BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF008N03

Length=668
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDO99712.1|  unnamed protein product                                315   3e-103   Coffea canephora [robusta coffee]
gb|KJB57703.1|  hypothetical protein B456_009G176400                    306   7e-102   Gossypium raimondii
gb|KHG02821.1|  Thiamine thiazole synthase 2, chloroplastic             310   3e-101   Gossypium arboreum [tree cotton]
gb|KDP39066.1|  hypothetical protein JCGZ_00823                         308   8e-101   Jatropha curcas
emb|CAN74175.1|  hypothetical protein VITISV_019223                     303   8e-101   Vitis vinifera
gb|KJB57700.1|  hypothetical protein B456_009G176400                    308   8e-101   Gossypium raimondii
ref|XP_010062976.1|  PREDICTED: thiamine thiazole synthase 1, chl...    307   3e-100   
gb|KJB67127.1|  hypothetical protein B456_010G176000                    306   7e-100   Gossypium raimondii
ref|XP_011096106.1|  PREDICTED: thiamine thiazole synthase 2, chl...    306   9e-100   Sesamum indicum [beniseed]
gb|KJB13600.1|  hypothetical protein B456_002G083700                    305   1e-99    Gossypium raimondii
emb|CBI23176.3|  unnamed protein product                                305   1e-99    Vitis vinifera
gb|ADG27845.1|  thiazole biosynthetic enzyme                            305   1e-99    Gossypium hirsutum [American cotton]
ref|XP_011037712.1|  PREDICTED: thiamine thiazole synthase 2, chl...    305   2e-99    Populus euphratica
ref|XP_011086171.1|  PREDICTED: thiamine thiazole synthase 2, chl...    305   2e-99    Sesamum indicum [beniseed]
ref|XP_002267414.1|  PREDICTED: thiamine thiazole synthase 2, chl...    305   2e-99    Vitis vinifera
gb|KHN47860.1|  Thiamine thiazole synthase 2, chloroplastic             298   2e-99    Glycine soja [wild soybean]
ref|XP_002305603.1|  hypothetical protein POPTR_0004s01990g             304   3e-99    Populus trichocarpa [western balsam poplar]
gb|KHG06769.1|  Thiamine thiazole synthase 1, chloroplastic             304   3e-99    Gossypium arboreum [tree cotton]
gb|KEH43920.1|  thiazole biosynthetic enzyme                            304   4e-99    Medicago truncatula
emb|CDY47441.1|  BnaC09g31160D                                          303   8e-99    Brassica napus [oilseed rape]
ref|XP_011000691.1|  PREDICTED: thiamine thiazole synthase 2, chl...    303   1e-98    Populus euphratica
ref|XP_004504342.1|  PREDICTED: thiamine thiazole synthase, chlor...    302   1e-98    Cicer arietinum [garbanzo]
gb|KHG29710.1|  Thiamine thiazole synthase 2, chloroplastic             303   1e-98    Gossypium arboreum [tree cotton]
emb|CDY41008.1|  BnaA02g27980D                                          300   2e-98    Brassica napus [oilseed rape]
ref|XP_002522858.1|  electron transfer flavoprotein-ubiquinone ox...    302   2e-98    Ricinus communis
gb|KCW70139.1|  hypothetical protein EUGRSUZ_F03433                     306   2e-98    Eucalyptus grandis [rose gum]
gb|AFK49632.1|  unknown                                                 302   3e-98    Lotus japonicus
ref|XP_009120006.1|  PREDICTED: thiamine thiazole synthase, chlor...    301   3e-98    Brassica rapa
gb|ABK21260.1|  unknown                                                 295   3e-98    Picea sitchensis
gb|KHN15802.1|  Thiamine thiazole synthase 2, chloroplastic             295   3e-98    Glycine soja [wild soybean]
gb|AFM35683.1|  thiamin biosynthetic protein                            301   4e-98    Vitis pseudoreticulata
ref|XP_009127069.1|  PREDICTED: thiamine thiazole synthase, chlor...    301   4e-98    Brassica rapa
ref|XP_010923945.1|  PREDICTED: thiamine thiazole synthase, chlor...    301   4e-98    Elaeis guineensis
emb|CDY28754.1|  BnaA02g09460D                                          301   5e-98    Brassica napus [oilseed rape]
ref|XP_006401539.1|  hypothetical protein EUTSA_v10013978mg             301   5e-98    Eutrema salsugineum [saltwater cress]
gb|ABK95834.1|  unknown                                                 298   6e-98    Populus trichocarpa [western balsam poplar]
ref|XP_007025992.1|  Thiazole biosynthetic enzyme                       302   8e-98    
gb|AFK44470.1|  unknown                                                 300   8e-98    Medicago truncatula
ref|XP_010267751.1|  PREDICTED: thiamine thiazole synthase 2, chl...    300   1e-97    Nelumbo nucifera [Indian lotus]
ref|XP_002317206.1|  hypothetical protein POPTR_0011s00500g             300   1e-97    Populus trichocarpa [western balsam poplar]
dbj|BAA88226.1|  thiamin biosynthetic enzyme                            300   1e-97    Glycine max [soybeans]
emb|CDY43024.1|  BnaA03g11710D                                          300   1e-97    Brassica napus [oilseed rape]
gb|AAV92531.1|  thiazole biosynthetic enzyme                            300   1e-97    Pseudotsuga menziesii var. menziesii
gb|AAV92552.1|  thiazole biosynthetic enzyme                            300   1e-97    Pseudotsuga menziesii var. menziesii
gb|AAV92529.1|  thiazole biosynthetic enzyme                            300   2e-97    Pseudotsuga menziesii var. menziesii
gb|AAV92537.1|  thiazole biosynthetic enzyme                            299   2e-97    Pseudotsuga menziesii var. menziesii
ref|XP_009408664.1|  PREDICTED: thiamine thiazole synthase 2, chl...    300   2e-97    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009132425.1|  PREDICTED: thiamine thiazole synthase, chlor...    300   2e-97    Brassica rapa
gb|EYU33910.1|  hypothetical protein MIMGU_mgv1a009148mg                300   2e-97    Erythranthe guttata [common monkey flower]
gb|AAW66657.1|  thiamine biosynthetic enzyme                            300   2e-97    Picrorhiza kurrooa
gb|AAV92538.1|  thiazole biosynthetic enzyme                            299   2e-97    Pseudotsuga menziesii var. menziesii
ref|XP_007143207.1|  hypothetical protein PHAVU_007G052900g             300   2e-97    Phaseolus vulgaris [French bean]
ref|XP_002316981.2|  hypothetical protein POPTR_0011s13820g             299   3e-97    Populus trichocarpa [western balsam poplar]
ref|XP_004496776.1|  PREDICTED: thiamine thiazole synthase 2, chl...    299   3e-97    Cicer arietinum [garbanzo]
ref|NP_001236824.1|  thiamin biosynthetic enzyme                        299   4e-97    
ref|XP_003556028.1|  PREDICTED: thiamine thiazole synthase 2, chl...    299   4e-97    Glycine max [soybeans]
gb|AAV92539.1|  thiazole biosynthetic enzyme                            298   6e-97    Pseudotsuga menziesii var. menziesii
gb|AAV92535.1|  thiazole biosynthetic enzyme                            298   1e-96    Pseudotsuga menziesii var. menziesii
ref|XP_003536550.1|  PREDICTED: thiamine thiazole synthase 2, chl...    298   1e-96    Glycine max [soybeans]
ref|XP_008803216.1|  PREDICTED: thiamine thiazole synthase 2, chl...    298   1e-96    Phoenix dactylifera
ref|XP_004505443.1|  PREDICTED: thiamine thiazole synthase, chlor...    297   1e-96    Cicer arietinum [garbanzo]
emb|CDP05793.1|  unnamed protein product                                295   1e-96    Coffea canephora [robusta coffee]
emb|CDY52570.1|  BnaC03g71780D                                          297   2e-96    Brassica napus [oilseed rape]
gb|EPS63253.1|  hypothetical protein M569_11533                         297   2e-96    Genlisea aurea
gb|ABK23376.1|  unknown                                                 297   4e-96    Picea sitchensis
gb|KFK27084.1|  hypothetical protein AALP_AA8G331900                    296   6e-96    Arabis alpina [alpine rockcress]
ref|XP_010545204.1|  PREDICTED: thiamine thiazole synthase, chlor...    296   6e-96    Tarenaya hassleriana [spider flower]
gb|AFK46185.1|  unknown                                                 295   9e-96    Medicago truncatula
ref|XP_003607681.1|  Thiazole biosynthetic enzyme                       295   1e-95    Medicago truncatula
ref|XP_006449089.1|  hypothetical protein CICLE_v10015727mg             295   1e-95    Citrus clementina [clementine]
gb|AFK48432.1|  unknown                                                 295   2e-95    Lotus japonicus
ref|XP_006467989.1|  PREDICTED: thiamine thiazole synthase 2, chl...    295   2e-95    Citrus sinensis [apfelsine]
ref|XP_006657781.1|  PREDICTED: thiamine thiazole synthase 2, chl...    294   3e-95    Oryza brachyantha
ref|XP_009388868.1|  PREDICTED: thiamine thiazole synthase 2, chl...    294   4e-95    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002864354.1|  hypothetical protein ARALYDRAFT_918614             293   7e-95    Arabidopsis lyrata subsp. lyrata
ref|NP_001059841.1|  Os07g0529600                                       293   1e-94    
ref|XP_008809851.1|  PREDICTED: thiamine thiazole synthase 1, chl...    293   1e-94    Phoenix dactylifera
dbj|BAC45141.1|  putative thiamine biosynthesis protein                 293   1e-94    Oryza sativa Japonica Group [Japonica rice]
gb|EYU27823.1|  hypothetical protein MIMGU_mgv1a009995mg                291   1e-94    Erythranthe guttata [common monkey flower]
emb|CAJ91138.1|  thiamin biosynthetic enzyme                            286   1e-94    Platanus x hispanica [London plane tree]
ref|XP_002973063.1|  hypothetical protein SELMODRAFT_271002             293   1e-94    Selaginella moellendorffii
ref|XP_002994429.1|  hypothetical protein SELMODRAFT_163429             293   1e-94    
gb|EAZ04139.1|  hypothetical protein OsI_26282                          292   1e-94    Oryza sativa Indica Group [Indian rice]
gb|AAV92554.1|  thiazole biosynthetic enzyme                            292   2e-94    Pseudotsuga menziesii var. menziesii
ref|XP_006280726.1|  hypothetical protein CARUB_v10026695mg             292   2e-94    Capsella rubella
gb|KHN46540.1|  Thiamine thiazole synthase 2, chloroplastic             286   2e-94    Glycine soja [wild soybean]
ref|XP_009590342.1|  PREDICTED: thiamine thiazole synthase, chlor...    292   2e-94    Nicotiana tomentosiformis
ref|XP_009774029.1|  PREDICTED: thiamine thiazole synthase, chlor...    292   3e-94    Nicotiana sylvestris
ref|XP_004244150.1|  PREDICTED: thiamine thiazole synthase, chlor...    292   3e-94    Solanum lycopersicum
ref|XP_011030844.1|  PREDICTED: LOW QUALITY PROTEIN: thiamine thi...    291   3e-94    Populus euphratica
ref|XP_010443053.1|  PREDICTED: thiamine thiazole synthase, chlor...    291   4e-94    Camelina sativa [gold-of-pleasure]
ref|XP_006360084.1|  PREDICTED: thiamine thiazole synthase 1, chl...    291   6e-94    Solanum tuberosum [potatoes]
ref|NP_200288.1|  thiazole biosynthetic enzyme                          291   6e-94    Arabidopsis thaliana [mouse-ear cress]
gb|EMT30436.1|  Thiazole biosynthetic enzyme 1-2, chloroplastic         290   8e-94    
gb|AAP03875.1|  putative chloroplast thiazole biosynthetic protein      290   9e-94    Nicotiana tabacum [American tobacco]
ref|XP_003563001.1|  PREDICTED: thiamine thiazole synthase 2, chl...    290   1e-93    Brachypodium distachyon [annual false brome]
ref|XP_010448624.1|  PREDICTED: thiamine thiazole synthase, chlor...    290   2e-93    Camelina sativa [gold-of-pleasure]
ref|XP_002281769.1|  PREDICTED: thiamine thiazole synthase 1, chl...    290   2e-93    Vitis vinifera
ref|XP_009378870.1|  PREDICTED: thiamine thiazole synthase, chlor...    290   2e-93    Pyrus x bretschneideri [bai li]
ref|XP_006845176.1|  hypothetical protein AMTR_s00005p00239290          289   2e-93    Amborella trichopoda
ref|XP_004965741.1|  PREDICTED: thiamine thiazole synthase 2, chl...    289   3e-93    Setaria italica
ref|NP_001236812.1|  thiamin biosynthetic enzyme                        288   4e-93    Glycine max [soybeans]
dbj|BAA88225.1|  thiamin biosynthetic enzyme                            288   4e-93    Glycine max [soybeans]
gb|EMS66450.1|  Thiazole biosynthetic enzyme 1-2, chloroplastic         288   4e-93    Triticum urartu
ref|XP_009358110.1|  PREDICTED: thiamine thiazole synthase, chlor...    288   5e-93    
gb|AGT16062.1|  Thiazole biosynthetic enzyme Thi4 family                288   1e-92    Saccharum hybrid cultivar R570
gb|AGT16507.1|  Thiazole biosynthetic enzyme Thi4 family                288   1e-92    Saccharum hybrid cultivar R570
gb|AGT15954.1|  Thiazole biosynthetic enzyme Thi4 family                287   1e-92    Saccharum hybrid cultivar R570
ref|XP_004294348.1|  PREDICTED: thiamine thiazole synthase, chlor...    288   1e-92    Fragaria vesca subsp. vesca
gb|AGT16846.1|  Thiazole biosynthetic enzyme Thi4 family                287   1e-92    Saccharum hybrid cultivar R570
ref|XP_004957903.1|  PREDICTED: thiamine thiazole synthase 2, chl...    287   1e-92    Setaria italica
gb|AGT17015.1|  thiazole biosynthetic enzyme                            287   2e-92    Saccharum hybrid cultivar R570
ref|XP_010670817.1|  PREDICTED: thiamine thiazole synthase, chlor...    286   3e-92    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010105570.1|  Thiamine thiazole synthase 2                       286   3e-92    
ref|XP_004294669.1|  PREDICTED: thiamine thiazole synthase, chlor...    286   3e-92    Fragaria vesca subsp. vesca
ref|XP_010670818.1|  PREDICTED: thiamine thiazole synthase 2, chl...    286   4e-92    Beta vulgaris subsp. vulgaris [field beet]
gb|AHA84206.1|  thiamin biosynthetic enzyme                             284   3e-91    Phaseolus vulgaris [French bean]
ref|XP_010485129.1|  PREDICTED: thiamine thiazole synthase, chlor...    290   3e-91    
gb|AFO59577.1|  thiamine biosynthetic enzyme                            284   3e-91    Saccharum hybrid cultivar GT28
gb|EYU19221.1|  hypothetical protein MIMGU_mgv1a009132mg                284   3e-91    Erythranthe guttata [common monkey flower]
ref|XP_010930933.1|  PREDICTED: LOW QUALITY PROTEIN: thiamine thi...    284   3e-91    
ref|XP_007021022.1|  Thiazole biosynthetic enzyme, chloroplast (A...    284   4e-91    Theobroma cacao [chocolate]
ref|XP_007132954.1|  hypothetical protein PHAVU_011G139100g             283   8e-91    Phaseolus vulgaris [French bean]
sp|Q38709.1|THI4_ALNGL  RecName: Full=Thiamine thiazole synthase,...    282   1e-90    Alnus glutinosa
ref|NP_001275783.1|  thiamine thiazole synthase, chloroplastic          282   1e-90    Citrus sinensis [apfelsine]
ref|XP_008366026.1|  PREDICTED: LOW QUALITY PROTEIN: thiamine thi...    283   2e-90    
gb|ACN66755.1|  thiazole biosynthetic enzyme                            275   4e-90    Carica papaya [mamon]
gb|EPS63028.1|  thiazole biosynthetic enzyme, chloroplastic             279   4e-90    Genlisea aurea
ref|XP_010670808.1|  PREDICTED: thiamine thiazole synthase 2, chl...    281   5e-90    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007213805.1|  hypothetical protein PRUPE_ppa007657mg             281   6e-90    Prunus persica
gb|KDO52968.1|  hypothetical protein CISIN_1g018414mg                   281   6e-90    Citrus sinensis [apfelsine]
ref|XP_006452193.1|  hypothetical protein CICLE_v10008765mg             280   8e-90    Citrus clementina [clementine]
ref|XP_001767495.1|  predicted protein                                  278   4e-89    
pdb|1RP0|A  Chain A, Crystal Structure Of Thi1 Protein From Arabi...    276   6e-89    Arabidopsis thaliana [mouse-ear cress]
ref|XP_001753819.1|  predicted protein                                  278   6e-89    
ref|XP_001767548.1|  predicted protein                                  278   8e-89    
ref|XP_008244366.1|  PREDICTED: thiamine thiazole synthase, chlor...    277   2e-88    Prunus mume [ume]
ref|XP_001755171.1|  predicted protein                                  275   7e-88    
ref|XP_001753698.1|  predicted protein                                  273   4e-87    
emb|CCJ09780.1|  putative thiazole biosynthetic enzyme                  269   8e-87    Hirudo medicinalis
gb|ACF85034.1|  unknown                                                 266   6e-85    Zea mays [maize]
gb|AHN11672.1|  thiamin biosynthetic enzyme                             260   9e-85    Phaseolus vulgaris [French bean]
ref|NP_001105696.1|  thiamine thiazole synthase 1, chloroplastic ...    266   2e-84    Zea mays [maize]
gb|AHN11665.1|  thiamin biosynthetic enzyme                             259   2e-84    Phaseolus vulgaris [French bean]
gb|AAZ93636.1|  pathogen-induced defense-responsive protein 8           266   2e-84    Oryza sativa Indica Group [Indian rice]
gb|KDO47270.1|  hypothetical protein CISIN_1g039605mg                   266   2e-84    Citrus sinensis [apfelsine]
gb|ACF87708.1|  unknown                                                 266   4e-84    Zea mays [maize]
ref|NP_001105697.1|  thiamine thiazole synthase 2, chloroplastic ...    266   4e-84    
ref|XP_006441062.1|  hypothetical protein CICLE_v10024231mg             266   4e-84    
ref|XP_002458014.1|  hypothetical protein SORBIDRAFT_03g025520          266   4e-84    Sorghum bicolor [broomcorn]
ref|XP_002463222.1|  hypothetical protein SORBIDRAFT_02g040060          265   5e-84    Sorghum bicolor [broomcorn]
gb|AHN11691.1|  thiamin biosynthetic enzyme                             257   1e-83    Phaseolus vulgaris [French bean]
gb|AGZ80417.1|  thiamin biosynthetic enzyme                             256   2e-83    Phaseolus vulgaris [French bean]
ref|XP_004152916.1|  PREDICTED: thiamine thiazole synthase, chlor...    263   4e-83    Cucumis sativus [cucumbers]
gb|AGZ80414.1|  thiamin biosynthetic enzyme                             256   4e-83    Phaseolus vulgaris [French bean]
ref|XP_008463440.1|  PREDICTED: thiamine thiazole synthase, chlor...    263   7e-83    Cucumis melo [Oriental melon]
gb|AHN11708.1|  thiamin biosynthetic enzyme                             255   8e-83    Phaseolus vulgaris [French bean]
gb|AGZ80422.1|  thiamin biosynthetic enzyme                             253   3e-82    Phaseolus vulgaris [French bean]
gb|AFW83047.1|  hypothetical protein ZEAMMB73_797739                    249   2e-77    
gb|KFH67165.1|  thiazole biosynthetic enzyme, chloroplastic             243   9e-76    Mortierella verticillata NRRL 6337
gb|KDO52969.1|  hypothetical protein CISIN_1g018414mg                   239   3e-74    Citrus sinensis [apfelsine]
gb|ACF85447.1|  unknown                                                 227   8e-72    Zea mays [maize]
gb|KDO30626.1|  hypothetical protein SPRG_04526                         228   1e-69    Saprolegnia parasitica CBS 223.65
ref|XP_008616182.1|  thiamine biosynthetic enzyme                       228   2e-69    Saprolegnia diclina VS20
ref|XP_008877253.1|  thiazole biosynthetic enzyme, chloroplastic,...    228   2e-69    Aphanomyces invadans
ref|XP_009844134.1|  thiazole biosynthesis enzyme, variant 2            225   2e-69    Aphanomyces astaci
ref|XP_009844132.1|  thiazole biosynthesis enzyme                       225   2e-68    Aphanomyces astaci
ref|XP_004496859.1|  PREDICTED: thiamine thiazole synthase, chlor...    225   3e-68    Cicer arietinum [garbanzo]
dbj|BAC79982.1|  putative thiamine biosynthesis protein                 223   6e-68    Oryza sativa Japonica Group [Japonica rice]
ref|XP_005648929.1|  thiazole biosynthetic enzyme                       221   5e-67    Coccomyxa subellipsoidea C-169
gb|ABR01228.1|  thiazole biosynthetic enzyme                            221   1e-66    Chlorella vulgaris
emb|CEP18429.1|  hypothetical protein                                   218   3e-66    Parasitella parasitica
dbj|GAN03507.1|  thiamin biosynthetic enzyme                            218   3e-66    Mucor ambiguus
gb|EPB86412.1|  thiazole biosynthetic enzyme, chloroplastic             218   3e-66    Mucor circinelloides f. circinelloides 1006PhL
gb|EPB91714.1|  thiazole biosynthetic enzyme, chloroplastic             217   7e-66    Mucor circinelloides f. circinelloides 1006PhL
ref|XP_002784437.1|  conserved hypothetical protein                     216   3e-65    Perkinsus marinus ATCC 50983
gb|EIE83081.1|  thiazole biosynthetic enzyme, chloroplastic             216   3e-65    Rhizopus delemar RA 99-880
emb|CEG62855.1|  Putative Thiamine thiazole synthase                    214   8e-65    Rhizopus microsporus
gb|ABK22862.1|  unknown                                                 215   9e-65    Picea sitchensis
gb|KIY92671.1|  thiamine biosynthetic enzyme                            215   2e-64    Monoraphidium neglectum
gb|KIY99977.1|  thiamine biosynthetic enzyme                            215   2e-64    Monoraphidium neglectum
ref|XP_005847930.1|  hypothetical protein CHLNCDRAFT_22703              212   6e-64    Chlorella variabilis
ref|XP_008386070.1|  PREDICTED: thiamine thiazole synthase, chlor...    211   1e-63    
emb|CDM85402.1|  unnamed protein product                                211   7e-63    Triticum aestivum [Canadian hard winter wheat]
gb|ABW74129.1|  thiamin biosynthetic enzyme                             203   2e-62    Mucor racemosus
gb|ADI88268.1|  HCF106 protein                                          199   6e-61    Silene latifolia
emb|CAB64776.1|  thiazole biosynthetic enzyme                           198   1e-60    Brassica juncea [brown mustard]
gb|ADI88272.1|  HCF106 protein                                          197   2e-60    Silene latifolia
emb|CBI23938.3|  unnamed protein product                                199   3e-60    Vitis vinifera
gb|ADI88468.1|  HCF106 protein                                          196   5e-60    Silene vulgaris [maiden's-tears]
gb|ADI88284.1|  HCF106 protein                                          196   8e-60    Silene latifolia
ref|XP_003522069.1|  PREDICTED: thiamine thiazole synthase, chlor...    200   1e-59    Glycine max [soybeans]
gb|AGB85035.1|  thiamine biosynthesis thi4 protein                      201   1e-59    Auxenochlorella protothecoides
ref|XP_011397717.1|  Thiamine thiazole synthase, chloroplastic          203   4e-59    Auxenochlorella protothecoides
ref|XP_001698672.1|  full-length thiazole biosynthetic enzyme           199   3e-58    Chlamydomonas reinhardtii
ref|XP_002951140.1|  hypothetical protein VOLCADRAFT_74900              196   3e-57    Volvox carteri f. nagariensis
ref|XP_002951138.1|  hypothetical protein VOLCADRAFT_74899              196   5e-57    Volvox carteri f. nagariensis
ref|XP_005834399.1|  putative THI4, thiamine                            190   5e-55    Guillardia theta CCMP2712
emb|CAH25337.1|  thiazole biosynthetic enzyme                           190   5e-55    Guillardia theta
ref|XP_007586590.1|  putative thiazole biosynthetic enzyme protein      188   3e-54    
gb|KFZ11494.1|  hypothetical protein V502_07520                         187   8e-54    Pseudogymnoascus sp. VKM F-4520 (FW-2644)
gb|EKG16915.1|  Thiamine biosynthesis Thi4 protein                      184   8e-54    Macrophomina phaseolina MS6
gb|EHL02685.1|  putative Thiazole biosynthetic enzyme, mitochondrial    186   1e-53    Glarea lozoyensis 74030
gb|KIN04678.1|  hypothetical protein OIDMADRAFT_17638                   186   1e-53    Oidiodendron maius Zn
ref|XP_001589094.1|  thiazole biosynthetic enzyme                       186   1e-53    Sclerotinia sclerotiorum 1980 UF-70
gb|KFY94986.1|  hypothetical protein V498_03597                         186   1e-53    Pseudogymnoascus sp. VKM F-4517 (FW-2822)
ref|XP_001549602.1|  thiazole biosynthetic enzyme                       186   1e-53    
ref|XP_008087498.1|  FAD/NAD(P)-binding protein                         186   2e-53    Glarea lozoyensis ATCC 20868
gb|KFY84898.1|  hypothetical protein V500_08902                         186   2e-53    Pseudogymnoascus sp. VKM F-4518 (FW-2643)
gb|ESZ95478.1|  thiazole biosynthetic enzyme                            186   2e-53    Sclerotinia borealis F-4128
gb|KFY70117.1|  hypothetical protein V499_09439                         186   2e-53    Pseudogymnoascus sp. VKM F-103
gb|KFZ09843.1|  hypothetical protein V501_05470                         186   2e-53    Pseudogymnoascus sp. VKM F-4519 (FW-2642)
ref|XP_007289177.1|  thiazole biosynthetic enzyme                       186   2e-53    Marssonina brunnea f. sp. 'multigermtubi' MB_m1
gb|EME42084.1|  hypothetical protein DOTSEDRAFT_73000                   186   3e-53    Dothistroma septosporum NZE10
ref|XP_003842741.1|  similar to thiazole biosynthetic enzyme            184   6e-53    Leptosphaeria maculans JN3
ref|XP_007672530.1|  hypothetical protein BAUCODRAFT_62660              184   8e-53    Baudoinia panamericana UAMH 10762
ref|XP_009228164.1|  thiazole biosynthetic enzyme                       184   8e-53    Gaeumannomyces tritici R3-111a-1
gb|KFY20175.1|  hypothetical protein V491_03934                         184   9e-53    Pseudogymnoascus sp. VKM F-3775
emb|CEI86769.1|  Putative Thiamine thiazole synthase                    182   1e-52    Rhizopus microsporus
gb|KFY43107.1|  hypothetical protein V494_02101                         183   1e-52    Pseudogymnoascus sp. VKM F-4513 (FW-928)
gb|KFY08103.1|  hypothetical protein V492_06538                         183   2e-52    Pseudogymnoascus sp. VKM F-4246
gb|KFX98431.1|  hypothetical protein O988_04337                         184   2e-52    Pseudogymnoascus sp. VKM F-3808
ref|XP_007928692.1|  hypothetical protein MYCFIDRAFT_211863             183   2e-52    Pseudocercospora fijiensis CIRAD86
gb|ELR08851.1|  thiazole biosynthetic enzyme, mitochondrial             183   2e-52    Pseudogymnoascus destructans 20631-21
gb|KFY24905.1|  hypothetical protein V493_04960                         182   3e-52    Pseudogymnoascus sp. VKM F-4281 (FW-2241)
gb|KJB57702.1|  hypothetical protein B456_009G176400                    181   9e-52    Gossypium raimondii
ref|XP_499918.1|  YALI0A09768p                                          181   1e-51    Yarrowia lipolytica CLIB122
gb|EAQ71495.1|  hypothetical protein MGCH7_ch7g902                      177   1e-51    Magnaporthe oryzae 70-15
gb|AGT99181.1|  thiazole biosynthetic enzyme                            181   1e-51    Acremonium chrysogenum
gb|ABG46357.1|  mitochondrial thiazole biosynthetic enzyme              181   1e-51    Trichoderma harzianum
gb|KHK14205.1|  ribulose-1,5-biphosphate synthetase                     174   1e-51    Listeria monocytogenes SHL007
gb|EHK27008.1|  hypothetical protein TRIVIDRAFT_215037                  181   1e-51    Trichoderma virens Gv29-8
ref|XP_008026201.1|  hypothetical protein SETTUDRAFT_177413             181   2e-51    Exserohilum turcica Et28A
ref|XP_007794010.1|  putative thiazole biosynthetic enzyme protein      180   2e-51    
emb|CEJ80029.1|  Putative Thiamine thiazole synthase                    180   2e-51    Torrubiella hemipterigena
emb|CCF45087.1|  thiazole biosynthetic enzyme                           180   3e-51    Colletotrichum higginsianum
ref|XP_007913237.1|  putative thiazole biosynthetic enzyme protein      180   3e-51    Phaeoacremonium minimum UCRPA7
ref|NP_596642.1|  thiazole biosynthetic enzyme                          180   3e-51    Schizosaccharomyces pombe
ref|XP_008598283.1|  mitochondrial thiazole biosynthetic enzyme         180   3e-51    Beauveria bassiana ARSEF 2860
gb|KGQ06713.1|  Thiamine thiazole synthase                              180   4e-51    Beauveria bassiana D1-5
ref|XP_001935439.1|  thiazole biosynthesis enzyme                       180   4e-51    Pyrenophora tritici-repentis Pt-1C-BFP
gb|ABN45968.1|  thiazole biosynthetic enzyme variant 1                  179   4e-51    Epichloe typhina
ref|XP_003297921.1|  hypothetical protein PTT_08482                     179   5e-51    
ref|XP_007277744.1|  thiazole biosynthetic enzyme                       177   5e-51    
emb|CEJ80028.1|  Putative Thiamine thiazole synthase                    181   7e-51    Torrubiella hemipterigena
ref|XP_006968797.1|  thiazole biosynthetic enzyme                       179   7e-51    Trichoderma reesei QM6a
gb|ENH83973.1|  thiazole biosynthetic enzyme                            179   8e-51    
ref|XP_002172093.1|  thiazole biosynthetic enzyme                       179   8e-51    Schizosaccharomyces japonicus yFS275
gb|KDB14289.1|  thiazole biosynthetic enzyme variant 1                  179   8e-51    Ustilaginoidea virens
ref|XP_006666857.1|  thiazole biosynthetic enzyme                       179   9e-51    Cordyceps militaris CM01
gb|EMD85953.1|  hypothetical protein COCHEDRAFT_1160889                 179   1e-50    Bipolaris maydis C5
gb|ELQ36693.1|  hypothetical protein OOU_Y34scaffold00646g4             177   1e-50    Magnaporthe oryzae Y34
gb|ACN39013.1|  thiazole synthase                                       178   1e-50    Epichloe festucae
ref|XP_003044703.1|  predicted protein                                  178   2e-50    [Nectria] haematococca mpVI 77-13-4
gb|KEQ70131.1|  putative thiazole synthase THI4_ASPOR thiazole bi...    178   2e-50    Aureobasidium namibiae CBS 147.97
gb|EFQ30532.1|  Thi4 family protein                                     178   2e-50    Colletotrichum graminicola M1.001
gb|KHN95056.1|  thiazole biosynthetic enzyme variant 1                  178   2e-50    Metarhizium album ARSEF 1941
gb|ACB70465.1|  thiazole biosynthetic enzyme                            177   2e-50    Trichoderma aureoviride
sp|P23617.1|THI4_FUSSH  RecName: Full=Thiamine thiazole synthase;...    177   2e-50    Fusarium phaseoli
gb|EHK44880.1|  hypothetical protein TRIATDRAFT_299703                  177   2e-50    Trichoderma atroviride IMI 206040
gb|KEQ99790.1|  hypothetical protein AUEXF2481DRAFT_35726               178   3e-50    Aureobasidium subglaciale EXF-2481
ref|XP_007821738.1|  thiazole biosynthetic enzyme variant 1             177   3e-50    Metarhizium robertsii ARSEF 23
gb|KID90425.1|  thiazole biosynthetic enzyme variant 1                  177   3e-50    Metarhizium guizhouense ARSEF 977
ref|XP_007807526.1|  thiazole biosynthetic enzyme variant 1             178   3e-50    Metarhizium acridum CQMa 102
ref|XP_003720575.1|  thiazole biosynthetic enzyme                       177   3e-50    Magnaporthe oryzae 70-15
ref|XP_003851349.1|  hypothetical protein MYCGRDRAFT_44262              177   3e-50    Zymoseptoria tritici IPO323
gb|EUN24789.1|  hypothetical protein COCVIDRAFT_17857                   177   3e-50    Bipolaris victoriae FI3
gb|KEY67925.1|  hypothetical protein S7711_02133                        177   3e-50    Stachybotrys chartarum IBT 7711
ref|XP_007701574.1|  hypothetical protein COCSADRAFT_38262              177   3e-50    Bipolaris sorokiniana ND90Pr
gb|KID99833.1|  thiazole biosynthetic enzyme variant 1                  177   3e-50    Metarhizium majus ARSEF 297
gb|EQB43457.1|  hypothetical protein CGLO_17887                         177   3e-50    Colletotrichum gloeosporioides Cg-14
ref|XP_001796354.1|  hypothetical protein SNOG_05965                    177   4e-50    Parastagonospora nodorum SN15
ref|XP_007713209.1|  hypothetical protein COCCADRAFT_27023              177   4e-50    Bipolaris zeicola 26-R-13
gb|EFW98890.1|  thiazole biosynthetic enzyme                            177   4e-50    Grosmannia clavigera kw1407
gb|KEQ59396.1|  Thi4-domain-containing protein                          177   4e-50    Aureobasidium melanogenum CBS 110374
emb|CCE33143.1|  probable CyPBP37 protein (protein binding to CyP41)    177   4e-50    Claviceps purpurea 20.1
ref|XP_006692218.1|  hypothetical protein CTHT_0017160                  177   4e-50    Chaetomium thermophilum var. thermophilum DSM 1495
ref|XP_007692325.1|  hypothetical protein COCMIDRAFT_30031              177   4e-50    Bipolaris oryzae ATCC 44560
gb|KFY50717.1|  hypothetical protein V496_09214                         186   4e-50    Pseudogymnoascus sp. VKM F-4515 (FW-2607)
ref|XP_009253330.1|  hypothetical protein FPSE_01936                    177   5e-50    
ref|XP_011318395.1|  hypothetical protein FGSG_02469                    176   6e-50    
emb|CDP29968.1|  Putative mitochondrial thiazole biosynthetic enz...    177   6e-50    
ref|XP_007591792.1|  thiazole biosynthetic enzyme                       177   6e-50    
sp|P23618.2|THI4_FUSOX  RecName: Full=Thiamine thiazole synthase;...    176   6e-50    
gb|EWG49587.1|  thiamine biosynthetic enzyme                            176   6e-50    
gb|EUC66166.1|  thiamine thiazole synthase                              176   9e-50    
ref|XP_007835960.1|  Thiamine thiazole synthase                         176   9e-50    
ref|XP_006388786.1|  hypothetical protein POPTR_0101s00250g             169   1e-49    
gb|EMT70803.1|  Thiazole biosynthetic enzyme, mitochondrial             176   1e-49    
ref|XP_003344754.1|  hypothetical protein SMAC_06409                    176   1e-49    
gb|ADI87873.1|  HCF106 protein                                          169   1e-49    
emb|CDK26023.1|  unnamed protein product                                174   1e-49    
ref|XP_007271222.1|  thiazole biosynthetic enzyme                       176   2e-49    
gb|ADI87863.1|  HCF106 protein                                          169   2e-49    
gb|KIL95952.1|  hypothetical protein FAVG1_00690                        175   2e-49    
gb|EXK40264.1|  thiamine biosynthetic enzyme                            177   2e-49    
gb|KHE80990.1|  hypothetical protein GE21DRAFT_10110                    176   2e-49    
gb|KEQ82031.1|  Thi4-domain-containing protein                          175   2e-49    
ref|XP_009853231.1|  hypothetical protein NEUTE1DRAFT_95662             176   2e-49    
gb|KFA66874.1|  hypothetical protein S40285_02303                       175   2e-49    
ref|XP_011395239.1|  thiazole biosynthetic enzyme, variant 2            176   2e-49    
ref|XP_006957782.1|  Thi4-domain-containing protein                     175   2e-49    
gb|KEZ45124.1|  Thiamine thiazole synthase                              174   4e-49    
gb|AAF25444.1|AF217503_1  putative thiazole synthase                    174   4e-49    
gb|KFX95262.1|  hypothetical protein V490_03958                         184   4e-49    
ref|XP_001819323.1|  thiazole biosynthetic enzyme                       174   5e-49    
gb|KFY37341.1|  hypothetical protein V495_07232                         183   5e-49    
ref|XP_002375225.1|  thiazole biosynthesis enzyme Sti35                 174   5e-49    
gb|EWG49586.1|  thiamine biosynthetic enzyme                            176   6e-49    
gb|ADI87875.1|  HCF106 protein                                          167   6e-49    
gb|ADI87865.1|  HCF106 protein                                          167   6e-49    
ref|XP_001227644.1|  thiazole biosynthetic enzyme, mitochondrial ...    174   6e-49    
gb|KDN34978.1|  hypothetical protein RSAG8_11984                        174   7e-49    
ref|XP_009269436.1|  Thiamine thiazole synthase                         174   7e-49    
gb|ABQ23424.1|  thiazole biosynthetic enzyme                            174   7e-49    
ref|XP_461084.2|  DEHA2F16654p                                          174   7e-49    
gb|EPX71211.1|  thiazole biosynthetic enzyme                            174   7e-49    
ref|XP_003665159.1|  hypothetical protein MYCTH_2315910                 174   7e-49    
gb|EPE04284.1|  thiazole biosynthetic enzyme                            174   8e-49    
dbj|GAD93648.1|  thiazole biosynthetic enzyme                           174   8e-49    
ref|XP_007757037.1|  thiazole biosynthetic enzyme, mitochondrial        174   9e-49    
ref|XP_002146762.1|  thiazole biosynthesis enzyme                       174   1e-48    
ref|XP_003654402.1|  hypothetical protein THITE_2117402                 174   1e-48    
gb|EMF12655.1|  thiazole biosynthetic enzyme, mitochondrial             174   1e-48    
gb|EPY53594.1|  thiazole biosynthetic enzyme                            173   1e-48    
ref|XP_002479053.1|  thiazole biosynthesis enzyme                       173   1e-48    
gb|KIV92747.1|  thiamine thiazole synthase                              173   1e-48    
emb|CCO32846.1|  Thiamine thiazole synthase AltName: Full=Stress-...    173   1e-48    
gb|KIV86535.1|  thiamine thiazole synthase, variant 2                   173   1e-48    
gb|EDK40113.2|  conserved hypothetical protein                          173   2e-48    
gb|KIV86533.1|  thiamine thiazole synthase                              173   2e-48    
gb|KEF63437.1|  thiazole biosynthetic enzyme, mitochondrial             172   2e-48    
gb|KDN61355.1|  putative Thi4 family protein                            172   3e-48    
gb|KIW21130.1|  thiamine thiazole synthase                              172   3e-48    
gb|KIH92073.1|  thiamine biosynthetic enzyme                            172   4e-48    
ref|XP_004199741.1|  Piso0_002284                                       172   4e-48    
gb|ERT00649.1|  thiazole biosynthetic enzyme, mitochondrial             172   4e-48    
dbj|GAA84055.1|  thiazole biosynthesis enzyme                           172   5e-48    
dbj|GAM85562.1|  hypothetical protein ANO11243_035690                   171   5e-48    
dbj|GAM35876.1|  thiazole biosynthetic enzyme                           172   6e-48    
ref|XP_001394167.1|  thiazole biosynthetic enzyme                       171   7e-48    
pdb|3JSK|A  Chain A, Thiazole Synthase From Neurospora Crassa           171   8e-48    
emb|CCM00650.1|  predicted protein                                      171   9e-48    
ref|XP_002615665.1|  hypothetical protein CLUG_04547                    167   1e-47    
ref|XP_004198891.1|  Piso0_002284                                       170   1e-47    
gb|ABL63512.1|  mitochondrial thiazole biosynthetic enzyme              170   2e-47    
ref|XP_001214996.1|  hypothetical protein ATEG_05818                    170   2e-47    
ref|XP_009648318.1|  STI35 protein                                      170   2e-47    
gb|KIJ62636.1|  hypothetical protein HYDPIDRAFT_94083                   170   2e-47    
emb|CCX30406.1|  Similar to Thiamine thiazole synthase; acc. no. ...    170   2e-47    
gb|ELQ63963.1|  hypothetical protein OOW_P131scaffold00904g6            178   2e-47    
ref|XP_001835983.2|  thiazole biosynthetic enzyme                       169   2e-47    
ref|XP_001267966.1|  thiazole biosynthesis enzyme                       170   2e-47    
gb|ADI87867.1|  HCF106 protein                                          162   3e-47    
ref|XP_003320392.1|  thiazole biosynthetic enzyme, mitochondrial        170   3e-47    
ref|XP_007399642.1|  hypothetical protein PHACADRAFT_177254             169   4e-47    
ref|XP_001483482.1|  conserved hypothetical protein                     169   5e-47    
ref|XP_750725.1|  thiazole biosynthesis enzyme                          169   5e-47    
ref|XP_007866883.1|  Thi4-domain-containing protein                     169   6e-47    
gb|KEY78369.1|  thiazole biosynthesis enzyme                            169   6e-47    
gb|EMD39842.1|  hypothetical protein CERSUDRAFT_112109                  169   6e-47    
gb|KIJ24322.1|  hypothetical protein M422DRAFT_274931                   169   7e-47    
gb|EYE95075.1|  Thi4 family thiamine biosynthetic enzyme                169   7e-47    
ref|XP_661532.1|  THI4_ASPOR Thiazole biosynthetic enzyme, mitoch...    169   7e-47    
ref|XP_001526313.1|  hypothetical protein LELG_02871                    169   7e-47    
ref|XP_001257952.1|  thiazole biosynthesis enzyme                       169   7e-47    
gb|EJT96874.1|  thiazole biosynthetic enzyme                            169   8e-47    
gb|EPT05287.1|  hypothetical protein FOMPIDRAFT_1112158                 168   9e-47    
gb|KDQ62341.1|  hypothetical protein JAAARDRAFT_170661                  168   1e-46    
ref|XP_008037799.1|  Thi4-domain-containing protein                     168   1e-46    
gb|KIO02829.1|  hypothetical protein M404DRAFT_27718                    167   2e-46    
gb|KII90613.1|  hypothetical protein PLICRDRAFT_538929                  167   2e-46    
ref|XP_007364009.1|  Thi4-domain-containing protein                     167   2e-46    
ref|XP_007380545.1|  thiazole biosynthetic enzyme                       167   2e-46    
gb|EMG50374.1|  hypothetical protein G210_4595                          167   3e-46    
ref|XP_006462581.1|  hypothetical protein AGABI2DRAFT_72787             166   3e-46    
gb|KIP06210.1|  hypothetical protein PHLGIDRAFT_468135                  166   4e-46    
gb|KIM63333.1|  hypothetical protein SCLCIDRAFT_752494                  166   5e-46    
gb|EPS32049.1|  hypothetical protein PDE_07008                          166   5e-46    
ref|XP_002492875.1|  Thiazole synthase, catalyzes formation of th...    167   6e-46    
ref|XP_007376158.1|  hypothetical protein SPAPADRAFT_51398              167   7e-46    
gb|EKV04849.1|  Thiazole biosynthesis enzyme                            166   7e-46    
gb|KIY62047.1|  thiazole biosynthetic enzyme                            166   7e-46    
gb|EIF46156.1|  thiazole biosynthetic enzyme                            166   7e-46    
ref|WP_043641419.1|  hypothetical protein                               163   7e-46    
sp|Q9UVF8.1|THI4_UROFA  RecName: Full=Thiamine thiazole synthase;...    166   9e-46    
ref|XP_003868755.1|  Thi4 thiamine biosynthetic enzyme precursor        166   1e-45    
ref|XP_007416429.1|  hypothetical protein MELLADRAFT_53832              166   1e-45    
gb|KIK99865.1|  hypothetical protein PAXRUDRAFT_822318                  165   1e-45    
ref|XP_002541542.1|  thiazole biosynthesis enzyme                       165   1e-45    
gb|KIM43217.1|  hypothetical protein M413DRAFT_444027                   165   1e-45    
gb|KGO71577.1|  Thiazole biosynthetic enzyme Thi4 family                165   2e-45    
emb|CCE44732.1|  hypothetical protein CPAR2_405360                      166   2e-45    
ref|XP_007319542.1|  hypothetical protein SERLADRAFT_470126             165   2e-45    
ref|XP_001386426.1|  hypothetical protein PICST_50942                   166   2e-45    
gb|KIW54196.1|  thiamine thiazole synthase                              165   2e-45    
gb|KDQ25745.1|  hypothetical protein PLEOSDRAFT_1057999                 164   2e-45    
gb|KDR82811.1|  hypothetical protein GALMADRAFT_238371                  163   2e-45    
gb|KIX08964.1|  thiamine thiazole synthase                              164   3e-45    
gb|KGK37032.1|  hypothetical protein JL09_g3847                         165   3e-45    
gb|ESW99744.1|  Thiamine thiazole synthase                              164   3e-45    
ref|XP_010759569.1|  thiazole biosynthetic enzyme, mitochondrial        164   4e-45    
ref|XP_007351669.1|  thiazole biosynthetic enzyme                       164   4e-45    
ref|XP_002797266.1|  thiazole biosynthesis enzyme                       164   4e-45    
gb|EGD98433.1|  Thi4 family protein                                     164   4e-45    
ref|XP_002564812.1|  Pc22g07960                                         164   4e-45    
gb|KGO43516.1|  Thiazole biosynthetic enzyme Thi4 family                164   4e-45    
gb|EEH05819.1|  thiazole biosynthetic enzyme                            164   5e-45    
ref|XP_007304939.1|  Thi4-domain-containing protein                     164   5e-45    
sp|C0NSF3.2|THI4_AJECG  RecName: Full=Thiamine thiazole synthase;...    164   5e-45    
ref|XP_001538310.1|  hypothetical protein HCAG_05915                    164   5e-45    
gb|EER41684.1|  thiazole biosynthetic enzyme                            164   5e-45    
gb|KIX99472.1|  thiamine thiazole synthase                              164   5e-45    
gb|KDN47179.1|  putative Thiamin biosynthetic enzyme                    164   5e-45    
dbj|GAK64104.1|  thi4-domain-containing protein                         164   7e-45    
gb|KDB24510.1|  thiazole biosynthetic enzyme, mitochondrial             163   9e-45    
gb|KIY43384.1|  Thi4-domain-containing protein                          163   9e-45    
gb|KIL63207.1|  hypothetical protein M378DRAFT_79929                    163   9e-45    
ref|XP_007745751.1|  thiazole biosynthetic enzyme, mitochondrial        163   9e-45    
gb|EEH38204.2|  thiazole biosynthesis enzyme                            164   9e-45    
ref|XP_002842761.1|  thiazole biosynthetic enzyme                       163   1e-44    
emb|CDI56388.1|  probable Thiamin biosynthetic enzyme                   163   1e-44    
gb|EEH19379.2|  thiazole biosynthetic enzyme, mitochondrial             163   1e-44    
gb|KIW39396.1|  thiamine thiazole synthase, variant 1                   162   1e-44    
gb|KIW92677.1|  thiamine thiazole synthase                              162   1e-44    
ref|XP_007882083.1|  hypothetical protein PFL1_06351                    163   2e-44    
ref|XP_003169195.1|  thiazole biosynthesis enzyme                       162   2e-44    
gb|EZF72777.1|  thiazole biosynthetic enzyme, mitochondrial             162   2e-44    
ref|XP_003013828.1|  hypothetical protein ARB_07940                     162   2e-44    
ref|XP_009154920.1|  thiazole biosynthetic enzyme, mitochondrial        162   2e-44    
gb|KIW68442.1|  thiamine thiazole synthase                              162   2e-44    
gb|KIW79545.1|  thiamine thiazole synthase                              162   2e-44    
gb|KIW29175.1|  thiamine thiazole synthase                              162   2e-44    
ref|XP_002548228.1|  hypothetical protein CTRG_02525                    162   2e-44    
gb|KIW39395.1|  thiamine thiazole synthase                              162   2e-44    
ref|XP_007728533.1|  thiazole biosynthetic enzyme, mitochondrial        162   3e-44    
ref|XP_007721137.1|  thiazole biosynthetic enzyme, mitochondrial        162   3e-44    
dbj|GAC98786.1|  flavin-binding monooxygenase-like                      162   3e-44    
ref|XP_008714161.1|  thiazole biosynthetic enzyme, mitochondrial        162   3e-44    
ref|XP_002626178.1|  thiazole biosynthesis enzyme                       162   3e-44    
gb|EEQ92538.1|  thiazole biosynthesis enzyme                            162   4e-44    
gb|EFW21941.1|  thiazole biosynthetic enzyme                            161   5e-44    
gb|KJA21255.1|  hypothetical protein HYPSUDRAFT_42403                   161   5e-44    
ref|XP_008726400.1|  thiazole biosynthetic enzyme, mitochondrial        161   6e-44    
ref|XP_001247344.1|  thiazole biosynthetic enzyme, mitochondrial ...    161   6e-44    
ref|XP_003066032.1|  thiazole biosynthetic enzyme, mitochondrial ...    161   6e-44    
emb|CDM36407.1|  Thiazole biosynthetic enzyme, mitochondrial            162   7e-44    
dbj|GAC72397.1|  hypothetical protein PANT_7d00078                      161   8e-44    
gb|ETS60793.1|  hypothetical protein PaG_04705                          160   8e-44    
ref|XP_003235740.1|  Thi4 family protein                                160   9e-44    
gb|KIM86133.1|  hypothetical protein PILCRDRAFT_816673                  160   9e-44    
emb|CCF51739.1|  probable Thiamin biosynthetic enzyme                   160   2e-43    
emb|CBQ71006.1|  probable Thiamin biosynthetic enzyme                   160   2e-43    
emb|CEG76808.1|  Putative Thiamine thiazole synthase                    158   2e-43    
gb|KFX46359.1|  Thiamine thiazole synthase                              159   2e-43    
gb|EQL00755.1|  thiazole biosynthetic enzyme variant 1                  159   3e-43    
ref|XP_007853538.1|  thiazole biosynthetic enzyme                       159   3e-43    
gb|EST05805.1|  flavin-binding monooxygenase-like                       159   3e-43    
ref|XP_011388856.1|  putative Thiamin biosynthetic enzyme               159   3e-43    
emb|CAA57779.1|  nmt2                                                   158   4e-43    
emb|CDG58549.1|  Thi4-2 protein                                         159   4e-43    
emb|CDG58546.1|  Thi4 protein                                           159   5e-43    
emb|CDG58548.1|  Thi4-1 protein                                         159   6e-43    
gb|ACZ34282.1|  thiazole synthase                                       158   8e-43    
ref|XP_003034505.1|  hypothetical protein SCHCODRAFT_84820              157   1e-42    
emb|CCV00434.1|  unnamed protein product                                158   2e-42    
ref|XP_007768494.1|  Thi4-domain-containing protein                     157   2e-42    
gb|KIK52064.1|  hypothetical protein GYMLUDRAFT_50135                   156   3e-42    
emb|CDG58547.1|  Thi4 protein                                           157   3e-42    
ref|XP_009546328.1|  hypothetical protein HETIRDRAFT_440039             157   1e-41    
gb|ABN45974.1|  thiazole biosynthetic enzyme variant 1                  154   2e-41    
gb|EGU11956.1|  Thiazole biosynthetic enzyme                            155   3e-41    
gb|ACN36998.1|  unknown                                                 151   3e-41    
gb|KGR10168.1|  thiazole biosynthesis enzyme                            154   6e-41    
gb|AAL86771.2|  THI4 enzyme                                             154   6e-41    
gb|EMS18749.1|  thiamine biosynthetic enzyme                            154   6e-41    
ref|XP_723197.1|  likely thiamine biosynthesis enzyme                   154   6e-41    
ref|XP_002419419.1|  thiamine biosynthesis enzyme, putative; thia...    154   6e-41    
gb|KHC63824.1|  thiazole biosynthesis enzyme                            154   6e-41    
gb|KHC37210.1|  thiazole biosynthesis enzyme                            154   7e-41    
gb|KGQ88127.1|  thiazole biosynthesis enzyme                            154   7e-41    
sp|C4YNP4.1|THI4_CANAW  RecName: Full=Thiamine thiazole synthase;...    151   7e-40    
emb|CDY42479.1|  BnaA10g08550D                                          147   4e-39    
ref|XP_006370641.1|  hypothetical protein POPTR_0001s44460g             144   9e-39    
sp|Q4PC85.1|THI4_USTMA  RecName: Full=Thiamine thiazole synthase;...    147   2e-38    
ref|XP_001731131.1|  hypothetical protein MGL_1314                      147   2e-38    
emb|CDO93401.1|  unnamed protein product                                145   8e-38    
ref|XP_011273842.1|  Thiazole biosynthetic enzyme                       143   3e-37    
ref|XP_451008.1|  hypothetical protein                                  143   5e-37    
gb|KCW75370.1|  hypothetical protein EUGRSUZ_E04118                     139   1e-36    
dbj|BAO40649.1|  thiazole biosynthetic enzyme                           140   3e-36    
gb|ACU23028.1|  unknown                                                 134   3e-36    
ref|XP_001647032.1|  hypothetical protein Kpol_1050p31                  140   4e-36    
ref|XP_449395.1|  hypothetical protein                                  140   6e-36    
ref|XP_003676118.1|  hypothetical protein NCAS_0D01750                  139   1e-35    
ref|XP_003683988.1|  hypothetical protein TPHA_0A04790                  138   2e-35    
ref|NP_982405.1|  AAL137Wp                                              138   3e-35    
emb|CDH15474.1|  probable Thiamine thiazole synthase                    137   7e-35    
emb|CDF87469.1|  BN860_07074g1_1                                        137   9e-35    
ref|XP_002551959.1|  KLTH0B03916p                                       136   2e-34    



