BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF008N24

Length=730
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006360245.1|  PREDICTED: uncharacterized protein At4g06744...    112   4e-25   
ref|XP_009588943.1|  PREDICTED: uncharacterized protein At4g06744...    111   1e-24   Nicotiana tomentosiformis
ref|XP_009793223.1|  PREDICTED: uncharacterized protein At4g06744...    110   2e-24   Nicotiana sylvestris
emb|CDP02523.1|  unnamed protein product                                110   3e-24   Coffea canephora [robusta coffee]
gb|KDP47121.1|  hypothetical protein JCGZ_22117                         108   9e-24   Jatropha curcas
ref|XP_004233445.1|  PREDICTED: uncharacterized protein At4g06744...    108   1e-23   Solanum lycopersicum
gb|EYU44430.1|  hypothetical protein MIMGU_mgv1a005057mg                105   1e-22   Erythranthe guttata [common monkey flower]
gb|KDP47120.1|  hypothetical protein JCGZ_22116                         103   5e-22   Jatropha curcas
ref|XP_002885307.1|  leucine-rich repeat family protein                 103   5e-22   Arabidopsis lyrata subsp. lyrata
ref|XP_006406513.1|  hypothetical protein EUTSA_v10020680mg             102   9e-22   Eutrema salsugineum [saltwater cress]
ref|XP_011099103.1|  PREDICTED: uncharacterized protein At4g06744...    102   1e-21   Sesamum indicum [beniseed]
emb|CDX99236.1|  BnaC05g33510D                                          101   2e-21   
emb|CDX92324.1|  BnaA05g20830D                                          101   3e-21   
ref|XP_009145802.1|  PREDICTED: uncharacterized protein At4g06744       101   3e-21   Brassica rapa
ref|XP_004170987.1|  PREDICTED: uncharacterized protein At4g06744...    100   4e-21   
gb|KDO59787.1|  hypothetical protein CISIN_1g011101mg                   101   4e-21   Citrus sinensis [apfelsine]
dbj|BAH19934.1|  AT1G49750                                            99.0    5e-21   Arabidopsis thaliana [mouse-ear cress]
gb|AEI72268.1|  leucine-rich repeat family protein                      100   6e-21   Citrus trifoliata [hardy orange]
ref|XP_010519298.1|  PREDICTED: uncharacterized protein At4g06744...    100   7e-21   Tarenaya hassleriana [spider flower]
ref|XP_011004900.1|  PREDICTED: uncharacterized protein At4g06744...  99.8    7e-21   Populus euphratica
ref|XP_006422961.1|  hypothetical protein CICLE_v10028242mg             100   8e-21   Citrus clementina [clementine]
ref|XP_004137107.1|  PREDICTED: uncharacterized protein At4g06744...    100   8e-21   
ref|NP_188563.1|  leucine-rich repeat-containing protein                100   9e-21   Arabidopsis thaliana [mouse-ear cress]
gb|KGN43906.1|  hypothetical protein Csa_7G073420                       100   1e-20   Cucumis sativus [cucumbers]
ref|XP_008454973.1|  PREDICTED: uncharacterized protein At4g06744...  99.8    2e-20   
ref|NP_175397.1|  leucine-rich repeat (LRR) family protein            99.0    3e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006393218.1|  hypothetical protein EUTSA_v10011424mg           99.0    3e-20   Eutrema salsugineum [saltwater cress]
gb|KCW54905.1|  hypothetical protein EUGRSUZ_I00883                   98.2    5e-20   Eucalyptus grandis [rose gum]
ref|XP_002518709.1|  serine-threonine protein kinase, plant-type,...  98.6    6e-20   Ricinus communis
ref|XP_006356575.1|  PREDICTED: uncharacterized protein At4g06744...  97.4    7e-20   Solanum tuberosum [potatoes]
ref|XP_010028214.1|  PREDICTED: uncharacterized protein At4g06744...  97.8    9e-20   Eucalyptus grandis [rose gum]
ref|XP_010555995.1|  PREDICTED: uncharacterized protein At4g06744...  97.4    9e-20   Tarenaya hassleriana [spider flower]
emb|CDY43618.1|  BnaC09g17570D                                        94.0    1e-19   Brassica napus [oilseed rape]
ref|XP_011004883.1|  PREDICTED: uncharacterized protein At4g06744...  95.9    2e-19   Populus euphratica
gb|KHN05611.1|  Hypothetical protein glysoja_047056                   95.9    2e-19   Glycine soja [wild soybean]
ref|XP_007157235.1|  hypothetical protein PHAVU_002G054000g           95.9    2e-19   Phaseolus vulgaris [French bean]
ref|XP_003538630.1|  PREDICTED: uncharacterized protein At4g06744...  95.9    2e-19   Glycine max [soybeans]
gb|KFK39280.1|  hypothetical protein AALP_AA3G224000                  96.3    2e-19   Arabis alpina [alpine rockcress]
gb|KJB77660.1|  hypothetical protein B456_012G149500                  95.9    3e-19   Gossypium raimondii
gb|KCW54907.1|  hypothetical protein EUGRSUZ_I00886                   93.6    3e-19   Eucalyptus grandis [rose gum]
ref|XP_006307323.1|  hypothetical protein CARUB_v10008944mg           96.3    3e-19   Capsella rubella
ref|XP_009762067.1|  PREDICTED: uncharacterized protein At4g06744...  95.5    4e-19   Nicotiana sylvestris
ref|XP_004248758.1|  PREDICTED: uncharacterized protein At4g06744...  94.7    6e-19   Solanum lycopersicum
ref|XP_002894215.1|  hypothetical protein ARALYDRAFT_474107           95.1    6e-19   
emb|CDY20865.1|  BnaC05g26270D                                        95.5    6e-19   Brassica napus [oilseed rape]
ref|XP_009145107.1|  PREDICTED: uncharacterized protein At4g06744...  95.5    7e-19   Brassica rapa
emb|CDY29337.1|  BnaA05g16040D                                        94.4    1e-18   Brassica napus [oilseed rape]
ref|XP_006433575.1|  hypothetical protein CICLE_v10003526mg           93.2    2e-18   Citrus clementina [clementine]
ref|XP_006472980.1|  PREDICTED: uncharacterized protein At4g06744...  92.8    2e-18   
ref|XP_010691719.1|  PREDICTED: uncharacterized protein At4g06744...  93.2    2e-18   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002510174.1|  serine-threonine protein kinase, plant-type,...  92.8    3e-18   Ricinus communis
ref|XP_009622015.1|  PREDICTED: uncharacterized protein At4g06744...  93.2    3e-18   Nicotiana tomentosiformis
ref|XP_011467740.1|  PREDICTED: uncharacterized protein At4g06744     93.2    3e-18   Fragaria vesca subsp. vesca
ref|XP_008236576.1|  PREDICTED: uncharacterized protein At4g06744...  92.8    4e-18   
gb|KDP24991.1|  hypothetical protein JCGZ_23974                       92.0    4e-18   Jatropha curcas
ref|XP_007201703.1|  hypothetical protein PRUPE_ppa004109mg           92.8    5e-18   Prunus persica
ref|XP_011088225.1|  PREDICTED: uncharacterized protein At4g06744...  92.0    6e-18   Sesamum indicum [beniseed]
ref|XP_010479447.1|  PREDICTED: leucine-rich repeat extensin-like...  92.4    7e-18   Camelina sativa [gold-of-pleasure]
gb|KDP24986.1|  hypothetical protein JCGZ_23969                       91.3    7e-18   Jatropha curcas
ref|XP_002282482.2|  PREDICTED: uncharacterized protein At4g06744...  91.7    1e-17   Vitis vinifera
gb|KDP41695.1|  hypothetical protein JCGZ_16102                       90.9    1e-17   Jatropha curcas
gb|KFK35980.1|  hypothetical protein AALP_AA4G062700                  91.3    1e-17   Arabis alpina [alpine rockcress]
ref|XP_007227115.1|  hypothetical protein PRUPE_ppa025707mg           91.3    1e-17   
ref|XP_010461823.1|  PREDICTED: uncharacterized protein At4g06744...  91.3    2e-17   Camelina sativa [gold-of-pleasure]
ref|XP_010500525.1|  PREDICTED: leucine-rich repeat extensin-like...  91.3    2e-17   Camelina sativa [gold-of-pleasure]
gb|KDO37099.1|  hypothetical protein CISIN_1g037101mg                 89.7    2e-17   Citrus sinensis [apfelsine]
ref|XP_006374888.1|  hypothetical protein POPTR_0014s02430g           90.1    2e-17   Populus trichocarpa [western balsam poplar]
gb|KJB32334.1|  hypothetical protein B456_005G236100                  90.1    2e-17   Gossypium raimondii
ref|XP_006297641.1|  hypothetical protein CARUB_v10013659mg           89.7    4e-17   Capsella rubella
gb|KJB14612.1|  hypothetical protein B456_002G134000                  89.4    4e-17   Gossypium raimondii
ref|XP_004137106.1|  PREDICTED: uncharacterized protein At4g06744...  88.6    6e-17   
gb|KHN30415.1|  Hypothetical protein glysoja_033153                   88.2    7e-17   Glycine soja [wild soybean]
ref|XP_008220262.1|  PREDICTED: uncharacterized protein At4g06744...  89.0    7e-17   Prunus mume [ume]
ref|XP_002300228.2|  hypothetical protein POPTR_0001s30990g           88.6    8e-17   
gb|KGN43905.1|  hypothetical protein Csa_7G073410                     89.0    9e-17   Cucumis sativus [cucumbers]
ref|XP_003516778.2|  PREDICTED: uncharacterized protein At4g06744...  88.6    1e-16   Glycine max [soybeans]
ref|XP_004304027.1|  PREDICTED: uncharacterized protein At4g06744...  88.2    1e-16   Fragaria vesca subsp. vesca
ref|XP_004171357.1|  PREDICTED: uncharacterized protein At4g06744...  88.6    1e-16   
gb|KJB12258.1|  hypothetical protein B456_002G008600                  88.6    1e-16   Gossypium raimondii
ref|XP_010263447.1|  PREDICTED: uncharacterized protein At4g06744...  88.6    1e-16   Nelumbo nucifera [Indian lotus]
ref|XP_008393778.1|  PREDICTED: uncharacterized protein At4g06744...  87.8    2e-16   
ref|XP_011000139.1|  PREDICTED: uncharacterized protein At4g06744...  87.4    2e-16   Populus euphratica
ref|XP_007017157.1|  Leucine-rich repeat family protein               87.0    3e-16   
ref|XP_011000899.1|  PREDICTED: uncharacterized protein At4g06744...  86.7    3e-16   Populus euphratica
emb|CDO97205.1|  unnamed protein product                              87.0    4e-16   Coffea canephora [robusta coffee]
ref|XP_002518710.1|  serine-threonine protein kinase, plant-type,...  86.3    4e-16   
ref|XP_008454972.1|  PREDICTED: uncharacterized protein At4g06744...  86.3    5e-16   Cucumis melo [Oriental melon]
emb|CDP01296.1|  unnamed protein product                              85.9    6e-16   Coffea canephora [robusta coffee]
ref|XP_010107857.1|  Uncharacterized protein L484_027444              85.9    6e-16   Morus notabilis
ref|XP_011029410.1|  PREDICTED: uncharacterized protein At4g06744...  85.9    6e-16   Populus euphratica
emb|CDY32853.1|  BnaC08g02750D                                        86.3    7e-16   Brassica napus [oilseed rape]
ref|XP_007157716.1|  hypothetical protein PHAVU_002G092300g           85.5    7e-16   Phaseolus vulgaris [French bean]
gb|KJB32335.1|  hypothetical protein B456_005G236200                  85.5    8e-16   Gossypium raimondii
ref|XP_010507626.1|  PREDICTED: uncharacterized protein At4g06744...  85.5    1e-15   Camelina sativa [gold-of-pleasure]
ref|XP_009107284.1|  PREDICTED: uncharacterized protein At4g06744     85.5    1e-15   Brassica rapa
ref|XP_010688602.1|  PREDICTED: uncharacterized protein At4g06744     85.1    2e-15   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008236564.1|  PREDICTED: uncharacterized protein At4g06744...  84.7    2e-15   Prunus mume [ume]
gb|AIE39583.1|  LRR receptor-like protein kinase                      80.5    2e-15   Humulus lupulus [common hop]
ref|XP_007042489.1|  Leucine-rich repeat family protein, putative     84.7    2e-15   
ref|XP_006346520.1|  PREDICTED: uncharacterized protein At4g06744...  84.0    3e-15   Solanum tuberosum [potatoes]
emb|CDY16514.1|  BnaA08g02530D                                        84.3    3e-15   Brassica napus [oilseed rape]
ref|XP_004231393.1|  PREDICTED: uncharacterized protein At4g06744     83.6    4e-15   Solanum lycopersicum
ref|XP_010270768.1|  PREDICTED: uncharacterized protein At4g06744...  84.0    4e-15   Nelumbo nucifera [Indian lotus]
ref|XP_010270780.1|  PREDICTED: uncharacterized protein At4g06744...  84.0    5e-15   Nelumbo nucifera [Indian lotus]
ref|XP_002313863.2|  hypothetical protein POPTR_0009s10140g           83.2    6e-15   
ref|XP_009359966.1|  PREDICTED: uncharacterized protein At4g06744...  83.6    6e-15   Pyrus x bretschneideri [bai li]
ref|XP_003607916.1|  Receptor protein kinase                          82.0    7e-15   
ref|XP_007201495.1|  hypothetical protein PRUPE_ppa014775mg           82.4    1e-14   
gb|KEH30896.1|  Serine/Threonine kinase, plant-type protein, puta...  81.6    2e-14   Medicago truncatula
ref|XP_010263446.1|  PREDICTED: uncharacterized protein At4g06744...  81.6    2e-14   Nelumbo nucifera [Indian lotus]
gb|AES90113.2|  Serine/Threonine kinase, plant-type protein, puta...  81.6    2e-14   Medicago truncatula
ref|XP_007042487.1|  Leucine-rich repeat family protein, putative     80.9    3e-14   
ref|XP_003528523.1|  PREDICTED: uncharacterized protein At4g06744...  80.9    3e-14   Glycine max [soybeans]
ref|XP_010487869.1|  PREDICTED: uncharacterized protein At4g06744...  81.3    4e-14   Camelina sativa [gold-of-pleasure]
ref|XP_011069732.1|  PREDICTED: uncharacterized protein At4g06744...  80.9    4e-14   Sesamum indicum [beniseed]
ref|XP_009605357.1|  PREDICTED: uncharacterized protein At4g06744...  80.5    4e-14   Nicotiana tomentosiformis
gb|KJB14611.1|  hypothetical protein B456_002G133900                  80.5    5e-14   Gossypium raimondii
ref|XP_010094650.1|  Uncharacterized protein L484_008882              80.5    5e-14   Morus notabilis
gb|KCW68710.1|  hypothetical protein EUGRSUZ_F02313                   79.7    6e-14   Eucalyptus grandis [rose gum]
ref|XP_007157715.1|  hypothetical protein PHAVU_002G092200g           80.5    6e-14   Phaseolus vulgaris [French bean]
ref|XP_006354850.1|  PREDICTED: uncharacterized protein At4g06744...  79.3    8e-14   Solanum tuberosum [potatoes]
ref|XP_009345138.1|  PREDICTED: uncharacterized protein At4g06744...  79.7    8e-14   Pyrus x bretschneideri [bai li]
ref|XP_004505256.1|  PREDICTED: uncharacterized protein At4g06744...  79.7    9e-14   Cicer arietinum [garbanzo]
ref|XP_010061722.1|  PREDICTED: uncharacterized protein At4g06744...  79.7    1e-13   Eucalyptus grandis [rose gum]
ref|XP_004291077.1|  PREDICTED: uncharacterized protein At4g06744...  79.7    1e-13   Fragaria vesca subsp. vesca
ref|XP_009592678.1|  PREDICTED: uncharacterized protein At4g06744...  79.3    1e-13   Nicotiana tomentosiformis
ref|XP_009784047.1|  PREDICTED: uncharacterized protein At4g06744...  79.3    1e-13   Nicotiana sylvestris
ref|XP_010466072.1|  PREDICTED: uncharacterized protein At4g06744...  79.0    2e-13   Camelina sativa [gold-of-pleasure]
ref|XP_004238131.2|  PREDICTED: probable inactive receptor kinase...  79.7    2e-13   
ref|XP_008342943.1|  PREDICTED: uncharacterized protein At4g06744...  78.2    3e-13   
ref|XP_003529407.1|  PREDICTED: uncharacterized protein At4g06744...  78.6    3e-13   Glycine max [soybeans]
ref|XP_004499033.1|  PREDICTED: uncharacterized protein At4g06744...  77.8    3e-13   Cicer arietinum [garbanzo]
gb|KHN43047.1|  Hypothetical protein glysoja_007577                   78.6    3e-13   Glycine soja [wild soybean]
ref|XP_008236575.1|  PREDICTED: uncharacterized protein At4g06744...  78.2    3e-13   Prunus mume [ume]
ref|XP_010094651.1|  Uncharacterized protein L484_008883              78.2    3e-13   Morus notabilis
ref|XP_010554992.1|  PREDICTED: uncharacterized protein At4g06744     77.8    4e-13   Tarenaya hassleriana [spider flower]
gb|KHN12808.1|  Hypothetical protein glysoja_008771                   75.5    4e-13   Glycine soja [wild soybean]
ref|XP_006422962.1|  hypothetical protein CICLE_v10028712mg           77.0    6e-13   
gb|KDP41694.1|  hypothetical protein JCGZ_16101                       77.4    6e-13   Jatropha curcas
gb|KDO59786.1|  hypothetical protein CISIN_1g048561mg                 77.0    7e-13   Citrus sinensis [apfelsine]
ref|NP_849339.1|  Leucine-rich repeat-containing protein              77.0    7e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007160878.1|  hypothetical protein PHAVU_001G024400g           77.0    7e-13   Phaseolus vulgaris [French bean]
ref|XP_006487027.1|  PREDICTED: uncharacterized protein At4g06744...  77.0    8e-13   Citrus sinensis [apfelsine]
ref|XP_004142874.1|  PREDICTED: uncharacterized protein At4g06744...  77.0    9e-13   Cucumis sativus [cucumbers]
ref|XP_010523006.1|  PREDICTED: uncharacterized protein At4g06744...  76.6    9e-13   Tarenaya hassleriana [spider flower]
gb|KFK39606.1|  hypothetical protein AALP_AA3G265800                  75.9    1e-12   Arabis alpina [alpine rockcress]
ref|XP_003555862.1|  PREDICTED: uncharacterized protein At4g06744...  76.3    2e-12   Glycine max [soybeans]
ref|XP_009768848.1|  PREDICTED: uncharacterized protein At4g06744...  75.5    2e-12   Nicotiana sylvestris
ref|XP_009617390.1|  PREDICTED: uncharacterized protein At4g06744...  75.5    2e-12   
ref|XP_003550327.1|  PREDICTED: uncharacterized protein At4g06744...  75.5    2e-12   Glycine max [soybeans]
ref|XP_003545325.1|  PREDICTED: uncharacterized protein At4g06744...  75.5    3e-12   Glycine max [soybeans]
gb|KHN22492.1|  Hypothetical protein glysoja_041167                   75.1    3e-12   Glycine soja [wild soybean]
ref|XP_008456159.1|  PREDICTED: uncharacterized protein At4g06744...  74.3    3e-12   Cucumis melo [Oriental melon]
gb|ADN33724.1|  LRR-family protein                                    75.1    3e-12   Cucumis melo subsp. melo
ref|XP_002874478.1|  leucine-rich repeat family protein               75.1    3e-12   
ref|XP_008444596.1|  PREDICTED: uncharacterized protein At4g06744...  75.1    4e-12   
ref|XP_004141388.1|  PREDICTED: uncharacterized protein At4g06744...  74.3    6e-12   Cucumis sativus [cucumbers]
ref|XP_010066095.1|  PREDICTED: uncharacterized protein At4g06744...  73.9    6e-12   Eucalyptus grandis [rose gum]
ref|XP_010065987.1|  PREDICTED: uncharacterized protein At4g06744...  74.3    6e-12   Eucalyptus grandis [rose gum]
ref|XP_008452581.1|  PREDICTED: uncharacterized protein At4g06744...  74.3    7e-12   Cucumis melo [Oriental melon]
ref|XP_004505255.1|  PREDICTED: uncharacterized protein At4g06744...  73.9    7e-12   Cicer arietinum [garbanzo]
gb|EYU37650.1|  hypothetical protein MIMGU_mgv11b016249mg             73.9    9e-12   Erythranthe guttata [common monkey flower]
ref|XP_003589141.1|  hypothetical protein MTR_1g018910                73.6    9e-12   Medicago truncatula
ref|XP_010421726.1|  PREDICTED: uncharacterized protein At4g06744     73.2    1e-11   Camelina sativa [gold-of-pleasure]
ref|XP_007017156.1|  LRR-family protein                               73.2    1e-11   
ref|XP_010455221.1|  PREDICTED: uncharacterized protein At4g06744...  73.2    1e-11   Camelina sativa [gold-of-pleasure]
ref|XP_010438766.1|  PREDICTED: uncharacterized protein At4g06744     73.2    1e-11   Camelina sativa [gold-of-pleasure]
ref|XP_009396708.1|  PREDICTED: uncharacterized protein At4g06744...  72.8    2e-11   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002282474.2|  PREDICTED: uncharacterized protein At4g06744     72.8    2e-11   Vitis vinifera
gb|EPS58531.1|  hypothetical protein M569_16282                       72.0    2e-11   Genlisea aurea
ref|XP_010664552.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  72.4    3e-11   Vitis vinifera
ref|XP_011074595.1|  PREDICTED: uncharacterized protein At4g06744...  72.4    3e-11   
emb|CAN61023.1|  hypothetical protein VITISV_001143                   72.4    3e-11   Vitis vinifera
ref|XP_010664550.1|  PREDICTED: uncharacterized protein At4g06744...  71.6    4e-11   Vitis vinifera
ref|XP_002284965.1|  PREDICTED: uncharacterized protein At4g06744...  72.0    4e-11   Vitis vinifera
ref|XP_004140710.1|  PREDICTED: uncharacterized protein At4g06744...  71.6    4e-11   Cucumis sativus [cucumbers]
ref|XP_004168435.1|  PREDICTED: uncharacterized protein At4g06744...  71.6    5e-11   
ref|XP_004953109.1|  PREDICTED: uncharacterized protein At4g06744...  71.6    5e-11   Setaria italica
ref|XP_002452450.1|  hypothetical protein SORBIDRAFT_04g026020        71.2    7e-11   Sorghum bicolor [broomcorn]
ref|XP_008798694.1|  PREDICTED: uncharacterized protein At4g06744...  71.2    8e-11   
dbj|BAJ86461.1|  predicted protein                                    70.9    9e-11   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006289202.1|  hypothetical protein CARUB_v10002650mg           70.9    9e-11   Capsella rubella
ref|XP_006397360.1|  hypothetical protein EUTSA_v10028721mg           70.5    1e-10   Eutrema salsugineum [saltwater cress]
gb|EMT03089.1|  hypothetical protein F775_11041                       70.5    1e-10   
ref|XP_009417193.1|  PREDICTED: uncharacterized protein At4g06744...  70.5    1e-10   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009395500.1|  PREDICTED: uncharacterized protein At4g06744...  70.1    1e-10   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003575361.1|  PREDICTED: uncharacterized protein At4g06744...  69.7    2e-10   Brachypodium distachyon [annual false brome]
gb|EYU25462.1|  hypothetical protein MIMGU_mgv1a024676mg              69.7    2e-10   Erythranthe guttata [common monkey flower]
ref|XP_009394537.1|  PREDICTED: uncharacterized protein At4g06744...  69.3    3e-10   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003575360.1|  PREDICTED: uncharacterized protein At4g06744...  69.3    3e-10   
ref|XP_010932202.1|  PREDICTED: uncharacterized protein At4g06744...  68.9    4e-10   Elaeis guineensis
gb|ABS78922.1|  At4g06744-like protein                                66.2    4e-10   Arabidopsis lyrata subsp. petraea
gb|ABS78915.1|  At4g06744-like protein                                65.9    5e-10   Arabidopsis lyrata subsp. lyrata
gb|ABS78900.1|  At4g06744-like protein                                65.9    5e-10   Arabidopsis lyrata subsp. petraea
gb|ABS78911.1|  At4g06744-like protein                                65.9    5e-10   Arabidopsis lyrata subsp. lyrata
gb|ABS78910.1|  At4g06744-like protein                                65.9    5e-10   Arabidopsis lyrata subsp. lyrata
gb|ABS78901.1|  At4g06744-like protein                                65.9    6e-10   Arabidopsis lyrata subsp. petraea
gb|ABS78920.1|  At4g06744-like protein                                65.9    6e-10   Arabidopsis lyrata subsp. petraea
gb|ABS78905.1|  At4g06744-like protein                                65.5    6e-10   Arabidopsis lyrata subsp. petraea
gb|ABS78899.1|  At4g06744-like protein                                65.1    1e-09   Arabidopsis halleri subsp. halleri
gb|ABS78902.1|  At4g06744-like protein                                64.7    1e-09   Arabidopsis lyrata subsp. petraea
ref|XP_007199295.1|  hypothetical protein PRUPE_ppa023082mg           67.4    1e-09   
ref|XP_009141268.1|  PREDICTED: uncharacterized protein At4g06744...  67.4    1e-09   Brassica rapa
gb|AFW62989.1|  leucine-rich repeat (LRR) family protein              67.4    1e-09   
ref|XP_004953107.1|  PREDICTED: uncharacterized protein At4g06744...  67.0    1e-09   
gb|AFW62990.1|  leucine-rich repeat (LRR) family protein              67.0    2e-09   
gb|ABS78906.1|  At4g06744-like protein                                64.3    2e-09   Arabidopsis lyrata subsp. petraea
ref|XP_008796513.1|  PREDICTED: uncharacterized protein At4g06744...  67.0    2e-09   
gb|ACF84038.1|  unknown                                               67.0    2e-09   Zea mays [maize]
ref|NP_001241706.1|  uncharacterized protein LOC100856884             67.0    2e-09   
gb|ACF79045.1|  unknown                                               67.0    2e-09   Zea mays [maize]
ref|NP_001148637.1|  LOC100282253                                     66.6    2e-09   
ref|XP_010927582.1|  PREDICTED: uncharacterized protein At4g06744...  66.6    2e-09   
ref|XP_008677766.1|  PREDICTED: uncharacterized protein LOC100856...  66.2    3e-09   
ref|XP_006647518.1|  PREDICTED: uncharacterized protein At4g06744...  65.5    5e-09   Oryza brachyantha
ref|XP_004976154.1|  PREDICTED: uncharacterized protein At4g06744...  65.5    6e-09   Setaria italica
ref|XP_010928365.1|  PREDICTED: uncharacterized protein At4g06744...  65.5    6e-09   Elaeis guineensis
gb|ACG34018.1|  protein binding protein                               65.1    7e-09   Zea mays [maize]
ref|XP_002446758.1|  hypothetical protein SORBIDRAFT_06g021870        64.7    1e-08   Sorghum bicolor [broomcorn]
ref|XP_004167460.1|  PREDICTED: uncharacterized protein At4g06744...  64.7    1e-08   
gb|AFW72330.1|  leucine-rich repeat (LRR) family protein              63.2    1e-08   
ref|XP_008663372.1|  PREDICTED: uncharacterized protein At4g06744...  63.9    2e-08   
gb|AEV41070.1|  uncharacterized protein At4g06744 precursor           63.2    3e-08   Oryza minuta
gb|AEV41116.1|  uncharacterized protein At4g06744 precursor           63.2    3e-08   Oryza officinalis
gb|EAY86685.1|  hypothetical protein OsI_08067                        63.2    3e-08   Oryza sativa Indica Group [Indian rice]
gb|AEV40972.1|  uncharacterized protein At4g06744 precursor           63.2    3e-08   Oryza punctata
ref|XP_004140807.1|  PREDICTED: uncharacterized protein LOC101203557  63.5    4e-08   
gb|AEV41023.1|  uncharacterized protein At4g06744 precursor           62.8    4e-08   Oryza minuta
gb|EAY86686.1|  hypothetical protein OsI_08068                        62.8    4e-08   Oryza sativa Indica Group [Indian rice]
gb|EEC73254.1|  hypothetical protein OsI_07372                        62.4    5e-08   Oryza sativa Indica Group [Indian rice]
ref|NP_001141180.1|  uncharacterized protein LOC100273267 precursor   62.4    6e-08   Zea mays [maize]
ref|XP_010227187.1|  PREDICTED: probable LRR receptor-like serine...  62.8    6e-08   
dbj|BAD21636.1|  leucine-rich repeat-like protein                     62.4    7e-08   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006653860.1|  PREDICTED: uncharacterized protein At4g06744...  61.6    1e-07   Oryza brachyantha
ref|XP_008799889.1|  PREDICTED: uncharacterized protein At4g06744...  61.2    1e-07   Phoenix dactylifera
ref|XP_009413340.1|  PREDICTED: uncharacterized protein At4g06744...  60.8    2e-07   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003580786.1|  PREDICTED: uncharacterized protein At4g06744     60.5    3e-07   Brachypodium distachyon [annual false brome]
ref|NP_001150111.1|  protein binding protein precursor                60.1    3e-07   
ref|XP_009144429.1|  PREDICTED: pollen-specific leucine-rich repe...  60.1    3e-07   Brassica rapa
ref|XP_006653579.1|  PREDICTED: uncharacterized protein At4g06744...  60.1    4e-07   Oryza brachyantha
ref|XP_006855188.1|  hypothetical protein AMTR_s00051p00142580        59.7    5e-07   Amborella trichopoda
emb|CDY72552.1|  BnaCnng78240D                                        59.3    7e-07   Brassica napus [oilseed rape]
emb|CDY18974.1|  BnaC01g20940D                                        59.3    7e-07   Brassica napus [oilseed rape]
ref|XP_004960235.1|  PREDICTED: uncharacterized protein At4g06744...  59.3    7e-07   
emb|CAE02949.1|  OSJNBa0014K14.21                                     58.9    8e-07   Oryza sativa Japonica Group [Japonica rice]
gb|EEE61292.1|  hypothetical protein OsJ_15379                        58.9    9e-07   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008456145.1|  PREDICTED: uncharacterized protein At4g06744...  58.5    1e-06   Cucumis melo [Oriental melon]
dbj|BAJ91151.1|  predicted protein                                    58.2    2e-06   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMT08852.1|  hypothetical protein F775_11606                       57.8    2e-06   
dbj|BAJ86489.1|  predicted protein                                    57.8    3e-06   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDY49661.1|  BnaC09g41390D                                        57.4    3e-06   Brassica napus [oilseed rape]
gb|EMT04546.1|  hypothetical protein F775_44003                       57.4    3e-06   
gb|EMS59107.1|  hypothetical protein TRIUR3_04108                     57.4    3e-06   Triticum urartu
gb|EMS61305.1|  hypothetical protein TRIUR3_11917                     57.4    3e-06   Triticum urartu
ref|XP_002447298.1|  hypothetical protein SORBIDRAFT_06g032310        56.2    7e-06   Sorghum bicolor [broomcorn]
ref|XP_006648837.1|  PREDICTED: uncharacterized protein At4g06744...  56.2    8e-06   Oryza brachyantha
gb|ACG42798.1|  leucine-rich repeat, plant specific                   55.8    1e-05   Zea mays [maize]
ref|XP_007285579.1|  aldo/keto reductase, putative                    55.8    1e-05   
ref|NP_001141186.1|  leucine-rich repeat (LRR) family protein pre...  55.5    1e-05   Zea mays [maize]
gb|EQB58412.1|  RAM signaling pathway protein                         55.5    1e-05   Colletotrichum gloeosporioides Cg-14
ref|NP_001054210.2|  Os04g0670100                                     54.3    4e-05   
gb|EEC78222.1|  hypothetical protein OsI_17861                        53.9    4e-05   Oryza sativa Indica Group [Indian rice]
gb|EAZ32358.1|  hypothetical protein OsJ_16568                        54.3    4e-05   Oryza sativa Japonica Group [Japonica rice]
emb|CAJ86091.1|  H0818H01.13                                          54.3    4e-05   Oryza sativa [red rice]
ref|XP_007152809.1|  hypothetical protein PHAVU_004G161500g           54.3    4e-05   Phaseolus vulgaris [French bean]
gb|AIE88270.1|  hypothetical protein OG_BBa0063K01.1                  53.9    4e-05   Oryza glaberrima
ref|XP_007601154.1|  crisp-1                                          52.4    1e-04   
gb|ENH81556.1|  leucine-rich repeat family protein                    52.4    1e-04   
ref|XP_001759047.1|  predicted protein                                51.6    2e-04   
ref|XP_002972291.1|  hypothetical protein SELMODRAFT_412903           50.4    6e-04   
ref|XP_002984203.1|  hypothetical protein SELMODRAFT_423462           50.4    6e-04   Selaginella moellendorffii
ref|XP_004512961.1|  PREDICTED: leucine-rich repeat extensin-like...  50.4    7e-04   Cicer arietinum [garbanzo]



