BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF008M19

Length=730
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009798984.1|  PREDICTED: probable protein S-acyltransferas...  99.8    2e-22   Nicotiana sylvestris
ref|XP_006347869.1|  PREDICTED: probable protein S-acyltransferas...  99.0    7e-21   Solanum tuberosum [potatoes]
ref|XP_006364242.1|  PREDICTED: probable protein S-acyltransferas...  98.2    1e-20   Solanum tuberosum [potatoes]
ref|XP_004248564.1|  PREDICTED: probable protein S-acyltransferas...  98.2    1e-20   Solanum lycopersicum
ref|XP_009610572.1|  PREDICTED: probable protein S-acyltransferas...  97.8    2e-20   Nicotiana tomentosiformis
ref|XP_010325709.1|  PREDICTED: probable protein S-acyltransferas...  97.4    3e-20   Solanum lycopersicum
ref|XP_009791941.1|  PREDICTED: probable protein S-acyltransferas...  97.1    4e-20   Nicotiana sylvestris
gb|EYU31985.1|  hypothetical protein MIMGU_mgv1a010704mg              96.3    6e-20   Erythranthe guttata [common monkey flower]
ref|XP_009616135.1|  PREDICTED: probable protein S-acyltransferas...  95.9    9e-20   Nicotiana tomentosiformis
emb|CDO97688.1|  unnamed protein product                              95.5    1e-19   Coffea canephora [robusta coffee]
ref|XP_011090630.1|  PREDICTED: probable protein S-acyltransferas...  93.6    5e-19   Sesamum indicum [beniseed]
ref|XP_007218730.1|  hypothetical protein PRUPE_ppa009076mg           93.6    5e-19   Prunus persica
ref|XP_010692246.1|  PREDICTED: probable protein S-acyltransferas...  93.6    5e-19   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008438165.1|  PREDICTED: probable protein S-acyltransferas...  93.6    6e-19   Cucumis melo [Oriental melon]
ref|XP_004133913.1|  PREDICTED: probable S-acyltransferase At3g60...  93.2    6e-19   Cucumis sativus [cucumbers]
ref|XP_002511714.1|  zinc finger protein, putative                    93.2    6e-19   Ricinus communis
gb|KJB09890.1|  hypothetical protein B456_001G174100                  93.2    8e-19   Gossypium raimondii
gb|KJB09889.1|  hypothetical protein B456_001G174100                  93.2    8e-19   Gossypium raimondii
gb|KHG00286.1|  hypothetical protein F383_19583                       93.2    8e-19   Gossypium arboreum [tree cotton]
ref|XP_006445267.1|  hypothetical protein CICLE_v10021302mg           92.8    1e-18   Citrus clementina [clementine]
ref|XP_008393352.1|  PREDICTED: probable protein S-acyltransferas...  92.4    1e-18   
ref|XP_010098912.1|  putative S-acyltransferase                       92.4    1e-18   Morus notabilis
ref|XP_009338113.1|  PREDICTED: probable protein S-acyltransferas...  92.0    2e-18   Pyrus x bretschneideri [bai li]
gb|KDP28757.1|  hypothetical protein JCGZ_14528                       92.0    2e-18   Jatropha curcas
ref|XP_010255627.1|  PREDICTED: probable protein S-acyltransferas...  92.0    2e-18   Nelumbo nucifera [Indian lotus]
ref|XP_010918308.1|  PREDICTED: probable protein S-acyltransferas...  91.7    2e-18   Elaeis guineensis
ref|XP_011469138.1|  PREDICTED: probable protein S-acyltransferas...  91.7    2e-18   Fragaria vesca subsp. vesca
ref|XP_004975099.1|  PREDICTED: probable S-acyltransferase At3g60...  91.7    3e-18   Setaria italica
gb|AFW57919.1|  palmitoyltransferase ZDHHC20, mRNA                    90.9    3e-18   
ref|XP_010056317.1|  PREDICTED: probable protein S-acyltransferas...  91.3    3e-18   Eucalyptus grandis [rose gum]
ref|XP_007052066.1|  DHHC-type zinc finger family protein isoform 1   91.7    3e-18   
gb|AES87286.2|  DHHC-type zinc finger protein                         91.3    4e-18   Medicago truncatula
ref|XP_011034295.1|  PREDICTED: probable protein S-acyltransferas...  91.3    4e-18   Populus euphratica
emb|CBI38870.3|  unnamed protein product                              90.9    4e-18   Vitis vinifera
gb|ABK24332.1|  unknown                                               91.3    4e-18   Picea sitchensis
ref|XP_003605089.1|  Palmitoyltransferase pfa3                        90.9    4e-18   
ref|XP_002279896.1|  PREDICTED: probable protein S-acyltransferas...  90.9    4e-18   Vitis vinifera
ref|XP_010276626.1|  PREDICTED: probable protein S-acyltransferas...  90.9    4e-18   Nelumbo nucifera [Indian lotus]
emb|CDX71777.1|  BnaC08g30970D                                        90.9    4e-18   
ref|XP_009116762.1|  PREDICTED: probable protein S-acyltransferas...  90.9    4e-18   Brassica rapa
emb|CDY52347.1|  BnaA09g38960D                                        90.9    4e-18   Brassica napus [oilseed rape]
ref|XP_003579517.1|  PREDICTED: probable protein S-acyltransferas...  90.9    4e-18   Brachypodium distachyon [annual false brome]
ref|NP_001148846.1|  palmitoyltransferase ZDHHC20                     90.9    4e-18   Zea mays [maize]
ref|XP_002446206.1|  hypothetical protein SORBIDRAFT_06g004040        90.9    5e-18   Sorghum bicolor [broomcorn]
ref|XP_008232660.1|  PREDICTED: probable protein S-acyltransferas...  92.8    7e-18   Prunus mume [ume]
ref|XP_011017489.1|  PREDICTED: probable protein S-acyltransferas...  90.5    7e-18   Populus euphratica
gb|ACU19432.1|  unknown                                               90.5    7e-18   Glycine max [soybeans]
ref|XP_006587892.1|  PREDICTED: probable protein S-acyltransferas...  90.1    8e-18   Glycine max [soybeans]
gb|EMS35725.1|  hypothetical protein TRIUR3_29953                     85.9    8e-18   Triticum urartu
gb|KJB41110.1|  hypothetical protein B456_007G090900                  90.1    9e-18   Gossypium raimondii
gb|KHG30156.1|  hypothetical protein F383_14468                       89.7    1e-17   Gossypium arboreum [tree cotton]
ref|XP_009389071.1|  PREDICTED: probable protein S-acyltransferas...  89.7    1e-17   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008343300.1|  PREDICTED: probable protein S-acyltransferas...  89.0    2e-17   Malus domestica [apple tree]
gb|KFK35280.1|  hypothetical protein AALP_AA5G264300                  89.0    2e-17   Arabis alpina [alpine rockcress]
ref|XP_010910428.1|  PREDICTED: probable protein S-acyltransferas...  86.3    2e-17   
gb|AHA84213.1|  palmitoyltransferase                                  89.0    2e-17   Phaseolus vulgaris [French bean]
ref|XP_003517050.1|  PREDICTED: probable protein S-acyltransferas...  89.0    2e-17   Glycine max [soybeans]
ref|XP_006402542.1|  hypothetical protein EUTSA_v10006120mg           89.0    2e-17   Eutrema salsugineum [saltwater cress]