>emb|CDO99712.1| unnamed protein product [Coffea canephora]
Length=353

 Score =   315 bits (806),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 155/175 (89%), Positives = 162/175 (93%), Gaps = 2/175 (1%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCGHDGP  486
            PNVKLF AVAAEDLIVK GRV GVVTNWALVSM  DTQSCMDPNVMEAK+VVSSCGHDGP
Sbjct  179  PNVKLFNAVAAEDLIVKGGRVAGVVTNWALVSMNHDTQSCMDPNVMEAKVVVSSCGHDGP  238

Query  485  FGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  306
            FG TGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM
Sbjct  239  FGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  298

Query  305  GPTFGAMMISGQKAAHLALKALGEPNALDGSASEV--AAPELILXSAENEEIADA  147
            GPTFGAMMISGQKAAHLAL+ALG+PNALDG+ SEV  A P+LIL +AE EE+ DA
Sbjct  299  GPTFGAMMISGQKAAHLALRALGQPNALDGTLSEVNTAQPDLILAAAETEEVVDA  353



>gb|KJB57703.1| hypothetical protein B456_009G176400 [Gossypium raimondii]
Length=219

 Score =   306 bits (784),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 150/175 (86%), Positives = 158/175 (90%), Gaps = 2/175 (1%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCGHDGP  486
            PNVKLF AVAAEDLIVK  RV GVVTNWALVSM  DTQSCMDPNVME+K+VVSSCGHDGP
Sbjct  45   PNVKLFNAVAAEDLIVKENRVAGVVTNWALVSMNHDTQSCMDPNVMESKVVVSSCGHDGP  104

Query  485  FGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  306
            FG TGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTRE+VPGMIVTGMEVAEIDGAPRM
Sbjct  105  FGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREVVPGMIVTGMEVAEIDGAPRM  164

Query  305  GPTFGAMMISGQKAAHLALKALGEPNALDGSASEV--AAPELILXSAENEEIADA  147
            GPTFGAMMISGQKAAHLALKALG+PNA+DG+ SE     PE +L +AE EEI DA
Sbjct  165  GPTFGAMMISGQKAAHLALKALGQPNAIDGTFSEAERVQPEFVLAAAETEEIVDA  219



>gb|KHG02821.1| Thiamine thiazole synthase 2, chloroplastic [Gossypium arboreum]
Length=355

 Score =   310 bits (793),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 151/175 (86%), Positives = 158/175 (90%), Gaps = 2/175 (1%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCGHDGP  486
            PNVKLF AVAAEDLIVK  RV GVVTNWALVSM  DTQSCMDPNVME+K+VVSSCGHDGP
Sbjct  181  PNVKLFNAVAAEDLIVKENRVAGVVTNWALVSMNHDTQSCMDPNVMESKVVVSSCGHDGP  240

Query  485  FGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  306
            FG TGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTRE+VPGMIVTGMEVAEIDGAPRM
Sbjct  241  FGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREVVPGMIVTGMEVAEIDGAPRM  300

Query  305  GPTFGAMMISGQKAAHLALKALGEPNALDGSASEV--AAPELILXSAENEEIADA  147
            GPTFGAMMISGQKAAHLALKALG+PNA+DG+ SE     PE +L SAE EEI DA
Sbjct  301  GPTFGAMMISGQKAAHLALKALGQPNAIDGTFSEAERVQPEFVLASAETEEIVDA  355



>gb|KDP39066.1| hypothetical protein JCGZ_00823 [Jatropha curcas]
Length=354

 Score =   308 bits (790),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 153/173 (88%), Positives = 161/173 (93%), Gaps = 2/173 (1%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCGHDGP  486
            PNVKLF AVAAEDLIVKNGRVGGVVTNWALVSM  DTQSCMDPNVMEAK+VVSSCGHDGP
Sbjct  184  PNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDTQSCMDPNVMEAKVVVSSCGHDGP  243

Query  485  FGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  306
            FG TGVKRLKSIGMI+SVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM
Sbjct  244  FGATGVKRLKSIGMIESVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  303

Query  305  GPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPELILXSAENEEIADA  147
            GPTFGAMMISGQKAAHLALKALG PNALDG+ +    PEL+L +AE+ +IADA
Sbjct  304  GPTFGAMMISGQKAAHLALKALGLPNALDGTFT--IHPELMLAAAESADIADA  354



>emb|CAN74175.1| hypothetical protein VITISV_019223 [Vitis vinifera]
Length=219

 Score =   303 bits (777),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 151/175 (86%), Positives = 158/175 (90%), Gaps = 2/175 (1%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCGHDGP  486
            PNVKLF AVAAEDLIVK  RV GVVTNWALVSM  DTQSCMDPNVMEAK+VVSSCGHDGP
Sbjct  45   PNVKLFNAVAAEDLIVKEERVAGVVTNWALVSMNHDTQSCMDPNVMEAKVVVSSCGHDGP  104

Query  485  FGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  306
            FG TGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM
Sbjct  105  FGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  164

Query  305  GPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAA--PELILXSAENEEIADA  147
            GPTFGAMMISGQKAAHLAL+ALG+PNA+DG+ +E     PELIL +AE  EI DA
Sbjct  165  GPTFGAMMISGQKAAHLALRALGQPNAIDGNYTEAETMQPELILAAAETGEIVDA  219



>gb|KJB57700.1| hypothetical protein B456_009G176400 [Gossypium raimondii]
 gb|KJB57701.1| hypothetical protein B456_009G176400 [Gossypium raimondii]
Length=355

 Score =   308 bits (790),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 150/175 (86%), Positives = 158/175 (90%), Gaps = 2/175 (1%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCGHDGP  486
            PNVKLF AVAAEDLIVK  RV GVVTNWALVSM  DTQSCMDPNVME+K+VVSSCGHDGP
Sbjct  181  PNVKLFNAVAAEDLIVKENRVAGVVTNWALVSMNHDTQSCMDPNVMESKVVVSSCGHDGP  240

Query  485  FGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  306
            FG TGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTRE+VPGMIVTGMEVAEIDGAPRM
Sbjct  241  FGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREVVPGMIVTGMEVAEIDGAPRM  300

Query  305  GPTFGAMMISGQKAAHLALKALGEPNALDGSASEV--AAPELILXSAENEEIADA  147
            GPTFGAMMISGQKAAHLALKALG+PNA+DG+ SE     PE +L +AE EEI DA
Sbjct  301  GPTFGAMMISGQKAAHLALKALGQPNAIDGTFSEAERVQPEFVLAAAETEEIVDA  355



>ref|XP_010062976.1| PREDICTED: thiamine thiazole synthase 1, chloroplastic [Eucalyptus 
grandis]
Length=357

 Score =   307 bits (786),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 152/173 (88%), Positives = 159/173 (92%), Gaps = 0/173 (0%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCGHDGP  486
            PNVKLF AVAAEDLIVKN RVGGVVTNWALVSM  DTQSCMDPNVMEAK+VVSSCGHDGP
Sbjct  185  PNVKLFNAVAAEDLIVKNDRVGGVVTNWALVSMNHDTQSCMDPNVMEAKVVVSSCGHDGP  244

Query  485  FGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  306
            FG TGVKRL+SIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDG+PRM
Sbjct  245  FGATGVKRLRSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGSPRM  304

Query  305  GPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPELILXSAENEEIADA  147
            GPTFGAMMISGQKAAHLALKALG PNALDGS      PELIL +A++ EIA+A
Sbjct  305  GPTFGAMMISGQKAAHLALKALGLPNALDGSYVGSIQPELILAAADSAEIAEA  357



>gb|KJB67127.1| hypothetical protein B456_010G176000 [Gossypium raimondii]
Length=356

 Score =   306 bits (784),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 150/175 (86%), Positives = 157/175 (90%), Gaps = 2/175 (1%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCGHDGP  486
            PNVKLF AVAAEDLIVK  RV GVVTNWALVSM  DTQSCMDPNVME+K+VVSSCGHDGP
Sbjct  182  PNVKLFNAVAAEDLIVKGNRVAGVVTNWALVSMNHDTQSCMDPNVMESKVVVSSCGHDGP  241

Query  485  FGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  306
            FG TGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM
Sbjct  242  FGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  301

Query  305  GPTFGAMMISGQKAAHLALKALGEPNALDGSASEV--AAPELILXSAENEEIADA  147
            GPTFGAMMISGQKAAHLALKALG+PNA+DG+ SE     PE +L +AE EE  DA
Sbjct  302  GPTFGAMMISGQKAAHLALKALGQPNAVDGTFSEAERVQPEFVLAAAETEETVDA  356



>ref|XP_011096106.1| PREDICTED: thiamine thiazole synthase 2, chloroplastic-like [Sesamum 
indicum]
Length=354

 Score =   306 bits (783),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 151/175 (86%), Positives = 158/175 (90%), Gaps = 2/175 (1%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCGHDGP  486
            PNVKLF AVAAEDLIVK GRV GVVTNWALVSM  DTQSCMDPNVMEAK+VVSSCGHDGP
Sbjct  180  PNVKLFNAVAAEDLIVKGGRVAGVVTNWALVSMNHDTQSCMDPNVMEAKVVVSSCGHDGP  239

Query  485  FGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  306
            FG TGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM
Sbjct  240  FGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  299

Query  305  GPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAA--PELILXSAENEEIADA  147
            GPTFGAMMISGQKAAHLAL+ALG+PNAL+GS  EV     E +L SAE++E  DA
Sbjct  300  GPTFGAMMISGQKAAHLALRALGQPNALEGSYREVKTGVEEFMLASAESDETVDA  354



>gb|KJB13600.1| hypothetical protein B456_002G083700 [Gossypium raimondii]
Length=357

 Score =   305 bits (782),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 150/173 (87%), Positives = 158/173 (91%), Gaps = 0/173 (0%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCGHDGP  486
            PNVKLF AVAAEDLIVK GRVGGVVTNWALVSM  DTQSCMDPNVMEAK+VVSSCGHDGP
Sbjct  185  PNVKLFNAVAAEDLIVKEGRVGGVVTNWALVSMNHDTQSCMDPNVMEAKVVVSSCGHDGP  244

Query  485  FGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  306
            FG TGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDG+PRM
Sbjct  245  FGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGSPRM  304

Query  305  GPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPELILXSAENEEIADA  147
            GPTFGAMMISGQKAAHLALK+LG PNA+DG+      PELIL +A++ E ADA
Sbjct  305  GPTFGAMMISGQKAAHLALKSLGLPNAIDGTYVGSIQPELILAAADSAETADA  357



>emb|CBI23176.3| unnamed protein product [Vitis vinifera]
Length=337

 Score =   305 bits (780),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 151/175 (86%), Positives = 158/175 (90%), Gaps = 2/175 (1%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCGHDGP  486
            PNVKLF AVAAEDLIVK  RV GVVTNWALVSM  DTQSCMDPNVMEAK+VVSSCGHDGP
Sbjct  163  PNVKLFNAVAAEDLIVKEERVAGVVTNWALVSMNHDTQSCMDPNVMEAKVVVSSCGHDGP  222

Query  485  FGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  306
            FG TGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM
Sbjct  223  FGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  282

Query  305  GPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAA--PELILXSAENEEIADA  147
            GPTFGAMMISGQKAAHLAL+ALG+PNA+DG+ +E     PELIL +AE  EI DA
Sbjct  283  GPTFGAMMISGQKAAHLALRALGQPNAIDGNYTEAETMQPELILAAAETGEIVDA  337



>gb|ADG27845.1| thiazole biosynthetic enzyme [Gossypium hirsutum]
Length=357

 Score =   305 bits (782),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 150/173 (87%), Positives = 158/173 (91%), Gaps = 0/173 (0%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCGHDGP  486
            PNVKLF AVAAEDLIVK GRVGGVVTNWALVSM  DTQSCMDPNVMEAK+VVSSCGHDGP
Sbjct  185  PNVKLFNAVAAEDLIVKEGRVGGVVTNWALVSMNHDTQSCMDPNVMEAKVVVSSCGHDGP  244

Query  485  FGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  306
            FG TGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDG+PRM
Sbjct  245  FGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGSPRM  304

Query  305  GPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPELILXSAENEEIADA  147
            GPTFGAMMISGQKAAHLALK+LG PNA+DG+      PELIL +A++ E ADA
Sbjct  305  GPTFGAMMISGQKAAHLALKSLGLPNAIDGTYVGSIHPELILAAADSAETADA  357



>ref|XP_011037712.1| PREDICTED: thiamine thiazole synthase 2, chloroplastic-like [Populus 
euphratica]
Length=350

 Score =   305 bits (781),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 151/173 (87%), Positives = 157/173 (91%), Gaps = 2/173 (1%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCGHDGP  486
            PNVKLF AVAAEDLIVK GRV GVVTNWALVSM  DTQSCMDPNVMEAK+VVSSCGHDGP
Sbjct  180  PNVKLFNAVAAEDLIVKGGRVSGVVTNWALVSMNHDTQSCMDPNVMEAKVVVSSCGHDGP  239

Query  485  FGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  306
            FG TGVKRLKSIGMIDSVPGMKALDMN AEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM
Sbjct  240  FGATGVKRLKSIGMIDSVPGMKALDMNAAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  299

Query  305  GPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPELILXSAENEEIADA  147
            GPTFGAMMISGQKAAHLALKALG+PNALDG+ S    PEL+L ++E  EI DA
Sbjct  300  GPTFGAMMISGQKAAHLALKALGQPNALDGTFS--LQPELVLAASEAGEIVDA  350



>ref|XP_011086171.1| PREDICTED: thiamine thiazole synthase 2, chloroplastic-like [Sesamum 
indicum]
Length=353

 Score =   305 bits (780),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 151/175 (86%), Positives = 158/175 (90%), Gaps = 2/175 (1%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCGHDGP  486
            PNVKLF AVAAEDLIVK GRV GVVTNWALVSM  DTQSCMDPNVMEAK+VVSSCGHDGP
Sbjct  179  PNVKLFNAVAAEDLIVKGGRVAGVVTNWALVSMNHDTQSCMDPNVMEAKVVVSSCGHDGP  238

Query  485  FGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  306
            FG TGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDG+PRM
Sbjct  239  FGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGSPRM  298

Query  305  GPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAA--PELILXSAENEEIADA  147
            GPTFGAMMISGQKAAHLAL+ALG+P+ALDG  +EV    PE IL SAE +E  DA
Sbjct  299  GPTFGAMMISGQKAAHLALRALGQPSALDGGRNEVKTDQPEFILASAEPDETVDA  353



>ref|XP_002267414.1| PREDICTED: thiamine thiazole synthase 2, chloroplastic [Vitis 
vinifera]
 sp|F6H7K5.1|THI42_VITVI RecName: Full=Thiamine thiazole synthase 2, chloroplastic; AltName: 
Full=Thiazole biosynthetic enzyme 2; Flags: Precursor 
[Vitis vinifera]
Length=355

 Score =   305 bits (780),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 151/175 (86%), Positives = 158/175 (90%), Gaps = 2/175 (1%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCGHDGP  486
            PNVKLF AVAAEDLIVK  RV GVVTNWALVSM  DTQSCMDPNVMEAK+VVSSCGHDGP
Sbjct  181  PNVKLFNAVAAEDLIVKEERVAGVVTNWALVSMNHDTQSCMDPNVMEAKVVVSSCGHDGP  240

Query  485  FGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  306
            FG TGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM
Sbjct  241  FGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  300

Query  305  GPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAA--PELILXSAENEEIADA  147
            GPTFGAMMISGQKAAHLAL+ALG+PNA+DG+ +E     PELIL +AE  EI DA
Sbjct  301  GPTFGAMMISGQKAAHLALRALGQPNAIDGNYTEAETMQPELILAAAETGEIVDA  355



>gb|KHN47860.1| Thiamine thiazole synthase 2, chloroplastic [Glycine soja]
Length=178

 Score =   298 bits (764),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 148/173 (86%), Positives = 158/173 (91%), Gaps = 2/173 (1%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCGHDGP  486
            PNVKLF AVAAEDLIVKNGRVGGVVTNWALVSM  DTQSCMDPNVMEAK+VVSSCGHDGP
Sbjct  8    PNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDTQSCMDPNVMEAKVVVSSCGHDGP  67

Query  485  FGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  306
            FG TGVKRLKSIG+IDSVPGMKALDMN AEDAIV+LTRE+VPGMIVTGMEVAEIDGAPRM
Sbjct  68   FGATGVKRLKSIGLIDSVPGMKALDMNKAEDAIVKLTREVVPGMIVTGMEVAEIDGAPRM  127

Query  305  GPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPELILXSAENEEIADA  147
            GPTFGAMMISGQKAAHLAL++LG PNALD   +    PEL+L +AE+ EIADA
Sbjct  128  GPTFGAMMISGQKAAHLALRSLGLPNALDSVGN--VHPELVLAAAESAEIADA  178



>ref|XP_002305603.1| hypothetical protein POPTR_0004s01990g [Populus trichocarpa]
 gb|ABK94925.1| unknown [Populus trichocarpa]
 gb|EEE86114.1| hypothetical protein POPTR_0004s01990g [Populus trichocarpa]
Length=350

 Score =   304 bits (779),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 152/173 (88%), Positives = 157/173 (91%), Gaps = 2/173 (1%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCGHDGP  486
            PNVKLF AVAAEDLIVK GRV GVVTNWALVSM  +TQSCMDPNVMEAKIVVSSCGHDGP
Sbjct  180  PNVKLFNAVAAEDLIVKGGRVSGVVTNWALVSMNHNTQSCMDPNVMEAKIVVSSCGHDGP  239

Query  485  FGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  306
            FG TGVKRLKSIGMIDSVPGMKALDMN AEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM
Sbjct  240  FGATGVKRLKSIGMIDSVPGMKALDMNAAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  299

Query  305  GPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPELILXSAENEEIADA  147
            GPTFGAMMISGQKAAHLALKALG+PNALDG+ S    PEL+L +AE  EI DA
Sbjct  300  GPTFGAMMISGQKAAHLALKALGQPNALDGTFS--LQPELVLAAAEAGEIVDA  350



>gb|KHG06769.1| Thiamine thiazole synthase 1, chloroplastic [Gossypium arboreum]
Length=357

 Score =   304 bits (779),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 149/173 (86%), Positives = 157/173 (91%), Gaps = 0/173 (0%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCGHDGP  486
            PNVKLF AVAAEDLIVK GRVGG+VTNWALVSM  DTQSCMDPNVMEAK+VVSSCGHDGP
Sbjct  185  PNVKLFNAVAAEDLIVKEGRVGGIVTNWALVSMNHDTQSCMDPNVMEAKVVVSSCGHDGP  244

Query  485  FGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  306
            FG TGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDG+PRM
Sbjct  245  FGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGSPRM  304

Query  305  GPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPELILXSAENEEIADA  147
            GPTFGAMMISGQKAAHLALK+LG PNA+DG+      PELIL  A++ E ADA
Sbjct  305  GPTFGAMMISGQKAAHLALKSLGLPNAIDGTHVGTIHPELILAVADSAETADA  357



>gb|KEH43920.1| thiazole biosynthetic enzyme [Medicago truncatula]
Length=349

 Score =   304 bits (778),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 147/173 (85%), Positives = 155/173 (90%), Gaps = 0/173 (0%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCGHDGP  486
            PNVKLF AVAAEDLIVK  RV GVVTNWALVSM  DTQSCMDPNVMEAK+VVSSCGHDGP
Sbjct  177  PNVKLFNAVAAEDLIVKENRVAGVVTNWALVSMNHDTQSCMDPNVMEAKVVVSSCGHDGP  236

Query  485  FGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  306
            FG TGVKRLKSIGMID VPGMKALDMNTAEDAIVRLTRE+VPGMIVTGMEVAEIDGAPRM
Sbjct  237  FGATGVKRLKSIGMIDHVPGMKALDMNTAEDAIVRLTREVVPGMIVTGMEVAEIDGAPRM  296

Query  305  GPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPELILXSAENEEIADA  147
            GPTFGAMMISGQKAAHLALKALG  NA+DG+    + PELIL SAE+++  DA
Sbjct  297  GPTFGAMMISGQKAAHLALKALGRNNAIDGTCESASEPELILASAESQDTVDA  349



>emb|CDY47441.1| BnaC09g31160D [Brassica napus]
Length=352

 Score =   303 bits (776),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 148/173 (86%), Positives = 156/173 (90%), Gaps = 0/173 (0%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCGHDGP  486
            PNVKLF AVAAEDLIVK  RVGGVVTNWALVSM  DTQSCMDPNVMEAKIVVSSCGHDGP
Sbjct  180  PNVKLFNAVAAEDLIVKGNRVGGVVTNWALVSMNHDTQSCMDPNVMEAKIVVSSCGHDGP  239

Query  485  FGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  306
            FG TGVKRLKSIG+ID VPGMKALDMNTAEDAIVRLTRE+VPGMIVTGMEVAEIDGAPRM
Sbjct  240  FGATGVKRLKSIGLIDHVPGMKALDMNTAEDAIVRLTREVVPGMIVTGMEVAEIDGAPRM  299

Query  305  GPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPELILXSAENEEIADA  147
            GPTFGAMMISGQKAAHLALKALG+PN LDGS     +PEL+L +A++ E  DA
Sbjct  300  GPTFGAMMISGQKAAHLALKALGQPNVLDGSYVGNLSPELVLAAADSAETVDA  352



>ref|XP_011000691.1| PREDICTED: thiamine thiazole synthase 2, chloroplastic-like [Populus 
euphratica]
Length=350

 Score =   303 bits (775),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 150/173 (87%), Positives = 157/173 (91%), Gaps = 2/173 (1%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCGHDGP  486
            PNVKLF AVAAEDLIVK GRV GVVTNWALVSM  DTQSCMDPNVMEAK+VVSSCGHDGP
Sbjct  180  PNVKLFNAVAAEDLIVKGGRVSGVVTNWALVSMNHDTQSCMDPNVMEAKVVVSSCGHDGP  239

Query  485  FGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  306
            FG TGVKRLKSIGMIDSVPGMKALDMN AEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM
Sbjct  240  FGATGVKRLKSIGMIDSVPGMKALDMNAAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  299

Query  305  GPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPELILXSAENEEIADA  147
            GPTFGAMMISGQKAAHLALKALG+PNA+DG+ S    PEL+L +AE  +I DA
Sbjct  300  GPTFGAMMISGQKAAHLALKALGQPNAIDGTLS--LQPELVLAAAEAGDIVDA  350



>ref|XP_004504342.1| PREDICTED: thiamine thiazole synthase, chloroplastic-like [Cicer 
arietinum]
Length=349

 Score =   302 bits (774),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 147/173 (85%), Positives = 160/173 (92%), Gaps = 2/173 (1%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCGHDGP  486
            PNVKLF AVAAEDLIVKNGRVGGVVTNWALVSM  DTQSCMDPNVMEAK+VVSSCGHDGP
Sbjct  179  PNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDTQSCMDPNVMEAKVVVSSCGHDGP  238

Query  485  FGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  306
            FG TGVKRLKSIG+ID+VPGMKALDMNTAEDAIVRLTRE+VPGMIVTGMEVAEIDGAPRM
Sbjct  239  FGATGVKRLKSIGLIDTVPGMKALDMNTAEDAIVRLTREVVPGMIVTGMEVAEIDGAPRM  298

Query  305  GPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPELILXSAENEEIADA  147
            GPTFGAMMISGQKAAHLALK+LG PNA+D + +    PEL+L +A+++E ADA
Sbjct  299  GPTFGAMMISGQKAAHLALKSLGLPNAVDYATN--IHPELVLAAADSDETADA  349



>gb|KHG29710.1| Thiamine thiazole synthase 2, chloroplastic [Gossypium arboreum]
Length=356

 Score =   303 bits (775),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 149/175 (85%), Positives = 156/175 (89%), Gaps = 2/175 (1%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCGHDGP  486
            PNVKLF AVAAEDLIVK  RV GVVTNWALVSM  DTQSCMDPNVME+K+VVSSCGHDGP
Sbjct  182  PNVKLFNAVAAEDLIVKGNRVAGVVTNWALVSMNHDTQSCMDPNVMESKVVVSSCGHDGP  241

Query  485  FGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  306
            FG TGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM
Sbjct  242  FGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  301

Query  305  GPTFGAMMISGQKAAHLALKALGEPNALD--GSASEVAAPELILXSAENEEIADA  147
            GPTFGAMMISGQKAAHLALKALG+PNA+D   S +E   PE +L +AE EE  DA
Sbjct  302  GPTFGAMMISGQKAAHLALKALGQPNAIDVTFSKAERVQPEFVLAAAETEETVDA  356



>emb|CDY41008.1| BnaA02g27980D [Brassica napus]
Length=280

 Score =   300 bits (768),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 147/173 (85%), Positives = 156/173 (90%), Gaps = 0/173 (0%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCGHDGP  486
            PNVKLF AVAAEDLIVK  RVGGVVTNWALVSM  DTQSCMDPNVMEAKIVVSSCGHDGP
Sbjct  108  PNVKLFNAVAAEDLIVKGNRVGGVVTNWALVSMNHDTQSCMDPNVMEAKIVVSSCGHDGP  167

Query  485  FGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  306
            FG TGVKRLKSIG+ID VPGMKALDMNTAEDAIVRLTRE+VPGMIVTGMEVAEIDGAPRM
Sbjct  168  FGATGVKRLKSIGLIDHVPGMKALDMNTAEDAIVRLTREVVPGMIVTGMEVAEIDGAPRM  227

Query  305  GPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPELILXSAENEEIADA  147
            GPTFGAMMISGQKAAHLALKALG+PN +DGS     +PEL+L +A++ E  DA
Sbjct  228  GPTFGAMMISGQKAAHLALKALGQPNVIDGSYVGDLSPELVLAAADSAETVDA  280



>ref|XP_002522858.1| electron transfer flavoprotein-ubiquinone oxidoreductase, putative 
[Ricinus communis]
 gb|EEF39556.1| electron transfer flavoprotein-ubiquinone oxidoreductase, putative 
[Ricinus communis]
Length=359

 Score =   302 bits (774),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 150/173 (87%), Positives = 159/173 (92%), Gaps = 2/173 (1%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCGHDGP  486
            PNVKLF AVAAEDLIVK GRVGGVVTNWALVSM  DTQSCMDPNVMEAK+VVSSCGHDGP
Sbjct  189  PNVKLFNAVAAEDLIVKEGRVGGVVTNWALVSMNHDTQSCMDPNVMEAKVVVSSCGHDGP  248

Query  485  FGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  306
            FG TGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDG+PRM
Sbjct  249  FGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGSPRM  308

Query  305  GPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPELILXSAENEEIADA  147
            GPTFGAMMISGQKAAHLALK+LG P+ALDG+ +    PEL+L +AE+ E ADA
Sbjct  309  GPTFGAMMISGQKAAHLALKSLGLPSALDGTFT--LHPELVLAAAESGETADA  359



>gb|KCW70139.1| hypothetical protein EUGRSUZ_F03433 [Eucalyptus grandis]
Length=487

 Score =   306 bits (785),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 152/173 (88%), Positives = 159/173 (92%), Gaps = 0/173 (0%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCGHDGP  486
            PNVKLF AVAAEDLIVKN RVGGVVTNWALVSM  DTQSCMDPNVMEAK+VVSSCGHDGP
Sbjct  315  PNVKLFNAVAAEDLIVKNDRVGGVVTNWALVSMNHDTQSCMDPNVMEAKVVVSSCGHDGP  374

Query  485  FGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  306
            FG TGVKRL+SIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDG+PRM
Sbjct  375  FGATGVKRLRSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGSPRM  434

Query  305  GPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPELILXSAENEEIADA  147
            GPTFGAMMISGQKAAHLALKALG PNALDGS      PELIL +A++ EIA+A
Sbjct  435  GPTFGAMMISGQKAAHLALKALGLPNALDGSYVGSIQPELILAAADSAEIAEA  487



>gb|AFK49632.1| unknown [Lotus japonicus]
Length=355

 Score =   302 bits (773),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 149/174 (86%), Positives = 155/174 (89%), Gaps = 1/174 (1%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCGHDGP  486
            PNVKLF AVAAEDLIVK GRV GVVTNWALVSM  DTQSCMDPNVMEAKIVVSSCGHDGP
Sbjct  182  PNVKLFNAVAAEDLIVKEGRVAGVVTNWALVSMNHDTQSCMDPNVMEAKIVVSSCGHDGP  241

Query  485  FGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  306
            FG TGVKRLKSIGMIDSVPGMKALDMNTAEDAIVR TRE+VPGMIVTGMEVAEIDGAPRM
Sbjct  242  FGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRFTREVVPGMIVTGMEVAEIDGAPRM  301

Query  305  GPTFGAMMISGQKAAHLALKALGEPNALDGSASEV-AAPELILXSAENEEIADA  147
            GPTFGAMMISGQKAAHLALKALG+ NA+DG+   V   PEL+L S + EE  DA
Sbjct  302  GPTFGAMMISGQKAAHLALKALGKNNAIDGTCEAVREEPELVLASVDAEETVDA  355



>ref|XP_009120006.1| PREDICTED: thiamine thiazole synthase, chloroplastic [Brassica 
rapa]
Length=352

 Score =   301 bits (772),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 147/172 (85%), Positives = 155/172 (90%), Gaps = 0/172 (0%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCGHDGP  486
            PNVKLF AVAAEDLIVK  RVGGVVTNWALVSM  DTQSCMDPNVMEAKIVVSSCGHDGP
Sbjct  180  PNVKLFNAVAAEDLIVKGNRVGGVVTNWALVSMNHDTQSCMDPNVMEAKIVVSSCGHDGP  239

Query  485  FGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  306
            FG TGVKRLKSIG+ID VPGMKALDMNTAEDAIVRLTRE+VPGMIVTGMEVAEIDGAPRM
Sbjct  240  FGATGVKRLKSIGLIDHVPGMKALDMNTAEDAIVRLTREVVPGMIVTGMEVAEIDGAPRM  299

Query  305  GPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPELILXSAENEEIAD  150
            GPTFGAMMISGQKAAHLALKALG+PN LDGS     +PEL+L +A++ E  D
Sbjct  300  GPTFGAMMISGQKAAHLALKALGQPNVLDGSYVGNLSPELVLAAADSAETVD  351



>gb|ABK21260.1| unknown [Picea sitchensis]
Length=179

 Score =   295 bits (756),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 143/168 (85%), Positives = 155/168 (92%), Gaps = 2/168 (1%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCGHDGP  486
            PNVKLF AVAAEDLI+K GRV GVVTNWALVSM  +TQSCMDPNVME+K+VVSSCGHDGP
Sbjct  8    PNVKLFNAVAAEDLIIKEGRVSGVVTNWALVSMNHNTQSCMDPNVMESKVVVSSCGHDGP  67

Query  485  FGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  306
            FG TGVKRLKS+GMID VPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDG+PRM
Sbjct  68   FGATGVKRLKSVGMIDKVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGSPRM  127

Query  305  GPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPELILXSAENE  162
            GPTFGAMM+SGQKAAHLALKALG+PNALDG+ +    PEL+L SAE+E
Sbjct  128  GPTFGAMMVSGQKAAHLALKALGQPNALDGTLT--VHPELVLASAEDE  173



>gb|KHN15802.1| Thiamine thiazole synthase 2, chloroplastic [Glycine soja]
Length=181

 Score =   295 bits (756),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 149/174 (86%), Positives = 155/174 (89%), Gaps = 1/174 (1%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCGHDGP  486
            PNVKLF AVAAEDLIVK GRV GVVTNWALVSM  DTQSCMDPNVMEAK+VVSSCGHDGP
Sbjct  8    PNVKLFNAVAAEDLIVKEGRVAGVVTNWALVSMNHDTQSCMDPNVMEAKVVVSSCGHDGP  67

Query  485  FGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  306
            FG TGVKRLKSIGMIDSVPGMKALDMN AEDAIVRLTREIVPGMIVTGMEVAEIDG+PRM
Sbjct  68   FGATGVKRLKSIGMIDSVPGMKALDMNAAEDAIVRLTREIVPGMIVTGMEVAEIDGSPRM  127

Query  305  GPTFGAMMISGQKAAHLALKALGEPNALDGSAS-EVAAPELILXSAENEEIADA  147
            GPTFGAMMISGQKAAHLALKALG  NA+DG+       P+LIL SA+ EEI DA
Sbjct  128  GPTFGAMMISGQKAAHLALKALGRNNAIDGTCGVGREEPQLILASADTEEIVDA  181



>gb|AFM35683.1| thiamin biosynthetic protein [Vitis pseudoreticulata]
Length=355

 Score =   301 bits (772),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 149/175 (85%), Positives = 157/175 (90%), Gaps = 2/175 (1%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCGHDGP  486
            PNVKL  AVAAEDLIVK  RV GVVTNWALVSM  DTQSCMDPNVMEAK+VVSSCGHDGP
Sbjct  181  PNVKLLNAVAAEDLIVKEERVAGVVTNWALVSMNHDTQSCMDPNVMEAKVVVSSCGHDGP  240

Query  485  FGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  306
            FG TGVKRLKS+GMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM
Sbjct  241  FGATGVKRLKSVGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  300

Query  305  GPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAA--PELILXSAENEEIADA  147
            GPTFGAMMISGQKAAHLAL+ALG+PNA+DG+ +E     PELIL +AE  EI DA
Sbjct  301  GPTFGAMMISGQKAAHLALRALGQPNAIDGNYTEAETMQPELILAAAETGEIVDA  355



>ref|XP_009127069.1| PREDICTED: thiamine thiazole synthase, chloroplastic-like [Brassica 
rapa]
Length=349

 Score =   301 bits (771),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 147/173 (85%), Positives = 156/173 (90%), Gaps = 0/173 (0%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCGHDGP  486
            PNVKLF AVAAEDLIVK  RVGGVVTNWALVSM  DTQSCMDPNVMEAKIVVSSCGHDGP
Sbjct  177  PNVKLFNAVAAEDLIVKGNRVGGVVTNWALVSMNHDTQSCMDPNVMEAKIVVSSCGHDGP  236

Query  485  FGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  306
            FG TGVKRLKSIG+ID VPGMKALDMNTAEDAIVRLTRE+VPGMIVTGMEVAEIDGAPRM
Sbjct  237  FGATGVKRLKSIGLIDHVPGMKALDMNTAEDAIVRLTREVVPGMIVTGMEVAEIDGAPRM  296

Query  305  GPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPELILXSAENEEIADA  147
            GPTFGAMMISGQKAAHLALKALG+PN +DGS     +PEL+L +A++ E  DA
Sbjct  297  GPTFGAMMISGQKAAHLALKALGQPNVIDGSYVGDLSPELVLAAADSAETVDA  349



