHHEYH  217
              L  PAPE+ VD+FP+K      PVE +   +  QC+ICL+EYE+GDK+RVLPCHHE+H
Sbjct  385  SVLSLPAPESVVDSFPVKSFSK--PVEVDTSNNVLQCHICLSEYEEGDKIRVLPCHHEFH  442

Query  216  MICIDKWLKE  187
            ++C+DKWLKE
Sbjct  443  LVCVDKWLKE  452



>ref|XP_006359526.1| PREDICTED: E3 ubiquitin-protein ligase RLIM-like isoform X2 [Solanum 
tuberosum]
Length=481

 Score =   166 bits (419),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 98/189 (52%), Positives = 130/189 (69%), Gaps = 7/189 (4%)
 Frame = -1

Query  747  NADDLGSHDRWLIDLNGDLHYDGVGYGSSYLGETGHHRNERRLPSRSEISERVHRGHRNR  568
            N+DD+ S DR L+D + +  ++G G      G     RNERR  SRSE+ ER+  G    
Sbjct  269  NSDDIASRDRLLLDFSDNSLHEGSGGNFPSNGS----RNERRRHSRSEMWERLPAGLIAS  324

Query  567  VSQPSFCPSGLHPDGtcscesfftseefsTLASISRIIMLAEALFEVIDEIHRQSFSLST  388
              + + CPSG+H DG CSCE+   S E  + ASISRI+MLAEALFEV+DEIHRQ  SLS 
Sbjct  325  DHRSATCPSGIHTDGPCSCETILMSRESGSRASISRIVMLAEALFEVLDEIHRQPMSLSL  384

Query  387  FSL--PAPEATVDAFPLKYHKTLDPVENALGDTQQCYICLAEYEDGDKLRVLPCHHEYHM  214
              L  PAPE+ VD+FP+K +   + V+ +  +  QC+ICL+EYE+GDK+RVLPCHHE+H+
Sbjct  385  SVLSLPAPESVVDSFPVKSYSKPEEVDTS-NNVLQCHICLSEYEEGDKIRVLPCHHEFHL  443

Query  213  ICIDKWLKE  187
            +C+DKWLKE
Sbjct  444  LCVDKWLKE  452



>ref|XP_004242710.1| PREDICTED: E3 ubiquitin-protein ligase RLIM-like isoform X1 [Solanum 
lycopersicum]
Length=521

 Score =   166 bits (420),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 99/190 (52%), Positives = 129/190 (68%), Gaps = 9/190 (5%)
 Frame = -1

Query  747  NADDLGSHDRWLIDLNGDLHYDGVGYGSSYLGETGHHRNERRLPSRSEISERVHRGHRNR  568
            N+DD+ +HDR L+D + +  ++G G      G     RNERR  SRSE+ ER+  G    
Sbjct  309  NSDDIAAHDRLLLDFSDNSFHEGSGGNFPSNGS----RNERRRHSRSEMWERLPAGLIAS  364

Query  567  VSQPSFCPSGLHPDGtcscesfftseefsTLASISRIIMLAEALFEVIDEIHRQSFSLST  388
              +   CPSG+H DG C+CE+   S E  + ASISRI+MLAEALFEV+DEIHRQ  SLS 
Sbjct  365  DHRSVTCPSGIHTDGPCTCETILMSRESGSRASISRIVMLAEALFEVLDEIHRQPMSLSL  424

Query  387  FSL--PAPEATVDAFPLKYHKTLDPVE-NALGDTQQCYICLAEYEDGDKLRVLPCHHEYH  217
              L  PAPE+ VD+FP+K      PVE +   +  QC+ICL+EYE+GDK+RVLPCHHE+H
Sbjct  425  SVLSLPAPESVVDSFPVKSFSK--PVEVDTSNNVLQCHICLSEYEEGDKIRVLPCHHEFH  482

Query  216  MICIDKWLKE  187
            ++C+DKWLKE
Sbjct  483  LVCVDKWLKE  492



>ref|XP_006359525.1| PREDICTED: E3 ubiquitin-protein ligase RLIM-like isoform X1 [Solanum 
tuberosum]
Length=521

 Score =   166 bits (420),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 98/189 (52%), Positives = 130/189 (69%), Gaps = 7/189 (4%)
 Frame = -1

Query  747  NADDLGSHDRWLIDLNGDLHYDGVGYGSSYLGETGHHRNERRLPSRSEISERVHRGHRNR  568
            N+DD+ S DR L+D + +  ++G G      G     RNERR  SRSE+ ER+  G    
Sbjct  309  NSDDIASRDRLLLDFSDNSLHEGSGGNFPSNGS----RNERRRHSRSEMWERLPAGLIAS  364

Query  567  VSQPSFCPSGLHPDGtcscesfftseefsTLASISRIIMLAEALFEVIDEIHRQSFSLST  388
              + + CPSG+H DG CSCE+   S E  + ASISRI+MLAEALFEV+DEIHRQ  SLS 
Sbjct  365  DHRSATCPSGIHTDGPCSCETILMSRESGSRASISRIVMLAEALFEVLDEIHRQPMSLSL  424

Query  387  FSL--PAPEATVDAFPLKYHKTLDPVENALGDTQQCYICLAEYEDGDKLRVLPCHHEYHM  214
              L  PAPE+ VD+FP+K +   + V+ +  +  QC+ICL+EYE+GDK+RVLPCHHE+H+
Sbjct  425  SVLSLPAPESVVDSFPVKSYSKPEEVDTS-NNVLQCHICLSEYEEGDKIRVLPCHHEFHL  483

Query  213  ICIDKWLKE  187
            +C+DKWLKE
Sbjct  484  LCVDKWLKE  492



>ref|XP_010687757.1| PREDICTED: uncharacterized protein LOC104901830 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=491

 Score =   162 bits (410),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 98/191 (51%), Positives = 125/191 (65%), Gaps = 7/191 (4%)
 Frame = -1

Query  753  TGNADDLGSHDRWLIDLNGDLHYDGVGYGSSYLGETGHHRNERRLPSRSEISERVHRGHR  574
            T ++D +GSH RWL+D+  D   DGVG      G      ++RR  SRSE  +R+ RG  
Sbjct  277  TEDSDLVGSHRRWLLDIGDDFFDDGVGAEPWRFGRRSRFTHDRRRNSRSEFWDRL-RGAT  335

Query  573  NRVSQPSFCPSGLHPDGtcscesfftseefsTLASISRIIMLAEALFEVIDEIHRQ--SF  400
               S  + CP  LHPDG+C+CE    +     L+SISRII+LAEALFEV+DEIHRQ  SF
Sbjct  336  TETSHRTSCPFDLHPDGSCTCEVDEEASA---LSSISRIILLAEALFEVLDEIHRQPDSF  392

Query  399  SLSTFSLPAPEATVDAFPLKYHKTLDPVENALGDTQQCYICLAEYEDGDKLRVLPCHHEY  220
            SLS  S+PAPE+ VD+ PLK ++     ++   D  QC+ICL EYE GD++RVLPC H Y
Sbjct  393  SLSMLSIPAPESVVDSLPLKTYEKPSTADHG-EDADQCHICLVEYEKGDQIRVLPCQHGY  451

Query  219  HMICIDKWLKE  187
            HM C+DKWLKE
Sbjct  452  HMSCVDKWLKE  462



>ref|XP_010687756.1| PREDICTED: uncharacterized protein LOC104901830 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=523

 Score =   162 bits (410),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 98/191 (51%), Positives = 125/191 (65%), Gaps = 7/191 (4%)
 Frame = -1

Query  753  TGNADDLGSHDRWLIDLNGDLHYDGVGYGSSYLGETGHHRNERRLPSRSEISERVHRGHR  574
            T ++D +GSH RWL+D+  D   DGVG      G      ++RR  SRSE  +R+ RG  
Sbjct  309  TEDSDLVGSHRRWLLDIGDDFFDDGVGAEPWRFGRRSRFTHDRRRNSRSEFWDRL-RGAT  367

Query  573  NRVSQPSFCPSGLHPDGtcscesfftseefsTLASISRIIMLAEALFEVIDEIHRQ--SF  400
               S  + CP  LHPDG+C+CE    +     L+SISRII+LAEALFEV+DEIHRQ  SF
Sbjct  368  TETSHRTSCPFDLHPDGSCTCEVDEEASA---LSSISRIILLAEALFEVLDEIHRQPDSF  424

Query  399  SLSTFSLPAPEATVDAFPLKYHKTLDPVENALGDTQQCYICLAEYEDGDKLRVLPCHHEY  220
            SLS  S+PAPE+ VD+ PLK ++     ++   D  QC+ICL EYE GD++RVLPC H Y
Sbjct  425  SLSMLSIPAPESVVDSLPLKTYEKPSTADHG-EDADQCHICLVEYEKGDQIRVLPCQHGY  483

Query  219  HMICIDKWLKE  187
            HM C+DKWLKE
Sbjct  484  HMSCVDKWLKE  494



>ref|XP_008343916.1| PREDICTED: E3 ubiquitin-protein ligase RNF13-like [Malus domestica]
Length=142

 Score =   141 bits (356),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 69/98 (70%), Positives = 79/98 (81%), Gaps = 3/98 (3%)
 Frame = -1

Query  474  ASISRIIMLAEALFEVIDEIHRQ--SFSLSTFSLPAPEATVDAFPLKYHKTLDPVENALG  301
            ASISRI+MLAEALFEV+DEIHRQ  S SLS  S PAP + VD FPLK H  +D  ++   
Sbjct  17   ASISRIVMLAEALFEVLDEIHRQPVSLSLSMVSAPAPASLVDGFPLKSHTKVDKPKSG-D  75

Query  300  DTQQCYICLAEYEDGDKLRVLPCHHEYHMICIDKWLKE  187
            D +QCYICLAEYE+GDK+RVLPCHHEYHM C+DKWLKE
Sbjct  76   DVEQCYICLAEYEEGDKIRVLPCHHEYHMSCVDKWLKE  113



>ref|XP_010542078.1| PREDICTED: E3 ubiquitin-protein ligase RLIM-like isoform X3 [Tarenaya 
hassleriana]
Length=496

 Score =   147 bits (371),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 94/189 (50%), Positives = 123/189 (65%), Gaps = 13/189 (7%)
 Frame = -1

Query  747  NADDLGSHDRWLIDLNGDLHYDGVGYGSSYLGETGHHRNERRLPSRSEISERVHRGHRNR  568
            + +D  S +R   DLNG      +G          ++R+E+R  SRSEI + V   + N+
Sbjct  290  SGNDALSQNRRPADLNGGPPSGQIGV---------NNRSEQRQHSRSEIWDIVFGINENQ  340

Query  567  VSQPSFCPSGLHPDGtcscesfftseefsTLASISRIIMLAEALFEVIDEIHRQS--FSL  394
              Q + CP G+HP G+CSC+S  T EE S   SISRI+MLAEALFEV+DE+  +S  FSL
Sbjct  341  -RQTNSCPFGVHPGGSCSCDSLLTGEESSIHLSISRIVMLAEALFEVLDEMQPRSAYFSL  399

Query  393  STFSLPAPEATVDAFPLKYHKTLDPVENALGDTQQCYICLAEYEDGDKLRVLPCHHEYHM  214
               S  APE+ V++FPL+ +      E +  D QQCYICL+EYEDGDK+R+LPCHHEYHM
Sbjct  400  PLTSHVAPESVVESFPLREYMKPKTAE-STDDVQQCYICLSEYEDGDKIRLLPCHHEYHM  458

Query  213  ICIDKWLKE  187
             C+DKWLKE
Sbjct  459  ACVDKWLKE  467



>ref|XP_010049886.1| PREDICTED: uncharacterized RING finger protein C4G3.12c-like 
isoform X2 [Eucalyptus grandis]
 ref|XP_010049887.1| PREDICTED: uncharacterized RING finger protein C4G3.12c-like 
isoform X2 [Eucalyptus grandis]
 gb|KCW82709.1| hypothetical protein EUGRSUZ_C04089 [Eucalyptus grandis]
Length=485

 Score =   144 bits (364),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 90/159 (57%), Positives = 112/159 (70%), Gaps = 3/159 (2%)
 Frame = -1

Query  660  YLGETGHHRNERRLPSRSEISERVHRGHRNRVSQPSFCPSGLHPDGtcscesfftseefs  481
            YLG   H  + RR   RSEI +R+  G  +   + + CPSGLHPDG CSC+SF  SE  +
Sbjct  300  YLGGRIHRSHHRRRRPRSEIWDRLRYGLSDNGGRTASCPSGLHPDGLCSCDSFSVSESST  359

Query  480  TLASISRIIMLAEALFEVIDEIHRQSFSLSTFSL-PAPEATVDAFPLKYHKTLDPVENAL  304
              +  SRI+MLAEALFEV+DEIHRQ   LS  ++ PAPE+ VD+FPLK +K     E   
Sbjct  360  HSSI-SRIVMLAEALFEVLDEIHRQPVPLSLSAVSPAPESVVDSFPLKNYKRTTKAEEG-  417

Query  303  GDTQQCYICLAEYEDGDKLRVLPCHHEYHMICIDKWLKE  187
            G+ +QCYICLAEYE+ DK+RVLPCHHEYH+ C+DKWLKE
Sbjct  418  GNGEQCYICLAEYEEEDKIRVLPCHHEYHVACVDKWLKE  456



>ref|XP_010049885.1| PREDICTED: uncharacterized RING finger protein C4G3.12c-like 
isoform X1 [Eucalyptus grandis]
 gb|KCW82708.1| hypothetical protein EUGRSUZ_C04089 [Eucalyptus grandis]
Length=531

 Score =   144 bits (364),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 90/159 (57%), Positives = 112/159 (70%), Gaps = 3/159 (2%)
 Frame = -1

Query  660  YLGETGHHRNERRLPSRSEISERVHRGHRNRVSQPSFCPSGLHPDGtcscesfftseefs  481
            YLG   H  + RR   RSEI +R+  G  +   + + CPSGLHPDG CSC+SF  SE  +
Sbjct  346  YLGGRIHRSHHRRRRPRSEIWDRLRYGLSDNGGRTASCPSGLHPDGLCSCDSFSVSESST  405

Query  480  TLASISRIIMLAEALFEVIDEIHRQSFSLSTFSL-PAPEATVDAFPLKYHKTLDPVENAL  304
              +  SRI+MLAEALFEV+DEIHRQ   LS  ++ PAPE+ VD+FPLK +K     E   
Sbjct  406  HSSI-SRIVMLAEALFEVLDEIHRQPVPLSLSAVSPAPESVVDSFPLKNYKRTTKAEEG-  463

Query  303  GDTQQCYICLAEYEDGDKLRVLPCHHEYHMICIDKWLKE  187
            G+ +QCYICLAEYE+ DK+RVLPCHHEYH+ C+DKWLKE
Sbjct  464  GNGEQCYICLAEYEEEDKIRVLPCHHEYHVACVDKWLKE  502



>ref|XP_010235925.1| PREDICTED: uncharacterized protein LOC100833892 isoform X2 [Brachypodium 
distachyon]
Length=475

 Score =   143 bits (360),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 93/190 (49%), Positives = 119/190 (63%), Gaps = 6/190 (3%)
 Frame = -1

Query  747  NADDLGSHDRWLIDLNGDLHYDGVGYGSSYLGETGHHRNERRLPSRSEISERVHRGHRNR  568
            ++DDLG + RWL DL  DL  D V   + Y     H        SRS I E       N 
Sbjct  271  DSDDLGFYTRWL-DLGDDLFGDEVEE-ARYFHRRRHGSIRLNQYSRSRIREHRRAIFDNG  328

Query  567  VSQPSF-CPSGLHPDGtcscesfftseefsTLASISRIIMLAEALFEVIDEIHRQ--SFS  397
              Q +  CP G+H  G C+C+SF  +EE S  ASISRI+ML EALFEV+DEIHRQ  S S
Sbjct  329  NGQSTAACPLGIHQIGRCTCDSFLVAEESSARASISRIVMLTEALFEVLDEIHRQPASLS  388

Query  396  LSTFSLPAPEATVDAFPLKYHKTLDPVENALGDTQQCYICLAEYEDGDKLRVLPCHHEYH  217
            LS  S+ APE+ V++ P K +K L+  + +  D +QC+ICL EYEDGD++R LPC HE+H
Sbjct  389  LSMVSVQAPESVVNSLPCKSYKKLETAQCS-ADLEQCHICLTEYEDGDQIRSLPCKHEFH  447

Query  216  MICIDKWLKE  187
            + C+DKWLKE
Sbjct  448  LQCVDKWLKE  457



>ref|XP_003570316.1| PREDICTED: uncharacterized protein LOC100833892 isoform X1 [Brachypodium 
distachyon]
Length=518

 Score =   143 bits (360),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 93/190 (49%), Positives = 119/190 (63%), Gaps = 6/190 (3%)
 Frame = -1

Query  747  NADDLGSHDRWLIDLNGDLHYDGVGYGSSYLGETGHHRNERRLPSRSEISERVHRGHRNR  568
            ++DDLG + RWL DL  DL  D V   + Y     H        SRS I E       N 
Sbjct  314  DSDDLGFYTRWL-DLGDDLFGDEVEE-ARYFHRRRHGSIRLNQYSRSRIREHRRAIFDNG  371

Query  567  VSQPSF-CPSGLHPDGtcscesfftseefsTLASISRIIMLAEALFEVIDEIHRQ--SFS  397
              Q +  CP G+H  G C+C+SF  +EE S  ASISRI+ML EALFEV+DEIHRQ  S S
Sbjct  372  NGQSTAACPLGIHQIGRCTCDSFLVAEESSARASISRIVMLTEALFEVLDEIHRQPASLS  431

Query  396  LSTFSLPAPEATVDAFPLKYHKTLDPVENALGDTQQCYICLAEYEDGDKLRVLPCHHEYH  217
            LS  S+ APE+ V++ P K +K L+  + +  D +QC+ICL EYEDGD++R LPC HE+H
Sbjct  432  LSMVSVQAPESVVNSLPCKSYKKLETAQCS-ADLEQCHICLTEYEDGDQIRSLPCKHEFH  490

Query  216  MICIDKWLKE  187
            + C+DKWLKE
Sbjct  491  LQCVDKWLKE  500



>ref|XP_008677723.1| PREDICTED: uncharacterized protein LOC100501846 isoform X1 [Zea 
mays]
 gb|AFW64131.1| putative RING zinc finger domain superfamily protein [Zea mays]
Length=513

 Score =   142 bits (359),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 92/196 (47%), Positives = 122/196 (62%), Gaps = 19/196 (10%)
 Frame = -1

Query  747  NADDLGSHDRWLIDLNGDLHYDGVGYGSSYLGETGHHRNERRLPSR-SEISERVHRGHRN  571
            +ADDLG +  WL DL  D+  +        LGE+ +    R    R S+ S    R HR 
Sbjct  311  DADDLGFYSTWL-DLGDDIFEE--------LGESRYFHRRRHGSIRVSQYSRSRIREHRR  361

Query  570  RV------SQPSFCPSGLHPDGtcscesfftseefsTLASISRIIMLAEALFEVIDEIHR  409
             V         + CP G+H  G C+C+SF  +EE S  ASISRI+ML EALFEV+DEIHR
Sbjct  362  AVFDSGNEQGTAACPLGIHQTGRCTCDSFLVAEESSARASISRIVMLTEALFEVLDEIHR  421

Query  408  Q--SFSLSTFSLPAPEATVDAFPLKYHKTLDPVENALGDTQQCYICLAEYEDGDKLRVLP  235
            Q  S SLS  S+ APE+ V++ P K +K L+  + +  D +QC+ICL EYEDGD++R+LP
Sbjct  422  QPASLSLSMVSVQAPESVVNSLPCKSYKKLEAPQRS-DDMEQCHICLTEYEDGDQIRILP  480

Query  234  CHHEYHMICIDKWLKE  187
            C HE+H+ C+DKWLKE
Sbjct  481  CKHEFHLQCVDKWLKE  496



>gb|ACG25313.1| zinc finger, C3HC4 type family protein [Zea mays]
Length=512

 Score =   142 bits (357),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 92/196 (47%), Positives = 121/196 (62%), Gaps = 19/196 (10%)
 Frame = -1

Query  747  NADDLGSHDRWLIDLNGDLHYDGVGYGSSYLGETGHHRNERRLPSR-SEISERVHRGHRN  571
            +ADDLG +  WL DL  D+  +        LGE+ +    R    R S+ S    R HR 
Sbjct  314  DADDLGFYSTWL-DLGDDIFEE--------LGESRYFHRRRHGSIRVSQYSRSRIREHRR  364

Query  570  RV------SQPSFCPSGLHPDGtcscesfftseefsTLASISRIIMLAEALFEVIDEIHR  409
             V         + CP G+H  G C+C+SF  +EE S  ASISRI+ML EALFEV+DEIHR
Sbjct  365  AVFDSGNEQSTAACPLGIHQTGRCTCDSFLVAEESSARASISRIVMLTEALFEVLDEIHR  424

Query  408  Q--SFSLSTFSLPAPEATVDAFPLKYHKTLDPVENALGDTQQCYICLAEYEDGDKLRVLP  235
            Q  S SLS  S+ APE+ V++ P K +K L+  + +  D +QC+ICL EYEDGD++R LP
Sbjct  425  QPASLSLSMVSVQAPESVVNSLPCKSYKKLEAPQRS-DDMEQCHICLNEYEDGDQIRTLP  483

Query  234  CHHEYHMICIDKWLKE  187
            C HE+H+ C+DKWLKE
Sbjct  484  CKHEFHLQCVDKWLKE  499



>ref|XP_007218486.1| hypothetical protein PRUPE_ppa012075mg [Prunus persica]
 gb|EMJ19685.1| hypothetical protein PRUPE_ppa012075mg [Prunus persica]
Length=184

 Score =   134 bits (338),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 77/142 (54%), Positives = 98/142 (69%), Gaps = 3/142 (2%)
 Frame = -1

Query  606  EISERVHRGHRNRVSQPSFCPSGLHPDGtcscesfftseefsTLASISRIIMLAEALFEV  427
            E+SER+H G  N     SFC S LH +GTCSCE+   +E  S  A++ RIIML EAL E+
Sbjct  23   ELSERLHGGLVNERGPRSFCSSRLHANGTCSCETSLMAEISSIHATVLRIIMLTEALNEI  82

Query  426  IDEIHRQSFSLS--TFSLPAPEATVDAFPLKYHKTLDPVENALGDTQQCYICLAEYEDGD  253
            +DEI     SLS    S PAPE  V++FPLK HK+ +  E+   D Q+CYICL+EY +GD
Sbjct  83   LDEIRHVPLSLSQSMLSPPAPENVVNSFPLKNHKS-EITESKAQDAQECYICLSEYNEGD  141

Query  252  KLRVLPCHHEYHMICIDKWLKE  187
            K+RVLPC HE+HM C+D+WLKE
Sbjct  142  KIRVLPCCHEFHMECVDRWLKE  163



>ref|NP_001183423.1| uncharacterized protein LOC100501846 [Zea mays]
 gb|ACR36722.1| unknown [Zea mays]
Length=505

 Score =   139 bits (351),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 92/195 (47%), Positives = 121/195 (62%), Gaps = 25/195 (13%)
 Frame = -1

Query  747  NADDLGSHDRWLIDLNGDLHYDGVGYGSSYLGETGHHRNERRLPSRSEISERVHRGHRNR  568
            +ADDLG +  WL DL  D+  +        LGE+      R    R   S R+ R HR  
Sbjct  311  DADDLGFYSTWL-DLGDDIFEE--------LGES------RYFHRRRHGSIRI-REHRRA  354

Query  567  V------SQPSFCPSGLHPDGtcscesfftseefsTLASISRIIMLAEALFEVIDEIHRQ  406
            V         + CP G+H  G C+C+SF  +EE S  ASISRI+ML EALFEV+DEIHRQ
Sbjct  355  VFDSGNEQGTAACPLGIHQTGRCTCDSFLVAEESSARASISRIVMLTEALFEVLDEIHRQ  414

Query  405  --SFSLSTFSLPAPEATVDAFPLKYHKTLDPVENALGDTQQCYICLAEYEDGDKLRVLPC  232
              S SLS  S+ APE+ V++ P K +K L+  + +  D +QC+ICL EYEDGD++R+LPC
Sbjct  415  PASLSLSMVSVQAPESVVNSLPCKSYKKLEAPQRS-DDMEQCHICLTEYEDGDQIRILPC  473

Query  231  HHEYHMICIDKWLKE  187
             HE+H+ C+DKWLKE
Sbjct  474  KHEFHLQCVDKWLKE  488



>ref|XP_008681417.1| PREDICTED: LOC100273142 isoform X2 [Zea mays]
Length=484

 Score =   139 bits (350),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 92/196 (47%), Positives = 120/196 (61%), Gaps = 19/196 (10%)
 Frame = -1