ref|XP_007134881.1|  hypothetical protein PHAVU_010G083900g           89.0    2e-17   Phaseolus vulgaris [French bean]
emb|CDY51805.1|  BnaC04g53110D                                        88.6    2e-17   Brassica napus [oilseed rape]
ref|XP_003521795.1|  PREDICTED: probable protein S-acyltransferas...  88.6    2e-17   Glycine max [soybeans]
emb|CDX74736.1|  BnaA05g04820D                                        88.6    2e-17   
emb|CDX71345.1|  BnaC07g06240D                                        88.6    2e-17   
ref|XP_009398464.1|  PREDICTED: probable protein S-acyltransferas...  88.6    2e-17   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009143136.1|  PREDICTED: probable protein S-acyltransferas...  88.6    2e-17   Brassica rapa
ref|XP_009143135.1|  PREDICTED: probable protein S-acyltransferas...  89.0    3e-17   
emb|CDX89079.1|  BnaA04g01070D                                        88.6    3e-17   
ref|XP_002882009.1|  hypothetical protein ARALYDRAFT_903981           88.6    3e-17   Arabidopsis lyrata subsp. lyrata
ref|XP_010524364.1|  PREDICTED: probable protein S-acyltransferas...  88.6    3e-17   Tarenaya hassleriana [spider flower]
gb|KHN40573.1|  Putative S-acyltransferase                            89.0    3e-17   Glycine soja [wild soybean]
gb|KJB49336.1|  hypothetical protein B456_008G114100                  88.2    3e-17   Gossypium raimondii
ref|XP_009399491.1|  PREDICTED: probable protein S-acyltransferas...  88.6    3e-17   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB49335.1|  hypothetical protein B456_008G114100                  88.2    3e-17   Gossypium raimondii
ref|XP_006602748.1|  PREDICTED: probable protein S-acyltransferas...  88.2    4e-17   Glycine max [soybeans]
ref|XP_003552340.1|  PREDICTED: probable protein S-acyltransferas...  88.2    4e-17   Glycine max [soybeans]
gb|KHN29455.1|  Putative S-acyltransferase                            87.4    6e-17   Glycine soja [wild soybean]
ref|XP_008798535.1|  PREDICTED: probable protein S-acyltransferas...  87.4    7e-17   Phoenix dactylifera
ref|XP_004492612.1|  PREDICTED: probable S-acyltransferase At3g60...  87.4    8e-17   Cicer arietinum [garbanzo]
ref|XP_008776787.1|  PREDICTED: probable protein S-acyltransferas...  87.4    8e-17   Phoenix dactylifera
ref|XP_006397719.1|  hypothetical protein EUTSA_v10001560mg           87.0    8e-17   Eutrema salsugineum [saltwater cress]
ref|XP_010413515.1|  PREDICTED: probable protein S-acyltransferas...  85.1    8e-17   Camelina sativa [gold-of-pleasure]
dbj|BAJ93966.1|  predicted protein                                    87.0    8e-17   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006851861.1|  hypothetical protein AMTR_s00041p00097340        87.0    8e-17   
gb|EMT07089.1|  Putative S-acyltransferase                            87.0    9e-17   
ref|XP_006291552.1|  hypothetical protein CARUB_v10017708mg           86.7    1e-16   Capsella rubella
ref|XP_006652138.1|  PREDICTED: probable protein S-acyltransferas...  86.7    1e-16   Oryza brachyantha
ref|XP_010508175.1|  PREDICTED: probable protein S-acyltransferas...  86.3    2e-16   
ref|XP_010506482.1|  PREDICTED: probable protein S-acyltransferas...  85.9    2e-16   Camelina sativa [gold-of-pleasure]
gb|KJB37584.1|  hypothetical protein B456_006G211800                  85.9    2e-16   Gossypium raimondii
ref|XP_010910146.1|  PREDICTED: probable protein S-acyltransferas...  85.9    2e-16   Elaeis guineensis
ref|XP_002302535.2|  zinc finger family protein                       85.5    3e-16   
gb|KFK37316.1|  hypothetical protein AALP_AA4G241200                  85.5    3e-16   Arabis alpina [alpine rockcress]
ref|NP_001051618.1|  Os03g0804300                                     85.1    4e-16   
gb|KHG01247.1|  hypothetical protein F383_23406                       84.3    4e-16   Gossypium arboreum [tree cotton]
ref|XP_010647607.1|  PREDICTED: probable protein S-acyltransferas...  82.4    4e-16   
gb|EEC76365.1|  hypothetical protein OsI_13959                        85.1    4e-16   Oryza sativa Indica Group [Indian rice]
gb|KHG16541.1|  hypothetical protein F383_02611                       85.1    5e-16   Gossypium arboreum [tree cotton]
emb|CAB82684.1|  putative protein                                     84.7    5e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002878349.1|  zinc finger family protein                       84.7    5e-16   Arabidopsis lyrata subsp. lyrata
ref|NP_191639.2|  DHHC-type zinc finger family protein                84.7    5e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010469144.1|  PREDICTED: probable protein S-acyltransferas...  84.7    5e-16   Camelina sativa [gold-of-pleasure]
ref|XP_002535239.1|  zinc finger protein, putative                    84.3    6e-16   
ref|XP_010413516.1|  PREDICTED: probable protein S-acyltransferas...  84.7    6e-16   Camelina sativa [gold-of-pleasure]
ref|XP_010544651.1|  PREDICTED: probable protein S-acyltransferas...  84.3    8e-16   Tarenaya hassleriana [spider flower]
ref|XP_010518152.1|  PREDICTED: probable protein S-acyltransferas...  84.0    1e-15   Camelina sativa [gold-of-pleasure]
gb|EPS68199.1|  hypothetical protein M569_06570                       84.0    1e-15   Genlisea aurea
ref|XP_009138811.1|  PREDICTED: probable protein S-acyltransferas...  83.6    1e-15   Brassica rapa
ref|XP_007209402.1|  hypothetical protein PRUPE_ppa009226mg           83.2    2e-15   Prunus persica
gb|KJB37583.1|  hypothetical protein B456_006G211800                  85.1    2e-15   Gossypium raimondii
ref|XP_010108133.1|  putative S-acyltransferase                       82.8    3e-15   Morus notabilis
ref|XP_008238650.1|  PREDICTED: probable protein S-acyltransferas...  82.4    3e-15   Prunus mume [ume]
ref|XP_004952412.1|  PREDICTED: probable S-acyltransferase At3g60...  82.4    4e-15   Setaria italica
ref|XP_011033891.1|  PREDICTED: probable protein S-acyltransferas...  82.0    5e-15   Populus euphratica
ref|XP_010662159.1|  PREDICTED: probable protein S-acyltransferas...  81.6    6e-15   Vitis vinifera
ref|NP_001169109.1|  palmitoyltransferase ZDHHC20                     81.3    9e-15   Zea mays [maize]
ref|XP_009362134.1|  PREDICTED: probable protein S-acyltransferas...  80.9    1e-14   Pyrus x bretschneideri [bai li]
ref|XP_008345376.1|  PREDICTED: probable protein S-acyltransferas...  81.3    1e-14   
ref|XP_006368710.1|  hypothetical protein POPTR_0001s08000g           80.9    1e-14   