>ref|XP_006360245.1| PREDICTED: uncharacterized protein At4g06744-like, partial [Solanum 
tuberosum]
Length=387

 Score =   112 bits (279),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 61/112 (54%), Positives = 72/112 (64%), Gaps = 4/112 (4%)
 Frame = -1

Query  730  VPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFF  551
            VPE+LCK+  LEEL+L  NYFTQIGPECR L+E+ VLDI  NCI+DL NQR  + C+ FF
Sbjct  275  VPETLCKISSLEELTLKYNYFTQIGPECRKLVEENVLDIGMNCIIDLKNQRKPEECETFF  334

Query  550  LHYQKCPDHKSLLYVPCDI-DESPRKAGphphphrpykkhkRGSSTTYAALK  398
            L  + C D KSL YVPC I D S R +           +     STTYAALK
Sbjct  335  LQKRNCRDMKSLSYVPCKIHDFSSRNSSSGRAHTTGDART---RSTTYAALK  383



>ref|XP_009588943.1| PREDICTED: uncharacterized protein At4g06744-like [Nicotiana 
tomentosiformis]
Length=515

 Score =   111 bits (278),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 59/111 (53%), Positives = 76/111 (68%), Gaps = 5/111 (5%)
 Frame = -1

Query  730  VPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFF  551
            VPESLCKL  L++L+L  NYFTQ+GPECR L+++K+LDI  NC+LDL NQR  + C+ FF
Sbjct  404  VPESLCKLSHLQKLTLKFNYFTQVGPECRKLIKEKILDISMNCVLDLENQRKPEECEAFF  463

Query  550  LHYQKCPDHKSLLYVPCDIDE-SPRKAGphphphrpykkhkRGSSTTYAAL  401
            L  +KCPD +SL  VPC+IDE S R++              R  STTYAA+
Sbjct  464  LQPRKCPDMESLSKVPCNIDEFSSRQSS----GRAYRHHRARAHSTTYAAI  510



>ref|XP_009793223.1| PREDICTED: uncharacterized protein At4g06744-like [Nicotiana 
sylvestris]
Length=511

 Score =   110 bits (276),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 62/112 (55%), Positives = 75/112 (67%), Gaps = 10/112 (9%)
 Frame = -1

Query  730  VPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFF  551
            VPESLCKL  LE+L+L  NYFTQ+GPECR L+++KVLDI  NCILDL NQR  + C+ FF
Sbjct  403  VPESLCKLGHLEKLTLKFNYFTQVGPECRKLIKEKVLDISMNCILDLENQRKPEECESFF  462

Query  550  LHYQKCPDHKSLLYVPCDIDE--SPRKAGphphphrpykkhkRGSSTTYAAL  401
            L  +KCPD +SL  VPC+IDE  S R+               R  STTYAA+
Sbjct  463  LQPRKCPDMESLSKVPCNIDEFSSGRRP--------HRHLRARARSTTYAAI  506



>emb|CDP02523.1| unnamed protein product [Coffea canephora]
Length=488

 Score =   110 bits (274),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 64/113 (57%), Positives = 72/113 (64%), Gaps = 8/113 (7%)
 Frame = -1

Query  730  VPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFF  551
            VPESLC L DLE L L  NYFTQ+GPECR L+EKKVL++  NCILDLP QRS + CK FF
Sbjct  378  VPESLCILGDLEVLDLKFNYFTQVGPECRKLIEKKVLNVTMNCILDLPCQRSPEECKAFF  437

Query  550  LHYQKCPDHKSLLYVPCDIDES--PRKAGphphphrpykkhkRGSSTTYAALK  398
              +  CPD KSL YVPC I+ S  P +A  H              S TYAALK
Sbjct  438  SKHWTCPDPKSLNYVPCGINVSKGPPQASDHVPKRARP------PSPTYAALK  484



>gb|KDP47121.1| hypothetical protein JCGZ_22117 [Jatropha curcas]
Length=497

 Score =   108 bits (271),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 50/77 (65%), Positives = 61/77 (79%), Gaps = 0/77 (0%)
 Frame = -1

Query  730  VPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFF  551
            VPE +C+LK L+ LSLSGNYFTQ+GPECR L++ K LD+  NCILDLP+QRSA  C+DFF
Sbjct  383  VPELVCELKTLQNLSLSGNYFTQVGPECRKLIKAKRLDVRKNCILDLPDQRSAAQCRDFF  442

Query  550  LHYQKCPDHKSLLYVPC  500
               +KCP+ KSL  VPC
Sbjct  443  SKNRKCPNEKSLTIVPC  459



>ref|XP_004233445.1| PREDICTED: uncharacterized protein At4g06744-like [Solanum lycopersicum]
Length=464

 Score =   108 bits (269),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 58/112 (52%), Positives = 74/112 (66%), Gaps = 5/112 (4%)
 Frame = -1

Query  730  VPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFF  551
            VPE+LCK+  LEEL+L  NYFTQIGPECR L+E+ VL+I  NCI+DL NQR  + C+ FF
Sbjct  353  VPETLCKISSLEELTLKYNYFTQIGPECRKLVEENVLNIGMNCIIDLENQRKPEECEAFF  412

Query  550  LHYQKCPDHKSLLYVPCDIDE-SPRKAGphphphrpykkhkRGSSTTYAALK  398
            L  + C D KSL Y+PC + E S R +       R +    +  STTYAA+K
Sbjct  413  LQKRNCRDMKSLSYIPCKLHEFSSRNSS----ARRAHTGDAKARSTTYAAVK  460



>gb|EYU44430.1| hypothetical protein MIMGU_mgv1a005057mg [Erythranthe guttata]
Length=498

 Score =   105 bits (263),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 49/82 (60%), Positives = 63/82 (77%), Gaps = 0/82 (0%)
 Frame = -1

Query  730  VPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFF  551
            VPESLC+L+DL+EL+L+ NYFTQ+GP CR L++   LDI  NC+LDLP+QRSA  C+ FF
Sbjct  387  VPESLCRLRDLDELTLNHNYFTQVGPACRKLIKSGKLDIRVNCVLDLPSQRSAAECEAFF  446

Query  550  LHYQKCPDHKSLLYVPCDIDES  485
            L  Q CP+ +S+  VPC ID S
Sbjct  447  LKQQYCPNRESMNIVPCKIDYS  468



>gb|KDP47120.1| hypothetical protein JCGZ_22116 [Jatropha curcas]
Length=455

 Score =   103 bits (257),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 47/77 (61%), Positives = 59/77 (77%), Gaps = 0/77 (0%)
 Frame = -1

Query  730  VPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFF  551
            VPE +C+L +L+ LSLSGN+FTQ+GPECR L+  K +D+  NCILDLP QRSA  CK+FF
Sbjct  343  VPEMVCQLPNLQNLSLSGNFFTQVGPECRKLIMLKRIDVGQNCILDLPYQRSADECKEFF  402

Query  550  LHYQKCPDHKSLLYVPC  500
               + CP+ KSL YVPC
Sbjct  403  SKRRTCPNEKSLTYVPC  419



>ref|XP_002885307.1| leucine-rich repeat family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61566.1| leucine-rich repeat family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=494

 Score =   103 bits (258),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 45/80 (56%), Positives = 59/80 (74%), Gaps = 0/80 (0%)
 Frame = -1

Query  730  VPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFF  551
            +PE +C+L  L+ LSLS NYFTQ+GP+CR L+++K+LD+  NCILDL NQR+   C  FF
Sbjct  383  IPEIVCELSALKNLSLSSNYFTQVGPKCRTLIKRKILDVGMNCILDLANQRAPWECAKFF  442

Query  550  LHYQKCPDHKSLLYVPCDID  491
            L  Q CP++KS  YVPC  D
Sbjct  443  LRKQSCPNYKSFFYVPCGKD  462



>ref|XP_006406513.1| hypothetical protein EUTSA_v10020680mg [Eutrema salsugineum]
 gb|ESQ47966.1| hypothetical protein EUTSA_v10020680mg [Eutrema salsugineum]
Length=464

 Score =   102 bits (255),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 44/80 (55%), Positives = 59/80 (74%), Gaps = 0/80 (0%)
 Frame = -1

Query  730  VPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFF  551
            +PE +C+L  L+ +SLS NYFTQ+GP+CR L++KK+LD+  NCILDLPNQR+   C  FF
Sbjct  353  IPEMVCELSALKNVSLSFNYFTQVGPKCRKLIKKKILDVRMNCILDLPNQRTPWECAKFF  412

Query  550  LHYQKCPDHKSLLYVPCDID  491
            +  Q CP+ KS  Y+PC  D
Sbjct  413  MRKQNCPNSKSFFYIPCGKD  432



>ref|XP_011099103.1| PREDICTED: uncharacterized protein At4g06744-like [Sesamum indicum]
Length=487

 Score =   102 bits (255),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 53/88 (60%), Positives = 64/88 (73%), Gaps = 3/88 (3%)
 Frame = -1

Query  730  VPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFF  551
            VPE LC L  L EL+L  NYFTQ+GP+CR L+  K LDI  NCILDLP+QRSA  C+ FF
Sbjct  378  VPEPLCNLGSLIELTLKFNYFTQVGPKCRKLIMSKKLDISMNCILDLPSQRSAAECETFF  437

Query  550  LHYQKCPDHKSLL-YVPCDID--ESPRK  476
            L+ Q CPD +SL+ Y+PC ID  ESP +
Sbjct  438  LNQQSCPDPQSLINYMPCKIDNHESPEE  465



>emb|CDX99236.1| BnaC05g33510D [Brassica napus]
Length=458

 Score =   101 bits (252),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 58/78 (74%), Gaps = 0/78 (0%)
 Frame = -1

Query  730  VPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFF  551
            +PE +C+L  L+ +SLS NYFTQ+GP+CR L++KK+LD+  NCILDLP QR+   C  FF
Sbjct  347  IPEIVCELSALKNISLSFNYFTQVGPKCRELIKKKILDVRMNCILDLPYQRTPWECAKFF  406

Query  550  LHYQKCPDHKSLLYVPCD  497
            +  QKCP  KS  Y+PCD
Sbjct  407  MRKQKCPKSKSFFYMPCD  424



>emb|CDX92324.1| BnaA05g20830D [Brassica napus]
Length=459

 Score =   101 bits (251),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 58/78 (74%), Gaps = 0/78 (0%)
 Frame = -1

Query  730  VPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFF  551
            +PE +C+L  L+ +SLS NYFTQ+GP+CR L++KK+LD+  NCILDLP QR+   C  FF
Sbjct  348  IPEIVCELSALKNVSLSFNYFTQVGPKCRELIKKKILDVRMNCILDLPYQRTPWECAKFF  407

Query  550  LHYQKCPDHKSLLYVPCD  497
            +  QKCP  KS  Y+PCD
Sbjct  408  MRKQKCPKSKSFFYMPCD  425



>ref|XP_009145802.1| PREDICTED: uncharacterized protein At4g06744 [Brassica rapa]
Length=459

 Score =   101 bits (251),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 58/78 (74%), Gaps = 0/78 (0%)
 Frame = -1

Query  730  VPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFF  551
            +PE +C+L  L+ +SLS NYFTQ+GP+CR L++KK+LD+  NCILDLP QR+   C  FF
Sbjct  348  IPEIVCELSALKNVSLSFNYFTQVGPKCRELIKKKILDVRMNCILDLPYQRTPWECAKFF  407

Query  550  LHYQKCPDHKSLLYVPCD  497
            +  QKCP  KS  Y+PCD
Sbjct  408  MRKQKCPKSKSFFYMPCD  425



>ref|XP_004170987.1| PREDICTED: uncharacterized protein At4g06744-like, partial [Cucumis 
sativus]
Length=357

 Score =   100 bits (248),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 42/77 (55%), Positives = 57/77 (74%), Gaps = 0/77 (0%)
 Frame = -1

Query  730  VPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFF  551
            VPE +CKL D+++L+L  N+ TQ+GP CR+L+ KKVLD+  NCIL LP Q+S + C  FF
Sbjct  247  VPEGVCKLPDIQQLTLRNNFITQVGPICRSLISKKVLDVSGNCILGLPEQKSEEECTHFF  306

Query  550  LHYQKCPDHKSLLYVPC  500
             H + CPD KS+ Y+PC
Sbjct  307  THVELCPDEKSMKYIPC  323



>gb|KDO59787.1| hypothetical protein CISIN_1g011101mg [Citrus sinensis]
Length=493

 Score =   101 bits (251),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 48/82 (59%), Positives = 60/82 (73%), Gaps = 0/82 (0%)
 Frame = -1

Query  730  VPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFF  551
            VPE +C+L  L  LSLS NYFTQ+GPECR L+++KVLD+  NCILDLPNQRS + C  FF
Sbjct  383  VPEIVCQLPKLVNLSLSYNYFTQVGPECRKLIKRKVLDVRMNCILDLPNQRSREECGKFF  442

Query  550  LHYQKCPDHKSLLYVPCDIDES  485
               +KCP+ +SL  VPC  + S
Sbjct  443  SESKKCPNERSLTLVPCARNRS  464



>dbj|BAH19934.1| AT1G49750 [Arabidopsis thaliana]
Length=275

 Score = 99.0 bits (245),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 41/78 (53%), Positives = 59/78 (76%), Gaps = 0/78 (0%)
 Frame = -1

Query  730  VPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFF  551
            +PE +C++  L+ +SLS NYFTQ+GP+CR L+++K++D+  NCILDLPNQ++   C  FF
Sbjct  161  IPEIVCEIACLQNVSLSNNYFTQVGPKCRKLIKRKIMDVSMNCILDLPNQKTPSECAKFF  220

Query  550  LHYQKCPDHKSLLYVPCD  497
            +  Q CP+ KSL  VPCD
Sbjct  221  MRKQTCPNSKSLFTVPCD  238



>gb|AEI72268.1| leucine-rich repeat family protein [Citrus trifoliata]
Length=448

 Score =   100 bits (249),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 47/77 (61%), Positives = 58/77 (75%), Gaps = 0/77 (0%)
 Frame = -1

Query  730  VPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFF  551
            VPE +C+L  L  LSLS NYFTQ+GPECR L+++KVLD+  NCILDLPNQRS + C  FF
Sbjct  338  VPEIVCQLPKLVNLSLSYNYFTQVGPECRKLIKRKVLDVRMNCILDLPNQRSPEECGKFF  397

Query  550  LHYQKCPDHKSLLYVPC  500
               +KCP+ +SL  VPC
Sbjct  398  SESKKCPNERSLTLVPC  414



>ref|XP_010519298.1| PREDICTED: uncharacterized protein At4g06744-like [Tarenaya hassleriana]
Length=451

 Score =   100 bits (249),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 43/77 (56%), Positives = 57/77 (74%), Gaps = 0/77 (0%)
 Frame = -1

Query  730  VPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFF  551
            +PE++C L  ++ LSLS NYFT +GP+CR L++KKVLD+  NCIL LPNQRSA  C  FF
Sbjct  340  IPETVCNLPRIQNLSLSYNYFTHVGPKCRELIKKKVLDVRMNCILGLPNQRSATECSKFF  399

Query  550  LHYQKCPDHKSLLYVPC  500
            +  Q CP+ KS  ++PC
Sbjct  400  MRKQPCPNPKSFFWIPC  416



>ref|XP_011004900.1| PREDICTED: uncharacterized protein At4g06744-like [Populus euphratica]
Length=406

 Score = 99.8 bits (247),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 48/87 (55%), Positives = 58/87 (67%), Gaps = 6/87 (7%)
 Frame = -1

Query  730  VPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFF  551
            VPE +C L  L  LSLS NYFTQ+GPECR L+ K++LD+  NCILDLP QRSA  C  FF
Sbjct  294  VPEMVCDLPRLANLSLSYNYFTQVGPECRKLISKRILDVRMNCILDLPGQRSAADCAKFF  353

Query  550  LHYQKCPDHKSLLYVPCDIDESPRKAG  470
               + CP+ +SL Y+PC      RK G
Sbjct  354  SKQRTCPNERSLSYIPC------RKGG  374



>ref|XP_006422961.1| hypothetical protein CICLE_v10028242mg [Citrus clementina]
 gb|ESR36201.1| hypothetical protein CICLE_v10028242mg [Citrus clementina]
Length=504

 Score =   100 bits (250),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 47/77 (61%), Positives = 58/77 (75%), Gaps = 0/77 (0%)
 Frame = -1

Query  730  VPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFF  551
            VPE +C+L  L  LSLS NYFTQ+GPECR L+++KVLD+  NCILDLPNQRS + C  FF
Sbjct  394  VPEIVCQLPKLVNLSLSYNYFTQVGPECRKLIKRKVLDVRMNCILDLPNQRSREECGKFF  453

Query  550  LHYQKCPDHKSLLYVPC  500
               +KCP+ +SL  VPC
Sbjct  454  SESKKCPNERSLTLVPC  470



>ref|XP_004137107.1| PREDICTED: uncharacterized protein At4g06744-like [Cucumis sativus]
Length=459

 Score =   100 bits (248),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 42/77 (55%), Positives = 57/77 (74%), Gaps = 0/77 (0%)
 Frame = -1

Query  730  VPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFF  551
            VPE +CKL D+++L+L  N+ TQ+GP CR+L+ KKVLD+  NCIL LP Q+S + C  FF
Sbjct  349  VPEGVCKLPDIQQLTLRNNFITQVGPICRSLISKKVLDVSGNCILGLPEQKSEEECTHFF  408

Query  550  LHYQKCPDHKSLLYVPC  500
             H + CPD KS+ Y+PC
Sbjct  409  THVELCPDEKSMKYIPC  425



>ref|NP_188563.1| leucine-rich repeat-containing protein [Arabidopsis thaliana]
 dbj|BAB02456.1| unnamed protein product [Arabidopsis thaliana]
 gb|AEE76223.1| leucine-rich repeat-containing protein [Arabidopsis thaliana]
Length=493

 Score =   100 bits (249),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 44/80 (55%), Positives = 58/80 (73%), Gaps = 0/80 (0%)
 Frame = -1

Query  730  VPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFF  551
            +PE +C+L  L+ LSLS NYFTQ+GP+CR L+++K+LD+  NCILDL NQR+   C  FF
Sbjct  382  IPEIVCELSALKNLSLSYNYFTQVGPKCRTLIKRKILDVGMNCILDLTNQRTPWECAKFF  441

Query  550  LHYQKCPDHKSLLYVPCDID  491
            L  Q CP+ KS  Y+PC  D
Sbjct  442  LRKQSCPNFKSFFYLPCGKD  461



>gb|KGN43906.1| hypothetical protein Csa_7G073420 [Cucumis sativus]
Length=488

 Score =   100 bits (248),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 42/77 (55%), Positives = 57/77 (74%), Gaps = 0/77 (0%)
 Frame = -1

Query  730  VPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFF  551
            VPE +CKL D+++L+L  N+ TQ+GP CR+L+ KKVLD+  NCIL LP Q+S + C  FF
Sbjct  378  VPEGVCKLPDIQQLTLRNNFITQVGPICRSLISKKVLDVSGNCILGLPEQKSEEECTHFF  437

Query  550  LHYQKCPDHKSLLYVPC  500
             H + CPD KS+ Y+PC
Sbjct  438  THVELCPDEKSMKYIPC  454



>ref|XP_008454973.1| PREDICTED: uncharacterized protein At4g06744-like [Cucumis melo]
Length=520

 Score = 99.8 bits (247),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 42/77 (55%), Positives = 56/77 (73%), Gaps = 0/77 (0%)
 Frame = -1

Query  730  VPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFF  551
            VPE +CKL +++ L+L  N+ TQ+GP CR+L+ KKVLD+  NCIL LP QRS + C  FF
Sbjct  410  VPEGVCKLPNIQNLTLRNNFITQVGPVCRSLISKKVLDVSGNCILGLPEQRSEEECTHFF  469

Query  550  LHYQKCPDHKSLLYVPC  500
             H + CPD KS+ Y+PC
Sbjct  470  THVELCPDEKSMKYIPC  486



>ref|NP_175397.1| leucine-rich repeat (LRR) family protein [Arabidopsis thaliana]
 gb|AAG13059.1|AC011807_18 Unknown protein [Arabidopsis thaliana]
 gb|AAS47632.1| At1g49750 [Arabidopsis thaliana]
 gb|AAS76756.1| At1g49750 [Arabidopsis thaliana]
 dbj|BAH19559.1| AT1G49750 [Arabidopsis thaliana]
 gb|AEE32471.1| leucine-rich repeat (LRR) family protein [Arabidopsis thaliana]
Length=494

 Score = 99.0 bits (245),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 41/78 (53%), Positives = 59/78 (76%), Gaps = 0/78 (0%)
 Frame = -1

Query  730  VPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFF  551
            +PE +C++  L+ +SLS NYFTQ+GP+CR L+++K++D+  NCILDLPNQ++   C  FF
Sbjct  380  IPEIVCEIACLQNVSLSNNYFTQVGPKCRKLIKRKIMDVSMNCILDLPNQKTPSECAKFF  439

Query  550  LHYQKCPDHKSLLYVPCD  497
            +  Q CP+ KSL  VPCD
Sbjct  440  MRKQTCPNSKSLFTVPCD  457



>ref|XP_006393218.1| hypothetical protein EUTSA_v10011424mg [Eutrema salsugineum]
 gb|ESQ30504.1| hypothetical protein EUTSA_v10011424mg [Eutrema salsugineum]
Length=496

 Score = 99.0 bits (245),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 41/77 (53%), Positives = 60/77 (78%), Gaps = 0/77 (0%)
 Frame = -1

Query  730  VPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFF  551
            +PE +C++  L+ LSLS NYFTQ+GP+CR L+++ +LD+  NCILDLPNQ+++Q C DFF
Sbjct  382  IPEIVCEISCLKNLSLSYNYFTQVGPKCRQLIKRNILDVRMNCILDLPNQKTSQECADFF  441

Query  550  LHYQKCPDHKSLLYVPC  500
            +  Q CP+ KS+  +PC
Sbjct  442  MRKQTCPNSKSMFRIPC  458



>gb|KCW54905.1| hypothetical protein EUGRSUZ_I00883 [Eucalyptus grandis]
Length=469

 Score = 98.2 bits (243),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 46/82 (56%), Positives = 57/82 (70%), Gaps = 0/82 (0%)
 Frame = -1

Query  730  VPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFF  551
            VPE++C L  L  L+L+ NYFTQ+GPECR L+ KK LD+  NCIL LP+QRS   C  FF
Sbjct  359  VPETVCVLPKLSALTLNNNYFTQVGPECRKLILKKKLDVRMNCILGLPSQRSPAECDAFF  418

Query  550  LHYQKCPDHKSLLYVPCDIDES  485
                KCP+ KS+ YVPC I +S
Sbjct  419  SKKVKCPNEKSMRYVPCKISQS  440



>ref|XP_002518709.1| serine-threonine protein kinase, plant-type, putative [Ricinus 
communis]
 gb|EEF43634.1| serine-threonine protein kinase, plant-type, putative [Ricinus 
communis]
Length=510

 Score = 98.6 bits (244),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 43/77 (56%), Positives = 58/77 (75%), Gaps = 0/77 (0%)
 Frame = -1

Query  730  VPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFF  551
            VPE +CKL +L+ LSLSGNYFTQ+GPECR L+  + LD+ NNCIL LPNQR  + C +FF
Sbjct  393  VPEIVCKLPNLQNLSLSGNYFTQVGPECRKLISLRRLDVRNNCILGLPNQRPPKACTEFF  452

Query  550  LHYQKCPDHKSLLYVPC  500
               ++C + +S+ Y+PC
Sbjct  453  SKPKQCANERSMNYIPC  469



>ref|XP_006356575.1| PREDICTED: uncharacterized protein At4g06744-like [Solanum tuberosum]
Length=444