Query  747  NADDLGSHDRWLIDLNGDLHYDGVGYGSSYLGETGHHRNERRLPSR-SEISERVHRGHRN  571
            +AD++G    WL DL  D+  +        LGE+ +    R    R S+ S    R HR 
Sbjct  282  DADEMGFFSTWL-DLGDDIFEE--------LGESRYFHRRRHGSIRVSQYSRSRIREHRR  332

Query  570  RV------SQPSFCPSGLHPDGtcscesfftseefsTLASISRIIMLAEALFEVIDEIHR  409
             V         + CP G+H  G C+C SFF +EE S  ASISRI+ML EALFEV+DEIHR
Sbjct  333  AVFDSGNEQNTAACPLGIHQIGRCTCNSFFIAEESSARASISRIVMLTEALFEVLDEIHR  392

Query  408  Q--SFSLSTFSLPAPEATVDAFPLKYHKTLDPVENALGDTQQCYICLAEYEDGDKLRVLP  235
            Q  S SLS  S+ APE+ VD+ P K +K L+  + +  D +QC+ICL EYEDGD++R LP
Sbjct  393  QPASLSLSMVSVQAPESVVDSLPCKSYKKLETPQCS-DDMEQCHICLTEYEDGDQIRTLP  451

Query  234  CHHEYHMICIDKWLKE  187
            C HE+H+ C+DKWLKE
Sbjct  452  CKHEFHLQCVDKWLKE  467



>ref|NP_001141061.1| LOC100273142 [Zea mays]
 gb|ACF85311.1| unknown [Zea mays]
 gb|AFW73879.1| putative RING zinc finger domain superfamily protein [Zea mays]
Length=510

 Score =   139 bits (351),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 92/196 (47%), Positives = 120/196 (61%), Gaps = 19/196 (10%)
 Frame = -1

Query  747  NADDLGSHDRWLIDLNGDLHYDGVGYGSSYLGETGHHRNERRLPSR-SEISERVHRGHRN  571
            +AD++G    WL DL  D+  +        LGE+ +    R    R S+ S    R HR 
Sbjct  308  DADEMGFFSTWL-DLGDDIFEE--------LGESRYFHRRRHGSIRVSQYSRSRIREHRR  358

Query  570  RV------SQPSFCPSGLHPDGtcscesfftseefsTLASISRIIMLAEALFEVIDEIHR  409
             V         + CP G+H  G C+C SFF +EE S  ASISRI+ML EALFEV+DEIHR
Sbjct  359  AVFDSGNEQNTAACPLGIHQIGRCTCNSFFIAEESSARASISRIVMLTEALFEVLDEIHR  418

Query  408  Q--SFSLSTFSLPAPEATVDAFPLKYHKTLDPVENALGDTQQCYICLAEYEDGDKLRVLP  235
            Q  S SLS  S+ APE+ VD+ P K +K L+  + +  D +QC+ICL EYEDGD++R LP
Sbjct  419  QPASLSLSMVSVQAPESVVDSLPCKSYKKLETPQCS-DDMEQCHICLTEYEDGDQIRTLP  477

Query  234  CHHEYHMICIDKWLKE  187
            C HE+H+ C+DKWLKE
Sbjct  478  CKHEFHLQCVDKWLKE  493



>ref|XP_004954239.1| PREDICTED: uncharacterized protein DDB_G0271670-like isoform 
X2 [Setaria italica]
Length=518

 Score =   139 bits (350),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 91/196 (46%), Positives = 120/196 (61%), Gaps = 19/196 (10%)
 Frame = -1

Query  747  NADDLGSHDRWLIDLNGDLHYDGVGYGSSYLGETGHHRNERRLPSR-SEISERVHRGHRN  571
            + DDLG +  WL D+  DL  +        L E+ H    R    R S+ S    R HR 
Sbjct  316  DVDDLGFYSTWL-DIGDDLFGE--------LEESRHFHRRRHGSIRVSQYSRSRIREHRR  366

Query  570  RV------SQPSFCPSGLHPDGtcscesfftseefsTLASISRIIMLAEALFEVIDEIHR  409
             V         + CP G+HP G C+C+SF  +EE S  ASISRI+ML EALFEV+DEIHR
Sbjct  367  AVFDSGNEQSTAACPLGIHPIGRCTCDSFLIAEESSARASISRIVMLTEALFEVLDEIHR  426

Query  408  Q--SFSLSTFSLPAPEATVDAFPLKYHKTLDPVENALGDTQQCYICLAEYEDGDKLRVLP  235
            Q  S SLS  S+ APE+ V++ P K +K L+  + +  D +QC+ICL EYEDG+++R LP
Sbjct  427  QPASLSLSMVSVQAPESVVNSLPCKSYKKLETPQCS-DDMEQCHICLTEYEDGEQIRTLP  485

Query  234  CHHEYHMICIDKWLKE  187
            C HE+H+ C+DKWLKE
Sbjct  486  CKHEFHLQCVDKWLKE  501



>ref|XP_011033495.1| PREDICTED: E3 ubiquitin-protein ligase RLIM-like isoform X1 [Populus 
euphratica]
Length=492

 Score =   139 bits (349),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 91/215 (42%), Positives = 113/215 (53%), Gaps = 61/215 (28%)
 Frame = -1

Query  741  DDLGSHDRWLIDLNGDLHYDGVGYGSSYLGETGHHRNERRLPSRSEISERVHR-GHRNRV  565
            DDL SHDRWL++ + D   DG+   S YLG                   R+HR   R R 
Sbjct  334  DDLESHDRWLLNSSVDFFSDGIDNDSRYLGR------------------RIHRLTERRRQ  375

Query  564  SQPSFCPSGLHPDGtcscesfftseefsTLASISRIIMLAEALFEVIDEIHRQ--SFSLS  391
            S+                                       +  +V+DEIHRQ  S SLS
Sbjct  376  SR---------------------------------------SELQVLDEIHRQPVSLSLS  396

Query  390  TFSLPAPEATVDAFPLKYHKTLDPVENALGDTQQCYICLAEYEDGDKLRVLPCHHEYHMI  211
              SLPAPE+ VD+FPLK HK +D VE    + +QCYICLAEYE+GDK+RVLPCHHEYHM 
Sbjct  397  MMSLPAPESIVDSFPLKNHKKVDKVEGN-DEEEQCYICLAEYEEGDKIRVLPCHHEYHMA  455

Query  210  CIDKWLKEvnrvcpvcrcnvcNGPGQSSISTTETP  106
            C+DKWLKE++ VC +CR +V  G  + SI   E P
Sbjct  456  CVDKWLKEIHGVCLLCRGDVREGANEPSIPNPEIP  490



>ref|XP_011033498.1| PREDICTED: E3 ubiquitin-protein ligase RLIM-like isoform X3 [Populus 
euphratica]
 ref|XP_011033499.1| PREDICTED: E3 ubiquitin-protein ligase RLIM-like isoform X3 [Populus 
euphratica]
 ref|XP_011033500.1| PREDICTED: E3 ubiquitin-protein ligase RLIM-like isoform X3 [Populus 
euphratica]
 ref|XP_011033501.1| PREDICTED: E3 ubiquitin-protein ligase RLIM-like isoform X3 [Populus 
euphratica]
 ref|XP_011033502.1| PREDICTED: E3 ubiquitin-protein ligase RLIM-like isoform X3 [Populus 
euphratica]
Length=450

 Score =   138 bits (348),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 91/215 (42%), Positives = 113/215 (53%), Gaps = 61/215 (28%)
 Frame = -1

Query  741  DDLGSHDRWLIDLNGDLHYDGVGYGSSYLGETGHHRNERRLPSRSEISERVHR-GHRNRV  565
            DDL SHDRWL++ + D   DG+   S YLG                   R+HR   R R 
Sbjct  292  DDLESHDRWLLNSSVDFFSDGIDNDSRYLGR------------------RIHRLTERRRQ  333

Query  564  SQPSFCPSGLHPDGtcscesfftseefsTLASISRIIMLAEALFEVIDEIHRQ--SFSLS  391
            S+                                       +  +V+DEIHRQ  S SLS
Sbjct  334  SR---------------------------------------SELQVLDEIHRQPVSLSLS  354

Query  390  TFSLPAPEATVDAFPLKYHKTLDPVENALGDTQQCYICLAEYEDGDKLRVLPCHHEYHMI  211
              SLPAPE+ VD+FPLK HK +D VE    + +QCYICLAEYE+GDK+RVLPCHHEYHM 
Sbjct  355  MMSLPAPESIVDSFPLKNHKKVDKVEGN-DEEEQCYICLAEYEEGDKIRVLPCHHEYHMA  413

Query  210  CIDKWLKEvnrvcpvcrcnvcNGPGQSSISTTETP  106
            C+DKWLKE++ VC +CR +V  G  + SI   E P
Sbjct  414  CVDKWLKEIHGVCLLCRGDVREGANEPSIPNPEIP  448



>ref|XP_011033497.1| PREDICTED: E3 ubiquitin-protein ligase RLIM-like isoform X2 [Populus 
euphratica]
Length=490

 Score =   138 bits (348),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 90/214 (42%), Positives = 111/214 (52%), Gaps = 61/214 (29%)
 Frame = -1

Query  741  DDLGSHDRWLIDLNGDLHYDGVGYGSSYLGETGHHRNERRLPSRSEISERVHRGHRNRVS  562
            DDL SHDRWL++ + D   DG+   S YLG                   R+HR    R  
Sbjct  334  DDLESHDRWLLNSSVDFFSDGIDNDSRYLGR------------------RIHRLTERR--  373

Query  561  QPSFCPSGLHPDGtcscesfftseefsTLASISRIIMLAEALFEVIDEIHRQ--SFSLST  388
                                                   ++  EV+DEIHRQ  S SLS 
Sbjct  374  --------------------------------------RQSRSEVLDEIHRQPVSLSLSM  395

Query  387  FSLPAPEATVDAFPLKYHKTLDPVENALGDTQQCYICLAEYEDGDKLRVLPCHHEYHMIC  208
             SLPAPE+ VD+FPLK HK +D VE    + +QCYICLAEYE+GDK+RVLPCHHEYHM C
Sbjct  396  MSLPAPESIVDSFPLKNHKKVDKVEGN-DEEEQCYICLAEYEEGDKIRVLPCHHEYHMAC  454

Query  207  IDKWLKEvnrvcpvcrcnvcNGPGQSSISTTETP  106
            +DKWLKE++ VC +CR +V  G  + SI   E P
Sbjct  455  VDKWLKEIHGVCLLCRGDVREGANEPSIPNPEIP  488



>ref|XP_004954238.1| PREDICTED: uncharacterized protein DDB_G0271670-like isoform 
X1 [Setaria italica]
Length=583

 Score =   138 bits (348),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 91/196 (46%), Positives = 120/196 (61%), Gaps = 19/196 (10%)
 Frame = -1

Query  747  NADDLGSHDRWLIDLNGDLHYDGVGYGSSYLGETGHHRNERRLPSR-SEISERVHRGHRN  571
            + DDLG +  WL D+  DL  +        L E+ H    R    R S+ S    R HR 
Sbjct  316  DVDDLGFYSTWL-DIGDDLFGE--------LEESRHFHRRRHGSIRVSQYSRSRIREHRR  366

Query  570  RV------SQPSFCPSGLHPDGtcscesfftseefsTLASISRIIMLAEALFEVIDEIHR  409
             V         + CP G+HP G C+C+SF  +EE S  ASISRI+ML EALFEV+DEIHR
Sbjct  367  AVFDSGNEQSTAACPLGIHPIGRCTCDSFLIAEESSARASISRIVMLTEALFEVLDEIHR  426

Query  408  Q--SFSLSTFSLPAPEATVDAFPLKYHKTLDPVENALGDTQQCYICLAEYEDGDKLRVLP  235
            Q  S SLS  S+ APE+ V++ P K +K L+  + +  D +QC+ICL EYEDG+++R LP
Sbjct  427  QPASLSLSMVSVQAPESVVNSLPCKSYKKLETPQCS-DDMEQCHICLTEYEDGEQIRTLP  485

Query  234  CHHEYHMICIDKWLKE  187
            C HE+H+ C+DKWLKE
Sbjct  486  CKHEFHLQCVDKWLKE  501



>ref|NP_001048403.1| Os02g0798600 [Oryza sativa Japonica Group]
 dbj|BAD36057.1| zinc finger protein-like [Oryza sativa Japonica Group]
 dbj|BAF10317.1| Os02g0798600 [Oryza sativa Japonica Group]
 gb|EEE57985.1| hypothetical protein OsJ_08736 [Oryza sativa Japonica Group]
Length=389

 Score =   137 bits (344),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 89/195 (46%), Positives = 113/195 (58%), Gaps = 17/195 (9%)
 Frame = -1

Query  747  NADDLGSHDRWLIDLNGDLHYDGVGYGSSYLGETGHHRNERRLPSRSEISERVHRGHRNR  568
            + DDLG + RWL DL  +L  D +     +      HR        S+ S    R HR  
Sbjct  187  DTDDLGFYSRWL-DLGDELFADEIEEARFF------HRRRHGSIRVSQYSRSRIREHRRA  239

Query  567  V------SQPSFCPSGLHPDGtcscesfftseefsTLASISRIIMLAEALFEVIDEIHRQ  406
            V           CP G+H  G C+C+SF  +EE S  ASISRI+ML EALFEV+DEIHRQ
Sbjct  240  VFDSGTDQSTVACPLGIHQIGRCTCDSFLIAEESSARASISRIVMLTEALFEVLDEIHRQ  299

Query  405  --SFSLSTFSLPAPEATVDAFPLKYHKTLDPVENALGDTQQCYICLAEYEDGDKLRVLPC  232
              S SLS  S  APE+ V++ P K +K          D +QC+ICL EYEDGD++R LPC
Sbjct  300  PASLSLSMVSAQAPESVVNSLPCKSYKK--QTAQCSDDMEQCHICLTEYEDGDQIRSLPC  357

Query  231  HHEYHMICIDKWLKE  187
             HE+H++C+DKWLKE
Sbjct  358  KHEFHLLCVDKWLKE  372



>ref|XP_010542076.1| PREDICTED: uncharacterized protein LOC104815393 isoform X2 [Tarenaya 
hassleriana]
Length=513

 Score =   138 bits (347),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 93/206 (45%), Positives = 122/206 (59%), Gaps = 29/206 (14%)
 Frame = -1

Query  747  NADDLGSHDRWLIDLNGDLHYDGVGYGSSYLGETGHHRNERRLPSRSEIS----------  598
            + +D  S +R   DLNG      +G          ++R+E+R  SRSE+           
Sbjct  289  SGNDALSQNRRPADLNGGPPSGQIGV---------NNRSEQRQHSRSEVPLVKPISSSLS  339

Query  597  ---ER----VHRGHRNRVSQPSFCPSGLHPDGtcscesfftseefsTLASISRIIMLAEA  439
               E+    +  G      Q + CP G+HP G+CSC+S  T EE S   SISRI+MLAEA
Sbjct  340  FNLEKQIWDIVFGINENQRQTNSCPFGVHPGGSCSCDSLLTGEESSIHLSISRIVMLAEA  399

Query  438  LFEVIDEIHRQS--FSLSTFSLPAPEATVDAFPLKYHKTLDPVENALGDTQQCYICLAEY  265
            LFEV+DE+  +S  FSL   S  APE+ V++FPL+ +      E +  D QQCYICL+EY
Sbjct  400  LFEVLDEMQPRSAYFSLPLTSHVAPESVVESFPLREYMKPKTAE-STDDVQQCYICLSEY  458

Query  264  EDGDKLRVLPCHHEYHMICIDKWLKE  187
            EDGDK+R+LPCHHEYHM C+DKWLKE
Sbjct  459  EDGDKIRLLPCHHEYHMACVDKWLKE  484



>ref|XP_010542075.1| PREDICTED: uncharacterized protein LOC104815393 isoform X1 [Tarenaya 
hassleriana]
Length=514

 Score =   138 bits (347),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 93/206 (45%), Positives = 122/206 (59%), Gaps = 29/206 (14%)
 Frame = -1

Query  747  NADDLGSHDRWLIDLNGDLHYDGVGYGSSYLGETGHHRNERRLPSRSEIS----------  598
            + +D  S +R   DLNG      +G          ++R+E+R  SRSE+           
Sbjct  290  SGNDALSQNRRPADLNGGPPSGQIGV---------NNRSEQRQHSRSEVPLVKPISSSLS  340

Query  597  ---ER----VHRGHRNRVSQPSFCPSGLHPDGtcscesfftseefsTLASISRIIMLAEA  439
               E+    +  G      Q + CP G+HP G+CSC+S  T EE S   SISRI+MLAEA
Sbjct  341  FNLEKQIWDIVFGINENQRQTNSCPFGVHPGGSCSCDSLLTGEESSIHLSISRIVMLAEA  400

Query  438  LFEVIDEIHRQS--FSLSTFSLPAPEATVDAFPLKYHKTLDPVENALGDTQQCYICLAEY  265
            LFEV+DE+  +S  FSL   S  APE+ V++FPL+ +      E +  D QQCYICL+EY
Sbjct  401  LFEVLDEMQPRSAYFSLPLTSHVAPESVVESFPLREYMKPKTAE-STDDVQQCYICLSEY  459

Query  264  EDGDKLRVLPCHHEYHMICIDKWLKE  187
            EDGDK+R+LPCHHEYHM C+DKWLKE
Sbjct  460  EDGDKIRLLPCHHEYHMACVDKWLKE  485



>gb|EEC74180.1| hypothetical protein OsI_09301 [Oryza sativa Indica Group]
Length=520

 Score =   136 bits (343),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 89/195 (46%), Positives = 113/195 (58%), Gaps = 17/195 (9%)
 Frame = -1

Query  747  NADDLGSHDRWLIDLNGDLHYDGVGYGSSYLGETGHHRNERRLPSRSEISERVHRGHRNR  568
            + DDLG + RWL DL  +L  D +     +      HR        S+ S    R HR  
Sbjct  318  DTDDLGFYSRWL-DLGDELFADEIEEARFF------HRRRHGSIRVSQYSRSRIREHRRA  370

Query  567  V------SQPSFCPSGLHPDGtcscesfftseefsTLASISRIIMLAEALFEVIDEIHRQ  406
            V           CP G+H  G C+C+SF  +EE S  ASISRI+ML EALFEV+DEIHRQ
Sbjct  371  VFDSGTDQSTVACPLGIHQIGRCTCDSFLIAEESSARASISRIVMLTEALFEVLDEIHRQ  430

Query  405  --SFSLSTFSLPAPEATVDAFPLKYHKTLDPVENALGDTQQCYICLAEYEDGDKLRVLPC  232
              S SLS  S  APE+ V++ P K +K          D +QC+ICL EYEDGD++R LPC
Sbjct  431  PASLSLSMVSAQAPESVVNSLPCKSYKK--QTAQCSDDMEQCHICLTEYEDGDQIRSLPC  488

Query  231  HHEYHMICIDKWLKE  187
             HE+H++C+DKWLKE
Sbjct  489  KHEFHLLCVDKWLKE  503



>ref|XP_008681416.1| PREDICTED: LOC100273142 isoform X1 [Zea mays]
Length=502

 Score =   136 bits (342),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 92/195 (47%), Positives = 119/195 (61%), Gaps = 25/195 (13%)
 Frame = -1

Query  747  NADDLGSHDRWLIDLNGDLHYDGVGYGSSYLGETGHHRNERRLPSRSEISERVHRGHRNR  568
            +AD++G    WL DL  D+  +        LGE+      R    R   S R+ R HR  
Sbjct  308  DADEMGFFSTWL-DLGDDIFEE--------LGES------RYFHRRRHGSIRI-REHRRA  351

Query  567  V------SQPSFCPSGLHPDGtcscesfftseefsTLASISRIIMLAEALFEVIDEIHRQ  406
            V         + CP G+H  G C+C SFF +EE S  ASISRI+ML EALFEV+DEIHRQ
Sbjct  352  VFDSGNEQNTAACPLGIHQIGRCTCNSFFIAEESSARASISRIVMLTEALFEVLDEIHRQ  411

Query  405  --SFSLSTFSLPAPEATVDAFPLKYHKTLDPVENALGDTQQCYICLAEYEDGDKLRVLPC  232
              S SLS  S+ APE+ VD+ P K +K L+  + +  D +QC+ICL EYEDGD++R LPC
Sbjct  412  PASLSLSMVSVQAPESVVDSLPCKSYKKLETPQCS-DDMEQCHICLTEYEDGDQIRTLPC  470

Query  231  HHEYHMICIDKWLKE  187
             HE+H+ C+DKWLKE
Sbjct  471  KHEFHLQCVDKWLKE  485



>ref|XP_006648059.1| PREDICTED: uncharacterized protein LOC102702632 isoform X2 [Oryza 
brachyantha]
Length=456

 Score =   135 bits (340),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 89/196 (45%), Positives = 112/196 (57%), Gaps = 17/196 (9%)
 Frame = -1

Query  750  GNADDLGSHDRWLIDLNGDLHYDGVGYGSSYLGETGHHRNERRLPSRSEISERVHRGHRN  571
             + DDLG + RW IDL  +L  D +     +      HR        S+ S    R HR 
Sbjct  253  SDTDDLGFYSRW-IDLGDELFADEIEEARFF------HRRRHGSIRVSQYSRSRIREHRR  305

Query  570  RV------SQPSFCPSGLHPDGtcscesfftseefsTLASISRIIMLAEALFEVIDEIHR  409
             V           CP G+H  G C+C+SF  +EE S  ASISRI+ML EALFEV+DEIHR
Sbjct  306  AVFDSGADQSTVACPLGIHQIGRCTCDSFLIAEESSARASISRIVMLTEALFEVLDEIHR  365

Query  408  Q--SFSLSTFSLPAPEATVDAFPLKYHKTLDPVENALGDTQQCYICLAEYEDGDKLRVLP  235
            Q  S SLS  S  APE+ V++ P K +K          D +QC+ICL EYEDGD++R LP
Sbjct  366  QPASLSLSMVSAQAPESVVNSLPCKSYKK--QTAQCSDDMEQCHICLTEYEDGDQIRSLP  423

Query  234  CHHEYHMICIDKWLKE  187
            C HE+H+ C+DKWLKE
Sbjct  424  CKHEFHLQCVDKWLKE  439



>ref|XP_008245341.1| PREDICTED: protein goliath-like [Prunus mume]
Length=184

 Score =   127 bits (319),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 78/142 (55%), Positives = 99/142 (70%), Gaps = 3/142 (2%)
 Frame = -1

Query  606  EISERVHRGHRNRVSQPSFCPSGLHPDGtcscesfftseefsTLASISRIIMLAEALFEV  427
            E+SER+H G  N     SFC S LH +GTCSCE+   +E  S  A++ RIIML EAL E+
Sbjct  23   ELSERLHGGLVNERGPRSFCSSRLHANGTCSCETSLMAEISSIHATVLRIIMLTEALNEI  82

Query  426  IDEIHR--QSFSLSTFSLPAPEATVDAFPLKYHKTLDPVENALGDTQQCYICLAEYEDGD  253
            +DEI     S S S  SLPAPE  V++FPL+ HK+ +  E+   D Q+CYICL+EY +GD
Sbjct  83   LDEIRHVPLSLSQSVLSLPAPENVVNSFPLRNHKS-EITESKAQDAQECYICLSEYNEGD  141

Query  252  KLRVLPCHHEYHMICIDKWLKE  187
            K+RVLPC HE+HM C+DKWLKE
Sbjct  142  KIRVLPCCHEFHMECVDKWLKE  163



>gb|EMS64581.1| E3 ubiquitin-protein ligase RNF12-B [Triticum urartu]
Length=576

 Score =   133 bits (334),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 93/195 (48%), Positives = 118/195 (61%), Gaps = 16/195 (8%)
 Frame = -1

Query  747  NADDLGSHDRWLIDLNGDLHYDGVGYGSSYLGETGHHRNERRLPSRSEISERVHRGHRNR  568
            + DDLG + RWL DL  DL  D V   + Y     H        SRS I E     HR  
Sbjct  345  DTDDLGFYSRWL-DLGDDLFGDEVEE-ARYFHRRRHGSIRVNQYSRSRIRE-----HRRA  397

Query  567  V------SQPSFCPSGLHPDGtcscesfftseefsTLASISRIIMLAEALFEVIDEIHRQ  406
            +         + CP G+H  G C+C++F  +EE S  ASISRI+ML EALFEV+DEIHRQ
Sbjct  398  IFDSGNGQSTAACPLGIHQIGRCTCDAFLVAEESSARASISRIVMLTEALFEVLDEIHRQ  457

Query  405  --SFSLSTFSLPAPEATVDAFPLKYHKTLDPVENALGDTQQCYICLAEYEDGDKLRVLPC  232
              S SLS  S  APEA V++ P K +K L+  + +  D +QC+ICL EYEDGD++R LPC
Sbjct  458  PSSLSLSMASAQAPEAVVNSLPCKSYKKLETAQCS-ADMEQCHICLTEYEDGDQIRSLPC  516