>ref|XP_010923945.1| PREDICTED: thiamine thiazole synthase, chloroplastic [Elaeis 
guineensis]
Length=360

 Score =   301 bits (772),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 147/174 (84%), Positives = 158/174 (91%), Gaps = 1/174 (1%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCGHDGP  486
            PNVKLF AVAAEDLIVK GRVGGVVTNWALVSM  DTQSCMDPNVME+K+VVSSCGHDGP
Sbjct  187  PNVKLFNAVAAEDLIVKEGRVGGVVTNWALVSMNHDTQSCMDPNVMESKVVVSSCGHDGP  246

Query  485  FGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  306
            FG TGVKRLK IGMIDSVPGMKALDMN+AEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM
Sbjct  247  FGATGVKRLKDIGMIDSVPGMKALDMNSAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  306

Query  305  GPTFGAMMISGQKAAHLALKALGEPNALDGS-ASEVAAPELILXSAENEEIADA  147
            GPTFGAMMISGQKAAHLALKALG PNALDG+  +E   PE++L S++  ++ DA
Sbjct  307  GPTFGAMMISGQKAAHLALKALGRPNALDGTIGTEQVHPEMVLASSDGGDVVDA  360



>emb|CDY28754.1| BnaA02g09460D [Brassica napus]
Length=349

 Score =   301 bits (771),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 147/173 (85%), Positives = 156/173 (90%), Gaps = 0/173 (0%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCGHDGP  486
            PNVKLF AVAAEDLIVK  RVGGVVTNWALVSM  DTQSCMDPNVMEAKIVVSSCGHDGP
Sbjct  177  PNVKLFNAVAAEDLIVKGNRVGGVVTNWALVSMNHDTQSCMDPNVMEAKIVVSSCGHDGP  236

Query  485  FGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  306
            FG TGVKRLKSIG+ID VPGMKALDMNTAEDAIVRLTRE+VPGMIVTGMEVAEIDGAPRM
Sbjct  237  FGATGVKRLKSIGLIDHVPGMKALDMNTAEDAIVRLTREVVPGMIVTGMEVAEIDGAPRM  296

Query  305  GPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPELILXSAENEEIADA  147
            GPTFGAMMISGQKAAHLALKALG+PN +DGS     +PEL+L +A++ E  DA
Sbjct  297  GPTFGAMMISGQKAAHLALKALGQPNVIDGSYVGDLSPELVLAAADSAETVDA  349



>ref|XP_006401539.1| hypothetical protein EUTSA_v10013978mg [Eutrema salsugineum]
 gb|ESQ42992.1| hypothetical protein EUTSA_v10013978mg [Eutrema salsugineum]
Length=350

 Score =   301 bits (771),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 147/173 (85%), Positives = 155/173 (90%), Gaps = 0/173 (0%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCGHDGP  486
            PNVKLF AVAAEDLIVK  RV GVVTNWALVSM  DTQSCMDPNVMEAKIVVSSCGHDGP
Sbjct  178  PNVKLFNAVAAEDLIVKGNRVAGVVTNWALVSMNHDTQSCMDPNVMEAKIVVSSCGHDGP  237

Query  485  FGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  306
            FG TGVKRLKSIG+ID VPGMKALDMNTAEDAIVRLTRE+VPGMIVTGMEVAEIDGAPRM
Sbjct  238  FGATGVKRLKSIGLIDHVPGMKALDMNTAEDAIVRLTREVVPGMIVTGMEVAEIDGAPRM  297

Query  305  GPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPELILXSAENEEIADA  147
            GPTFGAMMISGQKAAHLALKALG+PN LDGS     +PEL+L +A++ E  DA
Sbjct  298  GPTFGAMMISGQKAAHLALKALGQPNVLDGSYVGNLSPELVLAAADSAETVDA  350



>gb|ABK95834.1| unknown [Populus trichocarpa]
Length=278

 Score =   298 bits (763),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 149/173 (86%), Positives = 156/173 (90%), Gaps = 2/173 (1%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCGHDGP  486
            PNVKLF AVAAEDLIVK GRV GVVTNWALVSM  +TQSCMDPNVMEAK+VVSSCGHDGP
Sbjct  108  PNVKLFNAVAAEDLIVKGGRVSGVVTNWALVSMNHNTQSCMDPNVMEAKVVVSSCGHDGP  167

Query  485  FGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  306
            FG TGVKRLKSIGMIDSVPGMKALDMN AEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM
Sbjct  168  FGATGVKRLKSIGMIDSVPGMKALDMNAAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  227

Query  305  GPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPELILXSAENEEIADA  147
            GPTFGAMMISGQKAAHLALKALG+PNALDG+ S    PEL+L +AE  +  DA
Sbjct  228  GPTFGAMMISGQKAAHLALKALGQPNALDGTFS--LQPELVLAAAEAGDTVDA  278



>ref|XP_007025992.1| Thiazole biosynthetic enzyme [Theobroma cacao]
 gb|EOY28614.1| Thiazole biosynthetic enzyme [Theobroma cacao]
Length=387

 Score =   302 bits (773),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 149/175 (85%), Positives = 156/175 (89%), Gaps = 2/175 (1%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCGHDGP  486
            PNVKLF AVAAEDLIVK+ RV GVVTNWALVSM  DTQSCMDPNVMEAK+VVSSCGHDGP
Sbjct  213  PNVKLFNAVAAEDLIVKDNRVAGVVTNWALVSMNHDTQSCMDPNVMEAKVVVSSCGHDGP  272

Query  485  FGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  306
            FG TGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM
Sbjct  273  FGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  332

Query  305  GPTFGAMMISGQKAAHLALKALGEPNALDGSASE--VAAPELILXSAENEEIADA  147
            GPTFGAMMISGQKAAHLALKALG+PNA+DG+  E     PE +L +AE E   DA
Sbjct  333  GPTFGAMMISGQKAAHLALKALGQPNAIDGTFIEGGRVQPEFVLAAAETEGTVDA  387



>gb|AFK44470.1| unknown [Medicago truncatula]
Length=349

 Score =   300 bits (769),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 146/173 (84%), Positives = 154/173 (89%), Gaps = 0/173 (0%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCGHDGP  486
            PNVKLF AVAAEDLIVK  RV GVVTNWALVSM  DTQSCMDPNVMEAK+VVSSCGHDGP
Sbjct  177  PNVKLFNAVAAEDLIVKENRVAGVVTNWALVSMNHDTQSCMDPNVMEAKVVVSSCGHDGP  236

Query  485  FGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  306
            FG TGVKRLKSIGMID VPGMKALDMNTAEDAIVRLTRE+VPGMIVTGMEVAEIDGAPRM
Sbjct  237  FGATGVKRLKSIGMIDHVPGMKALDMNTAEDAIVRLTREVVPGMIVTGMEVAEIDGAPRM  296

Query  305  GPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPELILXSAENEEIADA  147
            GPTFGAMMISGQKAAHLALKALG  NA+DG+    + PELIL  AE+++  DA
Sbjct  297  GPTFGAMMISGQKAAHLALKALGRNNAIDGTCEFASEPELILAFAESQDTVDA  349



>ref|XP_010267751.1| PREDICTED: thiamine thiazole synthase 2, chloroplastic [Nelumbo 
nucifera]
Length=356

 Score =   300 bits (769),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 148/175 (85%), Positives = 159/175 (91%), Gaps = 2/175 (1%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCGHDGP  486
            PNVKLF AVA EDLIVK G+V GVVTNWALVSM  DTQSCMDPNVME+K+VVSSCGHDGP
Sbjct  182  PNVKLFNAVAVEDLIVKEGKVAGVVTNWALVSMNHDTQSCMDPNVMESKVVVSSCGHDGP  241

Query  485  FGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  306
            FG TGVKRLKSIG+I+SVPGMKALDMN AEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM
Sbjct  242  FGATGVKRLKSIGLIESVPGMKALDMNVAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  301

Query  305  GPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAA--PELILXSAENEEIADA  147
            GPTFGAMMISGQKAAHLALK+LG PNA+DG+ SE  +  PELIL SA++ EIADA
Sbjct  302  GPTFGAMMISGQKAAHLALKSLGLPNAIDGTYSEKGSIHPELILASADSTEIADA  356



>ref|XP_002317206.1| hypothetical protein POPTR_0011s00500g [Populus trichocarpa]
 gb|EEE97818.1| hypothetical protein POPTR_0011s00500g [Populus trichocarpa]
Length=350

 Score =   300 bits (769),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 149/173 (86%), Positives = 156/173 (90%), Gaps = 2/173 (1%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCGHDGP  486
            PNVKLF AVAAEDLIVK GRV GVVTNWALVSM  +TQSCMDPNVMEAK+VVSSCGHDGP
Sbjct  180  PNVKLFNAVAAEDLIVKGGRVSGVVTNWALVSMNHNTQSCMDPNVMEAKVVVSSCGHDGP  239

Query  485  FGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  306
            FG TGVKRLKSIGMIDSVPGMKALDMN AEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM
Sbjct  240  FGATGVKRLKSIGMIDSVPGMKALDMNAAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  299

Query  305  GPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPELILXSAENEEIADA  147
            GPTFGAMMISGQKAAHLALKALG+PNALDG+ S    PEL+L +AE  +  DA
Sbjct  300  GPTFGAMMISGQKAAHLALKALGQPNALDGTFS--LQPELVLAAAEAGDTVDA  350



>dbj|BAA88226.1| thiamin biosynthetic enzyme [Glycine max]
Length=349

 Score =   300 bits (768),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 148/173 (86%), Positives = 158/173 (91%), Gaps = 2/173 (1%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCGHDGP  486
            PNVKLF AVAAEDLIVKNGRVGGVVTNWALVSM  DTQSCMDPNVMEAK+VVSSCGHDGP
Sbjct  179  PNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDTQSCMDPNVMEAKVVVSSCGHDGP  238

Query  485  FGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  306
            FG TGVKRLKSIG+IDSVPGMKALDMN AEDAIV+LTRE+VPGMIVTGMEVAEIDGAPRM
Sbjct  239  FGATGVKRLKSIGLIDSVPGMKALDMNKAEDAIVKLTREVVPGMIVTGMEVAEIDGAPRM  298

Query  305  GPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPELILXSAENEEIADA  147
            GPTFGAMMISGQKAAHLAL++LG PNALD   +    PEL+L +AE+ EIADA
Sbjct  299  GPTFGAMMISGQKAAHLALRSLGLPNALDSVGN--VHPELVLAAAESAEIADA  349



>emb|CDY43024.1| BnaA03g11710D [Brassica napus]
Length=351

 Score =   300 bits (768),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 147/173 (85%), Positives = 155/173 (90%), Gaps = 0/173 (0%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCGHDGP  486
            PNVKLF AVAAEDLIVK  RVGGVVTNWALVSM  DTQSCMDPNVMEAKIVVSSCGHDGP
Sbjct  179  PNVKLFNAVAAEDLIVKGNRVGGVVTNWALVSMNHDTQSCMDPNVMEAKIVVSSCGHDGP  238

Query  485  FGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  306
            FG TGVKRLKSIG+ID VPGMKALDMNTAEDAIVRLTRE+VPGMIVTGMEVAEIDGAPRM
Sbjct  239  FGATGVKRLKSIGLIDHVPGMKALDMNTAEDAIVRLTREVVPGMIVTGMEVAEIDGAPRM  298

Query  305  GPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPELILXSAENEEIADA  147
            GPTFGAMMISGQKA HLALKALG+PNALDG+     +PEL+L  A++ E  DA
Sbjct  299  GPTFGAMMISGQKAGHLALKALGQPNALDGTYVGDLSPELVLAVADSAETVDA  351



>gb|AAV92531.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
 gb|AAV92533.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
 gb|AAV92534.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
 gb|AAV92536.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
 gb|AAV92542.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
 gb|AAV92543.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
 gb|AAV92544.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
 gb|AAV92545.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
 gb|AAV92547.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
 gb|AAV92548.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
 gb|AAV92549.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
 gb|AAV92550.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
 gb|AAV92551.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
 gb|AAV92555.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
 gb|AAV92556.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
Length=343

 Score =   300 bits (767),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 145/168 (86%), Positives = 155/168 (92%), Gaps = 2/168 (1%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCGHDGP  486
            PNVKLF AVAAEDLI+K GRV GVVTNWALVSM  DTQSCMDPNVME+K+VVSSCGHDGP
Sbjct  172  PNVKLFNAVAAEDLIIKEGRVSGVVTNWALVSMNHDTQSCMDPNVMESKVVVSSCGHDGP  231

Query  485  FGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  306
            FG TGVKRLKS+GMID VPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDG+PRM
Sbjct  232  FGATGVKRLKSVGMIDKVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGSPRM  291

Query  305  GPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPELILXSAENE  162
            GPTFGAMM+SGQKAAHLALKALG+PNALDG+   +  PEL+L SAENE
Sbjct  292  GPTFGAMMVSGQKAAHLALKALGQPNALDGTLKVL--PELVLASAENE  337



>gb|AAV92552.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
 gb|AAV92553.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
Length=343

 Score =   300 bits (767),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 145/168 (86%), Positives = 155/168 (92%), Gaps = 2/168 (1%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCGHDGP  486
            PNVKLF AVAAEDLI+K GRV GVVTNWALVSM  DTQSCMDPNVME+K+VVSSCGHDGP
Sbjct  172  PNVKLFNAVAAEDLIIKEGRVSGVVTNWALVSMNHDTQSCMDPNVMESKVVVSSCGHDGP  231

Query  485  FGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  306
            FG TGVKRLKS+GMID VPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDG+PRM
Sbjct  232  FGATGVKRLKSVGMIDKVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGSPRM  291

Query  305  GPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPELILXSAENE  162
            GPTFGAMM+SGQKAAHLALKALG+PNALDG+   +  PEL+L SAENE
Sbjct  292  GPTFGAMMVSGQKAAHLALKALGQPNALDGTLKVL--PELVLASAENE  337



>gb|AAV92529.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
 gb|AAV92530.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
 gb|AAV92532.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
 gb|AAV92540.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
 gb|AAV92541.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
 gb|AAV92546.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
Length=343

 Score =   300 bits (767),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 145/168 (86%), Positives = 155/168 (92%), Gaps = 2/168 (1%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCGHDGP  486
            PNVKLF AVAAEDLI+K GRV GVVTNWALVSM  DTQSCMDPNVME+K+VVSSCGHDGP
Sbjct  172  PNVKLFNAVAAEDLIIKEGRVSGVVTNWALVSMNHDTQSCMDPNVMESKVVVSSCGHDGP  231

Query  485  FGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  306
            FG TGVKRLKS+GMID VPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDG+PRM
Sbjct  232  FGATGVKRLKSVGMIDKVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGSPRM  291

Query  305  GPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPELILXSAENE  162
            GPTFGAMM+SGQKAAHLALKALG+PNALDG+   +  PEL+L SAENE
Sbjct  292  GPTFGAMMVSGQKAAHLALKALGQPNALDGTLKVL--PELVLASAENE  337



>gb|AAV92537.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
Length=343

 Score =   299 bits (766),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 145/168 (86%), Positives = 155/168 (92%), Gaps = 2/168 (1%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCGHDGP  486
            PNVKLF AVAAEDLI+K GRV GVVTNWALVSM  DTQSCMDPNVME+K+VVSSCGHDGP
Sbjct  172  PNVKLFNAVAAEDLIIKEGRVSGVVTNWALVSMNHDTQSCMDPNVMESKVVVSSCGHDGP  231

Query  485  FGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  306
            FG TGVKRLKS+GMID VPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDG+PRM
Sbjct  232  FGATGVKRLKSVGMIDKVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGSPRM  291

Query  305  GPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPELILXSAENE  162
            GPTFGAMM+SGQKAAHLALKALG+PNALDG+   +  PEL+L SAENE
Sbjct  292  GPTFGAMMVSGQKAAHLALKALGQPNALDGTLKVL--PELVLASAENE  337



>ref|XP_009408664.1| PREDICTED: thiamine thiazole synthase 2, chloroplastic {ECO:0000255|HAMAP-Rule:MF_03158}-like 
[Musa acuminata subsp. malaccensis]
Length=358

 Score =   300 bits (768),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 147/174 (84%), Positives = 156/174 (90%), Gaps = 1/174 (1%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCGHDGP  486
            PNVKLF AVAAEDLIVK GRV GVVTNWALVSM  DTQSCMDPNVMEA++VVSSCGHDGP
Sbjct  185  PNVKLFNAVAAEDLIVKEGRVAGVVTNWALVSMNHDTQSCMDPNVMEARVVVSSCGHDGP  244

Query  485  FGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  306
            FG TGVKRLK IGMIDSVPGMKALDMN AEDAIVRLTRE+VPGMIVTGMEVAEIDGAPRM
Sbjct  245  FGATGVKRLKGIGMIDSVPGMKALDMNAAEDAIVRLTREVVPGMIVTGMEVAEIDGAPRM  304

Query  305  GPTFGAMMISGQKAAHLALKALGEPNALDGS-ASEVAAPELILXSAENEEIADA  147
            GPTFGAMMISGQKAAHLALKALG PNA+DG+  +E   PEL+L S++  EI DA
Sbjct  305  GPTFGAMMISGQKAAHLALKALGRPNAIDGTIGAEAVQPELVLASSDAGEIVDA  358



>ref|XP_009132425.1| PREDICTED: thiamine thiazole synthase, chloroplastic-like [Brassica 
rapa]
Length=351

 Score =   300 bits (767),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 147/173 (85%), Positives = 155/173 (90%), Gaps = 0/173 (0%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCGHDGP  486
            PNVKLF AVAAEDLIVK  RVGGVVTNWALVSM  DTQSCMDPNVMEAKIVVSSCGHDGP
Sbjct  179  PNVKLFNAVAAEDLIVKGNRVGGVVTNWALVSMNHDTQSCMDPNVMEAKIVVSSCGHDGP  238

Query  485  FGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  306
            FG TGVKRLKSIG+ID VPGMKALDMNTAEDAIVRLTRE+VPGMIVTGMEVAEIDGAPRM
Sbjct  239  FGDTGVKRLKSIGLIDHVPGMKALDMNTAEDAIVRLTREVVPGMIVTGMEVAEIDGAPRM  298

Query  305  GPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPELILXSAENEEIADA  147
            GPTFGAMMISGQKA HLALKALG+PNALDG+     +PEL+L  A++ E  DA
Sbjct  299  GPTFGAMMISGQKAGHLALKALGQPNALDGTYVGDLSPELVLAVADSAETVDA  351



>gb|EYU33910.1| hypothetical protein MIMGU_mgv1a009148mg [Erythranthe guttata]
 gb|EYU33911.1| hypothetical protein MIMGU_mgv1a009148mg [Erythranthe guttata]
Length=351

 Score =   300 bits (767),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 148/173 (86%), Positives = 158/173 (91%), Gaps = 1/173 (1%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCGHDGP  486
            PNVKLF AVAAEDLIVK GRV GVVTNWALV+    TQSCMDPNVMEAKIVVSSCGHDGP
Sbjct  180  PNVKLFNAVAAEDLIVKGGRVAGVVTNWALVAQNHHTQSCMDPNVMEAKIVVSSCGHDGP  239

Query  485  FGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  306
            FG TGVKRL+SIGMI+SVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDG+PRM
Sbjct  240  FGATGVKRLRSIGMIESVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGSPRM  299

Query  305  GPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPELILXSAENEEIADA  147
            GPTFGAMMISGQKAAHLALKALG P+ALDGS SE A PEL+L SAE +++ +A
Sbjct  300  GPTFGAMMISGQKAAHLALKALGLPHALDGSYSE-AQPELVLASAEADDVVEA  351



>gb|AAW66657.1| thiamine biosynthetic enzyme [Picrorhiza kurrooa]
Length=354

 Score =   300 bits (767),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 146/173 (84%), Positives = 155/173 (90%), Gaps = 0/173 (0%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCGHDGP  486
            PNVKLF AVAAEDLIVK GRV GVVTNWALVSM  DTQSCMDPNVME+KIVVSSCGHDGP
Sbjct  182  PNVKLFNAVAAEDLIVKGGRVAGVVTNWALVSMNHDTQSCMDPNVMESKIVVSSCGHDGP  241

Query  485  FGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  306
            FG TGVKRL+SIGMIDSVPGMKALDMNTAEDAIVRL REIVPGMIVTGMEVAEIDG+PRM
Sbjct  242  FGATGVKRLRSIGMIDSVPGMKALDMNTAEDAIVRLAREIVPGMIVTGMEVAEIDGSPRM  301

Query  305  GPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPELILXSAENEEIADA  147
            GPTFGAMMISGQKAAHLALKALG+PNALD S   + A E +L +A+  +I DA
Sbjct  302  GPTFGAMMISGQKAAHLALKALGQPNALDDSYDGLKAEEFVLAAADAGDIVDA  354



>gb|AAV92538.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
Length=343

 Score =   299 bits (766),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 145/168 (86%), Positives = 155/168 (92%), Gaps = 2/168 (1%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCGHDGP  486
            PNVKLF AVAAEDLI+K GRV GVVTNWALVSM  DTQSCMDPNVME+K+VVSSCGHDGP
Sbjct  172  PNVKLFNAVAAEDLIIKEGRVSGVVTNWALVSMNHDTQSCMDPNVMESKVVVSSCGHDGP  231

Query  485  FGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  306
            FG TGVKRLKS+GMID VPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDG+PRM
Sbjct  232  FGATGVKRLKSVGMIDKVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGSPRM  291

Query  305  GPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPELILXSAENE  162
            GPTFGAMM+SGQKAAHLALKALG+PNALDG+   +  PEL+L SAENE
Sbjct  292  GPTFGAMMVSGQKAAHLALKALGQPNALDGTLKVL--PELLLASAENE  337



>ref|XP_007143207.1| hypothetical protein PHAVU_007G052900g [Phaseolus vulgaris]
 gb|ESW15201.1| hypothetical protein PHAVU_007G052900g [Phaseolus vulgaris]
Length=355

 Score =   300 bits (767),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 150/174 (86%), Positives = 155/174 (89%), Gaps = 1/174 (1%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCGHDGP  486
            PNVKLF AVAAEDLIVK GRV GVVTNWALVSM  DTQSCMDPNVMEAK+VVSSCGHDGP
Sbjct  182  PNVKLFNAVAAEDLIVKEGRVAGVVTNWALVSMNHDTQSCMDPNVMEAKVVVSSCGHDGP  241

Query  485  FGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  306
            FG TGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM
Sbjct  242  FGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  301

Query  305  GPTFGAMMISGQKAAHLALKALGEPNALDGSAS-EVAAPELILXSAENEEIADA  147
            GPTFGAMMISGQKAAHLALKALG  NA+DG+       PEL+L SA  E+I DA
Sbjct  302  GPTFGAMMISGQKAAHLALKALGRNNAIDGTCGVGREEPELVLASANTEDIVDA  355



>ref|XP_002316981.2| hypothetical protein POPTR_0011s13820g [Populus trichocarpa]
 gb|ABK94930.1| unknown [Populus trichocarpa]
 gb|EEE97593.2| hypothetical protein POPTR_0011s13820g [Populus trichocarpa]
Length=357

 Score =   299 bits (766),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 147/172 (85%), Positives = 156/172 (91%), Gaps = 0/172 (0%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCGHDGP  486
            PNVKLF AVAAEDLIVK GRVGGVVTNWALVSM  DTQSCMDPNVMEAK+VVSSCGHDGP
Sbjct  185  PNVKLFNAVAAEDLIVKEGRVGGVVTNWALVSMNHDTQSCMDPNVMEAKVVVSSCGHDGP  244

Query  485  FGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  306
            FG TGVKRLKSIGMIDSVPGMKALDMN AEDAIV+LTRE+VPGMIVTGMEVAEIDG+PRM
Sbjct  245  FGATGVKRLKSIGMIDSVPGMKALDMNAAEDAIVKLTREVVPGMIVTGMEVAEIDGSPRM  304

Query  305  GPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPELILXSAENEEIAD  150
            GPTFGAMMISGQKAAHLALK+LG PNALDG+      PELIL + E+ EIA+
Sbjct  305  GPTFGAMMISGQKAAHLALKSLGMPNALDGTFVGGIHPELILAAVESAEIAE  356



>ref|XP_004496776.1| PREDICTED: thiamine thiazole synthase 2, chloroplastic-like [Cicer 
arietinum]
Length=350

 Score =   299 bits (765),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 149/174 (86%), Positives = 155/174 (89%), Gaps = 1/174 (1%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCGHDGP  486
            PNVKLF AVAAEDLIVK GRVGGVVTNWALVSM  DTQSCMDPNVMEAK+VVSSCGHDGP
Sbjct  177  PNVKLFNAVAAEDLIVKEGRVGGVVTNWALVSMNHDTQSCMDPNVMEAKVVVSSCGHDGP  236

Query  485  FGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  306
            FG TGVKRLKSIGMID VPGMKALDMNTAEDAIVRLTRE+VPGMIVTGMEVAEIDGAPRM
Sbjct  237  FGATGVKRLKSIGMIDFVPGMKALDMNTAEDAIVRLTREVVPGMIVTGMEVAEIDGAPRM  296

Query  305  GPTFGAMMISGQKAAHLALKALGEPNALDGSA-SEVAAPELILXSAENEEIADA  147
            GPTFGAMMISGQKAAHLALKALG  NA+DG+  S    PEL+L S E E+  DA
Sbjct  297  GPTFGAMMISGQKAAHLALKALGRNNAIDGTCDSAREEPELVLASVELEDTVDA  350



>ref|NP_001236824.1| thiamin biosynthetic enzyme [Glycine max]
 dbj|BAA88228.1| thiamin biosynthetic enzyme [Glycine max]
Length=349

 Score =   299 bits (765),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 148/173 (86%), Positives = 157/173 (91%), Gaps = 2/173 (1%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCGHDGP  486
            PNVKLF AVAAEDLIVKNGRVGGVVTNWALVSM  DTQSCMDPNVMEAK+VVSSCGHDGP
Sbjct  179  PNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDTQSCMDPNVMEAKVVVSSCGHDGP  238

Query  485  FGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  306
            FG TGVKRLKSIG+IDSVPGMKALDMN AEDAIV LTRE+VPGMIVTGMEVAEIDGAPRM
Sbjct  239  FGATGVKRLKSIGLIDSVPGMKALDMNKAEDAIVELTREVVPGMIVTGMEVAEIDGAPRM  298

Query  305  GPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPELILXSAENEEIADA  147
            GPTFGAMMISGQKAAHLAL++LG PNALD   +    PEL+L +AE+ EIADA
Sbjct  299  GPTFGAMMISGQKAAHLALRSLGLPNALDSVGN--VHPELVLAAAESAEIADA  349



>ref|XP_003556028.1| PREDICTED: thiamine thiazole synthase 2, chloroplastic-like [Glycine 
max]
Length=351

 Score =   299 bits (765),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 149/174 (86%), Positives = 155/174 (89%), Gaps = 1/174 (1%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCGHDGP  486
            PNVKLF AVAAEDLIVK GRV GVVTNWALVSM  DTQSCMDPNVMEAK+VVSSCGHDGP
Sbjct  178  PNVKLFNAVAAEDLIVKEGRVAGVVTNWALVSMNHDTQSCMDPNVMEAKVVVSSCGHDGP  237

Query  485  FGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  306
            FG TGVKRLKSIGMIDSVPGMKALDMN AEDAIVRLTREIVPGMIVTGMEVAEIDG+PRM
Sbjct  238  FGATGVKRLKSIGMIDSVPGMKALDMNAAEDAIVRLTREIVPGMIVTGMEVAEIDGSPRM  297

Query  305  GPTFGAMMISGQKAAHLALKALGEPNALDGSAS-EVAAPELILXSAENEEIADA  147
            GPTFGAMMISGQKAAHLALKALG  NA+DG+       P+LIL SA+ EEI DA
Sbjct  298  GPTFGAMMISGQKAAHLALKALGRNNAIDGTCGVGREEPQLILASADTEEIVDA  351



>gb|AAV92539.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
Length=343

 Score =   298 bits (763),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 144/168 (86%), Positives = 155/168 (92%), Gaps = 2/168 (1%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCGHDGP  486
            PNVKLF AVAAEDLI+K GR+ GVVTNWALVSM  DTQSCMDPNVME+K+VVSSCGHDGP
Sbjct  172  PNVKLFNAVAAEDLIIKEGRMSGVVTNWALVSMNHDTQSCMDPNVMESKVVVSSCGHDGP  231

Query  485  FGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  306
            FG TGVKRLKS+GMID VPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDG+PRM
Sbjct  232  FGATGVKRLKSVGMIDKVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGSPRM  291

Query  305  GPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPELILXSAENE  162
            GPTFGAMM+SGQKAAHLALKALG+PNALDG+   +  PEL+L SAENE
Sbjct  292  GPTFGAMMVSGQKAAHLALKALGQPNALDGTLKVL--PELVLASAENE  337



>gb|AAV92535.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
Length=343

 Score =   298 bits (762),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 144/168 (86%), Positives = 154/168 (92%), Gaps = 2/168 (1%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCGHDGP  486
            PNVKLF AVAAEDLI+K  RV GVVTNWALVSM  DTQSCMDPNVME+K+VVSSCGHDGP
Sbjct  172  PNVKLFNAVAAEDLIIKEDRVSGVVTNWALVSMNHDTQSCMDPNVMESKVVVSSCGHDGP  231

Query  485  FGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  306
            FG TGVKRLKS+GMID VPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDG+PRM
Sbjct  232  FGATGVKRLKSVGMIDKVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGSPRM  291

Query  305  GPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPELILXSAENE  162
            GPTFGAMM+SGQKAAHLALKALG+PNALDG+   +  PEL+L SAENE
Sbjct  292  GPTFGAMMVSGQKAAHLALKALGQPNALDGTLKVL--PELVLASAENE  337



>ref|XP_003536550.1| PREDICTED: thiamine thiazole synthase 2, chloroplastic-like [Glycine 
max]
Length=351

 Score =   298 bits (762),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 148/174 (85%), Positives = 154/174 (89%), Gaps = 1/174 (1%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCGHDGP  486
            PNVKLF AVAAEDLIVK GRV GVVTNWALVSM  DTQSCMDPNVMEAK+VVSSCGHDGP
Sbjct  178  PNVKLFNAVAAEDLIVKEGRVAGVVTNWALVSMNHDTQSCMDPNVMEAKVVVSSCGHDGP  237

Query  485  FGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  306
            FG TGVKRLKSIGMIDSVPGMKALDMN AEDAIVRLTREIVPGMIVTGMEVAEIDG+PRM
Sbjct  238  FGATGVKRLKSIGMIDSVPGMKALDMNAAEDAIVRLTREIVPGMIVTGMEVAEIDGSPRM  297

Query  305  GPTFGAMMISGQKAAHLALKALGEPNALDGSAS-EVAAPELILXSAENEEIADA  147
            GPTFGAMMISGQKAAHLALKALG  NA+DG+       P+LI  SA+ EEI DA
Sbjct  298  GPTFGAMMISGQKAAHLALKALGRNNAIDGTCGVGREEPQLIFASADTEEIVDA  351



>ref|XP_008803216.1| PREDICTED: thiamine thiazole synthase 2, chloroplastic-like [Phoenix 
dactylifera]
Length=355

 Score =   298 bits (762),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 148/174 (85%), Positives = 156/174 (90%), Gaps = 1/174 (1%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCGHDGP  486
            PNVKLF AVAAE LIVK GRV GVVTNWALVSM  DTQSCMDPNVMEAK+VVSSCGHDGP
Sbjct  182  PNVKLFNAVAAEGLIVKEGRVAGVVTNWALVSMNHDTQSCMDPNVMEAKVVVSSCGHDGP  241

Query  485  FGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  306
            FG TGVKRLK IGMIDSVPGMKALDMN+AEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM
Sbjct  242  FGATGVKRLKDIGMIDSVPGMKALDMNSAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  301

Query  305  GPTFGAMMISGQKAAHLALKALGEPNALDG-SASEVAAPELILXSAENEEIADA  147
            GPTFGAMMISGQKAAHLALKALG PNALDG S +E   PE++L S+E  ++ DA
Sbjct  302  GPTFGAMMISGQKAAHLALKALGRPNALDGISWAEKVHPEMVLASSEGGDVVDA  355



>ref|XP_004505443.1| PREDICTED: thiamine thiazole synthase, chloroplastic-like [Cicer 
arietinum]
Length=352

 Score =   297 bits (761),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 145/173 (84%), Positives = 156/173 (90%), Gaps = 0/173 (0%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCGHDGP  486
            PNVKLF AVAAEDLIVKN RV GVVTNWALVSM  DTQSCMDPNVMEAK+VVSSCGHDGP
Sbjct  180  PNVKLFNAVAAEDLIVKNDRVAGVVTNWALVSMNHDTQSCMDPNVMEAKVVVSSCGHDGP  239

Query  485  FGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  306
            FG TGVKRLKSIG+IDSVPGMKALDMNTAEDAIVRLTRE+VPGMIVTGMEVAEIDGAPRM
Sbjct  240  FGATGVKRLKSIGLIDSVPGMKALDMNTAEDAIVRLTREVVPGMIVTGMEVAEIDGAPRM  299

Query  305  GPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPELILXSAENEEIADA  147
            GPTFGAMMISGQKAAHL L++LG PNA+D +      PEL+L +A++ EIADA
Sbjct  300  GPTFGAMMISGQKAAHLVLRSLGLPNAVDHAGDINTQPELVLAAADSVEIADA  352



>emb|CDP05793.1| unnamed protein product [Coffea canephora]
Length=280

 Score =   295 bits (755),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 145/173 (84%), Positives = 155/173 (90%), Gaps = 0/173 (0%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCGHDGP  486
            PNVKLF AVAAEDLIVK  RVGGVVTNWALVSM  DTQSCMDPNV+EAK+VVSSCGHDGP
Sbjct  108  PNVKLFNAVAAEDLIVKGSRVGGVVTNWALVSMNHDTQSCMDPNVVEAKVVVSSCGHDGP  167

Query  485  FGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  306
            FG TGVKRLKSIGMI++VPGMKALDMN AEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM
Sbjct  168  FGATGVKRLKSIGMIENVPGMKALDMNAAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  227

Query  305  GPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPELILXSAENEEIADA  147
            GPTFGAMMISGQKAAHLAL++LG PNALDG+ +    PELIL +A+  E  DA
Sbjct  228  GPTFGAMMISGQKAAHLALRSLGLPNALDGTYAGSIHPELILAAADASETVDA  280



>emb|CDY52570.1| BnaC03g71780D [Brassica napus]
Length=352

 Score =   297 bits (761),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 147/174 (84%), Positives = 156/174 (90%), Gaps = 1/174 (1%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKI-VVSSCGHDG  489
            PNVKLF AVAAEDLIVK  RVGGVVTNWALVSM  DTQSCMDPNVMEAKI VVSSCGHDG
Sbjct  179  PNVKLFNAVAAEDLIVKGNRVGGVVTNWALVSMNHDTQSCMDPNVMEAKIIVVSSCGHDG  238

Query  488  PFGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPR  309
            PFG TGVKRLKSIG+ID VPGMKALDMNTAEDAIVRLTRE+VPGMIVTGMEVAEIDGAPR
Sbjct  239  PFGATGVKRLKSIGLIDHVPGMKALDMNTAEDAIVRLTREVVPGMIVTGMEVAEIDGAPR  298

Query  308  MGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPELILXSAENEEIADA  147
            MGPTFGAMMISGQKA HLALKALG+PNALDG+     +PEL+L +A++ E  DA
Sbjct  299  MGPTFGAMMISGQKAGHLALKALGQPNALDGTYVGDLSPELVLAAADSAETVDA  352



>gb|EPS63253.1| hypothetical protein M569_11533 [Genlisea aurea]
Length=344

 Score =   297 bits (760),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 146/173 (84%), Positives = 154/173 (89%), Gaps = 0/173 (0%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCGHDGP  486
            PNVKLF AVAAEDLIVK GRV GVVTNWALVSM  DTQSCMDPNVMEAK+VVSSCGHDGP
Sbjct  172  PNVKLFNAVAAEDLIVKGGRVAGVVTNWALVSMNHDTQSCMDPNVMEAKVVVSSCGHDGP  231

Query  485  FGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  306
            FG TGVKRLKSIGMID+VPGMKALDMN AEDAIVRLTREIVPGMIVTGMEVAEIDG+PRM
Sbjct  232  FGATGVKRLKSIGMIDAVPGMKALDMNAAEDAIVRLTREIVPGMIVTGMEVAEIDGSPRM  291

Query  305  GPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPELILXSAENEEIADA  147
            GPTFGAMMISGQKAAHLAL+ALG PNALDG    V   E +L +AE +EI +A
Sbjct  292  GPTFGAMMISGQKAAHLALRALGLPNALDGGDLPVKEAEFVLAAAETDEIVEA  344



>gb|ABK23376.1| unknown [Picea sitchensis]
Length=368

 Score =   297 bits (760),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 143/168 (85%), Positives = 155/168 (92%), Gaps = 2/168 (1%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCGHDGP  486
            PNVKLF AVAAEDLI+K GRV GVVTNWALVSM  +TQSCMDPNVME+K+VVSSCGHDGP
Sbjct  197  PNVKLFNAVAAEDLIIKEGRVSGVVTNWALVSMNHNTQSCMDPNVMESKVVVSSCGHDGP  256

Query  485  FGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  306
            FG TGVKRLKS+GMID VPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDG+PRM
Sbjct  257  FGATGVKRLKSVGMIDKVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGSPRM  316

Query  305  GPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPELILXSAENE  162
            GPTFGAMM+SGQKAAHLALKALG+PNALDG+ +    PEL+L SAE+E
Sbjct  317  GPTFGAMMVSGQKAAHLALKALGQPNALDGTLT--VHPELVLASAEDE  362



>gb|KFK27084.1| hypothetical protein AALP_AA8G331900 [Arabis alpina]
Length=345

 Score =   296 bits (757),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 145/173 (84%), Positives = 153/173 (88%), Gaps = 0/173 (0%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCGHDGP  486
            PNVKLF AVAAEDLIVK  RV GVVTNWALVSM  DTQSCMDPNVMEAKIVVSSCGHDGP
Sbjct  173  PNVKLFNAVAAEDLIVKGNRVAGVVTNWALVSMNHDTQSCMDPNVMEAKIVVSSCGHDGP  232

Query  485  FGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  306
            FG TGVKRLKSIGMID VPGMKALDMNTAEDAIVRLTRE+VPGMIVTGMEVAEIDGAPRM
Sbjct  233  FGATGVKRLKSIGMIDHVPGMKALDMNTAEDAIVRLTREVVPGMIVTGMEVAEIDGAPRM  292

Query  305  GPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPELILXSAENEEIADA  147
            GPTFGAMMISGQKA  LALKALG PNA+DG+     +PEL+L +A++ E  DA
Sbjct  293  GPTFGAMMISGQKAGQLALKALGLPNAIDGTNVGELSPELVLAAADSAETVDA  345



>ref|XP_010545204.1| PREDICTED: thiamine thiazole synthase, chloroplastic [Tarenaya 
hassleriana]
Length=359

 Score =   296 bits (758),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 149/174 (86%), Positives = 156/174 (90%), Gaps = 1/174 (1%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCGHDGP  486
            PNVKLF AVAAEDLIVK  RVGGVVTNWALVSM  DTQSCMDPNVMEAK+VVSSCGHDGP
Sbjct  186  PNVKLFNAVAAEDLIVKGNRVGGVVTNWALVSMNHDTQSCMDPNVMEAKVVVSSCGHDGP  245

Query  485  FGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  306
            FG TGVKRLKSIGMID+VPGMKALDMN+AEDAIVRLTRE+VPGMIVTGMEVAEIDGA RM
Sbjct  246  FGATGVKRLKSIGMIDNVPGMKALDMNSAEDAIVRLTREVVPGMIVTGMEVAEIDGAARM  305

Query  305  GPTFGAMMISGQKAAHLALKALGEPNAL-DGSASEVAAPELILXSAENEEIADA  147
            GPTFGAMMISGQKAAHLALKALG PNAL DGS      PEL+L +AE+ E ADA
Sbjct  306  GPTFGAMMISGQKAAHLALKALGMPNALDDGSYLGKLHPELVLAAAESAETADA  359



>gb|AFK46185.1| unknown [Medicago truncatula]
Length=350

 Score =   295 bits (756),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 144/173 (83%), Positives = 159/173 (92%), Gaps = 2/173 (1%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCGHDGP  486
            PNVKLF AVAAEDLIVKN RVGGVVTNWALVSM  DTQSCMDPNVME+K+VVSSCGHDGP
Sbjct  180  PNVKLFNAVAAEDLIVKNERVGGVVTNWALVSMNHDTQSCMDPNVMESKVVVSSCGHDGP  239

Query  485  FGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  306
            FG TGVKRLKSIG+ID+VPGMKALDMNTAEDAIVRLTRE+VPGMIVTGMEVAEIDGAPRM
Sbjct  240  FGATGVKRLKSIGLIDTVPGMKALDMNTAEDAIVRLTREVVPGMIVTGMEVAEIDGAPRM  299

Query  305  GPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPELILXSAENEEIADA  147
            GPTFGAMMISGQKAAHLAL+ALG PNA+D + +    PEL+L +A++ +IA+A
Sbjct  300  GPTFGAMMISGQKAAHLALRALGLPNAVDHAGN--IHPELVLAAADSADIAEA  350



>ref|XP_003607681.1| Thiazole biosynthetic enzyme [Medicago truncatula]
 gb|AES89878.1| thiazole biosynthetic enzyme [Medicago truncatula]
Length=350

 Score =   295 bits (756),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 144/173 (83%), Positives = 159/173 (92%), Gaps = 2/173 (1%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCGHDGP  486
            PNVKLF AVAAEDLIVKN RVGGVVTNWALVSM  DTQSCMDPNVME+K+VVSSCGHDGP
Sbjct  180  PNVKLFNAVAAEDLIVKNERVGGVVTNWALVSMNHDTQSCMDPNVMESKVVVSSCGHDGP  239

Query  485  FGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  306
            FG TGVKRLKSIG+ID+VPGMKALDMNTAEDAIVRLTRE+VPGMIVTGMEVAEIDGAPRM
Sbjct  240  FGATGVKRLKSIGLIDTVPGMKALDMNTAEDAIVRLTREVVPGMIVTGMEVAEIDGAPRM  299

Query  305  GPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPELILXSAENEEIADA  147
            GPTFGAMMISGQKAAHLAL+ALG PNA+D + +    PEL+L +A++ +IA+A
Sbjct  300  GPTFGAMMISGQKAAHLALRALGLPNAVDHAGN--IHPELVLAAADSADIAEA  350



>ref|XP_006449089.1| hypothetical protein CICLE_v10015727mg [Citrus clementina]
 gb|ESR62329.1| hypothetical protein CICLE_v10015727mg [Citrus clementina]
Length=359

 Score =   295 bits (756),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 156/175 (89%), Positives = 160/175 (91%), Gaps = 2/175 (1%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCGHDGP  486
            PNVKLF AVAAEDLIVK GRVGGVVTNWALVSM  DTQSCMDPNVMEAKIVVSSCGHDGP
Sbjct  185  PNVKLFNAVAAEDLIVKGGRVGGVVTNWALVSMNHDTQSCMDPNVMEAKIVVSSCGHDGP  244

Query  485  FGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  306
            FG TGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM
Sbjct  245  FGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  304

Query  305  GPTFGAMMISGQKAAHLALKALGEPNALDGSASEVA--APELILXSAENEEIADA  147
            GPTFGAMMISGQKAAHLALKALG+PNA+DG+ SEV    PE IL + EN EI DA
Sbjct  305  GPTFGAMMISGQKAAHLALKALGQPNAIDGTFSEVTEVQPEFILAATENSEIVDA  359



>gb|AFK48432.1| unknown [Lotus japonicus]
Length=363

 Score =   295 bits (755),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 149/175 (85%), Positives = 159/175 (91%), Gaps = 2/175 (1%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCGHDGP  486
            PNVKLF AVAAEDLIVKNGRVGGVVTNWALVSM  DTQSCMDPNVMEAK+VVSSCGHDGP
Sbjct  189  PNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDTQSCMDPNVMEAKVVVSSCGHDGP  248

Query  485  FGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  306
            FG TGVKRLKSIG+ID VPGMKALDMNTAEDAIVRLTRE+VPGMIVTGMEVAEIDGAPRM
Sbjct  249  FGATGVKRLKSIGLIDRVPGMKALDMNTAEDAIVRLTREVVPGMIVTGMEVAEIDGAPRM  308