ref|XP_002304438.2|  hypothetical protein POPTR_0003s11520g           80.5    2e-14   Populus trichocarpa [western balsam poplar]
ref|XP_007039984.1|  DHHC-type zinc finger family protein             80.1    2e-14   
gb|KCW78273.1|  hypothetical protein EUGRSUZ_D02456                   79.3    3e-14   Eucalyptus grandis [rose gum]
gb|KDP42560.1|  hypothetical protein JCGZ_24334                       79.7    3e-14   Jatropha curcas
ref|XP_002994078.1|  hypothetical protein SELMODRAFT_449300           79.3    4e-14   Selaginella moellendorffii
ref|XP_010053896.1|  PREDICTED: probable protein S-acyltransferas...  79.3    4e-14   Eucalyptus grandis [rose gum]
ref|XP_011463771.1|  PREDICTED: probable protein S-acyltransferas...  79.3    5e-14   Fragaria vesca subsp. vesca
ref|XP_002989117.1|  hypothetical protein SELMODRAFT_184354           79.3    5e-14   
ref|XP_008437153.1|  PREDICTED: probable protein S-acyltransferas...  79.0    5e-14   Cucumis melo [Oriental melon]
emb|CDP08627.1|  unnamed protein product                              73.9    1e-13   Coffea canephora [robusta coffee]
ref|XP_004147573.1|  PREDICTED: probable S-acyltransferase At3g60...  77.8    1e-13   Cucumis sativus [cucumbers]
gb|KGN50197.1|  hypothetical protein Csa_5G158530                     77.8    2e-13   Cucumis sativus [cucumbers]
ref|XP_011029093.1|  PREDICTED: probable protein S-acyltransferas...  77.0    2e-13   Populus euphratica
ref|XP_011029092.1|  PREDICTED: probable protein S-acyltransferas...  77.0    3e-13   Populus euphratica
ref|XP_004515766.1|  PREDICTED: probable S-acyltransferase At3g60...  76.3    4e-13   Cicer arietinum [garbanzo]
ref|XP_001781101.1|  predicted protein                                72.8    9e-12   
gb|ADE76560.1|  unknown                                               72.8    9e-12   Picea sitchensis
ref|XP_010540019.1|  PREDICTED: probable protein S-acyltransferas...  72.4    1e-11   Tarenaya hassleriana [spider flower]
gb|KHG08036.1|  hypothetical protein F383_35334                       70.9    4e-11   Gossypium arboreum [tree cotton]
ref|XP_010100672.1|  putative S-acyltransferase                       70.1    5e-11   
gb|AFK47432.1|  unknown                                               65.9    8e-11   Medicago truncatula
gb|KJB25655.1|  hypothetical protein B456_004G202600                  68.9    8e-11   Gossypium raimondii
ref|XP_011039088.1|  PREDICTED: probable protein S-acyltransferas...  69.7    1e-10   Populus euphratica
gb|KJB09590.1|  hypothetical protein B456_001G151300                  68.6    1e-10   Gossypium raimondii
ref|XP_011039097.1|  PREDICTED: probable protein S-acyltransferas...  69.7    1e-10   Populus euphratica
ref|XP_008437841.1|  PREDICTED: probable protein S-acyltransferas...  69.3    1e-10   Cucumis melo [Oriental melon]
ref|XP_006491350.1|  PREDICTED: LOW QUALITY PROTEIN: probable pro...  69.3    2e-10   
ref|XP_006444753.1|  hypothetical protein CICLE_v10021463mg           68.9    2e-10   
gb|KDO86582.1|  hypothetical protein CISIN_1g021385mg                 69.3    2e-10   Citrus sinensis [apfelsine]
ref|XP_006444756.1|  hypothetical protein CICLE_v10021463mg           68.9    2e-10   
ref|XP_002320223.1|  hypothetical protein POPTR_0014s09980g           69.7    2e-10   
gb|KJB25653.1|  hypothetical protein B456_004G202600                  68.9    2e-10   Gossypium raimondii
ref|XP_003626591.1|  Palmitoyltransferase PFA4                        68.9    2e-10   Medicago truncatula
gb|KJB25654.1|  hypothetical protein B456_004G202600                  68.9    2e-10   Gossypium raimondii
ref|XP_004240115.1|  PREDICTED: probable protein S-acyltransferas...  68.9    2e-10   Solanum lycopersicum
ref|XP_010919145.1|  PREDICTED: probable protein S-acyltransferas...  68.9    2e-10   
gb|KJB09587.1|  hypothetical protein B456_001G151300                  68.6    2e-10   Gossypium raimondii
emb|CDX94118.1|  BnaC07g37520D                                        68.6    2e-10   
emb|CDX98764.1|  BnaA03g45490D                                        68.6    2e-10   
ref|XP_007051453.1|  DHHC-type zinc finger family protein             68.6    3e-10   
ref|XP_004167123.1|  PREDICTED: probable S-acyltransferase At4g00...  68.6    3e-10   
ref|XP_002263621.1|  PREDICTED: probable protein S-acyltransferas...  68.6    3e-10   Vitis vinifera
ref|XP_008355759.1|  PREDICTED: probable protein S-acyltransferas...  66.2    3e-10   
ref|XP_004494854.1|  PREDICTED: probable S-acyltransferase At4g00...  68.9    3e-10   
ref|XP_004133790.1|  PREDICTED: probable S-acyltransferase At4g00...  68.6    3e-10   Cucumis sativus [cucumbers]
ref|XP_009136121.1|  PREDICTED: probable protein S-acyltransferas...  64.3    4e-10   Brassica rapa
ref|XP_006440414.1|  hypothetical protein CICLE_v10021242mg           67.4    4e-10   
ref|XP_006602749.1|  PREDICTED: probable protein S-acyltransferas...  67.8    4e-10   Glycine max [soybeans]
ref|XP_009804295.1|  PREDICTED: probable protein S-acyltransferas...  65.9    4e-10   Nicotiana sylvestris
ref|XP_008779828.1|  PREDICTED: probable protein S-acyltransferas...  68.2    5e-10   Phoenix dactylifera
gb|KFK30666.1|  hypothetical protein AALP_AA6G012100                  67.8    5e-10   Arabis alpina [alpine rockcress]
emb|CDY41296.1|  BnaA01g12430D                                        64.7    5e-10   Brassica napus [oilseed rape]
ref|XP_002462839.1|  hypothetical protein SORBIDRAFT_02g032840        67.4    7e-10   Sorghum bicolor [broomcorn]
ref|XP_008779824.1|  PREDICTED: probable protein S-acyltransferas...  67.8    7e-10   Phoenix dactylifera
gb|KFK28858.1|  hypothetical protein AALP_AA7G057700                  67.4    7e-10   Arabis alpina [alpine rockcress]
gb|KDP28430.1|  hypothetical protein JCGZ_14201                       67.4    7e-10   Jatropha curcas
gb|KDO63753.1|  hypothetical protein CISIN_1g021223mg                 67.4    7e-10   Citrus sinensis [apfelsine]
ref|XP_006440415.1|  hypothetical protein CICLE_v10021242mg           67.4    7e-10   Citrus clementina [clementine]
ref|XP_006477282.1|  PREDICTED: probable protein S-acyltransferas...  67.4    7e-10   Citrus sinensis [apfelsine]
emb|CDX74374.1|  BnaA03g26730D                                        67.0    7e-10   
emb|CDX91862.1|  BnaC03g31640D                                        67.0    7e-10   
ref|XP_010054971.1|  PREDICTED: probable protein S-acyltransferas...  67.4    8e-10   Eucalyptus grandis [rose gum]