Query  231  HHEYHMICIDKWLKE  187
             HE+H+ C+DKWLKE
Sbjct  517  KHEFHLQCVDKWLKE  531



>ref|XP_010942170.1| PREDICTED: uncharacterized protein LOC105060248 isoform X2 [Elaeis 
guineensis]
Length=496

 Score =   132 bits (332),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 84/164 (51%), Positives = 107/164 (65%), Gaps = 2/164 (1%)
 Frame = -1

Query  741  DDLGSHDRWLIDLNGDLHYDGVGYGSSYLGETGHHRNERRLPSRSEISERVHRGHRNRVS  562
            DDLGS DRWL+D+  D+  +GV   S Y+    +H +     SRSEI ER+  G  +   
Sbjct  325  DDLGSRDRWLLDIGDDIFGNGVEDDSIYMRRRRYHPSGLSWHSRSEIRERIRAGFDDSNR  384

Query  561  QPSFCPSGLHPDGtcscesfftseefsTLASISRIIMLAEALFEVIDEIHRQ--SFSLST  388
            Q SFCP+GLHPDGTCSC+S   +EE ST ASISRI+MLAEALFEV+DEIHRQ  S SLS 
Sbjct  385  QTSFCPTGLHPDGTCSCDSLLMTEESSTRASISRIVMLAEALFEVLDEIHRQPVSLSLSM  444

Query  387  FSLPAPEATVDAFPLKYHKTLDPVENALGDTQQCYICLAEYEDG  256
             SLPAPE+ V++ P K ++ LD   +     Q C +C  +  +G
Sbjct  445  VSLPAPESVVNSLPSKNYEKLDGAGSGDDVEQVCPLCRGDVCEG  488



>ref|XP_006648058.1| PREDICTED: uncharacterized protein LOC102702632 isoform X1 [Oryza 
brachyantha]
Length=448

 Score =   132 bits (331),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 90/196 (46%), Positives = 113/196 (58%), Gaps = 25/196 (13%)
 Frame = -1

Query  750  GNADDLGSHDRWLIDLNGDLHYDGVGYGSSYLGETGHHRNERRLPSRSEISERVHRGHRN  571
             + DDLG + RW IDL  +L  D +     +      HR       R   S R+ R HR 
Sbjct  253  SDTDDLGFYSRW-IDLGDELFADEIEEARFF------HR-------RRHGSIRI-REHRR  297

Query  570  RV------SQPSFCPSGLHPDGtcscesfftseefsTLASISRIIMLAEALFEVIDEIHR  409
             V           CP G+H  G C+C+SF  +EE S  ASISRI+ML EALFEV+DEIHR
Sbjct  298  AVFDSGADQSTVACPLGIHQIGRCTCDSFLIAEESSARASISRIVMLTEALFEVLDEIHR  357

Query  408  Q--SFSLSTFSLPAPEATVDAFPLKYHKTLDPVENALGDTQQCYICLAEYEDGDKLRVLP  235
            Q  S SLS  S  APE+ V++ P K +K          D +QC+ICL EYEDGD++R LP
Sbjct  358  QPASLSLSMVSAQAPESVVNSLPCKSYKK--QTAQCSDDMEQCHICLTEYEDGDQIRSLP  415

Query  234  CHHEYHMICIDKWLKE  187
            C HE+H+ C+DKWLKE
Sbjct  416  CKHEFHLQCVDKWLKE  431



>ref|XP_004164172.1| PREDICTED: uncharacterized LOC101213468, partial [Cucumis sativus]
Length=532

 Score =   130 bits (327),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 61/102 (60%), Positives = 75/102 (74%), Gaps = 8/102 (8%)
 Frame = -1

Query  474  ASISRIIMLAEALFEVIDEIHRQSFSLSTF------SLPAPEATVDAFPLKYHKTLDPVE  313
            ASISRI+MLAEALFEV+DEIH+QS  LS+       SLPAP   VD+ P+K+H  L   +
Sbjct  409  ASISRIVMLAEALFEVLDEIHQQSVVLSSRPASSIGSLPAPNDVVDSLPVKFHSKLQKHQ  468

Query  312  NALGDTQQCYICLAEYEDGDKLRVLPCHHEYHMICIDKWLKE  187
            +   +  QCYICL EYE+GD +RVLPCHHE+H  C+DKWLKE
Sbjct  469  SE--EAAQCYICLVEYEEGDSMRVLPCHHEFHTTCVDKWLKE  508



>ref|XP_004150547.1| PREDICTED: uncharacterized protein LOC101213468 [Cucumis sativus]
 gb|KGN53461.1| hypothetical protein Csa_4G056520 [Cucumis sativus]
Length=587

 Score =   130 bits (328),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 61/102 (60%), Positives = 75/102 (74%), Gaps = 8/102 (8%)
 Frame = -1

Query  474  ASISRIIMLAEALFEVIDEIHRQSFSLSTF------SLPAPEATVDAFPLKYHKTLDPVE  313
            ASISRI+MLAEALFEV+DEIH+QS  LS+       SLPAP   VD+ P+K+H  L   +
Sbjct  464  ASISRIVMLAEALFEVLDEIHQQSVVLSSRPASSIGSLPAPNDVVDSLPVKFHSKLQKHQ  523

Query  312  NALGDTQQCYICLAEYEDGDKLRVLPCHHEYHMICIDKWLKE  187
            +   +  QCYICL EYE+GD +RVLPCHHE+H  C+DKWLKE
Sbjct  524  SE--EAAQCYICLVEYEEGDSMRVLPCHHEFHTTCVDKWLKE  563



>ref|XP_008681419.1| PREDICTED: LOC100273142 isoform X4 [Zea mays]
Length=474

 Score =   129 bits (324),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 60/98 (61%), Positives = 76/98 (78%), Gaps = 3/98 (3%)
 Frame = -1

Query  474  ASISRIIMLAEALFEVIDEIHRQ--SFSLSTFSLPAPEATVDAFPLKYHKTLDPVENALG  301
            ASISRI+ML EALFEV+DEIHRQ  S SLS  S+ APE+ VD+ P K +K L+  + +  
Sbjct  361  ASISRIVMLTEALFEVLDEIHRQPASLSLSMVSVQAPESVVDSLPCKSYKKLETPQCS-D  419

Query  300  DTQQCYICLAEYEDGDKLRVLPCHHEYHMICIDKWLKE  187
            D +QC+ICL EYEDGD++R LPC HE+H+ C+DKWLKE
Sbjct  420  DMEQCHICLTEYEDGDQIRTLPCKHEFHLQCVDKWLKE  457



>ref|XP_008681418.1| PREDICTED: LOC100273142 isoform X3 [Zea mays]
Length=482

 Score =   129 bits (324),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 60/98 (61%), Positives = 76/98 (78%), Gaps = 3/98 (3%)
 Frame = -1

Query  474  ASISRIIMLAEALFEVIDEIHRQ--SFSLSTFSLPAPEATVDAFPLKYHKTLDPVENALG  301
            ASISRI+ML EALFEV+DEIHRQ  S SLS  S+ APE+ VD+ P K +K L+  + +  
Sbjct  369  ASISRIVMLTEALFEVLDEIHRQPASLSLSMVSVQAPESVVDSLPCKSYKKLETPQCS-D  427

Query  300  DTQQCYICLAEYEDGDKLRVLPCHHEYHMICIDKWLKE  187
            D +QC+ICL EYEDGD++R LPC HE+H+ C+DKWLKE
Sbjct  428  DMEQCHICLTEYEDGDQIRTLPCKHEFHLQCVDKWLKE  465



>ref|XP_007156334.1| hypothetical protein PHAVU_003G2777000g, partial [Phaseolus vulgaris]
 gb|ESW28328.1| hypothetical protein PHAVU_003G2777000g, partial [Phaseolus vulgaris]
Length=514

 Score =   127 bits (320),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 63/103 (61%), Positives = 74/103 (72%), Gaps = 10/103 (10%)
 Frame = -1

Query  474  ASISRIIMLAEALFEVIDEIHRQSFSLS-------TFSLPAPEATVDAFPLKYHKTLDPV  316
            ASISRI+MLAEALFEV+DEIH+QS  LS       T S+PAP   VD+ P+K ++ L   
Sbjct  393  ASISRIVMLAEALFEVLDEIHQQSVVLSSRPSVSSTGSVPAPNDVVDSLPVKLYQKLHKH  452

Query  315  ENALGDTQQCYICLAEYEDGDKLRVLPCHHEYHMICIDKWLKE  187
            +    D  QCYICL EYEDGD +RVLPCHHE+H  CIDKWLKE
Sbjct  453  QE---DGAQCYICLVEYEDGDNMRVLPCHHEFHRTCIDKWLKE  492



>gb|KCW78408.1| hypothetical protein EUGRSUZ_D02574 [Eucalyptus grandis]
Length=507

 Score =   127 bits (320),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 59/103 (57%), Positives = 74/103 (72%), Gaps = 9/103 (9%)
 Frame = -1

Query  474  ASISRIIMLAEALFEVIDEIHRQSFSLSTF-------SLPAPEATVDAFPLKYHKTLDPV  316
            ASISRI+MLAEALFEV+DEIH+QS  LS+        S+PAP   VD+ P + +K L   
Sbjct  378  ASISRIVMLAEALFEVLDEIHQQSVVLSSRPSVSSIGSVPAPNEVVDSLPTRLYKKLQKN  437

Query  315  ENALGDTQQCYICLAEYEDGDKLRVLPCHHEYHMICIDKWLKE  187
            +N   +  QCYICL EYEDGD +R+LPC+HE+H  C+DKWLKE
Sbjct  438  QNE--EAAQCYICLVEYEDGDSMRILPCNHEFHRTCVDKWLKE  478



>ref|XP_008451863.1| PREDICTED: uncharacterized protein LOC103493025 isoform X1 [Cucumis 
melo]
Length=587

 Score =   128 bits (322),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 60/102 (59%), Positives = 75/102 (74%), Gaps = 8/102 (8%)
 Frame = -1

Query  474  ASISRIIMLAEALFEVIDEIHRQSFSLSTF------SLPAPEATVDAFPLKYHKTLDPVE  313
            ASISRI+MLAEALFEV+DEIH+QS  LS+       SLPAP   VD+ P+K++  L   +
Sbjct  464  ASISRIVMLAEALFEVLDEIHQQSVVLSSRPASSIGSLPAPNDVVDSLPVKFYSKLQ--K  521

Query  312  NALGDTQQCYICLAEYEDGDKLRVLPCHHEYHMICIDKWLKE  187
            +   +  QCYICL EYE+GD +RVLPCHHE+H  C+DKWLKE
Sbjct  522  HQTEEAAQCYICLVEYEEGDSMRVLPCHHEFHATCVDKWLKE  563



>ref|XP_010054024.1| PREDICTED: uncharacterized protein LOC104442332 isoform X1 [Eucalyptus 
grandis]
 gb|KCW78407.1| hypothetical protein EUGRSUZ_D02574 [Eucalyptus grandis]
Length=506

 Score =   127 bits (320),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 59/103 (57%), Positives = 74/103 (72%), Gaps = 9/103 (9%)
 Frame = -1

Query  474  ASISRIIMLAEALFEVIDEIHRQSFSLSTF-------SLPAPEATVDAFPLKYHKTLDPV  316
            ASISRI+MLAEALFEV+DEIH+QS  LS+        S+PAP   VD+ P + +K L   
Sbjct  377  ASISRIVMLAEALFEVLDEIHQQSVVLSSRPSVSSIGSVPAPNEVVDSLPTRLYKKLQKN  436

Query  315  ENALGDTQQCYICLAEYEDGDKLRVLPCHHEYHMICIDKWLKE  187
            +N   +  QCYICL EYEDGD +R+LPC+HE+H  C+DKWLKE
Sbjct  437  QNE--EAAQCYICLVEYEDGDSMRILPCNHEFHRTCVDKWLKE  477



>dbj|BAJ97192.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=563

 Score =   127 bits (319),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 58/103 (56%), Positives = 80/103 (78%), Gaps = 9/103 (9%)
 Frame = -1

Query  474  ASISRIIMLAEALFEVIDEIHRQSFSLSTF-------SLPAPEATVDAFPLKYHKTLDPV  316
            ASISRI+MLAEALFEV+DEIH+QS +LS+        S+PAP+  V++ P+K +K   P+
Sbjct  439  ASISRIVMLAEALFEVLDEIHQQSAALSSRPSFPSIGSVPAPKEIVESLPVKVYK--KPL  496

Query  315  ENALGDTQQCYICLAEYEDGDKLRVLPCHHEYHMICIDKWLKE  187
            ++   +T QCYICL EYE+GD +R+LPC+HE+H+ C+DKWLKE
Sbjct  497  KHQTDETAQCYICLVEYEEGDCIRILPCNHEFHLTCVDKWLKE  539



>ref|XP_011027973.1| PREDICTED: uncharacterized protein LOC105128143 [Populus euphratica]
Length=589

 Score =   127 bits (318),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 60/103 (58%), Positives = 74/103 (72%), Gaps = 9/103 (9%)
 Frame = -1

Query  474  ASISRIIMLAEALFEVIDEIHRQSFSLSTF-------SLPAPEATVDAFPLKYHKTLDPV  316
            ASISRI+MLAEALFEV+DEIH+QS  LS+        S+PAP   V++ P+K +      
Sbjct  467  ASISRIVMLAEALFEVLDEIHQQSVVLSSRPSISSLGSVPAPNEIVESLPVKLYAKSQKH  526

Query  315  ENALGDTQQCYICLAEYEDGDKLRVLPCHHEYHMICIDKWLKE  187
            +N   DT QCYICL EYE+GD +RVLPCHHE+H  C+DKWLKE
Sbjct  527  QNE--DTAQCYICLVEYEEGDSMRVLPCHHEFHRTCVDKWLKE  567



>ref|XP_003548587.1| PREDICTED: uncharacterized protein LOC100812272 [Glycine max]
Length=578

 Score =   126 bits (317),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 62/103 (60%), Positives = 73/103 (71%), Gaps = 10/103 (10%)
 Frame = -1

Query  474  ASISRIIMLAEALFEVIDEIHRQSFSLSTF-------SLPAPEATVDAFPLKYHKTLDPV  316
            ASISRI+MLAEALFEV+DEIH QS  LS+        S+PAP   VD+ P+K ++ L   
Sbjct  454  ASISRIVMLAEALFEVLDEIHHQSVVLSSRPSVSSIGSVPAPNDVVDSLPVKLYEKLHKH  513

Query  315  ENALGDTQQCYICLAEYEDGDKLRVLPCHHEYHMICIDKWLKE  187
            +    D  QCYICL EYEDGD +RVLPCHHE+H  CIDKWLKE
Sbjct  514  QE---DAAQCYICLVEYEDGDNMRVLPCHHEFHRTCIDKWLKE  553



>gb|KHN27508.1| E3 ubiquitin-protein ligase RING1-like [Glycine soja]
Length=578

 Score =   126 bits (317),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 62/103 (60%), Positives = 73/103 (71%), Gaps = 10/103 (10%)
 Frame = -1

Query  474  ASISRIIMLAEALFEVIDEIHRQSFSLSTF-------SLPAPEATVDAFPLKYHKTLDPV  316
            ASISRI+MLAEALFEV+DEIH QS  LS+        S+PAP   VD+ P+K ++ L   
Sbjct  454  ASISRIVMLAEALFEVLDEIHHQSVVLSSRPSVSSIGSVPAPNDVVDSLPVKLYEKLHKH  513

Query  315  ENALGDTQQCYICLAEYEDGDKLRVLPCHHEYHMICIDKWLKE  187
            +    D  QCYICL EYEDGD +RVLPCHHE+H  CIDKWLKE
Sbjct  514  QE---DAAQCYICLVEYEDGDNMRVLPCHHEFHRTCIDKWLKE  553



>ref|XP_010231451.1| PREDICTED: uncharacterized protein LOC100838775 [Brachypodium 
distachyon]
Length=525

 Score =   125 bits (315),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 58/103 (56%), Positives = 77/103 (75%), Gaps = 9/103 (9%)
 Frame = -1

Query  474  ASISRIIMLAEALFEVIDEIHRQSFSLSTF-------SLPAPEATVDAFPLKYHKTLDPV  316
            ASISRI+MLAEALFEV+DEIH+QS +LS+        S+PAP+  V+  P+K +K   P+
Sbjct  401  ASISRIVMLAEALFEVLDEIHQQSAALSSRPSFPSIGSVPAPKEIVECLPVKVYK--KPL  458

Query  315  ENALGDTQQCYICLAEYEDGDKLRVLPCHHEYHMICIDKWLKE  187
            +    +  QCYICL EYE+GD +RVLPC+HE+H+ C+DKWLKE
Sbjct  459  KQQADEAAQCYICLVEYEEGDCVRVLPCNHEFHLTCVDKWLKE  501



>ref|XP_010676682.1| PREDICTED: uncharacterized RING finger protein C4G3.12c isoform 
X1 [Beta vulgaris subsp. vulgaris]
Length=576

 Score =   126 bits (316),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 59/103 (57%), Positives = 75/103 (73%), Gaps = 9/103 (9%)
 Frame = -1

Query  474  ASISRIIMLAEALFEVIDEIHRQSFSLSTF-------SLPAPEATVDAFPLKYHKTLDPV  316
            ASISRI+MLAEALFEV+DEIH+QS  LS+        S+PAP   V++ P+K +     +
Sbjct  450  ASISRIVMLAEALFEVLDEIHQQSVVLSSRPSVSSIGSVPAPNEVVESLPVKAYTKSTKL  509

Query  315  ENALGDTQQCYICLAEYEDGDKLRVLPCHHEYHMICIDKWLKE  187
            +N   D  QCYICL EYE+GD++R+LPCHHE+H  CIDKWLKE
Sbjct  510  QNE--DVAQCYICLVEYEEGDEMRILPCHHEFHKKCIDKWLKE  550



>ref|XP_008373442.1| PREDICTED: uncharacterized protein DDB_G0271670 isoform X1 [Malus 
domestica]
Length=584

 Score =   126 bits (316),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 59/103 (57%), Positives = 74/103 (72%), Gaps = 9/103 (9%)
 Frame = -1

Query  474  ASISRIIMLAEALFEVIDEIHRQSFSLSTF-------SLPAPEATVDAFPLKYHKTLDPV  316
            ASISRI+MLAEALFEV+DEIH+QS  LS+        S+PAP   V++ P+K    L   
Sbjct  462  ASISRIVMLAEALFEVLDEIHQQSVVLSSRPSVSSIGSVPAPNEVVESLPVKLFSKLQ--  519

Query  315  ENALGDTQQCYICLAEYEDGDKLRVLPCHHEYHMICIDKWLKE  187
            +N   +  QCYICL EYE+GD++R+LPCHHE+H  CIDKWLKE
Sbjct  520  KNEYEEAAQCYICLVEYEEGDRMRILPCHHEFHKTCIDKWLKE  562



>ref|XP_009365723.1| PREDICTED: uncharacterized protein LOC103955550 isoform X1 [Pyrus 
x bretschneideri]
Length=583

 Score =   125 bits (315),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 59/103 (57%), Positives = 74/103 (72%), Gaps = 9/103 (9%)
 Frame = -1

Query  474  ASISRIIMLAEALFEVIDEIHRQSFSLSTF-------SLPAPEATVDAFPLKYHKTLDPV  316
            ASISRI+MLAEALFEV+DEIH+QS  LS+        S+PAP   V++ P+K    L   
Sbjct  461  ASISRIVMLAEALFEVLDEIHQQSVVLSSRPSVSSIGSVPAPNEVVESLPVKSFSKLQ--  518

Query  315  ENALGDTQQCYICLAEYEDGDKLRVLPCHHEYHMICIDKWLKE  187
            +N   +  QCYICL EYE+GD++R+LPCHHE+H  CIDKWLKE
Sbjct  519  KNEYEEAAQCYICLVEYEEGDRMRILPCHHEFHKTCIDKWLKE  561



>ref|XP_006368244.1| hypothetical protein POPTR_0001s00920g [Populus trichocarpa]
 gb|ERP64813.1| hypothetical protein POPTR_0001s00920g [Populus trichocarpa]
Length=579

 Score =   125 bits (315),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 59/103 (57%), Positives = 74/103 (72%), Gaps = 9/103 (9%)
 Frame = -1

Query  474  ASISRIIMLAEALFEVIDEIHRQSFSLSTF-------SLPAPEATVDAFPLKYHKTLDPV  316
            ASISRI+MLAEALFEV+DEIH+QS  LS+        S+PAP   V++ P+K +      
Sbjct  457  ASISRIVMLAEALFEVLDEIHQQSVVLSSRPSMSSLGSVPAPNEIVESLPVKLYAKAQKH  516

Query  315  ENALGDTQQCYICLAEYEDGDKLRVLPCHHEYHMICIDKWLKE  187
            +N   +T QCYICL EYE+GD +RVLPCHHE+H  C+DKWLKE
Sbjct  517  QNE--ETAQCYICLVEYEEGDSMRVLPCHHEFHRTCVDKWLKE  557



>ref|XP_007158096.1| hypothetical protein PHAVU_002G123800g [Phaseolus vulgaris]
 gb|ESW30090.1| hypothetical protein PHAVU_002G123800g [Phaseolus vulgaris]
Length=567

 Score =   125 bits (314),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 63/108 (58%), Positives = 75/108 (69%), Gaps = 20/108 (19%)
 Frame = -1

Query  474  ASISRIIMLAEALFEVIDEIHRQSFSLSTF-------SLPAPEATVDAFPLKYHKTL---  325
            ASISRI+MLAEALFEV+DEIH+QS  LS+        S+PAP   V++ P+K +K L   
Sbjct  446  ASISRIVMLAEALFEVLDEIHQQSVVLSSRPSVSSIGSVPAPNEVVESLPVKLYKKLHKH  505

Query  324  --DPVENALGDTQQCYICLAEYEDGDKLRVLPCHHEYHMICIDKWLKE  187
              +PV        QCYICL EYEDGD +RVLPCHHE+H  CIDKWLKE
Sbjct  506  QEEPV--------QCYICLVEYEDGDSMRVLPCHHEFHTTCIDKWLKE  545



>ref|XP_011018359.1| PREDICTED: uncharacterized protein LOC105121427 isoform X1 [Populus 
euphratica]
Length=585

 Score =   125 bits (315),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 59/103 (57%), Positives = 74/103 (72%), Gaps = 9/103 (9%)
 Frame = -1

Query  474  ASISRIIMLAEALFEVIDEIHRQSFSLSTF-------SLPAPEATVDAFPLKYHKTLDPV  316
            ASISRI+MLAEALFEV+DEIH+QS  LS+        S+PAP   V++ P+K +      
Sbjct  463  ASISRIVMLAEALFEVLDEIHQQSVVLSSRPSMSSLGSVPAPNEIVESLPVKLYAKAQKH  522

Query  315  ENALGDTQQCYICLAEYEDGDKLRVLPCHHEYHMICIDKWLKE  187
            +N   +T QCYICL EYE+GD +RVLPCHHE+H  C+DKWLKE
Sbjct  523  QNE--ETAQCYICLVEYEEGDSMRVLPCHHEFHRTCVDKWLKE  563



>ref|XP_011018360.1| PREDICTED: uncharacterized protein LOC105121427 isoform X2 [Populus 
euphratica]
Length=580

 Score =   125 bits (314),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 59/103 (57%), Positives = 74/103 (72%), Gaps = 9/103 (9%)
 Frame = -1

Query  474  ASISRIIMLAEALFEVIDEIHRQSFSLSTF-------SLPAPEATVDAFPLKYHKTLDPV  316
            ASISRI+MLAEALFEV+DEIH+QS  LS+        S+PAP   V++ P+K +      
Sbjct  458  ASISRIVMLAEALFEVLDEIHQQSVVLSSRPSMSSLGSVPAPNEIVESLPVKLYAKAQKH  517

Query  315  ENALGDTQQCYICLAEYEDGDKLRVLPCHHEYHMICIDKWLKE  187
            +N   +T QCYICL EYE+GD +RVLPCHHE+H  C+DKWLKE
Sbjct  518  QNE--ETAQCYICLVEYEEGDSMRVLPCHHEFHRTCVDKWLKE  558



>gb|KDP28062.1| hypothetical protein JCGZ_19470 [Jatropha curcas]
Length=590

 Score =   125 bits (314),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 60/103 (58%), Positives = 73/103 (71%), Gaps = 9/103 (9%)
 Frame = -1

Query  474  ASISRIIMLAEALFEVIDEIHRQSFSLSTF-------SLPAPEATVDAFPLKYHKTLDPV  316
            ASISRI+MLAEALFEV+DEIH+QS  LS+        S+PAP   V++ P+K +  L   
Sbjct  468  ASISRIVMLAEALFEVLDEIHQQSVVLSSRPSMSSLGSVPAPNEVVESLPVKSYTKLQKY  527

Query  315  ENALGDTQQCYICLAEYEDGDKLRVLPCHHEYHMICIDKWLKE  187
             N   +  QCYICL EYE+GD +RVLPCHHE+H  CIDKWLKE
Sbjct  528  HNE--EAAQCYICLVEYEEGDSMRVLPCHHEFHTSCIDKWLKE  568