Query  305  GPTFGAMMISGQKAAHLALKALGEPNALD-GSASEVAAPELILXSA-ENEEIADA  147
            GPTFGAMMISGQKAAHLAL +LG PNA+D  +A+    PEL+L +A E+ EIADA
Sbjct  309  GPTFGAMMISGQKAAHLALGSLGLPNAVDKNNAAGKIHPELVLAAATESAEIADA  363



>ref|XP_006467989.1| PREDICTED: thiamine thiazole synthase 2, chloroplastic-like [Citrus 
sinensis]
 gb|KDO75540.1| hypothetical protein CISIN_1g018188mg [Citrus sinensis]
Length=359

 Score =   295 bits (754),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 155/175 (89%), Positives = 160/175 (91%), Gaps = 2/175 (1%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCGHDGP  486
            PNVKLF AVAAEDLIVK GRVGGVVTNWALVSM  DTQSCMDPNVMEAKIVVSSCGHDGP
Sbjct  185  PNVKLFNAVAAEDLIVKGGRVGGVVTNWALVSMNHDTQSCMDPNVMEAKIVVSSCGHDGP  244

Query  485  FGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  306
            FG TGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM
Sbjct  245  FGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  304

Query  305  GPTFGAMMISGQKAAHLALKALGEPNALDGSASEVA--APELILXSAENEEIADA  147
            GPTFGAMMISGQKAAHLALKALG+PNA+DG+ SEV    PE +L + EN EI DA
Sbjct  305  GPTFGAMMISGQKAAHLALKALGQPNAIDGTFSEVTEVQPEFVLAATENSEIVDA  359



>ref|XP_006657781.1| PREDICTED: thiamine thiazole synthase 2, chloroplastic-like [Oryza 
brachyantha]
Length=351

 Score =   294 bits (752),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 144/176 (82%), Positives = 154/176 (88%), Gaps = 3/176 (2%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCGHDGP  486
            PNVKLF AVA EDLIVK GRVGGVVTNWALVSM  DTQSCMDPNVME+K+VVSSCGHDGP
Sbjct  176  PNVKLFNAVAVEDLIVKEGRVGGVVTNWALVSMNHDTQSCMDPNVMESKVVVSSCGHDGP  235

Query  485  FGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  306
            FG TGVKRL+ IGMID+VPGM+ALDMNTAED IVRLTRE+VPGMIVTGMEVAEIDGAPRM
Sbjct  236  FGATGVKRLQDIGMIDAVPGMRALDMNTAEDEIVRLTREVVPGMIVTGMEVAEIDGAPRM  295

Query  305  GPTFGAMMISGQKAAHLALKALGEPNALDGS---ASEVAAPELILXSAENEEIADA  147
            GPTFGAMMISGQKAAHLALKALG PNA+DG+   A     PELIL S ++ E  DA
Sbjct  296  GPTFGAMMISGQKAAHLALKALGRPNAIDGTIKKAPSATHPELILASKDDGETVDA  351



>ref|XP_009388868.1| PREDICTED: thiamine thiazole synthase 2, chloroplastic {ECO:0000255|HAMAP-Rule:MF_03158}-like 
[Musa acuminata subsp. malaccensis]
Length=360

 Score =   294 bits (752),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 145/167 (87%), Positives = 151/167 (90%), Gaps = 1/167 (1%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCGHDGP  486
            PNVKLF AVAAEDLIVK GRV GVVTNWALVSM  DTQSCMDPNVMEAK+VVSSCGHDGP
Sbjct  186  PNVKLFNAVAAEDLIVKEGRVAGVVTNWALVSMNHDTQSCMDPNVMEAKVVVSSCGHDGP  245

Query  485  FGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  306
            FG TGVKRLK IGMIDSVPGMKALDMN AEDAIVRLTRE+VPGMIVTGMEVAEIDGAPRM
Sbjct  246  FGATGVKRLKGIGMIDSVPGMKALDMNAAEDAIVRLTREVVPGMIVTGMEVAEIDGAPRM  305

Query  305  GPTFGAMMISGQKAAHLALKALGEPNALDGSA-SEVAAPELILXSAE  168
            GPTFGAMMISGQKAAHL LKALG PNALDG+  +E   PEL+L SA+
Sbjct  306  GPTFGAMMISGQKAAHLTLKALGRPNALDGTTRAEPLHPELVLASAD  352



>ref|XP_002864354.1| hypothetical protein ARALYDRAFT_918614 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40613.1| hypothetical protein ARALYDRAFT_918614 [Arabidopsis lyrata subsp. 
lyrata]
Length=352

 Score =   293 bits (750),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 144/173 (83%), Positives = 153/173 (88%), Gaps = 0/173 (0%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCGHDGP  486
            PNVKLF AVAAEDLIVK  RVGGVVTNWALV+   DTQSCMDPNVMEAKIVVSSCGHDGP
Sbjct  180  PNVKLFNAVAAEDLIVKGNRVGGVVTNWALVAQNHDTQSCMDPNVMEAKIVVSSCGHDGP  239

Query  485  FGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  306
            FG TGVKRLKSIGMID VPGMKALDMNTAEDAIVRLTRE+VPGMIVTGMEVAEIDGAPRM
Sbjct  240  FGATGVKRLKSIGMIDHVPGMKALDMNTAEDAIVRLTREVVPGMIVTGMEVAEIDGAPRM  299

Query  305  GPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPELILXSAENEEIADA  147
            GPTFGAMMISGQKA  LALKALG PNA+DG+     +PEL+L +A++ E  DA
Sbjct  300  GPTFGAMMISGQKAGQLALKALGLPNAIDGTNVGNLSPELVLAAADSAETVDA  352



>ref|NP_001059841.1| Os07g0529600 [Oryza sativa Japonica Group]
 dbj|BAC78562.1| thiamine biosynthetic enzyme [Oryza sativa Japonica Group]
 dbj|BAF21755.1| Os07g0529600 [Oryza sativa Japonica Group]
 dbj|BAG94352.1| unnamed protein product [Oryza sativa Japonica Group]
Length=355

 Score =   293 bits (749),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 145/177 (82%), Positives = 157/177 (89%), Gaps = 4/177 (2%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCGHDGP  486
            PNVKLF AVA EDLIVK GRVGGVVTNWALVSM  DTQSCMDPNVME+++VVSSCGHDGP
Sbjct  179  PNVKLFNAVAVEDLIVKEGRVGGVVTNWALVSMNHDTQSCMDPNVMESRVVVSSCGHDGP  238

Query  485  FGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  306
            FG TGVKRL+ IGMID+VPGM+ALDMNTAED IVRLTRE+VPGMIVTGMEVAEIDGAPRM
Sbjct  239  FGATGVKRLQDIGMIDAVPGMRALDMNTAEDEIVRLTREVVPGMIVTGMEVAEIDGAPRM  298

Query  305  GPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAA----PELILXSAENEEIADA  147
            GPTFGAMMISGQKAAHLALKALG PNA+DG+  + AA    PELIL S ++ EI DA
Sbjct  299  GPTFGAMMISGQKAAHLALKALGRPNAIDGTIKKAAAAAAHPELILASKDDGEIVDA  355



>ref|XP_008809851.1| PREDICTED: thiamine thiazole synthase 1, chloroplastic-like [Phoenix 
dactylifera]
Length=359

 Score =   293 bits (750),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 142/174 (82%), Positives = 156/174 (90%), Gaps = 1/174 (1%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCGHDGP  486
            PNVKLF AVA EDLIVK GRV GVVTNWALVSM  DTQSCMDPNVME+K+VVSSCGHDGP
Sbjct  186  PNVKLFNAVAVEDLIVKEGRVAGVVTNWALVSMNHDTQSCMDPNVMESKVVVSSCGHDGP  245

Query  485  FGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  306
            FG TGVKRLK IGMIDSVPGMKALDMN+AEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM
Sbjct  246  FGATGVKRLKDIGMIDSVPGMKALDMNSAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  305

Query  305  GPTFGAMMISGQKAAHLALKALGEPNALDGS-ASEVAAPELILXSAENEEIADA  147
            GPTFGAMM+SGQKAAHLALK+LG PNALDG+  +E   PE++L S++  ++ +A
Sbjct  306  GPTFGAMMVSGQKAAHLALKSLGRPNALDGTIGAEKVHPEMVLASSDGGDVVEA  359



>dbj|BAC45141.1| putative thiamine biosynthesis protein [Oryza sativa Japonica 
Group]
 gb|EAZ40087.1| hypothetical protein OsJ_24530 [Oryza sativa Japonica Group]
Length=352

 Score =   293 bits (749),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 145/177 (82%), Positives = 157/177 (89%), Gaps = 4/177 (2%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCGHDGP  486
            PNVKLF AVA EDLIVK GRVGGVVTNWALVSM  DTQSCMDPNVME+++VVSSCGHDGP
Sbjct  176  PNVKLFNAVAVEDLIVKEGRVGGVVTNWALVSMNHDTQSCMDPNVMESRVVVSSCGHDGP  235

Query  485  FGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  306
            FG TGVKRL+ IGMID+VPGM+ALDMNTAED IVRLTRE+VPGMIVTGMEVAEIDGAPRM
Sbjct  236  FGATGVKRLQDIGMIDAVPGMRALDMNTAEDEIVRLTREVVPGMIVTGMEVAEIDGAPRM  295

Query  305  GPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAA----PELILXSAENEEIADA  147
            GPTFGAMMISGQKAAHLALKALG PNA+DG+  + AA    PELIL S ++ EI DA
Sbjct  296  GPTFGAMMISGQKAAHLALKALGRPNAIDGTIKKAAAAAAHPELILASKDDGEIVDA  352



>gb|EYU27823.1| hypothetical protein MIMGU_mgv1a009995mg [Erythranthe guttata]
Length=325

 Score =   291 bits (746),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 146/176 (83%), Positives = 155/176 (88%), Gaps = 3/176 (2%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCGHDGP  486
            PNVKLF AVAAEDLIVK GRV GVVTNWALV+    TQSCMDPNVMEAKIVVSSCGHDGP
Sbjct  150  PNVKLFNAVAAEDLIVKGGRVAGVVTNWALVAQNHHTQSCMDPNVMEAKIVVSSCGHDGP  209

Query  485  FGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  306
            FG TGVKRL+SIGMI+SVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDG+PRM
Sbjct  210  FGATGVKRLRSIGMIESVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGSPRM  269

Query  305  GPTFGAMMISGQKAAHLALKALGEPNALDGSAS---EVAAPELILXSAENEEIADA  147
            GPTFGAMMISGQKAAHLAL+ALG PNALD S +   E A PE IL SA+++   DA
Sbjct  270  GPTFGAMMISGQKAAHLALRALGLPNALDVSYAGGVETAQPEFILASADSDVSVDA  325



>emb|CAJ91138.1| thiamin biosynthetic enzyme [Platanus x acerifolia]
Length=171

 Score =   286 bits (732),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 144/168 (86%), Positives = 155/168 (92%), Gaps = 2/168 (1%)
 Frame = -1

Query  644  AVAAEDLIVKNGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCGHDGPFGXTGVK  465
            AVAAEDLIVK GRV GVVTNWALVSM   TQSCMDPNVME+K+VVSSCGHDGPFG TGVK
Sbjct  4    AVAAEDLIVKEGRVAGVVTNWALVSMNHGTQSCMDPNVMESKVVVSSCGHDGPFGATGVK  63

Query  464  RLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRMGPTFGAM  285
            RLKSIGMIDSVPGMKALDMNTAEDAIVRLTRE+VPGMIVTGMEVAEIDGAPRMGPTFGAM
Sbjct  64   RLKSIGMIDSVPGMKALDMNTAEDAIVRLTREVVPGMIVTGMEVAEIDGAPRMGPTFGAM  123

Query  284  MISGQKAAHLALKALGEPNALDGSASEVAA--PELILXSAENEEIADA  147
            MISGQKAAHLALKALG PNA+DG+ S++ +  PELIL +AE+ +IADA
Sbjct  124  MISGQKAAHLALKALGLPNAMDGNYSDMGSIHPELILAAAESGDIADA  171



>ref|XP_002973063.1| hypothetical protein SELMODRAFT_271002 [Selaginella moellendorffii]
 gb|EFJ26284.1| hypothetical protein SELMODRAFT_271002 [Selaginella moellendorffii]
Length=356

 Score =   293 bits (749),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 142/169 (84%), Positives = 152/169 (90%), Gaps = 0/169 (0%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCGHDGP  486
            PNVKLF AVAAEDLI+K  +V GVVTNWALVSM   TQSCMDPNVMEAK+VVSSCGHDGP
Sbjct  183  PNVKLFNAVAAEDLIIKEDKVAGVVTNWALVSMNHHTQSCMDPNVMEAKVVVSSCGHDGP  242

Query  485  FGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  306
            FG  GVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTRE+VPGMIVTGMEVAEIDGAPRM
Sbjct  243  FGAAGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREVVPGMIVTGMEVAEIDGAPRM  302

Query  305  GPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPELILXSAENEE  159
            GPTFGAMMISGQKAAHLALK+LG PNA+DG+      PEL+L SAE++E
Sbjct  303  GPTFGAMMISGQKAAHLALKSLGMPNAIDGTLKAGYLPELVLASAEDDE  351



>ref|XP_002994429.1| hypothetical protein SELMODRAFT_163429 [Selaginella moellendorffii]
 gb|EFJ04508.1| hypothetical protein SELMODRAFT_163429 [Selaginella moellendorffii]
Length=356

 Score =   293 bits (749),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 142/169 (84%), Positives = 152/169 (90%), Gaps = 0/169 (0%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCGHDGP  486
            PNVKLF AVAAEDLI+K  +V GVVTNWALVSM   TQSCMDPNVMEAK+VVSSCGHDGP
Sbjct  183  PNVKLFNAVAAEDLIIKEDKVAGVVTNWALVSMNHHTQSCMDPNVMEAKVVVSSCGHDGP  242

Query  485  FGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  306
            FG  GVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTRE+VPGMIVTGMEVAEIDGAPRM
Sbjct  243  FGAAGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREVVPGMIVTGMEVAEIDGAPRM  302

Query  305  GPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPELILXSAENEE  159
            GPTFGAMMISGQKAAHLALK+LG PNA+DG+      PEL+L SAE++E
Sbjct  303  GPTFGAMMISGQKAAHLALKSLGMPNAIDGTLKAGYLPELVLASAEDDE  351



>gb|EAZ04139.1| hypothetical protein OsI_26282 [Oryza sativa Indica Group]
Length=353

 Score =   292 bits (748),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 145/178 (81%), Positives = 157/178 (88%), Gaps = 5/178 (3%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCGHDGP  486
            PNVKLF AVA EDLIVK GRVGGVVTNWALVSM  DTQSCMDPNVME+++VVSSCGHDGP
Sbjct  176  PNVKLFNAVAVEDLIVKEGRVGGVVTNWALVSMNHDTQSCMDPNVMESRVVVSSCGHDGP  235

Query  485  FGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  306
            FG TGVKRL+ IGMID+VPGM+ALDMNTAED IVRLTRE+VPGMIVTGMEVAEIDGAPRM
Sbjct  236  FGATGVKRLQDIGMIDAVPGMRALDMNTAEDEIVRLTREVVPGMIVTGMEVAEIDGAPRM  295

Query  305  GPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAA-----PELILXSAENEEIADA  147
            GPTFGAMMISGQKAAHLALKALG PNA+DG+  + AA     PELIL S ++ EI DA
Sbjct  296  GPTFGAMMISGQKAAHLALKALGRPNAIDGTIKKAAAAAAAHPELILASKDDGEIVDA  353



>gb|AAV92554.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
Length=351

 Score =   292 bits (748),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 145/176 (82%), Positives = 155/176 (88%), Gaps = 10/176 (6%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNGR--------VGGVVTNWALVSMXXDTQSCMDPNVMEAKIVV  510
            PNVKLF AVAAEDLI+K GR        V GVVTNWALVSM  DTQSCMDPNVME+K+VV
Sbjct  172  PNVKLFNAVAAEDLIIKEGRMLSYCEGLVSGVVTNWALVSMNHDTQSCMDPNVMESKVVV  231

Query  509  SSCGHDGPFGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVA  330
            SSCGHDGPFG TGVKRLKS+GMID VPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVA
Sbjct  232  SSCGHDGPFGATGVKRLKSVGMIDKVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVA  291

Query  329  EIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPELILXSAENE  162
            EIDG+PRMGPTFGAMM+SGQKAAHLALKALG+PNALDG+   +  PEL+L SAENE
Sbjct  292  EIDGSPRMGPTFGAMMVSGQKAAHLALKALGQPNALDGTLKVL--PELVLASAENE  345



>ref|XP_006280726.1| hypothetical protein CARUB_v10026695mg [Capsella rubella]
 gb|EOA13624.1| hypothetical protein CARUB_v10026695mg [Capsella rubella]
Length=350

 Score =   292 bits (747),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 143/173 (83%), Positives = 153/173 (88%), Gaps = 0/173 (0%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCGHDGP  486
            PNVKLF AVAAEDLIVK  RVGGVVTNWALV+   D+QSCMDPNVMEAKIVVSSCGHDGP
Sbjct  178  PNVKLFNAVAAEDLIVKGNRVGGVVTNWALVAQNHDSQSCMDPNVMEAKIVVSSCGHDGP  237

Query  485  FGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  306
            FG TGVKRLKSIGMID VPGMKALDMNTAEDAIVRLTRE+VPGMIVTGMEVAEIDGAPRM
Sbjct  238  FGATGVKRLKSIGMIDHVPGMKALDMNTAEDAIVRLTREVVPGMIVTGMEVAEIDGAPRM  297

Query  305  GPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPELILXSAENEEIADA  147
            GPTFGAMMISGQKA  LALKALG PNA+DG+     +PEL+L +A++ E  DA
Sbjct  298  GPTFGAMMISGQKAGQLALKALGLPNAIDGTNVGNLSPELVLAAADSAETVDA  350



>gb|KHN46540.1| Thiamine thiazole synthase 2, chloroplastic [Glycine soja]
Length=178

 Score =   286 bits (731),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 141/162 (87%), Positives = 149/162 (92%), Gaps = 2/162 (1%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCGHDGP  486
            PNVKLF AVAAEDLIVKNGRVGGVVTNWALVS+  DTQSCMDPNVMEAK+VVSSCGHDGP
Sbjct  8    PNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSLNHDTQSCMDPNVMEAKVVVSSCGHDGP  67

Query  485  FGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  306
            FG TGVKRLKSIG+IDSVPGMKALDMN AEDAIVRLTRE+VPGMIVTGMEVAEIDGAPRM
Sbjct  68   FGATGVKRLKSIGLIDSVPGMKALDMNKAEDAIVRLTREVVPGMIVTGMEVAEIDGAPRM  127

Query  305  GPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPELIL  180
            GPTFGAMMISGQKAAHLAL++LG PNALD   +    PEL+L
Sbjct  128  GPTFGAMMISGQKAAHLALRSLGLPNALDSVGN--VHPELVL  167



>ref|XP_009590342.1| PREDICTED: thiamine thiazole synthase, chloroplastic {ECO:0000255|HAMAP-Rule:MF_03158} 
[Nicotiana tomentosiformis]
Length=359

 Score =   292 bits (747),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 142/162 (88%), Positives = 147/162 (91%), Gaps = 0/162 (0%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCGHDGP  486
            PNVKLF AVA EDLIVKNGRVGGVVTNW+LVS   DTQSCMDPNVMEAKIVVSSCGHDGP
Sbjct  187  PNVKLFNAVATEDLIVKNGRVGGVVTNWSLVSQNHDTQSCMDPNVMEAKIVVSSCGHDGP  246

Query  485  FGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  306
             G TGVKRLKSIGMI+ VPGMKALDMN AEDAIVRLTRE+VPGMIVTGMEVAEIDGAPRM
Sbjct  247  MGATGVKRLKSIGMINHVPGMKALDMNAAEDAIVRLTREVVPGMIVTGMEVAEIDGAPRM  306

Query  305  GPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPELIL  180
            GPTFGAMMISGQKAAHLAL+ALG PNALDG+A     PELIL
Sbjct  307  GPTFGAMMISGQKAAHLALRALGLPNALDGTAESSIHPELIL  348



>ref|XP_009774029.1| PREDICTED: thiamine thiazole synthase, chloroplastic [Nicotiana 
sylvestris]
Length=358

 Score =   292 bits (747),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 142/162 (88%), Positives = 147/162 (91%), Gaps = 0/162 (0%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCGHDGP  486
            PNVKLF AVA EDLIVKNGRVGGVVTNW+LVS   DTQSCMDPNVMEAKIVVSSCGHDGP
Sbjct  186  PNVKLFNAVATEDLIVKNGRVGGVVTNWSLVSQNHDTQSCMDPNVMEAKIVVSSCGHDGP  245

Query  485  FGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  306
             G TGVKRLKSIGMI+ VPGMKALDMN AEDAIVRLTRE+VPGMIVTGMEVAEIDGAPRM
Sbjct  246  MGATGVKRLKSIGMINHVPGMKALDMNAAEDAIVRLTREVVPGMIVTGMEVAEIDGAPRM  305

Query  305  GPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPELIL  180
            GPTFGAMMISGQKAAHLAL+ALG PNALDG+A     PELIL
Sbjct  306  GPTFGAMMISGQKAAHLALRALGLPNALDGTAESSIHPELIL  347



>ref|XP_004244150.1| PREDICTED: thiamine thiazole synthase, chloroplastic [Solanum 
lycopersicum]
Length=354

 Score =   292 bits (747),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 141/162 (87%), Positives = 148/162 (91%), Gaps = 0/162 (0%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCGHDGP  486
            PNVKLF AVA EDLIVKNGRVGGVVTNW+LVS   DTQSCMDPNVMEAKIVVSSCGHDGP
Sbjct  182  PNVKLFNAVATEDLIVKNGRVGGVVTNWSLVSQNHDTQSCMDPNVMEAKIVVSSCGHDGP  241

Query  485  FGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  306
             G TGVKRL+SIGMI+SVPGMKALDMN AEDAIVRLTRE+VPGMIVTGMEVAEIDGAPRM
Sbjct  242  MGATGVKRLRSIGMINSVPGMKALDMNAAEDAIVRLTREVVPGMIVTGMEVAEIDGAPRM  301

Query  305  GPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPELIL  180
            GPTFGAMMISGQKAAHLAL+ALG PNALDG+A     PEL+L
Sbjct  302  GPTFGAMMISGQKAAHLALRALGLPNALDGTAETSVLPELML  343



>ref|XP_011030844.1| PREDICTED: LOW QUALITY PROTEIN: thiamine thiazole synthase, chloroplastic-like 
[Populus euphratica]
Length=357

 Score =   291 bits (746),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 144/172 (84%), Positives = 155/172 (90%), Gaps = 0/172 (0%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCGHDGP  486
            PNVKLF AVAAEDLIVK GRVGG+VTN ALVSM  DTQSCMDPNVMEAK+VVSSCGHDGP
Sbjct  185  PNVKLFNAVAAEDLIVKEGRVGGLVTNXALVSMNHDTQSCMDPNVMEAKVVVSSCGHDGP  244

Query  485  FGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  306
            FG TGVKRLKSIGMIDSVPGMKALDMN AEDAIV+LTRE+VPGMIVTGMEVAEIDG+PRM
Sbjct  245  FGATGVKRLKSIGMIDSVPGMKALDMNAAEDAIVKLTREVVPGMIVTGMEVAEIDGSPRM  304

Query  305  GPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPELILXSAENEEIAD  150
            GPTFGAMMISGQKAAHLALK+LG PNALDG+      PELIL + E+ +IA+
Sbjct  305  GPTFGAMMISGQKAAHLALKSLGMPNALDGTFVGGIHPELILAAVESADIAE  356



>ref|XP_010443053.1| PREDICTED: thiamine thiazole synthase, chloroplastic-like [Camelina 
sativa]
Length=351

 Score =   291 bits (745),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 142/173 (82%), Positives = 153/173 (88%), Gaps = 0/173 (0%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCGHDGP  486
            PNVKLF AVAAEDLIVK  RVGGVVTNWALV+   D+QSCMDPNVMEAKIVVSSCGHDGP
Sbjct  179  PNVKLFNAVAAEDLIVKGNRVGGVVTNWALVAQNHDSQSCMDPNVMEAKIVVSSCGHDGP  238

Query  485  FGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  306
            FG TGVKRL+SIGMID VPGMKALDMNTAEDAIVRLTRE+VPGMIVTGMEVAEIDG+PRM
Sbjct  239  FGATGVKRLRSIGMIDHVPGMKALDMNTAEDAIVRLTREVVPGMIVTGMEVAEIDGSPRM  298

Query  305  GPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPELILXSAENEEIADA  147
            GPTFGAMMISGQKA  LALKALG PNA+DG+     +PEL+L +AE+ E  DA
Sbjct  299  GPTFGAMMISGQKAGQLALKALGLPNAIDGTLVGNLSPELVLAAAESAETVDA  351



>ref|XP_006360084.1| PREDICTED: thiamine thiazole synthase 1, chloroplastic-like [Solanum 
tuberosum]
Length=357

 Score =   291 bits (744),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 140/162 (86%), Positives = 148/162 (91%), Gaps = 0/162 (0%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCGHDGP  486
            PNVKLF AVA EDLIVKNGRVGGVVTNW+LVS   DTQSCMDPNVMEAK+VVSSCGHDGP
Sbjct  185  PNVKLFNAVATEDLIVKNGRVGGVVTNWSLVSQNHDTQSCMDPNVMEAKVVVSSCGHDGP  244

Query  485  FGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  306
             G TGVKRL+SIGMI+SVPGMKALDMN AEDAIVRLTRE+VPGMIVTGMEVAEIDGAPRM
Sbjct  245  MGATGVKRLRSIGMINSVPGMKALDMNAAEDAIVRLTREVVPGMIVTGMEVAEIDGAPRM  304

Query  305  GPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPELIL  180
            GPTFGAMMISGQKAAHLAL+ALG PNALDG+A     PEL+L
Sbjct  305  GPTFGAMMISGQKAAHLALRALGLPNALDGTAETSILPELML  346



>ref|NP_200288.1| thiazole biosynthetic enzyme [Arabidopsis thaliana]
 sp|Q38814.1|THI4_ARATH RecName: Full=Thiamine thiazole synthase, chloroplastic; AltName: 
Full=Thiazole biosynthetic enzyme; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAL16153.1|AF428385_1 AT5g54770/MBG8_3 [Arabidopsis thaliana]
 gb|AAL16285.1|AF428355_1 AT5g54770/MBG8_3 [Arabidopsis thaliana]
 gb|AAL31936.1|AF419604_1 AT5g54770/MBG8_3 [Arabidopsis thaliana]
 gb|AAC97124.1| Thi1 protein [Arabidopsis thaliana]
 dbj|BAB08756.1| thiazole biosynthetic enzyme precursor (ARA6) [Arabidopsis thaliana]
 gb|AAL06876.1| AT5g54770/MBG8_3 [Arabidopsis thaliana]
 gb|AAL24202.1| AT5g54770/MBG8_3 [Arabidopsis thaliana]
 gb|AAN12914.1| At5g54770/MBG8_3 [Arabidopsis thaliana]
 gb|AED96539.1| thiazole biosynthetic enzyme [Arabidopsis thaliana]
Length=349

 Score =   291 bits (744),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 143/173 (83%), Positives = 152/173 (88%), Gaps = 0/173 (0%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCGHDGP  486
            PNVKLF AVAAEDLIVK  RVGGVVTNWALV+    TQSCMDPNVMEAKIVVSSCGHDGP
Sbjct  177  PNVKLFNAVAAEDLIVKGNRVGGVVTNWALVAQNHHTQSCMDPNVMEAKIVVSSCGHDGP  236

Query  485  FGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  306
            FG TGVKRLKSIGMID VPGMKALDMNTAEDAIVRLTRE+VPGMIVTGMEVAEIDGAPRM
Sbjct  237  FGATGVKRLKSIGMIDHVPGMKALDMNTAEDAIVRLTREVVPGMIVTGMEVAEIDGAPRM  296

Query  305  GPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPELILXSAENEEIADA  147
            GPTFGAMMISGQKA  LALKALG PNA+DG+     +PEL+L +A++ E  DA
Sbjct  297  GPTFGAMMISGQKAGQLALKALGLPNAIDGTLVGNLSPELVLAAADSAETVDA  349



>gb|EMT30436.1| Thiazole biosynthetic enzyme 1-2, chloroplastic [Aegilops tauschii]
Length=348

 Score =   290 bits (743),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 142/176 (81%), Positives = 151/176 (86%), Gaps = 3/176 (2%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCGHDGP  486
            PNVKLF AVA EDLIVK  RV GVVTNWALVSM  DTQSCMDPNVMEAK+VVSSCGHDGP
Sbjct  173  PNVKLFNAVAVEDLIVKENRVAGVVTNWALVSMNHDTQSCMDPNVMEAKVVVSSCGHDGP  232

Query  485  FGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  306
            FG TGVKRL+ IGMI +VPGMKALDMNTAEDAIVRLTRE+VPGMIVTGMEVAEIDGAPRM
Sbjct  233  FGATGVKRLQDIGMIQAVPGMKALDMNTAEDAIVRLTREVVPGMIVTGMEVAEIDGAPRM  292

Query  305  GPTFGAMMISGQKAAHLALKALGEPNALDGSASEVA---APELILXSAENEEIADA  147
            GPTFGAMMISGQKAAHLALKALG PN +DG+   V     PE+IL +  N +I DA
Sbjct  293  GPTFGAMMISGQKAAHLALKALGRPNGIDGTLKNVTPALHPEMILAATNNGDIVDA  348



>gb|AAP03875.1| putative chloroplast thiazole biosynthetic protein [Nicotiana 
tabacum]
Length=358

 Score =   290 bits (743),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 141/162 (87%), Positives = 147/162 (91%), Gaps = 0/162 (0%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCGHDGP  486
            PNVKLF AVA EDLIVKNGRVGGVVTNW+LVS   DTQSCMDPNVMEAKIVVSSCGHDGP
Sbjct  186  PNVKLFNAVATEDLIVKNGRVGGVVTNWSLVSQNHDTQSCMDPNVMEAKIVVSSCGHDGP  245

Query  485  FGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  306
             G TGVKRLKSIGMI+ VPGMKAL+MN AEDAIVRLTRE+VPGMIVTGMEVAEIDGAPRM
Sbjct  246  MGATGVKRLKSIGMINHVPGMKALNMNAAEDAIVRLTREVVPGMIVTGMEVAEIDGAPRM  305

Query  305  GPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPELIL  180
            GPTFGAMMISGQKAAHLAL+ALG PNALDG+A     PELIL
Sbjct  306  GPTFGAMMISGQKAAHLALRALGLPNALDGTAESSIHPELIL  347



>ref|XP_003563001.1| PREDICTED: thiamine thiazole synthase 2, chloroplastic [Brachypodium 
distachyon]
Length=352

 Score =   290 bits (742),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 142/176 (81%), Positives = 153/176 (87%), Gaps = 3/176 (2%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCGHDGP  486
            PNVKLF AVA EDLIVK  RV GVVTNWALVSM  DTQSCMDPNVMEAK+VVSSCGHDGP
Sbjct  177  PNVKLFNAVAVEDLIVKEDRVAGVVTNWALVSMNHDTQSCMDPNVMEAKVVVSSCGHDGP  236

Query  485  FGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  306
            FG TGVKRL+ IGMID+VPGMKALDMN AEDAIVRLTRE+VPGMIVTGMEVAEIDGAPRM
Sbjct  237  FGATGVKRLQDIGMIDTVPGMKALDMNMAEDAIVRLTREVVPGMIVTGMEVAEIDGAPRM  296

Query  305  GPTFGAMMISGQKAAHLALKALGEPNALDGS---ASEVAAPELILXSAENEEIADA  147
            GPTFGAMMISGQKAAHLALKALG PN +DG+   A+    PE++L SA N ++ DA
Sbjct  297  GPTFGAMMISGQKAAHLALKALGRPNGIDGTLKNATPALHPEMVLASANNGDVVDA  352



>ref|XP_010448624.1| PREDICTED: thiamine thiazole synthase, chloroplastic isoform 
X1 [Camelina sativa]
 ref|XP_010448632.1| PREDICTED: thiamine thiazole synthase, chloroplastic isoform 
X2 [Camelina sativa]
Length=351

 Score =   290 bits (741),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 141/173 (82%), Positives = 153/173 (88%), Gaps = 0/173 (0%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCGHDGP  486
            PNVKLF AVAAEDLIVK  RVGGVVTNWALV+   D+QSCMDPNVMEAKIVVSSCGHDGP
Sbjct  179  PNVKLFNAVAAEDLIVKGNRVGGVVTNWALVAQNHDSQSCMDPNVMEAKIVVSSCGHDGP  238

Query  485  FGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  306
            FG TGVKRL+SIGMID VPGMKALDMNTAEDAIVRLTRE+VPGMIVTGMEVAEIDG+PRM
Sbjct  239  FGATGVKRLRSIGMIDHVPGMKALDMNTAEDAIVRLTREVVPGMIVTGMEVAEIDGSPRM  298

Query  305  GPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPELILXSAENEEIADA  147
            GPTFGAMMISGQKA  LALKALG PNA+DG+     +PEL+L +A++ E  DA
Sbjct  299  GPTFGAMMISGQKAGQLALKALGLPNAIDGTLVGNLSPELVLAAADSAETVDA  351



>ref|XP_002281769.1| PREDICTED: thiamine thiazole synthase 1, chloroplastic [Vitis 
vinifera]
 sp|F6H9A9.1|THI41_VITVI RecName: Full=Thiamine thiazole synthase 1, chloroplastic; AltName: 
Full=Thiazole biosynthetic enzyme 1; Flags: Precursor 
[Vitis vinifera]
Length=353

 Score =   290 bits (741),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 139/162 (86%), Positives = 149/162 (92%), Gaps = 0/162 (0%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCGHDGP  486
            PNVKLF AVAAEDLI+K G+VGGVVTNWALVSM  DTQSCMDPNVMEAK+VVSSCGHDGP
Sbjct  180  PNVKLFNAVAAEDLIIKEGKVGGVVTNWALVSMNHDTQSCMDPNVMEAKVVVSSCGHDGP  239

Query  485  FGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  306
            FG TGVKRL+S+GMIDSVPGMKALDMNTAED IVRLTRE+VPGMIVTGMEVAEIDG+PRM
Sbjct  240  FGATGVKRLRSVGMIDSVPGMKALDMNTAEDEIVRLTREVVPGMIVTGMEVAEIDGSPRM  299

Query  305  GPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPELIL  180
            GPTFGAMMISGQKAAHLALK+LG PNALDG+      PEL+L
Sbjct  300  GPTFGAMMISGQKAAHLALKSLGLPNALDGTYIGNLHPELVL  341



>ref|XP_009378870.1| PREDICTED: thiamine thiazole synthase, chloroplastic-like [Pyrus 
x bretschneideri]
Length=359

 Score =   290 bits (741),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 142/162 (88%), Positives = 149/162 (92%), Gaps = 0/162 (0%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCGHDGP  486
            PNVKLF AVAAEDLI+K GRVGGVVTNWALVSM  DTQSCMDPNVMEAK+VVSSCGHDGP
Sbjct  187  PNVKLFNAVAAEDLIIKGGRVGGVVTNWALVSMNHDTQSCMDPNVMEAKVVVSSCGHDGP  246

Query  485  FGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  306
             G TGVKRL+S+GMI+SVPGMKALDMNTAEDAIV+LTREIVPGMIVTGMEVAEIDG+PRM
Sbjct  247  MGATGVKRLRSVGMIESVPGMKALDMNTAEDAIVKLTREIVPGMIVTGMEVAEIDGSPRM  306

Query  305  GPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPELIL  180
            GPTFGAMMISGQKAAHLALKALG PNALDGS      PELIL
Sbjct  307  GPTFGAMMISGQKAAHLALKALGLPNALDGSYVGGIQPELIL  348



>ref|XP_006845176.1| hypothetical protein AMTR_s00005p00239290 [Amborella trichopoda]
 gb|ERN06851.1| hypothetical protein AMTR_s00005p00239290 [Amborella trichopoda]
Length=355

 Score =   289 bits (740),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 144/174 (83%), Positives = 154/174 (89%), Gaps = 1/174 (1%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCGHDGP  486
            PNVKLF AVAAEDLIVK GRV GVVTNWALVSM  DTQSCMDPNVMEAK+VVSSCGHDGP
Sbjct  182  PNVKLFNAVAAEDLIVKEGRVAGVVTNWALVSMNHDTQSCMDPNVMEAKVVVSSCGHDGP  241

Query  485  FGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  306
            FG TGVKRL++IGMI+SVPGMKALDMN AEDAIVRLTRE+VPGMIVTGMEVAEIDG+PRM
Sbjct  242  FGATGVKRLRNIGMIESVPGMKALDMNVAEDAIVRLTREVVPGMIVTGMEVAEIDGSPRM  301

Query  305  GPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAA-PELILXSAENEEIADA  147
            GPTFGAMMISGQKAAHLALKALG PNA+DG+ S     PEL+L S+   E A A
Sbjct  302  GPTFGAMMISGQKAAHLALKALGLPNAVDGTYSLGGVHPELVLASSAEGETASA  355



>ref|XP_004965741.1| PREDICTED: thiamine thiazole synthase 2, chloroplastic-like [Setaria 
italica]
Length=351

 Score =   289 bits (739),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 143/176 (81%), Positives = 155/176 (88%), Gaps = 4/176 (2%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCGHDGP  486
            PNVKLF AVA EDLIVK GRVGGVVTNWALVSM  DTQSCMDPNVMEAKIVVSSCGHDGP
Sbjct  177  PNVKLFNAVAVEDLIVKQGRVGGVVTNWALVSMNHDTQSCMDPNVMEAKIVVSSCGHDGP  236

Query  485  FGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  306
            FG TGVKRL+ IGMI +VPGMKALDMNTAED IVRLTRE+VPGMIVTGMEVAEIDGAPRM
Sbjct  237  FGATGVKRLQDIGMISAVPGMKALDMNTAEDEIVRLTREVVPGMIVTGMEVAEIDGAPRM  296

Query  305  GPTFGAMMISGQKAAHLALKALGEPNALDGSAS---EVAAPELILXSAENEEIADA  147
            GPTFGAMMISGQKAAHLALKALG PNA+DG+A    +V   E ++ S +++E+ DA
Sbjct  297  GPTFGAMMISGQKAAHLALKALGRPNAIDGTAQTVPQVWREEFVIAS-KDDEVVDA  351



>ref|NP_001236812.1| thiamin biosynthetic enzyme [Glycine max]
 dbj|BAA88227.1| thiamin biosynthetic enzyme [Glycine max]
Length=345

 Score =   288 bits (738),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 141/162 (87%), Positives = 149/162 (92%), Gaps = 2/162 (1%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCGHDGP  486
            PNVKLF AVAAEDLIVKNGRVGGVVTNWALVS+  DTQSCMDPNVMEAK+VVSSCGHDGP
Sbjct  175  PNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSLNHDTQSCMDPNVMEAKVVVSSCGHDGP  234

Query  485  FGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  306
            FG TGVKRLKSIG+IDSVPGMKALDMN AEDAIVRLTRE+VPGMIVTGMEVAEIDGAPRM
Sbjct  235  FGATGVKRLKSIGLIDSVPGMKALDMNKAEDAIVRLTREVVPGMIVTGMEVAEIDGAPRM  294

Query  305  GPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPELIL  180
            GPTFGAMMISGQKAAHLAL++LG PNALD   +    PEL+L
Sbjct  295  GPTFGAMMISGQKAAHLALRSLGLPNALDSVGN--VHPELVL  334



>dbj|BAA88225.1| thiamin biosynthetic enzyme [Glycine max]
Length=345

 Score =   288 bits (738),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 141/162 (87%), Positives = 149/162 (92%), Gaps = 2/162 (1%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCGHDGP  486
            PNVKLF AVAAEDLIVKNGRVGGVVTNWALVS+  DTQSCMDPNVMEAK+VVSSCGHDGP
Sbjct  175  PNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSLNHDTQSCMDPNVMEAKVVVSSCGHDGP  234

Query  485  FGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  306
            FG TGVKRLKSIG+IDSVPGMKALDMN AEDAIVRLTRE+VPGMIVTGMEVAEIDGAPRM
Sbjct  235  FGATGVKRLKSIGLIDSVPGMKALDMNKAEDAIVRLTREVVPGMIVTGMEVAEIDGAPRM  294

Query  305  GPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPELIL  180
            GPTFGAMMISGQKAAHLAL++LG PNALD   +    PEL+L
Sbjct  295  GPTFGAMMISGQKAAHLALRSLGLPNALDSVGN--VHPELVL  334



>gb|EMS66450.1| Thiazole biosynthetic enzyme 1-2, chloroplastic [Triticum urartu]
Length=348

 Score =   288 bits (738),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 142/176 (81%), Positives = 151/176 (86%), Gaps = 3/176 (2%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCGHDGP  486
            PNVKLF AVA EDLIVK  RV GVVTNWALVSM  DTQSCMDPNVMEAK+VVSSCGHDGP
Sbjct  173  PNVKLFNAVAVEDLIVKEDRVAGVVTNWALVSMNHDTQSCMDPNVMEAKVVVSSCGHDGP  232

Query  485  FGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  306
            FG TGVKRL+ IGMI +VPGMKALDMNTAEDAIVRLTRE+VPGMIVTGMEVAEIDGAPRM
Sbjct  233  FGATGVKRLQDIGMIQAVPGMKALDMNTAEDAIVRLTREVVPGMIVTGMEVAEIDGAPRM  292

Query  305  GPTFGAMMISGQKAAHLALKALGEPNALDGSASEVA---APELILXSAENEEIADA  147
            GPTFGAMMISGQKAAHLALKALG PN +DG+   V     PE+IL +  N +I DA
Sbjct  293  GPTFGAMMISGQKAAHLALKALGRPNGIDGTLKNVTPALHPEMILAATNNGDIVDA  348



>ref|XP_009358110.1| PREDICTED: thiamine thiazole synthase, chloroplastic-like [Pyrus 
x bretschneideri]
Length=359

 Score =   288 bits (738),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 141/162 (87%), Positives = 148/162 (91%), Gaps = 0/162 (0%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCGHDGP  486
            PNVKLF AVAAEDLI+K GRVGGVVTNWALVSM  DTQSCMDPNVMEAK+VVSSCGHDGP
Sbjct  187  PNVKLFNAVAAEDLIIKGGRVGGVVTNWALVSMNHDTQSCMDPNVMEAKVVVSSCGHDGP  246

Query  485  FGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  306
             G TGVKRL+S+GMI+SVPGMKALDMN AEDAIV+LTREIVPGMIVTGMEVAEIDG+PRM
Sbjct  247  MGATGVKRLRSVGMIESVPGMKALDMNAAEDAIVKLTREIVPGMIVTGMEVAEIDGSPRM  306

Query  305  GPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPELIL  180
            GPTFGAMMISGQKAAHLALKALG PNALDGS      PELIL
Sbjct  307  GPTFGAMMISGQKAAHLALKALGLPNALDGSYVGGIQPELIL  348



>gb|AGT16062.1| Thiazole biosynthetic enzyme Thi4 family [Saccharum hybrid cultivar 
R570]
Length=355

 Score =   288 bits (736),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 141/175 (81%), Positives = 155/175 (89%), Gaps = 2/175 (1%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCGHDGP  486
            PNVKLF AVA EDLIVK GRVGGVVTNWALVSM  DTQSCMDPNVMEAK+VVSSCGHDGP
Sbjct  181  PNVKLFNAVAVEDLIVKQGRVGGVVTNWALVSMNHDTQSCMDPNVMEAKVVVSSCGHDGP  240

Query  485  FGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  306
            FG TGVKRL+ IGMI +VPGMKALDMNTAED IVRLTRE+VPGMIVTGMEVAEIDGAPRM
Sbjct  241  FGATGVKRLQDIGMISAVPGMKALDMNTAEDEIVRLTREVVPGMIVTGMEVAEIDGAPRM  300

Query  305  GPTFGAMMISGQKAAHLALKALGEPNALDGSASEV--AAPELILXSAENEEIADA  147
            GPTFGAMMISGQKAAHLALKALG PNA+DG+  +V  A  E  + +++++E+ DA
Sbjct  301  GPTFGAMMISGQKAAHLALKALGRPNAVDGTIPKVSPALREEFVIASKDDEVVDA  355



>gb|AGT16507.1| Thiazole biosynthetic enzyme Thi4 family [Saccharum hybrid cultivar 
R570]
Length=355