gb|KJB41112.1|  hypothetical protein B456_007G090900                  66.6    1e-09   Gossypium raimondii
ref|XP_009137276.1|  PREDICTED: probable protein S-acyltransferas...  66.6    1e-09   Brassica rapa
ref|XP_010448848.1|  PREDICTED: probable protein S-acyltransferas...  66.6    1e-09   Camelina sativa [gold-of-pleasure]
ref|XP_009134494.1|  PREDICTED: probable protein S-acyltransferas...  66.2    1e-09   Brassica rapa
dbj|BAJ34112.1|  unnamed protein product                              66.6    2e-09   Eutrema halophilum
ref|XP_006830293.1|  hypothetical protein AMTR_s00121p00069490        66.6    2e-09   
emb|CDY07150.1|  BnaCnng01650D                                        66.2    2e-09   
ref|XP_008233069.1|  PREDICTED: probable protein S-acyltransferas...  66.2    2e-09   Prunus mume [ume]
ref|XP_004506505.1|  PREDICTED: probable S-acyltransferase At3g60...  66.2    2e-09   Cicer arietinum [garbanzo]
ref|XP_010267431.1|  PREDICTED: probable protein S-acyltransferas...  65.9    2e-09   
ref|XP_010267425.1|  PREDICTED: probable protein S-acyltransferas...  66.2    2e-09   Nelumbo nucifera [Indian lotus]
ref|XP_010433998.1|  PREDICTED: probable protein S-acyltransferas...  66.2    2e-09   Camelina sativa [gold-of-pleasure]
ref|XP_006360644.1|  PREDICTED: probable protein S-acyltransferas...  66.2    2e-09   Solanum tuberosum [potatoes]
ref|XP_010439292.1|  PREDICTED: probable protein S-acyltransferas...  65.9    2e-09   Camelina sativa [gold-of-pleasure]
ref|XP_009366621.1|  PREDICTED: LOW QUALITY PROTEIN: probable pro...  65.9    3e-09   Pyrus x bretschneideri [bai li]
ref|XP_008376192.1|  PREDICTED: probable protein S-acyltransferas...  65.9    3e-09   Malus domestica [apple tree]
ref|XP_009607103.1|  PREDICTED: probable protein S-acyltransferas...  65.1    3e-09   
ref|XP_006288366.1|  hypothetical protein CARUB_v10001614mg           65.5    4e-09   Capsella rubella
ref|XP_004306624.1|  PREDICTED: probable protein S-acyltransferas...  65.5    4e-09   Fragaria vesca subsp. vesca
gb|KJB49337.1|  hypothetical protein B456_008G114100                  65.1    4e-09   Gossypium raimondii
ref|XP_002872926.1|  zinc ion binding protein                         65.1    4e-09   Arabidopsis lyrata subsp. lyrata
ref|XP_010456165.1|  PREDICTED: probable protein S-acyltransferas...  65.1    5e-09   
ref|XP_009111388.1|  PREDICTED: LOW QUALITY PROTEIN: probable pro...  65.1    5e-09   Brassica rapa
ref|XP_010422733.1|  PREDICTED: probable protein S-acyltransferas...  65.1    5e-09   Camelina sativa [gold-of-pleasure]
ref|XP_010428132.1|  PREDICTED: probable protein S-acyltransferas...  64.7    5e-09   Camelina sativa [gold-of-pleasure]
emb|CDY51717.1|  BnaA09g52040D                                        64.7    5e-09   Brassica napus [oilseed rape]
ref|XP_006657678.1|  PREDICTED: probable protein S-acyltransferas...  63.9    5e-09   Oryza brachyantha
ref|XP_006413626.1|  hypothetical protein EUTSA_v10024722mg           65.5    6e-09   
ref|XP_004957652.1|  PREDICTED: probable S-acyltransferase At4g00...  64.7    6e-09   Setaria italica
ref|XP_010238650.1|  PREDICTED: probable protein S-acyltransferas...  64.7    7e-09   
tpg|DAA40774.1|  TPA: hypothetical protein ZEAMMB73_782285            63.9    7e-09   
ref|XP_003560239.2|  PREDICTED: probable protein S-acyltransferas...  64.7    7e-09   Brachypodium distachyon [annual false brome]
ref|XP_009136109.1|  PREDICTED: probable protein S-acyltransferas...  64.7    7e-09   Brassica rapa
ref|XP_006283414.1|  hypothetical protein CARUB_v10004463mg           65.1    8e-09   
ref|NP_567668.1|  DHHC-type zinc finger family protein                64.3    9e-09   Arabidopsis thaliana [mouse-ear cress]
gb|ACF85839.1|  unknown                                               63.9    1e-08   Zea mays [maize]
ref|XP_009401747.1|  PREDICTED: probable protein S-acyltransferas...  64.3    1e-08   Musa acuminata subsp. malaccensis [pisang utan]
gb|AAM65313.1|  unknown                                               64.3    1e-08   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001154264.1|  DHHC-type zinc finger family protein             64.3    1e-08   
ref|XP_006396329.1|  hypothetical protein EUTSA_v10028856mg           63.9    1e-08   Eutrema salsugineum [saltwater cress]
ref|XP_010556619.1|  PREDICTED: probable protein S-acyltransferas...  63.2    2e-08   Tarenaya hassleriana [spider flower]
ref|XP_003521821.1|  PREDICTED: probable protein S-acyltransferas...  63.2    2e-08   Glycine max [soybeans]
ref|NP_567193.2|  putative S-acyltransferase                          63.2    2e-08   Arabidopsis thaliana [mouse-ear cress]
emb|CAA16560.1|  predicted protein                                    63.5    3e-08   Arabidopsis thaliana [mouse-ear cress]
gb|EMT22691.1|  hypothetical protein F775_15921                       60.8    3e-08   
ref|NP_001190801.1|  sterol 4-alpha methyl oxidase 1-3                63.2    3e-08   
ref|XP_002867753.1|  hypothetical protein ARALYDRAFT_329352           63.5    4e-08   
ref|XP_006598426.1|  PREDICTED: uncharacterized protein LOC100817234  63.2    4e-08   
dbj|BAK01014.1|  predicted protein                                    62.8    4e-08   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_007147347.1|  hypothetical protein PHAVU_006G116400g           62.0    5e-08   Phaseolus vulgaris [French bean]
gb|EEC81995.1|  hypothetical protein OsI_25930                        61.6    7e-08   Oryza sativa Indica Group [Indian rice]
gb|EEE67131.1|  hypothetical protein OsJ_24176                        61.6    7e-08   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009136132.1|  PREDICTED: probable protein S-acyltransferas...  59.7    3e-07   Brassica rapa
ref|XP_010691320.1|  PREDICTED: probable protein S-acyltransferas...  58.5    1e-06   Beta vulgaris subsp. vulgaris [field beet]
gb|EMS59025.1|  hypothetical protein TRIUR3_20383                     57.4    2e-06   Triticum urartu
ref|XP_006657677.1|  PREDICTED: probable protein S-acyltransferas...  55.1    1e-05   Oryza brachyantha
ref|XP_011082343.1|  PREDICTED: probable protein S-acyltransferas...  54.7    2e-05   
ref|XP_011082342.1|  PREDICTED: probable protein S-acyltransferas...  54.7    2e-05   Sesamum indicum [beniseed]
gb|EYU32291.1|  hypothetical protein MIMGU_mgv1a010611mg              53.9    4e-05   Erythranthe guttata [common monkey flower]
emb|CBI22146.3|  unnamed protein product                              53.5    6e-05   Vitis vinifera