>emb|CAN68374.1| hypothetical protein VITISV_033239 [Vitis vinifera]
Length=306

 Score =   122 bits (307),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 59/103 (57%), Positives = 73/103 (71%), Gaps = 9/103 (9%)
 Frame = -1

Query  474  ASISRIIMLAEALFEVIDEIHRQSFSLSTF-------SLPAPEATVDAFPLKYHKTLDPV  316
            ASISRI+MLAEALFEV+DEIH+QS  LS+        S+PAP   V++ PLK +      
Sbjct  180  ASISRIVMLAEALFEVLDEIHQQSVVLSSRPSVSSIGSVPAPNEVVESLPLKLYDKSQKH  239

Query  315  ENALGDTQQCYICLAEYEDGDKLRVLPCHHEYHMICIDKWLKE  187
            +N   +  QCYICL EYE+GD +RVLPCHHE+H  C+DKWLKE
Sbjct  240  QN--DEAAQCYICLVEYEEGDNMRVLPCHHEFHRTCVDKWLKE  280



>ref|XP_006878661.1| hypothetical protein AMTR_s00011p00266440 [Amborella trichopoda]
 gb|ERM94806.1| hypothetical protein AMTR_s00011p00266440 [Amborella trichopoda]
Length=555

 Score =   125 bits (313),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 60/103 (58%), Positives = 76/103 (74%), Gaps = 9/103 (9%)
 Frame = -1

Query  474  ASISRIIMLAEALFEVIDEIHRQSFSLSTF-------SLPAPEATVDAFPLKYHKTLDPV  316
            ASISRI+MLAEALFEV+DEIH+QS  LS+        S+PAP+  VD  P+K +  L+  
Sbjct  447  ASISRIVMLAEALFEVLDEIHQQSVVLSSRPSVSSLGSVPAPKEVVDCMPIKIYSKLEKH  506

Query  315  ENALGDTQQCYICLAEYEDGDKLRVLPCHHEYHMICIDKWLKE  187
            +N   +T QCYICL EYE+GD LR+LPCHH++H  C+DKWLKE
Sbjct  507  QNE--ETAQCYICLVEYEEGDCLRLLPCHHDFHRSCVDKWLKE  547



>ref|XP_011082154.1| PREDICTED: uncharacterized protein LOC105164987 [Sesamum indicum]
Length=578

 Score =   125 bits (313),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 61/104 (59%), Positives = 74/104 (71%), Gaps = 11/104 (11%)
 Frame = -1

Query  474  ASISRIIMLAEALFEVIDEIHRQSFSLSTF-------SLPAPEATVDAFPLK-YHKTLDP  319
            ASISRI+MLAEALFEV+DEIH+QS  LS+        S+PAP   VD+ PLK + K+   
Sbjct  456  ASISRIVMLAEALFEVLDEIHQQSVVLSSRPSVSSIGSVPAPNEVVDSLPLKIFSKSR--  513

Query  318  VENALGDTQQCYICLAEYEDGDKLRVLPCHHEYHMICIDKWLKE  187
             +    D  QCYICL EY+DGD +R+LPCHHE+H  CIDKWLKE
Sbjct  514  -KKTCDDAAQCYICLVEYDDGDSMRILPCHHEFHRACIDKWLKE  556



>ref|XP_002519918.1| ring finger protein, putative [Ricinus communis]
 gb|EEF42522.1| ring finger protein, putative [Ricinus communis]
Length=427

 Score =   123 bits (308),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 59/103 (57%), Positives = 73/103 (71%), Gaps = 9/103 (9%)
 Frame = -1

Query  474  ASISRIIMLAEALFEVIDEIHRQSFSLSTF-------SLPAPEATVDAFPLKYHKTLDPV  316
            ASISRI++LAEALFEV+DEIH+QS  LS+        S+PAP+  VD   +K +      
Sbjct  324  ASISRIVILAEALFEVLDEIHQQSAVLSSQPSISSLGSIPAPKEVVDRLTVKLYTKSQKH  383

Query  315  ENALGDTQQCYICLAEYEDGDKLRVLPCHHEYHMICIDKWLKE  187
            +N   DT QCYICL EYE+GD +R+LPCHHE+H  CIDKWLKE
Sbjct  384  QNE--DTAQCYICLVEYEEGDSMRILPCHHEFHRTCIDKWLKE  424



>ref|XP_006432887.1| hypothetical protein CICLE_v10000893mg [Citrus clementina]
 ref|XP_006494109.1| PREDICTED: uncharacterized protein LOC102616662 isoform X1 [Citrus 
sinensis]
 gb|ESR46127.1| hypothetical protein CICLE_v10000893mg [Citrus clementina]
Length=514

 Score =   124 bits (310),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 58/103 (56%), Positives = 73/103 (71%), Gaps = 9/103 (9%)
 Frame = -1

Query  474  ASISRIIMLAEALFEVIDEIHRQSFSLSTF-------SLPAPEATVDAFPLKYHKTLDPV  316
            ASISRI+MLAEALFEV+DEIH+QS  LS+        S+PAP   V++ P+K +      
Sbjct  392  ASISRIVMLAEALFEVLDEIHQQSVVLSSRPSMSSIGSIPAPNEVVESLPVKLYTKSQKY  451

Query  315  ENALGDTQQCYICLAEYEDGDKLRVLPCHHEYHMICIDKWLKE  187
            +N   +  QCYICL EYE+GD +RVLPCHHE+H  C+DKWLKE
Sbjct  452  QNE--EVTQCYICLLEYEEGDSVRVLPCHHEFHKTCVDKWLKE  492



>gb|KDO43649.1| hypothetical protein CISIN_1g010258mg [Citrus sinensis]
Length=514

 Score =   123 bits (309),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 58/103 (56%), Positives = 73/103 (71%), Gaps = 9/103 (9%)
 Frame = -1

Query  474  ASISRIIMLAEALFEVIDEIHRQSFSLSTF-------SLPAPEATVDAFPLKYHKTLDPV  316
            ASISRI+MLAEALFEV+DEIH+QS  LS+        S+PAP   V++ P+K +      
Sbjct  392  ASISRIVMLAEALFEVLDEIHQQSVVLSSRPSMSSIGSIPAPNEVVESLPVKLYTKSQKY  451

Query  315  ENALGDTQQCYICLAEYEDGDKLRVLPCHHEYHMICIDKWLKE  187
            +N   +  QCYICL EYE+GD +RVLPCHHE+H  C+DKWLKE
Sbjct  452  QNE--EVAQCYICLLEYEEGDSVRVLPCHHEFHKTCVDKWLKE  492



>emb|CBI29217.3| unnamed protein product [Vitis vinifera]
Length=498

 Score =   123 bits (309),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 59/103 (57%), Positives = 73/103 (71%), Gaps = 9/103 (9%)
 Frame = -1

Query  474  ASISRIIMLAEALFEVIDEIHRQSFSLSTF-------SLPAPEATVDAFPLKYHKTLDPV  316
            ASISRI+MLAEALFEV+DEIH+QS  LS+        S+PAP   V++ PLK +      
Sbjct  376  ASISRIVMLAEALFEVLDEIHQQSVVLSSRPSVSSIGSVPAPNEVVESLPLKLYDKSQKH  435

Query  315  ENALGDTQQCYICLAEYEDGDKLRVLPCHHEYHMICIDKWLKE  187
            +N   +  QCYICL EYE+GD +RVLPCHHE+H  C+DKWLKE
Sbjct  436  QN--DEAAQCYICLVEYEEGDNMRVLPCHHEFHRTCVDKWLKE  476



>ref|XP_006432888.1| hypothetical protein CICLE_v10000893mg [Citrus clementina]
 ref|XP_006494110.1| PREDICTED: uncharacterized protein LOC102616662 isoform X2 [Citrus 
sinensis]
 gb|ESR46128.1| hypothetical protein CICLE_v10000893mg [Citrus clementina]
Length=509

 Score =   123 bits (309),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 58/103 (56%), Positives = 73/103 (71%), Gaps = 9/103 (9%)
 Frame = -1

Query  474  ASISRIIMLAEALFEVIDEIHRQSFSLSTF-------SLPAPEATVDAFPLKYHKTLDPV  316
            ASISRI+MLAEALFEV+DEIH+QS  LS+        S+PAP   V++ P+K +      
Sbjct  387  ASISRIVMLAEALFEVLDEIHQQSVVLSSRPSMSSIGSIPAPNEVVESLPVKLYTKSQKY  446

Query  315  ENALGDTQQCYICLAEYEDGDKLRVLPCHHEYHMICIDKWLKE  187
            +N   +  QCYICL EYE+GD +RVLPCHHE+H  C+DKWLKE
Sbjct  447  QNE--EVTQCYICLLEYEEGDSVRVLPCHHEFHKTCVDKWLKE  487



>gb|KDO43648.1| hypothetical protein CISIN_1g010258mg [Citrus sinensis]
Length=509

 Score =   123 bits (309),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 58/103 (56%), Positives = 73/103 (71%), Gaps = 9/103 (9%)
 Frame = -1

Query  474  ASISRIIMLAEALFEVIDEIHRQSFSLSTF-------SLPAPEATVDAFPLKYHKTLDPV  316
            ASISRI+MLAEALFEV+DEIH+QS  LS+        S+PAP   V++ P+K +      
Sbjct  387  ASISRIVMLAEALFEVLDEIHQQSVVLSSRPSMSSIGSIPAPNEVVESLPVKLYTKSQKY  446

Query  315  ENALGDTQQCYICLAEYEDGDKLRVLPCHHEYHMICIDKWLKE  187
            +N   +  QCYICL EYE+GD +RVLPCHHE+H  C+DKWLKE
Sbjct  447  QNE--EVAQCYICLLEYEEGDSVRVLPCHHEFHKTCVDKWLKE  487



>ref|XP_010644636.1| PREDICTED: E3 ubiquitin-protein ligase RLIM isoform X2 [Vitis 
vinifera]
Length=561

 Score =   124 bits (310),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 59/103 (57%), Positives = 73/103 (71%), Gaps = 9/103 (9%)
 Frame = -1

Query  474  ASISRIIMLAEALFEVIDEIHRQSFSLSTF-------SLPAPEATVDAFPLKYHKTLDPV  316
            ASISRI+MLAEALFEV+DEIH+QS  LS+        S+PAP   V++ PLK +      
Sbjct  439  ASISRIVMLAEALFEVLDEIHQQSVVLSSRPSVSSIGSVPAPNEVVESLPLKLYDKSQKH  498

Query  315  ENALGDTQQCYICLAEYEDGDKLRVLPCHHEYHMICIDKWLKE  187
            +N   +  QCYICL EYE+GD +RVLPCHHE+H  C+DKWLKE
Sbjct  499  QN--DEAAQCYICLVEYEEGDNMRVLPCHHEFHRTCVDKWLKE  539



>ref|XP_002270708.1| PREDICTED: uncharacterized protein LOC100249371 isoform X1 [Vitis 
vinifera]
 ref|XP_010644631.1| PREDICTED: uncharacterized protein LOC100249371 isoform X1 [Vitis 
vinifera]
Length=566

 Score =   124 bits (310),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 59/103 (57%), Positives = 73/103 (71%), Gaps = 9/103 (9%)
 Frame = -1

Query  474  ASISRIIMLAEALFEVIDEIHRQSFSLSTF-------SLPAPEATVDAFPLKYHKTLDPV  316
            ASISRI+MLAEALFEV+DEIH+QS  LS+        S+PAP   V++ PLK +      
Sbjct  444  ASISRIVMLAEALFEVLDEIHQQSVVLSSRPSVSSIGSVPAPNEVVESLPLKLYDKSQKH  503

Query  315  ENALGDTQQCYICLAEYEDGDKLRVLPCHHEYHMICIDKWLKE  187
            +N   +  QCYICL EYE+GD +RVLPCHHE+H  C+DKWLKE
Sbjct  504  QN--DEAAQCYICLVEYEEGDNMRVLPCHHEFHRTCVDKWLKE  544



>ref|XP_009382631.1| PREDICTED: uncharacterized RING finger protein C4G3.12c-like 
[Musa acuminata subsp. malaccensis]
Length=523

 Score =   123 bits (308),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 58/103 (56%), Positives = 75/103 (73%), Gaps = 9/103 (9%)
 Frame = -1

Query  474  ASISRIIMLAEALFEVIDEIHRQSFSLSTF-------SLPAPEATVDAFPLKYHKTLDPV  316
            ASISRI+MLAEALFEV+DEIH+QS  LS+        S+PAP+  V+ FP+K ++     
Sbjct  403  ASISRIVMLAEALFEVLDEIHQQSVVLSSRPSFSSIGSVPAPKEVVECFPVKIYRKPSKT  462

Query  315  ENALGDTQQCYICLAEYEDGDKLRVLPCHHEYHMICIDKWLKE  187
            +N   +  QCYICL EYE+GD +R+LPC+HE+H  CIDKWLKE
Sbjct  463  QNE--EVAQCYICLVEYEEGDCMRMLPCNHEFHRTCIDKWLKE  503



>ref|XP_003612544.1| RING finger protein [Medicago truncatula]
 gb|AES95502.1| zinc finger, C3HC4 type (RING finger) protein [Medicago truncatula]
Length=560

 Score =   123 bits (309),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 60/103 (58%), Positives = 73/103 (71%), Gaps = 10/103 (10%)
 Frame = -1

Query  474  ASISRIIMLAEALFEVIDEIHRQSFSLSTF-------SLPAPEATVDAFPLKYHKTLDPV  316
            ASISRI+MLAEALFEV+DEIH+QS  LS+        S+PAP   V++ P+K +  L   
Sbjct  439  ASISRIVMLAEALFEVLDEIHQQSVVLSSRPSVSSIGSVPAPAEVVESLPVKLYTKL---  495

Query  315  ENALGDTQQCYICLAEYEDGDKLRVLPCHHEYHMICIDKWLKE  187
            +    +  QCYICL EYEDGD +RVLPCHHE+H  CIDKWLKE
Sbjct  496  QKHQEEPVQCYICLVEYEDGDSMRVLPCHHEFHTTCIDKWLKE  538



>ref|XP_003516501.1| PREDICTED: uncharacterized protein LOC100815830 isoform X1 [Glycine 
max]
Length=567

 Score =   123 bits (309),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 61/108 (56%), Positives = 74/108 (69%), Gaps = 20/108 (19%)
 Frame = -1

Query  474  ASISRIIMLAEALFEVIDEIHRQSFSLSTF-------SLPAPEATVDAFPLKYHKTL---  325
            ASISRI+MLAEALFEV+DEIH+QS  LS+        S+PAP   V++ P+K +  L   
Sbjct  446  ASISRIVMLAEALFEVLDEIHQQSMVLSSRPSVSSIGSVPAPNEVVESLPVKLYTKLHKH  505

Query  324  --DPVENALGDTQQCYICLAEYEDGDKLRVLPCHHEYHMICIDKWLKE  187
              +PV        QCYICL EYEDGD +RVLPCHHE+H  C+DKWLKE
Sbjct  506  QEEPV--------QCYICLVEYEDGDSMRVLPCHHEFHTTCVDKWLKE  545



>ref|XP_004512347.1| PREDICTED: uncharacterized protein LOC101497151 isoform X1 [Cicer 
arietinum]
Length=562

 Score =   123 bits (309),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 62/104 (60%), Positives = 74/104 (71%), Gaps = 12/104 (12%)
 Frame = -1

Query  474  ASISRIIMLAEALFEVIDEIHRQSFSLSTF-------SLPAPEATVDAFPLK-YHKTLDP  319
            ASISRI+MLAEALFEV+DEIH+QS  LS+        S+PAP   V++ P+K Y K+   
Sbjct  438  ASISRIVMLAEALFEVLDEIHQQSVVLSSRPSVSSIGSVPAPAEVVESLPVKLYTKSHKH  497

Query  318  VENALGDTQQCYICLAEYEDGDKLRVLPCHHEYHMICIDKWLKE  187
             E  +    QCYICL EYEDGD +RVLPCHHE+H  CIDKWLKE
Sbjct  498  QEEPV----QCYICLVEYEDGDSMRVLPCHHEFHTTCIDKWLKE  537



>ref|XP_004509520.1| PREDICTED: uncharacterized protein LOC101492704 isoform X1 [Cicer 
arietinum]
 ref|XP_004509521.1| PREDICTED: uncharacterized protein LOC101492704 isoform X2 [Cicer 
arietinum]
Length=528

 Score =   123 bits (308),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 64/104 (62%), Positives = 73/104 (70%), Gaps = 12/104 (12%)
 Frame = -1

Query  474  ASISRIIMLAEALFEVIDEIHRQSFSL-------STFSLPAPEATVDAFPLK-YHKTLDP  319
            ASISRI++LAEALFEV+DEIH QS  L       S  S+PAP + VD+ PLK Y K L  
Sbjct  407  ASISRIVILAEALFEVLDEIHLQSVVLPSHPSVSSIGSVPAPISVVDSLPLKLYDKLLKD  466

Query  318  VENALGDTQQCYICLAEYEDGDKLRVLPCHHEYHMICIDKWLKE  187
             E    D  +CYICL EYEDGD +RVLPCHHE+H  CIDKWLKE
Sbjct  467  QE----DATECYICLVEYEDGDSVRVLPCHHEFHRTCIDKWLKE  506



>ref|XP_008797986.1| PREDICTED: uncharacterized RING finger protein C4G3.12c isoform 
X2 [Phoenix dactylifera]
Length=498

 Score =   122 bits (307),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 58/103 (56%), Positives = 75/103 (73%), Gaps = 9/103 (9%)
 Frame = -1

Query  474  ASISRIIMLAEALFEVIDEIHRQSFSLSTF-------SLPAPEATVDAFPLKYHKTLDPV  316
            ASISRI+MLAEALFEV+DEIH+QS  LS+        S+PAP+  V+  P+K +  + P 
Sbjct  374  ASISRIVMLAEALFEVLDEIHQQSVVLSSRPSFSSIGSVPAPKEVVECMPIKVY--MKPH  431

Query  315  ENALGDTQQCYICLAEYEDGDKLRVLPCHHEYHMICIDKWLKE  187
            E+ +    QCYICL EYE+GD +R+LPC+HE+H  CIDKWLKE
Sbjct  432  EHQIDGAAQCYICLVEYEEGDCIRILPCNHEFHQTCIDKWLKE  474



>emb|CDP15688.1| unnamed protein product [Coffea canephora]
Length=565

 Score =   123 bits (308),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 60/103 (58%), Positives = 73/103 (71%), Gaps = 9/103 (9%)
 Frame = -1

Query  474  ASISRIIMLAEALFEVIDEIHRQSFSLSTF-------SLPAPEATVDAFPLKYHKTLDPV  316
            ASISRI+MLAEALFEV+DEIH+QS  LS+        S+PAP   VD+ PL+ +  L   
Sbjct  443  ASISRIVMLAEALFEVLDEIHQQSVVLSSRPSMSSLGSVPAPNEVVDSLPLRLYSKLQ--  500

Query  315  ENALGDTQQCYICLAEYEDGDKLRVLPCHHEYHMICIDKWLKE  187
            ++   +  QCYICL EYE+GD +RVLPC HEYH  CIDKWLKE
Sbjct  501  KHLQDEVAQCYICLVEYEEGDSVRVLPCRHEYHKACIDKWLKE  543



>ref|XP_004512348.1| PREDICTED: uncharacterized protein LOC101497151 isoform X2 [Cicer 
arietinum]
Length=559

 Score =   123 bits (308),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 62/104 (60%), Positives = 74/104 (71%), Gaps = 12/104 (12%)
 Frame = -1

Query  474  ASISRIIMLAEALFEVIDEIHRQSFSLSTF-------SLPAPEATVDAFPLK-YHKTLDP  319
            ASISRI+MLAEALFEV+DEIH+QS  LS+        S+PAP   V++ P+K Y K+   
Sbjct  438  ASISRIVMLAEALFEVLDEIHQQSVVLSSRPSVSSIGSVPAPAEVVESLPVKLYTKSHKH  497

Query  318  VENALGDTQQCYICLAEYEDGDKLRVLPCHHEYHMICIDKWLKE  187
             E  +    QCYICL EYEDGD +RVLPCHHE+H  CIDKWLKE
Sbjct  498  QEEPV----QCYICLVEYEDGDSMRVLPCHHEFHTTCIDKWLKE  537



>gb|KHN41757.1| E3 ubiquitin-protein ligase ATL9 [Glycine soja]
Length=582

 Score =   123 bits (308),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 61/108 (56%), Positives = 74/108 (69%), Gaps = 20/108 (19%)
 Frame = -1

Query  474  ASISRIIMLAEALFEVIDEIHRQSFSLSTF-------SLPAPEATVDAFPLKYHKTL---  325
            ASISRI+MLAEALFEV+DEIH+QS  LS+        S+PAP   V++ P+K +  L   
Sbjct  461  ASISRIVMLAEALFEVLDEIHQQSMVLSSRPSVSSIGSVPAPNEVVESLPVKLYTKLHKH  520

Query  324  --DPVENALGDTQQCYICLAEYEDGDKLRVLPCHHEYHMICIDKWLKE  187
              +PV        QCYICL EYEDGD +RVLPCHHE+H  C+DKWLKE
Sbjct  521  QEEPV--------QCYICLVEYEDGDSMRVLPCHHEFHTTCVDKWLKE  560



>ref|XP_003533473.1| PREDICTED: uncharacterized protein LOC100786091 isoform X1 [Glycine 
max]
Length=567

 Score =   123 bits (308),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 61/108 (56%), Positives = 74/108 (69%), Gaps = 20/108 (19%)
 Frame = -1

Query  474  ASISRIIMLAEALFEVIDEIHRQSFSLSTF-------SLPAPEATVDAFPLKYHKTL---  325
            ASISRI+MLAEALFEV+DEIH+QS  LS+        S+PAP   V++ P+K +  L   
Sbjct  446  ASISRIVMLAEALFEVLDEIHQQSVVLSSRPSVSSIGSVPAPNDVVESLPVKLYTKLHKH  505

Query  324  --DPVENALGDTQQCYICLAEYEDGDKLRVLPCHHEYHMICIDKWLKE  187
              +PV        QCYICL EYEDGD +RVLPCHHE+H  C+DKWLKE
Sbjct  506  QEEPV--------QCYICLVEYEDGDSMRVLPCHHEFHTTCVDKWLKE  545



>ref|XP_004301769.1| PREDICTED: uncharacterized protein LOC101314385 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=551

 Score =   122 bits (307),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 57/103 (55%), Positives = 74/103 (72%), Gaps = 9/103 (9%)
 Frame = -1

Query  474  ASISRIIMLAEALFEVIDEIHRQSFSLSTF-------SLPAPEATVDAFPLKYHKTLDPV  316
            ASISRI+MLAEALFEV+DEIH+QS  LS+        S+PAP   V++ P+K    +   
Sbjct  430  ASISRIVMLAEALFEVLDEIHQQSVVLSSRPSVSSIGSVPAPNEVVESLPVKLFSKVQKH  489

Query  315  ENALGDTQQCYICLAEYEDGDKLRVLPCHHEYHMICIDKWLKE  187
            +N   +  QCYICL EYE+GD++R+LPC+HE+H  CIDKWLKE
Sbjct  490  QNE--EAAQCYICLVEYEEGDEMRILPCNHEFHKTCIDKWLKE  530



>gb|KHN11800.1| RING finger protein 44 [Glycine soja]
Length=567

 Score =   122 bits (307),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 61/108 (56%), Positives = 74/108 (69%), Gaps = 20/108 (19%)
 Frame = -1

Query  474  ASISRIIMLAEALFEVIDEIHRQSFSLSTF-------SLPAPEATVDAFPLKYHKTL---  325
            ASISRI+MLAEALFEV+DEIH+QS  LS+        S+PAP   V++ P+K +  L   
Sbjct  446  ASISRIVMLAEALFEVLDEIHQQSVVLSSRPSVSSIGSVPAPNDVVESLPVKLYTKLHKH  505

Query  324  --DPVENALGDTQQCYICLAEYEDGDKLRVLPCHHEYHMICIDKWLKE  187
              +PV        QCYICL EYEDGD +RVLPCHHE+H  C+DKWLKE
Sbjct  506  QEEPV--------QCYICLVEYEDGDSMRVLPCHHEFHTTCVDKWLKE  545



>ref|XP_010266395.1| PREDICTED: uncharacterized RING finger protein C4G3.12c-like 
isoform X3 [Nelumbo nucifera]
Length=443

 Score =   122 bits (305),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 56/103 (54%), Positives = 75/103 (73%), Gaps = 9/103 (9%)
 Frame = -1

Query  474  ASISRIIMLAEALFEVIDEIHRQSFSLSTF-------SLPAPEATVDAFPLKYHKTLDPV  316
            ASISRI+MLAEALFEV+DEIH+QS  LS+        S+PAP+  V++ P+K +  +   
Sbjct  319  ASISRIVMLAEALFEVLDEIHQQSVVLSSRPSVSSIGSVPAPKEVVESIPVKIY--MKSQ  376