 Score =   288 bits (736),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 141/175 (81%), Positives = 155/175 (89%), Gaps = 2/175 (1%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCGHDGP  486
            PNVKLF AVA EDLIVK GRVGGVVTNWALVSM  DTQSCMDPNVMEAK+VVSSCGHDGP
Sbjct  181  PNVKLFNAVAVEDLIVKQGRVGGVVTNWALVSMNHDTQSCMDPNVMEAKVVVSSCGHDGP  240

Query  485  FGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  306
            FG TGVKRL+ IGMI +VPGMKALDMNTAED IVRLTRE+VPGMIVTGMEVAEIDGAPRM
Sbjct  241  FGATGVKRLQDIGMISAVPGMKALDMNTAEDEIVRLTREVVPGMIVTGMEVAEIDGAPRM  300

Query  305  GPTFGAMMISGQKAAHLALKALGEPNALDGSASEV--AAPELILXSAENEEIADA  147
            GPTFGAMMISGQKAAHLALKALG PNA+DG+  +V  A  E  + +++++E+ DA
Sbjct  301  GPTFGAMMISGQKAAHLALKALGRPNAVDGTIPKVSPALREEFVIASKDDEVVDA  355



>gb|AGT15954.1| Thiazole biosynthetic enzyme Thi4 family [Saccharum hybrid cultivar 
R570]
 gb|AGT16278.1| Thiazole biosynthetic enzyme Thi4 family [Saccharum hybrid cultivar 
R570]
 gb|AGT16833.1| Thiazole biosynthetic enzyme Thi4 family [Saccharum hybrid cultivar 
R570]
 gb|AGT17116.1| Thiazole biosynthetic enzyme Thi4 family [Saccharum hybrid cultivar 
R570]
Length=355

 Score =   287 bits (735),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 141/175 (81%), Positives = 155/175 (89%), Gaps = 2/175 (1%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCGHDGP  486
            PNVKLF AVA EDLIVK GRVGGVVTNWALVSM  DTQSCMDPNVMEAK+VVSSCGHDGP
Sbjct  181  PNVKLFNAVAVEDLIVKQGRVGGVVTNWALVSMNHDTQSCMDPNVMEAKVVVSSCGHDGP  240

Query  485  FGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  306
            FG TGVKRL+ IGMI +VPGMKALDMNTAED IVRLTRE+VPGMIVTGMEVAEIDGAPRM
Sbjct  241  FGATGVKRLQDIGMISAVPGMKALDMNTAEDEIVRLTREVVPGMIVTGMEVAEIDGAPRM  300

Query  305  GPTFGAMMISGQKAAHLALKALGEPNALDGSASEV--AAPELILXSAENEEIADA  147
            GPTFGAMMISGQKAAHLALKALG PNA+DG+  +V  A  E  + +++++E+ DA
Sbjct  301  GPTFGAMMISGQKAAHLALKALGRPNAVDGTIPKVSPALREEFVIASKDDEVVDA  355



>ref|XP_004294348.1| PREDICTED: thiamine thiazole synthase, chloroplastic [Fragaria 
vesca subsp. vesca]
Length=361

 Score =   288 bits (736),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 140/162 (86%), Positives = 147/162 (91%), Gaps = 0/162 (0%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCGHDGP  486
            PNVKLF AVAAEDLI+K GRVGGVVTNW+LVS   DTQSCMDPNVMEAK+VVSSCGHDGP
Sbjct  188  PNVKLFNAVAAEDLIIKGGRVGGVVTNWSLVSQNHDTQSCMDPNVMEAKVVVSSCGHDGP  247

Query  485  FGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  306
             G TGVKRL+S+GMIDSVPGMKALDMN AEDAIV+LTREIVPGMIVTGMEVAEIDG+PRM
Sbjct  248  MGATGVKRLRSVGMIDSVPGMKALDMNAAEDAIVKLTREIVPGMIVTGMEVAEIDGSPRM  307

Query  305  GPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPELIL  180
            GPTFGAMMISGQKAAHLALKALG PNALDGS      PELIL
Sbjct  308  GPTFGAMMISGQKAAHLALKALGLPNALDGSYVGGIQPELIL  349



>gb|AGT16846.1| Thiazole biosynthetic enzyme Thi4 family [Saccharum hybrid cultivar 
R570]
 gb|AGT16900.1| Thiazole biosynthetic enzyme Thi4 family [Saccharum hybrid cultivar 
R570]
Length=355

 Score =   287 bits (735),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 141/175 (81%), Positives = 155/175 (89%), Gaps = 2/175 (1%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCGHDGP  486
            PNVKLF AVA EDLIVK GRVGGVVTNWALVSM  DTQSCMDPNVMEAK+VVSSCGHDGP
Sbjct  181  PNVKLFNAVAVEDLIVKQGRVGGVVTNWALVSMNHDTQSCMDPNVMEAKVVVSSCGHDGP  240

Query  485  FGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  306
            FG TGVKRL+ IGMI +VPGMKALDMNTAED IVRLTRE+VPGMIVTGMEVAEIDGAPRM
Sbjct  241  FGATGVKRLQDIGMISAVPGMKALDMNTAEDEIVRLTREVVPGMIVTGMEVAEIDGAPRM  300

Query  305  GPTFGAMMISGQKAAHLALKALGEPNALDGSASEV--AAPELILXSAENEEIADA  147
            GPTFGAMMISGQKAAHLALKALG PNA+DG+  +V  A  E  + +++++E+ DA
Sbjct  301  GPTFGAMMISGQKAAHLALKALGRPNAVDGTIPKVSPALREEFVIASKDDEVVDA  355



>ref|XP_004957903.1| PREDICTED: thiamine thiazole synthase 2, chloroplastic-like [Setaria 
italica]
Length=350

 Score =   287 bits (735),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 142/176 (81%), Positives = 156/176 (89%), Gaps = 4/176 (2%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCGHDGP  486
            PNVKLF AVAAEDLIVK GRV GVVTNWALV+M   TQSCMDPNVMEAK+VVSSCGHDGP
Sbjct  176  PNVKLFNAVAAEDLIVKQGRVAGVVTNWALVAMNHGTQSCMDPNVMEAKVVVSSCGHDGP  235

Query  485  FGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  306
            FG TGVKRL+ IGMI +VPGMKALDMNTAEDAIVRLTRE+VPGMIVTGMEVAEIDGAPRM
Sbjct  236  FGATGVKRLQDIGMISAVPGMKALDMNTAEDAIVRLTREVVPGMIVTGMEVAEIDGAPRM  295

Query  305  GPTFGAMMISGQKAAHLALKALGEPNALDG---SASEVAAPELILXSAENEEIADA  147
            GPTFGAMMISGQKAAHLALKALG PNA+DG   +AS+    EL++ S +++E+ DA
Sbjct  296  GPTFGAMMISGQKAAHLALKALGRPNAIDGTTQTASQAWREELVMAS-KDDEVVDA  350



>gb|AGT17015.1| thiazole biosynthetic enzyme [Saccharum hybrid cultivar R570]
Length=355

 Score =   287 bits (734),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 140/175 (80%), Positives = 155/175 (89%), Gaps = 2/175 (1%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCGHDGP  486
            PNVKLF AVA EDLIV+ GRVGGVVTNWALVSM  DTQSCMDPNVMEAK+VVSSCGHDGP
Sbjct  181  PNVKLFNAVAVEDLIVRQGRVGGVVTNWALVSMNHDTQSCMDPNVMEAKVVVSSCGHDGP  240

Query  485  FGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  306
            FG TGVKRL+ IGMI +VPGMKALDMNTAED IVRLTRE+VPGMIVTGMEVAEIDGAPRM
Sbjct  241  FGATGVKRLQDIGMISAVPGMKALDMNTAEDEIVRLTREVVPGMIVTGMEVAEIDGAPRM  300

Query  305  GPTFGAMMISGQKAAHLALKALGEPNALDGSASEV--AAPELILXSAENEEIADA  147
            GPTFGAMMISGQKAAHLALKALG PNA+DG+  +V  A  E  + +++++E+ DA
Sbjct  301  GPTFGAMMISGQKAAHLALKALGRPNAVDGTIPKVSPALREEFVIASKDDEVVDA  355



>ref|XP_010670817.1| PREDICTED: thiamine thiazole synthase, chloroplastic-like isoform 
X1 [Beta vulgaris subsp. vulgaris]
Length=352

 Score =   286 bits (733),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 142/173 (82%), Positives = 153/173 (88%), Gaps = 2/173 (1%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCGHDGP  486
            PNVKLF AVAAEDLIVK GRV GVVTNWALVSM  +TQSCMDPNVMEAK+VVSSCGHDGP
Sbjct  182  PNVKLFNAVAAEDLIVKEGRVAGVVTNWALVSMNHNTQSCMDPNVMEAKVVVSSCGHDGP  241

Query  485  FGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  306
            FG TGVKRL+ IGMI SVPGM ALDMN+AEDAIVRLTRE+VPGMIVTGMEVAEIDGAPRM
Sbjct  242  FGATGVKRLQDIGMIKSVPGMSALDMNSAEDAIVRLTREVVPGMIVTGMEVAEIDGAPRM  301

Query  305  GPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPELILXSAENEEIADA  147
            GPTFGAMM+SGQKAAHLAL++LG  NALDG  S+   PEL L SAE+ E+ DA
Sbjct  302  GPTFGAMMLSGQKAAHLALRSLGLDNALDG--SDNLQPELQLASAESSEVVDA  352



>ref|XP_010105570.1| Thiamine thiazole synthase 2 [Morus notabilis]
 gb|EXC05099.1| Thiamine thiazole synthase 2 [Morus notabilis]
Length=353

 Score =   286 bits (733),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 154/174 (89%), Positives = 159/174 (91%), Gaps = 1/174 (1%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCGHDGP  486
            PNVKLF AVAAEDLIVK GRVGGVVTNWALVSM  DTQSCMDPNVMEAKIVVSSCGHDGP
Sbjct  180  PNVKLFNAVAAEDLIVKGGRVGGVVTNWALVSMNHDTQSCMDPNVMEAKIVVSSCGHDGP  239

Query  485  FGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  306
            FG TGVKRL+SIGMIDSVPGMKALDMN AEDAIVRLTREIVPGMIVTGMEVAEIDG+PRM
Sbjct  240  FGATGVKRLRSIGMIDSVPGMKALDMNAAEDAIVRLTREIVPGMIVTGMEVAEIDGSPRM  299

Query  305  GPTFGAMMISGQKAAHLALKALGEPNALDGSA-SEVAAPELILXSAENEEIADA  147
            GPTFGAMMISGQKAAHLALK+LG PNALDGS+      PELIL +AEN EIADA
Sbjct  300  GPTFGAMMISGQKAAHLALKSLGLPNALDGSSVGSNIHPELILAAAENAEIADA  353



>ref|XP_004294669.1| PREDICTED: thiamine thiazole synthase, chloroplastic-like [Fragaria 
vesca subsp. vesca]
Length=360

 Score =   286 bits (733),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 140/162 (86%), Positives = 147/162 (91%), Gaps = 0/162 (0%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCGHDGP  486
            PNVKLF AVAAEDLI+K GRV GVVTNWALVSM  DTQSCMDPNVMEAK+VVSSCGHDGP
Sbjct  187  PNVKLFNAVAAEDLIIKGGRVAGVVTNWALVSMNHDTQSCMDPNVMEAKVVVSSCGHDGP  246

Query  485  FGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  306
             G TGVKRL+S+GMI+SVPGMKALDMN AEDAIV+LTREIVPGMIVTGMEVAEIDG+PRM
Sbjct  247  MGATGVKRLRSVGMIESVPGMKALDMNAAEDAIVKLTREIVPGMIVTGMEVAEIDGSPRM  306

Query  305  GPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPELIL  180
            GPTFGAMMISGQKAAHLALKALG PNALDGS      PELIL
Sbjct  307  GPTFGAMMISGQKAAHLALKALGLPNALDGSYVGGIQPELIL  348



>ref|XP_010670818.1| PREDICTED: thiamine thiazole synthase 2, chloroplastic-like isoform 
X2 [Beta vulgaris subsp. vulgaris]
Length=352

 Score =   286 bits (732),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 142/173 (82%), Positives = 153/173 (88%), Gaps = 2/173 (1%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCGHDGP  486
            PNVKLF AVAAEDLIVK GRV GVVTNWALVSM  +TQSCMDPNVMEAK+VVSSCGHDGP
Sbjct  182  PNVKLFNAVAAEDLIVKEGRVAGVVTNWALVSMNHNTQSCMDPNVMEAKVVVSSCGHDGP  241

Query  485  FGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  306
            FG TGVKRL+ IGMI SVPGM ALDMN+AEDAIVRLTRE+VPGMIVTGMEVAEIDGAPRM
Sbjct  242  FGATGVKRLQDIGMIKSVPGMSALDMNSAEDAIVRLTREVVPGMIVTGMEVAEIDGAPRM  301

Query  305  GPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPELILXSAENEEIADA  147
            GPTFGAMM+SGQKAAHLAL++LG  NALDG  S+   PEL L SAE+ E+ DA
Sbjct  302  GPTFGAMMLSGQKAAHLALRSLGLDNALDG--SDNLQPELQLASAESSEVVDA  352



>gb|AHA84206.1| thiamin biosynthetic enzyme [Phaseolus vulgaris]
Length=348

 Score =   284 bits (726),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 140/162 (86%), Positives = 149/162 (92%), Gaps = 2/162 (1%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCGHDGP  486
            PNVKLF AVAAEDLIVK+G+VGGVVTNWALVSM  DTQSCMDPNVMEAK+VVSSCGHDGP
Sbjct  177  PNVKLFNAVAAEDLIVKDGKVGGVVTNWALVSMNHDTQSCMDPNVMEAKVVVSSCGHDGP  236

Query  485  FGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  306
            FG TGVKRLKSIGMID+VPGMKALDMN AEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM
Sbjct  237  FGATGVKRLKSIGMIDNVPGMKALDMNKAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  296

Query  305  GPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPELIL  180
            GPTFGAMMISGQKAAHLAL++LG PNAL+   +    PEL+L
Sbjct  297  GPTFGAMMISGQKAAHLALRSLGLPNALESVGN--VHPELVL  336



>ref|XP_010485129.1| PREDICTED: thiamine thiazole synthase, chloroplastic-like [Camelina 
sativa]
Length=548

 Score =   290 bits (742),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 141/173 (82%), Positives = 153/173 (88%), Gaps = 0/173 (0%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCGHDGP  486
            PNVKLF AVAAEDLIVK  RVGGVVTNWALV+   D+QSCMDPNVMEAKIVVSSCGHDGP
Sbjct  376  PNVKLFNAVAAEDLIVKGNRVGGVVTNWALVAQNHDSQSCMDPNVMEAKIVVSSCGHDGP  435

Query  485  FGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  306
            FG TGVKRL+SIGMID VPGMKALDMNTAEDAIVRLTRE+VPGMIVTGMEVAEIDG+PRM
Sbjct  436  FGATGVKRLRSIGMIDHVPGMKALDMNTAEDAIVRLTREVVPGMIVTGMEVAEIDGSPRM  495

Query  305  GPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPELILXSAENEEIADA  147
            GPTFGAMMISGQKA  LALKALG PNA+DG+     +PEL+L +A++ E  DA
Sbjct  496  GPTFGAMMISGQKAGQLALKALGLPNAIDGTLVGNLSPELVLAAADSAETVDA  548


 Score = 95.5 bits (236),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 57/107 (53%), Positives = 67/107 (63%), Gaps = 8/107 (7%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCGHDGP  486
            PNVKLF AVAAEDLIVK  RVGGVVTNWALV+   D+QSCMDPNVMEAKIVV S G    
Sbjct  178  PNVKLFNAVAAEDLIVKGNRVGGVVTNWALVAQNHDSQSCMDPNVMEAKIVVISIGLKPR  237

Query  485  FGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIV--RLTREIVPGMI  351
             G   V R  + G       + A   +  +++IV   +TR  +  MI
Sbjct  238  SGSVSV-RASTAGY-----DLNAFTFDPIKESIVSREMTRRYMTDMI  278



>gb|AFO59577.1| thiamine biosynthetic enzyme [Saccharum hybrid cultivar GT28]
Length=355

 Score =   284 bits (726),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 139/175 (79%), Positives = 154/175 (88%), Gaps = 2/175 (1%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCGHDGP  486
            PNVKLF AVA EDLIVK GRVGGVVTNWALVSM  DTQSCMDPNVMEAK+VVSSCGHDGP
Sbjct  181  PNVKLFNAVAVEDLIVKQGRVGGVVTNWALVSMNHDTQSCMDPNVMEAKVVVSSCGHDGP  240

Query  485  FGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  306
            FG TGVKRL+ IGMI +VPGMKALDMNTAED IVR TRE+VPGMIVTGMEVAEIDGAPRM
Sbjct  241  FGATGVKRLQDIGMISAVPGMKALDMNTAEDEIVRHTREVVPGMIVTGMEVAEIDGAPRM  300

Query  305  GPTFGAMMISGQKAAHLALKALGEPNALDGSASEV--AAPELILXSAENEEIADA  147
            GPTFGAMMISGQKAAHLAL+ALG PNA+DG+  +V  A  E  + +++++E+ DA
Sbjct  301  GPTFGAMMISGQKAAHLALQALGRPNAVDGTIPKVSPALREEFVIASKDDEVVDA  355



>gb|EYU19221.1| hypothetical protein MIMGU_mgv1a009132mg [Erythranthe guttata]
Length=352

 Score =   284 bits (726),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 143/173 (83%), Positives = 153/173 (88%), Gaps = 5/173 (3%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCGHDGP  486
            PNVKLF AVAAEDLIVK GRV GVVTNWALVSM  DTQSCMDPNVMEAK+VVSSCGHDGP
Sbjct  185  PNVKLFNAVAAEDLIVKGGRVAGVVTNWALVSMNHDTQSCMDPNVMEAKVVVSSCGHDGP  244

Query  485  FGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  306
            FG TGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM
Sbjct  245  FGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  304

Query  305  GPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPELILXSAENEEIADA  147
            GPTFGAMMISGQKAAH+AL++LG  N + GS      PE++L + ++ EI DA
Sbjct  305  GPTFGAMMISGQKAAHIALQSLGLANNV-GSIH----PEMVLAAVDDAEILDA  352



>ref|XP_010930933.1| PREDICTED: LOW QUALITY PROTEIN: thiamine thiazole synthase 1, 
chloroplastic-like [Elaeis guineensis]
Length=358

 Score =   284 bits (726),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 139/168 (83%), Positives = 152/168 (90%), Gaps = 1/168 (1%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCGHDGP  486
            PNVKLF A+AAEDLIVK GRVGGVVTNWALVSM  DTQSCMDPNV+EAK+VVSS GHDGP
Sbjct  184  PNVKLFNAMAAEDLIVKEGRVGGVVTNWALVSMNHDTQSCMDPNVVEAKVVVSSYGHDGP  243

Query  485  FGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  306
            FG TGVKRLK IGMIDSVPGMKA+DMN AEDAIVRLT+EIVPGMI+TGME AEIDGAPRM
Sbjct  244  FGATGVKRLKDIGMIDSVPGMKAVDMNAAEDAIVRLTKEIVPGMIITGMEDAEIDGAPRM  303

Query  305  GPTFGAMMISGQKAAHLALKALGEPNALDGS-ASEVAAPELILXSAEN  165
            GPTFGAMMISGQKAAHLALKALG PNALDG+  +E   PE++L S+++
Sbjct  304  GPTFGAMMISGQKAAHLALKALGRPNALDGTIGTEKVQPEMVLASSDD  351



>ref|XP_007021022.1| Thiazole biosynthetic enzyme, chloroplast (ARA6) (THI1) (THI4) 
[Theobroma cacao]
 gb|EOY12547.1| Thiazole biosynthetic enzyme, chloroplast (ARA6) (THI1) (THI4) 
[Theobroma cacao]
Length=358

 Score =   284 bits (726),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 150/173 (87%), Positives = 158/173 (91%), Gaps = 0/173 (0%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCGHDGP  486
            PNVKLF AVAAEDLIVK GRVGGVVTNWALVSM  DTQSCMDPNVMEAK+VVSSCGHDGP
Sbjct  186  PNVKLFNAVAAEDLIVKGGRVGGVVTNWALVSMNHDTQSCMDPNVMEAKVVVSSCGHDGP  245

Query  485  FGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  306
            FG TGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDG+PRM
Sbjct  246  FGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGSPRM  305

Query  305  GPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPELILXSAENEEIADA  147
            GPTFGAMMISGQKAAHLAL++LG PNALDG+      PELIL +A++ E ADA
Sbjct  306  GPTFGAMMISGQKAAHLALQSLGLPNALDGTYVGNIHPELILAAADSAETADA  358



>ref|XP_007132954.1| hypothetical protein PHAVU_011G139100g [Phaseolus vulgaris]
 gb|ESW04948.1| hypothetical protein PHAVU_011G139100g [Phaseolus vulgaris]
Length=348

 Score =   283 bits (723),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 139/162 (86%), Positives = 149/162 (92%), Gaps = 2/162 (1%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCGHDGP  486
            PNVKLF AVAAEDLIVK+G+VGGVVTNWALVSM  DTQSCMDPNVMEAK+VVSSCGHDGP
Sbjct  177  PNVKLFNAVAAEDLIVKDGKVGGVVTNWALVSMNHDTQSCMDPNVMEAKVVVSSCGHDGP  236

Query  485  FGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  306
            FG TGVKRLKSIG+ID+VPGMKALDMN AEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM
Sbjct  237  FGATGVKRLKSIGLIDNVPGMKALDMNKAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  296

Query  305  GPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPELIL  180
            GPTFGAMMISGQKAAHLAL++LG PNAL+   +    PEL+L
Sbjct  297  GPTFGAMMISGQKAAHLALRSLGLPNALESVGN--VHPELVL  336



>sp|Q38709.1|THI4_ALNGL RecName: Full=Thiamine thiazole synthase, chloroplastic; AltName: 
Full=Thiazole biosynthetic enzyme; Flags: Precursor [Alnus 
glutinosa]
 emb|CAA66064.1| thaizole biosynthetic enzmye [Alnus glutinosa]
Length=352

 Score =   282 bits (722),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 151/173 (87%), Positives = 157/173 (91%), Gaps = 0/173 (0%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCGHDGP  486
            PNVKLF AVAAEDLIVK GRVGGVVTNWALVSM  DTQSCMDPNVMEAK+VVSSCGHDGP
Sbjct  180  PNVKLFNAVAAEDLIVKGGRVGGVVTNWALVSMNHDTQSCMDPNVMEAKVVVSSCGHDGP  239

Query  485  FGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  306
            FG TGVK L+SIGMID+VPGMKALDMN AEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM
Sbjct  240  FGATGVKSLRSIGMIDTVPGMKALDMNVAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  299

Query  305  GPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPELILXSAENEEIADA  147
            GPTFGAMMISGQKAAHLALKALG PNALDGS      PELIL +A++ EIADA
Sbjct  300  GPTFGAMMISGQKAAHLALKALGLPNALDGSYVGGIHPELILAAADSAEIADA  352



>ref|NP_001275783.1| thiamine thiazole synthase, chloroplastic [Citrus sinensis]
 sp|O23787.1|THI4_CITSI RecName: Full=Thiamine thiazole synthase, chloroplastic; AltName: 
Full=Thiazole biosynthetic enzyme; Flags: Precursor [Citrus 
sinensis]
 emb|CAB05370.1| thi [Citrus sinensis]
Length=356

 Score =   282 bits (722),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 148/173 (86%), Positives = 158/173 (91%), Gaps = 0/173 (0%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCGHDGP  486
            PNVKLF AVAAEDLIVK GRVGGVVTNWALVSM  DTQSCMDPNVMEAK+VVSSCGHDGP
Sbjct  184  PNVKLFNAVAAEDLIVKGGRVGGVVTNWALVSMNHDTQSCMDPNVMEAKVVVSSCGHDGP  243

Query  485  FGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  306
            FG TGVKRLKSIGMI+ VPGMKALDMN+AEDAIVRLTRE+VPGMIVTGMEVAEIDGAPRM
Sbjct  244  FGATGVKRLKSIGMIEEVPGMKALDMNSAEDAIVRLTREVVPGMIVTGMEVAEIDGAPRM  303

Query  305  GPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPELILXSAENEEIADA  147
            GPTFGAMMISGQKAAHLALK+LG+PNALDG+      PELIL +A++ E ADA
Sbjct  304  GPTFGAMMISGQKAAHLALKSLGQPNALDGTYVGGVHPELILAAADSAETADA  356



>ref|XP_008366026.1| PREDICTED: LOW QUALITY PROTEIN: thiamine thiazole synthase, chloroplastic 
[Malus domestica]
Length=378

 Score =   283 bits (724),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 140/171 (82%), Positives = 149/171 (87%), Gaps = 0/171 (0%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCGHDGP  486
            PNVKLF AVAAEDLI+K GRVGGVVTNWALVSM  DTQSCMDPNVMEAK+VVSSCGHDGP
Sbjct  187  PNVKLFNAVAAEDLIIKGGRVGGVVTNWALVSMNHDTQSCMDPNVMEAKVVVSSCGHDGP  246

Query  485  FGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  306
             G TGVKRL+S+GMI+SVPGMKALDMN AEDAIV+LTREIVPGMIVTGMEVAEIDG+PRM
Sbjct  247  MGATGVKRLRSVGMIESVPGMKALDMNAAEDAIVKLTREIVPGMIVTGMEVAEIDGSPRM  306

Query  305  GPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPELILXSAENEEIA  153
            GPTFGAMMISGQKAAHLALKALG PNALD S         I X+  + EIA
Sbjct  307  GPTFGAMMISGQKAAHLALKALGXPNALDESYVGGXXXXXIJXAXXSAEIA  357



>gb|ACN66755.1| thiazole biosynthetic enzyme [Carica papaya]
Length=192

 Score =   275 bits (703),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 146/173 (84%), Positives = 156/173 (90%), Gaps = 0/173 (0%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCGHDGP  486
            PNVKLF AVAAEDLIVK GRVGGVVTNWALVSM  DTQSCMDPNVMEAK+VVSSCGHDGP
Sbjct  20   PNVKLFNAVAAEDLIVKGGRVGGVVTNWALVSMNHDTQSCMDPNVMEAKVVVSSCGHDGP  79

Query  485  FGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  306
            FG TGVKRLKSIGMID+VPGMKALDMN AEDAIVRL REIVPGMIVTGMEVAEIDGAPRM
Sbjct  80   FGATGVKRLKSIGMIDNVPGMKALDMNVAEDAIVRLAREIVPGMIVTGMEVAEIDGAPRM  139

Query  305  GPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPELILXSAENEEIADA  147
            GPTFGAMMISGQKAAHLALK+LG PNA+DG+ +    PEL+L + E+ E A+A
Sbjct  140  GPTFGAMMISGQKAAHLALKSLGLPNAVDGTYAGGLHPELVLAAGESAETAEA  192



>gb|EPS63028.1| thiazole biosynthetic enzyme, chloroplastic, partial [Genlisea 
aurea]
Length=291

 Score =   279 bits (713),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 137/161 (85%), Positives = 145/161 (90%), Gaps = 0/161 (0%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCGHDGP  486
            PNVKLF AVAAEDLIVK  RV GVVTNWALVSM  DTQSCMDPNVMEAKIVVSSCGHDGP
Sbjct  129  PNVKLFNAVAAEDLIVKGDRVAGVVTNWALVSMNHDTQSCMDPNVMEAKIVVSSCGHDGP  188

Query  485  FGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  306
            FG TGVKRLKSIGMI +VPGMKALDMN AEDAIVRLTRE+VPGMIVTGMEVAEIDGAPRM
Sbjct  189  FGATGVKRLKSIGMIQNVPGMKALDMNQAEDAIVRLTREVVPGMIVTGMEVAEIDGAPRM  248

Query  305  GPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPELI  183
            GPTFGAM+ISGQKAAHLALK+L  PNA+D + S +  PEL+
Sbjct  249  GPTFGAMIISGQKAAHLALKSLNLPNAIDQNHSPLPFPELV  289



>ref|XP_010670808.1| PREDICTED: thiamine thiazole synthase 2, chloroplastic-like [Beta 
vulgaris subsp. vulgaris]
Length=352

 Score =   281 bits (718),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 139/173 (80%), Positives = 150/173 (87%), Gaps = 2/173 (1%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCGHDGP  486
            PNVKLF AVAAEDLIVK GRV GVVTNWALVSM  +TQSCMDPNVMEAK+VVSSCGHDGP
Sbjct  182  PNVKLFNAVAAEDLIVKEGRVAGVVTNWALVSMNHNTQSCMDPNVMEAKVVVSSCGHDGP  241

Query  485  FGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  306
            FG TGVKRL+ IGMI SVPGM ALDMN+AEDAIVRLTRE+VPGMIVTGMEVAEIDGAPRM
Sbjct  242  FGATGVKRLQDIGMIKSVPGMSALDMNSAEDAIVRLTREVVPGMIVTGMEVAEIDGAPRM  301

Query  305  GPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPELILXSAENEEIADA  147
            GPTFGAMM+SGQKAAHLAL++ G  NALD   S+   PEL L S E+ E+ DA
Sbjct  302  GPTFGAMMLSGQKAAHLALRSFGLDNALD--RSDNLQPELQLASVEDAEVVDA  352



>ref|XP_007213805.1| hypothetical protein PRUPE_ppa007657mg [Prunus persica]
 gb|EMJ15004.1| hypothetical protein PRUPE_ppa007657mg [Prunus persica]
Length=360

 Score =   281 bits (718),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 148/173 (86%), Positives = 158/173 (91%), Gaps = 0/173 (0%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCGHDGP  486
            PNVKLF AVAAEDLIVK GRVGGVVTNWALVSM  DTQSCMDPNVMEAK+VVSSCGHDGP
Sbjct  188  PNVKLFNAVAAEDLIVKGGRVGGVVTNWALVSMNHDTQSCMDPNVMEAKVVVSSCGHDGP  247

Query  485  FGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  306
             G TGVKRL+SIGMI+SVPGMKALDMNTAEDAIV+LTREIVPGMIVTGMEVAEIDG+PRM
Sbjct  248  MGATGVKRLRSIGMIESVPGMKALDMNTAEDAIVKLTREIVPGMIVTGMEVAEIDGSPRM  307

Query  305  GPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPELILXSAENEEIADA  147
            GPTFGAMMISGQKAAHLALK+LG PNALDGS      PELIL +A++ EIA+A
Sbjct  308  GPTFGAMMISGQKAAHLALKSLGLPNALDGSYVGSIQPELILAAADSAEIAEA  360



>gb|KDO52968.1| hypothetical protein CISIN_1g018414mg [Citrus sinensis]
Length=356

 Score =   281 bits (718),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 147/172 (85%), Positives = 157/172 (91%), Gaps = 0/172 (0%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCGHDGP  486
            PNVKLF AVAAEDLIVK GRVGGVVTNWALVSM  DTQSCMDPNVMEAK+VVSSCGHDGP
Sbjct  184  PNVKLFNAVAAEDLIVKGGRVGGVVTNWALVSMNHDTQSCMDPNVMEAKVVVSSCGHDGP  243

Query  485  FGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  306
            FG TGVKRLKSIGMI+ VPGMKALDMN+AEDAIVRLTRE+VPGMIVTGMEVAEIDGAPRM
Sbjct  244  FGATGVKRLKSIGMIEEVPGMKALDMNSAEDAIVRLTREVVPGMIVTGMEVAEIDGAPRM  303

Query  305  GPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPELILXSAENEEIAD  150
            GPTFGAMMISGQKAAHLALK+LG+PNALDG+      PELIL +A++ E AD
Sbjct  304  GPTFGAMMISGQKAAHLALKSLGQPNALDGTYVGGVHPELILAAADSAETAD  355



>ref|XP_006452193.1| hypothetical protein CICLE_v10008765mg [Citrus clementina]
 gb|ESR65433.1| hypothetical protein CICLE_v10008765mg [Citrus clementina]
Length=356

 Score =   280 bits (717),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 147/173 (85%), Positives = 157/173 (91%), Gaps = 0/173 (0%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCGHDGP  486
            PNVKLF AVAAEDLIVK GRVGGVVTNWALVSM  DTQSCMDPNVMEAK+VVSSCGHDGP
Sbjct  184  PNVKLFNAVAAEDLIVKGGRVGGVVTNWALVSMNHDTQSCMDPNVMEAKVVVSSCGHDGP  243

Query  485  FGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  306
            FG TGVKRLKSIGMI+ VPGMKALDMN+AEDAIVRLTRE+VPGMIVTGMEVAEIDGAPRM
Sbjct  244  FGATGVKRLKSIGMIEEVPGMKALDMNSAEDAIVRLTREVVPGMIVTGMEVAEIDGAPRM  303

Query  305  GPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPELILXSAENEEIADA  147
            GPTFGAMMISGQKAAHLAL +LG+PNALDG+      PELIL +A++ E ADA
Sbjct  304  GPTFGAMMISGQKAAHLALNSLGQPNALDGTYVGGVHPELILAAADSAETADA  356



>ref|XP_001767495.1| predicted protein [Physcomitrella patens]
 sp|A9SMC8.1|THI44_PHYPA RecName: Full=Thiamine thiazole synthase 4, chloroplastic; AltName: 
Full=Thiazole biosynthetic enzyme 4; Flags: Precursor 
[Physcomitrella patens]
 gb|EDQ67630.1| predicted protein [Physcomitrella patens]
Length=343

 Score =   278 bits (711),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 133/168 (79%), Positives = 147/168 (88%), Gaps = 0/168 (0%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCGHDGP  486
            PNVKLF AVAAEDLI++  RV GVVTNWALV+   +TQSCMDPNVMEAK+VVSSCGHDGP
Sbjct  172  PNVKLFNAVAAEDLIIRGDRVSGVVTNWALVAQNHNTQSCMDPNVMEAKVVVSSCGHDGP  231

Query  485  FGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  306
            FG TGVKRL+SIGMI+SVPGMK LDMN AEDAIV+ TRE+VPGMIVTGMEVAEIDG+PRM
Sbjct  232  FGATGVKRLRSIGMIESVPGMKCLDMNAAEDAIVKHTREVVPGMIVTGMEVAEIDGSPRM  291

Query  305  GPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPELILXSAENE  162
            GPTFGAMMISGQKAAHLALKALG PN LDG+      PEL+L S ++E
Sbjct  292  GPTFGAMMISGQKAAHLALKALGLPNELDGNYKLNVHPELVLASTDDE  339



>pdb|1RP0|A Chain A, Crystal Structure Of Thi1 Protein From Arabidopsis Thaliana
 pdb|1RP0|B Chain B, Crystal Structure Of Thi1 Protein From Arabidopsis Thaliana
Length=284

 Score =   276 bits (705),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 135/151 (89%), Positives = 139/151 (92%), Gaps = 0/151 (0%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCGHDGP  486
            PNVKLF AVAAEDLIVK  RVGGVVTNWALV+    TQSCMDPNVMEAKIVVSSCGHDGP
Sbjct  133  PNVKLFNAVAAEDLIVKGNRVGGVVTNWALVAQNHHTQSCMDPNVMEAKIVVSSCGHDGP  192

Query  485  FGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  306
            FG TGVKRLKSIGMID VPGMKALDMNTAEDAIVRLTRE+VPGMIVTGMEVAEIDGAPRM
Sbjct  193  FGATGVKRLKSIGMIDHVPGMKALDMNTAEDAIVRLTREVVPGMIVTGMEVAEIDGAPRM  252

Query  305  GPTFGAMMISGQKAAHLALKALGEPNALDGS  213
            GPTFGAMMISGQKA  LALKALG PNA+DG+
Sbjct  253  GPTFGAMMISGQKAGQLALKALGLPNAIDGT  283



>ref|XP_001753819.1| predicted protein [Physcomitrella patens]
 sp|A9RHX1.1|THI41_PHYPA RecName: Full=Thiamine thiazole synthase 1, chloroplastic; AltName: 
Full=Thiazole biosynthetic enzyme 1; Flags: Precursor 
[Physcomitrella patens]
 gb|EDQ81571.1| predicted protein [Physcomitrella patens]
Length=357

 Score =   278 bits (711),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 133/168 (79%), Positives = 147/168 (88%), Gaps = 0/168 (0%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCGHDGP  486
            PNVKLF AVAAEDLI++  RV GVVTNWALV+   +TQSCMDPNVMEAK+VVSSCGHDGP
Sbjct  186  PNVKLFNAVAAEDLIIRGDRVSGVVTNWALVAQNHNTQSCMDPNVMEAKVVVSSCGHDGP  245

Query  485  FGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  306
            FG TGVKRL+SIGMI+SVPGMK LDMN AEDAIV+ TRE+VPGMIVTGMEVAEIDG+PRM
Sbjct  246  FGATGVKRLRSIGMIESVPGMKCLDMNAAEDAIVKHTREVVPGMIVTGMEVAEIDGSPRM  305

Query  305  GPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPELILXSAENE  162
            GPTFGAMMISGQKAAHLALKALG PN LDG+      PEL+L S ++E
Sbjct  306  GPTFGAMMISGQKAAHLALKALGLPNELDGNYKPNVHPELVLASTDDE  353



>ref|XP_001767548.1| predicted protein [Physcomitrella patens]
 sp|A9SME1.1|THI42_PHYPA RecName: Full=Thiamine thiazole synthase 2, chloroplastic; AltName: 
Full=Thiazole biosynthetic enzyme 2; Flags: Precursor 
[Physcomitrella patens]
 gb|EDQ67683.1| predicted protein [Physcomitrella patens]
Length=356

 Score =   278 bits (710),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 133/168 (79%), Positives = 147/168 (88%), Gaps = 0/168 (0%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCGHDGP  486
            PNVKLF AVAAEDLI++  RV GVVTNWALV+   +TQSCMDPNVMEAK+VVSSCGHDGP
Sbjct  185  PNVKLFNAVAAEDLIIRGDRVSGVVTNWALVAQNHNTQSCMDPNVMEAKVVVSSCGHDGP  244

Query  485  FGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  306
            FG TGVKRL+SIGMI+SVPGMK LDMN AEDAIV+ TRE+VPGMIVTGMEVAEIDG+PRM
Sbjct  245  FGATGVKRLRSIGMIESVPGMKCLDMNAAEDAIVKHTREVVPGMIVTGMEVAEIDGSPRM  304

Query  305  GPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPELILXSAENE  162
            GPTFGAMMISGQKAAHLALKALG PN LDG+      PEL+L S ++E
Sbjct  305  GPTFGAMMISGQKAAHLALKALGLPNELDGNYKPNVHPELVLASTDDE  352



>ref|XP_008244366.1| PREDICTED: thiamine thiazole synthase, chloroplastic [Prunus 
mume]
Length=360

 Score =   277 bits (708),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 147/173 (85%), Positives = 156/173 (90%), Gaps = 0/173 (0%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCGHDGP  486
            PNVKLF AVAAEDLIVK GRVGGVVTNWALVSM  DTQSCMDPNVMEAK+VVSSCGHDGP
Sbjct  188  PNVKLFNAVAAEDLIVKGGRVGGVVTNWALVSMNHDTQSCMDPNVMEAKVVVSSCGHDGP  247

Query  485  FGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  306
             G TGVKRL+SIGMI+SVPGMKALDMN AEDAIV LTREIVPGMIVTGMEVAEIDG+PRM
Sbjct  248  MGATGVKRLRSIGMIESVPGMKALDMNAAEDAIVELTREIVPGMIVTGMEVAEIDGSPRM  307

Query  305  GPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPELILXSAENEEIADA  147
            GPTFGAMMISGQKAAHLALK+LG PNALDGS      PELIL +A++ EIA+A
Sbjct  308  GPTFGAMMISGQKAAHLALKSLGLPNALDGSYVGSIQPELILAAADSAEIAEA  360



>ref|XP_001755171.1| predicted protein [Physcomitrella patens]
 gb|EDQ80115.1| predicted protein [Physcomitrella patens]
Length=358

 Score =   275 bits (704),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 132/167 (79%), Positives = 146/167 (87%), Gaps = 0/167 (0%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCGHDGP  486
            PNVKLF AVAAEDLI++  RV GVVTNWALV+   +TQSCMDPNVMEAK+VVSSCGHDGP
Sbjct  187  PNVKLFNAVAAEDLIIRGDRVSGVVTNWALVAQNHNTQSCMDPNVMEAKVVVSSCGHDGP  246

Query  485  FGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  306
            FG TGVKRL+SIGMI+SVPGMK LDMN AEDAIV+ TREIVPGMIVTGMEVAEIDG+PRM
Sbjct  247  FGATGVKRLRSIGMIESVPGMKCLDMNAAEDAIVKHTREIVPGMIVTGMEVAEIDGSPRM  306

Query  305  GPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPELILXSAEN  165
            GPTFGAMMISGQKAAHLALKALG PN +DG+      PEL+L S ++
Sbjct  307  GPTFGAMMISGQKAAHLALKALGLPNEVDGNYKPNVHPELVLASTDD  353



>ref|XP_001753698.1| predicted protein [Physcomitrella patens]
 ref|XP_001753700.1| predicted protein [Physcomitrella patens]
 sp|A9RHW6.1|THI43_PHYPA RecName: Full=Thiamine thiazole synthase 3, chloroplastic; AltName: 
Full=Thiazole biosynthetic enzyme 3; Flags: Precursor 
[Physcomitrella patens]
 gb|EDQ81450.1| predicted protein [Physcomitrella patens]
 gb|EDQ81452.1| predicted protein [Physcomitrella patens]
Length=357

 Score =   273 bits (699),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 130/167 (78%), Positives = 146/167 (87%), Gaps = 0/167 (0%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCGHDGP  486
            PNVKLF AVAAEDLI++  RV GVVTNWALV+   +TQSCMDPNVMEAK+VVSSCGHDGP
Sbjct  186  PNVKLFNAVAAEDLIIRGDRVSGVVTNWALVAQNHNTQSCMDPNVMEAKVVVSSCGHDGP  245

Query  485  FGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  306
            FG TGVKRL+SIGMI+SVPGMK LDMN AEDAIV+ TRE+VPGMIVTGMEVAEIDG+PRM
Sbjct  246  FGATGVKRLRSIGMIESVPGMKCLDMNAAEDAIVKHTREVVPGMIVTGMEVAEIDGSPRM  305

Query  305  GPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPELILXSAEN  165
            GPTFGAMMISGQKAAHLAL+ALG PN +DG+      PEL+L S ++
Sbjct  306  GPTFGAMMISGQKAAHLALRALGLPNEVDGNYKPNVHPELVLASTDD  352



>emb|CCJ09780.1| putative thiazole biosynthetic enzyme, partial [Hirudo medicinalis]
Length=242

 Score =   269 bits (687),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 145/174 (83%), Positives = 154/174 (89%), Gaps = 1/174 (1%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCGHDGP  486
            PNVKLF  VAAEDLIVK GRVGGVVTNWALVSM  DTQSCMDPNVMEAK+VVSSCGHDGP
Sbjct  69   PNVKLFNTVAAEDLIVKGGRVGGVVTNWALVSMNHDTQSCMDPNVMEAKVVVSSCGHDGP  128

Query  485  FGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  306
            FG TGVKRLKSIGMID+VPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM
Sbjct  129  FGATGVKRLKSIGMIDNVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  188

Query  305  GPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPELILXSAEN-EEIADA  147
            GPTFGAMMISGQKAAHLAL+ LG PN LDG+      P+L L +A++  EI +A
Sbjct  189  GPTFGAMMISGQKAAHLALRTLGLPNELDGTNVGNVQPKLTLAAADDGNEIVEA  242



>gb|ACF85034.1| unknown [Zea mays]
Length=307

 Score =   266 bits (680),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 140/173 (81%), Positives = 154/173 (89%), Gaps = 1/173 (1%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCGHDGP  486
            PNVKLF AVA EDLIV+ GRVGGVVTNWALVSM  DTQSCMDPNVMEAK+VVSSCGHDGP
Sbjct  136  PNVKLFNAVAVEDLIVRGGRVGGVVTNWALVSMNHDTQSCMDPNVMEAKVVVSSCGHDGP  195

Query  485  FGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  306
            FG TGVKRL+ IGMI +VPGMKALDMNTAED IVRLTRE+VPGMIVTGMEVAEIDGAPRM
Sbjct  196  FGATGVKRLQDIGMISAVPGMKALDMNTAEDEIVRLTREVVPGMIVTGMEVAEIDGAPRM  255