>ref|XP_009798984.1| PREDICTED: probable protein S-acyltransferase 14, partial [Nicotiana 
sylvestris]
Length=136

 Score = 99.8 bits (247),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 44/52 (85%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = -3

Query  728  RYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDGQE  573
            RYDLGRKRNFEQVFGMD++YWFIPAYSEEDLR +PALHGLEYP KP +D QE
Sbjct  85   RYDLGRKRNFEQVFGMDKRYWFIPAYSEEDLRRIPALHGLEYPSKPDLDAQE  136



>ref|XP_006347869.1| PREDICTED: probable protein S-acyltransferase 14-like [Solanum 
tuberosum]
Length=309

 Score = 99.0 bits (245),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 43/53 (81%), Positives = 49/53 (92%), Gaps = 0/53 (0%)
 Frame = -3

Query  728  RYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDGQEF  570
            RYDLGRKRNFEQVFG+D+QYWFIP+YSEEDLR +PALHGLEYP KP ++ QEF
Sbjct  257  RYDLGRKRNFEQVFGLDKQYWFIPSYSEEDLRRMPALHGLEYPSKPELESQEF  309



>ref|XP_006364242.1| PREDICTED: probable protein S-acyltransferase 14-like [Solanum 
tuberosum]
Length=308

 Score = 98.2 bits (243),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 43/52 (83%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = -3

Query  728  RYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDGQE  573
            RYDLGRKRNFEQVFG+D++YWFIPAYSEEDLR +PALHGLEYP KP +D QE
Sbjct  257  RYDLGRKRNFEQVFGLDKRYWFIPAYSEEDLRRIPALHGLEYPSKPDLDAQE  308



>ref|XP_004248564.1| PREDICTED: probable protein S-acyltransferase 14 [Solanum lycopersicum]
Length=308

 Score = 98.2 bits (243),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 43/52 (83%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = -3

Query  728  RYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDGQE  573
            RYDLGRKRNFEQVFG+D++YWFIPAYSEEDLR +PALHGLEYP KP +D QE
Sbjct  257  RYDLGRKRNFEQVFGLDKRYWFIPAYSEEDLRRIPALHGLEYPSKPDLDAQE  308



>ref|XP_009610572.1| PREDICTED: probable protein S-acyltransferase 14 [Nicotiana tomentosiformis]
Length=308

 Score = 97.8 bits (242),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 43/52 (83%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = -3

Query  728  RYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDGQE  573
            RYDLGRKRNFEQVFGMD++YWFIPAYSEEDLR +PALHG EYP KP +D QE
Sbjct  257  RYDLGRKRNFEQVFGMDKRYWFIPAYSEEDLRRIPALHGFEYPSKPDLDAQE  308



>ref|XP_010325709.1| PREDICTED: probable protein S-acyltransferase 14 [Solanum lycopersicum]
Length=309

 Score = 97.4 bits (241),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 42/53 (79%), Positives = 49/53 (92%), Gaps = 0/53 (0%)
 Frame = -3

Query  728  RYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDGQEF  570
            RYDLGRKRNFEQVFG+D+Q+WFIP+YSEEDLR +PALHGLEYP KP ++ QEF
Sbjct  257  RYDLGRKRNFEQVFGLDKQHWFIPSYSEEDLRRMPALHGLEYPSKPELESQEF  309



>ref|XP_009791941.1| PREDICTED: probable protein S-acyltransferase 14 [Nicotiana sylvestris]
Length=309

 Score = 97.1 bits (240),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 42/53 (79%), Positives = 49/53 (92%), Gaps = 0/53 (0%)
 Frame = -3

Query  728  RYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDGQEF  570
            RYDLGRKRNFEQVFG+D++YWFIPAYSEEDLR +PALHGLEYP KP ++ Q+F
Sbjct  257  RYDLGRKRNFEQVFGLDKRYWFIPAYSEEDLRRIPALHGLEYPSKPELESQDF  309