Query  315  ENALGDTQQCYICLAEYEDGDKLRVLPCHHEYHMICIDKWLKE  187
            ++   +  QCYICL EYE+GD +R+LPCHHE+H  C+DKWLKE
Sbjct  377  KHMNEEAAQCYICLVEYEEGDSMRILPCHHEFHQTCVDKWLKE  419



>ref|XP_008797985.1| PREDICTED: uncharacterized RING finger protein C4G3.12c isoform 
X1 [Phoenix dactylifera]
Length=541

 Score =   122 bits (307),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 58/103 (56%), Positives = 75/103 (73%), Gaps = 9/103 (9%)
 Frame = -1

Query  474  ASISRIIMLAEALFEVIDEIHRQSFSLSTF-------SLPAPEATVDAFPLKYHKTLDPV  316
            ASISRI+MLAEALFEV+DEIH+QS  LS+        S+PAP+  V+  P+K +  + P 
Sbjct  417  ASISRIVMLAEALFEVLDEIHQQSVVLSSRPSFSSIGSVPAPKEVVECMPIKVY--MKPH  474

Query  315  ENALGDTQQCYICLAEYEDGDKLRVLPCHHEYHMICIDKWLKE  187
            E+ +    QCYICL EYE+GD +R+LPC+HE+H  CIDKWLKE
Sbjct  475  EHQIDGAAQCYICLVEYEEGDCIRILPCNHEFHQTCIDKWLKE  517



>ref|XP_003548701.1| PREDICTED: uncharacterized protein LOC100800896 isoform X1 [Glycine 
max]
 gb|KHN26084.1| E3 ubiquitin-protein ligase RNF13 [Glycine soja]
Length=581

 Score =   123 bits (308),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 60/103 (58%), Positives = 72/103 (70%), Gaps = 10/103 (10%)
 Frame = -1

Query  474  ASISRIIMLAEALFEVIDEIHRQSFSLSTFS-------LPAPEATVDAFPLKYHKTLDPV  316
            A+ISRI+MLAEALFEV+DEIH QS  LS+         +PAP   VD+ P+K ++ L   
Sbjct  457  ANISRIVMLAEALFEVLDEIHLQSVVLSSRPSVSSIGPVPAPNDVVDSLPVKLYEKLHKH  516

Query  315  ENALGDTQQCYICLAEYEDGDKLRVLPCHHEYHMICIDKWLKE  187
            +    D  QCYICL EYEDGD +RVLPCHHE+H  CIDKWLKE
Sbjct  517  QE---DAAQCYICLVEYEDGDNMRVLPCHHEFHRTCIDKWLKE  556



>ref|XP_010275184.1| PREDICTED: uncharacterized protein LOC104610322 isoform X1 [Nelumbo 
nucifera]
Length=571

 Score =   122 bits (307),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 59/104 (57%), Positives = 75/104 (72%), Gaps = 11/104 (11%)
 Frame = -1

Query  474  ASISRIIMLAEALFEVIDEIHRQSFSLSTF-------SLPAPEATVDAFPLK-YHKTLDP  319
            ASISRI+MLAEALFEV+DEIH+QS  LS+        S+PAP+  V++ P+K Y K+   
Sbjct  455  ASISRIVMLAEALFEVLDEIHQQSVVLSSRPSVSSIGSVPAPKEVVESIPVKIYMKSQKH  514

Query  318  VENALGDTQQCYICLAEYEDGDKLRVLPCHHEYHMICIDKWLKE  187
            +     +  QCYICL EYE+GD +R+LPCHHE+H  CIDKWLKE
Sbjct  515  LNE---EAAQCYICLVEYEEGDSMRILPCHHEFHQTCIDKWLKE  555



>ref|XP_006359939.1| PREDICTED: uncharacterized protein DDB_G0271670-like isoform 
X1 [Solanum tuberosum]
Length=578

 Score =   122 bits (306),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 58/103 (56%), Positives = 71/103 (69%), Gaps = 9/103 (9%)
 Frame = -1

Query  474  ASISRIIMLAEALFEVIDEIHRQSFSLSTF-------SLPAPEATVDAFPLKYHKTLDPV  316
            ASISRI+MLAEALFEV+DEIH+QS  LS+        S+PAP   V++ P+K +      
Sbjct  461  ASISRIVMLAEALFEVLDEIHQQSVVLSSQPSVSSIGSVPAPNEVVESLPVKSYNKFRRS  520

Query  315  ENALGDTQQCYICLAEYEDGDKLRVLPCHHEYHMICIDKWLKE  187
             N   +  QCYICL EYE+GD LR LPCHHE+H  C+DKWLKE
Sbjct  521  SN--DEVAQCYICLVEYEEGDMLRTLPCHHEFHRTCVDKWLKE  561



>ref|XP_004246031.1| PREDICTED: uncharacterized protein LOC101258477 isoform X1 [Solanum 
lycopersicum]
Length=573

 Score =   122 bits (305),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 58/103 (56%), Positives = 71/103 (69%), Gaps = 9/103 (9%)
 Frame = -1

Query  474  ASISRIIMLAEALFEVIDEIHRQSFSLSTF-------SLPAPEATVDAFPLKYHKTLDPV  316
            ASISRI+MLAEALFEV+DEIH+QS  LS+        S+PAP   V++ P+K +      
Sbjct  456  ASISRIVMLAEALFEVLDEIHQQSVVLSSQPSVSSIGSVPAPNEVVESLPVKSYNKFRRS  515

Query  315  ENALGDTQQCYICLAEYEDGDKLRVLPCHHEYHMICIDKWLKE  187
             N   +  QCYICL EYE+GD LR LPCHHE+H  C+DKWLKE
Sbjct  516  SN--DEVAQCYICLVEYEEGDMLRTLPCHHEFHRTCVDKWLKE  556



>gb|EYU37447.1| hypothetical protein MIMGU_mgv1a023483mg, partial [Erythranthe 
guttata]
Length=450

 Score =   121 bits (303),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 62/105 (59%), Positives = 69/105 (66%), Gaps = 13/105 (12%)
 Frame = -1

Query  474  ASISRIIMLAEALFEVIDEIHRQSFSL-------STFSLPAPEATVDAFPLKYHKTLD--  322
            ASISRI+MLAEALFEV+DEIH+QS  L       S  S+PAP   VD+ PL         
Sbjct  328  ASISRIVMLAEALFEVLDEIHQQSVVLPSRPSVSSIGSVPAPSEVVDSLPLIIFSNFKRK  387

Query  321  PVENALGDTQQCYICLAEYEDGDKLRVLPCHHEYHMICIDKWLKE  187
            P E    D  QCYICL EYEDGD +R LPCHHE+H  CIDKWLKE
Sbjct  388  PCE----DAAQCYICLVEYEDGDSMRSLPCHHEFHRACIDKWLKE  428



>ref|XP_009413209.1| PREDICTED: uncharacterized protein LOC103994565 [Musa acuminata 
subsp. malaccensis]
Length=532

 Score =   121 bits (304),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 57/103 (55%), Positives = 74/103 (72%), Gaps = 9/103 (9%)
 Frame = -1

Query  474  ASISRIIMLAEALFEVIDEIHRQSFSLSTF-------SLPAPEATVDAFPLKYHKTLDPV  316
            ASISRI+MLAEALFEV+DEIH+QS +LS+        S+PAP+  V+  P+K +      
Sbjct  408  ASISRIVMLAEALFEVLDEIHQQSIALSSRPSFSSIGSVPAPKEVVECIPIKIYNKPSKT  467

Query  315  ENALGDTQQCYICLAEYEDGDKLRVLPCHHEYHMICIDKWLKE  187
            +N   +  QCYICL EYE+GD +R+LPC+HE+H  CIDKWLKE
Sbjct  468  QNE--EAAQCYICLVEYEEGDCIRMLPCNHEFHRTCIDKWLKE  508



>ref|XP_010942980.1| PREDICTED: uncharacterized protein LOC105060831 isoform X1 [Elaeis 
guineensis]
Length=537

 Score =   121 bits (304),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 57/103 (55%), Positives = 75/103 (73%), Gaps = 9/103 (9%)
 Frame = -1

Query  474  ASISRIIMLAEALFEVIDEIHRQSFSLSTF-------SLPAPEATVDAFPLKYHKTLDPV  316
            ASISRI+MLAEALFEV+DEIH+QS  LS+        S+PAP+  V+  P+K +  + P 
Sbjct  413  ASISRIVMLAEALFEVLDEIHQQSVVLSSRPSFSSIGSVPAPKEVVECMPIKIY--MKPH  470

Query  315  ENALGDTQQCYICLAEYEDGDKLRVLPCHHEYHMICIDKWLKE  187
            ++   +  QCYICL EYE+GD +R+LPC+HE+H  CIDKWLKE
Sbjct  471  QHQNDEAAQCYICLVEYEEGDCMRILPCNHEFHRTCIDKWLKE  513



>ref|XP_007210254.1| hypothetical protein PRUPE_ppa003419mg [Prunus persica]
 gb|EMJ11453.1| hypothetical protein PRUPE_ppa003419mg [Prunus persica]
Length=576

 Score =   122 bits (305),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 59/103 (57%), Positives = 73/103 (71%), Gaps = 9/103 (9%)
 Frame = -1

Query  474  ASISRIIMLAEALFEVIDEIHRQSFSLSTF-------SLPAPEATVDAFPLKYHKTLDPV  316
            ASISRI+MLAEALFEV+DEIH+QS  LS+        S+PAP   V++ P+K    L   
Sbjct  454  ASISRIVMLAEALFEVLDEIHQQSVVLSSRPSVSSIGSVPAPTEVVESLPVKLFSKLQ--  511

Query  315  ENALGDTQQCYICLAEYEDGDKLRVLPCHHEYHMICIDKWLKE  187
            ++   +  QCYICL EYE+GD +RVLPCHHE+H  CIDKWLKE
Sbjct  512  KHQYEEAAQCYICLVEYEEGDIMRVLPCHHEFHKTCIDKWLKE  554



>ref|XP_010266389.1| PREDICTED: uncharacterized protein LOC104603919 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010266390.1| PREDICTED: uncharacterized protein LOC104603919 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010266392.1| PREDICTED: uncharacterized protein LOC104603919 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010266393.1| PREDICTED: uncharacterized protein LOC104603919 isoform X1 [Nelumbo 
nucifera]
Length=586

 Score =   122 bits (306),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 56/103 (54%), Positives = 75/103 (73%), Gaps = 9/103 (9%)
 Frame = -1

Query  474  ASISRIIMLAEALFEVIDEIHRQSFSLSTF-------SLPAPEATVDAFPLKYHKTLDPV  316
            ASISRI+MLAEALFEV+DEIH+QS  LS+        S+PAP+  V++ P+K +  +   
Sbjct  462  ASISRIVMLAEALFEVLDEIHQQSVVLSSRPSVSSIGSVPAPKEVVESIPVKIY--MKSQ  519

Query  315  ENALGDTQQCYICLAEYEDGDKLRVLPCHHEYHMICIDKWLKE  187
            ++   +  QCYICL EYE+GD +R+LPCHHE+H  C+DKWLKE
Sbjct  520  KHMNEEAAQCYICLVEYEEGDSMRILPCHHEFHQTCVDKWLKE  562



>ref|XP_008238020.1| PREDICTED: uncharacterized protein LOC103336702 [Prunus mume]
Length=576

 Score =   122 bits (305),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 59/103 (57%), Positives = 73/103 (71%), Gaps = 9/103 (9%)
 Frame = -1

Query  474  ASISRIIMLAEALFEVIDEIHRQSFSLSTF-------SLPAPEATVDAFPLKYHKTLDPV  316
            ASISRI+MLAEALFEV+DEIH+QS  LS+        S+PAP   V++ P+K    L   
Sbjct  454  ASISRIVMLAEALFEVLDEIHQQSVVLSSRPSVSSIGSVPAPTEVVESLPVKLFSKLQ--  511

Query  315  ENALGDTQQCYICLAEYEDGDKLRVLPCHHEYHMICIDKWLKE  187
            ++   +  QCYICL EYE+GD +RVLPCHHE+H  CIDKWLKE
Sbjct  512  KHQYEEAAQCYICLVEYEEGDIMRVLPCHHEFHKTCIDKWLKE  554



>gb|KFK31579.1| hypothetical protein AALP_AA6G130400 [Arabis alpina]
Length=532

 Score =   121 bits (304),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 60/104 (58%), Positives = 73/104 (70%), Gaps = 13/104 (13%)
 Frame = -1

Query  474  ASISRIIMLAEALFEVIDEIHRQSFSLSTF--------SLPAPEATVDAFPLKYHKTLDP  319
            ASISRI++LAEALFEV+DEIH+QS  LS+         S+PAP   VD  P+K + T  P
Sbjct  412  ASISRIVLLAEALFEVLDEIHQQSVVLSSQQPSVSSIGSVPAPNDVVDLLPIKLY-TKSP  470

Query  318  VENALGDTQQCYICLAEYEDGDKLRVLPCHHEYHMICIDKWLKE  187
             E    D+ QCYICL EYE+GD +R LPCHHE+H  C+DKWLKE
Sbjct  471  SE----DSSQCYICLVEYEEGDTIRTLPCHHEFHRTCVDKWLKE  510



>ref|XP_010942981.1| PREDICTED: uncharacterized protein LOC105060831 isoform X2 [Elaeis 
guineensis]
Length=536

 Score =   121 bits (304),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 57/103 (55%), Positives = 75/103 (73%), Gaps = 9/103 (9%)
 Frame = -1

Query  474  ASISRIIMLAEALFEVIDEIHRQSFSLSTF-------SLPAPEATVDAFPLKYHKTLDPV  316
            ASISRI+MLAEALFEV+DEIH+QS  LS+        S+PAP+  V+  P+K +  + P 
Sbjct  412  ASISRIVMLAEALFEVLDEIHQQSVVLSSRPSFSSIGSVPAPKEVVECMPIKIY--MKPH  469

Query  315  ENALGDTQQCYICLAEYEDGDKLRVLPCHHEYHMICIDKWLKE  187
            ++   +  QCYICL EYE+GD +R+LPC+HE+H  CIDKWLKE
Sbjct  470  QHQNDEAAQCYICLVEYEEGDCMRILPCNHEFHRTCIDKWLKE  512



>gb|EMT17820.1| RING finger protein 13 [Aegilops tauschii]
Length=598

 Score =   122 bits (305),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 70/123 (57%), Positives = 91/123 (74%), Gaps = 3/123 (2%)
 Frame = -1

Query  549  CPSGLHPDGtcscesfftseefsTLASISRIIMLAEALFEVIDEIHRQ--SFSLSTFSLP  376
            CP G+H  G C+C++F  +EE S  ASISRI+ML EALFEV+DEIHRQ  S SLS  S  
Sbjct  458  CPLGIHQIGRCTCDAFLVAEESSARASISRIVMLTEALFEVLDEIHRQPSSLSLSMASAQ  517

Query  375  APEATVDAFPLKYHKTLDPVENALGDTQQCYICLAEYEDGDKLRVLPCHHEYHMICIDKW  196
            APE+ V++ P K +K L+  + +  D +QC+ICL EYEDGD++R LPC HE+H+ C+DKW
Sbjct  518  APESVVNSLPCKSYKKLETAQCS-ADMEQCHICLTEYEDGDQIRSLPCKHEFHLQCVDKW  576

Query  195  LKE  187
            LKE
Sbjct  577  LKE  579



>ref|XP_002304401.2| hypothetical protein POPTR_0003s10580g [Populus trichocarpa]
 gb|EEE79380.2| hypothetical protein POPTR_0003s10580g [Populus trichocarpa]
Length=588

 Score =   121 bits (304),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 59/103 (57%), Positives = 72/103 (70%), Gaps = 9/103 (9%)
 Frame = -1

Query  474  ASISRIIMLAEALFEVIDEIHRQSF-------SLSTFSLPAPEATVDAFPLKYHKTLDPV  316
            ASISRI+MLAEALFEV+DEIH+QS          S  S+PAP   V++ P+K +      
Sbjct  466  ASISRIVMLAEALFEVLDEIHQQSVVLSSLPSMSSLGSVPAPNEIVESLPVKLYAKSQKH  525

Query  315  ENALGDTQQCYICLAEYEDGDKLRVLPCHHEYHMICIDKWLKE  187
            +N   DT QCYICL EYE+GD +RVLPCHHE+H  C+DKWLKE
Sbjct  526  QNE--DTAQCYICLVEYEEGDSMRVLPCHHEFHRTCVDKWLKE  566



>ref|XP_007040898.1| RING/U-box superfamily protein, putative [Theobroma cacao]
 gb|EOY25399.1| RING/U-box superfamily protein, putative [Theobroma cacao]
Length=526

 Score =   120 bits (302),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 57/103 (55%), Positives = 74/103 (72%), Gaps = 9/103 (9%)
 Frame = -1

Query  474  ASISRIIMLAEALFEVIDEIHRQSFSLSTF-------SLPAPEATVDAFPLKYHKTLDPV  316
            ASISRI+MLAEALFEV+DEIH+QS  LS+        S+PAP   V++ P+K +     +
Sbjct  404  ASISRIVMLAEALFEVLDEIHQQSVVLSSRPSVSSIGSVPAPNEVVESLPVKVYTKSHKL  463

Query  315  ENALGDTQQCYICLAEYEDGDKLRVLPCHHEYHMICIDKWLKE  187
            +N   +  QCYICL EYE+GD +R+LPC+HE+H  CIDKWLKE
Sbjct  464  QN--DEAAQCYICLVEYEEGDSMRILPCNHEFHRACIDKWLKE  504



>ref|XP_008656336.1| PREDICTED: E3 ubiquitin-protein ligase RLIM [Zea mays]
 gb|ACF78494.1| unknown [Zea mays]
 gb|ACF85565.1| unknown [Zea mays]
 gb|ACL53058.1| unknown [Zea mays]
 gb|AFW82141.1| putative RING zinc finger domain superfamily protein [Zea mays]
Length=528

 Score =   120 bits (301),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 58/104 (56%), Positives = 74/104 (71%), Gaps = 10/104 (10%)
 Frame = -1

Query  474  ASISRIIMLAEALFEVIDEIHRQSFSLSTF--------SLPAPEATVDAFPLKYHKTLDP  319
            ASISRI+MLAEALFEV+DEIH QS +LS+         S+PAP   V+  P K ++   P
Sbjct  404  ASISRIVMLAEALFEVLDEIHHQSAALSSSRPAFSSIGSVPAPREIVERLPAKVYRR--P  461

Query  318  VENALGDTQQCYICLAEYEDGDKLRVLPCHHEYHMICIDKWLKE  187
            ++    +  QCYICL EYE+GD LR+LPCHHE+H+ C+DKWLKE
Sbjct  462  LKYHSEEAAQCYICLVEYEEGDCLRILPCHHEFHLTCVDKWLKE  505



>ref|XP_004962197.1| PREDICTED: E3 ubiquitin-protein ligase RLIM-like [Setaria italica]
Length=536

 Score =   120 bits (301),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 56/104 (54%), Positives = 77/104 (74%), Gaps = 10/104 (10%)
 Frame = -1

Query  474  ASISRIIMLAEALFEVIDEIHRQSFSLSTF--------SLPAPEATVDAFPLKYHKTLDP  319
            ASISRI+MLAEALFEV+DEIH+QS +LS+         S+PAP   V+  P+K ++   P
Sbjct  411  ASISRIVMLAEALFEVLDEIHQQSAALSSSRPSFSSIGSVPAPREIVECLPVKVYR--KP  468

Query  318  VENALGDTQQCYICLAEYEDGDKLRVLPCHHEYHMICIDKWLKE  187
            +++   +  QCYICL EYE+GD +R+LPC+HE+H+ C+DKWLKE
Sbjct  469  LKHRTEEAAQCYICLVEYEEGDCVRILPCNHEFHLTCVDKWLKE  512



>ref|XP_009610445.1| PREDICTED: uncharacterized protein LOC104104147 isoform X1 [Nicotiana 
tomentosiformis]
Length=583

 Score =   121 bits (303),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 58/103 (56%), Positives = 71/103 (69%), Gaps = 9/103 (9%)
 Frame = -1

Query  474  ASISRIIMLAEALFEVIDEIHRQSFSLSTF-------SLPAPEATVDAFPLKYHKTLDPV  316
            ASISRI+MLAEALFEV+DEIH+QS  LS+        S+PAP   V++ P+K +      
Sbjct  461  ASISRIVMLAEALFEVLDEIHQQSVVLSSQPSVSSIGSVPAPNEVVESLPVKSYNKFRRS  520

Query  315  ENALGDTQQCYICLAEYEDGDKLRVLPCHHEYHMICIDKWLKE  187
             N   +  QCYICL EYE+GD LR LPCHHE+H  C+DKWLKE
Sbjct  521  SN--DEVAQCYICLVEYEEGDILRTLPCHHEFHRTCVDKWLKE  561



>ref|XP_009761903.1| PREDICTED: uncharacterized protein LOC104214009 isoform X1 [Nicotiana 
sylvestris]
Length=581

 Score =   120 bits (302),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 58/103 (56%), Positives = 71/103 (69%), Gaps = 9/103 (9%)
 Frame = -1

Query  474  ASISRIIMLAEALFEVIDEIHRQSFSLSTF-------SLPAPEATVDAFPLKYHKTLDPV  316
            ASISRI+MLAEALFEV+DEIH+QS  LS+        S+PAP   V++ P+K +      
Sbjct  459  ASISRIVMLAEALFEVLDEIHQQSVVLSSQPFVSSIGSVPAPNEVVESLPVKSYNKFHRS  518

Query  315  ENALGDTQQCYICLAEYEDGDKLRVLPCHHEYHMICIDKWLKE  187
             N   +  QCYICL EYE+GD LR LPCHHE+H  C+DKWLKE
Sbjct  519  SN--DEVAQCYICLVEYEEGDILRTLPCHHEFHRTCVDKWLKE  559



>emb|CDY66374.1| BnaCnng50560D [Brassica napus]
Length=512

 Score =   119 bits (299),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 57/104 (55%), Positives = 72/104 (69%), Gaps = 13/104 (13%)
 Frame = -1

Query  474  ASISRIIMLAEALFEVIDEIHRQSFSLSTF--------SLPAPEATVDAFPLKYHKTLDP  319
            ASISRI++LAEALFEV+DEIH+QS  LS+         S+PAP   VD  P+K +     
Sbjct  392  ASISRIVLLAEALFEVLDEIHQQSVVLSSQQPSVSSIGSVPAPNDVVDLLPIKQY-----  446

Query  318  VENALGDTQQCYICLAEYEDGDKLRVLPCHHEYHMICIDKWLKE  187
             ++   D+ QCYICL EYE+GD +R LPCHHE+H  C+DKWLKE
Sbjct  447  TKSQSEDSSQCYICLVEYEEGDTIRALPCHHEFHRTCVDKWLKE  490



>ref|XP_002439736.1| hypothetical protein SORBIDRAFT_09g019240 [Sorghum bicolor]
 gb|EES18166.1| hypothetical protein SORBIDRAFT_09g019240 [Sorghum bicolor]
Length=535

 Score =   120 bits (300),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 58/104 (56%), Positives = 74/104 (71%), Gaps = 10/104 (10%)
 Frame = -1

Query  474  ASISRIIMLAEALFEVIDEIHRQSFSLSTF--------SLPAPEATVDAFPLKYHKTLDP  319
            ASISRI+MLAEALFEV+DEIH QS +LS+         S+PAP   V+  P K ++   P
Sbjct  411  ASISRIVMLAEALFEVLDEIHHQSAALSSSRPSFSSIGSVPAPREIVERLPAKVYRK--P  468

Query  318  VENALGDTQQCYICLAEYEDGDKLRVLPCHHEYHMICIDKWLKE  187
            ++    +  QCYICL EYE+GD LR+LPCHHE+H+ C+DKWLKE
Sbjct  469  LKYQSDEAAQCYICLVEYEEGDCLRILPCHHEFHLTCVDKWLKE  512



>ref|XP_006398197.1| hypothetical protein EUTSA_v10000852mg [Eutrema salsugineum]
 gb|ESQ39650.1| hypothetical protein EUTSA_v10000852mg [Eutrema salsugineum]
Length=535

 Score =   119 bits (299),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 57/104 (55%), Positives = 72/104 (69%), Gaps = 13/104 (13%)
 Frame = -1

Query  474  ASISRIIMLAEALFEVIDEIHRQSFSLSTF--------SLPAPEATVDAFPLKYHKTLDP  319
            ASISRI++LAEALFEV+DEIH+QS  LS+         S+PAP   VD  P+K +     
Sbjct  415  ASISRIVLLAEALFEVLDEIHQQSVVLSSQQPSVSSIGSVPAPNDVVDLLPVKKY-----  469

Query  318  VENALGDTQQCYICLAEYEDGDKLRVLPCHHEYHMICIDKWLKE  187
             ++   D+ QCYICL EYE+GD +R LPCHHE+H  C+DKWLKE
Sbjct  470  TKSQSDDSSQCYICLVEYEEGDTIRTLPCHHEFHRTCVDKWLKE  513