 Score = 97.4 bits (241),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 46/82 (56%), Positives = 60/82 (73%), Gaps = 0/82 (0%)
 Frame = -1

Query  730  VPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFF  551
            VPE +CKL +L+ L+LS NYFT++GPEC+ L++KKVLD+  NCI  LP QRSA+ C  FF
Sbjct  338  VPELVCKLCNLKNLTLSYNYFTEVGPECKKLIQKKVLDVRMNCIPGLPMQRSAEECAAFF  397

Query  550  LHYQKCPDHKSLLYVPCDIDES  485
               + CPD KS+ +VPC I  S
Sbjct  398  CKPRSCPDEKSMGFVPCSIGSS  419



>ref|XP_010028214.1| PREDICTED: uncharacterized protein At4g06744-like [Eucalyptus 
grandis]
Length=513

 Score = 97.8 bits (242),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 46/82 (56%), Positives = 57/82 (70%), Gaps = 0/82 (0%)
 Frame = -1

Query  730  VPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFF  551
            VPE++C L  L  L+L+ NYFTQ+GPECR L+ KK LD+  NCIL LP+QRS   C  FF
Sbjct  403  VPETVCVLPKLSALTLNNNYFTQVGPECRKLILKKKLDVRMNCILGLPSQRSPAECDAFF  462

Query  550  LHYQKCPDHKSLLYVPCDIDES  485
                KCP+ KS+ YVPC I +S
Sbjct  463  SKKVKCPNEKSMRYVPCKISQS  484



>ref|XP_010555995.1| PREDICTED: uncharacterized protein At4g06744-like [Tarenaya hassleriana]
Length=481

 Score = 97.4 bits (241),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 42/77 (55%), Positives = 58/77 (75%), Gaps = 0/77 (0%)
 Frame = -1

Query  730  VPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFF  551
            VPE +C L  ++ LSLS NYFTQ+GP+CR L++K+VLD+  NCILDLPNQRS   C  FF
Sbjct  368  VPEIVCDLPRIQNLSLSYNYFTQVGPKCRELIKKRVLDVRMNCILDLPNQRSPDDCAKFF  427

Query  550  LHYQKCPDHKSLLYVPC  500
            +  + CP+ +S+ ++PC
Sbjct  428  MRKESCPNPESVFWMPC  444



>emb|CDY43618.1| BnaC09g17570D [Brassica napus]
Length=210

 Score = 94.0 bits (232),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 38/77 (49%), Positives = 58/77 (75%), Gaps = 0/77 (0%)
 Frame = -1

Query  730  VPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFF  551
            +PE +C++  L+ LSLS N+FTQ+GP+CRNL+++ +LD+  NCILDLPNQ++   C +FF
Sbjct  96   IPEIVCEISSLKNLSLSYNFFTQVGPKCRNLIKRNILDVRMNCILDLPNQKTPLECANFF  155

Query  550  LHYQKCPDHKSLLYVPC  500
            +    CP+ KS+  +PC
Sbjct  156  MRKLTCPNSKSMFRIPC  172



>ref|XP_011004883.1| PREDICTED: uncharacterized protein At4g06744-like, partial [Populus 
euphratica]
Length=394

 Score = 95.9 bits (237),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 47/87 (54%), Positives = 57/87 (66%), Gaps = 6/87 (7%)
 Frame = -1

Query  730  VPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFF  551
            VPE +C L  L  LSLS NYFTQ+G ECR L+ K++LD+  NCILDLP QRSA  C  FF
Sbjct  282  VPEMVCDLPRLANLSLSYNYFTQVGHECRKLISKRILDVRMNCILDLPGQRSAADCAKFF  341

Query  550  LHYQKCPDHKSLLYVPCDIDESPRKAG  470
               + CP+ +SL Y+PC      RK G
Sbjct  342  SKQRTCPNERSLNYIPC------RKGG  362



>gb|KHN05611.1| Hypothetical protein glysoja_047056 [Glycine soja]
Length=418

 Score = 95.9 bits (237),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 47/80 (59%), Positives = 56/80 (70%), Gaps = 3/80 (4%)
 Frame = -1

Query  730  VPESLCKLKDLE---ELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCK  560
            VPE LC+L  L     LSLS NYFTQ+GP CRNL++ KVLD+ NNCIL LPNQR    C 
Sbjct  311  VPEMLCQLPGLRNNGSLSLSDNYFTQVGPACRNLIKNKVLDVSNNCILGLPNQRPHGQCT  370

Query  559  DFFLHYQKCPDHKSLLYVPC  500
            +FF   + CP+ K+L YVPC
Sbjct  371  EFFSKIKPCPNPKNLHYVPC  390



>ref|XP_007157235.1| hypothetical protein PHAVU_002G054000g [Phaseolus vulgaris]
 gb|ESW29229.1| hypothetical protein PHAVU_002G054000g [Phaseolus vulgaris]
Length=433

 Score = 95.9 bits (237),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 46/80 (58%), Positives = 57/80 (71%), Gaps = 3/80 (4%)
 Frame = -1

Query  730  VPESLCKLKDLEE---LSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCK  560
            VPE++C+L  L     LSLS NYFTQ+GP CR L+E  VLD+ NNCIL LPNQR+ + C 
Sbjct  323  VPETVCELPGLRNRGNLSLSDNYFTQVGPACRRLIEANVLDVRNNCILGLPNQRTHEQCS  382

Query  559  DFFLHYQKCPDHKSLLYVPC  500
             FF + + CP+ KSL YVPC
Sbjct  383  QFFSNLKPCPNPKSLNYVPC  402



>ref|XP_003538630.1| PREDICTED: uncharacterized protein At4g06744-like [Glycine max]
Length=437

 Score = 95.9 bits (237),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 47/80 (59%), Positives = 56/80 (70%), Gaps = 3/80 (4%)
 Frame = -1

Query  730  VPESLCKLKDLE---ELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCK  560
            VPE LC+L  L     LSLS NYFTQ+GP CRNL++ KVLD+ NNCIL LPNQR    C 
Sbjct  330  VPEMLCQLPGLRNNGSLSLSDNYFTQVGPACRNLIKNKVLDVSNNCILGLPNQRPHGQCT  389

Query  559  DFFLHYQKCPDHKSLLYVPC  500
            +FF   + CP+ K+L YVPC
Sbjct  390  EFFSKIKPCPNPKNLHYVPC  409



>gb|KFK39280.1| hypothetical protein AALP_AA3G224000 [Arabis alpina]
Length=480

 Score = 96.3 bits (238),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 43/77 (56%), Positives = 55/77 (71%), Gaps = 0/77 (0%)
 Frame = -1

Query  730  VPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFF  551
            +PE +C+L  L+ LSLS NYFTQ+GP+CR L++ K+LD+  NCILDL NQRS   C  FF
Sbjct  369  IPEIVCELSALKNLSLSFNYFTQVGPKCRKLIKTKILDVRMNCILDLANQRSPWECAKFF  428

Query  550  LHYQKCPDHKSLLYVPC  500
            L  Q C + KS  Y+PC
Sbjct  429  LRKQNCHNFKSFFYIPC  445



>gb|KJB77660.1| hypothetical protein B456_012G149500 [Gossypium raimondii]
Length=449

 Score = 95.9 bits (237),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 43/77 (56%), Positives = 55/77 (71%), Gaps = 0/77 (0%)
 Frame = -1

Query  730  VPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFF  551
            VPE++CKL  L +LSLS NYFT +GP CR L+EKK LD+  NCI  LPNQRS + C +FF
Sbjct  338  VPETVCKLPMLNKLSLSNNYFTHVGPACRGLIEKKKLDVKKNCIYGLPNQRSEKECVEFF  397

Query  550  LHYQKCPDHKSLLYVPC  500
            L  + CP  ++  +VPC
Sbjct  398  LKKKDCPRMETFYWVPC  414



>gb|KCW54907.1| hypothetical protein EUGRSUZ_I00886 [Eucalyptus grandis]
Length=240

 Score = 93.6 bits (231),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 42/81 (52%), Positives = 56/81 (69%), Gaps = 0/81 (0%)
 Frame = -1

Query  730  VPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFF  551
            VPE++C L  L  L+L+ NYFTQ+GPECR L+ KK L++  NCIL LP+QRS   C  FF
Sbjct  130  VPETVCMLPKLSALTLNNNYFTQVGPECRKLILKKKLNVRMNCILGLPSQRSPAECDAFF  189

Query  550  LHYQKCPDHKSLLYVPCDIDE  488
                KCP+ +S+ Y+PC I +
Sbjct  190  SKKVKCPNERSMRYLPCKISQ  210



>ref|XP_006307323.1| hypothetical protein CARUB_v10008944mg [Capsella rubella]
 gb|EOA40221.1| hypothetical protein CARUB_v10008944mg [Capsella rubella]
Length=496

 Score = 96.3 bits (238),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 46/77 (60%), Positives = 55/77 (71%), Gaps = 0/77 (0%)
 Frame = -1

Query  730  VPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFF  551
            +PE +C++  L+ LSLS NYFTQ GP+CR L+E KVLD+  NCILDLPNQ + Q C DFF
Sbjct  382  IPEIVCEIACLKNLSLSYNYFTQAGPKCRKLIESKVLDVRMNCILDLPNQNTPQQCADFF  441

Query  550  LHYQKCPDHKSLLYVPC  500
               Q C D KSL  VPC
Sbjct  442  KRRQTCADPKSLFIVPC  458



>ref|XP_009762067.1| PREDICTED: uncharacterized protein At4g06744-like [Nicotiana 
sylvestris]
Length=462

 Score = 95.5 bits (236),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 46/79 (58%), Positives = 57/79 (72%), Gaps = 0/79 (0%)
 Frame = -1

Query  730  VPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFF  551
            VPE +CKL +L+ LSLS NYFT++GPEC+ L+++KVLD+  NCI  LP QRSA  C  FF
Sbjct  348  VPELVCKLSNLKNLSLSYNYFTEVGPECKKLIQRKVLDVRMNCIPGLPMQRSAAECAAFF  407

Query  550  LHYQKCPDHKSLLYVPCDI  494
               + CPD KSL  VPC I
Sbjct  408  CKPRSCPDEKSLGIVPCTI  426



>ref|XP_004248758.1| PREDICTED: uncharacterized protein At4g06744-like [Solanum lycopersicum]
Length=442

 Score = 94.7 bits (234),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 45/81 (56%), Positives = 58/81 (72%), Gaps = 0/81 (0%)
 Frame = -1

Query  730  VPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFF  551
            VPE +CKL +L+ L+LS NYF ++GPEC+ L+EK+VLDI  NCI  LP QRSA+ C  FF
Sbjct  336  VPELVCKLCNLKNLTLSYNYFNEVGPECKKLIEKRVLDIKMNCIPGLPMQRSAEECAAFF  395

Query  550  LHYQKCPDHKSLLYVPCDIDE  488
               + CPD KSL +VPC +  
Sbjct  396  CKPRSCPDEKSLGFVPCSVGS  416



>ref|XP_002894215.1| hypothetical protein ARALYDRAFT_474107 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH70474.1| hypothetical protein ARALYDRAFT_474107 [Arabidopsis lyrata subsp. 
lyrata]
Length=478

 Score = 95.1 bits (235),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 40/77 (52%), Positives = 59/77 (77%), Gaps = 0/77 (0%)
 Frame = -1

Query  730  VPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFF  551
            +PE +C++  L+ +SLS NYFTQ+GP+CRNL+++K++D+  NCILDLPNQ++   C +FF
Sbjct  364  IPEIVCEIACLKNVSLSYNYFTQVGPKCRNLIKRKIMDVSMNCILDLPNQKTPSECANFF  423

Query  550  LHYQKCPDHKSLLYVPC  500
            +  Q C + KSL  VPC
Sbjct  424  MRKQTCLNSKSLFTVPC  440



>emb|CDY20865.1| BnaC05g26270D [Brassica napus]
Length=516

 Score = 95.5 bits (236),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 39/77 (51%), Positives = 58/77 (75%), Gaps = 0/77 (0%)
 Frame = -1

Query  730  VPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFF  551
            +PE +C++  L+ LSLS N+FTQ+GP+CRNL++K +LD+  NCILDLPNQ++   C +FF
Sbjct  403  IPEIVCEISSLKNLSLSYNFFTQVGPKCRNLIKKNILDVRMNCILDLPNQKTPLECANFF  462

Query  550  LHYQKCPDHKSLLYVPC  500
            +    CP+ KS+  +PC
Sbjct  463  MQKHICPNSKSMFRIPC  479



>ref|XP_009145107.1| PREDICTED: uncharacterized protein At4g06744-like [Brassica rapa]
Length=555

 Score = 95.5 bits (236),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 38/77 (49%), Positives = 58/77 (75%), Gaps = 0/77 (0%)
 Frame = -1

Query  730  VPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFF  551
            +PE +C++  L+ LSLS N+FTQ+GP+CRNL+++ +LD+  NCILDLPNQ++   C +FF
Sbjct  441  IPEIVCEISSLKNLSLSYNFFTQVGPKCRNLIKRNILDVRMNCILDLPNQKTPLECANFF  500

Query  550  LHYQKCPDHKSLLYVPC  500
            +    CP+ KS+  +PC
Sbjct  501  MRKHTCPNSKSMFRIPC  517



>emb|CDY29337.1| BnaA05g16040D [Brassica napus]
Length=475

 Score = 94.4 bits (233),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 38/77 (49%), Positives = 58/77 (75%), Gaps = 0/77 (0%)
 Frame = -1

Query  730  VPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFF  551
            +PE +C++  L+ LSLS N+FTQ+GP+CRNL+++ +LD+  NCILDLPNQ++   C +FF
Sbjct  361  IPEIVCEISSLKNLSLSYNFFTQVGPKCRNLIKRNILDVRMNCILDLPNQKTPLECANFF  420

Query  550  LHYQKCPDHKSLLYVPC  500
            +    CP+ KS+  +PC
Sbjct  421  MRKLTCPNSKSMFRIPC  437



>ref|XP_006433575.1| hypothetical protein CICLE_v10003526mg [Citrus clementina]
 gb|ESR46815.1| hypothetical protein CICLE_v10003526mg [Citrus clementina]
Length=429

 Score = 93.2 bits (230),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 46/86 (53%), Positives = 53/86 (62%), Gaps = 0/86 (0%)
 Frame = -1

Query  730  VPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFF  551
            VPE++C L +L   SLS NYFT  GP CR L+EK VLD+ NNCI DLP QRS   C DFF
Sbjct  341  VPEAVCGLPNLLHFSLSDNYFTHAGPLCRFLIEKGVLDVRNNCIPDLPFQRSVAECADFF  400

Query  550  LHYQKCPDHKSLLYVPCDIDESPRKA  473
             H + CP   S  Y+PC     P  A
Sbjct  401  AHPRFCPHMWSYTYIPCKPYYIPEMA  426



>ref|XP_006472980.1| PREDICTED: uncharacterized protein At4g06744-like [Citrus sinensis]
Length=429

 Score = 92.8 bits (229),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 46/86 (53%), Positives = 53/86 (62%), Gaps = 0/86 (0%)
 Frame = -1

Query  730  VPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFF  551
            VPE++C L +L   SLS NYFT  GP CR L+EK VLD+ NNCI DLP QRS   C DFF
Sbjct  341  VPEAVCGLPNLLHFSLSDNYFTHAGPLCRFLIEKGVLDVRNNCIPDLPFQRSVSECADFF  400

Query  550  LHYQKCPDHKSLLYVPCDIDESPRKA  473
             H + CP   S  Y+PC     P  A
Sbjct  401  AHPRFCPHMWSYTYIPCKPYFIPEMA  426



>ref|XP_010691719.1| PREDICTED: uncharacterized protein At4g06744-like [Beta vulgaris 
subsp. vulgaris]
Length=463

 Score = 93.2 bits (230),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 43/77 (56%), Positives = 54/77 (70%), Gaps = 0/77 (0%)
 Frame = -1

Query  730  VPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFF  551
            VPE +C L  L++LSL  NYFTQ+GPEC  L+ K VLD+ NNCIL LPNQ+S ++C  FF
Sbjct  355  VPEEVCMLPHLKQLSLCNNYFTQVGPECMKLVHKGVLDVTNNCILGLPNQKSKEMCASFF  414

Query  550  LHYQKCPDHKSLLYVPC  500
               + C + KSL  VPC
Sbjct  415  KRPKTCGEEKSLTIVPC  431



>ref|XP_002510174.1| serine-threonine protein kinase, plant-type, putative [Ricinus 
communis]
 gb|EEF52361.1| serine-threonine protein kinase, plant-type, putative [Ricinus 
communis]
Length=437

 Score = 92.8 bits (229),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 43/77 (56%), Positives = 53/77 (69%), Gaps = 0/77 (0%)
 Frame = -1

Query  730  VPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFF  551
            VPE +CK+++L  LSLS NYFT +GP CR L+ K VLD+ NNCI DLP QRS   C +FF
Sbjct  346  VPELVCKMENLVNLSLSDNYFTTVGPWCRILIAKGVLDVRNNCIPDLPFQRSIMECANFF  405

Query  550  LHYQKCPDHKSLLYVPC  500
             H + CP   S  Y+PC
Sbjct  406  AHPRFCPHMWSYTYIPC  422



>ref|XP_009622015.1| PREDICTED: uncharacterized protein At4g06744-like [Nicotiana 
tomentosiformis]
Length=466

 Score = 93.2 bits (230),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 46/79 (58%), Positives = 56/79 (71%), Gaps = 0/79 (0%)
 Frame = -1

Query  730  VPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFF  551
            VPE +CKL +L+ LSLS NYFT++G EC+ L+E+KVLD+  NCI  LP QRSA  C  FF
Sbjct  351  VPELVCKLSNLKNLSLSYNYFTEVGSECKKLIERKVLDVRMNCIPGLPMQRSAAECAAFF  410

Query  550  LHYQKCPDHKSLLYVPCDI  494
               + CPD KSL  VPC I
Sbjct  411  CKPRSCPDEKSLEIVPCRI  429



>ref|XP_011467740.1| PREDICTED: uncharacterized protein At4g06744 [Fragaria vesca 
subsp. vesca]
Length=504

 Score = 93.2 bits (230),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 43/77 (56%), Positives = 53/77 (69%), Gaps = 0/77 (0%)
 Frame = -1

Query  730  VPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFF  551
            VPE +CKL  L  LSL+ NYFTQ+GP CR L++K  L +DNNCILDL  QR    C  FF
Sbjct  396  VPELVCKLPSLMNLSLANNYFTQVGPACRKLIKKGFLHVDNNCILDLKYQRPKSECASFF  455

Query  550  LHYQKCPDHKSLLYVPC  500
               + CP+ +SLLY+PC
Sbjct  456  SKPRYCPNERSLLYIPC  472



>ref|XP_008236576.1| PREDICTED: uncharacterized protein At4g06744-like [Prunus mume]
Length=481

 Score = 92.8 bits (229),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 40/77 (52%), Positives = 53/77 (69%), Gaps = 0/77 (0%)
 Frame = -1

Query  730  VPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFF  551
            VPE +C L +L    L+ NYFT++GPECR L++KKVLD+  NCIL  PNQ++   C  FF
Sbjct  374  VPEQVCTLSNLRNFYLANNYFTEVGPECRKLIKKKVLDVRQNCILGQPNQKTKAQCTAFF  433

Query  550  LHYQKCPDHKSLLYVPC  500
               +KCP+ K + YVPC
Sbjct  434  SKPRKCPNEKEMTYVPC  450



>gb|KDP24991.1| hypothetical protein JCGZ_23974 [Jatropha curcas]
Length=413

 Score = 92.0 bits (227),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 44/82 (54%), Positives = 57/82 (70%), Gaps = 1/82 (1%)
 Frame = -1

Query  730  VPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFF  551
            VPE +C L++L  LSLS NYFT++GP C  L++  VLDI  NCIL LPNQRS   C  FF
Sbjct  309  VPEVVCALENLANLSLSNNYFTKLGPLCWKLVKSGVLDIRQNCILGLPNQRSFHECFIFF  368

Query  550  LHYQKCPDHKSLL-YVPCDIDE  488
            LH + CP H +LL ++PC + +
Sbjct  369  LHPRYCPYHPTLLNFIPCKVHQ  390



>ref|XP_007201703.1| hypothetical protein PRUPE_ppa004109mg [Prunus persica]
 gb|EMJ02902.1| hypothetical protein PRUPE_ppa004109mg [Prunus persica]
Length=529

 Score = 92.8 bits (229),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 40/77 (52%), Positives = 54/77 (70%), Gaps = 0/77 (0%)
 Frame = -1

Query  730  VPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFF  551
            VPE +C L +L   SL+ NYFT++GPECR L++KK+LD+  NCIL  PNQ++   C  FF
Sbjct  422  VPEQVCTLSNLGNFSLANNYFTEVGPECRKLMKKKLLDVRQNCILGEPNQKTKAQCNAFF  481

Query  550  LHYQKCPDHKSLLYVPC  500
               +KCP+ K + YVPC
Sbjct  482  SKPRKCPNEKEMTYVPC  498



>ref|XP_011088225.1| PREDICTED: uncharacterized protein At4g06744-like [Sesamum indicum]
Length=460

 Score = 92.0 bits (227),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 49/114 (43%), Positives = 63/114 (55%), Gaps = 2/114 (2%)
 Frame = -1

Query  730  VPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFF  551
            VPE +CKL +L  LSLS NYFT++GPECR L+ K VLD+  NCI  LP QRS   C  FF
Sbjct  348  VPELVCKLANLGNLSLSYNYFTKVGPECRKLINKNVLDLTMNCIPGLPGQRSPAQCHAFF  407

Query  550  LHYQKCPDHKSLLYVPCDIDESPRKAGphphphrpykkhkRGSSTTYAALKVDR  389
               + CPD  S  ++PC+ +   R+               +  S +YAAL   R
Sbjct  408  SKARSCPDEGSFSWMPCNANS--RRNSLELSDSVSTSTGSKEPSRSYAALHPHR  459



>ref|XP_010479447.1| PREDICTED: leucine-rich repeat extensin-like protein 3 [Camelina 
sativa]
Length=502

 Score = 92.4 bits (228),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 45/87 (52%), Positives = 59/87 (68%), Gaps = 0/87 (0%)
 Frame = -1

Query  730  VPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFF  551
            +PE +C++  L+ LSLS NYFTQ GP+CR L+E+K+LD+  NCILDLPNQ+  + C  FF
Sbjct  388  IPEIVCEIACLKNLSLSYNYFTQAGPKCRKLIERKILDVRMNCILDLPNQKRPEECAVFF  447

Query  550  LHYQKCPDHKSLLYVPCDIDESPRKAG  470
               Q C D KSL  VPC  + +  K G
Sbjct  448  KRKQTCSDPKSLFIVPCGKNPNRLKPG  474



>gb|KDP24986.1| hypothetical protein JCGZ_23969 [Jatropha curcas]
Length=413

 Score = 91.3 bits (225),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 43/82 (52%), Positives = 56/82 (68%), Gaps = 1/82 (1%)
 Frame = -1

Query  730  VPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFF  551
            VPE +C L++L  LSLS NYFT++GP C  L++  VLDI  NCIL LPNQRS   C  FF
Sbjct  309  VPEVVCALENLANLSLSNNYFTKVGPLCWKLVKSGVLDIRQNCILGLPNQRSFHECFIFF  368

Query  550  LHYQKCPDHKSLL-YVPCDIDE  488
            LH + CP H +L  ++PC + +
Sbjct  369  LHPRYCPYHPTLFNFIPCKVHQ  390



>ref|XP_002282482.2| PREDICTED: uncharacterized protein At4g06744-like [Vitis vinifera]
Length=507

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 42/77 (55%), Positives = 54/77 (70%), Gaps = 0/77 (0%)
 Frame = -1

Query  730  VPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFF  551
            VPE+LC+L +L  LSLS NYFTQ+GP+CR L+ +K LD+  NCIL LP Q+    C  FF
Sbjct  404  VPETLCELPNLYNLSLSHNYFTQVGPKCRKLITEKKLDVRMNCILGLPQQKPEHACSHFF  463

Query  550  LHYQKCPDHKSLLYVPC  500
               ++CPD KS + VPC
Sbjct  464  SQVRQCPDPKSFIKVPC  480



>gb|KDP41695.1| hypothetical protein JCGZ_16102 [Jatropha curcas]
Length=424

 Score = 90.9 bits (224),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 44/77 (57%), Positives = 52/77 (68%), Gaps = 0/77 (0%)
 Frame = -1

Query  730  VPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFF  551
            VPE +C+L+ L  LSLS NYF  +GP CR L+EK V+DI NNCI DLP QRS + C DFF
Sbjct  331  VPELVCELQSLVNLSLSDNYFITVGPLCRILIEKGVVDIRNNCIPDLPFQRSVEECADFF  390

Query  550  LHYQKCPDHKSLLYVPC  500
             H + CP   S  Y PC
Sbjct  391  AHPKFCPRMWSYTYSPC  407



>gb|KFK35980.1| hypothetical protein AALP_AA4G062700 [Arabis alpina]
Length=490

 Score = 91.3 bits (225),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 40/77 (52%), Positives = 54/77 (70%), Gaps = 0/77 (0%)
 Frame = -1

Query  730  VPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFF  551
            +PE +C+L  L  LSLS NYFTQ+GP+CR L++  +LD+  NCILDLPNQ++   C  FF
Sbjct  378  IPEIVCELSCLMNLSLSYNYFTQVGPKCRTLIKSNILDVRMNCILDLPNQKTPMECAKFF  437

Query  550  LHYQKCPDHKSLLYVPC  500
            +  Q CP+  S+  VPC
Sbjct  438  MKKQTCPNSHSMFLVPC  454



>ref|XP_007227115.1| hypothetical protein PRUPE_ppa025707mg, partial [Prunus persica]
 gb|EMJ28314.1| hypothetical protein PRUPE_ppa025707mg, partial [Prunus persica]
Length=482

 Score = 91.3 bits (225),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 42/77 (55%), Positives = 54/77 (70%), Gaps = 0/77 (0%)
 Frame = -1

Query  730  VPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFF  551
            VPE +C L++L +LSLS NYFT +GP CR L+ + VLD+ NNCI DLP Q+S + C DFF
Sbjct  334  VPEVVCGLQNLVDLSLSDNYFTNVGPLCRMLIGRGVLDVRNNCIPDLPFQKSIEECADFF  393

Query  550  LHYQKCPDHKSLLYVPC  500
             H + CP   S  Y+PC
Sbjct  394  AHPRFCPYMGSYTYIPC  410



>ref|XP_010461823.1| PREDICTED: uncharacterized protein At4g06744-like [Camelina sativa]
Length=490

 Score = 91.3 bits (225),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 43/77 (56%), Positives = 55/77 (71%), Gaps = 0/77 (0%)
 Frame = -1

Query  730  VPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFF  551
            +PE +C++  L+ LSLS NYFTQ GP+CR L+E+K+LD+  NCILDLPNQ+  + C  FF
Sbjct  376  IPEIVCEIACLKNLSLSYNYFTQAGPKCRKLIERKILDVRMNCILDLPNQKRPEECAVFF  435

Query  550  LHYQKCPDHKSLLYVPC  500
               Q C D KSL  VPC
Sbjct  436  KRKQTCSDPKSLFIVPC  452



>ref|XP_010500525.1| PREDICTED: leucine-rich repeat extensin-like protein 3 [Camelina 
sativa]
Length=504

 Score = 91.3 bits (225),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 43/77 (56%), Positives = 55/77 (71%), Gaps = 0/77 (0%)
 Frame = -1

Query  730  VPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFF  551
            +PE +C++  L+ LSLS NYFTQ GP+CR L+E+K+LD+  NCILDLPNQ+  + C  FF
Sbjct  390  IPEIVCEIACLKNLSLSYNYFTQAGPKCRKLIERKILDVRMNCILDLPNQKRPEECAVFF  449

Query  550  LHYQKCPDHKSLLYVPC  500
               Q C D KSL  VPC
Sbjct  450  KRKQTCSDPKSLFIVPC  466



>gb|KDO37099.1| hypothetical protein CISIN_1g037101mg, partial [Citrus sinensis]
Length=395

 Score = 89.7 bits (221),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 43/76 (57%), Positives = 50/76 (66%), Gaps = 0/76 (0%)
 Frame = -1