>gb|EYU31985.1| hypothetical protein MIMGU_mgv1a010704mg [Erythranthe guttata]
Length=304

 Score = 96.3 bits (238),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 42/53 (79%), Positives = 47/53 (89%), Gaps = 0/53 (0%)
 Frame = -3

Query  728  RYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDGQEF  570
            RYDLGRKRNFEQVFGMD++YWF+PAYSEEDLR +PAL G EYP KP +D QEF
Sbjct  252  RYDLGRKRNFEQVFGMDKKYWFVPAYSEEDLRRMPALQGFEYPSKPDLDSQEF  304



>ref|XP_009616135.1| PREDICTED: probable protein S-acyltransferase 14 [Nicotiana tomentosiformis]
Length=309

 Score = 95.9 bits (237),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 42/53 (79%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = -3

Query  728  RYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDGQEF  570
            RYDLGRKRNFEQVFG+D++YWFIPAYSEEDLR +PALHGLEYP KP ++ Q F
Sbjct  257  RYDLGRKRNFEQVFGLDKRYWFIPAYSEEDLRRIPALHGLEYPSKPELESQVF  309



>emb|CDO97688.1| unnamed protein product [Coffea canephora]
Length=300

 Score = 95.5 bits (236),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 42/53 (79%), Positives = 46/53 (87%), Gaps = 0/53 (0%)
 Frame = -3

Query  728  RYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDGQEF  570
            RYDLGRKRNFEQVFG+DR+YWFIP YSEED+R +PAL GLEYP KP  D QEF
Sbjct  248  RYDLGRKRNFEQVFGLDRRYWFIPTYSEEDIRRIPALQGLEYPSKPDFDAQEF  300



>ref|XP_011090630.1| PREDICTED: probable protein S-acyltransferase 14 [Sesamum indicum]
Length=302

 Score = 93.6 bits (231),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 41/51 (80%), Positives = 46/51 (90%), Gaps = 0/51 (0%)
 Frame = -3

Query  728  RYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDGQ  576
            RYDLGR+RNFEQVFGMD++YWFIPAYSEEDLR +PAL GLEYP KP +D Q
Sbjct  252  RYDLGRRRNFEQVFGMDKKYWFIPAYSEEDLRRIPALQGLEYPSKPDLDAQ  302



>ref|XP_007218730.1| hypothetical protein PRUPE_ppa009076mg [Prunus persica]
 ref|XP_008232661.1| PREDICTED: probable protein S-acyltransferase 14 isoform X2 [Prunus 
mume]
 gb|EMJ19929.1| hypothetical protein PRUPE_ppa009076mg [Prunus persica]
Length=307

 Score = 93.6 bits (231),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 41/53 (77%), Positives = 47/53 (89%), Gaps = 0/53 (0%)
 Frame = -3

Query  728  RYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDGQEF  570
            RYDLGRK+NFEQVFGMD++YWFIPAYSEEDLR +PAL GLEYP +P  + QEF
Sbjct  255  RYDLGRKKNFEQVFGMDKRYWFIPAYSEEDLRRIPALQGLEYPSRPEFNSQEF  307



>ref|XP_010692246.1| PREDICTED: probable protein S-acyltransferase 14 [Beta vulgaris 
subsp. vulgaris]
Length=307

 Score = 93.6 bits (231),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 40/53 (75%), Positives = 47/53 (89%), Gaps = 0/53 (0%)
 Frame = -3

Query  728  RYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDGQEF  570
            RYDLG+K+NF+QVFGMDR+YWFIPAYSEED+R +P L GLEYP KP +D QEF
Sbjct  255  RYDLGKKKNFQQVFGMDRRYWFIPAYSEEDIRRMPELQGLEYPSKPDLDAQEF  307



>ref|XP_008438165.1| PREDICTED: probable protein S-acyltransferase 14 [Cucumis melo]
Length=307

 Score = 93.6 bits (231),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 41/53 (77%), Positives = 47/53 (89%), Gaps = 0/53 (0%)
 Frame = -3

Query  728  RYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDGQEF  570
            RYDLGRKRNFEQVFGMD++YW IPAYS+EDLR +PAL GLEYP KP ++ QEF
Sbjct  255  RYDLGRKRNFEQVFGMDKRYWLIPAYSDEDLRRMPALQGLEYPSKPELESQEF  307



>ref|XP_004133913.1| PREDICTED: probable S-acyltransferase At3g60800-like [Cucumis 
sativus]
 ref|XP_004170066.1| PREDICTED: probable S-acyltransferase At3g60800-like [Cucumis 
sativus]
 gb|KGN56601.1| hypothetical protein Csa_3G126160 [Cucumis sativus]
Length=307

 Score = 93.2 bits (230),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 41/53 (77%), Positives = 47/53 (89%), Gaps = 0/53 (0%)
 Frame = -3

Query  728  RYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDGQEF  570
            RYDLGRKRNFEQVFGMD++YW IPAYS+EDLR +PAL GLEYP KP ++ QEF
Sbjct  255  RYDLGRKRNFEQVFGMDKRYWLIPAYSDEDLRRMPALQGLEYPSKPELESQEF  307



>ref|XP_002511714.1| zinc finger protein, putative [Ricinus communis]
 gb|EEF50383.1| zinc finger protein, putative [Ricinus communis]
Length=307

 Score = 93.2 bits (230),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 41/53 (77%), Positives = 47/53 (89%), Gaps = 0/53 (0%)
 Frame = -3

Query  728  RYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDGQEF  570
            RYDLGR++NFEQVFG D++YWFIPAYSEEDLR +PAL GLEYP KP +D QEF
Sbjct  255  RYDLGRRKNFEQVFGADKRYWFIPAYSEEDLRRMPALQGLEYPSKPELDSQEF  307



>gb|KJB09890.1| hypothetical protein B456_001G174100 [Gossypium raimondii]
Length=297

 Score = 93.2 bits (230),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 41/53 (77%), Positives = 46/53 (87%), Gaps = 0/53 (0%)
 Frame = -3

Query  728  RYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDGQEF  570
            RYDLGRK+NFEQVFG D++YWFIPAYS+EDLR +PAL GLEYP KP  D QEF
Sbjct  245  RYDLGRKKNFEQVFGTDKRYWFIPAYSDEDLRRMPALQGLEYPSKPDFDSQEF  297



>gb|KJB09889.1| hypothetical protein B456_001G174100 [Gossypium raimondii]
 gb|KJB09892.1| hypothetical protein B456_001G174100 [Gossypium raimondii]
Length=304

 Score = 93.2 bits (230),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 41/53 (77%), Positives = 46/53 (87%), Gaps = 0/53 (0%)
 Frame = -3