>ref|XP_009101610.1| PREDICTED: uncharacterized protein LOC103827808 [Brassica rapa]
 ref|XP_009101611.1| PREDICTED: uncharacterized protein LOC103827808 [Brassica rapa]
 ref|XP_009101612.1| PREDICTED: uncharacterized protein LOC103827808 [Brassica rapa]
Length=488

 Score =   119 bits (298),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 57/104 (55%), Positives = 72/104 (69%), Gaps = 13/104 (13%)
 Frame = -1

Query  474  ASISRIIMLAEALFEVIDEIHRQSFSLSTF--------SLPAPEATVDAFPLKYHKTLDP  319
            ASISRI++LAEALFEV+DEIH+QS  LS+         S+PAP   VD  P+K +     
Sbjct  368  ASISRIVLLAEALFEVLDEIHQQSVVLSSQQPSVSSIGSVPAPNDVVDLLPIKQY-----  422

Query  318  VENALGDTQQCYICLAEYEDGDKLRVLPCHHEYHMICIDKWLKE  187
             ++   D+ QCYICL EYE+GD +R LPCHHE+H  C+DKWLKE
Sbjct  423  TKSQSEDSSQCYICLVEYEEGDTIRTLPCHHEFHRTCVDKWLKE  466



>ref|XP_006398196.1| hypothetical protein EUTSA_v10000852mg [Eutrema salsugineum]
 gb|ESQ39649.1| hypothetical protein EUTSA_v10000852mg [Eutrema salsugineum]
Length=533

 Score =   119 bits (299),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 57/104 (55%), Positives = 72/104 (69%), Gaps = 13/104 (13%)
 Frame = -1

Query  474  ASISRIIMLAEALFEVIDEIHRQSFSLSTF--------SLPAPEATVDAFPLKYHKTLDP  319
            ASISRI++LAEALFEV+DEIH+QS  LS+         S+PAP   VD  P+K +     
Sbjct  413  ASISRIVLLAEALFEVLDEIHQQSVVLSSQQPSVSSIGSVPAPNDVVDLLPVKKY-----  467

Query  318  VENALGDTQQCYICLAEYEDGDKLRVLPCHHEYHMICIDKWLKE  187
             ++   D+ QCYICL EYE+GD +R LPCHHE+H  C+DKWLKE
Sbjct  468  TKSQSDDSSQCYICLVEYEEGDTIRTLPCHHEFHRTCVDKWLKE  511



>emb|CDY39419.1| BnaAnng05500D [Brassica napus]
Length=488

 Score =   119 bits (298),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 57/104 (55%), Positives = 72/104 (69%), Gaps = 13/104 (13%)
 Frame = -1

Query  474  ASISRIIMLAEALFEVIDEIHRQSFSLSTF--------SLPAPEATVDAFPLKYHKTLDP  319
            ASISRI++LAEALFEV+DEIH+QS  LS+         S+PAP   VD  P+K +     
Sbjct  368  ASISRIVLLAEALFEVLDEIHQQSVVLSSQQPSVSSIGSVPAPNDVVDLLPIKQY-----  422

Query  318  VENALGDTQQCYICLAEYEDGDKLRVLPCHHEYHMICIDKWLKE  187
             ++   D+ QCYICL EYE+GD +R LPCHHE+H  C+DKWLKE
Sbjct  423  TKSQSEDSSQCYICLVEYEEGDTIRTLPCHHEFHRTCVDKWLKE  466



>ref|XP_008649595.1| PREDICTED: uncharacterized protein DDB_G0271670-like [Zea mays]
 gb|AFW77876.1| putative RING zinc finger domain superfamily protein [Zea mays]
Length=527

 Score =   119 bits (298),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 58/104 (56%), Positives = 74/104 (71%), Gaps = 10/104 (10%)
 Frame = -1

Query  474  ASISRIIMLAEALFEVIDEIHRQSFSLSTF--------SLPAPEATVDAFPLKYHKTLDP  319
            ASISRI+MLAEALFEV+DEIH QS +LS+         S+PAP   V+  P K ++   P
Sbjct  403  ASISRIVMLAEALFEVLDEIHHQSAALSSSRPSFSSIGSVPAPREIVERLPSKVYR--KP  460

Query  318  VENALGDTQQCYICLAEYEDGDKLRVLPCHHEYHMICIDKWLKE  187
            ++    +  QCYICL EYE+GD LR+LPCHHE+H+ C+DKWLKE
Sbjct  461  LKYQSEEAAQCYICLVEYEEGDCLRILPCHHEFHLTCVDKWLKE  504



>gb|EEE63593.1| hypothetical protein OsJ_18410 [Oryza sativa Japonica Group]
Length=521

 Score =   118 bits (296),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 56/104 (54%), Positives = 77/104 (74%), Gaps = 11/104 (11%)
 Frame = -1

Query  474  ASISRIIMLAEALFEVIDEIHRQSFSLSTF-------SLPAPEATVDAFPLK-YHKTLDP  319
            ASISRI+MLAEALFEV+DEIH+QS +LS+        S+PAP+  V+  P+K Y ++L  
Sbjct  397  ASISRIVMLAEALFEVLDEIHQQSAALSSRPSFSSIGSVPAPKEVVERLPVKVYRRSL--  454

Query  318  VENALGDTQQCYICLAEYEDGDKLRVLPCHHEYHMICIDKWLKE  187
             ++   +  QCYICL EY +GD +R+LPC+HE+H+ C+DKWLKE
Sbjct  455  -KHQTEEAAQCYICLVEYAEGDCVRILPCNHEFHLTCVDKWLKE  497



>gb|EAY97905.1| hypothetical protein OsI_19822 [Oryza sativa Indica Group]
Length=521

 Score =   118 bits (296),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 56/104 (54%), Positives = 77/104 (74%), Gaps = 11/104 (11%)
 Frame = -1

Query  474  ASISRIIMLAEALFEVIDEIHRQSFSLSTF-------SLPAPEATVDAFPLK-YHKTLDP  319
            ASISRI+MLAEALFEV+DEIH+QS +LS+        S+PAP+  V+  P+K Y ++L  
Sbjct  397  ASISRIVMLAEALFEVLDEIHQQSAALSSRPSFSSIGSVPAPKEVVERLPVKVYRRSL--  454

Query  318  VENALGDTQQCYICLAEYEDGDKLRVLPCHHEYHMICIDKWLKE  187
             ++   +  QCYICL EY +GD +R+LPC+HE+H+ C+DKWLKE
Sbjct  455  -KHQTEEAAQCYICLVEYAEGDCVRILPCNHEFHLTCVDKWLKE  497



>ref|XP_006654355.1| PREDICTED: uncharacterized protein LOC102715390 [Oryza brachyantha]
Length=527

 Score =   118 bits (296),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 56/104 (54%), Positives = 77/104 (74%), Gaps = 11/104 (11%)
 Frame = -1

Query  474  ASISRIIMLAEALFEVIDEIHRQSFSLSTF-------SLPAPEATVDAFPLK-YHKTLDP  319
            ASISRI+MLAEALFEV+DEIH+QS +LS+        S+PAP+  V+  P+K Y ++L  
Sbjct  403  ASISRIVMLAEALFEVLDEIHQQSAALSSRPSFSSIGSVPAPKEVVERLPVKVYRRSL--  460

Query  318  VENALGDTQQCYICLAEYEDGDKLRVLPCHHEYHMICIDKWLKE  187
             ++   +  QCYICL EY +GD +R+LPC+HE+H+ C+DKWLKE
Sbjct  461  -KHQTEEAAQCYICLVEYAEGDCVRILPCNHEFHLTCVDKWLKE  503



>ref|NP_001055435.1| Os05g0389600 [Oryza sativa Japonica Group]
 gb|AAT47441.1| unknown protein, contains zinc finger domain, PF00097 [Oryza 
sativa Japonica Group]
 dbj|BAF17349.1| Os05g0389600 [Oryza sativa Japonica Group]
 dbj|BAG95105.1| unnamed protein product [Oryza sativa Japonica Group]
Length=549

 Score =   118 bits (296),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 56/104 (54%), Positives = 77/104 (74%), Gaps = 11/104 (11%)
 Frame = -1

Query  474  ASISRIIMLAEALFEVIDEIHRQSFSLSTF-------SLPAPEATVDAFPLK-YHKTLDP  319
            ASISRI+MLAEALFEV+DEIH+QS +LS+        S+PAP+  V+  P+K Y ++L  
Sbjct  425  ASISRIVMLAEALFEVLDEIHQQSAALSSRPSFSSIGSVPAPKEVVERLPVKVYRRSL--  482

Query  318  VENALGDTQQCYICLAEYEDGDKLRVLPCHHEYHMICIDKWLKE  187
             ++   +  QCYICL EY +GD +R+LPC+HE+H+ C+DKWLKE
Sbjct  483  -KHQTEEAAQCYICLVEYAEGDCVRILPCNHEFHLTCVDKWLKE  525



>ref|XP_010538594.1| PREDICTED: uncharacterized protein LOC104812893 [Tarenaya hassleriana]
Length=575

 Score =   118 bits (295),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 58/103 (56%), Positives = 71/103 (69%), Gaps = 8/103 (8%)
 Frame = -1

Query  474  ASISRIIMLAEALFEVIDEIHRQSFSLST-------FSLPAPEATVDAFPLKYHKTLDPV  316
            ASISR++MLAEALFEV+DEIH+QS  LS+        S+PAP   VD  P+K + T    
Sbjct  450  ASISRLVMLAEALFEVLDEIHQQSVVLSSEPSVSPIGSVPAPNNVVDLLPVKPY-TKSHA  508

Query  315  ENALGDTQQCYICLAEYEDGDKLRVLPCHHEYHMICIDKWLKE  187
            E     + QCYICL EYE+GD +R LPCHHE+H  C+DKWLKE
Sbjct  509  ERNEEASSQCYICLLEYEEGDTIRTLPCHHEFHRTCVDKWLKE  551



>gb|KEH20328.1| zinc finger, C3HC4 type (RING finger) protein [Medicago truncatula]
Length=464

 Score =   117 bits (292),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 56/103 (54%), Positives = 72/103 (70%), Gaps = 10/103 (10%)
 Frame = -1

Query  474  ASISRIIMLAEALFEVIDEIHRQSFSLSTF-------SLPAPEATVDAFPLKYHKTLDPV  316
            ASISR+++LAEALFEV+DEIH+QS  LS+        S+PAP   V++ P+K ++     
Sbjct  340  ASISRVVVLAEALFEVLDEIHQQSVVLSSHPSVSSIGSVPAPINVVESLPVKLYEKFHKH  399

Query  315  ENALGDTQQCYICLAEYEDGDKLRVLPCHHEYHMICIDKWLKE  187
            +    D  QCYICL EY DGD +RVLPC+HE+H  CIDKWLKE
Sbjct  400  QE---DATQCYICLVEYNDGDSVRVLPCNHEFHRTCIDKWLKE  439



>ref|XP_003628997.1| RING finger protein [Medicago truncatula]
Length=503

 Score =   117 bits (293),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 56/103 (54%), Positives = 72/103 (70%), Gaps = 10/103 (10%)
 Frame = -1

Query  474  ASISRIIMLAEALFEVIDEIHRQSFSLSTF-------SLPAPEATVDAFPLKYHKTLDPV  316
            ASISR+++LAEALFEV+DEIH+QS  LS+        S+PAP   V++ P+K ++     
Sbjct  379  ASISRVVVLAEALFEVLDEIHQQSVVLSSHPSVSSIGSVPAPINVVESLPVKLYEKFHKH  438

Query  315  ENALGDTQQCYICLAEYEDGDKLRVLPCHHEYHMICIDKWLKE  187
            +    D  QCYICL EY DGD +RVLPC+HE+H  CIDKWLKE
Sbjct  439  QE---DATQCYICLVEYNDGDSVRVLPCNHEFHRTCIDKWLKE  478



>gb|AET03473.2| zinc finger, C3HC4 type (RING finger) protein [Medicago truncatula]
Length=503

 Score =   117 bits (292),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 56/103 (54%), Positives = 72/103 (70%), Gaps = 10/103 (10%)
 Frame = -1

Query  474  ASISRIIMLAEALFEVIDEIHRQSFSLSTF-------SLPAPEATVDAFPLKYHKTLDPV  316
            ASISR+++LAEALFEV+DEIH+QS  LS+        S+PAP   V++ P+K ++     
Sbjct  379  ASISRVVVLAEALFEVLDEIHQQSVVLSSHPSVSSIGSVPAPINVVESLPVKLYEKFHKH  438

Query  315  ENALGDTQQCYICLAEYEDGDKLRVLPCHHEYHMICIDKWLKE  187
            +    D  QCYICL EY DGD +RVLPC+HE+H  CIDKWLKE
Sbjct  439  QE---DATQCYICLVEYNDGDSVRVLPCNHEFHRTCIDKWLKE  478



>gb|KHG06875.1| RING finger 38 [Gossypium arboreum]
Length=510

 Score =   117 bits (292),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 56/103 (54%), Positives = 72/103 (70%), Gaps = 9/103 (9%)
 Frame = -1

Query  474  ASISRIIMLAEALFEVIDEIHRQSFSLSTF-------SLPAPEATVDAFPLKYHKTLDPV  316
            AS+SRI+MLAEALFEV+DEIH+QS  LS+        S+PAP   V+  P+K +     +
Sbjct  389  ASLSRIVMLAEALFEVLDEIHQQSVVLSSRPSVSSIGSVPAPNEVVELLPVKIYNKSHKL  448

Query  315  ENALGDTQQCYICLAEYEDGDKLRVLPCHHEYHMICIDKWLKE  187
             N   +  QCYICL EYE+GD +R+LPC+HE+H  CIDKWLKE
Sbjct  449  HN--DEAGQCYICLLEYEEGDSMRILPCNHEFHRTCIDKWLKE  489



>gb|KHG17348.1| E3 ubiquitin-protein ligase [Gossypium arboreum]
Length=374

 Score =   115 bits (289),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 56/103 (54%), Positives = 74/103 (72%), Gaps = 10/103 (10%)
 Frame = -1

Query  474  ASISRIIMLAEALFEVIDEIHRQSFSLSTF-------SLPAPEATVDAFPLKYHKTLDPV  316
            +S+SRI+MLAEALFEV+DEIH+QS  LS+        S PAP   V++ P+K +K+   +
Sbjct  253  SSVSRIVMLAEALFEVLDEIHQQSMVLSSRPSVSPIGSFPAPNEVVESLPVKVYKSPK-L  311

Query  315  ENALGDTQQCYICLAEYEDGDKLRVLPCHHEYHMICIDKWLKE  187
            +N   +  QCYICL EYE+GD +R LPC+HE+H  CIDKWLKE
Sbjct  312  KN--DEAVQCYICLVEYEEGDSIRRLPCNHEFHRTCIDKWLKE  352



>gb|KJB25088.1| hypothetical protein B456_004G176400 [Gossypium raimondii]
Length=447

 Score =   116 bits (290),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 56/103 (54%), Positives = 75/103 (73%), Gaps = 10/103 (10%)
 Frame = -1

Query  474  ASISRIIMLAEALFEVIDEIHRQSFSLSTF-------SLPAPEATVDAFPLKYHKTLDPV  316
            +S+SRI+MLAEALFEV+DEIH+QS  LS+        S+PAP   V++ P+K +K+   +
Sbjct  326  SSVSRIVMLAEALFEVLDEIHQQSMVLSSRPSVSPIGSVPAPNEVVESLPVKVYKSPK-L  384

Query  315  ENALGDTQQCYICLAEYEDGDKLRVLPCHHEYHMICIDKWLKE  187
            +N   +  QCYICL EYE+GD +R LPC+HE+H  CIDKWLKE
Sbjct  385  KN--DEAVQCYICLVEYEEGDSIRRLPCNHEFHRTCIDKWLKE  425



>dbj|BAB10250.1| unnamed protein product [Arabidopsis thaliana]
Length=546

 Score =   117 bits (292),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 56/104 (54%), Positives = 70/104 (67%), Gaps = 13/104 (13%)
 Frame = -1

Query  474  ASISRIIMLAEALFEVIDEIHRQSFSLSTF--------SLPAPEATVDAFPLKYHKTLDP  319
            ASISRI++LAEALFEV+DEIH+QS  LS+         S+PAP   VD  P+K +     
Sbjct  425  ASISRIVLLAEALFEVLDEIHQQSVVLSSQQPSVSSIGSVPAPNDVVDLLPIKLY-----  479

Query  318  VENALGDTQQCYICLAEYEDGDKLRVLPCHHEYHMICIDKWLKE  187
             ++   D  QCYICL EYE+ D +R LPCHHE+H  C+DKWLKE
Sbjct  480  TKSQSEDPSQCYICLVEYEEADSIRTLPCHHEFHKTCVDKWLKE  523



>ref|XP_002863492.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH39751.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
Length=544

 Score =   116 bits (291),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 56/104 (54%), Positives = 70/104 (67%), Gaps = 13/104 (13%)
 Frame = -1

Query  474  ASISRIIMLAEALFEVIDEIHRQSFSLSTF--------SLPAPEATVDAFPLKYHKTLDP  319
            ASISRI++LAEALFEV+DEIH+QS  LS+         S+PAP   VD  P+K +     
Sbjct  423  ASISRIVLLAEALFEVLDEIHQQSVVLSSQQPSVSSIGSVPAPNDVVDLLPIKLY-----  477

Query  318  VENALGDTQQCYICLAEYEDGDKLRVLPCHHEYHMICIDKWLKE  187
             ++   D  QCYICL EYE+ D +R LPCHHE+H  C+DKWLKE
Sbjct  478  TKSQSEDPSQCYICLVEYEEADTIRTLPCHHEFHKTCVDKWLKE  521



>ref|XP_002517219.1| ring finger protein, putative [Ricinus communis]
 gb|EEF45119.1| ring finger protein, putative [Ricinus communis]
Length=554

 Score =   116 bits (291),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 56/103 (54%), Positives = 72/103 (70%), Gaps = 9/103 (9%)
 Frame = -1

Query  474  ASISRIIMLAEALFEVIDEIHRQSF-------SLSTFSLPAPEATVDAFPLKYHKTLDPV  316
            ASISRI+MLAEALFEV+DEIH+QS          S  S+PAP   V++ P++ +  L   
Sbjct  444  ASISRIVMLAEALFEVLDEIHQQSVVLSSQPSLSSLGSVPAPNEVVESLPVELYTKLQKH  503

Query  315  ENALGDTQQCYICLAEYEDGDKLRVLPCHHEYHMICIDKWLKE  187
            ++   +  QCYICL EYE+GD +R+LPCHHE+H  CIDKWLKE
Sbjct  504  QSE--EAAQCYICLVEYEEGDSMRILPCHHEFHRTCIDKWLKE  544



>ref|XP_011027972.1| PREDICTED: uncharacterized protein LOC105128142 [Populus euphratica]
Length=589

 Score =   117 bits (292),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 57/103 (55%), Positives = 71/103 (69%), Gaps = 9/103 (9%)
 Frame = -1

Query  474  ASISRIIMLAEALFEVIDEIHRQSFSLSTF-------SLPAPEATVDAFPLKYHKTLDPV  316
            ASISRI+MLAEALFEV+DEIH+QS  LS+        S+PAP   V++ P+K +      
Sbjct  467  ASISRIVMLAEALFEVLDEIHQQSVVLSSRPSISSLGSVPAPNEIVESLPVKLYAKSQKH  526

Query  315  ENALGDTQQCYICLAEYEDGDKLRVLPCHHEYHMICIDKWLKE  187
            +N   DT QCYICL EYE GD +RVL  HHE+H  C++KWLKE
Sbjct  527  QNE--DTAQCYICLVEYEKGDSMRVLAYHHEFHRTCVEKWLKE  567



>ref|NP_001119377.1| RING/U-box domain-containing protein [Arabidopsis thaliana]
 gb|AED95228.1| RING/U-box domain-containing protein [Arabidopsis thaliana]
Length=546

 Score =   116 bits (290),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 56/104 (54%), Positives = 70/104 (67%), Gaps = 13/104 (13%)
 Frame = -1

Query  474  ASISRIIMLAEALFEVIDEIHRQSFSLSTF--------SLPAPEATVDAFPLKYHKTLDP  319
            ASISRI++LAEALFEV+DEIH+QS  LS+         S+PAP   VD  P+K +     
Sbjct  425  ASISRIVLLAEALFEVLDEIHQQSVVLSSQQPSVSSIGSVPAPNDVVDLLPIKLY-----  479

Query  318  VENALGDTQQCYICLAEYEDGDKLRVLPCHHEYHMICIDKWLKE  187
             ++   D  QCYICL EYE+ D +R LPCHHE+H  C+DKWLKE
Sbjct  480  TKSQSEDPSQCYICLVEYEEADSIRTLPCHHEFHKTCVDKWLKE  523



>ref|NP_199342.2| RING/U-box domain-containing protein [Arabidopsis thaliana]
 gb|AAW80858.1| At5g45290 [Arabidopsis thaliana]
 gb|AAW80870.1| At5g45290 [Arabidopsis thaliana]
 gb|AED95227.1| RING/U-box domain-containing protein [Arabidopsis thaliana]
Length=545

 Score =   116 bits (290),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 56/104 (54%), Positives = 70/104 (67%), Gaps = 13/104 (13%)
 Frame = -1

Query  474  ASISRIIMLAEALFEVIDEIHRQSFSLSTF--------SLPAPEATVDAFPLKYHKTLDP  319
            ASISRI++LAEALFEV+DEIH+QS  LS+         S+PAP   VD  P+K +     
Sbjct  425  ASISRIVLLAEALFEVLDEIHQQSVVLSSQQPSVSSIGSVPAPNDVVDLLPIKLY-----  479

Query  318  VENALGDTQQCYICLAEYEDGDKLRVLPCHHEYHMICIDKWLKE  187
             ++   D  QCYICL EYE+ D +R LPCHHE+H  C+DKWLKE
Sbjct  480  TKSQSEDPSQCYICLVEYEEADSIRTLPCHHEFHKTCVDKWLKE  523



>gb|AAL47429.1| AT5g45290/K9E15_7 [Arabidopsis thaliana]
Length=545

 Score =   116 bits (290),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 56/104 (54%), Positives = 70/104 (67%), Gaps = 13/104 (13%)
 Frame = -1

Query  474  ASISRIIMLAEALFEVIDEIHRQSFSLSTF--------SLPAPEATVDAFPLKYHKTLDP  319
            ASISRI++LAEALFEV+DEIH+QS  LS+         S+PAP   VD  P+K +     
Sbjct  425  ASISRIVLLAEALFEVLDEIHQQSVVLSSQQPSVSSIGSVPAPNDVVDLLPIKLY-----  479

Query  318  VENALGDTQQCYICLAEYEDGDKLRVLPCHHEYHMICIDKWLKE  187
             ++   D  QCYICL EYE+ D +R LPCHHE+H  C+DKWLKE
Sbjct  480  TKSQSEDPSQCYICLVEYEEADSIRALPCHHEFHKTCVDKWLKE  523



>ref|XP_010529275.1| PREDICTED: E3 ubiquitin-protein ligase RLIM isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010529276.1| PREDICTED: E3 ubiquitin-protein ligase RLIM isoform X2 [Tarenaya 
hassleriana]
Length=555

 Score =   114 bits (285),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 64/129 (50%), Positives = 85/129 (66%), Gaps = 10/129 (8%)
 Frame = -1

Query  549  CPSGLHPDGtcscesfftseefsTLASISRIIMLAEALFEVIDEIHRQSFSLSTF-----  385
            CP G    G C+C +  T++E +  ASISRI+MLAEALFEV+DEIH+QS  LS+      
Sbjct  406  CPLGQTQAGRCTCRATNTTDETNARASISRIVMLAEALFEVLDEIHQQSVVLSSSQPSVS  465

Query  384  ---SLPAPEATVDAFPLKYHKTLDPVENALGDTQQCYICLAEYEDGDKLRVLPCHHEYHM  214
               S+PAP   V++ P++ +      +N   +  QCYICL EYE+GD +R LPCHHE+H 
Sbjct  466  SIGSVPAPNDVVESLPVRLYAKSHKEQN--DEASQCYICLLEYEEGDSVRTLPCHHEFHR  523

Query  213  ICIDKWLKE  187
             C+DKWLKE
Sbjct  524  TCVDKWLKE  532



>ref|XP_006279608.1| hypothetical protein CARUB_v10026185mg [Capsella rubella]
 gb|EOA12506.1| hypothetical protein CARUB_v10026185mg [Capsella rubella]
Length=552

 Score =   114 bits (285),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 55/104 (53%), Positives = 69/104 (66%), Gaps = 13/104 (13%)
 Frame = -1