Query  730  VPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFF  551
            VPE++C L +L   SLS NYFT  GP CR L+EK VLD+ NNCI DLP QRS   C DFF
Sbjct  320  VPEAVCGLPNLLHFSLSDNYFTHAGPLCRFLIEKGVLDVRNNCIPDLPFQRSVAECADFF  379

Query  550  LHYQKCPDHKSLLYVP  503
             H + CP   S  Y+P
Sbjct  380  AHPRFCPHMWSYTYIP  395



>ref|XP_006374888.1| hypothetical protein POPTR_0014s02430g [Populus trichocarpa]
 gb|ERP52685.1| hypothetical protein POPTR_0014s02430g [Populus trichocarpa]
Length=430

 Score = 90.1 bits (222),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 44/87 (51%), Positives = 54/87 (62%), Gaps = 3/87 (3%)
 Frame = -1

Query  730  VPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFF  551
            VPE +C+L+ L   SLS NYFT +GP CR+L  K VLDI NNCI  LP QRS   C DF 
Sbjct  337  VPEVVCELEKLRNFSLSANYFTTLGPMCRDLFYKGVLDITNNCIPGLPFQRSVVECLDFI  396

Query  550  LHYQKCPDHKSLLYVPCDIDESPRKAG  470
             H + CP   S  ++PC+   SP  +G
Sbjct  397  AHPKSCPRMWSYTFIPCN---SPFSSG  420



>gb|KJB32334.1| hypothetical protein B456_005G236100 [Gossypium raimondii]
Length=433

 Score = 90.1 bits (222),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 44/77 (57%), Positives = 53/77 (69%), Gaps = 0/77 (0%)
 Frame = -1

Query  730  VPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFF  551
            VPE +C+LK+L+ LSLS NYFTQ+GP CR+L+ KK LD+ NNCILDLP QRS   C  FF
Sbjct  322  VPEIVCQLKNLQNLSLSYNYFTQVGPACRDLIMKKKLDVKNNCILDLPFQRSEAECTAFF  381

Query  550  LHYQKCPDHKSLLYVPC  500
                 C    S  +VPC
Sbjct  382  SRNLYCDRKDSFKWVPC  398



>ref|XP_006297641.1| hypothetical protein CARUB_v10013659mg [Capsella rubella]
 gb|EOA30539.1| hypothetical protein CARUB_v10013659mg [Capsella rubella]
Length=458

 Score = 89.7 bits (221),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 46/80 (58%), Positives = 59/80 (74%), Gaps = 0/80 (0%)
 Frame = -1

Query  730  VPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFF  551
            +PE LC+L  L+ LSLS NYFTQ+GP+CR L++KK+LD+  NCILDL NQR+   C  FF
Sbjct  347  IPEILCELSSLKNLSLSSNYFTQVGPKCRTLIKKKILDVGMNCILDLANQRTPWECTKFF  406

Query  550  LHYQKCPDHKSLLYVPCDID  491
            L  QKCP+ K+  Y+PC  D
Sbjct  407  LRKQKCPNFKTFFYIPCGKD  426



>gb|KJB14612.1| hypothetical protein B456_002G134000 [Gossypium raimondii]
Length=422

 Score = 89.4 bits (220),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 42/77 (55%), Positives = 52/77 (68%), Gaps = 0/77 (0%)
 Frame = -1

Query  730  VPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFF  551
            VPE +C+L  L  LSLS NYF  +GP CR L+E+ VLD+ NNCI DLP QRS + C +FF
Sbjct  330  VPEVVCELGKLMNLSLSENYFIHVGPMCRILIERGVLDVRNNCIPDLPFQRSVEECANFF  389

Query  550  LHYQKCPDHKSLLYVPC  500
             H + CP   S  Y+PC
Sbjct  390  AHPRFCPRMWSYNYIPC  406



>ref|XP_004137106.1| PREDICTED: uncharacterized protein At4g06744-like [Cucumis sativus]
Length=398

 Score = 88.6 bits (218),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 37/77 (48%), Positives = 53/77 (69%), Gaps = 0/77 (0%)
 Frame = -1

Query  730  VPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFF  551
            +PE +CKL +L++ +LS N+ TQ+GP CR+L+ K +LD+  NCIL LP QR  + C +FF
Sbjct  294  IPEDVCKLPNLQKFNLSNNFITQVGPVCRSLIWKNILDVSGNCILGLPKQRPEKECTNFF  353

Query  550  LHYQKCPDHKSLLYVPC  500
                 CPD KS+  +PC
Sbjct  354  SKAHSCPDEKSMKIIPC  370



>gb|KHN30415.1| Hypothetical protein glysoja_033153 [Glycine soja]
Length=384

 Score = 88.2 bits (217),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 45/80 (56%), Positives = 52/80 (65%), Gaps = 3/80 (4%)
 Frame = -1

Query  730  VPESLCKLKDLEE---LSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCK  560
            VPE LC L  L     LSLS NYFTQ+GP CRNL++  VLD+  NCIL LPNQR    C 
Sbjct  276  VPEMLCLLPGLRNNGNLSLSDNYFTQVGPACRNLIKTNVLDVSYNCILGLPNQRPHGQCT  335

Query  559  DFFLHYQKCPDHKSLLYVPC  500
            +FF   + CP+ K L YVPC
Sbjct  336  EFFSKIKPCPNPKYLHYVPC  355



>ref|XP_008220262.1| PREDICTED: uncharacterized protein At4g06744-like [Prunus mume]
Length=464

 Score = 89.0 bits (219),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 41/77 (53%), Positives = 53/77 (69%), Gaps = 0/77 (0%)
 Frame = -1

Query  730  VPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFF  551
            VPE +C L++L  LSLS NYFT +GP CR L+ + VLD+ NNCI DLP Q+S + C DFF
Sbjct  369  VPEVVCGLQNLVNLSLSDNYFTNVGPLCRMLIGRGVLDVRNNCIPDLPFQKSIEECADFF  428

Query  550  LHYQKCPDHKSLLYVPC  500
               + CP   S +Y+PC
Sbjct  429  ARPRLCPYMGSYIYIPC  445



>ref|XP_002300228.2| hypothetical protein POPTR_0001s30990g [Populus trichocarpa]
 gb|EEE85033.2| hypothetical protein POPTR_0001s30990g [Populus trichocarpa]
Length=421

 Score = 88.6 bits (218),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 43/84 (51%), Positives = 52/84 (62%), Gaps = 0/84 (0%)
 Frame = -1

Query  730  VPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFF  551
            VPE +C L  L  LSLS NYFT++GP CR L+   VLDI  NCI DLP+QRS   C  F 
Sbjct  313  VPEVVCALGKLVNLSLSSNYFTELGPTCRKLVNSGVLDIKKNCIHDLPDQRSVLECDAFS  372

Query  550  LHYQKCPDHKSLLYVPCDIDESPR  479
            LH + CP+  S   +PC +  SP 
Sbjct  373  LHPRYCPNPASFNLIPCKVPSSPS  396



>gb|KGN43905.1| hypothetical protein Csa_7G073410 [Cucumis sativus]
Length=468

 Score = 89.0 bits (219),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 37/77 (48%), Positives = 53/77 (69%), Gaps = 0/77 (0%)
 Frame = -1

Query  730  VPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFF  551
            +PE +CKL +L++ +LS N+ TQ+GP CR+L+ K +LD+  NCIL LP QR  + C +FF
Sbjct  364  IPEDVCKLPNLQKFNLSNNFITQVGPVCRSLIWKNILDVSGNCILGLPKQRPEKECTNFF  423

Query  550  LHYQKCPDHKSLLYVPC  500
                 CPD KS+  +PC
Sbjct  424  SKAHSCPDEKSMKIIPC  440



>ref|XP_003516778.2| PREDICTED: uncharacterized protein At4g06744-like [Glycine max]
Length=463

 Score = 88.6 bits (218),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 45/80 (56%), Positives = 52/80 (65%), Gaps = 3/80 (4%)
 Frame = -1

Query  730  VPESLCKLKDLEE---LSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCK  560
            VPE LC L  L     LSLS NYFTQ+GP CRNL++  VLD+  NCIL LPNQR    C 
Sbjct  355  VPEMLCLLPGLRNNGNLSLSDNYFTQVGPACRNLIKTNVLDVSYNCILGLPNQRPHGQCT  414

Query  559  DFFLHYQKCPDHKSLLYVPC  500
            +FF   + CP+ K L YVPC
Sbjct  415  EFFSKIKPCPNPKYLHYVPC  434



>ref|XP_004304027.1| PREDICTED: uncharacterized protein At4g06744-like [Fragaria vesca 
subsp. vesca]
Length=411

 Score = 88.2 bits (217),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 43/77 (56%), Positives = 53/77 (69%), Gaps = 0/77 (0%)
 Frame = -1

Query  730  VPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFF  551
            VPE LC+L +L  LSLS NYFT +G  CR L+EK VLDI NNCI DL +QRSA+ C  FF
Sbjct  314  VPEVLCELGNLANLSLSNNYFTGVGTACRKLIEKGVLDIRNNCIQDLADQRSAEECALFF  373

Query  550  LHYQKCPDHKSLLYVPC  500
            LH + C   ++   +PC
Sbjct  374  LHPKSCLHPETYSLIPC  390



>ref|XP_004171357.1| PREDICTED: uncharacterized protein At4g06744-like [Cucumis sativus]
Length=466

 Score = 88.6 bits (218),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/77 (48%), Positives = 53/77 (69%), Gaps = 0/77 (0%)
 Frame = -1

Query  730  VPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFF  551
            +PE +CKL +L++ +LS N+ TQ+GP CR+L+ K +LD+  NCIL LP QR  + C +FF
Sbjct  362  IPEDVCKLPNLQKFNLSNNFITQVGPVCRSLIWKNILDVSGNCILGLPKQRPEKECTNFF  421

Query  550  LHYQKCPDHKSLLYVPC  500
                 CPD KS+  +PC
Sbjct  422  SKAHSCPDEKSMKIIPC  438



>gb|KJB12258.1| hypothetical protein B456_002G008600 [Gossypium raimondii]
Length=497

 Score = 88.6 bits (218),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 41/77 (53%), Positives = 53/77 (69%), Gaps = 0/77 (0%)
 Frame = -1

Query  730  VPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFF  551
            VPE +C+L +L+ LSLS NYFTQ+GP CR+L+ KK L++ NNCILDLP QRS   C  FF
Sbjct  380  VPEIVCRLSNLQNLSLSSNYFTQVGPACRDLVMKKKLNVKNNCILDLPEQRSKADCAMFF  439

Query  550  LHYQKCPDHKSLLYVPC  500
                 C   +S  ++PC
Sbjct  440  SRKLICDRTESFKWIPC  456



>ref|XP_010263447.1| PREDICTED: uncharacterized protein At4g06744-like [Nelumbo nucifera]
Length=467

 Score = 88.6 bits (218),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 41/85 (48%), Positives = 57/85 (67%), Gaps = 4/85 (5%)
 Frame = -1

Query  730  VPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFF  551
            +PE++C L++L  LSLS NYFT +GP CRNL++  VL+++NNCI  LPNQRS   C  F 
Sbjct  350  IPEAVCALRNLVNLSLSDNYFTSVGPTCRNLIKNGVLNVNNNCIHGLPNQRSVGECSAF-  408

Query  550  LHYQKC--PDHKSLLYVPCDIDESP  482
             H   C  P   S  ++PC++ +SP
Sbjct  409  -HPGSCPYPPSYSFSFIPCELPQSP  432



>ref|XP_008393778.1| PREDICTED: uncharacterized protein At4g06744-like [Malus domestica]
Length=463

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 41/78 (53%), Positives = 53/78 (68%), Gaps = 1/78 (1%)
 Frame = -1

Query  730  VPESLC-KLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDF  554
            VPE +C +L+ LE  SLS NYFT +GP CR+L+ K VLD+ NNC+ DLP QR  + C DF
Sbjct  370  VPEVVCHELQSLENFSLSDNYFTNVGPICRSLIGKGVLDVTNNCVPDLPFQRPVEECADF  429

Query  553  FLHYQKCPDHKSLLYVPC  500
            F H + CP   +  Y+PC
Sbjct  430  FAHPRFCPFMWTYTYIPC  447



>ref|XP_011000139.1| PREDICTED: uncharacterized protein At4g06744-like [Populus euphratica]
Length=421

 Score = 87.4 bits (215),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 42/83 (51%), Positives = 54/83 (65%), Gaps = 0/83 (0%)
 Frame = -1

Query  730  VPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFF  551
            VPE +C L  L  LSLS NYFT++GP CR L++  VLDI  NCI DLP+QRS   C+ F 
Sbjct  313  VPEVVCALGKLVNLSLSSNYFTELGPTCRKLVDSGVLDIKKNCIHDLPDQRSVLECEAFS  372

Query  550  LHYQKCPDHKSLLYVPCDIDESP  482
            L  + CP+ +S   +PC +  SP
Sbjct  373  LQRRYCPNPESFNLIPCKVPSSP  395



>ref|XP_007017157.1| Leucine-rich repeat family protein [Theobroma cacao]
 gb|EOY14382.1| Leucine-rich repeat family protein [Theobroma cacao]
Length=441

 Score = 87.0 bits (214),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 41/77 (53%), Positives = 50/77 (65%), Gaps = 0/77 (0%)
 Frame = -1

Query  730  VPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFF  551
            VPE LC+L  L  LSLS NYF  +GP CR L+E++VLD+ NNCI  LP QRS   C +FF
Sbjct  349  VPEVLCELGKLVNLSLSDNYFIHVGPLCRILIERRVLDVRNNCIPGLPFQRSIVECANFF  408

Query  550  LHYQKCPDHKSLLYVPC  500
             H   CP   S  ++PC
Sbjct  409  AHPMFCPRMWSYTFIPC  425



>ref|XP_011000899.1| PREDICTED: uncharacterized protein At4g06744-like [Populus euphratica]
Length=423

 Score = 86.7 bits (213),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 43/82 (52%), Positives = 53/82 (65%), Gaps = 0/82 (0%)
 Frame = -1

Query  730  VPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFF  551
            VPE LC L  L  LSLS NYFT++GP+C  L ++ VLDI  NCI DLP QRSA+ C  F 
Sbjct  313  VPEVLCALGKLVNLSLSSNYFTKLGPKCGELEKRGVLDIRKNCIPDLPGQRSARECAAFS  372

Query  550  LHYQKCPDHKSLLYVPCDIDES  485
            LH + C +  S  Y+PC +  S
Sbjct  373  LHPRYCSNPASFNYIPCKVPSS  394



>emb|CDO97205.1| unnamed protein product [Coffea canephora]
Length=446

 Score = 87.0 bits (214),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 39/78 (50%), Positives = 51/78 (65%), Gaps = 0/78 (0%)
 Frame = -1

Query  730  VPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFF  551
            VP+ +C+L +LE   LS NYFT +GPEC  L+++KVLD+  NCI  LPNQRS   C  FF
Sbjct  341  VPDPICQLPNLESFDLSSNYFTGVGPECWKLIQRKVLDVTMNCIPGLPNQRSKAECDAFF  400

Query  550  LHYQKCPDHKSLLYVPCD  497
               + C +  SL +VPC 
Sbjct  401  CKPRSCSNQGSLTWVPCS  418



>ref|XP_002518710.1| serine-threonine protein kinase, plant-type, putative [Ricinus 
communis]
 gb|EEF43635.1| serine-threonine protein kinase, plant-type, putative [Ricinus 
communis]
Length=418

 Score = 86.3 bits (212),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 42/79 (53%), Positives = 51/79 (65%), Gaps = 0/79 (0%)
 Frame = -1

Query  730  VPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFF  551
            VPE +C L +L  LSLS NYFT+IGP C  L++  VLDI NNCI  LP+QRS   C  FF
Sbjct  311  VPEVVCALGNLANLSLSNNYFTKIGPLCWKLVKTGVLDIRNNCIHGLPDQRSWHECFFFF  370

Query  550  LHYQKCPDHKSLLYVPCDI  494
            LH + CP      ++PC I
Sbjct  371  LHPKYCPYPSFFHFIPCKI  389



>ref|XP_008454972.1| PREDICTED: uncharacterized protein At4g06744-like [Cucumis melo]
Length=428

 Score = 86.3 bits (212),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 39/77 (51%), Positives = 51/77 (66%), Gaps = 0/77 (0%)
 Frame = -1

Query  730  VPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFF  551
            VPE +CKL +L+  +L  N+FTQ+GP CR+L+ K VLD+  NCIL LP QR  + C  FF
Sbjct  325  VPEDVCKLPNLQRFNLRNNFFTQVGPICRSLIWKDVLDVSGNCILGLPKQRPEKECTYFF  384

Query  550  LHYQKCPDHKSLLYVPC  500
                 CPD KS+  +PC
Sbjct  385  SKPHSCPDDKSMKIIPC  401



>emb|CDP01296.1| unnamed protein product [Coffea canephora]
Length=418

 Score = 85.9 bits (211),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 39/77 (51%), Positives = 48/77 (62%), Gaps = 0/77 (0%)
 Frame = -1

Query  730  VPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFF  551
            VPE +C L +L  LSLS NYFT +GP C NL++K VLD+  NCI  LP QRS   C  FF
Sbjct  322  VPEVVCALGNLANLSLSDNYFTTVGPICWNLIKKGVLDVRKNCIAGLPFQRSVWECAHFF  381

Query  550  LHYQKCPDHKSLLYVPC  500
               + CP   +  Y+PC
Sbjct  382  ARPRYCPYWAAFTYIPC  398



>ref|XP_010107857.1| Uncharacterized protein L484_027444 [Morus notabilis]
 gb|EXC17257.1| Uncharacterized protein L484_027444 [Morus notabilis]
Length=420

 Score = 85.9 bits (211),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 37/87 (43%), Positives = 52/87 (60%), Gaps = 0/87 (0%)
 Frame = -1

Query  730  VPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFF  551
            +PE +C +  L   SL  NYFT +GPECR +++ +VLD+  NCI  LP QRSA+ C  FF
Sbjct  309  IPEQICAVGSLVNFSLFDNYFTSVGPECRKMIKSRVLDVRKNCIRGLPEQRSAEECASFF  368

Query  550  LHYQKCPDHKSLLYVPCDIDESPRKAG  470
            L  + C    S  ++PC++  S    G
Sbjct  369  LKPRSCSHPSSFTFMPCEVQPSSESDG  395



>ref|XP_011029410.1| PREDICTED: uncharacterized protein At4g06744-like [Populus euphratica]
Length=430

 Score = 85.9 bits (211),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 41/82 (50%), Positives = 50/82 (61%), Gaps = 0/82 (0%)
 Frame = -1

Query  730  VPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFF  551
            VPE +C+LK L   SLS NYFT +GP CR L  + VLD+ NNCI  LP QRS   C DF 
Sbjct  337  VPEVICELKKLRNFSLSDNYFTALGPVCRELFYEGVLDVTNNCIPGLPFQRSVVECLDFI  396

Query  550  LHYQKCPDHKSLLYVPCDIDES  485
             H + CP   S  ++PC +  S
Sbjct  397  AHPKSCPWMWSYTFIPCKLPFS  418



>emb|CDY32853.1| BnaC08g02750D [Brassica napus]
Length=481

 Score = 86.3 bits (212),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 43/77 (56%), Positives = 57/77 (74%), Gaps = 0/77 (0%)
 Frame = -1

Query  730  VPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFF  551
            +PE +C+L  L+ LSLS NYFTQ GP+CR L+++ +LD   NCI+ LPNQ++AQ C  FF
Sbjct  367  IPEIVCELSSLKNLSLSYNYFTQAGPKCRELIKRSILDARMNCIIGLPNQKTAQECATFF  426

Query  550  LHYQKCPDHKSLLYVPC  500
            +H Q CPD KS+  VPC
Sbjct  427  MHRQTCPDPKSMYLVPC  443



>ref|XP_007157716.1| hypothetical protein PHAVU_002G092300g [Phaseolus vulgaris]
 gb|ESW29710.1| hypothetical protein PHAVU_002G092300g [Phaseolus vulgaris]
Length=413

 Score = 85.5 bits (210),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 41/86 (48%), Positives = 58/86 (67%), Gaps = 1/86 (1%)
 Frame = -1

Query  730  VPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFF  551
            VPE +C L +L  LSLS NYFT++GP C++L+++ VLD+ NNCI+ LP+QRSA+ C  FF
Sbjct  309  VPEVVCALGNLANLSLSYNYFTKVGPSCKSLIQRGVLDVRNNCIVGLPDQRSAKECMAFF  368

Query  550  LHYQKCPDHKSLLYVPCDIDES-PRK  476
               + C    S   +PC I  + PR+
Sbjct  369  SIPRSCLHPASFNIIPCQIHWTKPRE  394



>gb|KJB32335.1| hypothetical protein B456_005G236200 [Gossypium raimondii]
Length=413

 Score = 85.5 bits (210),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 39/78 (50%), Positives = 55/78 (71%), Gaps = 1/78 (1%)
 Frame = -1

Query  730  VPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFF  551
            VPE LC L +LE L+LSGNYFT++GP CR L++  +LD+  NC+ DLP+QRS   C +F+
Sbjct  306  VPEELCALVNLENLTLSGNYFTKVGPACRKLIKNGILDMTQNCVPDLPHQRSLLECTEFY  365

Query  550  LHYQK-CPDHKSLLYVPC  500
            L Y + CP  ++   +PC
Sbjct  366  LKYIRFCPYPETYKIIPC  383



>ref|XP_010507626.1| PREDICTED: uncharacterized protein At4g06744-like [Camelina sativa]
Length=458

 Score = 85.5 bits (210),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 43/80 (54%), Positives = 57/80 (71%), Gaps = 0/80 (0%)
 Frame = -1

Query  730  VPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFF  551
            +PE LC+L  L+ LSLS NYFTQ+GP+CR L+++K+LD+  NCI DL NQR+   C  FF
Sbjct  347  IPEILCELSSLKNLSLSSNYFTQVGPKCRTLIKRKILDVGRNCIQDLANQRTWWECARFF  406

Query  550  LHYQKCPDHKSLLYVPCDID  491
            +  Q CP+ KS  Y+PC  D
Sbjct  407  MRRQNCPNSKSFFYIPCGKD  426



>ref|XP_009107284.1| PREDICTED: uncharacterized protein At4g06744 [Brassica rapa]
Length=475

 Score = 85.5 bits (210),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 42/77 (55%), Positives = 57/77 (74%), Gaps = 0/77 (0%)
 Frame = -1

Query  730  VPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFF  551
            +PE +C+L  L+ LSLS NYFTQ GP+CR L+++ +LD+  NCILDLPNQ++A  C  FF
Sbjct  361  IPEIVCELSSLKNLSLSYNYFTQAGPKCRELIKRNILDVRMNCILDLPNQKTASECSTFF  420

Query  550  LHYQKCPDHKSLLYVPC  500
            +  Q CPD KS+  +PC
Sbjct  421  MQRQTCPDPKSMYLIPC  437



>ref|XP_010688602.1| PREDICTED: uncharacterized protein At4g06744 [Beta vulgaris subsp. 
vulgaris]
Length=461

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 38/77 (49%), Positives = 51/77 (66%), Gaps = 0/77 (0%)
 Frame = -1

Query  730  VPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFF  551
            VP+ LC+L +L +L LS NYFTQ+GP CRNL+ + +LD+ NNC+ DLP QRS   C  FF
Sbjct  380  VPDMLCQLPNLGKLDLSDNYFTQVGPACRNLISRGILDVKNNCVPDLPYQRSVFECASFF  439

Query  550  LHYQKCPDHKSLLYVPC  500
               + CP   +   +PC
Sbjct  440  AVPKNCPYMDTFKIIPC  456



>ref|XP_008236564.1| PREDICTED: uncharacterized protein At4g06744-like [Prunus mume]
Length=416

 Score = 84.7 bits (208),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 52/77 (68%), Gaps = 0/77 (0%)
 Frame = -1

Query  730  VPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFF  551
            VP+++CK ++LE  S + NYFT+IGP C  L+ K++LD+  NCI  LPNQ++A  C  FF
Sbjct  296  VPDAVCKFRNLERFSAANNYFTRIGPACLALIRKRILDVRGNCIPGLPNQKTAAQCAAFF  355

Query  550  LHYQKCPDHKSLLYVPC  500
               + CP  ++L  +PC
Sbjct  356  SIPRTCPRPRTLSIIPC  372



>gb|AIE39583.1| LRR receptor-like protein kinase, partial [Humulus lupulus]
Length=141

 Score = 80.5 bits (197),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 38/71 (54%), Positives = 48/71 (68%), Gaps = 0/71 (0%)
 Frame = -1

Query  730  VPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFF  551
            VPES+CKL +L   +LSGNY TQ+GP CR L+  K L++D NCI DLP QRS + C  FF
Sbjct  70   VPESVCKLPNLSNFTLSGNYITQVGPMCRKLINSKRLNVDWNCIRDLPKQRSFEDCGHFF  129

Query  550  LHYQKCPDHKS  518
                +CP+  S
Sbjct  130  SKDHQCPECSS  140



>ref|XP_007042489.1| Leucine-rich repeat family protein, putative [Theobroma cacao]
 gb|EOX98320.1| Leucine-rich repeat family protein, putative [Theobroma cacao]
Length=497

 Score = 84.7 bits (208),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 42/78 (54%), Positives = 52/78 (67%), Gaps = 1/78 (1%)
 Frame = -1

Query  730  VPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFF  551
            VPE +C+L  +E LSL+ NYFTQ+GP CR L+ KK LD+ NNCILDLPNQ+S   C  FF
Sbjct  384  VPEIVCQLPKIENLSLANNYFTQVGPACRKLIWKKKLDVRNNCILDLPNQKSKDECAKFF  443

Query  550  LHYQ-KCPDHKSLLYVPC  500
                  C   +S  +VPC
Sbjct  444  SRPPLGCERKESFKWVPC  461



>ref|XP_006346520.1| PREDICTED: uncharacterized protein At4g06744-like [Solanum tuberosum]
Length=397

 Score = 84.0 bits (206),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 41/86 (48%), Positives = 56/86 (65%), Gaps = 1/86 (1%)
 Frame = -1

Query  730  VPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFF  551
            VPE +C LK+L   +LS NYFT++GP CR L++  VL+++ NCI  LPNQRS   C  F 
Sbjct  291  VPEVICSLKNLVNFTLSYNYFTKVGPLCRELIDNGVLNVEKNCINGLPNQRSILECVLFR  350

Query  550  LHYQKCPDHKSLLYVPCDIDE-SPRK  476
            +  + CP  KSL  +PC+I   SP +
Sbjct  351  MQIKLCPLQKSLRIIPCNISNFSPHR  376



>emb|CDY16514.1| BnaA08g02530D [Brassica napus]
Length=475

 Score = 84.3 bits (207),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 42/77 (55%), Positives = 56/77 (73%), Gaps = 0/77 (0%)
 Frame = -1

Query  730  VPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFF  551
            +PE +C+L  L+ LSLS NYFTQ GP+CR L+++ +LD+  NCILDLPNQ+ A  C  FF
Sbjct  361  IPEIVCELSSLKNLSLSYNYFTQAGPKCRELIKRNILDVRMNCILDLPNQKMASECSTFF  420

Query  550  LHYQKCPDHKSLLYVPC  500
            +  Q CPD KS+  +PC
Sbjct  421  MQRQTCPDPKSMYLIPC  437



>ref|XP_004231393.1| PREDICTED: uncharacterized protein At4g06744 [Solanum lycopersicum]
Length=394

 Score = 83.6 bits (205),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 41/86 (48%), Positives = 56/86 (65%), Gaps = 1/86 (1%)
 Frame = -1

Query  730  VPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFF  551
            VPE +C LK+L   +LS NYFT++GP CR L+E  VL+++ NCI  LPNQR    C  F 
Sbjct  291  VPEVICSLKNLVNFTLSYNYFTKVGPLCRELIENGVLNVEKNCINGLPNQRPILECVLFR  350

Query  550  LHYQKCPDHKSLLYVPCDIDE-SPRK  476
            +  + CP  KSL  +PC+I + SP +
Sbjct  351  MRIKLCPLQKSLRIIPCNISKFSPHR  376



>ref|XP_010270768.1| PREDICTED: uncharacterized protein At4g06744-like [Nelumbo nucifera]
Length=475

 Score = 84.0 bits (206),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 41/86 (48%), Positives = 55/86 (64%), Gaps = 4/86 (5%)
 Frame = -1