Query  728  RYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDGQEF  570
            RYDLGRK+NFEQVFG D++YWFIPAYS+EDLR +PAL GLEYP KP  D QEF
Sbjct  252  RYDLGRKKNFEQVFGTDKRYWFIPAYSDEDLRRMPALQGLEYPSKPDFDSQEF  304



>gb|KHG00286.1| hypothetical protein F383_19583 [Gossypium arboreum]
Length=307

 Score = 93.2 bits (230),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 41/53 (77%), Positives = 46/53 (87%), Gaps = 0/53 (0%)
 Frame = -3

Query  728  RYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDGQEF  570
            RYDLGRK+NFEQVFG D++YWFIPAYS+EDLR +PAL GLEYP KP  D QEF
Sbjct  255  RYDLGRKKNFEQVFGTDKRYWFIPAYSDEDLRRMPALQGLEYPSKPDFDSQEF  307



>ref|XP_006445267.1| hypothetical protein CICLE_v10021302mg [Citrus clementina]
 ref|XP_006490917.1| PREDICTED: probable protein S-acyltransferase 14-like [Citrus 
sinensis]
 gb|ESR58507.1| hypothetical protein CICLE_v10021302mg [Citrus clementina]
 gb|KDO85813.1| hypothetical protein CISIN_1g021813mg [Citrus sinensis]
Length=307

 Score = 92.8 bits (229),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/53 (75%), Positives = 46/53 (87%), Gaps = 0/53 (0%)
 Frame = -3

Query  728  RYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDGQEF  570
            RYDLGRK+NFEQVFG D++YWFIPAYS+ED+R +PAL GLEYP KP  D QEF
Sbjct  255  RYDLGRKKNFEQVFGTDKRYWFIPAYSDEDIRKMPALQGLEYPSKPDFDSQEF  307



>ref|XP_008393352.1| PREDICTED: probable protein S-acyltransferase 14 [Malus domestica]
Length=307

 Score = 92.4 bits (228),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 41/53 (77%), Positives = 46/53 (87%), Gaps = 0/53 (0%)
 Frame = -3

Query  728  RYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDGQEF  570
            RYDLGRK+NFEQVFG D++YWFIPAYS+EDLR +PAL GLEYP KP  D QEF
Sbjct  255  RYDLGRKKNFEQVFGTDKRYWFIPAYSDEDLRRIPALQGLEYPSKPEFDSQEF  307



>ref|XP_010098912.1| putative S-acyltransferase [Morus notabilis]
 gb|EXB76214.1| putative S-acyltransferase [Morus notabilis]
Length=308

 Score = 92.4 bits (228),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 41/53 (77%), Positives = 46/53 (87%), Gaps = 0/53 (0%)
 Frame = -3

Query  728  RYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDGQEF  570
            RYDLG+K+NFEQVFG D++YWFIPAYSEEDLR +PAL GLEYP KP  D QEF
Sbjct  256  RYDLGQKKNFEQVFGADKRYWFIPAYSEEDLRRMPALQGLEYPSKPDFDSQEF  308



>ref|XP_009338113.1| PREDICTED: probable protein S-acyltransferase 14 [Pyrus x bretschneideri]
Length=307

 Score = 92.0 bits (227),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 41/53 (77%), Positives = 46/53 (87%), Gaps = 0/53 (0%)
 Frame = -3

Query  728  RYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDGQEF  570
            RYDLGRK+NFEQVFG D++YWFIPAYS+EDLR +PAL GLEYP KP  D QEF
Sbjct  255  RYDLGRKKNFEQVFGTDKRYWFIPAYSDEDLRRIPALQGLEYPSKPEFDSQEF  307



>gb|KDP28757.1| hypothetical protein JCGZ_14528 [Jatropha curcas]
Length=307

 Score = 92.0 bits (227),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 39/53 (74%), Positives = 47/53 (89%), Gaps = 0/53 (0%)
 Frame = -3

Query  728  RYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDGQEF  570
            RYDLGR++NFEQVFG D++YWF+PAYS+EDLR +PAL GLEYP KP +D QEF
Sbjct  255  RYDLGRRKNFEQVFGADKRYWFVPAYSDEDLRRMPALQGLEYPSKPDLDCQEF  307



>ref|XP_010255627.1| PREDICTED: probable protein S-acyltransferase 14 [Nelumbo nucifera]
Length=316

 Score = 92.0 bits (227),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 40/53 (75%), Positives = 46/53 (87%), Gaps = 0/53 (0%)
 Frame = -3

Query  728  RYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDGQEF  570
            RYDLGRK+NFEQVFG D++YWFIPAYSEEDLR +PAL GLEYP  P +D QE+
Sbjct  264  RYDLGRKKNFEQVFGTDKRYWFIPAYSEEDLRRMPALQGLEYPSNPVLDAQEY  316



>ref|XP_010918308.1| PREDICTED: probable protein S-acyltransferase 14 [Elaeis guineensis]
Length=317

 Score = 91.7 bits (226),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 39/53 (74%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = -3

Query  728  RYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDGQEF  570
            +YDLGRK+NFEQVFG D++YWFIPAYSEEDLR +PAL GL+YP KP    QEF
Sbjct  265  KYDLGRKKNFEQVFGTDKKYWFIPAYSEEDLRKIPALQGLDYPTKPDFSAQEF  317



>ref|XP_011469138.1| PREDICTED: probable protein S-acyltransferase 14 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=307

 Score = 91.7 bits (226),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 41/53 (77%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = -3

Query  728  RYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDGQEF  570
            RYDLGRK+NFEQVFG D+ YWFIPAYSEEDLR +PAL GLEYP KP  D Q+F
Sbjct  255  RYDLGRKKNFEQVFGTDKLYWFIPAYSEEDLRRIPALQGLEYPSKPEFDSQDF  307



>ref|XP_004975099.1| PREDICTED: probable S-acyltransferase At3g60800-like [Setaria 
italica]
Length=316

 Score = 91.7 bits (226),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 40/52 (77%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = -3

Query  725  YDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDGQEF  570
            YDLGRKRNF QVFG DR+YWFIPAYSEEDLR +PAL GL+YP++P  DGQE 
Sbjct  265  YDLGRKRNFAQVFGNDRKYWFIPAYSEEDLRRIPALQGLDYPVRPDFDGQEL  316



>gb|AFW57919.1| palmitoyltransferase ZDHHC20, mRNA [Zea mays]
Length=243

 Score = 90.9 bits (224),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 40/52 (77%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = -3

Query  725  YDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDGQEF  570
            YDLGRKRNF QVFG DR+YWFIPAYSEEDLR  PAL GL+YP++P  DGQE 
Sbjct  192  YDLGRKRNFAQVFGNDRKYWFIPAYSEEDLRRTPALQGLDYPVRPDFDGQEL  243