Query  305  GPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPELILXSAENEEIADA  147
            GPTFGAMMISGQKAAHLALKALG PNA+DG+ S     EL++ + +++E+ DA
Sbjct  256  GPTFGAMMISGQKAAHLALKALGRPNAVDGTMSPPLREELMI-AYKDDEVVDA  307



>gb|AHN11672.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11673.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11675.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11676.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11682.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11683.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11684.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11686.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11687.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11694.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11695.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11698.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11699.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11706.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11707.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11710.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11712.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11717.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11718.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11719.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11720.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11721.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11722.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11730.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11731.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11732.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11734.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11740.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11742.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11743.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11744.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11749.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11751.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11752.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11756.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
Length=142

 Score =   260 bits (664),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 127/136 (93%), Positives = 131/136 (96%), Gaps = 0/136 (0%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCGHDGP  486
            PNVKLF AVAAEDLIVK+G+VGGVVTNWALVSM  DTQSCMDPNVMEAK+VVSSCGHDGP
Sbjct  7    PNVKLFNAVAAEDLIVKDGKVGGVVTNWALVSMNHDTQSCMDPNVMEAKVVVSSCGHDGP  66

Query  485  FGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  306
            FG TGVKRLKSIGMID+VPGMKALDMN AEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM
Sbjct  67   FGATGVKRLKSIGMIDNVPGMKALDMNKAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  126

Query  305  GPTFGAMMISGQKAAH  258
            GPTFGAMMISGQKAAH
Sbjct  127  GPTFGAMMISGQKAAH  142



>ref|NP_001105696.1| thiamine thiazole synthase 1, chloroplastic precursor [Zea mays]
 sp|Q41738.1|THI41_MAIZE RecName: Full=Thiamine thiazole synthase 1, chloroplastic; AltName: 
Full=Thiazole biosynthetic enzyme 1; Flags: Precursor 
[Zea mays]
 gb|AAA96738.1| thiamine biosynthetic enzyme [Zea mays]
 gb|ACF86401.1| unknown [Zea mays]
 gb|AFW83048.1| thiazole biosynthetic enzyme 1-1, Precursor [Zea mays]
Length=354

 Score =   266 bits (680),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 140/173 (81%), Positives = 154/173 (89%), Gaps = 1/173 (1%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCGHDGP  486
            PNVKLF AVA EDLIV+ GRVGGVVTNWALVSM  DTQSCMDPNVMEAK+VVSSCGHDGP
Sbjct  183  PNVKLFNAVAVEDLIVRGGRVGGVVTNWALVSMNHDTQSCMDPNVMEAKVVVSSCGHDGP  242

Query  485  FGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  306
            FG TGVKRL+ IGMI +VPGMKALDMNTAED IVRLTRE+VPGMIVTGMEVAEIDGAPRM
Sbjct  243  FGATGVKRLQDIGMISAVPGMKALDMNTAEDEIVRLTREVVPGMIVTGMEVAEIDGAPRM  302

Query  305  GPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPELILXSAENEEIADA  147
            GPTFGAMMISGQKAAHLALKALG PNA+DG+ S     EL++ + +++E+ DA
Sbjct  303  GPTFGAMMISGQKAAHLALKALGRPNAVDGTMSPPLREELMI-AYKDDEVVDA  354



>gb|AHN11665.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11666.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11667.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11668.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11669.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11670.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11671.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11674.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11677.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11678.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11679.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11680.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11681.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11685.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11688.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11689.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11690.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11692.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11693.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11696.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11697.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11700.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11701.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11702.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11703.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11704.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11705.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11709.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11711.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11713.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11714.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11715.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11716.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11723.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11724.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11725.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11726.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11727.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11728.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11729.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11733.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11735.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11736.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11737.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11738.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11739.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11741.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11745.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11746.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11747.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11748.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11750.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11753.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11754.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11755.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11757.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
Length=142

 Score =   259 bits (661),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 126/136 (93%), Positives = 131/136 (96%), Gaps = 0/136 (0%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCGHDGP  486
            PNVKLF AVAAEDLIVK+G+VGGVVTNWALVSM  DTQSCMDPNVMEAK+VVSSCGHDGP
Sbjct  7    PNVKLFNAVAAEDLIVKDGKVGGVVTNWALVSMNHDTQSCMDPNVMEAKVVVSSCGHDGP  66

Query  485  FGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  306
            FG TGVKRLKSIG+ID+VPGMKALDMN AEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM
Sbjct  67   FGATGVKRLKSIGLIDNVPGMKALDMNKAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  126

Query  305  GPTFGAMMISGQKAAH  258
            GPTFGAMMISGQKAAH
Sbjct  127  GPTFGAMMISGQKAAH  142



>gb|AAZ93636.1| pathogen-induced defense-responsive protein 8 [Oryza sativa Indica 
Group]
Length=352

 Score =   266 bits (680),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 137/177 (77%), Positives = 147/177 (83%), Gaps = 4/177 (2%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCGHDGP  486
            PNVKLF AVA EDLIVK GRVG VVTN        DTQ  MDPNVME K+VVSSCGHDGP
Sbjct  176  PNVKLFNAVAVEDLIVKKGRVGRVVTNLGACVNDHDTQPGMDPNVMEFKVVVSSCGHDGP  235

Query  485  FGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  306
            FG TGVKRL+ IGMID+VPGM+ALDMNTAED IVRLTRE+VPGMIVTGMEVAEIDGAPRM
Sbjct  236  FGATGVKRLQDIGMIDAVPGMRALDMNTAEDEIVRLTREVVPGMIVTGMEVAEIDGAPRM  295

Query  305  GPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAA----PELILXSAENEEIADA  147
            GPTFGAMMISGQKAAHLALKALG PNA+DG+  + AA    PELIL S ++ EI DA
Sbjct  296  GPTFGAMMISGQKAAHLALKALGRPNAIDGTIKKAAAAAAHPELILASKDDGEIVDA  352



>gb|KDO47270.1| hypothetical protein CISIN_1g039605mg [Citrus sinensis]
Length=352

 Score =   266 bits (680),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 132/173 (76%), Positives = 144/173 (83%), Gaps = 12/173 (7%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCGHDGP  486
            PNVKLF AVAAEDLIVK  RVGG+VTNWALVSM  D+QSCMDPNVMEAK+VVSSCGHDGP
Sbjct  192  PNVKLFNAVAAEDLIVKGNRVGGIVTNWALVSMNHDSQSCMDPNVMEAKVVVSSCGHDGP  251

Query  485  FGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  306
            FG TGV+            GMKALDMNTAEDAIV+LTREIVPGMIV GMEVAEIDGAPRM
Sbjct  252  FGATGVR------------GMKALDMNTAEDAIVKLTREIVPGMIVAGMEVAEIDGAPRM  299

Query  305  GPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPELILXSAENEEIADA  147
            GPTFGAMMISGQKAAHLALK+LG+PNA+DG+      PEL+L ++   EIADA
Sbjct  300  GPTFGAMMISGQKAAHLALKSLGQPNAMDGTYVGSIHPELVLAASSPAEIADA  352



>gb|ACF87708.1| unknown [Zea mays]
 gb|ACN36053.1| unknown [Zea mays]
 tpg|DAA58589.1| TPA: thiazole biosynthetic enzyme 1-2, Precursor [Zea mays]
Length=355

 Score =   266 bits (679),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 140/175 (80%), Positives = 154/175 (88%), Gaps = 2/175 (1%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCGHDGP  486
            PNVKLF AVA EDLIV+ GRVGGVVTNWALVSM  DTQSCMDPNVMEAK+VVSSCGHDGP
Sbjct  181  PNVKLFNAVAVEDLIVRRGRVGGVVTNWALVSMNHDTQSCMDPNVMEAKVVVSSCGHDGP  240

Query  485  FGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  306
            FG TGVKRL+ IGMI +VPGMKALDMN AED IVRLTRE+VPGMIVTGMEVAEIDGAPRM
Sbjct  241  FGATGVKRLQDIGMISAVPGMKALDMNAAEDEIVRLTREVVPGMIVTGMEVAEIDGAPRM  300

Query  305  GPTFGAMMISGQKAAHLALKALGEPNALDGSASEV--AAPELILXSAENEEIADA  147
            GPTFGAMMISGQKAAHLALKALG PNA+DG+  EV  A  E  + +++++E+ DA
Sbjct  301  GPTFGAMMISGQKAAHLALKALGRPNAVDGTIPEVSPALREEFVIASKDDEVVDA  355



>ref|NP_001105697.1| thiamine thiazole synthase 2, chloroplastic precursor [Zea mays]
 sp|Q41739.1|THI42_MAIZE RecName: Full=Thiamine thiazole synthase 2, chloroplastic; AltName: 
Full=Thiazole biosynthetic enzyme 2; Flags: Precursor 
[Zea mays]
 gb|AAA96739.1| thiamine biosynthetic enzyme [Zea mays]
Length=354

 Score =   266 bits (679),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 140/175 (80%), Positives = 154/175 (88%), Gaps = 2/175 (1%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCGHDGP  486
            PNVKLF AVA EDLIV+ GRVGGVVTNWALVSM  DTQSCMDPNVMEAK+VVSSCGHDGP
Sbjct  180  PNVKLFNAVAVEDLIVRRGRVGGVVTNWALVSMNHDTQSCMDPNVMEAKVVVSSCGHDGP  239

Query  485  FGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  306
            FG TGVKRL+ IGMI +VPGMKALDMN AED IVRLTRE+VPGMIVTGMEVAEIDGAPRM
Sbjct  240  FGATGVKRLQDIGMISAVPGMKALDMNAAEDEIVRLTREVVPGMIVTGMEVAEIDGAPRM  299

Query  305  GPTFGAMMISGQKAAHLALKALGEPNALDGSASEV--AAPELILXSAENEEIADA  147
            GPTFGAMMISGQKAAHLALKALG PNA+DG+  EV  A  E  + +++++E+ DA
Sbjct  300  GPTFGAMMISGQKAAHLALKALGRPNAVDGTIPEVSPALREEFVIASKDDEVVDA  354



>ref|XP_006441062.1| hypothetical protein CICLE_v10024231mg [Citrus clementina]
 gb|ESR54302.1| hypothetical protein CICLE_v10024231mg [Citrus clementina]
Length=353

 Score =   266 bits (679),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 133/173 (77%), Positives = 144/173 (83%), Gaps = 11/173 (6%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCGHDGP  486
            PNVKLF AVAAEDLIVK  RVGG+VTNWALVSM  D+QSCMDPNVMEAK+VVSSCGHDGP
Sbjct  192  PNVKLFNAVAAEDLIVKGNRVGGIVTNWALVSMNHDSQSCMDPNVMEAKVVVSSCGHDGP  251

Query  485  FGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  306
            FG TG           SVPGMKALDMNTAEDAIV+LTREIVPGMIV GMEVAEIDGA RM
Sbjct  252  FGATG-----------SVPGMKALDMNTAEDAIVKLTREIVPGMIVAGMEVAEIDGALRM  300

Query  305  GPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPELILXSAENEEIADA  147
            GPTFGAMMISGQKAAHLALK+LG+PNA+DG+      PEL+L ++   EIADA
Sbjct  301  GPTFGAMMISGQKAAHLALKSLGQPNAMDGTYVGSIHPELVLAASSPAEIADA  353



>ref|XP_002458014.1| hypothetical protein SORBIDRAFT_03g025520 [Sorghum bicolor]
 sp|C5XNN6.1|THI41_SORBI RecName: Full=Thiamine thiazole synthase 1, chloroplastic; AltName: 
Full=Thiazole biosynthetic enzyme 1; Flags: Precursor 
[Sorghum bicolor]
 gb|EES03134.1| hypothetical protein SORBIDRAFT_03g025520 [Sorghum bicolor]
Length=354

 Score =   266 bits (679),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 141/175 (81%), Positives = 155/175 (89%), Gaps = 2/175 (1%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCGHDGP  486
            PNVKLF AVA EDLIVK GRVGGVVTNWALVSM  DTQSCMDPNVMEAK+VVSSCGHDGP
Sbjct  180  PNVKLFNAVAVEDLIVKGGRVGGVVTNWALVSMNHDTQSCMDPNVMEAKVVVSSCGHDGP  239

Query  485  FGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  306
            FG TGVKRL+ IGMI +VPGMKALDMN AEDAIVRLTRE+VPGMIVTGMEVAEIDGAPRM
Sbjct  240  FGATGVKRLQDIGMIAAVPGMKALDMNAAEDAIVRLTREVVPGMIVTGMEVAEIDGAPRM  299

Query  305  GPTFGAMMISGQKAAHLALKALGEPNALDGSASEV--AAPELILXSAENEEIADA  147
            GPTFGAMMISGQKAAHLALKALG PNA+DG+  +V  A  E  + +++++E+ DA
Sbjct  300  GPTFGAMMISGQKAAHLALKALGRPNAVDGTIPKVSPALREEFVIASKDDEVVDA  354



>ref|XP_002463222.1| hypothetical protein SORBIDRAFT_02g040060 [Sorghum bicolor]
 sp|C5X2M4.1|THI42_SORBI RecName: Full=Thiamine thiazole synthase 2, chloroplastic; AltName: 
Full=Thiazole biosynthetic enzyme 2; Flags: Precursor 
[Sorghum bicolor]
 gb|EER99743.1| hypothetical protein SORBIDRAFT_02g040060 [Sorghum bicolor]
Length=352

 Score =   265 bits (678),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 141/176 (80%), Positives = 155/176 (88%), Gaps = 4/176 (2%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCGHDGP  486
            PNVKLF AVA EDLIVK GRVGGVVTNWALVSM  DTQSCMDPNVMEAK+VVSSCGHDGP
Sbjct  178  PNVKLFNAVAVEDLIVKGGRVGGVVTNWALVSMNHDTQSCMDPNVMEAKVVVSSCGHDGP  237

Query  485  FGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  306
            FG TGVKRL+ IGMI  VPGMKALDMNTAED IVRLTRE+VPGMIVTGMEVAEIDGAPRM
Sbjct  238  FGATGVKRLQDIGMISDVPGMKALDMNTAEDEIVRLTREVVPGMIVTGMEVAEIDGAPRM  297

Query  305  GPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPEL---ILXSAENEEIADA  147
            GPTFGAMMISGQKAAHLALKALG PNA+DG+  +V +P L    + +++++E+ DA
Sbjct  298  GPTFGAMMISGQKAAHLALKALGRPNAVDGTI-KVVSPALRQEFVIASKDDEVVDA  352



>gb|AHN11691.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
Length=142

 Score =   257 bits (656),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 125/136 (92%), Positives = 130/136 (96%), Gaps = 0/136 (0%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCGHDGP  486
            PNVKLF AVAAEDLIVK+G+VGGVVTNWALVSM  DTQSCMDPNVMEAK+VVSSCGHDGP
Sbjct  7    PNVKLFNAVAAEDLIVKDGKVGGVVTNWALVSMNHDTQSCMDPNVMEAKVVVSSCGHDGP  66

Query  485  FGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  306
            FG TGVKRLKSIG+ID+VPGMKALDMN AEDAIVRLTREIVPGMIVTGMEVAEIDG PRM
Sbjct  67   FGATGVKRLKSIGLIDNVPGMKALDMNKAEDAIVRLTREIVPGMIVTGMEVAEIDGGPRM  126

Query  305  GPTFGAMMISGQKAAH  258
            GPTFGAMMISGQKAAH
Sbjct  127  GPTFGAMMISGQKAAH  142



>gb|AGZ80417.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AGZ80423.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AGZ80424.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AGZ80426.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AGZ80427.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AGZ80429.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AGZ80430.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
Length=145

 Score =   256 bits (655),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 126/135 (93%), Positives = 130/135 (96%), Gaps = 0/135 (0%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCGHDGP  486
            PNVKLF AVAAEDLIVK+G+VGGVVTNWALVSM  DTQSCMDPNVMEAK+VVSSCGHDGP
Sbjct  11   PNVKLFNAVAAEDLIVKDGKVGGVVTNWALVSMNHDTQSCMDPNVMEAKVVVSSCGHDGP  70

Query  485  FGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  306
            FG TGVKRLKSIGMID+VPGMKALDMN AEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM
Sbjct  71   FGATGVKRLKSIGMIDNVPGMKALDMNKAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  130

Query  305  GPTFGAMMISGQKAA  261
            GPTFGAMMISGQKAA
Sbjct  131  GPTFGAMMISGQKAA  145



>ref|XP_004152916.1| PREDICTED: thiamine thiazole synthase, chloroplastic-like [Cucumis 
sativus]
 ref|XP_004172748.1| PREDICTED: thiamine thiazole synthase, chloroplastic-like [Cucumis 
sativus]
 gb|KGN56149.1| hypothetical protein Csa_3G078800 [Cucumis sativus]
Length=359

 Score =   263 bits (672),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 136/148 (92%), Positives = 141/148 (95%), Gaps = 0/148 (0%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCGHDGP  486
            PNVKLF AVAAEDLIVK GRVGGVVTNWALVSM  DTQSCMDPNVMEAK+VVSSCGHDGP
Sbjct  181  PNVKLFNAVAAEDLIVKGGRVGGVVTNWALVSMNHDTQSCMDPNVMEAKVVVSSCGHDGP  240

Query  485  FGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  306
            FG TGVKRLKSIGMIDSVPGMKALDMNTAEDAIVR TRE+VPGMIVTGMEVAEIDGAPRM
Sbjct  241  FGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRFTREVVPGMIVTGMEVAEIDGAPRM  300

Query  305  GPTFGAMMISGQKAAHLALKALGEPNAL  222
            GPTFGAMMISGQKAAHLALK+LGE N++
Sbjct  301  GPTFGAMMISGQKAAHLALKSLGEANSI  328



>gb|AGZ80414.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AGZ80415.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AGZ80416.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AGZ80418.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AGZ80419.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AGZ80420.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AGZ80421.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AGZ80425.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AGZ80428.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AGZ80431.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AGZ80432.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AGZ80433.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AGZ80434.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AGZ80435.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
Length=145

 Score =   256 bits (653),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 125/135 (93%), Positives = 130/135 (96%), Gaps = 0/135 (0%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCGHDGP  486
            PNVKLF AVAAEDLIVK+G+VGGVVTNWALVSM  DTQSCMDPNVMEAK+VVSSCGHDGP
Sbjct  11   PNVKLFNAVAAEDLIVKDGKVGGVVTNWALVSMNHDTQSCMDPNVMEAKVVVSSCGHDGP  70

Query  485  FGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  306
            FG TGVKRLKSIG+ID+VPGMKALDMN AEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM
Sbjct  71   FGATGVKRLKSIGLIDNVPGMKALDMNKAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  130

Query  305  GPTFGAMMISGQKAA  261
            GPTFGAMMISGQKAA
Sbjct  131  GPTFGAMMISGQKAA  145



>ref|XP_008463440.1| PREDICTED: thiamine thiazole synthase, chloroplastic [Cucumis 
melo]
Length=359

 Score =   263 bits (671),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 136/150 (91%), Positives = 142/150 (95%), Gaps = 0/150 (0%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCGHDGP  486
            PNVKLF AVAAEDLIVK GRVGGVVTNWALVSM  DTQSCMDPNVMEAK+VVSSCGHDGP
Sbjct  181  PNVKLFNAVAAEDLIVKGGRVGGVVTNWALVSMNHDTQSCMDPNVMEAKVVVSSCGHDGP  240

Query  485  FGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  306
            FG TGVKRLKSIG+IDSVPGMKALDMNTAEDAIVR TRE+VPGMIVTGMEVAEIDGAPRM
Sbjct  241  FGATGVKRLKSIGLIDSVPGMKALDMNTAEDAIVRFTREVVPGMIVTGMEVAEIDGAPRM  300

Query  305  GPTFGAMMISGQKAAHLALKALGEPNALDG  216
            GPTFGAMMISGQKAAHLALK+LGE N++ G
Sbjct  301  GPTFGAMMISGQKAAHLALKSLGEANSIGG  330



>gb|AHN11708.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
Length=142

 Score =   255 bits (651),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 125/136 (92%), Positives = 129/136 (95%), Gaps = 0/136 (0%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCGHDGP  486
            PNVKLF AVAAEDLIVK+G+VGGVVTNWALVSM  DTQSCMDPNVMEAK+VVSSCGHDGP
Sbjct  7    PNVKLFNAVAAEDLIVKDGKVGGVVTNWALVSMNHDTQSCMDPNVMEAKVVVSSCGHDGP  66

Query  485  FGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  306
            FG TGVKRLKSIGMID+VP MKALDMN AEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM
Sbjct  67   FGATGVKRLKSIGMIDNVPRMKALDMNKAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  126

Query  305  GPTFGAMMISGQKAAH  258
            GPTFGAMMIS QKAAH
Sbjct  127  GPTFGAMMISXQKAAH  142



>gb|AGZ80422.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
Length=145

 Score =   253 bits (647),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 124/135 (92%), Positives = 129/135 (96%), Gaps = 0/135 (0%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCGHDGP  486
            PNVKLF AVAAEDLIVK+G+VGGVVTNWALVSM  DTQSCMDPNVMEAK+VVSSCGHDGP
Sbjct  11   PNVKLFNAVAAEDLIVKDGKVGGVVTNWALVSMNHDTQSCMDPNVMEAKVVVSSCGHDGP  70

Query  485  FGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  306
            FG TGVKRLKSIG+ID+VPGMKALDMN AEDAIVRLTREIVPGMIVTGMEVAEIDG PRM
Sbjct  71   FGATGVKRLKSIGLIDNVPGMKALDMNKAEDAIVRLTREIVPGMIVTGMEVAEIDGGPRM  130

Query  305  GPTFGAMMISGQKAA  261
            GPTFGAMMISGQKAA
Sbjct  131  GPTFGAMMISGQKAA  145



>gb|AFW83047.1| hypothetical protein ZEAMMB73_797739 [Zea mays]
Length=384

 Score =   249 bits (637),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 140/203 (69%), Positives = 154/203 (76%), Gaps = 31/203 (15%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCGHDGP  486
            PNVKLF AVA EDLIV+ GRVGGVVTNWALVSM  DTQSCMDPNVMEAK+VVSSCGHDGP
Sbjct  183  PNVKLFNAVAVEDLIVRGGRVGGVVTNWALVSMNHDTQSCMDPNVMEAKVVVSSCGHDGP  242

Query  485  FGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  306
            FG TGVKRL+ IGMI +VPGMKALDMNTAED IVRLTRE+VPGMIVTGMEVAEIDGAPRM
Sbjct  243  FGATGVKRLQDIGMISAVPGMKALDMNTAEDEIVRLTREVVPGMIVTGMEVAEIDGAPRM  302

Query  305  ------------------------------GPTFGAMMISGQKAAHLALKALGEPNALDG  216
                                          GPTFGAMMISGQKAAHLALKALG PNA+DG
Sbjct  303  VSSEEDNTHVIAILTESMRNMSKIVCWLLQGPTFGAMMISGQKAAHLALKALGRPNAVDG  362

Query  215  SASEVAAPELILXSAENEEIADA  147
            + S     EL++ + +++E+ DA
Sbjct  363  TMSPPLREELMI-AYKDDEVVDA  384



>gb|KFH67165.1| thiazole biosynthetic enzyme, chloroplastic [Mortierella verticillata 
NRRL 6337]
Length=307

 Score =   243 bits (619),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 115/149 (77%), Positives = 130/149 (87%), Gaps = 0/149 (0%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCGHDGP  486
            PNVKLF A+AAEDLIVKNGRV GVVTNW LV++  DTQSCMDPNV+EAK+VVSS GHDGP
Sbjct  158  PNVKLFNALAAEDLIVKNGRVAGVVTNWTLVTLNHDTQSCMDPNVIEAKVVVSSTGHDGP  217

Query  485  FGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  306
             G +GVKRL+ IG+I +VPGM ALDMN AED IVR TRE+VPGM++TGMEVAE+DG PRM
Sbjct  218  MGASGVKRLQKIGLIKNVPGMIALDMNAAEDGIVRNTREVVPGMVITGMEVAELDGCPRM  277

Query  305  GPTFGAMMISGQKAAHLALKALGEPNALD  219
            GPTFGAMM+SGQKAAH ALK+LG  N LD
Sbjct  278  GPTFGAMMLSGQKAAHCALKSLGLANVLD  306



>gb|KDO52969.1| hypothetical protein CISIN_1g018414mg [Citrus sinensis]
Length=321

 Score =   239 bits (610),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 125/137 (91%), Positives = 130/137 (95%), Gaps = 0/137 (0%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCGHDGP  486
            PNVKLF AVAAEDLIVK GRVGGVVTNWALVSM  DTQSCMDPNVMEAK+VVSSCGHDGP
Sbjct  184  PNVKLFNAVAAEDLIVKGGRVGGVVTNWALVSMNHDTQSCMDPNVMEAKVVVSSCGHDGP  243

Query  485  FGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  306
            FG TGVKRLKSIGMI+ VPGMKALDMN+AEDAIVRLTRE+VPGMIVTGMEVAEIDGAPRM
Sbjct  244  FGATGVKRLKSIGMIEEVPGMKALDMNSAEDAIVRLTREVVPGMIVTGMEVAEIDGAPRM  303

Query  305  GPTFGAMMISGQKAAHL  255
            GPTFGAMMISGQKAA +
Sbjct  304  GPTFGAMMISGQKAARM  320



>gb|ACF85447.1| unknown [Zea mays]
Length=143

 Score =   227 bits (578),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 112/143 (78%), Positives = 125/143 (87%), Gaps = 2/143 (1%)
 Frame = -1

Query  569  MXXDTQSCMDPNVMEAKIVVSSCGHDGPFGXTGVKRLKSIGMIDSVPGMKALDMNTAEDA  390
            M  DTQSCMDPNVMEAK+VVSSCGHDGPFG TGVKRL+ IGMI +VPGMKALDMN AED 
Sbjct  1    MNHDTQSCMDPNVMEAKVVVSSCGHDGPFGATGVKRLQDIGMISAVPGMKALDMNAAEDE  60

Query  389  IVRLTREIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSA  210
            IVRLTRE+VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALG PNA+DG+ 
Sbjct  61   IVRLTREVVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGRPNAVDGTI  120

Query  209  SEV--AAPELILXSAENEEIADA  147
             EV  A  E  + +++++E+ DA
Sbjct  121  PEVSPALREEFVIASKDDEVVDA  143



>gb|KDO30626.1| hypothetical protein SPRG_04526 [Saprolegnia parasitica CBS 223.65]
Length=334

 Score =   228 bits (580),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 108/157 (69%), Positives = 131/157 (83%), Gaps = 0/157 (0%)
 Frame = -1

Query  662  NVKLFXAVAAEDLIVKNGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCGHDGPF  483
            N+KLF A A EDLI+KNGRVGGVVTNW LV++   TQSCMDPNVME K+++S+CGHDGP 
Sbjct  173  NIKLFNATAIEDLIIKNGRVGGVVTNWTLVTLNHGTQSCMDPNVMEGKVLISACGHDGPM  232

Query  482  GXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRMG  303
            G +GVKRL++IGM++++PGM  LDM  AEDAIV  T+EIVPGMIV GMEVAE+DGAPRMG
Sbjct  233  GASGVKRLQNIGMVENIPGMGPLDMGAAEDAIVAGTKEIVPGMIVAGMEVAELDGAPRMG  292

Query  302  PTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAP  192
            PTFG MMISGQKAAHLAL+ALG  + ++ + S   +P
Sbjct  293  PTFGGMMISGQKAAHLALEALGIKSHINPNMSFAMSP  329



>ref|XP_008616182.1| thiamine biosynthetic enzyme [Saprolegnia diclina VS20]
 gb|EQC30329.1| thiamine biosynthetic enzyme [Saprolegnia diclina VS20]
Length=334

 Score =   228 bits (580),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 108/157 (69%), Positives = 131/157 (83%), Gaps = 0/157 (0%)
 Frame = -1

Query  662  NVKLFXAVAAEDLIVKNGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCGHDGPF  483
            N+KLF A A EDLI+KNGRVGGVVTNW LV++   TQSCMDPNVME K+++S+CGHDGP 
Sbjct  173  NIKLFNATAIEDLIIKNGRVGGVVTNWTLVTLNHGTQSCMDPNVMEGKVLISACGHDGPM  232

Query  482  GXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRMG  303
            G +GVKRL++IGM++++PGM  LDM  AEDAIV  T+EIVPGMIV GMEVAE+DGAPRMG
Sbjct  233  GASGVKRLQNIGMVENIPGMGPLDMGAAEDAIVAGTKEIVPGMIVAGMEVAELDGAPRMG  292

Query  302  PTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAP  192
            PTFG MMISGQKAAHLAL+ALG  + ++ + S   +P
Sbjct  293  PTFGGMMISGQKAAHLALEALGIKSHINPNMSFAMSP  329



>ref|XP_008877253.1| thiazole biosynthetic enzyme, chloroplastic, variant [Aphanomyces 
invadans]
 ref|XP_008877254.1| thiazole biosynthetic enzyme, chloroplastic [Aphanomyces invadans]
 gb|ETV94050.1| thiazole biosynthetic enzyme, chloroplastic [Aphanomyces invadans]
 gb|ETV94051.1| thiazole biosynthetic enzyme, chloroplastic, variant [Aphanomyces 
invadans]
Length=333

 Score =   228 bits (580),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 106/148 (72%), Positives = 127/148 (86%), Gaps = 0/148 (0%)
 Frame = -1

Query  662  NVKLFXAVAAEDLIVKNGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCGHDGPF  483
            N+KLF A A EDLI+K GRVGGVVTNW LV++   TQSCMDPNVME+K+++S+CGHDGP 
Sbjct  172  NIKLFNATAIEDLIIKKGRVGGVVTNWTLVTLNHGTQSCMDPNVMESKVLISACGHDGPM  231

Query  482  GXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRMG  303
            G +GVKRL++IGM+D +PGM  LDM  AEDAIV+ T+EIVPGMIV GMEVAE++GAPRMG
Sbjct  232  GASGVKRLQNIGMVDHIPGMGCLDMAAAEDAIVKGTQEIVPGMIVAGMEVAELEGAPRMG  291

Query  302  PTFGAMMISGQKAAHLALKALGEPNALD  219
            PTFG MMISGQKAAHLAL++LG  + LD
Sbjct  292  PTFGGMMISGQKAAHLALESLGIKSHLD  319



>ref|XP_009844134.1| thiazole biosynthesis enzyme, variant 2 [Aphanomyces astaci]
 gb|ETV66359.1| thiazole biosynthesis enzyme, variant 2 [Aphanomyces astaci]
Length=270

 Score =   225 bits (573),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 105/148 (71%), Positives = 126/148 (85%), Gaps = 0/148 (0%)
 Frame = -1

Query  662  NVKLFXAVAAEDLIVKNGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCGHDGPF  483
            N+KLF A A EDLI+K G+VGGVVTNW LV++   TQSCMDPNVME K+++S+CGHDGP 
Sbjct  109  NIKLFNATAIEDLIIKKGKVGGVVTNWTLVTLNHGTQSCMDPNVMEGKVLISACGHDGPM  168

Query  482  GXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRMG  303
            G +GVKRL++IGM+D +PGM  LDM  AEDAIV+ T+EIVPGMIV GMEVAE++GAPRMG
Sbjct  169  GASGVKRLQNIGMVDHIPGMGCLDMGAAEDAIVKGTQEIVPGMIVCGMEVAELEGAPRMG  228

Query  302  PTFGAMMISGQKAAHLALKALGEPNALD  219
            PTFG MMISGQKAAHLAL++LG  + LD
Sbjct  229  PTFGGMMISGQKAAHLALESLGIKSHLD  256



>ref|XP_009844132.1| thiazole biosynthesis enzyme [Aphanomyces astaci]
 ref|XP_009844133.1| thiazole biosynthesis enzyme, variant 1 [Aphanomyces astaci]
 gb|ETV66357.1| thiazole biosynthesis enzyme [Aphanomyces astaci]
 gb|ETV66358.1| thiazole biosynthesis enzyme, variant 1 [Aphanomyces astaci]
Length=333

 Score =   225 bits (573),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 105/148 (71%), Positives = 126/148 (85%), Gaps = 0/148 (0%)
 Frame = -1

Query  662  NVKLFXAVAAEDLIVKNGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCGHDGPF  483
            N+KLF A A EDLI+K G+VGGVVTNW LV++   TQSCMDPNVME K+++S+CGHDGP 
Sbjct  172  NIKLFNATAIEDLIIKKGKVGGVVTNWTLVTLNHGTQSCMDPNVMEGKVLISACGHDGPM  231

Query  482  GXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRMG  303
            G +GVKRL++IGM+D +PGM  LDM  AEDAIV+ T+EIVPGMIV GMEVAE++GAPRMG
Sbjct  232  GASGVKRLQNIGMVDHIPGMGCLDMGAAEDAIVKGTQEIVPGMIVCGMEVAELEGAPRMG  291

Query  302  PTFGAMMISGQKAAHLALKALGEPNALD  219
            PTFG MMISGQKAAHLAL++LG  + LD
Sbjct  292  PTFGGMMISGQKAAHLALESLGIKSHLD  319



>ref|XP_004496859.1| PREDICTED: thiamine thiazole synthase, chloroplastic-like [Cicer 
arietinum]
Length=360

 Score =   225 bits (573),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 107/148 (72%), Positives = 124/148 (84%), Gaps = 0/148 (0%)
 Frame = -1

Query  662  NVKLFXAVAAEDLIVKNGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCGHDGPF  483
            N+KLF AVAAEDLIVK GRVGGVVTNWALVSM  D QSCM+P+ MEAK+VVSSCGHDGPF
Sbjct  213  NMKLFNAVAAEDLIVKEGRVGGVVTNWALVSMKHDIQSCMNPHAMEAKVVVSSCGHDGPF  272

Query  482  GXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRMG  303
            G  G+K L+ +GMID V G+ +LDMNT+E A VRLT+EIVPGMI+TGMEVAE+ G PR+G
Sbjct  273  GANGLKMLERVGMIDFVRGINSLDMNTSEHAFVRLTKEIVPGMIITGMEVAEMYGTPRVG  332

Query  302  PTFGAMMISGQKAAHLALKALGEPNALD  219
              FGAMMISGQK AHLAL  L + NA++
Sbjct  333  LIFGAMMISGQKTAHLALMTLEKNNAIN  360



>dbj|BAC79982.1| putative thiamine biosynthesis protein [Oryza sativa Japonica 
Group]
Length=306

 Score =   223 bits (567),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 105/120 (88%), Positives = 112/120 (93%), Gaps = 0/120 (0%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCGHDGP  486
            PNVKLF AVA EDLIVK GRVGGVVTNWALVSM  DTQSCMDPNVME+++VVSSCGHDGP
Sbjct  176  PNVKLFNAVAVEDLIVKEGRVGGVVTNWALVSMNHDTQSCMDPNVMESRVVVSSCGHDGP  235

Query  485  FGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  306
            FG TGVKRL+ IGMID+VPGM+ALDMNTAED IVRLTRE+VPGMIVTGMEVAEIDGAPRM
Sbjct  236  FGATGVKRLQDIGMIDAVPGMRALDMNTAEDEIVRLTREVVPGMIVTGMEVAEIDGAPRM  295



>ref|XP_005648929.1| thiazole biosynthetic enzyme [Coccomyxa subellipsoidea C-169]
 gb|EIE24385.1| thiazole biosynthetic enzyme [Coccomyxa subellipsoidea C-169]
Length=317

 Score =   221 bits (562),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 109/168 (65%), Positives = 127/168 (76%), Gaps = 8/168 (5%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNGR-----VGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSC  501
            PN+KLF A A EDL+V+        VGG VTNW LVS+  DTQ CMDPNV+E K++VSS 
Sbjct  147  PNIKLFNATAVEDLVVREDELRGKYVGGAVTNWTLVSLNHDTQMCMDPNVLECKVMVSST  206

Query  500  GHDGPFGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEID  321
            GHDGP G +GVKRL+ +GM+  VPGM ALDMNTAEDA+VR TRE+VPGM++ GMEVAE+D
Sbjct  207  GHDGPMGASGVKRLQRLGMVTGVPGMAALDMNTAEDAVVRNTREVVPGMVICGMEVAELD  266

Query  320  GAPRMGPTFGAMMISGQKAAHLALKALGEPNALDG---SASEVAAPEL  186
            G PRMGPTFGAM +SGQKAAH AL +L   NALD    S   V APEL
Sbjct  267  GCPRMGPTFGAMFMSGQKAAHCALNSLRRQNALDKDVPSRVAVPAPEL  314



>gb|ABR01228.1| thiazole biosynthetic enzyme [Chlorella vulgaris]
 gb|ABR01230.1| thiazole biosynthetic enzyme [Chlorella vulgaris]
 gb|ABR01236.1| thiazole biosynthetic enzyme [Chlorella vulgaris]
Length=340

 Score =   221 bits (562),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 104/158 (66%), Positives = 124/158 (78%), Gaps = 4/158 (3%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNGR----VGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCG  498
            PN+KLF A AAEDLIVK  +    V G VTNW LVS+  DTQ CMDPNV+EAK++VSSCG
Sbjct  172  PNIKLFNATAAEDLIVKQDKRGKYVAGAVTNWTLVSLNHDTQMCMDPNVIEAKVMVSSCG  231

Query  497  HDGPFGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDG  318
            HDGP G  GVKRL  +GM+++ PGM ALDMN+AEDA+V  TREIVPGM++ GMEVAE+DG
Sbjct  232  HDGPMGAAGVKRLAKLGMVEATPGMGALDMNSAEDAVVDRTREIVPGMVICGMEVAELDG  291

Query  317  APRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASE  204
             PRMGPTFGAM +SGQKAAH+AL +L     L+ +A E
Sbjct  292  CPRMGPTFGAMFMSGQKAAHVALNSLRRQQELEAAAKE  329



>emb|CEP18429.1| hypothetical protein [Parasitella parasitica]
Length=309

 Score =   218 bits (556),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 103/142 (73%), Positives = 120/142 (85%), Gaps = 0/142 (0%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCGHDGP  486
            PNVKLF A A EDLIVKNG+V GVVTNW LV++  +TQSCMDPNVMEAK+VVS  GHDGP
Sbjct  155  PNVKLFNATAVEDLIVKNGKVAGVVTNWTLVTLNHNTQSCMDPNVMEAKVVVSGTGHDGP  214

Query  485  FGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  306
             G +GVKRL+SIG+I    GM +LDMN AED IV+ TRE+VPGM+VTGME+AE+DGAPRM
Sbjct  215  MGASGVKRLESIGLIKENKGMLSLDMNAAEDDIVKYTREVVPGMVVTGMELAELDGAPRM  274

Query  305  GPTFGAMMISGQKAAHLALKAL  240
            GPTFGAM+ISGQKAA+ A  +L
Sbjct  275  GPTFGAMLISGQKAAYAARASL  296



>dbj|GAN03507.1| thiamin biosynthetic enzyme [Mucor ambiguus]
Length=313

 Score =   218 bits (556),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 104/153 (68%), Positives = 125/153 (82%), Gaps = 0/153 (0%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCGHDGP  486
            PNVKLF A A EDLIVKNG+V GVVTNW LV++  +TQSCMDPNVMEAK++VS  GHDGP
Sbjct  158  PNVKLFNATAVEDLIVKNGKVAGVVTNWTLVTLNHNTQSCMDPNVMEAKVIVSGTGHDGP  217

Query  485  FGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  306
             G +GVKRL+SIG+I+   GM +LDMN AED IV+ TRE+VPGM+VTGME+AE+DGAPRM
Sbjct  218  MGASGVKRLESIGLIEGNKGMLSLDMNAAEDDIVKYTREVVPGMVVTGMELAELDGAPRM  277

Query  305  GPTFGAMMISGQKAAHLALKALGEPNALDGSAS  207
            GPTFGAM+ISGQKAA+ A  +L      + +AS
Sbjct  278  GPTFGAMLISGQKAAYAARASLKRQAEEERAAS  310



>gb|EPB86412.1| thiazole biosynthetic enzyme, chloroplastic [Mucor circinelloides 
f. circinelloides 1006PhL]
Length=310

 Score =   218 bits (556),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 102/142 (72%), Positives = 121/142 (85%), Gaps = 0/142 (0%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCGHDGP  486
            PNVKLF A A EDLIVKNG+V GVVTNW LV++  +TQSCMDPNVMEAK++VS  GHDGP
Sbjct  156  PNVKLFNATAVEDLIVKNGKVAGVVTNWTLVTLNHNTQSCMDPNVMEAKVIVSGTGHDGP  215

Query  485  FGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  306
             G +GVKRL+SIG+I+   GM +LDMN AED IV+ TRE+VPGM+VTGME+AE+DGAPRM
Sbjct  216  MGASGVKRLESIGLIEGNKGMLSLDMNAAEDDIVKYTREVVPGMVVTGMELAELDGAPRM  275

Query  305  GPTFGAMMISGQKAAHLALKAL  240
            GPTFGAM+ISGQKAA+ A  +L
Sbjct  276  GPTFGAMLISGQKAAYAARASL  297



>gb|EPB91714.1| thiazole biosynthetic enzyme, chloroplastic [Mucor circinelloides 
f. circinelloides 1006PhL]
Length=310

 Score =   217 bits (553),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 101/136 (74%), Positives = 119/136 (88%), Gaps = 0/136 (0%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCGHDGP  486
            PNVKLF A AAEDLIVK+G+V GVVTNW LVS+  +TQSCMDPNV+EAK+VVS  GHDGP
Sbjct  156  PNVKLFNATAAEDLIVKDGKVAGVVTNWTLVSLNHNTQSCMDPNVVEAKVVVSGTGHDGP  215

Query  485  FGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  306
             G +GVKRL++IG+ID   GM +LDMN AED IV+ TRE+VPGM+VTGME+AE+DGAPRM
Sbjct  216  MGASGVKRLEAIGLIDEKKGMLSLDMNAAEDDIVKYTREVVPGMVVTGMELAELDGAPRM  275

Query  305  GPTFGAMMISGQKAAH  258
            GPTFGAM+ISGQKAA+
Sbjct  276  GPTFGAMLISGQKAAY  291



>ref|XP_002784437.1| conserved hypothetical protein [Perkinsus marinus ATCC 50983]
 gb|EER16233.1| conserved hypothetical protein [Perkinsus marinus ATCC 50983]
Length=325

 Score =   216 bits (551),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 103/142 (73%), Positives = 119/142 (84%), Gaps = 0/142 (0%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCGHDGP  486
            PNVKLF A A EDLIVK GRV GVVTNW LVS+  DTQSCMDPNVME+++V+S+ GHDGP
Sbjct  154  PNVKLFNATAVEDLIVKGGRVSGVVTNWTLVSLNHDTQSCMDPNVMESRVVISATGHDGP  213

Query  485  FGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  306
             G +GVKRL+ +G++DS+ GM ALDMN+AEDAIV  TREI PGMIV GMEVAE+ GAPRM
Sbjct  214  MGASGVKRLEKLGLVDSLRGMGALDMNSAEDAIVEGTREIAPGMIVAGMEVAELSGAPRM  273

Query  305  GPTFGAMMISGQKAAHLALKAL  240
            GPTFGAMMISG KAA +A + L
Sbjct  274  GPTFGAMMISGVKAARVAQQIL  295



>gb|EIE83081.1| thiazole biosynthetic enzyme, chloroplastic [Rhizopus delemar 
RA 99-880]
Length=305

 Score =   216 bits (549),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 101/135 (75%), Positives = 115/135 (85%), Gaps = 0/135 (0%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCGHDGP  486
            PNVKLF A A EDLIVK  +V GVVTNW LVS+  DTQSCMDPNV+EAK++VS  GHDGP
Sbjct  151  PNVKLFNATAVEDLIVKKNKVAGVVTNWTLVSLNHDTQSCMDPNVIEAKVIVSGTGHDGP  210

Query  485  FGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  306
             G +GVKRL+SIG+ID   GM +LDMN AED IVR TRE+VPGM+VTGME+AE+DGAPRM
Sbjct  211  MGASGVKRLESIGLIDQKKGMLSLDMNAAEDDIVRYTREVVPGMVVTGMELAELDGAPRM  270

Query  305  GPTFGAMMISGQKAA  261
            GPTFGAM+ISGQKAA
Sbjct  271  GPTFGAMLISGQKAA  285



>emb|CEG62855.1| Putative Thiamine thiazole synthase [Rhizopus microsporus]
Length=307

 Score =   214 bits (546),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 102/142 (72%), Positives = 118/142 (83%), Gaps = 0/142 (0%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCGHDGP  486
            PNVKLF A A EDLIVK  +V GVVTNW LVS+  DTQSCMDPNV+EAK+VVS  GHDGP
Sbjct  153  PNVKLFNATAVEDLIVKKNKVAGVVTNWTLVSLNHDTQSCMDPNVIEAKVVVSGTGHDGP  212