Query  730  VPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDF-  554
            +PE +C L +L  LSLS NYF  +GP CR+L+++ VLD+ NNCI  LPNQR A  C DF 
Sbjct  358  IPEEVCGLGNLANLSLSDNYFRYLGPTCRSLIKRGVLDVSNNCIHGLPNQRPAAECWDFY  417

Query  553  FLHYQKCPD---HKSLLYVPCDIDES  485
            + H + CP      +   VPC+I+ S
Sbjct  418  YFHLKHCPSSLPRYNANVVPCNINHS  443



>ref|XP_010270780.1| PREDICTED: uncharacterized protein At4g06744-like [Nelumbo nucifera]
Length=495

 Score = 84.0 bits (206),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 43/80 (54%), Positives = 53/80 (66%), Gaps = 1/80 (1%)
 Frame = -1

Query  730  VPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFF  551
            VPE +C L  L   SLS NYFTQ+GP+CR L++K  LDI NNCILDLP+QR A  C+ FF
Sbjct  386  VPEVVCGLPSLANFSLSDNYFTQVGPKCRELIKKGKLDIRNNCILDLPSQRPADHCEKFF  445

Query  550  LHYQK-CPDHKSLLYVPCDI  494
                K C D K+   +PC +
Sbjct  446  SSNPKYCSDLKTNTMIPCRL  465



>ref|XP_002313863.2| hypothetical protein POPTR_0009s10140g [Populus trichocarpa]
 gb|EEE87818.2| hypothetical protein POPTR_0009s10140g [Populus trichocarpa]
Length=424

 Score = 83.2 bits (204),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 40/79 (51%), Positives = 50/79 (63%), Gaps = 0/79 (0%)
 Frame = -1

Query  730  VPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFF  551
            VPE +C L  L  LSLS NYFT++GP+C  L    VLDI  NCI DLP QRSA+ C  F 
Sbjct  313  VPEVVCALGKLVNLSLSSNYFTKLGPKCTKLERSGVLDIRKNCIPDLPGQRSARECAAFS  372

Query  550  LHYQKCPDHKSLLYVPCDI  494
            LH + C +  S  ++PC +
Sbjct  373  LHRRYCSNPASFNFIPCKV  391



>ref|XP_009359966.1| PREDICTED: uncharacterized protein At4g06744-like [Pyrus x bretschneideri]
Length=468

 Score = 83.6 bits (205),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 40/80 (50%), Positives = 52/80 (65%), Gaps = 1/80 (1%)
 Frame = -1

Query  730  VPESLC-KLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDF  554
            VPE LC +L+ L   SLS NYFT +GP CR+L+ K VLD+ NNC+ DL  QR  + C DF
Sbjct  375  VPEVLCHELQSLANFSLSDNYFTNVGPICRSLIGKGVLDVTNNCVPDLLFQRPVEECADF  434

Query  553  FLHYQKCPDHKSLLYVPCDI  494
            F H + CP   +  Y+PC +
Sbjct  435  FAHPRFCPFMWTYTYIPCKL  454



>ref|XP_003607916.1| Receptor protein kinase [Medicago truncatula]
Length=366

 Score = 82.0 bits (201),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 41/80 (51%), Positives = 55/80 (69%), Gaps = 3/80 (4%)
 Frame = -1

Query  730  VPESLCKLKDLEE---LSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCK  560
            VPES+C L  ++    LSL+GNYFT++ P C +LL+ K+LD+ NNCI  LPNQRS Q C 
Sbjct  253  VPESVCVLSGIKNNGNLSLAGNYFTKLEPACWSLLKSKILDVSNNCIPGLPNQRSKQECY  312

Query  559  DFFLHYQKCPDHKSLLYVPC  500
            +F    + C + +SL YVPC
Sbjct  313  EFQCKIKPCSNPQSLSYVPC  332



>ref|XP_007201495.1| hypothetical protein PRUPE_ppa014775mg [Prunus persica]
 gb|EMJ02694.1| hypothetical protein PRUPE_ppa014775mg [Prunus persica]
Length=427

 Score = 82.4 bits (202),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 49/77 (64%), Gaps = 0/77 (0%)
 Frame = -1

Query  730  VPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFF  551
            VPE++C L+ LE  + + NYFT+IGP C  L+ KK+LD+  NC+  LPNQ++A  C  FF
Sbjct  307  VPEAVCGLRHLERFNAANNYFTRIGPACMTLIRKKILDVRGNCLPGLPNQKTAAQCAAFF  366

Query  550  LHYQKCPDHKSLLYVPC  500
               + CP    L  +PC
Sbjct  367  SIPRTCPRRTRLSIIPC  383



>gb|KEH30896.1| Serine/Threonine kinase, plant-type protein, putative [Medicago 
truncatula]
Length=413

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/86 (43%), Positives = 51/86 (59%), Gaps = 0/86 (0%)
 Frame = -1

Query  730  VPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFF  551
            VPE +C L +LE L+LS NYF ++GP CR L++  VLD+  NCI DLP+QR  + C  F+
Sbjct  310  VPEVVCSLGNLENLTLSYNYFNRVGPLCRKLIKSGVLDVKKNCIFDLPDQRPMEDCVKFY  369

Query  550  LHYQKCPDHKSLLYVPCDIDESPRKA  473
               + C    S   +PC +   PR  
Sbjct  370  AVPRTCLGSGSFTVIPCQLPMKPRGG  395



>ref|XP_010263446.1| PREDICTED: uncharacterized protein At4g06744-like [Nelumbo nucifera]
Length=474

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 41/87 (47%), Positives = 56/87 (64%), Gaps = 1/87 (1%)
 Frame = -1

Query  730  VPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFF  551
            VPE +C L  L  LSLS NYFTQ+GP+CR+L++K  L ++NNCILDL +QRS   C+ FF
Sbjct  364  VPEVVCALPKLANLSLSDNYFTQVGPKCRHLIKKGRLHLENNCILDLKSQRSPAECEKFF  423

Query  550  -LHYQKCPDHKSLLYVPCDIDESPRKA  473
                + C   K+   +PC +    +KA
Sbjct  424  SSSMEYCSYEKTFNVIPCKLRHHSKKA  450



>gb|AES90113.2| Serine/Threonine kinase, plant-type protein, putative [Medicago 
truncatula]
Length=460

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 41/80 (51%), Positives = 55/80 (69%), Gaps = 3/80 (4%)
 Frame = -1

Query  730  VPESLCKLKDLEE---LSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCK  560
            VPES+C L  ++    LSL+GNYFT++ P C +LL+ K+LD+ NNCI  LPNQRS Q C 
Sbjct  347  VPESVCVLSGIKNNGNLSLAGNYFTKLEPACWSLLKSKILDVSNNCIPGLPNQRSKQECY  406

Query  559  DFFLHYQKCPDHKSLLYVPC  500
            +F    + C + +SL YVPC
Sbjct  407  EFQCKIKPCSNPQSLSYVPC  426



>ref|XP_007042487.1| Leucine-rich repeat family protein, putative [Theobroma cacao]
 gb|EOX98318.1| Leucine-rich repeat family protein, putative [Theobroma cacao]
Length=415

 Score = 80.9 bits (198),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 39/78 (50%), Positives = 53/78 (68%), Gaps = 1/78 (1%)
 Frame = -1

Query  730  VPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFF  551
            VPE LC L +LE LSLS NYFT++GP CR L++  VL++  NCI DLP+Q+S   C +F+
Sbjct  309  VPELLCALGNLENLSLSDNYFTKVGPICRKLIKNGVLNVRQNCIHDLPDQKSLHECAEFY  368

Query  550  LHYQK-CPDHKSLLYVPC  500
            L Y + CP   +   +PC
Sbjct  369  LKYIRLCPYPATYKIIPC  386



>ref|XP_003528523.1| PREDICTED: uncharacterized protein At4g06744-like [Glycine max]
 gb|KHN43048.1| Hypothetical protein glysoja_007578 [Glycine soja]
Length=417

 Score = 80.9 bits (198),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 38/85 (45%), Positives = 51/85 (60%), Gaps = 0/85 (0%)
 Frame = -1

Query  730  VPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFF  551
            VPE +C L +L   SLS NYFT++GP C+ L+++ VLD+  NCI  LP+QRS + C  FF
Sbjct  309  VPEVVCALGNLANFSLSYNYFTKVGPLCKMLIQRGVLDVRKNCIFGLPDQRSVRECMAFF  368

Query  550  LHYQKCPDHKSLLYVPCDIDESPRK  476
            L  + C       +VPC I     K
Sbjct  369  LIPKSCSHPALFNFVPCQIQHHWTK  393



>ref|XP_010487869.1| PREDICTED: uncharacterized protein At4g06744-like [Camelina sativa]
Length=459

 Score = 81.3 bits (199),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 41/80 (51%), Positives = 56/80 (70%), Gaps = 0/80 (0%)
 Frame = -1

Query  730  VPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFF  551
            +PE LC+L  L+ LSLS NYFTQ+GP+CR L+++K+LD+  NCI  L NQR+   C  FF
Sbjct  347  IPEILCELSSLKNLSLSSNYFTQVGPKCRTLIKRKILDVGMNCIRGLANQRTWWECARFF  406

Query  550  LHYQKCPDHKSLLYVPCDID  491
            +  + CP+ KS  Y+PC  D
Sbjct  407  MRRKNCPNSKSFFYIPCGKD  426



>ref|XP_011069732.1| PREDICTED: uncharacterized protein At4g06744-like [Sesamum indicum]
Length=424

 Score = 80.9 bits (198),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 37/77 (48%), Positives = 47/77 (61%), Gaps = 0/77 (0%)
 Frame = -1

Query  730  VPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFF  551
            +PE LC L +L  LSLS NYFT +GP C  L++  VLD+  NCI  LP QRS   C  FF
Sbjct  328  IPEVLCGLGNLANLSLSDNYFTGVGPVCWRLIKNGVLDVKKNCIPGLPFQRSVAECAAFF  387

Query  550  LHYQKCPDHKSLLYVPC  500
             H + CP   +  ++PC
Sbjct  388  AHPRYCPYMPTYAHIPC  404



>ref|XP_009605357.1| PREDICTED: uncharacterized protein At4g06744-like [Nicotiana 
tomentosiformis]
Length=382

 Score = 80.5 bits (197),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 37/77 (48%), Positives = 49/77 (64%), Gaps = 0/77 (0%)
 Frame = -1

Query  730  VPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFF  551
            VP+ +C L +L  LSLS NYFT +GP C +L+   VLD+ NNCI  LP QRS   C +FF
Sbjct  289  VPDVICALGNLANLSLSDNYFTGVGPICLSLIRNGVLDLKNNCIPGLPFQRSFAECVEFF  348

Query  550  LHYQKCPDHKSLLYVPC  500
             + + CP   +  Y+PC
Sbjct  349  AYPRYCPHMATYSYIPC  365



>gb|KJB14611.1| hypothetical protein B456_002G133900 [Gossypium raimondii]
Length=441

 Score = 80.5 bits (197),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 52/82 (63%), Gaps = 0/82 (0%)
 Frame = -1

Query  730  VPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFF  551
            VPE LC+L +    +LS NYFTQ+GP+CR L++ + L+++ NCI+ LP QRSA  C +FF
Sbjct  332  VPEVLCRLPNAFNFTLSNNYFTQVGPQCRRLIKLRRLNVNRNCIMGLPFQRSATDCANFF  391

Query  550  LHYQKCPDHKSLLYVPCDIDES  485
               + C    +   +PC +  +
Sbjct  392  SKPRSCARESTFSIIPCRLPAA  413



>ref|XP_010094650.1| Uncharacterized protein L484_008882 [Morus notabilis]
 gb|EXB56501.1| Uncharacterized protein L484_008882 [Morus notabilis]
Length=415

 Score = 80.5 bits (197),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 42/88 (48%), Positives = 56/88 (64%), Gaps = 2/88 (2%)
 Frame = -1

Query  730  VPESLC-KLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDF  554
            VPE +C +LK+L   SLS NYFT +GP CR L+E+ VLD+  NCI DLP QRS + C  F
Sbjct  316  VPEVVCDELKNLANFSLSDNYFTYVGPLCRRLIERGVLDVRRNCIPDLPYQRSMEECGAF  375

Query  553  FLHYQK-CPDHKSLLYVPCDIDESPRKA  473
            F + ++ CP   S  ++PC     PR +
Sbjct  376  FSYPRRFCPYMWSYNHIPCQPPHYPRYS  403



>gb|KCW68710.1| hypothetical protein EUGRSUZ_F02313 [Eucalyptus grandis]
Length=362

 Score = 79.7 bits (195),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 40/80 (50%), Positives = 49/80 (61%), Gaps = 3/80 (4%)
 Frame = -1

Query  730  VPESLCKL---KDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCK  560
            VPE +C L   ++L  LSLS NYF  +GP CR L+EK +L++ NNCI DLP QR    C 
Sbjct  267  VPEPICWLGLNRNLVNLSLSDNYFQHVGPWCRALIEKGILNVRNNCIPDLPFQRPVADCA  326

Query  559  DFFLHYQKCPDHKSLLYVPC  500
             FF   + CP   S  YVPC
Sbjct  327  RFFAQPRPCPRMWSYSYVPC  346



>ref|XP_007157715.1| hypothetical protein PHAVU_002G092200g [Phaseolus vulgaris]
 gb|ESW29709.1| hypothetical protein PHAVU_002G092200g [Phaseolus vulgaris]
Length=449

 Score = 80.5 bits (197),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 38/90 (42%), Positives = 52/90 (58%), Gaps = 3/90 (3%)
 Frame = -1

Query  730  VPESLCKLKDLEE---LSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCK  560
            VP+++C++  L     LSL+ NYF  +GP C +L++ KVLD+  NCI  LPNQRS   C 
Sbjct  342  VPDNVCQISSLRNNGNLSLADNYFNDVGPSCWSLIKSKVLDVSKNCIRGLPNQRSPYECS  401

Query  559  DFFLHYQKCPDHKSLLYVPCDIDESPRKAG  470
             F+     CP+  S  YVPC  + S    G
Sbjct  402  QFYKRKTTCPNPSSFYYVPCRGNPSSETTG  431



>ref|XP_006354850.1| PREDICTED: uncharacterized protein At4g06744-like [Solanum tuberosum]
Length=384

 Score = 79.3 bits (194),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 37/77 (48%), Positives = 46/77 (60%), Gaps = 0/77 (0%)
 Frame = -1

Query  730  VPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFF  551
            VP+ +C L +L  LSLS NYFT  GP C  L+E  VLD+ NNCI   P QRS   C  FF
Sbjct  291  VPDVICALGNLANLSLSDNYFTGFGPICLRLIENGVLDLRNNCIPGFPFQRSIAECVAFF  350

Query  550  LHYQKCPDHKSLLYVPC  500
             + + CP   +  Y+PC
Sbjct  351  AYPRYCPHMATYTYIPC  367



>ref|XP_009345138.1| PREDICTED: uncharacterized protein At4g06744-like [Pyrus x bretschneideri]
Length=426

 Score = 79.7 bits (195),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 40/87 (46%), Positives = 54/87 (62%), Gaps = 2/87 (2%)
 Frame = -1

Query  730  VPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFF  551
            +PE LC+L +L  LSLS NYFT +GP CR L+E  VLD+  NCI  L +QRSA+ C  FF
Sbjct  328  LPEVLCELGNLVNLSLSNNYFTSVGPMCRKLIENGVLDLRKNCIQHLADQRSAEECALFF  387

Query  550  LHYQKCPDHKSLLYVPCDIDESPRKAG  470
             + + CP   +   +PC +   P+  G
Sbjct  388  GNPRSCPHPATFSLLPCKV--PPKSKG  412



>ref|XP_004505256.1| PREDICTED: uncharacterized protein At4g06744-like [Cicer arietinum]
Length=470

 Score = 79.7 bits (195),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 39/80 (49%), Positives = 53/80 (66%), Gaps = 3/80 (4%)
 Frame = -1

Query  730  VPESLCKLKDLEE---LSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCK  560
            VPES+C L  +     LSLS NYFT IGP C +L++ ++LD+  NCI  +PNQRS + C 
Sbjct  356  VPESVCVLPGIRNNGNLSLSDNYFTSIGPACWSLIKYRILDVSKNCIPGIPNQRSPRECY  415

Query  559  DFFLHYQKCPDHKSLLYVPC  500
            +F    + C +H+SL YVPC
Sbjct  416  EFQCKKKACSNHESLSYVPC  435



>ref|XP_010061722.1| PREDICTED: uncharacterized protein At4g06744-like [Eucalyptus 
grandis]
Length=455

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 40/80 (50%), Positives = 49/80 (61%), Gaps = 3/80 (4%)
 Frame = -1

Query  730  VPESLCKL---KDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCK  560
            VPE +C L   ++L  LSLS NYF  +GP CR L+EK +L++ NNCI DLP QR    C 
Sbjct  360  VPEPICWLGLNRNLVNLSLSDNYFQHVGPWCRALIEKGILNVRNNCIPDLPFQRPVADCA  419

Query  559  DFFLHYQKCPDHKSLLYVPC  500
             FF   + CP   S  YVPC
Sbjct  420  RFFAQPRPCPRMWSYSYVPC  439



>ref|XP_004291077.1| PREDICTED: uncharacterized protein At4g06744-like [Fragaria vesca 
subsp. vesca]
Length=430

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 36/79 (46%), Positives = 51/79 (65%), Gaps = 1/79 (1%)
 Frame = -1

Query  730  VPESLCKL-KDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDF  554
            VP+ +C+L  +L   SLS NYF  +GP C+ L+++ +LD+ NNCI  LP QRS + C  F
Sbjct  337  VPDVICELLVNLANFSLSDNYFIHVGPICQRLIQRGLLDVTNNCIPGLPFQRSVEECAGF  396

Query  553  FLHYQKCPDHKSLLYVPCD  497
            F H + CP+  S  Y+PC 
Sbjct  397  FAHPRFCPNMWSYTYIPCS  415



>ref|XP_009592678.1| PREDICTED: uncharacterized protein At4g06744-like [Nicotiana 
tomentosiformis]
Length=425

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 36/79 (46%), Positives = 50/79 (63%), Gaps = 0/79 (0%)
 Frame = -1

Query  730  VPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFF  551
            VPE +C L +L   +LS NYFT++GP CR L++K +L+++ NCI  LPNQRS   C  F 
Sbjct  319  VPEVVCSLTNLVNFTLSNNYFTKVGPLCRELIKKGILNVEKNCIFGLPNQRSIVECLIFR  378

Query  550  LHYQKCPDHKSLLYVPCDI  494
               + CP  K+   +PC I
Sbjct  379  GQIKLCPLQKTYSVIPCKI  397



>ref|XP_009784047.1| PREDICTED: uncharacterized protein At4g06744-like [Nicotiana 
sylvestris]
Length=426

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 37/79 (47%), Positives = 51/79 (65%), Gaps = 0/79 (0%)
 Frame = -1

Query  730  VPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFF  551
            VPE +C L +L   +LS NYFT++GP CR L++K +L+++ NCIL LPNQRS   C  F 
Sbjct  320  VPEVVCSLTNLVNFTLSYNYFTKVGPLCRELIKKGILNVEKNCILGLPNQRSIVECLIFR  379

Query  550  LHYQKCPDHKSLLYVPCDI  494
               + CP  K+   +PC I
Sbjct  380  GQIKLCPLQKTYNVIPCKI  398



>ref|XP_010466072.1| PREDICTED: uncharacterized protein At4g06744-like [Camelina sativa]
Length=469

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 40/80 (50%), Positives = 55/80 (69%), Gaps = 0/80 (0%)
 Frame = -1

Query  730  VPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFF  551
            +PE LC+L  L+ LSLS NYFTQ+GP+CR L+++++LD+  NCI  L NQR+   C  FF
Sbjct  358  IPEILCELSSLKNLSLSSNYFTQVGPKCRTLIKRRILDVGRNCIRGLANQRTWWECARFF  417

Query  550  LHYQKCPDHKSLLYVPCDID  491
            +  Q CP+ KS   +PC  D
Sbjct  418  MRRQNCPNSKSFFNIPCGKD  437



>ref|XP_004238131.2| PREDICTED: probable inactive receptor kinase At5g67200 [Solanum 
lycopersicum]
Length=1206

 Score = 79.7 bits (195),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/77 (49%), Positives = 47/77 (61%), Gaps = 0/77 (0%)
 Frame = -1

Query  730  VPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFF  551
            VP+ +C L++L  LSLS NYFT  GP C  L+E  VLD+ NNCI   P QRS   C  FF
Sbjct  291  VPDVICALENLANLSLSDNYFTGFGPICLRLIENGVLDLRNNCIPGFPFQRSIAECVAFF  350

Query  550  LHYQKCPDHKSLLYVPC  500
             + + CP   S  Y+PC
Sbjct  351  AYPRYCPHMASYTYIPC  367



>ref|XP_008342943.1| PREDICTED: uncharacterized protein At4g06744-like [Malus domestica]
Length=424

 Score = 78.2 bits (191),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 38/86 (44%), Positives = 53/86 (62%), Gaps = 2/86 (2%)
 Frame = -1

Query  727  PESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFL  548
            PE +C+L +L  LSLS NYFT +GP CR L++  VLD+  NCI  L +QRS + C  FF+
Sbjct  329  PEVVCELGNLVNLSLSNNYFTSVGPICRQLIKNGVLDLRKNCIQHLADQRSVEECALFFV  388

Query  547  HYQKCPDHKSLLYVPCDIDESPRKAG  470
              + CPD  +   +PC +   P+  G
Sbjct  389  KPRSCPDPSTFSLLPCKV--PPKSKG  412



>ref|XP_003529407.1| PREDICTED: uncharacterized protein At4g06744-like [Glycine max]
Length=449

 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 36/80 (45%), Positives = 52/80 (65%), Gaps = 3/80 (4%)
 Frame = -1

Query  730  VPESLCKLKDLEE---LSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCK  560
            VP++LC++  +     LSL+ NYF +IGP C +L++ KVLD+  NCI  LPNQ+S + C 
Sbjct  340  VPDNLCQIPSIRNNGNLSLANNYFNEIGPSCWSLIKSKVLDVSGNCIPGLPNQKSPKECY  399

Query  559  DFFLHYQKCPDHKSLLYVPC  500
             F+   + CP+  S  YVPC
Sbjct  400  QFYKTKKTCPNPNSFYYVPC  419



>ref|XP_004499033.1| PREDICTED: uncharacterized protein At4g06744-like [Cicer arietinum]
Length=382

 Score = 77.8 bits (190),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 38/80 (48%), Positives = 51/80 (64%), Gaps = 1/80 (1%)
 Frame = -1

Query  730  VPESLCK-LKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDF  554
            VP+ LC+ L++L   SL  NYFT +GP CR L+E+ +LD+  NCILDLP QRS   C DF
Sbjct  292  VPDVLCEGLENLVNFSLYDNYFTHVGPFCRMLIERGILDVGKNCILDLPFQRSVIECADF  351

Query  553  FLHYQKCPDHKSLLYVPCDI  494
            F   + CP      + PC++
Sbjct  352  FSRPKMCPFMWFHSFFPCNV  371



>gb|KHN43047.1| Hypothetical protein glysoja_007577 [Glycine soja]
Length=456

 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 36/80 (45%), Positives = 52/80 (65%), Gaps = 3/80 (4%)
 Frame = -1

Query  730  VPESLCKLKDLEE---LSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCK  560
            VP++LC++  +     LSL+ NYF +IGP C +L++ KVLD+  NCI  LPNQ+S + C 
Sbjct  347  VPDNLCQIPSIRNNGNLSLANNYFNEIGPSCWSLIKSKVLDVSGNCIPGLPNQKSPKECY  406

Query  559  DFFLHYQKCPDHKSLLYVPC  500
             F+   + CP+  S  YVPC
Sbjct  407  QFYKTKKTCPNPNSFYYVPC  426



>ref|XP_008236575.1| PREDICTED: uncharacterized protein At4g06744-like [Prunus mume]
Length=423

 Score = 78.2 bits (191),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 39/87 (45%), Positives = 53/87 (61%), Gaps = 2/87 (2%)
 Frame = -1

Query  730  VPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFF  551
            VPE +C+L +L  LSLS NYFT +GP CR L++  VLD+  NCI DL +QRS + C  F 
Sbjct  325  VPEVVCELGNLANLSLSNNYFTMVGPICRKLIKSGVLDLRKNCIRDLADQRSVEECASFS  384

Query  550  LHYQKCPDHKSLLYVPCDIDESPRKAG  470
             H + C   +S   +PC +   P+  G
Sbjct  385  SHPRSCLHPESFSVMPCKV--PPKSKG  409



>ref|XP_010094651.1| Uncharacterized protein L484_008883 [Morus notabilis]
 gb|EXB56502.1| Uncharacterized protein L484_008883 [Morus notabilis]
Length=437

 Score = 78.2 bits (191),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 49/82 (60%), Gaps = 0/82 (0%)
 Frame = -1

Query  730  VPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFF  551
            +PESLC+L +    +LS N+FTQ+G +CR L+    L++  NCIL LP+Q+S   C  FF
Sbjct  327  IPESLCRLPNAYNFTLSYNFFTQVGVQCRRLIRAGTLNVRRNCILGLPDQKSTAECGRFF  386

Query  550  LHYQKCPDHKSLLYVPCDIDES  485
               + CP   +   V C+I  +
Sbjct  387  SRARTCPRENTFSIVTCNISAT  408



>ref|XP_010554992.1| PREDICTED: uncharacterized protein At4g06744 [Tarenaya hassleriana]
Length=392

 Score = 77.8 bits (190),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 41/85 (48%), Positives = 53/85 (62%), Gaps = 7/85 (8%)
 Frame = -1

Query  730  VPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFF  551
            VPE+ C L++L   SLS NYFT++GP CR L+ K VLD+ NNCI  LPNQRS + C DF 
Sbjct  296  VPETACVLRNLANFSLSDNYFTRVGPFCRILIRKGVLDVRNNCIPLLPNQRSVKECVDFL  355

Query  550  LHYQKCPDHKSLLYVPCDIDESPRK  476
               + C    S ++ P  +   PRK
Sbjct  356  AKPKYC----SHMWFPSSV---PRK  373



>gb|KHN12808.1| Hypothetical protein glysoja_008771 [Glycine soja]
Length=224

 Score = 75.5 bits (184),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 38/80 (48%), Positives = 49/80 (61%), Gaps = 1/80 (1%)
 Frame = -1

Query  730  VPESLC-KLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDF  554
            VPE +C  L +L   SLS NYFT +GP CR L+++ VLD+ NNCI DLP QRS   C +F
Sbjct  137  VPEVVCVGLVNLVNFSLSDNYFTHVGPFCRMLIQRGVLDVRNNCIPDLPFQRSVMECAEF  196

Query  553  FLHYQKCPDHKSLLYVPCDI  494
            F   + CP       +PC +
Sbjct  197  FATPRMCPFMWFHGLIPCKL  216



>ref|XP_006422962.1| hypothetical protein CICLE_v10028712mg [Citrus clementina]
 gb|ESR36202.1| hypothetical protein CICLE_v10028712mg [Citrus clementina]
Length=360

 Score = 77.0 bits (188),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 38/78 (49%), Positives = 48/78 (62%), Gaps = 0/78 (0%)
 Frame = -1

Query  730  VPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFF  551
            VPE LC L +L  LSLS NYFT +GP CR L++  VLD++ NCI  LP+QRS   C  FF
Sbjct  253  VPEVLCALDNLVNLSLSNNYFTGVGPLCRKLIKNGVLDVNRNCIHYLPDQRSTHECALFF  312

Query  550  LHYQKCPDHKSLLYVPCD  497
            L  + C       ++PC 
Sbjct  313  LQPRFCFYPSWYNFIPCS  330



>gb|KDP41694.1| hypothetical protein JCGZ_16101 [Jatropha curcas]
Length=438

 Score = 77.4 bits (189),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 33/85 (39%), Positives = 48/85 (56%), Gaps = 0/85 (0%)
 Frame = -1

Query  730  VPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFF  551
            +PE LC+L +    +L+ NYFTQ+GP+CR L+  + L+++ NCI  L  QR A  C  FF
Sbjct  330  IPEVLCRLPNAFNFTLTYNYFTQVGPQCRRLIRARRLNVNRNCIFGLTGQRPAAECARFF  389