Query  474  ASISRIIMLAEALFEVIDEIHRQSFSLSTF--------SLPAPEATVDAFPLKYHKTLDP  319
            ASISRI++LAEALFEV+DEIH+QS  LS+         S+PAP   VD  P K +     
Sbjct  432  ASISRIVLLAEALFEVLDEIHQQSVVLSSQQPSVSSIGSVPAPNDVVDLLPTKLY-----  486

Query  318  VENALGDTQQCYICLAEYEDGDKLRVLPCHHEYHMICIDKWLKE  187
             ++   D+ QCYICL EYE+ D +R LPC HE+H  C+DKWLKE
Sbjct  487  TKSQSEDSSQCYICLVEYEEADTIRTLPCRHEFHKTCVDKWLKE  530



>ref|XP_010441759.1| PREDICTED: uncharacterized protein LOC104724892 [Camelina sativa]
Length=547

 Score =   112 bits (281),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 55/104 (53%), Positives = 68/104 (65%), Gaps = 13/104 (13%)
 Frame = -1

Query  474  ASISRIIMLAEALFEVIDEIHRQSFSLSTF--------SLPAPEATVDAFPLKYHKTLDP  319
            ASISRI++LAEALFEV+DEIH+QS  LS+         S+PAP   VD  P K +     
Sbjct  427  ASISRIVLLAEALFEVLDEIHQQSVVLSSQQPSVSSIGSVPAPNDVVDLLPTKLY-----  481

Query  318  VENALGDTQQCYICLAEYEDGDKLRVLPCHHEYHMICIDKWLKE  187
             ++   D  QCYICL EYE+ D +R LPC HE+H  C+DKWLKE
Sbjct  482  TKSQSEDPSQCYICLVEYEEADTIRTLPCRHEFHKTCVDKWLKE  525



>ref|XP_010481610.1| PREDICTED: uncharacterized protein LOC104760389 [Camelina sativa]
Length=548

 Score =   112 bits (281),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 55/104 (53%), Positives = 68/104 (65%), Gaps = 13/104 (13%)
 Frame = -1

Query  474  ASISRIIMLAEALFEVIDEIHRQSFSLSTF--------SLPAPEATVDAFPLKYHKTLDP  319
            ASISRI++LAEALFEV+DEIH+QS  LS+         S+PAP   VD  P K +     
Sbjct  428  ASISRIVLLAEALFEVLDEIHQQSVVLSSQQPSVSSIGSVPAPNDVVDLLPTKIY-----  482

Query  318  VENALGDTQQCYICLAEYEDGDKLRVLPCHHEYHMICIDKWLKE  187
             ++   D  QCYICL EYE+ D +R LPC HE+H  C+DKWLKE
Sbjct  483  TKSQSEDPSQCYICLVEYEEADTIRTLPCRHEFHKTCVDKWLKE  526



>ref|XP_010494621.1| PREDICTED: uncharacterized protein LOC104771743 [Camelina sativa]
Length=550

 Score =   112 bits (281),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 55/104 (53%), Positives = 68/104 (65%), Gaps = 13/104 (13%)
 Frame = -1

Query  474  ASISRIIMLAEALFEVIDEIHRQSFSLSTF--------SLPAPEATVDAFPLKYHKTLDP  319
            ASISRI++LAEALFEV+DEIH+QS  LS+         S+PAP   VD  P K +     
Sbjct  430  ASISRIVLLAEALFEVLDEIHQQSVVLSSQQPSVSSIGSVPAPNDVVDLLPTKLY-----  484

Query  318  VENALGDTQQCYICLAEYEDGDKLRVLPCHHEYHMICIDKWLKE  187
             ++   D  QCYICL EYE+ D +R LPC HE+H  C+DKWLKE
Sbjct  485  TKSQSEDPSQCYICLVEYEEADTIRTLPCRHEFHKTCVDKWLKE  528



>ref|XP_010054025.1| PREDICTED: uncharacterized protein LOC104442332 isoform X2 [Eucalyptus 
grandis]
Length=499

 Score =   111 bits (278),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 51/96 (53%), Positives = 65/96 (68%), Gaps = 2/96 (2%)
 Frame = -1

Query  474  ASISRIIMLAEALFEVIDEIHRQSFSLSTFSLPAPEATVDAFPLKYHKTLDPVENALGDT  295
            ASISRI+MLAEALFE    +  +    S  S+PAP   VD+ P + +K L   +N   + 
Sbjct  377  ASISRIVMLAEALFEQSVVLSSRPSVSSIGSVPAPNEVVDSLPTRLYKKLQKNQNE--EA  434

Query  294  QQCYICLAEYEDGDKLRVLPCHHEYHMICIDKWLKE  187
             QCYICL EYEDGD +R+LPC+HE+H  C+DKWLKE
Sbjct  435  AQCYICLVEYEDGDSMRILPCNHEFHRTCVDKWLKE  470



>gb|EYU42322.1| hypothetical protein MIMGU_mgv1a0068871mg, partial [Erythranthe 
guttata]
Length=363

 Score =   110 bits (275),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 89/154 (58%), Positives = 108/154 (70%), Gaps = 3/154 (2%)
 Frame = -1

Query  744  ADDLGSHDRWLIDLNGDLHYDG-VGYGSSYLGETGHHRNERRLPSRSEISERVHRGHRNR  568
            ADD+G +DRWL+D +GD++Y+G  G      G     RNERRL  RSE+SER        
Sbjct  208  ADDVGPNDRWLLDFSGDVNYEGATGRDLDSFGARFRRRNERRLLMRSEVSERSIGDINEG  267

Query  567  VSQPSFCPSGLHPDGtcscesfftseefsTLASISRIIMLAEALFEVIDEIHRQ--SFSL  394
              Q +FC SGLH DGTCSC+SFFT EE ++LASISRII+LAEALFEV+DEI  Q  S SL
Sbjct  268  APQTAFCTSGLHLDGTCSCDSFFTPEESTSLASISRIIVLAEALFEVLDEIQNQSLSLSL  327

Query  393  STFSLPAPEATVDAFPLKYHKTLDPVENALGDTQ  292
            ST SLPAPE+ VD+FPLKYHK+L   ++   D Q
Sbjct  328  STLSLPAPESLVDSFPLKYHKSLKKSDDDSADAQ  361



>ref|XP_008451865.1| PREDICTED: uncharacterized protein LOC103493025 isoform X2 [Cucumis 
melo]
Length=580

 Score =   110 bits (275),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 53/96 (55%), Positives = 67/96 (70%), Gaps = 3/96 (3%)
 Frame = -1

Query  474  ASISRIIMLAEALFEVIDEIHRQSFSLSTFSLPAPEATVDAFPLKYHKTLDPVENALGDT  295
            ASISRI+MLAEALFE    +  +  S S  SLPAP   VD+ P+K++  L   ++   + 
Sbjct  464  ASISRIVMLAEALFEQSVVLSSRPAS-SIGSLPAPNDVVDSLPVKFYSKLQ--KHQTEEA  520

Query  294  QQCYICLAEYEDGDKLRVLPCHHEYHMICIDKWLKE  187
             QCYICL EYE+GD +RVLPCHHE+H  C+DKWLKE
Sbjct  521  AQCYICLVEYEEGDSMRVLPCHHEFHATCVDKWLKE  556



>ref|XP_010676683.1| PREDICTED: uncharacterized protein LOC104892442 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=569

 Score =   110 bits (275),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 51/96 (53%), Positives = 66/96 (69%), Gaps = 2/96 (2%)
 Frame = -1

Query  474  ASISRIIMLAEALFEVIDEIHRQSFSLSTFSLPAPEATVDAFPLKYHKTLDPVENALGDT  295
            ASISRI+MLAEALFE    +  +    S  S+PAP   V++ P+K +     ++N   D 
Sbjct  450  ASISRIVMLAEALFEQSVVLSSRPSVSSIGSVPAPNEVVESLPVKAYTKSTKLQNE--DV  507

Query  294  QQCYICLAEYEDGDKLRVLPCHHEYHMICIDKWLKE  187
             QCYICL EYE+GD++R+LPCHHE+H  CIDKWLKE
Sbjct  508  AQCYICLVEYEEGDEMRILPCHHEFHKKCIDKWLKE  543



>ref|XP_008373443.1| PREDICTED: uncharacterized protein DDB_G0271670 isoform X2 [Malus 
domestica]
Length=577

 Score =   110 bits (275),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 51/96 (53%), Positives = 65/96 (68%), Gaps = 2/96 (2%)
 Frame = -1

Query  474  ASISRIIMLAEALFEVIDEIHRQSFSLSTFSLPAPEATVDAFPLKYHKTLDPVENALGDT  295
            ASISRI+MLAEALFE    +  +    S  S+PAP   V++ P+K    L   +N   + 
Sbjct  462  ASISRIVMLAEALFEQSVVLSSRPSVSSIGSVPAPNEVVESLPVKLFSKLQ--KNEYEEA  519

Query  294  QQCYICLAEYEDGDKLRVLPCHHEYHMICIDKWLKE  187
             QCYICL EYE+GD++R+LPCHHE+H  CIDKWLKE
Sbjct  520  AQCYICLVEYEEGDRMRILPCHHEFHKTCIDKWLKE  555



>ref|XP_009365724.1| PREDICTED: uncharacterized protein LOC103955550 isoform X2 [Pyrus 
x bretschneideri]
Length=576

 Score =   110 bits (274),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 51/96 (53%), Positives = 65/96 (68%), Gaps = 2/96 (2%)
 Frame = -1

Query  474  ASISRIIMLAEALFEVIDEIHRQSFSLSTFSLPAPEATVDAFPLKYHKTLDPVENALGDT  295
            ASISRI+MLAEALFE    +  +    S  S+PAP   V++ P+K    L   +N   + 
Sbjct  461  ASISRIVMLAEALFEQSVVLSSRPSVSSIGSVPAPNEVVESLPVKSFSKLQ--KNEYEEA  518

Query  294  QQCYICLAEYEDGDKLRVLPCHHEYHMICIDKWLKE  187
             QCYICL EYE+GD++R+LPCHHE+H  CIDKWLKE
Sbjct  519  AQCYICLVEYEEGDRMRILPCHHEFHKTCIDKWLKE  554



>ref|XP_009761905.1| PREDICTED: uncharacterized protein LOC104214009 isoform X2 [Nicotiana 
sylvestris]
Length=574

 Score =   110 bits (274),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 52/96 (54%), Positives = 63/96 (66%), Gaps = 2/96 (2%)
 Frame = -1

Query  474  ASISRIIMLAEALFEVIDEIHRQSFSLSTFSLPAPEATVDAFPLKYHKTLDPVENALGDT  295
            ASISRI+MLAEALFE    +  Q F  S  S+PAP   V++ P+K +       N   + 
Sbjct  459  ASISRIVMLAEALFEQSVVLSSQPFVSSIGSVPAPNEVVESLPVKSYNKFHRSSN--DEV  516

Query  294  QQCYICLAEYEDGDKLRVLPCHHEYHMICIDKWLKE  187
             QCYICL EYE+GD LR LPCHHE+H  C+DKWLKE
Sbjct  517  AQCYICLVEYEEGDILRTLPCHHEFHRTCVDKWLKE  552



>ref|XP_007158097.1| hypothetical protein PHAVU_002G123800g [Phaseolus vulgaris]
 gb|ESW30091.1| hypothetical protein PHAVU_002G123800g [Phaseolus vulgaris]
Length=560

 Score =   109 bits (273),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 55/101 (54%), Positives = 66/101 (65%), Gaps = 13/101 (13%)
 Frame = -1

Query  474  ASISRIIMLAEALFEVIDEIHRQSFSLSTFSLPAPEATVDAFPLKYHKTL-----DPVEN  310
            ASISRI+MLAEALFE    +  +    S  S+PAP   V++ P+K +K L     +PV  
Sbjct  446  ASISRIVMLAEALFEQSVVLSSRPSVSSIGSVPAPNEVVESLPVKLYKKLHKHQEEPV--  503

Query  309  ALGDTQQCYICLAEYEDGDKLRVLPCHHEYHMICIDKWLKE  187
                  QCYICL EYEDGD +RVLPCHHE+H  CIDKWLKE
Sbjct  504  ------QCYICLVEYEDGDSMRVLPCHHEFHTTCIDKWLKE  538



>ref|XP_006359940.1| PREDICTED: uncharacterized protein DDB_G0271670-like isoform 
X2 [Solanum tuberosum]
Length=571

 Score =   108 bits (269),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 51/96 (53%), Positives = 62/96 (65%), Gaps = 2/96 (2%)
 Frame = -1

Query  474  ASISRIIMLAEALFEVIDEIHRQSFSLSTFSLPAPEATVDAFPLKYHKTLDPVENALGDT  295
            ASISRI+MLAEALFE    +  Q    S  S+PAP   V++ P+K +       N   + 
Sbjct  461  ASISRIVMLAEALFEQSVVLSSQPSVSSIGSVPAPNEVVESLPVKSYNKFRRSSN--DEV  518

Query  294  QQCYICLAEYEDGDKLRVLPCHHEYHMICIDKWLKE  187
             QCYICL EYE+GD LR LPCHHE+H  C+DKWLKE
Sbjct  519  AQCYICLVEYEEGDMLRTLPCHHEFHRTCVDKWLKE  554



>ref|XP_010325629.1| PREDICTED: uncharacterized protein LOC101258477 isoform X2 [Solanum 
lycopersicum]
Length=566

 Score =   107 bits (268),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 51/96 (53%), Positives = 62/96 (65%), Gaps = 2/96 (2%)
 Frame = -1

Query  474  ASISRIIMLAEALFEVIDEIHRQSFSLSTFSLPAPEATVDAFPLKYHKTLDPVENALGDT  295
            ASISRI+MLAEALFE    +  Q    S  S+PAP   V++ P+K +       N   + 
Sbjct  456  ASISRIVMLAEALFEQSVVLSSQPSVSSIGSVPAPNEVVESLPVKSYNKFRRSSN--DEV  513

Query  294  QQCYICLAEYEDGDKLRVLPCHHEYHMICIDKWLKE  187
             QCYICL EYE+GD LR LPCHHE+H  C+DKWLKE
Sbjct  514  AQCYICLVEYEEGDMLRTLPCHHEFHRTCVDKWLKE  549



>ref|XP_006573493.1| PREDICTED: uncharacterized protein LOC100815830 isoform X2 [Glycine 
max]
Length=560

 Score =   107 bits (267),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 53/101 (52%), Positives = 65/101 (64%), Gaps = 13/101 (13%)
 Frame = -1

Query  474  ASISRIIMLAEALFEVIDEIHRQSFSLSTFSLPAPEATVDAFPLKYHKTL-----DPVEN  310
            ASISRI+MLAEALFE    +  +    S  S+PAP   V++ P+K +  L     +PV  
Sbjct  446  ASISRIVMLAEALFEQSMVLSSRPSVSSIGSVPAPNEVVESLPVKLYTKLHKHQEEPV--  503

Query  309  ALGDTQQCYICLAEYEDGDKLRVLPCHHEYHMICIDKWLKE  187
                  QCYICL EYEDGD +RVLPCHHE+H  C+DKWLKE
Sbjct  504  ------QCYICLVEYEDGDSMRVLPCHHEFHTTCVDKWLKE  538



>ref|XP_006587658.1| PREDICTED: uncharacterized protein LOC100786091 isoform X2 [Glycine 
max]
Length=560

 Score =   107 bits (267),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 53/101 (52%), Positives = 65/101 (64%), Gaps = 13/101 (13%)
 Frame = -1

Query  474  ASISRIIMLAEALFEVIDEIHRQSFSLSTFSLPAPEATVDAFPLKYHKTL-----DPVEN  310
            ASISRI+MLAEALFE    +  +    S  S+PAP   V++ P+K +  L     +PV  
Sbjct  446  ASISRIVMLAEALFEQSVVLSSRPSVSSIGSVPAPNDVVESLPVKLYTKLHKHQEEPV--  503

Query  309  ALGDTQQCYICLAEYEDGDKLRVLPCHHEYHMICIDKWLKE  187
                  QCYICL EYEDGD +RVLPCHHE+H  C+DKWLKE
Sbjct  504  ------QCYICLVEYEDGDSMRVLPCHHEFHTTCVDKWLKE  538



>ref|XP_009610446.1| PREDICTED: uncharacterized protein LOC104104147 isoform X2 [Nicotiana 
tomentosiformis]
Length=576

 Score =   107 bits (266),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 51/96 (53%), Positives = 62/96 (65%), Gaps = 2/96 (2%)
 Frame = -1

Query  474  ASISRIIMLAEALFEVIDEIHRQSFSLSTFSLPAPEATVDAFPLKYHKTLDPVENALGDT  295
            ASISRI+MLAEALFE    +  Q    S  S+PAP   V++ P+K +       N   + 
Sbjct  461  ASISRIVMLAEALFEQSVVLSSQPSVSSIGSVPAPNEVVESLPVKSYNKFRRSSN--DEV  518

Query  294  QQCYICLAEYEDGDKLRVLPCHHEYHMICIDKWLKE  187
             QCYICL EYE+GD LR LPCHHE+H  C+DKWLKE
Sbjct  519  AQCYICLVEYEEGDILRTLPCHHEFHRTCVDKWLKE  554



>ref|XP_010275185.1| PREDICTED: uncharacterized protein LOC104610322 isoform X2 [Nelumbo 
nucifera]
Length=564

 Score =   107 bits (266),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 51/97 (53%), Positives = 66/97 (68%), Gaps = 4/97 (4%)
 Frame = -1

Query  474  ASISRIIMLAEALFEVIDEIHRQSFSLSTFSLPAPEATVDAFPLK-YHKTLDPVENALGD  298
            ASISRI+MLAEALFE    +  +    S  S+PAP+  V++ P+K Y K+   +     +
Sbjct  455  ASISRIVMLAEALFEQSVVLSSRPSVSSIGSVPAPKEVVESIPVKIYMKSQKHLNE---E  511

Query  297  TQQCYICLAEYEDGDKLRVLPCHHEYHMICIDKWLKE  187
              QCYICL EYE+GD +R+LPCHHE+H  CIDKWLKE
Sbjct  512  AAQCYICLVEYEEGDSMRILPCHHEFHQTCIDKWLKE  548



>ref|XP_011465298.1| PREDICTED: uncharacterized protein LOC101314385 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=544

 Score =   106 bits (265),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 49/96 (51%), Positives = 65/96 (68%), Gaps = 2/96 (2%)
 Frame = -1

Query  474  ASISRIIMLAEALFEVIDEIHRQSFSLSTFSLPAPEATVDAFPLKYHKTLDPVENALGDT  295
            ASISRI+MLAEALFE    +  +    S  S+PAP   V++ P+K    +   +N   + 
Sbjct  430  ASISRIVMLAEALFEQSVVLSSRPSVSSIGSVPAPNEVVESLPVKLFSKVQKHQNE--EA  487

Query  294  QQCYICLAEYEDGDKLRVLPCHHEYHMICIDKWLKE  187
             QCYICL EYE+GD++R+LPC+HE+H  CIDKWLKE
Sbjct  488  AQCYICLVEYEEGDEMRILPCNHEFHKTCIDKWLKE  523



>ref|XP_010266394.1| PREDICTED: uncharacterized protein LOC104603919 isoform X2 [Nelumbo 
nucifera]
Length=579

 Score =   105 bits (263),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 48/96 (50%), Positives = 66/96 (69%), Gaps = 2/96 (2%)
 Frame = -1

Query  474  ASISRIIMLAEALFEVIDEIHRQSFSLSTFSLPAPEATVDAFPLKYHKTLDPVENALGDT  295
            ASISRI+MLAEALFE    +  +    S  S+PAP+  V++ P+K +  +   ++   + 
Sbjct  462  ASISRIVMLAEALFEQSVVLSSRPSVSSIGSVPAPKEVVESIPVKIY--MKSQKHMNEEA  519

Query  294  QQCYICLAEYEDGDKLRVLPCHHEYHMICIDKWLKE  187
             QCYICL EYE+GD +R+LPCHHE+H  C+DKWLKE
Sbjct  520  AQCYICLVEYEEGDSMRILPCHHEFHQTCVDKWLKE  555



>ref|XP_006372133.1| hypothetical protein POPTR_0018s12260g [Populus trichocarpa]
 gb|ERP49930.1| hypothetical protein POPTR_0018s12260g [Populus trichocarpa]
Length=437

 Score =   102 bits (254),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 65/110 (59%), Positives = 75/110 (68%), Gaps = 0/110 (0%)
 Frame = -1

Query  753  TGNADDLGSHDRWLIDLNGDLHYDGVGYGSSYLGETGHHRNERRLPSRSEISERVHRGHR  574
            T N DDL SHDRWL+D +GD   DG+G  S Y+    H  NERR  SRSEI ER+  G  
Sbjct  326  TDNTDDLESHDRWLLDFSGDFFDDGIGSDSGYMSRRIHRLNERRRHSRSEIWERLRGGLD  385

Query  573  NRVSQPSFCPSGLHPDGtcscesfftseefsTLASISRIIMLAEALFEVI  424
                + + CPSGLHPDGTCSCESF  +EE S   SISRI+MLAEALFEV+
Sbjct  386  ENGRRTTSCPSGLHPDGTCSCESFLMAEESSARGSISRIVMLAEALFEVV  435



>gb|AFW70578.1| putative homeodomain-like transcription factor superfamily protein 
[Zea mays]
Length=793

 Score =   103 bits (256),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 48/89 (54%), Positives = 64/89 (72%), Gaps = 3/89 (3%)
 Frame = -1

Query  447  AEALFEVIDEIHRQ--SFSLSTFSLPAPEATVDAFPLKYHKTLDPVENALGDTQQCYICL  274
             E   +V+DEIHRQ  S SLS  S+ APE+ VD+ P K +K L+  + +  D +QC+ICL
Sbjct  455  GENFLQVLDEIHRQPASLSLSMVSVQAPESVVDSLPCKSYKKLETPQCS-DDMEQCHICL  513

Query  273  AEYEDGDKLRVLPCHHEYHMICIDKWLKE  187
             EYEDGD++R LPC HE+H+ C+DKWLKE
Sbjct  514  TEYEDGDQIRTLPCKHEFHLQCVDKWLKE  542



>ref|XP_006372134.1| hypothetical protein POPTR_0018s12260g [Populus trichocarpa]
 gb|ERP49931.1| hypothetical protein POPTR_0018s12260g [Populus trichocarpa]
Length=451

 Score = 99.8 bits (247),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 64/109 (59%), Positives = 74/109 (68%), Gaps = 0/109 (0%)
 Frame = -1

Query  753  TGNADDLGSHDRWLIDLNGDLHYDGVGYGSSYLGETGHHRNERRLPSRSEISERVHRGHR  574
            T N DDL SHDRWL+D +GD   DG+G  S Y+    H  NERR  SRSEI ER+  G  
Sbjct  326  TDNTDDLESHDRWLLDFSGDFFDDGIGSDSGYMSRRIHRLNERRRHSRSEIWERLRGGLD  385

Query  573  NRVSQPSFCPSGLHPDGtcscesfftseefsTLASISRIIMLAEALFEV  427
                + + CPSGLHPDGTCSCESF  +EE S   SISRI+MLAEALFE+
Sbjct  386  ENGRRTTSCPSGLHPDGTCSCESFLMAEESSARGSISRIVMLAEALFEL  434



>ref|XP_006372135.1| hypothetical protein POPTR_0018s12260g [Populus trichocarpa]
 gb|ERP49932.1| hypothetical protein POPTR_0018s12260g [Populus trichocarpa]
Length=481

 Score = 99.8 bits (247),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 64/108 (59%), Positives = 73/108 (68%), Gaps = 0/108 (0%)
 Frame = -1

Query  753  TGNADDLGSHDRWLIDLNGDLHYDGVGYGSSYLGETGHHRNERRLPSRSEISERVHRGHR  574
            T N DDL SHDRWL+D +GD   DG+G  S Y+    H  NERR  SRSEI ER+  G  
Sbjct  326  TDNTDDLESHDRWLLDFSGDFFDDGIGSDSGYMSRRIHRLNERRRHSRSEIWERLRGGLD  385

Query  573  NRVSQPSFCPSGLHPDGtcscesfftseefsTLASISRIIMLAEALFE  430
                + + CPSGLHPDGTCSCESF  +EE S   SISRI+MLAEALFE
Sbjct  386  ENGRRTTSCPSGLHPDGTCSCESFLMAEESSARGSISRIVMLAEALFE  433



>ref|XP_006599202.1| PREDICTED: uncharacterized protein LOC100800896 isoform X3 [Glycine 
max]
Length=516

 Score = 97.4 bits (241),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 47/89 (53%), Positives = 58/89 (65%), Gaps = 10/89 (11%)
 Frame = -1

Query  432  EVIDEIHRQSFSLSTFS-------LPAPEATVDAFPLKYHKTLDPVENALGDTQQCYICL  274
            +V+DEIH QS  LS+         +PAP   VD+ P+K ++ L   +    D  QCYICL
Sbjct  406  QVLDEIHLQSVVLSSRPSVSSIGPVPAPNDVVDSLPVKLYEKLHKHQE---DAAQCYICL  462