Query  485  FGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  306
             G +GVKRL+SIG+I    GM +LDMN AED IV+ TRE+VPGM+VTGME+AE+DGAPRM
Sbjct  213  MGASGVKRLESIGLIAQKKGMLSLDMNAAEDDIVKYTREVVPGMVVTGMELAELDGAPRM  272

Query  305  GPTFGAMMISGQKAAHLALKAL  240
            GPTFGAM+ISGQKAA+ A  +L
Sbjct  273  GPTFGAMLISGQKAAYAARASL  294



>gb|ABK22862.1| unknown [Picea sitchensis]
Length=335

 Score =   215 bits (548),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 112/168 (67%), Positives = 122/168 (73%), Gaps = 35/168 (21%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCGHDGP  486
            PNVKLF AVAAEDLI+K GRV GVVTNWALVSM  +TQSCMDPNVME+K+VVSSCGHDGP
Sbjct  197  PNVKLFNAVAAEDLIIKEGRVSGVVTNWALVSMNHNTQSCMDPNVMESKVVVSSCGHDGP  256

Query  485  FGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  306
            FG TGVKRLKS+GMID VPGMKALDMNTAEDAIVRLTRE                     
Sbjct  257  FGATGVKRLKSVGMIDKVPGMKALDMNTAEDAIVRLTRE---------------------  295

Query  305  GPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPELILXSAENE  162
                        KAAHLALKALG+PNALDG+ +    PEL+L SAE+E
Sbjct  296  ------------KAAHLALKALGQPNALDGTLT--VHPELVLASAEDE  329



>gb|KIY92671.1| thiamine biosynthetic enzyme [Monoraphidium neglectum]
Length=351

 Score =   215 bits (548),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 100/147 (68%), Positives = 119/147 (81%), Gaps = 5/147 (3%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNG-----RVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSC  501
            PNVKLF A A EDLIV++      R+GGVVTNW LV++  DTQSCMDPNV+EAK+VVS+C
Sbjct  181  PNVKLFNATAVEDLIVRDDAVSGRRIGGVVTNWTLVTLHHDTQSCMDPNVLEAKVVVSTC  240

Query  500  GHDGPFGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEID  321
            GHDGP G   VKRL  +GM+D +PGM ALDMN AED IV  TRE+VPGM++ GME++EID
Sbjct  241  GHDGPMGAHSVKRLAKLGMVDEIPGMAALDMNAAEDRIVANTREVVPGMVLAGMELSEID  300

Query  320  GAPRMGPTFGAMMISGQKAAHLALKAL  240
            G+PRMGPTFGAM +SGQKAAH+AL  L
Sbjct  301  GSPRMGPTFGAMFVSGQKAAHVALGVL  327



>gb|KIY99977.1| thiamine biosynthetic enzyme [Monoraphidium neglectum]
Length=359

 Score =   215 bits (548),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 100/147 (68%), Positives = 119/147 (81%), Gaps = 5/147 (3%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNG-----RVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSC  501
            PNVKLF A A EDLIV++      R+GGVVTNW LV++  DTQSCMDPNV+EAK+VVS+C
Sbjct  190  PNVKLFNATAVEDLIVRDDAVSGRRIGGVVTNWTLVTLHHDTQSCMDPNVLEAKVVVSTC  249

Query  500  GHDGPFGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEID  321
            GHDGP G   VKRL  +GM+D +PGM ALDMN AED IV  TRE+VPGM++ GME++EID
Sbjct  250  GHDGPMGAHSVKRLAKLGMVDEIPGMAALDMNAAEDRIVANTREVVPGMVLAGMELSEID  309

Query  320  GAPRMGPTFGAMMISGQKAAHLALKAL  240
            G+PRMGPTFGAM +SGQKAAH+AL  L
Sbjct  310  GSPRMGPTFGAMFVSGQKAAHVALGVL  336



>ref|XP_005847930.1| hypothetical protein CHLNCDRAFT_22703 [Chlorella variabilis]
 gb|EFN55828.1| hypothetical protein CHLNCDRAFT_22703 [Chlorella variabilis]
Length=300

 Score =   212 bits (540),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 101/147 (69%), Positives = 117/147 (80%), Gaps = 5/147 (3%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNGR-----VGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSC  501
            PN+KLF A AAEDLIVK        V G VTNW LVS+  DTQ CMDPNV+EAK++VSSC
Sbjct  129  PNIKLFNATAAEDLIVKQDETRGKYVAGAVTNWTLVSLNHDTQMCMDPNVIEAKVMVSSC  188

Query  500  GHDGPFGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEID  321
            GHDGP G  GVKRL  +GM++  PGM ALDMN+AEDA+V  TREIVPGM++ GMEVAE+D
Sbjct  189  GHDGPMGAAGVKRLARLGMVEKTPGMGALDMNSAEDAVVDRTREIVPGMVICGMEVAELD  248

Query  320  GAPRMGPTFGAMMISGQKAAHLALKAL  240
            G PRMGPTFGAM +SGQKAAH+AL +L
Sbjct  249  GCPRMGPTFGAMFMSGQKAAHVALNSL  275



>ref|XP_008386070.1| PREDICTED: thiamine thiazole synthase, chloroplastic-like [Malus 
domestica]
Length=312

 Score =   211 bits (538),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 99/120 (83%), Positives = 110/120 (92%), Gaps = 0/120 (0%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCGHDGP  486
            PNVKLF AVAAEDLI+K GRVGGVVTNWALVSM  DTQSCMDPNVMEAK+VVSSCGHDGP
Sbjct  187  PNVKLFNAVAAEDLIIKGGRVGGVVTNWALVSMNHDTQSCMDPNVMEAKVVVSSCGHDGP  246

Query  485  FGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  306
             G TGVKRL+S+GMI+SVPG KALDMNTA+D IV+LTREI+PG IVTGME+ EI+G+PRM
Sbjct  247  MGATGVKRLRSVGMIESVPGXKALDMNTAKDTIVKLTREIMPGXIVTGMEITEINGSPRM  306



>emb|CDM85402.1| unnamed protein product [Triticum aestivum]
Length=338

 Score =   211 bits (536),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 112/157 (71%), Positives = 122/157 (78%), Gaps = 8/157 (5%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNGRVGGVVTNWALVSMXXDT----QSCMDPNVMEAKIVVSSCG  498
            PNVKLF  V  EDL+VK  RV GVVTNWALVSM  DT    QS MD NVMEAKIVVSSCG
Sbjct  176  PNVKLFNGVVVEDLVVKEHRVTGVVTNWALVSMNQDTHSQTQSHMDANVMEAKIVVSSCG  235

Query  497  HDGPFGXTG--VKRLKSIGMIDSVP--GMKALDMNTAEDAIVRLTREIVPGMIVTGMEVA  330
            H+G F   G  VKRL+ IGMI +VP  GM+ALD N +EDAIV LTRE+VPGMIV G+EVA
Sbjct  236  HEGLFSANGKGVKRLEDIGMIKTVPRTGMEALDTNVSEDAIVGLTREVVPGMIVAGIEVA  295

Query  329  EIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALD  219
            EIDG  RM PTFGA +ISGQKAAHLALKALG PN +D
Sbjct  296  EIDGPQRMCPTFGATIISGQKAAHLALKALGRPNGID  332



>gb|ABW74129.1| thiamin biosynthetic enzyme, partial [Mucor racemosus]
Length=145

 Score =   203 bits (516),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 94/131 (72%), Positives = 113/131 (86%), Gaps = 0/131 (0%)
 Frame = -1

Query  632  EDLIVKNGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCGHDGPFGXTGVKRLKS  453
            EDLIVKNG+V GVVTNW LV++  +TQSCMDPNVMEAK++VS  GHDGP G +GVKRL+S
Sbjct  2    EDLIVKNGKVAGVVTNWTLVTLNHNTQSCMDPNVMEAKVIVSGTGHDGPMGASGVKRLES  61

Query  452  IGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISG  273
            IG+I+   GM +LDMN AED IV+ TRE+VPGM+VTGME+AE+DGAPRMGPTFGAM+ISG
Sbjct  62   IGLIEGNKGMLSLDMNAAEDDIVKYTREVVPGMVVTGMELAELDGAPRMGPTFGAMLISG  121

Query  272  QKAAHLALKAL  240
            QKAA+ A  +L
Sbjct  122  QKAAYAARASL  132



>gb|ADI88268.1| HCF106 protein, partial [Silene latifolia]
 gb|ADI88269.1| HCF106 protein, partial [Silene latifolia]
 gb|ADI88270.1| HCF106 protein, partial [Silene latifolia]
 gb|ADI88271.1| HCF106 protein, partial [Silene latifolia]
 gb|ADI88276.1| HCF106 protein, partial [Silene latifolia]
 gb|ADI88277.1| HCF106 protein, partial [Silene latifolia]
 gb|ADI88282.1| HCF106 protein, partial [Silene latifolia]
 gb|ADI88283.1| HCF106 protein, partial [Silene latifolia]
 gb|ADI88286.1| HCF106 protein, partial [Silene latifolia]
 gb|ADI88287.1| HCF106 protein, partial [Silene latifolia]
 gb|ADI88288.1| HCF106 protein, partial [Silene latifolia]
 gb|ADI88289.1| HCF106 protein, partial [Silene latifolia]
 gb|ADI88291.1| HCF106 protein, partial [Silene latifolia]
 gb|ADI88292.1| HCF106 protein, partial [Silene latifolia]
 gb|ADI88293.1| HCF106 protein, partial [Silene latifolia]
 gb|ADI88294.1| HCF106 protein, partial [Silene latifolia]
 gb|ADI88295.1| HCF106 protein, partial [Silene latifolia]
 gb|ADI88296.1| HCF106 protein, partial [Silene latifolia]
 gb|ADI88297.1| HCF106 protein, partial [Silene latifolia]
 gb|ADI88298.1| HCF106 protein, partial [Silene latifolia]
 gb|ADI88299.1| HCF106 protein, partial [Silene latifolia]
 gb|ADI88300.1| HCF106 protein, partial [Silene latifolia]
 gb|ADI88301.1| HCF106 protein, partial [Silene latifolia]
 gb|ADI88302.1| HCF106 protein, partial [Silene latifolia]
 gb|ADI88303.1| HCF106 protein, partial [Silene latifolia]
 gb|ADI88304.1| HCF106 protein, partial [Silene latifolia]
 gb|ADI88305.1| HCF106 protein, partial [Silene latifolia]
 gb|ADI88306.1| HCF106 protein, partial [Silene latifolia]
 gb|ADI88307.1| HCF106 protein, partial [Silene latifolia]
 gb|ADI88308.1| HCF106 protein, partial [Silene latifolia]
 gb|ADI88309.1| HCF106 protein, partial [Silene latifolia]
 gb|ADI88310.1| HCF106 protein, partial [Silene latifolia]
 gb|ADI88311.1| HCF106 protein, partial [Silene latifolia]
Length=137

 Score =   199 bits (505),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 96/111 (86%), Positives = 101/111 (91%), Gaps = 0/111 (0%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCGHDGP  486
            PNVKLF AVA EDLIVK+GRV GVVTNWALVSM  DTQSCMDPNVMEAK+VVSSCGHDGP
Sbjct  27   PNVKLFNAVAVEDLIVKSGRVSGVVTNWALVSMNHDTQSCMDPNVMEAKVVVSSCGHDGP  86

Query  485  FGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEV  333
            FG TGVKRL  IG+I +VPGM ALDMNTAEDAIVRLTRE+VPGMIVTGMEV
Sbjct  87   FGATGVKRLLDIGLIKNVPGMSALDMNTAEDAIVRLTREVVPGMIVTGMEV  137



>emb|CAB64776.1| thiazole biosynthetic enzyme [Brassica juncea]
Length=134

 Score =   198 bits (504),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 108/132 (82%), Positives = 117/132 (89%), Gaps = 0/132 (0%)
 Frame = -1

Query  560  DTQSCMDPNVMEAKIVVSSCGHDGPFGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVR  381
            DTQSCMDPNVMEAKIVVSSCGHDGPFG TGVKRLKSIG+ID VPGMKALDMNT EDAIVR
Sbjct  3    DTQSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGLIDHVPGMKALDMNTVEDAIVR  62

Query  380  LTREIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEV  201
            LTRE+   MIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKAL +PN +DGS    
Sbjct  63   LTREVDLDMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALAQPNVIDGSYVGE  122

Query  200  AAPELILXSAEN  165
             +PEL+L + ++
Sbjct  123  LSPELVLAAPDS  134



>gb|ADI88272.1| HCF106 protein, partial [Silene latifolia]
 gb|ADI88273.1| HCF106 protein, partial [Silene latifolia]
 gb|ADI88274.1| HCF106 protein, partial [Silene latifolia]
 gb|ADI88275.1| HCF106 protein, partial [Silene latifolia]
 gb|ADI88278.1| HCF106 protein, partial [Silene latifolia]
 gb|ADI88279.1| HCF106 protein, partial [Silene latifolia]
 gb|ADI88280.1| HCF106 protein, partial [Silene latifolia]
 gb|ADI88281.1| HCF106 protein, partial [Silene latifolia]
 gb|ADI88290.1| HCF106 protein, partial [Silene latifolia]
 gb|ADI88312.1| HCF106 protein, partial [Silene latifolia]
 gb|ADI88313.1| HCF106 protein, partial [Silene latifolia]
 gb|ADI88314.1| HCF106 protein, partial [Silene latifolia]
 gb|ADI88315.1| HCF106 protein, partial [Silene latifolia]
 gb|ADI88467.1| HCF106 protein [Silene vulgaris]
Length=137

 Score =   197 bits (501),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 95/111 (86%), Positives = 101/111 (91%), Gaps = 0/111 (0%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCGHDGP  486
            PNVKLF AVA EDLIVK+GRV GVVTNWALVSM  DTQSCMDPNVMEAK+VVSSCGHDGP
Sbjct  27   PNVKLFNAVAVEDLIVKSGRVSGVVTNWALVSMNHDTQSCMDPNVMEAKVVVSSCGHDGP  86

Query  485  FGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEV  333
            FG TGVKRL  IG+I +VPGM ALDMN+AEDAIVRLTRE+VPGMIVTGMEV
Sbjct  87   FGATGVKRLLDIGLIKNVPGMSALDMNSAEDAIVRLTREVVPGMIVTGMEV  137



>emb|CBI23938.3| unnamed protein product [Vitis vinifera]
Length=212

 Score =   199 bits (507),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 96/113 (85%), Positives = 104/113 (92%), Gaps = 0/113 (0%)
 Frame = -1

Query  518  IVVSSCGHDGPFGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGM  339
            +VVSSCGHDGPFG TGVKRL+S+GMIDSVPGMKALDMNTAED IVRLTRE+VPGMIVTGM
Sbjct  88   VVVSSCGHDGPFGATGVKRLRSVGMIDSVPGMKALDMNTAEDEIVRLTREVVPGMIVTGM  147

Query  338  EVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPELIL  180
            EVAEIDG+PRMGPTFGAMMISGQKAAHLALK+LG PNALDG+      PEL+L
Sbjct  148  EVAEIDGSPRMGPTFGAMMISGQKAAHLALKSLGLPNALDGTYIGNLHPELVL  200



>gb|ADI88468.1| HCF106 protein [Silene vulgaris]
Length=137

 Score =   196 bits (499),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 94/111 (85%), Positives = 101/111 (91%), Gaps = 0/111 (0%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCGHDGP  486
            PNVKLF AVA EDLIVK+GRV GVVTNWALVSM  DTQSCMDPNVMEAK+VVSSCGHDGP
Sbjct  27   PNVKLFNAVAVEDLIVKSGRVSGVVTNWALVSMNHDTQSCMDPNVMEAKVVVSSCGHDGP  86

Query  485  FGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEV  333
            FG TGVKRL  IG+I +VPGM ALDMN+AEDAIVRLTRE+VPGMIVTG+EV
Sbjct  87   FGATGVKRLLDIGLIKNVPGMSALDMNSAEDAIVRLTREVVPGMIVTGLEV  137



>gb|ADI88284.1| HCF106 protein, partial [Silene latifolia]
 gb|ADI88285.1| HCF106 protein, partial [Silene latifolia]
Length=137

 Score =   196 bits (498),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 94/111 (85%), Positives = 101/111 (91%), Gaps = 0/111 (0%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCGHDGP  486
            PNVKLF AVA EDLIVK+GRV GVVTNWALVSM  DTQSCMDPNVMEAK+VVSSCGHDGP
Sbjct  27   PNVKLFNAVAVEDLIVKSGRVSGVVTNWALVSMNHDTQSCMDPNVMEAKVVVSSCGHDGP  86

Query  485  FGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEV  333
            FG TGVKRL  IG+I +VPGM ALDMN+AEDAIVR+TRE+VPGMIVTGMEV
Sbjct  87   FGATGVKRLLDIGLIKNVPGMSALDMNSAEDAIVRVTREVVPGMIVTGMEV  137



>ref|XP_003522069.1| PREDICTED: thiamine thiazole synthase, chloroplastic-like [Glycine 
max]
Length=284

 Score =   200 bits (509),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 108/167 (65%), Positives = 121/167 (72%), Gaps = 5/167 (3%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCGHDGP  486
            PNVK F AV A+DLI+K GRV   VTN ALVSM  DTQSCMDPNVMEAK+VVSSCGHDGP
Sbjct  104  PNVKRFNAVVAKDLIMKEGRV---VTNLALVSMNHDTQSCMDPNVMEAKVVVSSCGHDGP  160

Query  485  FGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  306
               TGVKRLKSIGMID+VPGMKALD  +    +VRLTREIV GMIVTGMEVAEI G+PRM
Sbjct  161  LSATGVKRLKSIGMIDNVPGMKALDTKSIGMVVVRLTREIVLGMIVTGMEVAEIGGSPRM  220

Query  305  GPTFGAMM-ISGQKAAHLALKALGEPNALDGSASE-VAAPELILXSA  171
            GP    M  ++ +    + LKALG  NA+DG+       P LI  S 
Sbjct  221  GPYLSMMFKLTFKLMERVELKALGRNNAIDGTCGVGTEEPHLIFAST  267



>gb|AGB85035.1| thiamine biosynthesis thi4 protein, partial [Auxenochlorella 
protothecoides]
Length=327

 Score =   201 bits (512),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 100/148 (68%), Positives = 115/148 (78%), Gaps = 6/148 (4%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKN-----GR-VGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSS  504
            PN+KLF A AAEDLIVK+     GR V G VTNW LVS+  DTQ CMDPN + +K++VSS
Sbjct  118  PNIKLFNATAAEDLIVKDISAKGGRHVAGAVTNWTLVSLNHDTQMCMDPNTILSKVMVSS  177

Query  503  CGHDGPFGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEI  324
             GHDGP G +GVKRL  +GMI+  PGM ALDMNTAEDA+V  TREIVPGM++ GMEVAE+
Sbjct  178  TGHDGPMGASGVKRLAKLGMIEKAPGMGALDMNTAEDAVVDRTREIVPGMVICGMEVAEL  237

Query  323  DGAPRMGPTFGAMMISGQKAAHLALKAL  240
            DG PRMGPTFGAM ISG KA H AL +L
Sbjct  238  DGCPRMGPTFGAMFISGLKAVHCALASL  265



>ref|XP_011397717.1| Thiamine thiazole synthase, chloroplastic [Auxenochlorella protothecoides]
 gb|KFM24829.1| Thiamine thiazole synthase, chloroplastic [Auxenochlorella protothecoides]
Length=419

 Score =   203 bits (516),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 101/148 (68%), Positives = 116/148 (78%), Gaps = 6/148 (4%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKN-----GR-VGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSS  504
            PN+KLF A AAEDLIVK+     GR V G VTNW LVS+  DTQ CMDPN + +K++VSS
Sbjct  248  PNIKLFNATAAEDLIVKDIPAKGGRHVAGAVTNWTLVSLNHDTQMCMDPNTILSKVMVSS  307

Query  503  CGHDGPFGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEI  324
             GHDGP G +GVKRL  +GMI+  PGM ALDMNTAEDA+V  TREIVPGM++ GMEVAE+
Sbjct  308  TGHDGPMGASGVKRLAKLGMIEKAPGMGALDMNTAEDAVVDRTREIVPGMVICGMEVAEL  367

Query  323  DGAPRMGPTFGAMMISGQKAAHLALKAL  240
            DG PRMGPTFGAM ISG KAAH AL +L
Sbjct  368  DGCPRMGPTFGAMFISGLKAAHCALASL  395


 Score = 89.0 bits (219),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 44/71 (62%), Positives = 52/71 (73%), Gaps = 6/71 (8%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKN-----GR-VGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSS  504
            PN+KLF A AAEDLIVK+     GR V G VTNW LVS+  DTQ CMDPN + +K++VSS
Sbjct  109  PNIKLFNATAAEDLIVKDIPAKGGRHVAGAVTNWTLVSLNHDTQMCMDPNTILSKVMVSS  168

Query  503  CGHDGPFGXTG  471
             GHDGP G +G
Sbjct  169  TGHDGPMGASG  179



>ref|XP_001698672.1| full-length thiazole biosynthetic enzyme [Chlamydomonas reinhardtii]
 sp|A8J9T5.1|THI4_CHLRE RecName: Full=Thiamine thiazole synthase, chloroplastic; AltName: 
Full=Thiazole biosynthetic enzyme; Flags: Precursor [Chlamydomonas 
reinhardtii]
 gb|EDO99354.1| full-length thiazole biosynthetic enzyme [Chlamydomonas reinhardtii]
Length=357

 Score =   199 bits (506),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 99/152 (65%), Positives = 118/152 (78%), Gaps = 10/152 (7%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVK--------NGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVV  510
            PNVKLF A A EDLIVK          RV GVVTNW+LV+    TQSCMDPNV+EA +VV
Sbjct  186  PNVKLFNATAVEDLIVKPDPALGPGGRRVAGVVTNWSLVAQAHGTQSCMDPNVIEAGVVV  245

Query  509  SSCGHDGPFGXTGVKRLKSIGMI--DSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGME  336
            S+CGHDGPFG TGVKRL  +GM+    VPGM ALDM  AE +IV  TRE+VPGM++TGME
Sbjct  246  SACGHDGPFGATGVKRLARLGMVPGGEVPGMGALDMEAAEGSIVNNTREVVPGMVLTGME  305

Query  335  VAEIDGAPRMGPTFGAMMISGQKAAHLALKAL  240
            +AE+DG+PRMGPTFGAM++SG +AAH+A+ AL
Sbjct  306  LAEVDGSPRMGPTFGAMIVSGMRAAHMAVAAL  337



>ref|XP_002951140.1| hypothetical protein VOLCADRAFT_74900 [Volvox carteri f. nagariensis]
 gb|EFJ47669.1| hypothetical protein VOLCADRAFT_74900 [Volvox carteri f. nagariensis]
Length=359

 Score =   196 bits (499),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 98/151 (65%), Positives = 116/151 (77%), Gaps = 9/151 (6%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVK-------NGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVS  507
            PNVKLF A A EDLIVK         RV GVVTNW+LV+    TQSCMDPNV+EA +VVS
Sbjct  186  PNVKLFNATAVEDLIVKPDPQLGGARRVAGVVTNWSLVAQAHGTQSCMDPNVIEAGVVVS  245

Query  506  SCGHDGPFGXTGVKRLKSIGMI--DSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEV  333
            +CGHDGPFG T VKRL  +GM+    VPGM ALDM  AE AIV  TRE+VPGM++ GME+
Sbjct  246  ACGHDGPFGATSVKRLARLGMVPGGEVPGMGALDMEAAEGAIVGGTREVVPGMVLAGMEL  305

Query  332  AEIDGAPRMGPTFGAMMISGQKAAHLALKAL  240
            AE+DG+PRMGPTFGAM++SG++AAH+AL  L
Sbjct  306  AEVDGSPRMGPTFGAMIVSGRRAAHVALAVL  336



>ref|XP_002951138.1| hypothetical protein VOLCADRAFT_74899 [Volvox carteri f. nagariensis]
 gb|EFJ47667.1| hypothetical protein VOLCADRAFT_74899 [Volvox carteri f. nagariensis]
Length=355

 Score =   196 bits (498),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 98/151 (65%), Positives = 116/151 (77%), Gaps = 9/151 (6%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVK-------NGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVS  507
            PNVKLF A A EDLIVK         RV GVVTNW+LV+    TQSCMDPNV+EA +VVS
Sbjct  185  PNVKLFNATAVEDLIVKPDPQLGGARRVAGVVTNWSLVAQAHGTQSCMDPNVIEAGVVVS  244

Query  506  SCGHDGPFGXTGVKRLKSIGMID--SVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEV  333
            +CGHDGPFG T VKRL  +GM+    VPGM ALDM  AE AIV  TRE+VPGM++ GME+
Sbjct  245  ACGHDGPFGATSVKRLARLGMVPGGEVPGMGALDMEAAEGAIVGGTREVVPGMVLAGMEL  304

Query  332  AEIDGAPRMGPTFGAMMISGQKAAHLALKAL  240
            AE+DG+PRMGPTFGAM++SG++AAH+AL  L
Sbjct  305  AEVDGSPRMGPTFGAMIVSGRRAAHVALAVL  335



>ref|XP_005834399.1| putative THI4, thiamine [Guillardia theta CCMP2712]
 gb|EKX47419.1| putative THI4, thiamine [Guillardia theta CCMP2712]
Length=325

 Score =   190 bits (482),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 92/142 (65%), Positives = 109/142 (77%), Gaps = 10/142 (7%)
 Frame = -1

Query  662  NVKLFXAVAAEDLIVKNGRVG-----GVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCG  498
            NVKLF A A EDLIVK    G     GVVTNW LV++  DTQSCMDPNV+E+K++VS CG
Sbjct  165  NVKLFNATAVEDLIVKQDPQGLKYCAGVVTNWTLVALNHDTQSCMDPNVIESKVIVSGCG  224

Query  497  HDGPFGXTGVKRLKSIGMIDS-----VPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEV  333
            HDGPFG   VKRL  +GM+D      + GM ALDMN+AED IV  TRE+VPGMI+TGME+
Sbjct  225  HDGPFGAQCVKRLAKLGMLDEYAQNGIQGMGALDMNSAEDKIVNNTREVVPGMILTGMEL  284

Query  332  AEIDGAPRMGPTFGAMMISGQK  267
            AE+DG+PRMGPTFGAM +SGQ+
Sbjct  285  AEVDGSPRMGPTFGAMFVSGQR  306



>emb|CAH25337.1| thiazole biosynthetic enzyme [Guillardia theta]
Length=328

 Score =   190 bits (482),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 92/142 (65%), Positives = 109/142 (77%), Gaps = 10/142 (7%)
 Frame = -1

Query  662  NVKLFXAVAAEDLIVKNGRVG-----GVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCG  498
            NVKLF A A EDLIVK    G     GVVTNW LV++  DTQSCMDPNV+E+K++VS CG
Sbjct  168  NVKLFNATAVEDLIVKQDPQGLKYCAGVVTNWTLVALNHDTQSCMDPNVIESKVIVSGCG  227

Query  497  HDGPFGXTGVKRLKSIGMIDS-----VPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEV  333
            HDGPFG   VKRL  +GM+D      + GM ALDMN+AED IV  TRE+VPGMI+TGME+
Sbjct  228  HDGPFGAQCVKRLAKLGMLDEYAQNGIQGMGALDMNSAEDKIVNNTREVVPGMILTGMEL  287

Query  332  AEIDGAPRMGPTFGAMMISGQK  267
            AE+DG+PRMGPTFGAM +SGQ+
Sbjct  288  AEVDGSPRMGPTFGAMFVSGQR  309



>ref|XP_007586590.1| putative thiazole biosynthetic enzyme protein [Neofusicoccum 
parvum UCRNP2]
 gb|EOD45932.1| putative thiazole biosynthetic enzyme protein [Neofusicoccum 
parvum UCRNP2]
Length=329

 Score =   188 bits (477),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 94/153 (61%), Positives = 110/153 (72%), Gaps = 6/153 (4%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNG------RVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSS  504
            PNVKLF A A EDLI +        R+ GVVTNW LVSM  D QSCMDPN + A +V+S+
Sbjct  172  PNVKLFNATAVEDLITRPAADGTGVRIAGVVTNWTLVSMHHDDQSCMDPNTINAPVVIST  231

Query  503  CGHDGPFGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEI  324
             GHDGPFG   VKRL S+  +D + GM+ LDMN AEDAIV+ TREIVPG+IV GME++E+
Sbjct  232  TGHDGPFGAFSVKRLVSMQQLDKLGGMRGLDMNNAEDAIVKRTREIVPGLIVGGMELSEV  291

Query  323  DGAPRMGPTFGAMMISGQKAAHLALKALGEPNA  225
            DGA RMGPTFGAM +SG KAA  ALK   E  A
Sbjct  292  DGANRMGPTFGAMALSGVKAAEEALKVFDERKA  324



>gb|KFZ11494.1| hypothetical protein V502_07520 [Pseudogymnoascus pannorum VKM 
F-4520 (FW-2644)]
Length=335

 Score =   187 bits (475),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 91/156 (58%), Positives = 114/156 (73%), Gaps = 9/156 (6%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNG---------RVGGVVTNWALVSMXXDTQSCMDPNVMEAKIV  513
            PN+KLF A   EDLI +N          ++ GVVTNW LV+M  D QSCMDPN + A I+
Sbjct  176  PNIKLFNATCVEDLITRNAGDAADPSAVQIAGVVTNWTLVTMHHDDQSCMDPNTINAPII  235

Query  512  VSSCGHDGPFGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEV  333
            +S+ GHDGPFG   VKRL S+G ++ + GM+ LDMNTAEDAIV+ TREIVPG+IV GME+
Sbjct  236  ISTTGHDGPFGAFCVKRLVSMGQLEKLNGMRGLDMNTAEDAIVKGTREIVPGLIVGGMEL  295

Query  332  AEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNA  225
            +EIDG+ RMGPTFGAM++SG KAA  AL+A  +  A
Sbjct  296  SEIDGSNRMGPTFGAMVLSGCKAAEAALEAFDQRKA  331



>gb|EKG16915.1| Thiamine biosynthesis Thi4 protein [Macrophomina phaseolina MS6]
Length=236

 Score =   184 bits (466),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 92/150 (61%), Positives = 108/150 (72%), Gaps = 6/150 (4%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNG------RVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSS  504
            PNVKLF A   EDLI +        R+ GVVTNW LVSM  D QSCMDPN + A IV+S+
Sbjct  79   PNVKLFNATTVEDLITRPAADGSGVRIAGVVTNWTLVSMHHDDQSCMDPNTINAPIVIST  138

Query  503  CGHDGPFGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEI  324
             GHDGPFG   VKRL S+  ++ + GM+ LDMN AEDAIV+ TREIVPG+IV GME++E+
Sbjct  139  TGHDGPFGAFSVKRLVSMQQLEKLGGMRGLDMNNAEDAIVKRTREIVPGLIVGGMELSEV  198

Query  323  DGAPRMGPTFGAMMISGQKAAHLALKALGE  234
            DGA RMGPTFGAM +SG KAA  ALK   E
Sbjct  199  DGANRMGPTFGAMALSGVKAAEEALKVFDE  228



>gb|EHL02685.1| putative Thiazole biosynthetic enzyme, mitochondrial [Glarea 
lozoyensis 74030]
Length=322

 Score =   186 bits (473),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 91/149 (61%), Positives = 109/149 (73%), Gaps = 5/149 (3%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNG-----RVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSC  501
            PN+KLF A A EDLI +       R+ GVVTNW LV+M  D QSCMDPN + A IVVS+ 
Sbjct  167  PNIKLFNATAVEDLITRQNSDGTLRIAGVVTNWTLVTMHHDDQSCMDPNTINAPIVVSTT  226

Query  500  GHDGPFGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEID  321
            GHDGPFG   VKRL S+  I+ + GM+ LDMNTAEDAIV+ TRE+VPG++V GME++E+D
Sbjct  227  GHDGPFGAFCVKRLVSMQQIEKLGGMRGLDMNTAEDAIVKRTREVVPGLVVGGMELSEVD  286

Query  320  GAPRMGPTFGAMMISGQKAAHLALKALGE  234
            GA RMGPTFGAM +SG KAA   LK   E
Sbjct  287  GANRMGPTFGAMALSGVKAAEEVLKVFDE  315



>gb|KIN04678.1| hypothetical protein OIDMADRAFT_17638 [Oidiodendron maius Zn]
Length=322

 Score =   186 bits (472),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 94/149 (63%), Positives = 111/149 (74%), Gaps = 5/149 (3%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVK---NG--RVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSC  501
            PN+KLF A A EDLI +   NG  RV GVVTNW LVSM  D QSCMDPN + A IV+S+ 
Sbjct  167  PNIKLFNATAVEDLITRPTANGGVRVAGVVTNWTLVSMHHDDQSCMDPNTINAPIVISTT  226

Query  500  GHDGPFGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEID  321
            GHDGPFG   VKRL S+  I+ + GM+ LDMN+AEDAIV  TRE++PG+IV GME++E+D
Sbjct  227  GHDGPFGAFSVKRLVSMQQIEKLGGMRGLDMNSAEDAIVTKTREVIPGLIVGGMELSEVD  286

Query  320  GAPRMGPTFGAMMISGQKAAHLALKALGE  234
            GA RMGPTFGAM +SG KAA  ALK   E
Sbjct  287  GANRMGPTFGAMALSGVKAAEEALKVFEE  315



>ref|XP_001589094.1| thiazole biosynthetic enzyme [Sclerotinia sclerotiorum 1980]
 sp|A7EWL8.1|THI4_SCLS1 RecName: Full=Thiamine thiazole synthase; AltName: Full=Thiazole 
biosynthetic enzyme [Sclerotinia sclerotiorum 1980 UF-70]
 gb|EDN93860.1| thiazole biosynthetic enzyme [Sclerotinia sclerotiorum 1980 UF-70]
Length=326

 Score =   186 bits (472),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 93/152 (61%), Positives = 110/152 (72%), Gaps = 5/152 (3%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVK-----NGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSC  501
            PN+KLF A + EDLI +     N R+ GVVTNW LV+M  D QSCMDPN + A IV+S+ 
Sbjct  171  PNIKLFNATSVEDLITRQTADGNIRIAGVVTNWTLVTMHHDDQSCMDPNTINAPIVISTT  230

Query  500  GHDGPFGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEID  321
            GHDGPFG   VKRL S+  I  + GM+ LDMN AEDAIV+ TREIVPG+IV GME++E+D
Sbjct  231  GHDGPFGAFCVKRLVSMNQIKELGGMRGLDMNVAEDAIVKKTREIVPGLIVGGMELSEVD  290

Query  320  GAPRMGPTFGAMMISGQKAAHLALKALGEPNA  225
            GA RMGPTFGAM +SG KAA  ALK   E  A
Sbjct  291  GANRMGPTFGAMALSGVKAAEEALKVFDERKA  322



>gb|KFY94986.1| hypothetical protein V498_03597 [Pseudogymnoascus pannorum VKM 
F-4517 (FW-2822)]
Length=328

 Score =   186 bits (472),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 91/156 (58%), Positives = 114/156 (73%), Gaps = 9/156 (6%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNG---------RVGGVVTNWALVSMXXDTQSCMDPNVMEAKIV  513
            PN+KLF A   EDLI +N          ++ GVVTNW LV+M  D QSCMDPN + A I+
Sbjct  169  PNIKLFNATCVEDLITRNAGDAADPSAVQIAGVVTNWTLVTMHHDDQSCMDPNTINAPII  228

Query  512  VSSCGHDGPFGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEV  333
            +S+ GHDGPFG   VKRL S+G ++ + GM+ LDMNTAEDAIV+ TREIVPG+IV GME+
Sbjct  229  ISTTGHDGPFGAFCVKRLVSMGQLEKLNGMRGLDMNTAEDAIVKGTREIVPGLIVGGMEL  288

Query  332  AEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNA  225
            +EIDG+ RMGPTFGAM++SG KAA  AL+A  +  A
Sbjct  289  SEIDGSNRMGPTFGAMVLSGCKAAEAALEAFDQRKA  324



>ref|XP_001549602.1| thiazole biosynthetic enzyme [Botrytis cinerea B05.10]
 emb|CCD55366.1| similar to thiazole biosynthetic enzyme [Botrytis cinerea T4]
 gb|EMR84691.1| putative thiazole biosynthetic enzyme protein [Botrytis cinerea 
BcDW1]
Length=328

 Score =   186 bits (472),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 92/152 (61%), Positives = 110/152 (72%), Gaps = 5/152 (3%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNG-----RVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSC  501
            PN+KLF A A EDLI +       R+ GVVTNW LV+M  D QSCMDPN + A IV+S+ 
Sbjct  173  PNIKLFNATAVEDLITRQTPDGSIRIAGVVTNWTLVTMHHDDQSCMDPNTINAPIVISTT  232

Query  500  GHDGPFGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEID  321
            GHDGPFG   VKRL S+  I+ + GM+ LDMN AEDAIV+ TREIVPG+IV GME++E+D
Sbjct  233  GHDGPFGAFCVKRLVSMNQIEKLGGMRGLDMNVAEDAIVKRTREIVPGLIVGGMELSEVD  292

Query  320  GAPRMGPTFGAMMISGQKAAHLALKALGEPNA  225
            GA RMGPTFGAM +SG KAA  AL+   E  A
Sbjct  293  GANRMGPTFGAMALSGVKAAEEALRVFDERKA  324



>ref|XP_008087498.1| FAD/NAD(P)-binding protein [Glarea lozoyensis ATCC 20868]
 gb|EPE26179.1| FAD/NAD(P)-binding protein [Glarea lozoyensis ATCC 20868]
Length=328

 Score =   186 bits (472),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 91/149 (61%), Positives = 109/149 (73%), Gaps = 5/149 (3%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNG-----RVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSC  501
            PN+KLF A A EDLI +       R+ GVVTNW LV+M  D QSCMDPN + A IVVS+ 
Sbjct  173  PNIKLFNATAVEDLITRQNSDGTLRIAGVVTNWTLVTMHHDDQSCMDPNTINAPIVVSTT  232

Query  500  GHDGPFGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEID  321
            GHDGPFG   VKRL S+  I+ + GM+ LDMNTAEDAIV+ TRE+VPG++V GME++E+D
Sbjct  233  GHDGPFGAFCVKRLVSMQQIEKLGGMRGLDMNTAEDAIVKRTREVVPGLVVGGMELSEVD  292

Query  320  GAPRMGPTFGAMMISGQKAAHLALKALGE  234
            GA RMGPTFGAM +SG KAA   LK   E
Sbjct  293  GANRMGPTFGAMALSGVKAAEEVLKVFDE  321



>gb|KFY84898.1| hypothetical protein V500_08902 [Pseudogymnoascus pannorum VKM 
F-4518 (FW-2643)]
Length=330

 Score =   186 bits (472),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 91/156 (58%), Positives = 114/156 (73%), Gaps = 9/156 (6%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNG---------RVGGVVTNWALVSMXXDTQSCMDPNVMEAKIV  513
            PN+KLF A   EDLI +N          ++ GVVTNW LV+M  D QSCMDPN + A I+
Sbjct  171  PNIKLFNATCVEDLITRNAGDAADPSAVQIAGVVTNWTLVTMHHDDQSCMDPNTINAPII  230

Query  512  VSSCGHDGPFGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEV  333
            +S+ GHDGPFG   VKRL S+G ++ + GM+ LDMNTAEDAIV+ TREIVPG+IV GME+
Sbjct  231  ISTTGHDGPFGAFCVKRLVSMGQLEKLNGMRGLDMNTAEDAIVKGTREIVPGLIVGGMEL  290

Query  332  AEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNA  225
            +EIDG+ RMGPTFGAM++SG KAA  AL+A  +  A
Sbjct  291  SEIDGSNRMGPTFGAMVLSGCKAAEAALEAFDQRKA  326



>gb|ESZ95478.1| thiazole biosynthetic enzyme [Sclerotinia borealis F-4157]
Length=328

 Score =   186 bits (472),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 92/152 (61%), Positives = 110/152 (72%), Gaps = 5/152 (3%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNG-----RVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSC  501
            PN+KLF A A EDLI +       R+ GVVTNW LV+M  D QSCMDPN + A +V+S+ 
Sbjct  173  PNIKLFNATAVEDLITRQTADGKVRIAGVVTNWTLVTMHHDDQSCMDPNTINAPVVISTT  232

Query  500  GHDGPFGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEID  321
            GHDGPFG   VKRL S+  I+ + GM+ LDMN AEDAIV+ TREIVPG+IV GME++E+D
Sbjct  233  GHDGPFGAFCVKRLVSMNQIEQLGGMRGLDMNVAEDAIVKRTREIVPGLIVGGMELSEVD  292

Query  320  GAPRMGPTFGAMMISGQKAAHLALKALGEPNA  225
            GA RMGPTFGAM +SG KAA  ALK   E  A
Sbjct  293  GANRMGPTFGAMALSGVKAAEEALKIFDERKA  324



>gb|KFY70117.1| hypothetical protein V499_09439 [Pseudogymnoascus pannorum VKM 
F-103]
Length=328

 Score =   186 bits (471),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 91/156 (58%), Positives = 114/156 (73%), Gaps = 9/156 (6%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNG---------RVGGVVTNWALVSMXXDTQSCMDPNVMEAKIV  513
            PN+KLF A   EDLI +N          ++ GVVTNW LV+M  D QSCMDPN + A I+
Sbjct  169  PNIKLFNATCVEDLITRNAGDPADPTAVQIAGVVTNWTLVTMHHDDQSCMDPNTINAPII  228

Query  512  VSSCGHDGPFGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEV  333
            +S+ GHDGPFG   VKRL S+G ++ + GM+ LDMNTAEDAIV+ TREIVPG+IV GME+
Sbjct  229  ISTTGHDGPFGAFCVKRLVSMGQLEKLNGMRGLDMNTAEDAIVKGTREIVPGLIVGGMEL  288

Query  332  AEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNA  225
            +EIDG+ RMGPTFGAM++SG KAA  AL+A  +  A
Sbjct  289  SEIDGSNRMGPTFGAMVLSGCKAAEAALEAFDQRKA  324



>gb|KFZ09843.1| hypothetical protein V501_05470 [Pseudogymnoascus pannorum VKM 
F-4519 (FW-2642)]
Length=330

 Score =   186 bits (471),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 91/156 (58%), Positives = 114/156 (73%), Gaps = 9/156 (6%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNG---------RVGGVVTNWALVSMXXDTQSCMDPNVMEAKIV  513
            PN+KLF A   EDLI +N          ++ GVVTNW LV+M  D QSCMDPN + A I+
Sbjct  171  PNIKLFNATCVEDLITRNAGDPADPTAVQIAGVVTNWTLVTMHHDDQSCMDPNTINAPII  230

Query  512  VSSCGHDGPFGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEV  333
            +S+ GHDGPFG   VKRL S+G ++ + GM+ LDMNTAEDAIV+ TREIVPG+IV GME+
Sbjct  231  ISTTGHDGPFGAFCVKRLVSMGQLEKLNGMRGLDMNTAEDAIVKGTREIVPGLIVGGMEL  290

Query  332  AEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNA  225
            +EIDG+ RMGPTFGAM++SG KAA  AL+A  +  A
Sbjct  291  SEIDGSNRMGPTFGAMVLSGCKAAEAALEAFDQRKA  326



>ref|XP_007289177.1| thiazole biosynthetic enzyme [Marssonina brunnea f. sp. 'multigermtubi' 
MB_m1]
 gb|EKD20606.1| thiazole biosynthetic enzyme [Marssonina brunnea f. sp. 'multigermtubi' 
MB_m1]
Length=327

 Score =   186 bits (471),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 92/149 (62%), Positives = 110/149 (74%), Gaps = 5/149 (3%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNG-----RVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSC  501
            PN+KLF A A EDLI +       R+ GVVTNW LV+M  D QSCMDPN + A +V+S+ 
Sbjct  172  PNIKLFNATAVEDLITRASPDGTLRIAGVVTNWTLVTMHHDDQSCMDPNTINAPLVISTT  231

Query  500  GHDGPFGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEID  321
            GHDGPFG   VKRL S+  I+ + GM+ LDMNTAEDAIV+ TREIVPG+IV GME++E+D
Sbjct  232  GHDGPFGAFCVKRLVSMQQIEKLGGMRGLDMNTAEDAIVKRTREIVPGLIVGGMELSEVD  291