Query  550  LHYQKCPDHKSLLYVPCDIDESPRK  476
               + C    S   +PC +  S  K
Sbjct  390  ARPRTCARESSFSLIPCSLPASSMK  414



>gb|KDO59786.1| hypothetical protein CISIN_1g048561mg, partial [Citrus sinensis]
Length=382

 Score = 77.0 bits (188),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 38/78 (49%), Positives = 48/78 (62%), Gaps = 0/78 (0%)
 Frame = -1

Query  730  VPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFF  551
            VPE LC L +L  LSLS NYFT +GP CR L++  VLD++ NCI  LP+QRS   C  FF
Sbjct  275  VPEVLCALDNLVNLSLSNNYFTGVGPLCRKLIKNGVLDVNRNCIHYLPDQRSTHECALFF  334

Query  550  LHYQKCPDHKSLLYVPCD  497
            L  + C       ++PC 
Sbjct  335  LQPRFCFYPSWYNFIPCS  352



>ref|NP_849339.1| Leucine-rich repeat-containing protein [Arabidopsis thaliana]
 sp|Q8W3M4.1|Y4744_ARATH RecName: Full=Uncharacterized protein At4g06744; Flags: Precursor 
[Arabidopsis thaliana]
 dbj|BAB83614.1| extensin-like protein [Arabidopsis thaliana]
 gb|AEE82560.1| Leucine-rich repeat-containing protein [Arabidopsis thaliana]
Length=404

 Score = 77.0 bits (188),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 40/71 (56%), Positives = 48/71 (68%), Gaps = 4/71 (6%)
 Frame = -1

Query  730  VPESLCKL--KDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKD  557
            VPE++C L   +L  LSLS NYFT +GP CR LLEK VLD+ NNCI   P QRS Q C +
Sbjct  303  VPEAVCMLLRDNLVNLSLSDNYFTHVGPWCRGLLEKGVLDVGNNCIPFFPGQRSMQECAE  362

Query  556  FFLHYQK--CP  530
            FF+  +K  CP
Sbjct  363  FFVKPKKYYCP  373



>ref|XP_007160878.1| hypothetical protein PHAVU_001G024400g [Phaseolus vulgaris]
 gb|ESW32872.1| hypothetical protein PHAVU_001G024400g [Phaseolus vulgaris]
Length=427

 Score = 77.0 bits (188),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 38/80 (48%), Positives = 50/80 (63%), Gaps = 1/80 (1%)
 Frame = -1

Query  730  VPESLCK-LKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDF  554
            VPE +C  L +L   SLS NYFT +GP CR L+++ VLD+ NNCI DLP QRS   C +F
Sbjct  341  VPEVVCAGLVNLVNFSLSDNYFTHVGPLCRILIQRGVLDVRNNCIPDLPFQRSVIECAEF  400

Query  553  FLHYQKCPDHKSLLYVPCDI  494
            F   + CP      ++PC +
Sbjct  401  FATPRMCPFMWFYSFIPCKL  420



>ref|XP_006487027.1| PREDICTED: uncharacterized protein At4g06744-like [Citrus sinensis]
Length=418

 Score = 77.0 bits (188),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 38/78 (49%), Positives = 48/78 (62%), Gaps = 0/78 (0%)
 Frame = -1

Query  730  VPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFF  551
            VPE LC L +L  LSLS NYFT +GP CR L++  VLD++ NCI  LP+QRS   C  FF
Sbjct  311  VPEVLCALDNLVNLSLSNNYFTGVGPLCRKLIKNGVLDVNRNCIHYLPDQRSTHECALFF  370

Query  550  LHYQKCPDHKSLLYVPCD  497
            L  + C       ++PC 
Sbjct  371  LQPRFCFYPSWYNFIPCS  388



>ref|XP_004142874.1| PREDICTED: uncharacterized protein At4g06744-like [Cucumis sativus]
 ref|XP_004156371.1| PREDICTED: uncharacterized protein At4g06744-like [Cucumis sativus]
 gb|KGN62484.1| hypothetical protein Csa_2G356090 [Cucumis sativus]
Length=438

 Score = 77.0 bits (188),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 39/114 (34%), Positives = 57/114 (50%), Gaps = 0/114 (0%)
 Frame = -1

Query  730  VPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFF  551
            +PES+C+L D+  ++LS NYFT+IGP CR L+  + L I  NCI     Q++   C  FF
Sbjct  322  IPESICRLPDIYNITLSNNYFTRIGPVCRKLVIAQRLHIQGNCIPGFRLQKTQSQCAAFF  381

Query  550  LHYQKCPDHKSLLYVPCDIDESPRKAGphphphrpykkhkRGSSTTYAALKVDR  389
               + CP   +  YVPC +  +                    S  +YAAL++ R
Sbjct  382  AKPRTCPRANTFSYVPCVLPTAAEAVQLDKAKVTSVDDMVPPSPRSYAALEMPR  435



>ref|XP_010523006.1| PREDICTED: uncharacterized protein At4g06744-like [Tarenaya hassleriana]
Length=423

 Score = 76.6 bits (187),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 36/77 (47%), Positives = 48/77 (62%), Gaps = 0/77 (0%)
 Frame = -1

Query  730  VPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFF  551
            VPE++C L++L   SLS NYFT +GP CR L+E+ VLD+ NNCI  LPNQR  + C  F 
Sbjct  320  VPETVCMLQNLANFSLSDNYFTHVGPFCRILIERGVLDVRNNCIPFLPNQRPFKECLGFL  379

Query  550  LHYQKCPDHKSLLYVPC  500
               + C       ++PC
Sbjct  380  ARPKYCSHMWFHSFIPC  396



>gb|KFK39606.1| hypothetical protein AALP_AA3G265800 [Arabis alpina]
Length=403

 Score = 75.9 bits (185),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 37/79 (47%), Positives = 49/79 (62%), Gaps = 2/79 (3%)
 Frame = -1

Query  730  VPESLCKL--KDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKD  557
            +PES+C L   +L   SLS NYFT +GP CR+L E  VLD+ NNC+  LP QRS + C +
Sbjct  304  IPESVCMLLRVNLVNFSLSDNYFTHMGPWCRSLFEIGVLDVRNNCLPFLPGQRSMKECAE  363

Query  556  FFLHYQKCPDHKSLLYVPC  500
            FF   + CP      ++PC
Sbjct  364  FFFKPKYCPYRWFHSFIPC  382



>ref|XP_003555862.1| PREDICTED: uncharacterized protein At4g06744-like [Glycine max]
 gb|KHN32258.1| Hypothetical protein glysoja_039284 [Glycine soja]
Length=454

 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/80 (44%), Positives = 52/80 (65%), Gaps = 3/80 (4%)
 Frame = -1

Query  730  VPESLCKLKDLEE---LSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCK  560
            VP++LC++  +     LSL+ NYF +IGP C +L++ KVLD+  NCI  LP+Q+S + C 
Sbjct  344  VPDNLCQIPSIRNNGNLSLADNYFKEIGPSCWSLIKSKVLDVSRNCIPGLPDQKSPKECY  403

Query  559  DFFLHYQKCPDHKSLLYVPC  500
             F+   + CP+  S  YVPC
Sbjct  404  QFYKTKKTCPNQNSFYYVPC  423



>ref|XP_009768848.1| PREDICTED: uncharacterized protein At4g06744-like [Nicotiana 
sylvestris]
Length=408

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 49/77 (64%), Gaps = 0/77 (0%)
 Frame = -1

Query  730  VPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFF  551
            VPE +C L +L  LSLS N+F  +GP C +L+++ V+D+  NCI  LP+QRS   C  FF
Sbjct  318  VPEVICSLGNLANLSLSHNFFIGVGPICLSLIKEGVVDVRKNCIPGLPSQRSTAECVAFF  377

Query  550  LHYQKCPDHKSLLYVPC  500
               + CP  ++  Y+PC
Sbjct  378  AQPRYCPYMETYSYIPC  394



>ref|XP_009617390.1| PREDICTED: uncharacterized protein At4g06744-like [Nicotiana 
tomentosiformis]
Length=420

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/77 (43%), Positives = 50/77 (65%), Gaps = 0/77 (0%)
 Frame = -1

Query  730  VPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFF  551
            VPE +C L++L  LSLS N+F  +GP C +L+++ V+D+  NCI  LP+QRS   C  +F
Sbjct  320  VPEVVCSLRNLANLSLSNNFFIGVGPICLSLIKEGVVDVRKNCIPGLPSQRSTAECVAYF  379

Query  550  LHYQKCPDHKSLLYVPC  500
               + CP  ++  Y+PC
Sbjct  380  AQPRYCPYMETYSYIPC  396



>ref|XP_003550327.1| PREDICTED: uncharacterized protein At4g06744-like [Glycine max]
Length=443

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 38/80 (48%), Positives = 49/80 (61%), Gaps = 1/80 (1%)
 Frame = -1

Query  730  VPESLC-KLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDF  554
            VPE +C  L +L   SLS NYFT +GP CR L+++ VLD+ NNCI DLP QRS   C +F
Sbjct  356  VPEVVCVGLVNLVNFSLSDNYFTHVGPFCRMLIQRGVLDVRNNCIPDLPFQRSVMECAEF  415

Query  553  FLHYQKCPDHKSLLYVPCDI  494
            F   + CP       +PC +
Sbjct  416  FATPRMCPFMWFHGLIPCKL  435



>ref|XP_003545325.1| PREDICTED: uncharacterized protein At4g06744-like [Glycine max]
Length=435

 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 38/80 (48%), Positives = 49/80 (61%), Gaps = 1/80 (1%)
 Frame = -1

Query  730  VPESLC-KLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDF  554
            VPE +C  L +L   SLS NYFT +GP CR L+++ VLD+ NNCI DLP QRS   C +F
Sbjct  348  VPEVVCVGLVNLVNFSLSDNYFTHVGPLCRMLIQRGVLDVRNNCIPDLPFQRSVMECAEF  407

Query  553  FLHYQKCPDHKSLLYVPCDI  494
            F   + CP       +PC +
Sbjct  408  FATPRMCPFMWFHGLIPCKL  427



>gb|KHN22492.1| Hypothetical protein glysoja_041167 [Glycine soja]
Length=410

 Score = 75.1 bits (183),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 38/80 (48%), Positives = 49/80 (61%), Gaps = 1/80 (1%)
 Frame = -1

Query  730  VPESLC-KLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDF  554
            VPE +C  L +L   SLS NYFT +GP CR L+++ VLD+ NNCI DLP QRS   C +F
Sbjct  323  VPEVVCVGLVNLVNFSLSDNYFTHVGPLCRMLIQRGVLDVRNNCIPDLPFQRSVMECAEF  382

Query  553  FLHYQKCPDHKSLLYVPCDI  494
            F   + CP       +PC +
Sbjct  383  FATPRMCPFMWFHGLIPCKL  402



>ref|XP_008456159.1| PREDICTED: uncharacterized protein At4g06744-like [Cucumis melo]
Length=315

 Score = 74.3 bits (181),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 38/77 (49%), Positives = 52/77 (68%), Gaps = 0/77 (0%)
 Frame = -1

Query  730  VPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFF  551
            VPE +CKL +L   +L  N+FTQ+GPEC+ L++KK+LD+ NNCI  LP QRS   C +F 
Sbjct  206  VPEEICKLPNLGNFTLRNNFFTQVGPECKKLIKKKILDVSNNCIPGLPKQRSKTECLEFA  265

Query  550  LHYQKCPDHKSLLYVPC  500
               + C + KS  Y+PC
Sbjct  266  YRPKYCGNDKSFTYIPC  282



>gb|ADN33724.1| LRR-family protein [Cucumis melo subsp. melo]
Length=439

 Score = 75.1 bits (183),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 33/77 (43%), Positives = 46/77 (60%), Gaps = 0/77 (0%)
 Frame = -1

Query  730  VPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFF  551
            +PES+C+L D+  ++LS NYFT+IGP CR L+  + L I  NCI     Q++   C  FF
Sbjct  322  IPESICRLPDIYNITLSNNYFTRIGPVCRKLVTAQRLHIQGNCIPGFRLQKTQSQCAAFF  381

Query  550  LHYQKCPDHKSLLYVPC  500
               + CP   +  YVPC
Sbjct  382  AKPRTCPRANTFSYVPC  398



>ref|XP_002874478.1| leucine-rich repeat family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50737.1| leucine-rich repeat family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=409

 Score = 75.1 bits (183),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 37/71 (52%), Positives = 48/71 (68%), Gaps = 4/71 (6%)
 Frame = -1

Query  730  VPESLCKL--KDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKD  557
            +PE++C L   +L  LSLS NYFT +GP CR LL++ VLD+ NNCI   P QRS Q C +
Sbjct  308  IPEAVCMLLRDNLVNLSLSNNYFTHVGPWCRGLLDRGVLDVSNNCIPFFPGQRSMQECAE  367

Query  556  FFLHYQK--CP  530
            FF+  +K  CP
Sbjct  368  FFVKPKKYYCP  378



>ref|XP_008444596.1| PREDICTED: uncharacterized protein At4g06744-like [Cucumis melo]
Length=507

 Score = 75.1 bits (183),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 33/77 (43%), Positives = 46/77 (60%), Gaps = 0/77 (0%)
 Frame = -1

Query  730  VPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFF  551
            +PES+C+L D+  ++LS NYFT+IGP CR L+  + L I  NCI     Q++   C  FF
Sbjct  394  IPESICRLPDIYNITLSNNYFTRIGPVCRKLVTAQRLHIQGNCIPGFRLQKTQSQCAAFF  453

Query  550  LHYQKCPDHKSLLYVPC  500
               + CP   +  YVPC
Sbjct  454  AKPRTCPRANTFSYVPC  470



>ref|XP_004141388.1| PREDICTED: uncharacterized protein At4g06744-like [Cucumis sativus]
 ref|XP_004172481.1| PREDICTED: uncharacterized protein At4g06744-like [Cucumis sativus]
 gb|KGN55219.1| hypothetical protein Csa_4G641530 [Cucumis sativus]
Length=433

 Score = 74.3 bits (181),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 37/77 (48%), Positives = 46/77 (60%), Gaps = 0/77 (0%)
 Frame = -1

Query  730  VPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFF  551
            VPE +C L+ L  L+LS NYFT +GP CR L+ + VL+I NNCI DLP QR    C  F 
Sbjct  337  VPEMVCALRHLVNLTLSDNYFTVVGPLCRILIGRGVLNIRNNCIPDLPFQRPIIECAKFL  396

Query  550  LHYQKCPDHKSLLYVPC  500
               + CP   S   +PC
Sbjct  397  AFPRICPRMWSYTLMPC  413



>ref|XP_010066095.1| PREDICTED: uncharacterized protein At4g06744-like [Eucalyptus 
grandis]
 gb|KCW63891.1| hypothetical protein EUGRSUZ_G01566 [Eucalyptus grandis]
Length=382

 Score = 73.9 bits (180),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 36/86 (42%), Positives = 47/86 (55%), Gaps = 4/86 (5%)
 Frame = -1

Query  730  VPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFF  551
            +PE +C +  L  LSLS NYF  IGP C  L+++ VLD+  NCI  LPNQR    C  F+
Sbjct  273  IPEVVCSMPKLSNLSLSDNYFNHIGPLCWKLVKRGVLDVRMNCIFGLPNQRPHYECVKFY  332

Query  550  LHY----QKCPDHKSLLYVPCDIDES  485
             H       CP    +  +PC I+ S
Sbjct  333  FHSFWFRWVCPWQYLMSAIPCKINSS  358



>ref|XP_010065987.1| PREDICTED: uncharacterized protein At4g06744-like [Eucalyptus 
grandis]
Length=418

 Score = 74.3 bits (181),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 36/86 (42%), Positives = 47/86 (55%), Gaps = 4/86 (5%)
 Frame = -1

Query  730  VPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFF  551
            +PE +C +  L  LSLS NYF  IGP C  L+++ VLD+  NCI  LPNQR    C  F+
Sbjct  309  IPEVVCSMPKLSNLSLSDNYFNHIGPLCWKLVKRGVLDVRMNCIFGLPNQRPHYECVKFY  368

Query  550  LHY----QKCPDHKSLLYVPCDIDES  485
             H       CP    +  +PC I+ S
Sbjct  369  FHSFWFRWVCPWQYLMSAIPCKINSS  394



>ref|XP_008452581.1| PREDICTED: uncharacterized protein At4g06744-like [Cucumis melo]
Length=433

 Score = 74.3 bits (181),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 37/77 (48%), Positives = 46/77 (60%), Gaps = 0/77 (0%)
 Frame = -1

Query  730  VPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFF  551
            VPE +C L+ L  L+LS NYFT +GP CR L+ + VL+I NNCI DLP QR    C  F 
Sbjct  337  VPEVVCALRHLVNLTLSDNYFTVVGPLCRILIGRGVLNIRNNCIPDLPFQRPIIECAKFL  396

Query  550  LHYQKCPDHKSLLYVPC  500
               + CP   S   +PC
Sbjct  397  AFPRICPRMWSYTLMPC  413



>ref|XP_004505255.1| PREDICTED: uncharacterized protein At4g06744-like [Cicer arietinum]
Length=407

 Score = 73.9 bits (180),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 33/77 (43%), Positives = 49/77 (64%), Gaps = 0/77 (0%)
 Frame = -1

Query  730  VPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFF  551
            VPE +C L +L  LSLS NYF ++GP C+ L+   V+D+ NNCILD+P+QR  + C  F+
Sbjct  305  VPEVVCALGNLANLSLSYNYFNRVGPICKKLIRSGVVDVRNNCILDVPDQRPLKECVAFY  364

Query  550  LHYQKCPDHKSLLYVPC  500
               + C   ++   +PC
Sbjct  365  SVPRTCLRSRTFSIIPC  381



>gb|EYU37650.1| hypothetical protein MIMGU_mgv11b016249mg [Erythranthe guttata]
Length=440

 Score = 73.9 bits (180),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 38/85 (45%), Positives = 51/85 (60%), Gaps = 3/85 (4%)
 Frame = -1

Query  730  VPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFF  551
            VPE +C+L +L  LSLS NYFT IGP+C  L+EK VL +  NCI  LP+QR+   C+ FF
Sbjct  328  VPELVCELPNLVTLSLSYNYFTGIGPKCLELVEKNVLHLRMNCIPGLPDQRTRAQCRAFF  387

Query  550  LHYQKCPDHKSLLYVPCDIDESPRK  476
               + CP      ++PC      R+
Sbjct  388  STAKGCPRSN---WIPCSSGGVIRR  409



>ref|XP_003589141.1| hypothetical protein MTR_1g018910 [Medicago truncatula]
 gb|ABD32635.1| Leucine-rich repeat, plant specific [Medicago truncatula]
 gb|ACJ86225.1| unknown [Medicago truncatula]
 gb|AES59392.1| Serine/Threonine kinase, plant-type protein, putative [Medicago 
truncatula]
 gb|AFK35532.1| unknown [Medicago truncatula]
Length=378

 Score = 73.6 bits (179),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 49/80 (61%), Gaps = 1/80 (1%)
 Frame = -1

Query  730  VPESLCK-LKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDF  554
            VP+ +C  L++L   SLS NYFT +GP CR L+++ VLD+  NCI DLP QRS   C DF
Sbjct  288  VPDFVCAGLENLVNFSLSDNYFTHVGPFCRMLIQRGVLDVGKNCIHDLPFQRSLIECADF  347

Query  553  FLHYQKCPDHKSLLYVPCDI  494
            F   + CP      + PC+ 
Sbjct  348  FTRPKICPFTWFHGFYPCNF  367



>ref|XP_010421726.1| PREDICTED: uncharacterized protein At4g06744 [Camelina sativa]
Length=407

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 36/71 (51%), Positives = 48/71 (68%), Gaps = 4/71 (6%)
 Frame = -1

Query  730  VPESLCKL--KDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKD  557
            +PE++C +   +L  LSLS NYFT +GP CR LL++ VLD+ NNCI   P QRS Q C +
Sbjct  306  IPEAVCMVLRDNLVNLSLSDNYFTHVGPWCRGLLDRGVLDVSNNCIPFFPGQRSMQECAE  365

Query  556  FFLHYQK--CP  530
            FF+  +K  CP
Sbjct  366  FFVKPKKYYCP  376



>ref|XP_007017156.1| LRR-family protein [Theobroma cacao]
 gb|EOY14381.1| LRR-family protein [Theobroma cacao]
Length=441

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 50/82 (61%), Gaps = 0/82 (0%)
 Frame = -1

Query  730  VPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFF  551
            +PE LC+L      +LS NYFTQ+GP+CR L+  + L+++ NCI+ LPNQRSA  C  FF
Sbjct  332  IPEVLCRLPRAFNFTLSNNYFTQVGPQCRRLIRLRRLNVNRNCIMGLPNQRSAADCGRFF  391

Query  550  LHYQKCPDHKSLLYVPCDIDES  485
               + C    +   +PC +  +
Sbjct  392  ARPRTCARESTFSIIPCRLPAA  413



>ref|XP_010455221.1| PREDICTED: uncharacterized protein At4g06744-like [Camelina sativa]
Length=407

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 36/71 (51%), Positives = 48/71 (68%), Gaps = 4/71 (6%)
 Frame = -1

Query  730  VPESLCKL--KDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKD  557
            +PE++C +   +L  LSLS NYFT +GP CR LL++ VLD+ NNCI   P QRS Q C +
Sbjct  306  IPEAVCMVLRDNLVNLSLSDNYFTHVGPWCRGLLDRGVLDVSNNCIPFFPGQRSMQECAE  365

Query  556  FFLHYQK--CP  530
            FF+  +K  CP
Sbjct  366  FFVKPKKYYCP  376



>ref|XP_010438766.1| PREDICTED: uncharacterized protein At4g06744 [Camelina sativa]
Length=407

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 36/71 (51%), Positives = 48/71 (68%), Gaps = 4/71 (6%)
 Frame = -1

Query  730  VPESLCKL--KDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKD  557
            +PE++C +   +L  LSLS NYFT +GP CR LL++ VLD+ NNCI   P QRS Q C +
Sbjct  306  IPEAVCMVLRDNLVNLSLSDNYFTHVGPWCRGLLDRGVLDVSNNCIPFFPGQRSMQECAE  365

Query  556  FFLHYQK--CP  530
            FF+  +K  CP
Sbjct  366  FFVKPKKYYCP  376



>ref|XP_009396708.1| PREDICTED: uncharacterized protein At4g06744-like [Musa acuminata 
subsp. malaccensis]
Length=441

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 38/89 (43%), Positives = 53/89 (60%), Gaps = 8/89 (9%)
 Frame = -1

Query  730  VPESLCKLK---DLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCK  560
            VP+ +C+L    +L  LSLSGNYFT +G  C +L++ KVLD+  NCI  LP QRS   C 
Sbjct  334  VPDVVCRLAKDGNLANLSLSGNYFTWLGHSCWDLVKTKVLDVRQNCIPGLPEQRSPAECS  393

Query  559  DFFLHYQKC-PDHKSLLYVPCDIDESPRK  476
             F+   ++C P H     +PC + + P K
Sbjct  394  TFWWGPKQCLPSHD----IPCSLPKGPTK  418



>ref|XP_002282474.2| PREDICTED: uncharacterized protein At4g06744 [Vitis vinifera]
 emb|CBI32376.3| unnamed protein product [Vitis vinifera]
Length=445

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/61 (56%), Positives = 44/61 (72%), Gaps = 0/61 (0%)
 Frame = -1

Query  730  VPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFF  551
            VPE LC LK+L+ L+LS NYFT+IGP CR+L+    +D+ NNCI +LP+QR    C  FF
Sbjct  339  VPEELCALKNLQNLTLSDNYFTKIGPNCRDLIPTGKIDLRNNCIRNLPDQRPRSDCLAFF  398

Query  550  L  548
            L
Sbjct  399  L  399



>gb|EPS58531.1| hypothetical protein M569_16282, partial [Genlisea aurea]
Length=344

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 36/79 (46%), Positives = 42/79 (53%), Gaps = 0/79 (0%)
 Frame = -1

Query  730  VPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFF  551
            VP+ LC+L  L  LSLS NYFT  G  C  L+   VLD+ NNCI  LP QR    C  FF
Sbjct  264  VPDLLCRLSKLTNLSLSDNYFTVAGDSCMGLIRSGVLDLTNNCIPGLPFQRPPMECAAFF  323

Query  550  LHYQKCPDHKSLLYVPCDI  494
                 CP+      +PC I
Sbjct  324  AGQPSCPNQYIFSKIPCRI  342



>ref|XP_010664552.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein At4g06744-like 
[Vitis vinifera]
Length=459

 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 37/71 (52%), Positives = 45/71 (63%), Gaps = 0/71 (0%)
 Frame = -1

Query  730  VPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFF  551
            VPE LC+L +L  LSL  NYF Q+G  CR+L+ K +LDI  NCI DLP QRS   C D F
Sbjct  357  VPEVLCQLPNLLNLSLYDNYFMQVGLACRSLIWKGLLDIRKNCIPDLPFQRSVAECADLF  416

Query  550  LHYQKCPDHKS  518
             + + CP   S
Sbjct  417  QYPRFCPYMNS  427



>ref|XP_011074595.1| PREDICTED: uncharacterized protein At4g06744-like [Sesamum indicum]
Length=411

 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 36/77 (47%), Positives = 44/77 (57%), Gaps = 0/77 (0%)
 Frame = -1

Query  730  VPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFF  551
            VP+ LC L++L  LSLS NY TQ GP C  L++  VLD+  NCI   P QRS   C  FF
Sbjct  318  VPDVLCGLRNLMNLSLSDNYLTQAGPSCMRLIKNGVLDVRKNCIPGQPFQRSVAECAAFF  377

Query  550  LHYQKCPDHKSLLYVPC  500
               + CP   +   VPC
Sbjct  378  ARPRNCPYMDTYSQVPC  394



>emb|CAN61023.1| hypothetical protein VITISV_001143 [Vitis vinifera]
Length=479

 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 37/71 (52%), Positives = 45/71 (63%), Gaps = 0/71 (0%)
 Frame = -1

Query  730  VPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFF  551
            VPE LC+L +L  LSL  NYF Q+G  CR+L+ K +LDI  NCI DLP QRS   C D F
Sbjct  377  VPEVLCQLPNLLNLSLYDNYFMQVGLACRSLIWKGLLDIRKNCIPDLPFQRSVAECADLF  436

Query  550  LHYQKCPDHKS  518
             + + CP   S
Sbjct  437  QYPRFCPYMNS  447



>ref|XP_010664550.1| PREDICTED: uncharacterized protein At4g06744 isoform X2 [Vitis 
vinifera]
Length=425

 Score = 71.6 bits (174),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 33/78 (42%), Positives = 44/78 (56%), Gaps = 0/78 (0%)
 Frame = -1

Query  730  VPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFF  551
            +P+SLC+L +    +LS NYF  IGP C+ L+    LD+  NCI  LPNQRSA  C  F+
Sbjct  315  IPDSLCRLPNAYNFTLSYNYFNSIGPYCKRLVNIGRLDVRRNCITGLPNQRSAAECTAFY  374

Query  550  LHYQKCPDHKSLLYVPCD  497
               + CP   S   + C 
Sbjct  375  SVSRTCPRPGSFNVITCS  392



>ref|XP_002284965.1| PREDICTED: uncharacterized protein At4g06744 isoform X1 [Vitis 
vinifera]
 emb|CAN61024.1| hypothetical protein VITISV_001144 [Vitis vinifera]
 emb|CBI19481.3| unnamed protein product [Vitis vinifera]
Length=437

 Score = 72.0 bits (175),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 33/78 (42%), Positives = 44/78 (56%), Gaps = 0/78 (0%)
 Frame = -1

Query  730  VPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFF  551
            +P+SLC+L +    +LS NYF  IGP C+ L+    LD+  NCI  LPNQRSA  C  F+
Sbjct  327  IPDSLCRLPNAYNFTLSYNYFNSIGPYCKRLVNIGRLDVRRNCITGLPNQRSAAECTAFY  386

Query  550  LHYQKCPDHKSLLYVPCD  497
               + CP   S   + C 
Sbjct  387  SVSRTCPRPGSFNVITCS  404



>ref|XP_004140710.1| PREDICTED: uncharacterized protein At4g06744-like [Cucumis sativus]
 gb|KGN57507.1| hypothetical protein Csa_3G200180 [Cucumis sativus]
Length=450