Query  273  AEYEDGDKLRVLPCHHEYHMICIDKWLKE  187
             EYEDGD +RVLPCHHE+H  CIDKWLKE
Sbjct  463  VEYEDGDNMRVLPCHHEFHRTCIDKWLKE  491



>ref|XP_009338815.1| PREDICTED: receptor homology region, transmembrane domain- and 
RING domain-containing protein 2-like, partial [Pyrus x bretschneideri]
Length=92

 Score = 84.3 bits (207),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 37/69 (54%), Positives = 48/69 (70%), Gaps = 2/69 (3%)
 Frame = -1

Query  393  STFSLPAPEATVDAFPLKYHKTLDPVENALGDTQQCYICLAEYEDGDKLRVLPCHHEYHM  214
            S  S+PAP   V++ P+K    L   ++   +  QCYICL EYE+GD++RVLPCHHE+H 
Sbjct  4    SIGSVPAPNEVVESLPVKLFSKLQ--KDQYEEATQCYICLVEYEEGDRMRVLPCHHEFHK  61

Query  213  ICIDKWLKE  187
             CIDKWLKE
Sbjct  62   TCIDKWLKE  70



>gb|EPS57989.1| hypothetical protein M569_16829, partial [Genlisea aurea]
Length=101

 Score = 83.6 bits (205),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 45/88 (51%), Positives = 58/88 (66%), Gaps = 9/88 (10%)
 Frame = -1

Query  429  VIDEIHRQSFSLSTF-------SLPAPEATVDAFPLKYHKTLDPVENALGDTQQCYICLA  271
            V+DEIH+QS  LS+        S+PAP   VD+ PLK    L   +  + +  QCYICL 
Sbjct  1    VLDEIHQQSVVLSSRPSVSSLGSIPAPNEVVDSLPLKLFSKLK--KKTIEEVAQCYICLV  58

Query  270  EYEDGDKLRVLPCHHEYHMICIDKWLKE  187
            EYE+GD +R+LPCHHE+H  C+DKWLKE
Sbjct  59   EYEEGDSMRILPCHHEFHRTCVDKWLKE  86



>ref|XP_008646805.1| PREDICTED: uncharacterized protein LOC103628370 [Zea mays]
Length=372

 Score = 85.1 bits (209),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 36/65 (55%), Positives = 49/65 (75%), Gaps = 1/65 (2%)
 Frame = -1

Query  381  LPAPEATVDAFPLKYHKTLDPVENALGDTQQCYICLAEYEDGDKLRVLPCHHEYHMICID  202
            L APE+ VD+ P K +K L+  + +  D +QC+ICL EYEDGD++R LPC HE+H+ C+D
Sbjct  253  LQAPESVVDSLPCKSYKKLETPQCS-DDMEQCHICLTEYEDGDQIRTLPCKHEFHLQCVD  311

Query  201  KWLKE  187
            KWLKE
Sbjct  312  KWLKE  316



>ref|XP_010244859.1| PREDICTED: uncharacterized protein LOC104588570 isoform X2 [Nelumbo 
nucifera]
Length=434

 Score = 85.9 bits (211),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 63/111 (57%), Positives = 75/111 (68%), Gaps = 3/111 (3%)
 Frame = -1

Query  753  TGNADDLGSHDRWLIDLNGDLHYDGVGYGSSYLGETGHHRNERRLPSRSEISERVHRGHR  574
            T +ADDLGS +RWL+D +GDL  DG G    YLG + H   + R  S  EI ER HRG  
Sbjct  322  TEDADDLGSPNRWLLDFSGDLFEDGFGGDLGYLGRS-HGIYQHRWNSGPEIWER-HRGDL  379

Query  573  NRVS-QPSFCPSGLHPDGtcscesfftseefsTLASISRIIMLAEALFEVI  424
            +    + +FC SGLHPDGTCSC SF  +EE  T ASISRI+MLAEALFEV+
Sbjct  380  DESGRRTTFCASGLHPDGTCSCGSFLVTEESGTRASISRIVMLAEALFEVL  430



>ref|XP_002454715.1| hypothetical protein SORBIDRAFT_04g036100 [Sorghum bicolor]
 gb|EES07691.1| hypothetical protein SORBIDRAFT_04g036100 [Sorghum bicolor]
Length=470

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 70/163 (43%), Positives = 93/163 (57%), Gaps = 19/163 (12%)
 Frame = -1

Query  747  NADDLGSHDRWLIDLNGDLHYDGVGYGSSYLGETGHHRNERRLPSR-SEISERVHRGHRN  571
            +ADDLG +  WL DL  D+  +        LGE+ +    R    R S+ S    R HR 
Sbjct  315  DADDLGFYSTWL-DLGDDIFEE--------LGESRYFHRRRHGSIRVSQYSRSRIREHRR  365

Query  570  RV------SQPSFCPSGLHPDGtcscesfftseefsTLASISRIIMLAEALFEVIDEIHR  409
             V         + CP G+HP G C+C+SF  +EE S  ASISRI+ML EALFEV+DEIHR
Sbjct  366  AVFDSGNEQSTAACPLGIHPIGRCTCDSFLIAEESSARASISRIVMLTEALFEVLDEIHR  425

Query  408  Q--SFSLSTFSLPAPEATVDAFPLKYHKTLDPVENALGDTQQC  286
            Q  S SLS  S+ APE+ V++ P K +K L+  + +  D +QC
Sbjct  426  QPASLSLSMVSVQAPESVVNSLPCKSYKKLETPQCS-DDMEQC  467



>gb|AAT68478.1| unknown [Zea mays]
Length=68

 Score = 70.9 bits (172),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 38/54 (70%), Gaps = 9/54 (17%)
 Frame = -1

Query  348  PLKYHKTLDPVENALGDTQQCYICLAEYEDGDKLRVLPCHHEYHMICIDKWLKE  187
            PL+YH           +  QCYICL EYE+GD LR+LPCHHE+H+ C+DKWLKE
Sbjct  1    PLQYHSE---------EAAQCYICLVEYEEGDCLRILPCHHEFHLTCVDKWLKE  45



>gb|EYU42321.1| hypothetical protein MIMGU_mgv1a0068872mg, partial [Erythranthe 
guttata]
Length=63

 Score = 67.8 bits (164),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 28/34 (82%), Positives = 33/34 (97%), Gaps = 0/34 (0%)
 Frame = -1

Query  288  CYICLAEYEDGDKLRVLPCHHEYHMICIDKWLKE  187
            CYICL++YE+GDKLRVLPC+HEYH+ CIDKWLKE
Sbjct  1    CYICLSDYEEGDKLRVLPCNHEYHVSCIDKWLKE  34



>ref|XP_002973809.1| hypothetical protein SELMODRAFT_100003, partial [Selaginella 
moellendorffii]
 gb|EFJ24764.1| hypothetical protein SELMODRAFT_100003, partial [Selaginella 
moellendorffii]
Length=61

 Score = 67.4 bits (163),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 25/35 (71%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = -1

Query  291  QCYICLAEYEDGDKLRVLPCHHEYHMICIDKWLKE  187
            +C+ICL EYE+GD++RVLPC HEYH  C+DKWLKE
Sbjct  1    RCHICLVEYEEGDQIRVLPCQHEYHQACVDKWLKE  35



>ref|XP_002983588.1| hypothetical protein SELMODRAFT_118474, partial [Selaginella 
moellendorffii]
 gb|EFJ15489.1| hypothetical protein SELMODRAFT_118474, partial [Selaginella 
moellendorffii]
Length=62

 Score = 67.4 bits (163),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 25/35 (71%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = -1

Query  291  QCYICLAEYEDGDKLRVLPCHHEYHMICIDKWLKE  187
            +C+ICL EYE+GD++RVLPC HEYH  C+DKWLKE
Sbjct  1    RCHICLVEYEEGDQIRVLPCQHEYHQACVDKWLKE  35



>ref|XP_010096419.1| E3 ubiquitin-protein ligase [Morus notabilis]
 gb|EXB64090.1| E3 ubiquitin-protein ligase [Morus notabilis]
Length=69

 Score = 67.4 bits (163),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = -1

Query  291  QCYICLAEYEDGDKLRVLPCHHEYHMICIDKWLKE  187
            +CYICL EYE+GD++R+LPCHHE+H  C+DKWLKE
Sbjct  6    KCYICLVEYEEGDRMRILPCHHEFHKTCVDKWLKE  40



>gb|AFW73880.1| putative RING zinc finger domain superfamily protein [Zea mays]
Length=446

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 63/143 (44%), Positives = 80/143 (56%), Gaps = 18/143 (13%)
 Frame = -1

Query  747  NADDLGSHDRWLIDLNGDLHYDGVGYGSSYLGETGHHRNERRLPSR-SEISERVHRGHRN  571
            +AD++G    WL DL  D+  +        LGE+ +    R    R S+ S    R HR 
Sbjct  308  DADEMGFFSTWL-DLGDDIFEE--------LGESRYFHRRRHGSIRVSQYSRSRIREHRR  358

Query  570  RV------SQPSFCPSGLHPDGtcscesfftseefsTLASISRIIMLAEALFEVIDEIHR  409
             V         + CP G+H  G C+C SFF +EE S  ASISRI+ML EALFEV+DEIHR
Sbjct  359  AVFDSGNEQNTAACPLGIHQIGRCTCNSFFIAEESSARASISRIVMLTEALFEVLDEIHR  418

Query  408  Q--SFSLSTFSLPAPEATVDAFP  346
            Q  S SLS  S+ APE+ VD+ P
Sbjct  419  QPASLSLSMVSVQAPESVVDSLP  441



>dbj|BAK00814.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=425

 Score = 69.3 bits (168),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 66/153 (43%), Positives = 84/153 (55%), Gaps = 15/153 (10%)
 Frame = -1

Query  747  NADDLGSHDRWLIDLNGDLHYDGVGYGSSYLGETGHHRNERRLPSRSEISERVHRGHRNR  568
            + DDLG + RWL DL  DL  D V   + Y     H        SRS I E     HR  
Sbjct  273  DTDDLGFYSRWL-DLGDDLFGDEVEE-ARYFHRRRHGSIRVNQYSRSRIRE-----HRRA  325

Query  567  V------SQPSFCPSGLHPDGtcscesfftseefsTLASISRIIMLAEALFEVIDEIHRQ  406
            +         + CP G+H  G C+C++F  +EE S  ASISRI+ML EALFEV+DEIHRQ
Sbjct  326  IFDSGNGQSTAACPLGIHQIGRCTCDAFLVAEESSARASISRIVMLTEALFEVLDEIHRQ  385

Query  405  --SFSLSTFSLPAPEATVDAFPLKYHKTLDPVE  313
              S SLS  S  APE+ V++ P K +K L+  +
Sbjct  386  PSSLSLSMASAQAPESVVNSLPCKSYKKLETAQ  418



>ref|XP_001770745.1| predicted protein [Physcomitrella patens]
 gb|EDQ64427.1| predicted protein, partial [Physcomitrella patens]
Length=65

 Score = 63.9 bits (154),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 26/35 (74%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = -1

Query  291  QCYICLAEYEDGDKLRVLPCHHEYHMICIDKWLKE  187
            +C+ICL EYEDGD++RVLPC HEYH  C+DKWLKE
Sbjct  1    RCHICLVEYEDGDEIRVLPCQHEYHKDCVDKWLKE  35



>gb|KJB63216.1| hypothetical protein B456_010G0001003, partial [Gossypium raimondii]
Length=53

 Score = 63.5 bits (153),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = -1

Query  303  GDTQQCYICLAEYEDGDKLRVLPCHHEYHMICIDKWLKE  187
            G   +CYICL EYE+GD +R+LPC+HE+H  CID WLKE
Sbjct  13   GPNLRCYICLLEYEEGDSMRILPCNHEFHRTCIDNWLKE  51



>ref|XP_008309585.1| PREDICTED: uncharacterized protein DDB_G0271670-like isoform 
X1 [Cynoglossus semilaevis]
Length=459

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 36/58 (62%), Gaps = 5/58 (9%)
 Frame = -1

Query  360  VDAFPLKYHKTLDPVENALGDTQQCYICLAEYEDGDKLRVLPCHHEYHMICIDKWLKE  187
            +  FP K  K       + G   QC IC  +Y DG+KLR+LPC H+YHM CID+WLK+
Sbjct  385  IQRFPTKTFKNA-----SCGGNTQCQICFCDYTDGEKLRMLPCFHDYHMKCIDRWLKD  437



>ref|XP_008309586.1| PREDICTED: uncharacterized protein DDB_G0271670-like isoform 
X2 [Cynoglossus semilaevis]
Length=458

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 36/58 (62%), Gaps = 5/58 (9%)
 Frame = -1

Query  360  VDAFPLKYHKTLDPVENALGDTQQCYICLAEYEDGDKLRVLPCHHEYHMICIDKWLKE  187
            +  FP K  K       + G   QC IC  +Y DG+KLR+LPC H+YHM CID+WLK+
Sbjct  384  IQRFPTKTFKNA-----SCGGNTQCQICFCDYTDGEKLRMLPCFHDYHMKCIDRWLKD  436



>ref|XP_002980346.1| hypothetical protein SELMODRAFT_112690 [Selaginella moellendorffii]
 gb|EFJ18606.1| hypothetical protein SELMODRAFT_112690 [Selaginella moellendorffii]
Length=101

 Score = 62.8 bits (151),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 35/56 (63%), Gaps = 3/56 (5%)
 Frame = -1

Query  360  VDAFPLKYHKTLDPVENALGDTQQCYICLAEYEDGDKLRVLPCHHEYHMICIDKWL  193
            V A P    K L    +  G +  C ICL EYE G+KLRVLPCHH++H  C+D+WL
Sbjct  6    VKALPTVIFKCLG---DGQGTSDTCAICLEEYESGEKLRVLPCHHDFHAACVDQWL  58



>gb|KFH67898.1| hypothetical protein MVEG_06629 [Mortierella verticillata NRRL 
6337]
Length=376

 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 37/61 (61%), Gaps = 3/61 (5%)
 Frame = -1

Query  375  APEATVDAFPLKYHKTLDPVENALGDTQQCYICLAEYEDGDKLRVLPCHHEYHMICIDKW  196
            AP   V   P+K   T    EN   D  +C ICL +YED D+LRVLPC H+YH+ CID W
Sbjct  209  APTEVVSNLPIKVFYTAKLQEN---DPVECVICLEDYEDEDELRVLPCKHQYHVACIDNW  265

Query  195  L  193
            L
Sbjct  266  L  266



>ref|XP_005098689.1| PREDICTED: E3 ubiquitin-protein ligase RNF6-like isoform X3 [Aplysia 
californica]
Length=454

 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 35/88 (40%), Positives = 51/88 (58%), Gaps = 14/88 (16%)
 Frame = -1

Query  441  ALFEVIDEIHRQSFSLSTFSLPAPEATVDAFPLKYHK--TLDPVENALG--DTQQCYICL  274
            AL E I E++R    LS       ++ +D  P   H+  + +  E   G  D+QQC ICL
Sbjct  360  ALAEQIGEVNR---GLS-------KSELDKLPTSKHRCDSSEGAEAGAGSADSQQCNICL  409

Query  273  AEYEDGDKLRVLPCHHEYHMICIDKWLK  190
             +YE+GD+ R LPC H++H  C+D+WLK
Sbjct  410  NDYENGDRKRNLPCKHDFHKDCVDQWLK  437



>ref|XP_005098687.1| PREDICTED: E3 ubiquitin-protein ligase RNF6-like isoform X1 [Aplysia 
californica]
 ref|XP_005098688.1| PREDICTED: E3 ubiquitin-protein ligase RNF6-like isoform X2 [Aplysia 
californica]
Length=465

 Score = 66.2 bits (160),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 35/88 (40%), Positives = 51/88 (58%), Gaps = 14/88 (16%)
 Frame = -1

Query  441  ALFEVIDEIHRQSFSLSTFSLPAPEATVDAFPLKYHK--TLDPVENALG--DTQQCYICL  274
            AL E I E++R    LS       ++ +D  P   H+  + +  E   G  D+QQC ICL
Sbjct  371  ALAEQIGEVNR---GLS-------KSELDKLPTSKHRCDSSEGAEAGAGSADSQQCNICL  420

Query  273  AEYEDGDKLRVLPCHHEYHMICIDKWLK  190
             +YE+GD+ R LPC H++H  C+D+WLK
Sbjct  421  NDYENGDRKRNLPCKHDFHKDCVDQWLK  448



>ref|XP_005098690.1| PREDICTED: E3 ubiquitin-protein ligase RNF6-like isoform X4 [Aplysia 
californica]
Length=439

 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 35/88 (40%), Positives = 51/88 (58%), Gaps = 14/88 (16%)
 Frame = -1

Query  441  ALFEVIDEIHRQSFSLSTFSLPAPEATVDAFPLKYHK--TLDPVENALG--DTQQCYICL  274
            AL E I E++R    LS       ++ +D  P   H+  + +  E   G  D+QQC ICL
Sbjct  345  ALAEQIGEVNR---GLS-------KSELDKLPTSKHRCDSSEGAEAGAGSADSQQCNICL  394

Query  273  AEYEDGDKLRVLPCHHEYHMICIDKWLK  190
             +YE+GD+ R LPC H++H  C+D+WLK
Sbjct  395  NDYENGDRKRNLPCKHDFHKDCVDQWLK  422



>ref|XP_005937012.1| PREDICTED: trichohyalin-like isoform X1 [Haplochromis burtoni]
 ref|XP_005937013.1| PREDICTED: trichohyalin-like isoform X2 [Haplochromis burtoni]
 ref|XP_005937014.1| PREDICTED: trichohyalin-like isoform X3 [Haplochromis burtoni]
Length=380

 Score = 65.5 bits (158),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 31/83 (37%), Positives = 48/83 (58%), Gaps = 6/83 (7%)
 Frame = -1

Query  435  FEVIDEIHRQSFSLSTFSLPAPEATVDAFPLKYHKTLDPVENALGDTQQCYICLAEYEDG  256
            +E + E+  +  ++ T  L A +  +  FP K  +         G   QC IC+ +Y DG
Sbjct  280  YESLLELEERQGAVRTNQLSATD--IQRFPTKVFQGC----GGSGGNTQCQICVCDYSDG  333

Query  255  DKLRVLPCHHEYHMICIDKWLKE  187
            +KLR+LPC H+YH+ CID+WLK+
Sbjct  334  EKLRILPCFHDYHVQCIDQWLKD  356



>ref|XP_005368578.1| PREDICTED: E3 ubiquitin-protein ligase RLIM-like [Microtus ochrogaster]
Length=550

 Score = 65.9 bits (159),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = -1

Query  294  QQCYICLAEYEDGDKLRVLPCHHEYHMICIDKWLKE  187
            + C IC+ EY +GDKLRVLPC HEYH+ CID+WL E
Sbjct  494  KTCIICITEYTEGDKLRVLPCSHEYHVHCIDRWLSE  529



>gb|KJB84438.1| hypothetical protein B456_N0257002, partial [Gossypium raimondii]
Length=86

 Score = 61.2 bits (147),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = -1

Query  288  CYICLAEYEDGDKLRVLPCHHEYHMICIDKWLKE  187
            CYICL EYE+GD +R+  C+HE+H  CIDKWLKE
Sbjct  1    CYICLLEYEEGDSMRIFACNHEFHRTCIDKWLKE  34



>ref|XP_005832378.1| hypothetical protein GUITHDRAFT_163270 [Guillardia theta CCMP2712]
 gb|EKX45398.1| hypothetical protein GUITHDRAFT_163270 [Guillardia theta CCMP2712]
Length=206

 Score = 63.2 bits (152),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 33/96 (34%), Positives = 50/96 (52%), Gaps = 10/96 (10%)
 Frame = -1

Query  471  SISRIIMLAEALFEVIDEIH---RQSFSLSTFSLPAPEATVDAFPLKYHKTLDPVENALG  301
            S  R+++L EAL E ++ +    R    +    L  P + V + P       D       
Sbjct  73   SADRMMLLMEALVEFLEAVEGGARGGTLVPQADLRTPTSVVASLPTCRFSGGD-------  125

Query  300  DTQQCYICLAEYEDGDKLRVLPCHHEYHMICIDKWL  193
            D+++CYICL+ +E  + +R LPC HE+H  CIDKWL
Sbjct  126  DSKECYICLSNFETDELIRKLPCQHEFHAHCIDKWL  161



>ref|XP_002962565.1| hypothetical protein SELMODRAFT_67002, partial [Selaginella moellendorffii]
 gb|EFJ36028.1| hypothetical protein SELMODRAFT_67002, partial [Selaginella moellendorffii]
Length=290

 Score = 64.3 bits (155),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 35/56 (63%), Gaps = 3/56 (5%)
 Frame = -1

Query  360  VDAFPLKYHKTLDPVENALGDTQQCYICLAEYEDGDKLRVLPCHHEYHMICIDKWL  193
            V A P    K L    +  G +  C ICL EYE G+KLRVLPCHH++H  C+D+WL
Sbjct  207  VKALPTVIFKCLG---DGQGTSDTCAICLEEYESGEKLRVLPCHHDFHAACVDQWL  259



>ref|XP_005745220.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like [Pundamilia 
nyererei]
Length=361

 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 31/83 (37%), Positives = 48/83 (58%), Gaps = 6/83 (7%)
 Frame = -1

Query  435  FEVIDEIHRQSFSLSTFSLPAPEATVDAFPLKYHKTLDPVENALGDTQQCYICLAEYEDG  256
            +E + E+  +  ++ T  L A +  +  FP K  +         G   QC IC+ +Y DG
Sbjct  261  YESLLELEERQGAVRTNQLSATD--IQRFPTKVFQGC----GGSGGNTQCQICVCDYSDG  314

Query  255  DKLRVLPCHHEYHMICIDKWLKE  187
            +KLR+LPC H+YH+ CID+WLK+
Sbjct  315  EKLRILPCFHDYHVHCIDQWLKD  337



>ref|XP_008296350.1| PREDICTED: E3 ubiquitin-protein ligase RLIM-like isoform X1 [Stegastes 
partitus]
Length=409

 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 37/58 (64%), Gaps = 5/58 (9%)
 Frame = -1

Query  360  VDAFPLKYHKTLDPVENALGDTQQCYICLAEYEDGDKLRVLPCHHEYHMICIDKWLKE  187
            +  FP K  ++     N+     QC IC  EY DG+KLR+LPC H+YH+ CID+WLK+
Sbjct  335  IQRFPTKTFQSASSAGNS-----QCQICFCEYTDGEKLRMLPCFHDYHVPCIDRWLKD  387



>ref|XP_008296351.1| PREDICTED: E3 ubiquitin-protein ligase RLIM-like isoform X2 [Stegastes 
partitus]
Length=408

 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 37/58 (64%), Gaps = 5/58 (9%)
 Frame = -1

Query  360  VDAFPLKYHKTLDPVENALGDTQQCYICLAEYEDGDKLRVLPCHHEYHMICIDKWLKE  187
            +  FP K  ++     N+     QC IC  EY DG+KLR+LPC H+YH+ CID+WLK+
Sbjct  334  IQRFPTKTFQSASSAGNS-----QCQICFCEYTDGEKLRMLPCFHDYHVPCIDRWLKD  386



>ref|XP_001923015.2| PREDICTED: uncharacterized protein wu:fb39e10 [Danio rerio]
Length=474

 Score = 64.3 bits (155),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 43/61 (70%), Gaps = 5/61 (8%)
 Frame = -1

Query  369  EATVDAFPLKYHKTLDPVENALGDTQQCYICLAEYEDGDKLRVLPCHHEYHMICIDKWLK  190
            +A ++  P+K   T DP  +A G T  C IC +EY+ G++LR+LPC H+YH+ CID+WLK
Sbjct  401  KAEIERLPIK---TYDPTHSA-GKTD-CQICFSEYKAGERLRMLPCLHDYHVKCIDRWLK  455

Query  189  E  187
            E
Sbjct  456  E  456



>ref|XP_007907222.1| PREDICTED: topoisomerase I damage affected protein 7-like isoform 
X1 [Callorhinchus milii]
Length=659

 Score = 64.3 bits (155),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 40/59 (68%), Gaps = 5/59 (8%)
 Frame = -1

Query  366  ATVDAFPLKYHKTLDPVENALGDTQQCYICLAEYEDGDKLRVLPCHHEYHMICIDKWLK  190
            A ++  P K+    DP  +A G TQ CYIC ++Y   +KLR+LPC H+YH+ CID+WLK
Sbjct  586  AEINRLPTKF---FDPA-HAAGKTQ-CYICFSDYLPTEKLRILPCIHDYHIQCIDRWLK  639



>gb|ABI35905.1| ring finger protein 13 [Bubalus bubalis]
Length=44

 Score = 58.9 bits (141),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 23/34 (68%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = -1

Query  288  CYICLAEYEDGDKLRVLPCHHEYHMICIDKWLKE  187
            C ICL EYEDGDKLR+LPC H YH  C+D WL +
Sbjct  1    CAICLDEYEDGDKLRILPCSHAYHCKCVDPWLTK  34



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1401010927050