Query  320  GAPRMGPTFGAMMISGQKAAHLALKALGE  234
            GA RMGPTFGAM +SG KAA  ALK   E
Sbjct  292  GANRMGPTFGAMALSGVKAAEEALKVFEE  320



>gb|EME42084.1| hypothetical protein DOTSEDRAFT_73000 [Dothistroma septosporum 
NZE10]
Length=339

 Score =   186 bits (471),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 93/152 (61%), Positives = 111/152 (73%), Gaps = 5/152 (3%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVK-----NGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSC  501
            PNVKLF A A EDLI +     N R+ GVVTNW LVSM  D QSCMDPN + A +++S+ 
Sbjct  180  PNVKLFNATAVEDLITRTDAHGNIRIAGVVTNWTLVSMHHDDQSCMDPNTINAPVIISTT  239

Query  500  GHDGPFGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEID  321
            GHDGPFG   VKRL S+G I ++ GM+ LDMN AEDAIV+ TREI PG+IV GME++E+D
Sbjct  240  GHDGPFGAFSVKRLVSMGSIPALGGMRGLDMNVAEDAIVKCTREIAPGLIVGGMELSEVD  299

Query  320  GAPRMGPTFGAMMISGQKAAHLALKALGEPNA  225
            GA RMGPTFGAM +SG KAA  ALK   +  A
Sbjct  300  GANRMGPTFGAMALSGVKAAEEALKIFEQRKA  331



>ref|XP_003842741.1| similar to thiazole biosynthetic enzyme [Leptosphaeria maculans 
JN3]
 emb|CBX99262.1| similar to thiazole biosynthetic enzyme [Leptosphaeria maculans 
JN3]
Length=334

 Score =   184 bits (468),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 93/159 (58%), Positives = 113/159 (71%), Gaps = 9/159 (6%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNG---------RVGGVVTNWALVSMXXDTQSCMDPNVMEAKIV  513
            PNVKLF A A EDLI +           R+ GVVTNW LVSM  D QSCMDPN + A ++
Sbjct  175  PNVKLFNATAVEDLITRPAPTATDPNAVRIAGVVTNWTLVSMHHDDQSCMDPNTINAPLI  234

Query  512  VSSCGHDGPFGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEV  333
            +S+ GHDGPFG   VKRL S+  I+ + GM+ LDM TAEDAIV+ TREIVPG+IV GME+
Sbjct  235  ISTTGHDGPFGAFSVKRLVSMQQIEKLGGMRGLDMRTAEDAIVKRTREIVPGLIVGGMEL  294

Query  332  AEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDG  216
            +E+DGA RMGPTFGAM++SG KAA  A+    E NA +G
Sbjct  295  SEVDGANRMGPTFGAMVLSGVKAAEEAVGVWDERNAQNG  333



>ref|XP_007672530.1| hypothetical protein BAUCODRAFT_62660 [Baudoinia compniacensis 
UAMH 10762]
 gb|EMD00030.1| hypothetical protein BAUCODRAFT_62660 [Baudoinia compniacensis 
UAMH 10762]
Length=315

 Score =   184 bits (466),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 91/152 (60%), Positives = 110/152 (72%), Gaps = 5/152 (3%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNG-----RVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSC  501
            PNVKLF A A EDLI +       R+ GVVTNW LVSM  D QSCMDPN + A +++S+ 
Sbjct  153  PNVKLFNATAVEDLITRKDGKGGIRIAGVVTNWTLVSMHHDDQSCMDPNTINAPVIISTT  212

Query  500  GHDGPFGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEID  321
            GHDGPFG    KRL S+  + ++ GM+ LDMNTAEDAIV+ TREIVPG+I+ GME++E+D
Sbjct  213  GHDGPFGAFSAKRLVSMNALSALGGMRGLDMNTAEDAIVKGTREIVPGLIIGGMELSEVD  272

Query  320  GAPRMGPTFGAMMISGQKAAHLALKALGEPNA  225
            GA RMGPTFGAM +SG KAA  ALK   E  A
Sbjct  273  GANRMGPTFGAMALSGVKAAEEALKVFEERRA  304



>ref|XP_009228164.1| thiazole biosynthetic enzyme [Gaeumannomyces graminis var. tritici 
R3-111a-1]
 gb|EJT70986.1| thiazole biosynthetic enzyme [Gaeumannomyces graminis var. tritici 
R3-111a-1]
Length=331

 Score =   184 bits (467),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 91/144 (63%), Positives = 108/144 (75%), Gaps = 5/144 (3%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNG-----RVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSC  501
            PNVKLF A A EDLI + G     RV GVVTNW LVSM  D QSCMDPN + A +V+S+ 
Sbjct  176  PNVKLFNATAVEDLITRQGEGGRVRVAGVVTNWTLVSMHHDDQSCMDPNTINAPLVISTT  235

Query  500  GHDGPFGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEID  321
            GHDGPFG   VKRL S+  +D + GM+ LDM +AEDAIV+ TREIVPG+IV GME++E+D
Sbjct  236  GHDGPFGAFSVKRLVSMKQLDQLGGMRGLDMQSAEDAIVKNTREIVPGLIVGGMELSEVD  295

Query  320  GAPRMGPTFGAMMISGQKAAHLAL  249
            GA RMGPTFGAM +SG KAA  A+
Sbjct  296  GANRMGPTFGAMALSGVKAAEEAM  319



>gb|KFY20175.1| hypothetical protein V491_03934 [Pseudogymnoascus pannorum VKM 
F-3775]
Length=328

 Score =   184 bits (467),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 91/156 (58%), Positives = 112/156 (72%), Gaps = 9/156 (6%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNG---------RVGGVVTNWALVSMXXDTQSCMDPNVMEAKIV  513
            PNVKLF A   EDLI +N          ++ GVVTNW LV+M  D QSCMDPN + A I+
Sbjct  169  PNVKLFNATCVEDLITRNAGDPSDPTAVQIAGVVTNWTLVTMHHDDQSCMDPNTINAPII  228

Query  512  VSSCGHDGPFGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEV  333
            +S+ GHDGPFG   VKRL S+G ++ + GM+ LDMNTAEDAIV+ TREIVPG+IV GME+
Sbjct  229  ISTTGHDGPFGAFCVKRLVSMGQLEKLNGMRGLDMNTAEDAIVKGTREIVPGLIVGGMEL  288

Query  332  AEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNA  225
            +EIDG+ RMGPTFGAM +SG KAA  AL+   +  A
Sbjct  289  SEIDGSNRMGPTFGAMCLSGCKAAEAALEVFDQRKA  324



>emb|CEI86769.1| Putative Thiamine thiazole synthase [Rhizopus microsporus]
Length=273

 Score =   182 bits (461),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 86/120 (72%), Positives = 99/120 (83%), Gaps = 0/120 (0%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCGHDGP  486
            PNVKLF A A EDLIVK  +V GVVTNW LVS+  DTQSCMDPNV+EAK+VVS  GHDGP
Sbjct  153  PNVKLFNATAVEDLIVKKNKVAGVVTNWTLVSLNHDTQSCMDPNVIEAKVVVSGTGHDGP  212

Query  485  FGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  306
             G +GVKRL+SIG+I    GM +LDMN AED IV+ TRE+VPGM+VTGME+AE+DGAPRM
Sbjct  213  MGASGVKRLESIGLIAQKKGMLSLDMNAAEDDIVKYTREVVPGMVVTGMELAELDGAPRM  272



>gb|KFY43107.1| hypothetical protein V494_02101 [Pseudogymnoascus pannorum VKM 
F-4513 (FW-928)]
Length=328

 Score =   183 bits (465),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 91/156 (58%), Positives = 111/156 (71%), Gaps = 9/156 (6%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNG---------RVGGVVTNWALVSMXXDTQSCMDPNVMEAKIV  513
            PNVKLF A   EDLI +N          ++ GVVTNW LV+M  D QSCMDPN + A I+
Sbjct  169  PNVKLFNATCVEDLITRNAGDASDPTAVQIAGVVTNWTLVTMHHDDQSCMDPNTINAPII  228

Query  512  VSSCGHDGPFGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEV  333
            +S+ GHDGPFG   VKRL S+G ++ + GM+ LDMNTAEDAIV+ TREIVPG+IV GME+
Sbjct  229  ISTTGHDGPFGAFCVKRLVSMGQLEKLNGMRGLDMNTAEDAIVKGTREIVPGLIVGGMEL  288

Query  332  AEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNA  225
            +EIDG+ RMGPTFGAM +SG KAA  AL+      A
Sbjct  289  SEIDGSNRMGPTFGAMCLSGCKAAEAALEVFDRRKA  324



>gb|KFY08103.1| hypothetical protein V492_06538 [Pseudogymnoascus pannorum VKM 
F-4246]
Length=328

 Score =   183 bits (465),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 91/156 (58%), Positives = 111/156 (71%), Gaps = 9/156 (6%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNG---------RVGGVVTNWALVSMXXDTQSCMDPNVMEAKIV  513
            PNVKLF A   EDLI +N          ++ GVVTNW LV+M  D QSCMDPN + A I+
Sbjct  169  PNVKLFNATCVEDLITRNAGDASDPTAVQIAGVVTNWTLVTMHHDDQSCMDPNTINAPII  228

Query  512  VSSCGHDGPFGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEV  333
            +S+ GHDGPFG   VKRL S+G ++ + GM+ LDMNTAEDAIV+ TREIVPG+IV GME+
Sbjct  229  ISTTGHDGPFGAFCVKRLVSMGQLEKLNGMRGLDMNTAEDAIVKGTREIVPGLIVGGMEL  288

Query  332  AEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNA  225
            +EIDG+ RMGPTFGAM +SG KAA  AL+      A
Sbjct  289  SEIDGSNRMGPTFGAMCLSGCKAAEAALEVFDRRKA  324



>gb|KFX98431.1| hypothetical protein O988_04337, partial [Pseudogymnoascus pannorum 
VKM F-3808]
Length=343

 Score =   184 bits (466),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 89/156 (57%), Positives = 112/156 (72%), Gaps = 9/156 (6%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNG---------RVGGVVTNWALVSMXXDTQSCMDPNVMEAKIV  513
            PN+KLF A   EDL+ +N          ++ GVVTNW LV+M  D QSCMDPN + A I+
Sbjct  184  PNIKLFNATCVEDLMTRNANDPADPKAVQIAGVVTNWTLVTMHHDDQSCMDPNTINAPII  243

Query  512  VSSCGHDGPFGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEV  333
            +S+ GHDGPFG   VKRL S+G ++ + GM+ LDMNTAEDAIV+ TREIVPG+IV GME+
Sbjct  244  ISTTGHDGPFGAFCVKRLVSMGQLEKLNGMRGLDMNTAEDAIVKGTREIVPGLIVGGMEL  303

Query  332  AEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNA  225
            +EIDG+ RMGPTFGAM +SG KAA  AL+   +  A
Sbjct  304  SEIDGSNRMGPTFGAMCLSGCKAAEAALEVFDQRKA  339



>ref|XP_007928692.1| hypothetical protein MYCFIDRAFT_211863 [Pseudocercospora fijiensis 
CIRAD86]
 gb|EME81519.1| hypothetical protein MYCFIDRAFT_211863 [Pseudocercospora fijiensis 
CIRAD86]
Length=340

 Score =   183 bits (465),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 92/152 (61%), Positives = 113/152 (74%), Gaps = 5/152 (3%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVK---NGRV--GGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSC  501
            PNVKLF A A EDLI +   NG +   GVVTNW LVSM  D QSCMDPN + A ++VS+ 
Sbjct  181  PNVKLFNATAVEDLITRKNANGHIQLAGVVTNWTLVSMHHDDQSCMDPNTINAPVIVSTT  240

Query  500  GHDGPFGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEID  321
            GHDGPFG   VKRL S+G+I ++ GM+ LDMNTAEDAIV+ TREI PG++V GME++E+D
Sbjct  241  GHDGPFGAFSVKRLVSMGVIPTLGGMRGLDMNTAEDAIVKGTREIAPGLVVGGMELSEVD  300

Query  320  GAPRMGPTFGAMMISGQKAAHLALKALGEPNA  225
            GA RMGPTFGAM +SG KAA + L+   +  A
Sbjct  301  GANRMGPTFGAMALSGVKAAEVVLEIFDQRKA  332



>gb|ELR08851.1| thiazole biosynthetic enzyme, mitochondrial [Pseudogymnoascus 
destructans 20631-21]
Length=328

 Score =   183 bits (464),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 90/156 (58%), Positives = 111/156 (71%), Gaps = 9/156 (6%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNG---------RVGGVVTNWALVSMXXDTQSCMDPNVMEAKIV  513
            PN+KLF A   EDLI +N          ++ GVVTNW LV+M  D QSCMDPN + A I+
Sbjct  169  PNIKLFNATCVEDLITRNAGDAVDPSAVQIAGVVTNWTLVTMHHDDQSCMDPNTINAPII  228

Query  512  VSSCGHDGPFGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEV  333
            +S+ GHDGPFG   VKRL S+G ++ + GM+ LDMNTAEDAIV+ TREIVPG+IV GME+
Sbjct  229  ISTTGHDGPFGAFCVKRLVSMGQLEKLNGMRGLDMNTAEDAIVKGTREIVPGLIVGGMEL  288

Query  332  AEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNA  225
            +EIDG+ RMGPTFGAM+ SG  AA  ALK   +  A
Sbjct  289  SEIDGSNRMGPTFGAMVYSGVAAAEAALKVFDQRKA  324



>gb|KFY24905.1| hypothetical protein V493_04960 [Pseudogymnoascus pannorum VKM 
F-4281 (FW-2241)]
Length=329

 Score =   182 bits (463),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 90/156 (58%), Positives = 111/156 (71%), Gaps = 9/156 (6%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNG---------RVGGVVTNWALVSMXXDTQSCMDPNVMEAKIV  513
            PN+KLF A   EDLI +N          ++ GVVTNW LV+M  D QSCMDPN + A I+
Sbjct  169  PNIKLFNATCVEDLITRNAGDAADPTAVQIAGVVTNWTLVTMHHDDQSCMDPNTINAPII  228

Query  512  VSSCGHDGPFGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEV  333
            +S+ GHDGPFG   VKRL S+G ++ + GM+ LDMNTAEDAIV+ TREIVPG+IV GME+
Sbjct  229  ISTTGHDGPFGAFCVKRLVSMGQLEKLNGMRGLDMNTAEDAIVKGTREIVPGLIVGGMEL  288

Query  332  AEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNA  225
            +EIDG+ RMGPTFGAM+ SG  AA  ALK   +  A
Sbjct  289  SEIDGSNRMGPTFGAMVYSGVVAAETALKVFDQRKA  324



>gb|KJB57702.1| hypothetical protein B456_009G176400 [Gossypium raimondii]
Length=304

 Score =   181 bits (458),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 99/175 (57%), Positives = 106/175 (61%), Gaps = 53/175 (30%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCGHDGP  486
            PNVKLF AVAAEDLIVK  RV GVVTNWALVSM  DTQSCMDPNVME+K+VVSSCGHDGP
Sbjct  181  PNVKLFNAVAAEDLIVKENRVAGVVTNWALVSMNHDTQSCMDPNVMESKVVVSSCGHDGP  240

Query  485  FGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRM  306
            FG TGVKRLKSIGMIDSVP                                         
Sbjct  241  FGATGVKRLKSIGMIDSVP-----------------------------------------  259

Query  305  GPTFGAMMISGQKAAHLALKALGEPNALDGSASEV--AAPELILXSAENEEIADA  147
                      G KAAHLALKALG+PNA+DG+ SE     PE +L +AE EEI DA
Sbjct  260  ----------GMKAAHLALKALGQPNAIDGTFSEAERVQPEFVLAAAETEEIVDA  304



>ref|XP_499918.1| YALI0A09768p [Yarrowia lipolytica]
 sp|Q3V7I4.1|THI4_YARLI RecName: Full=Thiamine thiazole synthase; AltName: Full=Thiazole 
biosynthetic enzyme [Yarrowia lipolytica CLIB122]
 emb|CAG83845.1| YALI0A09768p [Yarrowia lipolytica CLIB122]
Length=317

 Score =   181 bits (459),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 89/147 (61%), Positives = 107/147 (73%), Gaps = 5/147 (3%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVK-----NGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSC  501
            PNVKLF A A EDLI +     N R+ GVVTNW LVSM  D QSCMDPN + A I++S+ 
Sbjct  162  PNVKLFNATAVEDLITRKDAQGNLRIAGVVTNWTLVSMHHDDQSCMDPNTINAPIIISTT  221

Query  500  GHDGPFGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEID  321
            GHDGPFG   VKRL S+  I+ + GM+ LDM  AEDAIV+ TREIVPG++V GME++E+D
Sbjct  222  GHDGPFGAFSVKRLVSMNAIEKLGGMRGLDMGLAEDAIVKRTREIVPGLVVGGMELSEVD  281

Query  320  GAPRMGPTFGAMMISGQKAAHLALKAL  240
            GA RMGPTFGAM +SG KAA   L+  
Sbjct  282  GANRMGPTFGAMALSGVKAAETVLEVF  308



>gb|EAQ71495.1| hypothetical protein MGCH7_ch7g902 [Magnaporthe oryzae 70-15]
Length=202

 Score =   177 bits (450),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 88/145 (61%), Positives = 106/145 (73%), Gaps = 7/145 (5%)
 Frame = -1

Query  662  NVKLFXAVAAEDLIVKNG-------RVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSS  504
            NVKLF A A EDLI +         RV GVVTNW LVSM  D QSCMDPN + A +V+S+
Sbjct  46   NVKLFNATAVEDLITRREGGDNAGVRVAGVVTNWTLVSMHHDDQSCMDPNTINAPVVIST  105

Query  503  CGHDGPFGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEI  324
             GHDGPFG    KRL S+  I+ + GM+ LDM +AEDAIV+ TREIVPG+I+ GME++EI
Sbjct  106  TGHDGPFGAFSAKRLVSMKQIEQLGGMRGLDMQSAEDAIVKRTREIVPGLIIGGMELSEI  165

Query  323  DGAPRMGPTFGAMMISGQKAAHLAL  249
            DGA RMGPTFGAM++SG KAA  A+
Sbjct  166  DGANRMGPTFGAMVLSGVKAAEEAM  190



>gb|AGT99181.1| thiazole biosynthetic enzyme [Acremonium chrysogenum]
 gb|KFH43147.1| Thiamine thiazole synthase-like protein [Acremonium chrysogenum 
ATCC 11550]
Length=328

 Score =   181 bits (459),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 90/147 (61%), Positives = 110/147 (75%), Gaps = 5/147 (3%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVK--NG---RVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSC  501
            PNVKLF A   EDLI +  NG   R+ GVVTNW LV+M  D QSCMDPN + A +++S+ 
Sbjct  173  PNVKLFNATCVEDLITRPSNGQDVRIAGVVTNWTLVTMHHDDQSCMDPNTINAPVIISTT  232

Query  500  GHDGPFGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEID  321
            GHDGP G   VKRL S+  I+ + GM+ LDMNTAEDAIV+ TREIVPG+IV GME++E+D
Sbjct  233  GHDGPMGAFSVKRLVSMQRIEKLGGMRGLDMNTAEDAIVKNTREIVPGLIVGGMELSEVD  292

Query  320  GAPRMGPTFGAMMISGQKAAHLALKAL  240
            GA RMGPTFGAM++SG KAA  AL+  
Sbjct  293  GANRMGPTFGAMVLSGVKAAEEALRVF  319



>gb|ABG46357.1| mitochondrial thiazole biosynthetic enzyme [Trichoderma harzianum]
Length=322

 Score =   181 bits (458),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 91/146 (62%), Positives = 107/146 (73%), Gaps = 4/146 (3%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNG----RVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCG  498
            PNVKLF A   EDLI +      R+ GVVTNW LVSM  D QSCMDPN + A +V+S+ G
Sbjct  168  PNVKLFNATCVEDLITRPSAEGVRIAGVVTNWTLVSMHHDDQSCMDPNTINAPLVISTTG  227

Query  497  HDGPFGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDG  318
            HDGP G   VKRL S+G I+ + GM+ LDMN AEDAIV+ TRE+VPG+IV GME++EIDG
Sbjct  228  HDGPMGAFCVKRLVSMGRIEKLGGMRGLDMNRAEDAIVKNTREVVPGLIVGGMELSEIDG  287

Query  317  APRMGPTFGAMMISGQKAAHLALKAL  240
            A RMGPTFGAM +SG KAA  ALK  
Sbjct  288  ANRMGPTFGAMALSGVKAAEEALKVF  313



>gb|KHK14205.1| ribulose-1,5-biphosphate synthetase [Listeria monocytogenes SHL007]
Length=101

 Score =   174 bits (440),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 83/95 (87%), Positives = 87/95 (92%), Gaps = 0/95 (0%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCGHDGP  486
            PNVKLF AVAAEDLI+K  RV GVVTNWALVSM  D+QSCMDPNVMEAK+VVSSCGHDGP
Sbjct  5    PNVKLFNAVAAEDLIIKEDRVSGVVTNWALVSMNHDSQSCMDPNVMEAKVVVSSCGHDGP  64

Query  485  FGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVR  381
            FG TGVKRLKSIGMID VPGMKALDMNTAEDAIV+
Sbjct  65   FGATGVKRLKSIGMIDKVPGMKALDMNTAEDAIVK  99



>gb|EHK27008.1| hypothetical protein TRIVIDRAFT_215037 [Trichoderma virens Gv29-8]
Length=322

 Score =   181 bits (458),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 91/144 (63%), Positives = 107/144 (74%), Gaps = 4/144 (3%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNG----RVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCG  498
            PNVKLF A   EDLI +      R+ GVVTNW LVSM  D QSCMDPN + A +V+S+ G
Sbjct  168  PNVKLFNATCVEDLITRPSAEGVRIAGVVTNWTLVSMHHDDQSCMDPNTINAPLVISTTG  227

Query  497  HDGPFGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDG  318
            HDGP G   VKRL S+G I+ + GM+ LDMN AEDAIV+ TRE+VPG+IV GME++EIDG
Sbjct  228  HDGPMGAFCVKRLVSMGRIEKLGGMRGLDMNRAEDAIVKNTREVVPGLIVGGMELSEIDG  287

Query  317  APRMGPTFGAMMISGQKAAHLALK  246
            A RMGPTFGAM +SG KAA  ALK
Sbjct  288  ANRMGPTFGAMALSGVKAAEEALK  311



>ref|XP_008026201.1| hypothetical protein SETTUDRAFT_177413 [Setosphaeria turcica 
Et28A]
 gb|EOA86208.1| hypothetical protein SETTUDRAFT_177413 [Setosphaeria turcica 
Et28A]
Length=335

 Score =   181 bits (458),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 92/156 (59%), Positives = 110/156 (71%), Gaps = 9/156 (6%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNG---------RVGGVVTNWALVSMXXDTQSCMDPNVMEAKIV  513
            PNVKLF A A EDLI +           R+ GVVTNW LVSM  D QSCMDPN + A +V
Sbjct  174  PNVKLFNATAVEDLITRPAPTANDPNAVRIAGVVTNWTLVSMHHDDQSCMDPNTINAPLV  233

Query  512  VSSCGHDGPFGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEV  333
            +S+ GHDGPFG   VKRL S+  I+ + GM+ LDM TAEDAIV+ TREIVPG+IV GME+
Sbjct  234  ISTTGHDGPFGAFCVKRLVSMQQIEKLGGMRGLDMRTAEDAIVKRTREIVPGLIVGGMEL  293

Query  332  AEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNA  225
            +E+DGA RMGPTFGAM +SG KAA  A+    E +A
Sbjct  294  SEVDGANRMGPTFGAMALSGVKAAEEAMNVWEERHA  329



>ref|XP_007794010.1| putative thiazole biosynthetic enzyme protein [Eutypa lata UCREL1]
 gb|EMR66906.1| putative thiazole biosynthetic enzyme protein [Eutypa lata UCREL1]
Length=326

 Score =   180 bits (457),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 90/150 (60%), Positives = 107/150 (71%), Gaps = 6/150 (4%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNG------RVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSS  504
            PNVKLF A A EDLI +        RV GVVTNW LVSM  D QSCMDPN + A +++S+
Sbjct  170  PNVKLFNATAVEDLITRRDEADGSIRVAGVVTNWTLVSMHHDDQSCMDPNTINAPVIIST  229

Query  503  CGHDGPFGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEI  324
             GHDGPFG    KRL S+G ++ + GM+ LDMN AEDAIV+ TRE+VPG+I  GME++EI
Sbjct  230  TGHDGPFGAFSAKRLVSMGALERLGGMRGLDMNRAEDAIVKGTREVVPGLICGGMELSEI  289

Query  323  DGAPRMGPTFGAMMISGQKAAHLALKALGE  234
            DGA RMGPTFGAM +SG KAA  AL    E
Sbjct  290  DGANRMGPTFGAMALSGVKAAEEALAVFEE  319



>emb|CEJ80029.1| Putative Thiamine thiazole synthase [Torrubiella hemipterigena]
Length=329

 Score =   180 bits (457),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 91/150 (61%), Positives = 109/150 (73%), Gaps = 6/150 (4%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNG------RVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSS  504
            PNVKLF A   EDLI + G      R+ GVVTNW LVSM  D QSCMDPN +   ++VS+
Sbjct  173  PNVKLFNATCVEDLITRPGLDGEGVRIAGVVTNWTLVSMHHDDQSCMDPNTINCPLIVST  232

Query  503  CGHDGPFGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEI  324
             GHDGP G   VKRL S+  I+ + GM+ LDMNTAEDAIV+ TREIVPG+IV GME++E+
Sbjct  233  TGHDGPMGAFCVKRLVSMQRIEKLGGMRGLDMNTAEDAIVKGTREIVPGLIVGGMELSEV  292

Query  323  DGAPRMGPTFGAMMISGQKAAHLALKALGE  234
            DGA RMGPTFGAM++SG KAA  ALK   +
Sbjct  293  DGANRMGPTFGAMVLSGVKAAEEALKVFDQ  322



>emb|CCF45087.1| thiazole biosynthetic enzyme [Colletotrichum higginsianum]
Length=322

 Score =   180 bits (456),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 91/144 (63%), Positives = 106/144 (74%), Gaps = 5/144 (3%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNG-----RVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSC  501
            PNVKLF A   EDLI +       RV GVVTNW LVSM  D QSCMDPN + A +V+S+ 
Sbjct  167  PNVKLFNATTVEDLITRKNEDGTLRVAGVVTNWTLVSMHHDDQSCMDPNTINAPLVISTT  226

Query  500  GHDGPFGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEID  321
            GHDGPFG   VKRL S+  I+ + GM+ LDM TAEDAIV+ TREIVPG+IV GME++E+D
Sbjct  227  GHDGPFGAFCVKRLVSMKQIEQLGGMRGLDMQTAEDAIVKGTREIVPGLIVGGMELSEVD  286

Query  320  GAPRMGPTFGAMMISGQKAAHLAL  249
            GA RMGPTFGAM +SG KAA  AL
Sbjct  287  GANRMGPTFGAMALSGVKAAEEAL  310



>ref|XP_007913237.1| putative thiazole biosynthetic enzyme protein [Togninia minima 
UCRPA7]
 gb|EOO01967.1| putative thiazole biosynthetic enzyme protein [Togninia minima 
UCRPA7]
Length=326

 Score =   180 bits (456),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 89/149 (60%), Positives = 108/149 (72%), Gaps = 7/149 (5%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNG-------RVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVS  507
            PN+KLF A A EDLI +         R+ GVVTNW LVSM  D QSCMDPN + A +V+S
Sbjct  169  PNIKLFNATAVEDLITRPSAGEEDGVRIAGVVTNWTLVSMHHDDQSCMDPNTINAPLVIS  228

Query  506  SCGHDGPFGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAE  327
            + GHDGPFG   VKRL S+  ++ + GM+ LDM +AEDAIV+ TREIVPG+IV GME++E
Sbjct  229  TTGHDGPFGAFSVKRLVSMKQLEQLGGMRGLDMASAEDAIVKGTREIVPGLIVGGMELSE  288

Query  326  IDGAPRMGPTFGAMMISGQKAAHLALKAL  240
            +DGA RMGPTFGAM +SG KAA  ALK  
Sbjct  289  VDGANRMGPTFGAMALSGVKAAEEALKVF  317



>ref|NP_596642.1| thiazole biosynthetic enzyme [Schizosaccharomyces pombe 972h-]
 sp|P40998.2|THI4_SCHPO RecName: Full=Thiamine thiazole synthase; AltName: Full=Thiazole 
biosynthetic enzyme [Schizosaccharomyces pombe 972h-]
 emb|CAA21093.1| thiazole biosynthetic enzyme [Schizosaccharomyces pombe]
Length=328

 Score =   180 bits (456),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 91/154 (59%), Positives = 107/154 (69%), Gaps = 5/154 (3%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNG-----RVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSC  501
            PNVKLF A A EDLIVK G     R+ GVVTNW LVS+    QSCMDPN + A +VVS+ 
Sbjct  171  PNVKLFNATAVEDLIVKEGKDGKQRIAGVVTNWTLVSLNHGLQSCMDPNTINAHLVVSAT  230

Query  500  GHDGPFGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEID  321
            GHDGPFG   VKRL S  ++ ++  M+ LDMN AED IV+ TRE+ PGMIV GME++E D
Sbjct  231  GHDGPFGAFCVKRLASAQLVSNLHDMRPLDMNRAEDLIVKGTREVFPGMIVGGMELSEFD  290

Query  320  GAPRMGPTFGAMMISGQKAAHLALKALGEPNALD  219
            GA RMGPTFG MM SG KAA  AL    E  A++
Sbjct  291  GANRMGPTFGGMMFSGIKAAQEALAIFDERKAVN  324



>ref|XP_008598283.1| mitochondrial thiazole biosynthetic enzyme [Beauveria bassiana 
ARSEF 2860]
 gb|EJP65993.1| mitochondrial thiazole biosynthetic enzyme [Beauveria bassiana 
ARSEF 2860]
Length=330

 Score =   180 bits (456),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 90/149 (60%), Positives = 108/149 (72%), Gaps = 7/149 (5%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNGR-------VGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVS  507
            PN+KLF A   EDLI + GR       + GVVTNW LVSM  D QSCMDPN + A +++S
Sbjct  173  PNIKLFNATCVEDLITRAGRDGDEGVRIAGVVTNWTLVSMHHDNQSCMDPNTINAPLIIS  232

Query  506  SCGHDGPFGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAE  327
            + GHDGP G   VKRL S+  I+ + GM+ LDMNTAEDAIV+ TREIVPG+IV GME++E
Sbjct  233  TTGHDGPMGAFCVKRLVSMQRIEKLGGMRGLDMNTAEDAIVKGTREIVPGLIVGGMELSE  292

Query  326  IDGAPRMGPTFGAMMISGQKAAHLALKAL  240
            +DGA RMGPTFGAM +SG KAA  ALK  
Sbjct  293  VDGANRMGPTFGAMALSGLKAAEEALKVF  321



>gb|KGQ06713.1| Thiamine thiazole synthase [Beauveria bassiana D1-5]
Length=330

 Score =   180 bits (456),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 90/149 (60%), Positives = 108/149 (72%), Gaps = 7/149 (5%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNGR-------VGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVS  507
            PN+KLF A   EDLI + GR       + GVVTNW LVSM  D QSCMDPN + A +++S
Sbjct  173  PNIKLFNATCVEDLITRAGRDGDEGVRIAGVVTNWTLVSMHHDDQSCMDPNTINAPLIIS  232

Query  506  SCGHDGPFGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAE  327
            + GHDGP G   VKRL S+  I+ + GM+ LDMNTAEDAIV+ TREIVPG+IV GME++E
Sbjct  233  TTGHDGPMGAFCVKRLVSMQRIEKLGGMRGLDMNTAEDAIVKGTREIVPGLIVGGMELSE  292

Query  326  IDGAPRMGPTFGAMMISGQKAAHLALKAL  240
            +DGA RMGPTFGAM +SG KAA  ALK  
Sbjct  293  VDGANRMGPTFGAMALSGLKAAEEALKVF  321



>ref|XP_001935439.1| thiazole biosynthesis enzyme [Pyrenophora tritici-repentis Pt-1C-BFP]
 gb|EDU48013.1| thiazole biosynthesis enzyme [Pyrenophora tritici-repentis Pt-1C-BFP]
Length=329

 Score =   180 bits (456),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 91/156 (58%), Positives = 109/156 (70%), Gaps = 9/156 (6%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNG---------RVGGVVTNWALVSMXXDTQSCMDPNVMEAKIV  513
            PNVKLF A A EDLI +           R+ GVVTNW LVSM  D QSCMDPN + A +V
Sbjct  169  PNVKLFNATAVEDLITRPAPTSSDPNAIRIAGVVTNWTLVSMHHDDQSCMDPNTINAPLV  228

Query  512  VSSCGHDGPFGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEV  333
            +S+ GHDGPFG   VKRL S+  I+ + GM+ LDM TAEDAIV+ TRE+VPG+IV GME+
Sbjct  229  ISTTGHDGPFGAFCVKRLVSMQQIEKLGGMRGLDMRTAEDAIVKRTREVVPGLIVGGMEL  288

Query  332  AEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNA  225
            +E+DGA RMGPTFGAM +SG KAA  A+    E  A
Sbjct  289  SEVDGANRMGPTFGAMALSGVKAAEEAVSVWEERQA  324



>gb|ABN45968.1| thiazole biosynthetic enzyme variant 1 [Epichloe typhina]
 gb|ABN45969.1| thiazole biosynthetic enzyme variant 2 [Epichloe typhina]
 gb|ABN45970.1| thiazole biosynthetic enzyme variant 3 [Epichloe typhina]
 gb|ABN45971.1| thiazole biosynthetic enzyme variant 4 [Epichloe typhina]
 gb|ABN45972.1| thiazole biosynthetic enzyme variant 5 [Epichloe typhina]
Length=320

 Score =   179 bits (455),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 89/146 (61%), Positives = 108/146 (74%), Gaps = 4/146 (3%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNG----RVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCG  498
            PN+K+F A   EDLI +      R+ GVVTNW LVSM  D QSCMDPN + A +V+S+ G
Sbjct  166  PNIKMFNATCVEDLITRPSEEGVRISGVVTNWTLVSMHHDDQSCMDPNTINAPLVISTTG  225

Query  497  HDGPFGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDG  318
            HDGP G   VKRL S+  I+ + GM+ LDMNTAEDAIV+ TREIVPG+IV GME++E+DG
Sbjct  226  HDGPMGAFCVKRLVSMQRIEKLGGMRGLDMNTAEDAIVKNTREIVPGLIVGGMELSEVDG  285

Query  317  APRMGPTFGAMMISGQKAAHLALKAL  240
            A RMGPTFGAM++SG KAA  ALK  
Sbjct  286  ANRMGPTFGAMVLSGLKAAEEALKVF  311



>ref|XP_003297921.1| hypothetical protein PTT_08482 [Pyrenophora teres f. teres 0-1]
 gb|EFQ93956.1| hypothetical protein PTT_08482 [Pyrenophora teres f. teres 0-1]
Length=329

 Score =   179 bits (455),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 91/156 (58%), Positives = 109/156 (70%), Gaps = 9/156 (6%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNG---------RVGGVVTNWALVSMXXDTQSCMDPNVMEAKIV  513
            PNVKLF A A EDLI +           R+ GVVTNW LVSM  D QSCMDPN + A +V
Sbjct  169  PNVKLFNATAVEDLITRPAPTSSDPNAIRIAGVVTNWTLVSMHHDDQSCMDPNTINAPLV  228

Query  512  VSSCGHDGPFGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEV  333
            +S+ GHDGPFG   VKRL S+  I+ + GM+ LDM TAEDAIV+ TRE+VPG+IV GME+
Sbjct  229  ISTTGHDGPFGAFCVKRLVSMQQIEKLGGMRGLDMRTAEDAIVKRTREVVPGLIVGGMEL  288

Query  332  AEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNA  225
            +E+DGA RMGPTFGAM +SG KAA  A+    E  A
Sbjct  289  SEVDGANRMGPTFGAMALSGVKAAEEAVNVWEERKA  324



>ref|XP_007277744.1| thiazole biosynthetic enzyme [Colletotrichum gloeosporioides 
Nara gc5]
 gb|ELA33205.1| thiazole biosynthetic enzyme [Colletotrichum gloeosporioides 
Nara gc5]
Length=269

 Score =   177 bits (450),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 90/144 (63%), Positives = 105/144 (73%), Gaps = 5/144 (3%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNG-----RVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSC  501
            PNVKLF A A EDLI +       RV GVVTNW LVSM  D QSCMDPN + A +V+S+ 
Sbjct  114  PNVKLFNATAVEDLITRKEADGSVRVAGVVTNWTLVSMHHDDQSCMDPNTINAPLVISTT  173

Query  500  GHDGPFGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEID  321
            GHDGPFG   VKRL S+  I+ + GM+ LDM  AEDAIV+ TREIV G+IV GME++E+D
Sbjct  174  GHDGPFGAFSVKRLVSMKQIEQLGGMRGLDMKEAEDAIVKGTREIVKGLIVGGMELSEVD  233

Query  320  GAPRMGPTFGAMMISGQKAAHLAL  249
            GA RMGPTFGAM +SG KAA  AL
Sbjct  234  GANRMGPTFGAMALSGVKAAEEAL  257



>emb|CEJ80028.1| Putative Thiamine thiazole synthase [Torrubiella hemipterigena]
Length=381

 Score =   181 bits (458),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 91/150 (61%), Positives = 109/150 (73%), Gaps = 6/150 (4%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNG------RVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSS  504
            PNVKLF A   EDLI + G      R+ GVVTNW LVSM  D QSCMDPN +   ++VS+
Sbjct  225  PNVKLFNATCVEDLITRPGLDGEGVRIAGVVTNWTLVSMHHDDQSCMDPNTINCPLIVST  284

Query  503  CGHDGPFGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEI  324
             GHDGP G   VKRL S+  I+ + GM+ LDMNTAEDAIV+ TREIVPG+IV GME++E+
Sbjct  285  TGHDGPMGAFCVKRLVSMQRIEKLGGMRGLDMNTAEDAIVKGTREIVPGLIVGGMELSEV  344

Query  323  DGAPRMGPTFGAMMISGQKAAHLALKALGE  234
            DGA RMGPTFGAM++SG KAA  ALK   +
Sbjct  345  DGANRMGPTFGAMVLSGVKAAEEALKVFDQ  374



>ref|XP_006968797.1| thiazole biosynthetic enzyme [Trichoderma reesei QM6a]
 gb|EGR45359.1| thiazole biosynthetic enzyme [Trichoderma reesei QM6a]
 gb|ETR98040.1| thiazole biosynthetic enzyme [Trichoderma reesei RUT C-30]
Length=324

 Score =   179 bits (454),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 90/146 (62%), Positives = 107/146 (73%), Gaps = 4/146 (3%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNG----RVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCG  498
            PNVKLF A   EDLI +      R+ GVVTNW LVSM  D QSCMDPN + A +V+S+ G
Sbjct  170  PNVKLFNATCVEDLITRPSAEGVRIAGVVTNWTLVSMHHDDQSCMDPNTINAPLVISTTG  229

Query  497  HDGPFGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDG  318
            HDGP G   VKRL S+G I+ + GM+ LDM+ AEDAIV+ TRE+VPG+IV GME++EIDG
Sbjct  230  HDGPMGAFCVKRLVSMGRIEKLGGMRGLDMSRAEDAIVKNTREVVPGLIVGGMELSEIDG  289

Query  317  APRMGPTFGAMMISGQKAAHLALKAL  240
            A RMGPTFGAM +SG KAA  ALK  
Sbjct  290  ANRMGPTFGAMALSGVKAAEEALKVF  315



>gb|ENH83973.1| thiazole biosynthetic enzyme [Colletotrichum orbiculare MAFF 
240422]
Length=329

 Score =   179 bits (454),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 89/144 (62%), Positives = 105/144 (73%), Gaps = 5/144 (3%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNG-----RVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSC  501
            PNVKLF A   EDLI +       R+ GVVTNW LVSM  D QSCMDPN + A +V+S+ 
Sbjct  174  PNVKLFNATTVEDLITRKDESGRVRIAGVVTNWTLVSMHHDDQSCMDPNTINAPLVISTT  233

Query  500  GHDGPFGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEID  321
            GHDGPFG   VKRL S+  I+ + GM+ LDM  AEDAIV+ TREIVPG+IV GME++E+D
Sbjct  234  GHDGPFGAFSVKRLVSMKQIEQLGGMRGLDMQAAEDAIVKGTREIVPGLIVGGMELSEVD  293

Query  320  GAPRMGPTFGAMMISGQKAAHLAL  249
            GA RMGPTFGAM +SG KAA  AL
Sbjct  294  GANRMGPTFGAMALSGVKAAEEAL  317



>ref|XP_002172093.1| thiazole biosynthetic enzyme [Schizosaccharomyces japonicus yFS275]
 gb|EEB05800.1| thiazole biosynthetic enzyme [Schizosaccharomyces japonicus yFS275]
Length=326

 Score =   179 bits (453),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 90/154 (58%), Positives = 106/154 (69%), Gaps = 5/154 (3%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKN-----GRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSC  501
            PN+KLF A A EDLIVK       R+ GVVTNW LVS+   TQSCMDPN + A +VVS+ 
Sbjct  165  PNIKLFNATAVEDLIVKEDEKGEQRIAGVVTNWTLVSLNHGTQSCMDPNTLNAHVVVSAT  224

Query  500  GHDGPFGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEID  321
            GHDGPFG   VKRL    +I ++  M+ LDMN AED IV+ TREI PG+I TGME++E+D
Sbjct  225  GHDGPFGAFCVKRLAKAKLIPALGDMRCLDMNRAEDHIVKGTREIYPGLIATGMELSEVD  284

Query  320  GAPRMGPTFGAMMISGQKAAHLALKALGEPNALD  219
            G  RMG TFGAMM SG KAA  AL    E  AL+
Sbjct  285  GRNRMGATFGAMMFSGVKAAQTALSIFDERRALN  318



>gb|KDB14289.1| thiazole biosynthetic enzyme variant 1 [Ustilaginoidea virens]
Length=321

 Score =   179 bits (453),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 89/146 (61%), Positives = 107/146 (73%), Gaps = 4/146 (3%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVKNG----RVGGVVTNWALVSMXXDTQSCMDPNVMEAKIVVSSCG  498
            PNVK+F A   EDLI +      R+ GVVTNW LVSM  D QSCMDPN + A +V+S+ G
Sbjct  167  PNVKMFNATCVEDLITRPSEQGVRISGVVTNWTLVSMHHDDQSCMDPNTINAPLVISTTG  226

Query  497  HDGPFGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDG  318
            HDGP G   VKRL S+  I+ + GM+ LDMN+AEDAIV+ TREIVPG+IV GME++E+DG
Sbjct  227  HDGPMGAFSVKRLVSMQRIEKLGGMRGLDMNSAEDAIVKNTREIVPGLIVGGMELSEVDG  286

Query  317  APRMGPTFGAMMISGQKAAHLALKAL  240
            A RMGPTFGAM +SG KAA  ALK  
Sbjct  287  ANRMGPTFGAMALSGLKAAEEALKVF  312



>ref|XP_006666857.1| thiazole biosynthetic enzyme [Cordyceps militaris CM01]
 gb|EGX96980.1| thiazole biosynthetic enzyme [Cordyceps militaris CM01]
Length=330

 Score =   179 bits (453),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 90/151 (60%), Positives = 108/151 (72%), Gaps = 9/151 (6%)
 Frame = -1

Query  665  PNVKLFXAVAAEDLIVK---------NGRVGGVVTNWALVSMXXDTQSCMDPNVMEAKIV  513
            PN+KLF A   EDLI +         N R+ GVVTNW LVSM  D QSCMDPN + A ++
Sbjct  171  PNIKLFNATCVEDLITRAAPAGDDPANVRIAGVVTNWTLVSMHHDDQSCMDPNTINAPLI  230

Query  512  VSSCGHDGPFGXTGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEV  333
            +S+ GHDGP G   VKRL S+  I+ + GM+ LDMNTAEDAIV+ TREIVPG+IV GME+
Sbjct  231  ISTTGHDGPMGAFCVKRLVSMQRIEKLGGMRGLDMNTAEDAIVKGTREIVPGLIVGGMEL  290

Query  332  AEIDGAPRMGPTFGAMMISGQKAAHLALKAL  240
            +E+DGA RMGPTFGAM +SG KAA  ALK  
Sbjct  291  SEVDGANRMGPTFGAMALSGVKAAEEALKVF  321



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1050626367960