 Score = 71.6 bits (174),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 37/77 (48%), Positives = 51/77 (66%), Gaps = 0/77 (0%)
 Frame = -1

Query  730  VPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFF  551
            VPE +CKL +L   +L  N+FTQ+G EC+ L++KK+LD+ NNCI  LP QRS + C  F 
Sbjct  341  VPEEICKLPNLGNFTLRNNFFTQVGAECKKLIKKKILDVSNNCIPGLPKQRSKEECLQFA  400

Query  550  LHYQKCPDHKSLLYVPC  500
               + C + KS  Y+PC
Sbjct  401  YRPKYCGNDKSFTYIPC  417



>ref|XP_004168435.1| PREDICTED: uncharacterized protein At4g06744-like [Cucumis sativus]
Length=453

 Score = 71.6 bits (174),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 37/77 (48%), Positives = 51/77 (66%), Gaps = 0/77 (0%)
 Frame = -1

Query  730  VPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFF  551
            VPE +CKL +L   +L  N+FTQ+G EC+ L++KK+LD+ NNCI  LP QRS + C  F 
Sbjct  341  VPEEICKLPNLGNFTLRNNFFTQVGAECKKLIKKKILDVSNNCIPGLPKQRSKEECLQFA  400

Query  550  LHYQKCPDHKSLLYVPC  500
               + C + KS  Y+PC
Sbjct  401  YRPKYCGNDKSFTYIPC  417



>ref|XP_004953109.1| PREDICTED: uncharacterized protein At4g06744-like [Setaria italica]
Length=433

 Score = 71.6 bits (174),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 36/80 (45%), Positives = 46/80 (58%), Gaps = 4/80 (5%)
 Frame = -1

Query  730  VPESLCKLKD----LEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVC  563
            VP++LCKL      L  L+LSGNYFT +GP C  L++  VLD+ NNCI  L NQR    C
Sbjct  324  VPDALCKLAGPAGRLANLTLSGNYFTSVGPACAALIKDGVLDVKNNCIPGLANQRRPVEC  383

Query  562  KDFFLHYQKCPDHKSLLYVP  503
              F  H + CP   + +  P
Sbjct  384  AVFHSHPKTCPAASAQVACP  403



>ref|XP_002452450.1| hypothetical protein SORBIDRAFT_04g026020 [Sorghum bicolor]
 gb|EES05426.1| hypothetical protein SORBIDRAFT_04g026020 [Sorghum bicolor]
Length=433

 Score = 71.2 bits (173),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 43/71 (61%), Gaps = 4/71 (6%)
 Frame = -1

Query  730  VPESLCKLKD----LEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVC  563
            VP++LCKL      L  L+LSGNYFT +GP C  L++  VLD+ NNCI  L NQR A  C
Sbjct  324  VPDALCKLAGPAGRLANLTLSGNYFTSVGPACATLIKDGVLDVKNNCIPGLANQRRAAEC  383

Query  562  KDFFLHYQKCP  530
              F    + CP
Sbjct  384  AAFQSQPKTCP  394



>ref|XP_008798694.1| PREDICTED: uncharacterized protein At4g06744-like [Phoenix dactylifera]
Length=469

 Score = 71.2 bits (173),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 40/90 (44%), Positives = 51/90 (57%), Gaps = 9/90 (10%)
 Frame = -1

Query  730  VPESLCKLKD---LEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCK  560
            VP+ LC+L D   L  LSLS NYFT +G  C  L+++ +LD+  NCI  LP QRS   C 
Sbjct  344  VPDVLCRLADVGHLANLSLSSNYFTWVGTSCWQLIKRGILDVRKNCIRGLPEQRSPAECA  403

Query  559  DFFLHYQKCPDHKSLLYVPCDIDESPRKAG  470
             F    + CP    L ++PC I   PRK G
Sbjct  404  QFLKQPKYCP---YLPHIPCRI---PRKDG  427



>dbj|BAJ86461.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=444

 Score = 70.9 bits (172),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 40/83 (48%), Positives = 50/83 (60%), Gaps = 9/83 (11%)
 Frame = -1

Query  730  VPESLCKLK---DLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCK  560
            V +SLC+L     L  L+LSGNYFT +GP C +L+ +  L++D NCIL  PNQRS Q C 
Sbjct  335  VHDSLCRLAYDGRLANLTLSGNYFTWLGPCCWDLIREGKLNVDRNCILWAPNQRSFQECA  394

Query  559  DFF---LHYQKCPDHKSLLYVPC  500
            +FF        CP  K   YVPC
Sbjct  395  EFFHENWARMTCPVSK---YVPC  414



>ref|XP_006289202.1| hypothetical protein CARUB_v10002650mg [Capsella rubella]
 gb|EOA22100.1| hypothetical protein CARUB_v10002650mg [Capsella rubella]
Length=407

 Score = 70.9 bits (172),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 37/71 (52%), Positives = 47/71 (66%), Gaps = 4/71 (6%)
 Frame = -1

Query  730  VPESLCKL--KDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKD  557
            +PE +C L   +L  LSLS NYFT +GP CR LL++ VLD+ NNCI  L  QRS Q C +
Sbjct  306  IPEPVCMLLRDNLLNLSLSDNYFTHVGPWCRGLLDRGVLDVSNNCIPFLQGQRSMQECAE  365

Query  556  FFLHYQK--CP  530
            FF+  +K  CP
Sbjct  366  FFVRPKKYYCP  376



>ref|XP_006397360.1| hypothetical protein EUTSA_v10028721mg [Eutrema salsugineum]
 gb|ESQ38813.1| hypothetical protein EUTSA_v10028721mg [Eutrema salsugineum]
Length=391

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 38/89 (43%), Positives = 52/89 (58%), Gaps = 6/89 (7%)
 Frame = -1

Query  730  VPESLCKL--KDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKD  557
            +PE++C L   ++  LSLS NYFT +GP C+ L E+ VLD+ NNCI   P QRS   C +
Sbjct  291  IPEAVCMLLWDNIVNLSLSDNYFTHVGPWCKGLFERGVLDVTNNCIPFFPGQRSIDECAE  350

Query  556  FFLHYQ-KCPDHKSLLYVPC---DIDESP  482
            FF+  +  CP      ++PC    I  SP
Sbjct  351  FFVKPKYYCPHPWFHRFLPCRYSHISSSP  379



>gb|EMT03089.1| hypothetical protein F775_11041 [Aegilops tauschii]
Length=447

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 40/83 (48%), Positives = 50/83 (60%), Gaps = 9/83 (11%)
 Frame = -1

Query  730  VPESLCKLK---DLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCK  560
            V +SLC+L     L  L+LSGNYFT +GP C +L+ +  L++D NCIL  PNQRS Q C 
Sbjct  338  VHDSLCRLAYDGRLANLTLSGNYFTWLGPCCWDLIREGKLNVDRNCILWAPNQRSFQECA  397

Query  559  DFF---LHYQKCPDHKSLLYVPC  500
            +FF        CP  K   YVPC
Sbjct  398  EFFHDNWARMTCPVSK---YVPC  417



>ref|XP_009417193.1| PREDICTED: uncharacterized protein At4g06744-like [Musa acuminata 
subsp. malaccensis]
Length=456

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 39/91 (43%), Positives = 55/91 (60%), Gaps = 9/91 (10%)
 Frame = -1

Query  730  VPESLCKLKD---LEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCK  560
            VP+ +C+L     L  LSLS NYFT + P C  L+++KVLD+  NCI  LPNQR  + C 
Sbjct  335  VPDVVCQLAKYGHLANLSLSDNYFTSVAPSCAGLIQQKVLDVRKNCIPGLPNQRPPEACA  394

Query  559  DFFLHYQK--CPDHKSLLYVPCDIDESPRKA  473
             +FL+  K  CP+ +   Y+PC +  + R A
Sbjct  395  -WFLNRPKITCPNAQ---YIPCHLPWAGRDA  421



>ref|XP_009395500.1| PREDICTED: uncharacterized protein At4g06744-like [Musa acuminata 
subsp. malaccensis]
Length=448

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 35/84 (42%), Positives = 49/84 (58%), Gaps = 6/84 (7%)
 Frame = -1

Query  730  VPESLCKLK---DLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCK  560
            VP+ +C+L    +L  LSLSGNYFT +G  C +L++ KVLD+ +NCI+ LP QR    C 
Sbjct  341  VPDVVCRLAKDGNLANLSLSGNYFTSLGLSCWDLVKSKVLDVRHNCIVGLPEQRPPSECS  400

Query  559  DFFLHYQKCPDHKSLLYVPCDIDE  488
             F    + CP      Y+PC +  
Sbjct  401  KFLWRPKHCPVSH---YIPCSLSN  421



>ref|XP_003575361.1| PREDICTED: uncharacterized protein At4g06744-like [Brachypodium 
distachyon]
Length=436

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 49/86 (57%), Gaps = 1/86 (1%)
 Frame = -1

Query  730  VPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFF  551
            VP++LCKL  L  L+L+GNYF+ +GP C  L+++ VLD+  NCI  L NQR+   C  F 
Sbjct  328  VPDALCKLGRLANLTLAGNYFSSVGPACSALIKEGVLDVKRNCIPGLANQRAPAECTSFM  387

Query  550  LHYQ-KCPDHKSLLYVPCDIDESPRK  476
               +  CP   + +  P +     +K
Sbjct  388  SQPKASCPAASAPVSCPAEAAADAKK  413



>gb|EYU25462.1| hypothetical protein MIMGU_mgv1a024676mg, partial [Erythranthe 
guttata]
Length=400

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 41/70 (59%), Gaps = 0/70 (0%)
 Frame = -1

Query  730  VPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFF  551
            VPE LC +  L  LSLS NYFT++GP C  L++  VLD+  NC+  LP QRS   C  FF
Sbjct  303  VPEVLCGIGSLANLSLSDNYFTRVGPVCLGLIKSGVLDLRKNCVPGLPLQRSWAECGAFF  362

Query  550  LHYQKCPDHK  521
               + C  H 
Sbjct  363  ARPRYCVAHA  372



>ref|XP_009394537.1| PREDICTED: uncharacterized protein At4g06744-like [Musa acuminata 
subsp. malaccensis]
Length=438

 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 48/82 (59%), Gaps = 6/82 (7%)
 Frame = -1

Query  730  VPESLCKLK---DLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCK  560
            VP+ +C+L    +L  LSLSGNYFT +G  C +L+++KVLD+  NCI   P QR    C 
Sbjct  333  VPDVVCRLAKDGNLANLSLSGNYFTSLGHSCWDLIKRKVLDVRQNCIPWFPEQRRPVECW  392

Query  559  DFFLHYQKCPDHKSLLYVPCDI  494
             F  H + CP      Y+PC +
Sbjct  393  RFLWHRKFCPFFH---YIPCGL  411



>ref|XP_003575360.1| PREDICTED: uncharacterized protein At4g06744-like [Brachypodium 
distachyon]
Length=423

 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 47/86 (55%), Gaps = 1/86 (1%)
 Frame = -1

Query  730  VPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFF  551
            VP++LCKL  L  L+L+GNYF+ +GP C  L++  VLD+  NCI  L NQR+   C  F 
Sbjct  315  VPDALCKLGRLANLTLAGNYFSSVGPACSALVKDGVLDVKRNCIPGLANQRAPAECASFM  374

Query  550  LH-YQKCPDHKSLLYVPCDIDESPRK  476
                  CP   + +  P +     +K
Sbjct  375  SQPKASCPAASAPVSCPAEAAADAKK  400



>ref|XP_010932202.1| PREDICTED: uncharacterized protein At4g06744-like [Elaeis guineensis]
Length=465

 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 47/82 (57%), Gaps = 6/82 (7%)
 Frame = -1

Query  730  VPESLCKLKD---LEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCK  560
            VP+ +C L D   L  LSLS NYFT +G  C  L+E+ +LD+  NCI  LPNQRS + C 
Sbjct  345  VPDVVCLLADFGKLANLSLSSNYFTSLGKSCWKLIERGILDVRRNCIPWLPNQRSPEECG  404

Query  559  DFFLHYQKCPDHKSLLYVPCDI  494
             F    + CP      Y+PC I
Sbjct  405  WFLKQRKYCPVSP---YIPCHI  423



>gb|ABS78922.1| At4g06744-like protein, partial [Arabidopsis lyrata subsp. petraea]
 gb|ABS78923.1| At4g06744-like protein, partial [Arabidopsis lyrata subsp. petraea]
Length=174

 Score = 66.2 bits (160),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 32/56 (57%), Positives = 39/56 (70%), Gaps = 2/56 (4%)
 Frame = -1

Query  730  VPESLCKL--KDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQ  569
            VPE++C L   +L  LSLS NYFT +GP CR LL++ VLD+ NNCI   P QRS Q
Sbjct  119  VPEAVCMLLRDNLVNLSLSBNYFTHVGPWCRGLLDRGVLDVSNNCIPFFPGQRSMQ  174



>gb|ABS78915.1| At4g06744-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ABS78917.1| At4g06744-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ABS78919.1| At4g06744-like protein, partial [Arabidopsis lyrata subsp. lyrata]
Length=174

 Score = 65.9 bits (159),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 31/56 (55%), Positives = 39/56 (70%), Gaps = 2/56 (4%)
 Frame = -1

Query  730  VPESLCKL--KDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQ  569
            +PE++C L   +L  LSLS NYFT +GP CR LL++ VLD+ NNCI   P QRS Q
Sbjct  119  IPEAVCMLLRDNLVNLSLSNNYFTHVGPWCRGLLDRGVLDVSNNCIPFFPGQRSMQ  174



>gb|ABS78900.1| At4g06744-like protein, partial [Arabidopsis lyrata subsp. petraea]
 gb|ABS78903.1| At4g06744-like protein, partial [Arabidopsis lyrata subsp. petraea]
 gb|ABS78904.1| At4g06744-like protein, partial [Arabidopsis lyrata subsp. petraea]
Length=174

 Score = 65.9 bits (159),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 31/56 (55%), Positives = 39/56 (70%), Gaps = 2/56 (4%)
 Frame = -1

Query  730  VPESLCKL--KDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQ  569
            +PE++C L   +L  LSLS NYFT +GP CR LL++ VLD+ NNCI   P QRS Q
Sbjct  119  IPETVCMLLRDNLVNLSLSNNYFTHVGPWCRGLLDRGVLDVSNNCIPFFPGQRSMQ  174



>gb|ABS78911.1| At4g06744-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ABS78912.1| At4g06744-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ABS78914.1| At4g06744-like protein, partial [Arabidopsis lyrata subsp. lyrata]
Length=174

 Score = 65.9 bits (159),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 31/56 (55%), Positives = 39/56 (70%), Gaps = 2/56 (4%)
 Frame = -1

Query  730  VPESLCKL--KDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQ  569
            +PE++C L   +L  LSLS NYFT +GP CR LL++ VLD+ NNCI   P QRS Q
Sbjct  119  IPEAVCMLLRDNLVNLSLSNNYFTHVGPWCRGLLDRGVLDVSNNCIPFFPGQRSMQ  174



>gb|ABS78910.1| At4g06744-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ABS78918.1| At4g06744-like protein, partial [Arabidopsis lyrata subsp. lyrata]
Length=174

 Score = 65.9 bits (159),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 31/56 (55%), Positives = 39/56 (70%), Gaps = 2/56 (4%)
 Frame = -1

Query  730  VPESLCKL--KDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQ  569
            +PE++C L   +L  LSLS NYFT +GP CR LL++ VLD+ NNCI   P QRS Q
Sbjct  119  IPEAVCMLLRDNLVNLSLSNNYFTHVGPWCRGLLDRGVLDVSNNCIPFFPGQRSMQ  174



>gb|ABS78901.1| At4g06744-like protein, partial [Arabidopsis lyrata subsp. petraea]
 gb|ABS78913.1| At4g06744-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ABS78916.1| At4g06744-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ABS78925.1| At4g06744-like protein, partial [Arabidopsis lyrata subsp. petraea]
 gb|ABS78926.1| At4g06744-like protein, partial [Arabidopsis lyrata subsp. petraea]
 gb|ABS78927.1| At4g06744-like protein, partial [Arabidopsis lyrata subsp. petraea]
 gb|ABS78928.1| At4g06744-like protein, partial [Arabidopsis lyrata subsp. petraea]
 gb|ABS78929.1| At4g06744-like protein, partial [Arabidopsis lyrata subsp. petraea]
 gb|ABS78930.1| At4g06744-like protein, partial [Arabidopsis lyrata subsp. petraea]
 gb|ABS78931.1| At4g06744-like protein, partial [Arabidopsis lyrata subsp. petraea]
Length=174

 Score = 65.9 bits (159),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 31/56 (55%), Positives = 39/56 (70%), Gaps = 2/56 (4%)
 Frame = -1

Query  730  VPESLCKL--KDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQ  569
            +PE++C L   +L  LSLS NYFT +GP CR LL++ VLD+ NNCI   P QRS Q
Sbjct  119  IPEAVCMLLRDNLVNLSLSNNYFTHVGPWCRGLLDRGVLDVSNNCIPFFPGQRSMQ  174



>gb|ABS78920.1| At4g06744-like protein, partial [Arabidopsis lyrata subsp. petraea]
 gb|ABS78921.1| At4g06744-like protein, partial [Arabidopsis lyrata subsp. petraea]
 gb|ABS78924.1| At4g06744-like protein, partial [Arabidopsis lyrata subsp. petraea]
Length=174

 Score = 65.9 bits (159),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 32/56 (57%), Positives = 39/56 (70%), Gaps = 2/56 (4%)
 Frame = -1

Query  730  VPESLCKL--KDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQ  569
            VPE++C L   +L  LSLS NYFT +GP CR LL++ VLD+ NNCI   P QRS Q
Sbjct  119  VPEAVCMLLRDNLVNLSLSDNYFTHVGPWCRGLLDRGVLDVSNNCIPFFPGQRSMQ  174



>gb|ABS78905.1| At4g06744-like protein, partial [Arabidopsis lyrata subsp. petraea]
 gb|ABS78908.1| At4g06744-like protein, partial [Arabidopsis lyrata subsp. petraea]
 gb|ABS78909.1| At4g06744-like protein, partial [Arabidopsis lyrata subsp. petraea]
Length=174

 Score = 65.5 bits (158),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 32/56 (57%), Positives = 39/56 (70%), Gaps = 2/56 (4%)
 Frame = -1

Query  730  VPESLCKL--KDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQ  569
            VPE++C L   +L  LSLS NYFT +GP CR LL++ VLD+ NNCI   P QRS Q
Sbjct  119  VPEAVCMLLRDNLVNLSLSDNYFTHVGPWCRGLLDRGVLDVSNNCIPFFPGQRSMQ  174



>gb|ABS78899.1| At4g06744-like protein, partial [Arabidopsis halleri subsp. halleri]
Length=174

 Score = 65.1 bits (157),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/56 (57%), Positives = 38/56 (68%), Gaps = 2/56 (4%)
 Frame = -1

Query  730  VPESLCKL--KDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQ  569
            VPE++C L   +L  LSLS NYFT +GP CR LL+  VLD+ NNCI   P QRS Q
Sbjct  119  VPEAVCMLLRDNLVNLSLSNNYFTHVGPWCRGLLDXGVLDVSNNCIPFFPGQRSMQ  174



>gb|ABS78902.1| At4g06744-like protein, partial [Arabidopsis lyrata subsp. petraea]
Length=174

 Score = 64.7 bits (156),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/56 (55%), Positives = 38/56 (68%), Gaps = 2/56 (4%)
 Frame = -1

Query  730  VPESLCKL--KDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQ  569
            +PE +C L   +L  LSLS NYFT +GP CR LL++ VLD+ NNCI   P QRS Q
Sbjct  119  IPEXVCMLLRDNLVNLSLSNNYFTHVGPWCRGLLDRGVLDVSNNCIPFFPGQRSMQ  174



>ref|XP_007199295.1| hypothetical protein PRUPE_ppa023082mg, partial [Prunus persica]
 gb|EMJ00494.1| hypothetical protein PRUPE_ppa023082mg, partial [Prunus persica]
Length=398

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/56 (55%), Positives = 40/56 (71%), Gaps = 0/56 (0%)
 Frame = -1

Query  730  VPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVC  563
            VPE +C+L +L  LSLS NYFT +GP CR L++  VLD+  NCI DL +QRS + C
Sbjct  291  VPEVVCELGNLANLSLSNNYFTMVGPICRKLIKSGVLDLRKNCIRDLADQRSVEEC  346



>ref|XP_009141268.1| PREDICTED: uncharacterized protein At4g06744 isoform X1 [Brassica 
rapa]
Length=391

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 49/80 (61%), Gaps = 3/80 (4%)
 Frame = -1

Query  730  VPESLCKL--KDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKD  557
            +P+++C    ++L   SLS NYFT +GP C+ L+E+ VLD+ NNCI   P QRS + C +
Sbjct  291  IPDAVCMFLRENLVNFSLSDNYFTHVGPWCKILVERGVLDVRNNCIPFFPGQRSIEECAE  350

Query  556  FFLH-YQKCPDHKSLLYVPC  500
            FF+     CP      ++PC
Sbjct  351  FFVKPNYYCPHAWFHSFLPC  370



>gb|AFW62989.1| leucine-rich repeat (LRR) family protein [Zea mays]
Length=391

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 35/80 (44%), Positives = 44/80 (55%), Gaps = 4/80 (5%)
 Frame = -1

Query  730  VPESLCKLKD----LEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVC  563
            VP++LCKL      L  L+LSGNYFT  GP C  L++  VLD+ NNCI  L NQR    C
Sbjct  282  VPDALCKLAGPAGRLANLTLSGNYFTSAGPACAALIKDGVLDVKNNCIPGLTNQRRPAEC  341

Query  562  KDFFLHYQKCPDHKSLLYVP  503
              F    + CP   + +  P
Sbjct  342  AAFQSQPKTCPAASTQVTCP  361



>ref|XP_004953107.1| PREDICTED: uncharacterized protein At4g06744-like [Setaria italica]
Length=404

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 41/71 (58%), Gaps = 4/71 (6%)
 Frame = -1

Query  730  VPESLCKLKD----LEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVC  563
            VP++LCKL      L  L+L GNYFT +GP C  L++  VLD+ NNCI  L NQR    C
Sbjct  295  VPDALCKLAGPAGRLANLTLPGNYFTSVGPACAALIKDGVLDVKNNCIPGLANQRHPAEC  354

Query  562  KDFFLHYQKCP  530
              F    + CP
Sbjct  355  AAFHSQPKTCP  365



>gb|AFW62990.1| leucine-rich repeat (LRR) family protein [Zea mays]
Length=404

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/80 (44%), Positives = 44/80 (55%), Gaps = 4/80 (5%)
 Frame = -1

Query  730  VPESLCKLKD----LEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVC  563
            VP++LCKL      L  L+LSGNYFT  GP C  L++  VLD+ NNCI  L NQR    C
Sbjct  295  VPDALCKLAGPAGRLANLTLSGNYFTSAGPACAALIKDGVLDVKNNCIPGLTNQRRPAEC  354

Query  562  KDFFLHYQKCPDHKSLLYVP  503
              F    + CP   + +  P
Sbjct  355  AAFQSQPKTCPAASTQVTCP  374



>gb|ABS78906.1| At4g06744-like protein, partial [Arabidopsis lyrata subsp. petraea]
 gb|ABS78907.1| At4g06744-like protein, partial [Arabidopsis lyrata subsp. petraea]
Length=174

 Score = 64.3 bits (155),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 38/55 (69%), Gaps = 2/55 (4%)
 Frame = -1

Query  727  PESLCKL--KDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQ  569
            PE++C L   +L  LSLS NYFT +GP CR LL++ VLD+ NNCI   P QRS Q
Sbjct  120  PEAVCMLLRDNLVNLSLSBNYFTHVGPWCRGLLDRGVLDVSNNCIPFFPGQRSMQ  174



>ref|XP_008796513.1| PREDICTED: uncharacterized protein At4g06744-like, partial [Phoenix 
dactylifera]
Length=402

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 50/82 (61%), Gaps = 6/82 (7%)
 Frame = -1

Query  730  VPESLCKLKD---LEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCK  560
            VP+ +C+L D   L  LSLS NYFT +G  C  L+++ +LD+ +NCI  LP+QRS + C 
Sbjct  282  VPDVVCRLADYGHLANLSLSSNYFTLLGFSCWELIDRGILDVRHNCIPGLPDQRSPEECA  341

Query  559  DFFLHYQKCPDHKSLLYVPCDI  494
             F    + CP    L Y+PC I
Sbjct  342  WFLKQPKYCP---VLPYIPCYI  360



>gb|ACF84038.1| unknown [Zea mays]
 gb|AFW62991.1| leucine-rich repeat (LRR) family protein [Zea mays]
Length=435

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/80 (44%), Positives = 44/80 (55%), Gaps = 4/80 (5%)
 Frame = -1

Query  730  VPESLCKLKD----LEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVC  563
            VP++LCKL      L  L+LSGNYFT  GP C  L++  VLD+ NNCI  L NQR    C
Sbjct  326  VPDALCKLAGPAGRLANLTLSGNYFTSAGPACAALIKDGVLDVKNNCIPGLTNQRRPAEC  385

Query  562  KDFFLHYQKCPDHKSLLYVP  503
              F    + CP   + +  P
Sbjct  386  AAFQSQPKTCPAASTQVTCP  405



>ref|NP_001241706.1| uncharacterized protein LOC100856884 [Zea mays]
 gb|ACF85236.1| unknown [Zea mays]
Length=458

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/80 (44%), Positives = 44/80 (55%), Gaps = 4/80 (5%)
 Frame = -1

Query  730  VPESLCKLKD----LEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVC  563
            VP++LCKL      L  L+LSGNYFT  GP C  L++  VLD+ NNCI  L NQR    C
Sbjct  349  VPDALCKLAGPAGRLANLTLSGNYFTSAGPACAALIKDGVLDVKNNCIPGLTNQRRPAEC  408

Query  562  KDFFLHYQKCPDHKSLLYVP  503
              F    + CP   + +  P
Sbjct  409  AAFQSQPKTCPAASTQVTCP  428



>gb|ACF79045.1| unknown [Zea mays]
 gb|ACF86020.1| unknown [Zea mays]
 gb|AFW62992.1| leucine-rich repeat (LRR) family protein [Zea mays]
Length=458

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/80 (44%), Positives = 44/80 (55%), Gaps = 4/80 (5%)
 Frame = -1

Query  730  VPESLCKLKD----LEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVC  563
            VP++LCKL      L  L+LSGNYFT  GP C  L++  VLD+ NNCI  L NQR    C
Sbjct  349  VPDALCKLAGPAGRLANLTLSGNYFTSAGPACAALIKDGVLDVKNNCIPGLTNQRRPAEC  408

Query  562  KDFFLHYQKCPDHKSLLYVP  503
              F    + CP   + +  P
Sbjct  409  AAFQSQPKTCPAASTQVTCP  428



>ref|NP_001148637.1| LOC100282253 [Zea mays]
 gb|ACG32331.1| protein binding protein [Zea mays]
Length=445

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/80 (44%), Positives = 44/80 (55%), Gaps = 4/80 (5%)
 Frame = -1

Query  730  VPESLCKLKD----LEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVC  563
            VP++LCKL      L  L+LSGNYFT  GP C  L++  VLD+ NNCI  L NQR    C
Sbjct  336  VPDALCKLAGPAGRLANLTLSGNYFTSAGPACAALIKDGVLDVKNNCIPGLTNQRRPAEC  395

Query  562  KDFFLHYQKCPDHKSLLYVP  503
              F    + CP   + +  P
Sbjct  396  AAFQSQPKTCPAASTQVTCP  415



>ref|XP_010927582.1| PREDICTED: uncharacterized protein At4g06744-like [Elaeis guineensis]
Length=469

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 46/125 (37%), Positives = 58/125 (46%), Gaps = 17/125 (14%)
 Frame = -1

Query  730  VPESLCKLKD---LEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCK  560
            VP+ +C+L D   L  LSLS NYFT +G  C  LLE+ +LD+  NCI  LP+QRS   C 
Sbjct  349  VPDVVCRLADVGHLANLSLSSNYFTWLGTSCWRLLERGILDVRKNCIRGLPDQRSPAECF  408

Query  559  DFFLHYQKCPDHKSLLYVPCDIDESPRKAGphphphrpykkhkRGSS--------TTYAA  404
             F    + CP      ++PC +   P K G   H          G          TTY A
Sbjct  409  WFLKQPKYCPYFP---HIPCRL---PWKDGGAVHSAAAMLPAVGGGRDKAPASRYTTYTA  462

Query  403  LKVDR  389
            L   R
Sbjct  463  LHNRR  467



>ref|XP_008677766.1| PREDICTED: uncharacterized protein LOC100856884 isoform X1 [Zea 
mays]
Length=467

 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 35/80 (44%), Positives = 44/80 (55%), Gaps = 4/80 (5%)
 Frame = -1

Query  730  VPESLCKLKD----LEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVC  563
            VP++LCKL      L  L+LSGNYFT  GP C  L++  VLD+ NNCI  L NQR    C
Sbjct  358  VPDALCKLAGPAGRLANLTLSGNYFTSAGPACAALIKDGVLDVKNNCIPGLTNQRRPAEC  417

Query  562  KDFFLHYQKCPDHKSLLYVP  503
              F    + CP   + +  P
Sbjct  418  AAFQSQPKTCPAASTQVTCP  437



>ref|XP_006647518.1| PREDICTED: uncharacterized protein At4g06744-like [Oryza brachyantha]
Length=427

 Score = 65.5 bits (158),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 47/85 (55%), Gaps = 6/85 (7%)
 Frame = -1

Query  730  VPESLCKLKD-----LEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQV  566
            +P++LCKL       L  L+LS NYFT +GP C  L++  VL++ NNCI  L NQR    
Sbjct  317  IPDALCKLAAGPAGRLANLTLSSNYFTSVGPSCLPLIKDGVLNVKNNCIPGLANQRQPAE  376

Query  565  CKDFFLHYQKCPDHKSLLYVPCDID  491
            C  F    + CP   S  +V C ++
Sbjct  377  CASFLSQPKTCPP-ASAAHVACPVE  400



>ref|XP_004976154.1| PREDICTED: uncharacterized protein At4g06744-like [Setaria italica]
Length=458

 Score = 65.5 bits (158),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 50/79 (63%), Gaps = 5/79 (6%)
 Frame = -1

Query  730  VPESLCKLK--DLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKD  557
            VP++LC+L    L+ L+LSGNYFT +G  C +L+++  L++D NCI   PNQRS + C  
Sbjct  345  VPDALCRLAFGRLKNLTLSGNYFTSLGSCCWDLIKEGRLNVDRNCIQWAPNQRSHEECAK  404

Query  556  FFLHYQKCPDHKSLLYVPC  500
            F    + CP +    Y+PC
Sbjct  405  FQRQTKSCPVNS---YLPC  420



>ref|XP_010928365.1| PREDICTED: uncharacterized protein At4g06744-like [Elaeis guineensis]
Length=457

 Score = 65.5 bits (158),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 37/88 (42%), Positives = 47/88 (53%), Gaps = 8/88 (9%)
 Frame = -1

Query  730  VPESLCKLK---DLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCK  560
            VP+ +C+L     L  LSLSGNYFT IG  C  L++  VLD+  NCI   P+QR    C 
Sbjct  342  VPDVVCRLAKTGQLANLSLSGNYFTSIGYSCWELIKSGVLDVRQNCIPGFPDQRRPDECW  401

Query  559  DFFLH--YQKCPDHKSLLYVPCDIDESP  482
             FF H  +  CP      Y+PC    +P
Sbjct  402  WFFTHPRHYFCPFFH---YIPCKCPVAP  426



>gb|ACG34018.1| protein binding protein [Zea mays]
 tpg|DAA37048.1| TPA: leucine-rich repeat (LRR) family protein [Zea mays]
Length=442

 Score = 65.1 bits (157),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 50/79 (63%), Gaps = 5/79 (6%)
 Frame = -1

Query  730  VPESLCKL--KDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKD  557
            VP++LC+L   +L+ L+LS NYFT +G  C +L+++  L++D NCI   PNQRS + C  
Sbjct  339  VPDALCRLAFSNLKNLTLSDNYFTSLGSCCWDLIKEGRLNVDRNCIQWAPNQRSHEDCAK  398

Query  556  FFLHYQKCPDHKSLLYVPC  500
            F    + CP +    YVPC
Sbjct  399  FLRQPKSCPVNN---YVPC  414



>ref|XP_002446758.1| hypothetical protein SORBIDRAFT_06g021870 [Sorghum bicolor]
 gb|EES11086.1| hypothetical protein SORBIDRAFT_06g021870 [Sorghum bicolor]
Length=455

 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 49/79 (62%), Gaps = 5/79 (6%)
 Frame = -1

Query  730  VPESLCKL--KDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKD  557
            VP++LC+L    L+ L+LSGNYFT +G  C +L+++  L++D NCI   PNQRS   C  
Sbjct  346  VPDALCRLAFSHLKNLTLSGNYFTSLGSCCWDLIKEGRLNVDRNCIQWAPNQRSHDECAK  405

Query  556  FFLHYQKCPDHKSLLYVPC  500
            F    + CP +    Y+PC
Sbjct  406  FLRKPKTCPVNN---YLPC  421



>ref|XP_004167460.1| PREDICTED: uncharacterized protein At4g06744-like [Cucumis sativus]
 gb|KGN57510.1| hypothetical protein Csa_3G200700 [Cucumis sativus]
Length=429

 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 43/105 (41%), Positives = 54/105 (51%), Gaps = 0/105 (0%)
 Frame = -1

Query  730  VPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFF  551
            VPE +C L +L  LSLS NYFT+IGP CR L+   VLD+  NCI  LP+QRS   C   +
Sbjct  322  VPEVVCDLGNLLNLSLSDNYFTKIGPSCRKLVRNGVLDLRKNCIRGLPDQRSPLDCFFSY  381

Query  550  LHYQKCPDHKSLLYVPCDIDESPRKAGphphphrpykkhkRGSST  416
            L    CP   +  +VPC   +S    G              G+ST
Sbjct  382  LFQYPCPFPATYGFVPCQKSKSIHSFGTGQQKRSYVPIANGGNST  426



>gb|AFW72330.1| leucine-rich repeat (LRR) family protein [Zea mays]
Length=245

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 44/76 (58%), Gaps = 5/76 (7%)
 Frame = -1

Query  730  VPESLCKLKD----LEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVC  563
            VP++LC+L      L  L+LSGNYFT +GP C  L++  VL++ +NCI  L NQR  + C
Sbjct  135  VPDALCRLAGPTGRLANLTLSGNYFTSVGPACAALIKDGVLNVKSNCIPGLANQRRPEEC  194

Query  562  KDFFLHYQK-CPDHKS  518
              F     K CP   +
Sbjct  195  AAFIQSRPKTCPAAAT  210



>ref|XP_008663372.1| PREDICTED: uncharacterized protein At4g06744-like [Zea mays]
 gb|AFW58791.1| leucine-rich repeat (LRR) family protein [Zea mays]
Length=548

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 49/79 (62%), Gaps = 5/79 (6%)
 Frame = -1

Query  730  VPESLCKL--KDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKD  557
            VP++LC+L    L+ L+LS NYFT +G  C +L+++  L++D NCI   PNQRS + C  
Sbjct  440  VPDALCRLAFSHLKNLTLSDNYFTSLGSCCWDLIKEGRLNVDRNCIQWAPNQRSHEECAR  499

Query  556  FFLHYQKCPDHKSLLYVPC  500
            F    + CP +    YVPC
Sbjct  500  FLRKPKTCPVNN---YVPC  515



>gb|AEV41070.1| uncharacterized protein At4g06744 precursor [Oryza minuta]
Length=455

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 36/83 (43%), Positives = 47/83 (57%), Gaps = 7/83 (8%)
 Frame = -1

Query  730  VPESLC---KLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCK  560
            +P+ LC   K   L+ LSLS NYF  +G  C  L+  KVLD+  NCIL+ PNQR A  C 
Sbjct  351  IPDVLCMLAKTGKLQNLSLSDNYFHSVGHHCLELVRSKVLDVRLNCILNFPNQRPALECA  410

Query  559  DFFLHYQKCPDHKSLL-YVPCDI  494
             F   Y   P H   + ++PCD+
Sbjct  411  RF---YADPPQHCPFVPHIPCDL  430



>gb|AEV41116.1| uncharacterized protein At4g06744 precursor [Oryza officinalis]
Length=462

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 36/83 (43%), Positives = 47/83 (57%), Gaps = 7/83 (8%)
 Frame = -1

Query  730  VPESLC---KLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCK  560
            +P+ LC   K   L+ LSLS NYF  +G  C  L+  KVLD+  NCIL+ PNQR A  C 
Sbjct  351  IPDVLCMLAKTGKLQNLSLSDNYFHSVGHHCLELVRSKVLDVRLNCILNFPNQRPALECA  410

Query  559  DFFLHYQKCPDHKSLL-YVPCDI  494
             F   Y   P H   + ++PCD+
Sbjct  411  RF---YADPPQHCPFVPHIPCDL  430



>gb|EAY86685.1| hypothetical protein OsI_08067 [Oryza sativa Indica Group]
Length=428

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 30/72 (42%), Positives = 41/72 (57%), Gaps = 5/72 (7%)
 Frame = -1

Query  730  VPESLCKLKD-----LEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQV  566
            +P++LCKL       L  L+LS NYFT +GP C +L++  VL++ NNCI    NQR    
Sbjct  318  IPDALCKLATGPAGRLANLTLSSNYFTSVGPACLSLIKDGVLNVKNNCIPGFANQRRPAE  377

Query  565  CKDFFLHYQKCP  530
            C  F    + CP
Sbjct  378  CASFHSQPKTCP  389



>gb|AEV40972.1| uncharacterized protein At4g06744 precursor [Oryza punctata]
Length=457

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 36/83 (43%), Positives = 47/83 (57%), Gaps = 7/83 (8%)
 Frame = -1

Query  730  VPESLC---KLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCK  560
            +P+ LC   K   L+ LSLS NYF  +G  C  L+  KVLD+  NCIL+ PNQR A  C 
Sbjct  349  IPDVLCMLAKTGKLQNLSLSDNYFHSVGHHCLELVRSKVLDVRLNCILNFPNQRPALECA  408

Query  559  DFFLHYQKCPDHKSLL-YVPCDI  494
             F   Y   P H   + ++PCD+
Sbjct  409  RF---YADPPQHCPFVPHIPCDL  428



>ref|XP_004140807.1| PREDICTED: uncharacterized protein LOC101203557 [Cucumis sativus]
Length=1406

 Score = 63.5 bits (153),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 40/87 (46%), Positives = 50/87 (57%), Gaps = 0/87 (0%)
 Frame = -1

Query  730   VPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFF  551
             VPE +C L +L  LSLS NYFT+IGP CR L+   VLD+  NCI  LP+QRS   C   +
Sbjct  965   VPEVVCDLGNLLNLSLSDNYFTKIGPSCRKLVRNGVLDLRKNCIRGLPDQRSPLDCFFSY  1024

Query  550   LHYQKCPDHKSLLYVPCDIDESPRKAG  470
             L    CP   +  +VPC   +S    G
Sbjct  1025  LFQYPCPFPATYGFVPCQKSKSIHSFG  1051



>gb|AEV41023.1| uncharacterized protein At4g06744 precursor [Oryza minuta]
Length=472

 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 36/83 (43%), Positives = 47/83 (57%), Gaps = 7/83 (8%)
 Frame = -1

Query  730  VPESLC---KLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCK  560
            +P+ LC   K   L+ LSLS NYF  +G  C  L+  KVLD+  NCIL+ PNQR A  C 
Sbjct  364  IPDVLCMLAKTGKLQNLSLSDNYFHSVGHHCLELVRSKVLDVRLNCILNFPNQRPALECA  423

Query  559  DFFLHYQKCPDHKSLL-YVPCDI  494
             F   Y   P H   + ++PCD+
Sbjct  424  RF---YADPPQHCPFVPHIPCDL  443



>gb|EAY86686.1| hypothetical protein OsI_08068 [Oryza sativa Indica Group]
Length=426

 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/72 (42%), Positives = 41/72 (57%), Gaps = 5/72 (7%)
 Frame = -1

Query  730  VPESLCKLK-----DLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQV  566
            +P++LCKL       L  L+LS NYFT +GP C +L++  VL++ NNCI    NQR    
Sbjct  316  IPDALCKLAVGPAGRLANLTLSSNYFTSVGPACLSLIKDGVLNVKNNCIPGFTNQRRPAE  375

Query  565  CKDFFLHYQKCP  530
            C  F    + CP
Sbjct  376  CASFHSQPKTCP  387



>gb|EEC73254.1| hypothetical protein OsI_07372 [Oryza sativa Indica Group]
Length=324

 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 41/72 (57%), Gaps = 5/72 (7%)
 Frame = -1

Query  730  VPESLCKLKD-----LEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQV  566
            +P+ LCKL       L  L+LS NYFT +GP C +L++  VL++ NNCI  L NQR    
Sbjct  219  IPDVLCKLAAGPAGRLANLTLSSNYFTSVGPSCLSLIKDGVLNVKNNCIPGLANQRRPAE  278

Query  565  CKDFFLHYQKCP  530
            C  F    + CP
Sbjct  279  CASFHSQPKICP  290



>ref|NP_001141180.1| uncharacterized protein LOC100273267 precursor [Zea mays]
 gb|ACF85643.1| unknown [Zea mays]
Length=437

 Score = 62.4 bits (150),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 32/72 (44%), Positives = 43/72 (60%), Gaps = 5/72 (7%)
 Frame = -1

Query  730  VPESLCKLKD----LEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVC  563
            VP++LC+L      L  L+LSGNYFT +GP C  L++  VL++ +NCI  L NQR  + C
Sbjct  327  VPDALCRLAGPTGRLANLTLSGNYFTSVGPACAALIKDGVLNVKSNCIPGLANQRRPEEC  386

Query  562  KDFFLHYQK-CP  530
              F     K CP
Sbjct  387  AAFIQSRPKTCP  398



>ref|XP_010227187.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 [Brachypodium distachyon]
Length=1492

 Score = 62.8 bits (151),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 34/85 (40%), Positives = 51/85 (60%), Gaps = 9/85 (11%)
 Frame = -1

Query  730  VPESLCKLKD----LEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVC  563
            VP++LC+L      L  L+LSGNYFT +G  C +L+ +  L++D NCI   PNQRS + C
Sbjct  339  VPDALCQLASSGGRLVNLTLSGNYFTWLGACCWDLINEGKLNVDRNCIPWAPNQRSHEEC  398

Query  562  KDFFLHYQKCPDHKSL---LYVPCD  497
              FF  ++K   H +    ++ PC+
Sbjct  399  ARFF--FRKIESHATCPISVHAPCE  421



>dbj|BAD21636.1| leucine-rich repeat-like protein [Oryza sativa Japonica Group]
 dbj|BAG96332.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG89227.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96570.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96587.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96588.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96789.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96794.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96849.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96872.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG97586.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG99736.1| unnamed protein product [Oryza sativa Japonica Group]
Length=438

 Score = 62.4 bits (150),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 30/72 (42%), Positives = 41/72 (57%), Gaps = 5/72 (7%)
 Frame = -1

Query  730  VPESLCKLKD-----LEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQV  566
            +P++LCKL       L  L+LS NYFT +GP C +L++  VL++ NNCI    NQR    
Sbjct  328  IPDALCKLAAVPAGRLANLTLSSNYFTSVGPACLSLIKDGVLNVRNNCIPGFANQRRPAE  387

Query  565  CKDFFLHYQKCP  530
            C  F    + CP
Sbjct  388  CASFHSQPKACP  399



>ref|XP_006653860.1| PREDICTED: uncharacterized protein At4g06744-like [Oryza brachyantha]
Length=448

 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 35/83 (42%), Positives = 46/83 (55%), Gaps = 7/83 (8%)
 Frame = -1

Query  730  VPESLC---KLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCK  560
            +P+ LC   K   L+ LSLS NYF  +G  C  L   +VLD+  NCIL+ PNQR A  C 
Sbjct  347  IPDVLCILAKTGKLQNLSLSDNYFHSVGHHCLELARSRVLDVRLNCILNFPNQRPALECA  406

Query  559  DFFLHYQKCPDHKSLL-YVPCDI  494
             F   Y   P H   + ++PCD+
Sbjct  407  RF---YADPPQHCPFVPHIPCDL  426



>ref|XP_008799889.1| PREDICTED: uncharacterized protein At4g06744-like [Phoenix dactylifera]
Length=447

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 37/83 (45%), Positives = 45/83 (54%), Gaps = 11/83 (13%)
 Frame = -1

Query  730  VPESLCKLK---DLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCK  560
            VP+ +C+L     L  LSLSGNYFT IG  C  L++  VLD+  NCI   P QR    C 
Sbjct  333  VPDVVCRLAKTGQLANLSLSGNYFTWIGHSCWELVKSGVLDVRQNCIPGFPEQRHPDECW  392

Query  559  DFFL---HYQKCPDHKSLLYVPC  500
             FF    HY  CP    L ++PC
Sbjct  393  WFFAQPKHY--CP---FLHFIPC  410



>ref|XP_009413340.1| PREDICTED: uncharacterized protein At4g06744-like [Musa acuminata 
subsp. malaccensis]
Length=464

 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 37/89 (42%), Positives = 50/89 (56%), Gaps = 9/89 (10%)
 Frame = -1

Query  730  VPESLCKLKD---LEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCK  560
            VP+ +C+L     L  LSLS NYFT + P C +L+   VLD+  NCI  LP+QRS + C 
Sbjct  343  VPDVVCRLAKYGKLVNLSLSDNYFTSLAPSCISLIHSNVLDVRKNCIPWLPHQRSPEECA  402

Query  559  DFFLHYQK--CPDHKSLLYVPCDIDESPR  479
             +FL   K  CP+     Y+PC +    R
Sbjct  403  -WFLKLPKVFCPNAH---YIPCHLPWEGR  427



>ref|XP_003580786.1| PREDICTED: uncharacterized protein At4g06744 [Brachypodium distachyon]
Length=443

 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 35/83 (42%), Positives = 45/83 (54%), Gaps = 7/83 (8%)
 Frame = -1

Query  730  VPESLCKLKD---LEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCK  560
            VP+ LC L     L  LSLS NYF  +G  C  L+  +VLD+  NCIL  P QR A  C 
Sbjct  335  VPDVLCALAKTGKLGNLSLSDNYFHSVGRLCMELVRSRVLDVKKNCILGFPRQRPAMECA  394

Query  559  DFFLHYQK-CPDHKSLLYVPCDI  494
             F+    K CP    + ++PCD+
Sbjct  395  AFYADPSKHCP---FIPHIPCDL  414



>ref|NP_001150111.1| protein binding protein precursor [Zea mays]
 gb|ACG37876.1| protein binding protein [Zea mays]
Length=424

 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 30/63 (48%), Positives = 36/63 (57%), Gaps = 4/63 (6%)
 Frame = -1

Query  730  VPESLCKLKD----LEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVC  563
            VPE+LC L      L  L+LS NYFT + P C  L++  VLD+ NNCI  L NQR    C
Sbjct  315  VPEALCMLAGPAGRLTNLTLSSNYFTSVAPACAALIKDGVLDVKNNCIPGLANQRRPAEC  374

Query  562  KDF  554
              F
Sbjct  375  AAF  377



>ref|XP_009144429.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 3 [Brassica rapa]
Length=410

 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 36/88 (41%), Positives = 48/88 (55%), Gaps = 4/88 (5%)
 Frame = -1

Query  730  VPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKK-VLDIDNNCILDLPNQRSAQVCKDF  554
            VP  +C L  L+ L++S NYF++    CRNL  +  V D  NNC+ D P+QRS +VC+D 
Sbjct  314  VPLGVCVLPSLQNLTVSDNYFSEEEGTCRNLTSRGIVFDDSNNCLPDKPHQRSHKVCEDV  373

Query  553  FLHYQKCPDHKSLLYVPCDIDESPRKAG  470
              H   C DH+     P     SP  AG
Sbjct  374  LDHPVDCYDHECSAVAP---QASPFAAG  398



>ref|XP_006653579.1| PREDICTED: uncharacterized protein At4g06744-like [Oryza brachyantha]
Length=456

 Score = 60.1 bits (144),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 48/82 (59%), Gaps = 6/82 (7%)
 Frame = -1

Query  730  VPESLCKLK-----DLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQV  566
            VP++LCKL       L+ L+LS NYFT +G  C +L+++  L+++ NCI   PNQRS + 
Sbjct  346  VPDALCKLAFAWTGRLKNLTLSNNYFTSLGSCCWDLIKEGKLNVERNCIPWAPNQRSHEE  405

Query  565  CKDFFLHYQKCPDHKSLLYVPC  500
            C  FF H  K        YVPC
Sbjct  406  CAAFF-HRTKTSACPVNSYVPC  426



>ref|XP_006855188.1| hypothetical protein AMTR_s00051p00142580 [Amborella trichopoda]
 gb|ERN16655.1| hypothetical protein AMTR_s00051p00142580 [Amborella trichopoda]
Length=449

 Score = 59.7 bits (143),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 35/60 (58%), Gaps = 0/60 (0%)
 Frame = -1

Query  730  VPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFF  551
            +PES+C L  L  L++SGNY   +GP CR L  K  LD   NCI   PNQR A  C  F+
Sbjct  348  LPESVCVLGQLMNLTVSGNYLRSLGPACRQLARKGKLDDRLNCITGRPNQRPAADCAAFY  407



>emb|CDY72552.1| BnaCnng78240D [Brassica napus]
Length=390

 Score = 59.3 bits (142),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 36/88 (41%), Positives = 48/88 (55%), Gaps = 4/88 (5%)
 Frame = -1

Query  730  VPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKK-VLDIDNNCILDLPNQRSAQVCKDF  554
            VP  +C L  L+ L++S NYF++    CRNL  +  V D  NNC+ D P+QRS +VC+D 
Sbjct  294  VPLGVCVLPSLQNLTVSDNYFSEEEGICRNLTSRGIVFDDSNNCLPDKPHQRSHKVCEDV  353

Query  553  FLHYQKCPDHKSLLYVPCDIDESPRKAG  470
              H   C DH+     P     SP  AG
Sbjct  354  LDHPVDCYDHECSAVAP---QASPFAAG  378



>emb|CDY18974.1| BnaC01g20940D [Brassica napus]
Length=390

 Score = 59.3 bits (142),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 36/88 (41%), Positives = 48/88 (55%), Gaps = 4/88 (5%)
 Frame = -1

Query  730  VPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKK-VLDIDNNCILDLPNQRSAQVCKDF  554
            VP  +C L  L+ L++S NYF++    CRNL  +  V D  NNC+ D P+QRS +VC+D 
Sbjct  294  VPLGVCVLPSLQNLTVSDNYFSEEEGICRNLTSRGIVFDDSNNCLPDKPHQRSHKVCEDV  353

Query  553  FLHYQKCPDHKSLLYVPCDIDESPRKAG  470
              H   C DH+     P     SP  AG
Sbjct  354  LDHPVDCYDHECSAVAP---QASPFAAG  378



>ref|XP_004960235.1| PREDICTED: uncharacterized protein At4g06744-like [Setaria italica]
Length=512

 Score = 59.3 bits (142),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 33/83 (40%), Positives = 47/83 (57%), Gaps = 7/83 (8%)
 Frame = -1

Query  730  VPESLC---KLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCK  560
            VP+ +C   K   L+ LSLS N+F  +G  C  L+  +VLD+  NCIL  P+QR A  C 
Sbjct  411  VPDVVCLLAKTGKLQNLSLSDNFFHSVGHHCMELVRSRVLDVRRNCILGFPDQRPALECA  470

Query  559  DFFLHYQK-CPDHKSLLYVPCDI  494
             F+    K CP    + ++PCD+
Sbjct  471  AFYADPTKHCP---FIPHIPCDL  490



>emb|CAE02949.1| OSJNBa0014K14.21 [Oryza sativa Japonica Group]
 emb|CAE05560.1| OSJNBb0116K07.13 [Oryza sativa Japonica Group]
 gb|EAY94774.1| hypothetical protein OsI_16554 [Oryza sativa Indica Group]
 dbj|BAG90092.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG97019.1| unnamed protein product [Oryza sativa Japonica Group]
Length=454

 Score = 58.9 bits (141),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 45/82 (55%), Gaps = 6/82 (7%)
 Frame = -1

Query  730  VPESLCKLK-----DLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQV  566
            VP +LC+L       L  L+LS NYFT +G  C +L+++  L++D NCI   PNQRS   
Sbjct  342  VPNALCELAFSWSGRLRNLTLSNNYFTSLGSCCWDLIKEGKLNVDRNCIPYAPNQRSHDE  401

Query  565  CKDFFLHYQKCPDHKSLLYVPC  500
            C  FF H  K        YVPC
Sbjct  402  CAAFF-HRTKTSACPCNTYVPC  422



>gb|EEE61292.1| hypothetical protein OsJ_15379 [Oryza sativa Japonica Group]
Length=432

 Score = 58.9 bits (141),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 45/82 (55%), Gaps = 6/82 (7%)
 Frame = -1

Query  730  VPESLCKLK-----DLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQV  566
            VP +LC+L       L  L+LS NYFT +G  C +L+++  L++D NCI   PNQRS   
Sbjct  320  VPNALCELAFSWSGRLRNLTLSNNYFTSLGSCCWDLIKEGKLNVDRNCIPYAPNQRSHDE  379

Query  565  CKDFFLHYQKCPDHKSLLYVPC  500
            C  FF H  K        YVPC
Sbjct  380  CAAFF-HRTKTSACPCNTYVPC  400



>ref|XP_008456145.1| PREDICTED: uncharacterized protein At4g06744-like [Cucumis melo]
Length=424

 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 38/87 (44%), Positives = 48/87 (55%), Gaps = 0/87 (0%)
 Frame = -1

Query  730  VPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFF  551
            VPE +C+L +L  LSLS NY T+IGP CR L+   VLD+  NCI  LP+QRS   C    
Sbjct  317  VPEVVCELGNLLNLSLSDNYLTKIGPSCRKLVRNGVLDLRKNCIRGLPDQRSPLDCFFSS  376

Query  550  LHYQKCPDHKSLLYVPCDIDESPRKAG  470
            L    CP   +  +VPC   +     G
Sbjct  377  LFRYPCPFPATYGFVPCQKSKGIHSFG  403



>dbj|BAJ91151.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ96549.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=541

 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 34/83 (41%), Positives = 44/83 (53%), Gaps = 7/83 (8%)
 Frame = -1

Query  730  VPESLC---KLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCK  560
            VP+ LC   K   L  LSLS NYF  +G  C  L+  +VLD+  NCIL  P QR    C 
Sbjct  421  VPDVLCLLAKTGKLTNLSLSDNYFHSVGYHCMELVRSRVLDVRRNCILGFPGQRPHIECA  480

Query  559  DFFLHYQK-CPDHKSLLYVPCDI  494
             F+    K CP    + ++PCD+
Sbjct  481  MFYADPTKHCP---FIPHIPCDL  500



>gb|EMT08852.1| hypothetical protein F775_11606 [Aegilops tauschii]
Length=518

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 34/83 (41%), Positives = 44/83 (53%), Gaps = 7/83 (8%)
 Frame = -1

Query  730  VPESLC---KLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCK  560
            VP+ LC   K   L  LSLS NYF  +G  C  L+  +VLD+  NCIL  P QR    C 
Sbjct  404  VPDVLCLLAKTGKLTNLSLSDNYFHSVGYHCMELVRSRVLDVRRNCILGFPGQRPHIECA  463

Query  559  DFFLHYQK-CPDHKSLLYVPCDI  494
             F+    K CP    + ++PCD+
Sbjct  464  MFYADPTKHCP---FIPHIPCDL  483



>dbj|BAJ86489.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=452

 Score = 57.8 bits (138),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 36/85 (42%), Positives = 47/85 (55%), Gaps = 12/85 (14%)
 Frame = -1

Query  730  VPESLCKLK------DLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQ  569
            VP++LC+L        L  L+LS NYFT +G  C  L+++  L++  NCI   PNQRS +
Sbjct  346  VPDALCRLAYPSSGGHLANLTLSDNYFTSLGSCCWALIKQGKLNVARNCIPYAPNQRSHE  405

Query  568  VCKDFFLHYQK--CPDHKSLLYVPC  500
             C  FF H  K  CP      YVPC
Sbjct  406  ECAGFF-HRTKTTCPVST---YVPC  426



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1313813971470