>ref|XP_010056317.1| PREDICTED: probable protein S-acyltransferase 14 [Eucalyptus 
grandis]
Length=307

 Score = 91.3 bits (225),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 39/53 (74%), Positives = 46/53 (87%), Gaps = 0/53 (0%)
 Frame = -3

Query  728  RYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDGQEF  570
            RYDLGR++NFEQVFG D+ YWFIPAYSEED+R +PAL GLEYP +PG D +EF
Sbjct  255  RYDLGRRKNFEQVFGTDKLYWFIPAYSEEDIRRMPALQGLEYPSRPGFDSEEF  307



>ref|XP_007052066.1| DHHC-type zinc finger family protein isoform 1 [Theobroma cacao]
 gb|EOX96223.1| DHHC-type zinc finger family protein isoform 1 [Theobroma cacao]
Length=353

 Score = 91.7 bits (226),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 40/53 (75%), Positives = 46/53 (87%), Gaps = 0/53 (0%)
 Frame = -3

Query  728  RYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDGQEF  570
            RYDLGRK+NFEQVFG D++YWFIPAYS+EDLR +PAL GLEYP KP  D QE+
Sbjct  252  RYDLGRKKNFEQVFGTDKRYWFIPAYSDEDLRRMPALQGLEYPSKPDFDSQEY  304



>gb|AES87286.2| DHHC-type zinc finger protein [Medicago truncatula]
Length=299

 Score = 91.3 bits (225),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 39/51 (76%), Positives = 45/51 (88%), Gaps = 0/51 (0%)
 Frame = -3

Query  728  RYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDGQ  576
            RYDLGR++NFEQVFGMD++YWFIPAYSEED+R +PAL GLEYP KP  D Q
Sbjct  249  RYDLGRRKNFEQVFGMDKKYWFIPAYSEEDVRRMPALQGLEYPSKPDFDSQ  299



>ref|XP_011034295.1| PREDICTED: probable protein S-acyltransferase 14 [Populus euphratica]
Length=307

 Score = 91.3 bits (225),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 40/53 (75%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = -3

Query  728  RYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDGQEF  570
            RYDLGRK+NFEQVFG D++YWFIP YSE+DLR +PAL GLEYP KP  D QEF
Sbjct  255  RYDLGRKKNFEQVFGADKRYWFIPTYSEDDLRRMPALQGLEYPSKPDFDSQEF  307



>emb|CBI38870.3| unnamed protein product [Vitis vinifera]
Length=300

 Score = 90.9 bits (224),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 39/53 (74%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = -3

Query  728  RYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDGQEF  570
            RYDLGRK+NFEQVFG D+ YWFIPAY+EEDLR +P L GLE+P KP +D QEF
Sbjct  248  RYDLGRKKNFEQVFGTDKLYWFIPAYTEEDLRRMPVLQGLEFPSKPDLDAQEF  300



>gb|ABK24332.1| unknown [Picea sitchensis]
Length=316

 Score = 91.3 bits (225),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 41/53 (77%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = -3

Query  728  RYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDGQEF  570
            RYDLGRKRNFEQVFG  + YW IPAY EEDLR +PALHGLEYP KP +D QEF
Sbjct  264  RYDLGRKRNFEQVFGTQKLYWLIPAYFEEDLRRMPALHGLEYPSKPDLDAQEF  316



>ref|XP_003605089.1| Palmitoyltransferase pfa3 [Medicago truncatula]
Length=292

 Score = 90.9 bits (224),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 39/51 (76%), Positives = 45/51 (88%), Gaps = 0/51 (0%)
 Frame = -3

Query  728  RYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDGQ  576
            RYDLGR++NFEQVFGMD++YWFIPAYSEED+R +PAL GLEYP KP  D Q
Sbjct  242  RYDLGRRKNFEQVFGMDKKYWFIPAYSEEDVRRMPALQGLEYPSKPDFDSQ  292



>ref|XP_002279896.1| PREDICTED: probable protein S-acyltransferase 14 [Vitis vinifera]
 ref|XP_010661650.1| PREDICTED: probable protein S-acyltransferase 14 [Vitis vinifera]
 emb|CAN80505.1| hypothetical protein VITISV_010744 [Vitis vinifera]
Length=307

 Score = 90.9 bits (224),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 39/53 (74%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = -3

Query  728  RYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDGQEF  570
            RYDLGRK+NFEQVFG D+ YWFIPAY+EEDLR +P L GLE+P KP +D QEF
Sbjct  255  RYDLGRKKNFEQVFGTDKLYWFIPAYTEEDLRRMPVLQGLEFPSKPDLDAQEF  307



>ref|XP_010276626.1| PREDICTED: probable protein S-acyltransferase 14 [Nelumbo nucifera]
 ref|XP_010276634.1| PREDICTED: probable protein S-acyltransferase 14 [Nelumbo nucifera]
Length=316

 Score = 90.9 bits (224),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 39/53 (74%), Positives = 46/53 (87%), Gaps = 0/53 (0%)
 Frame = -3

Query  728  RYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDGQEF  570
            RYDLGRK+NFEQVFG D++YWFIPAYSEED+R +PAL GLEYP  P +D QE+
Sbjct  264  RYDLGRKKNFEQVFGTDKRYWFIPAYSEEDIRRIPALQGLEYPSNPVLDAQEY  316



>emb|CDX71777.1| BnaC08g30970D [Brassica napus]
Length=305

 Score = 90.9 bits (224),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 39/51 (76%), Positives = 44/51 (86%), Gaps = 0/51 (0%)
 Frame = -3

Query  728  RYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDGQ  576
            RYDLGRK+NFEQVFGMD++YWFIP Y+EEDLR +P LHGLEYP KP  D Q
Sbjct  255  RYDLGRKKNFEQVFGMDKRYWFIPGYTEEDLRRMPELHGLEYPSKPDFDSQ  305



>ref|XP_009116762.1| PREDICTED: probable protein S-acyltransferase 14 [Brassica rapa]
Length=305

 Score = 90.9 bits (224),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 39/51 (76%), Positives = 44/51 (86%), Gaps = 0/51 (0%)
 Frame = -3

Query  728  RYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDGQ  576
            RYDLGRK+NFEQVFGMD++YWFIP Y+EEDLR +P LHGLEYP KP  D Q
Sbjct  255  RYDLGRKKNFEQVFGMDKRYWFIPGYTEEDLRRMPELHGLEYPSKPDFDSQ  305



>emb|CDY52347.1| BnaA09g38960D [Brassica napus]
Length=305

 Score = 90.9 bits (224),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 39/51 (76%), Positives = 44/51 (86%), Gaps = 0/51 (0%)
 Frame = -3

Query  728  RYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDGQ  576
            RYDLGRK+NFEQVFGMD++YWFIP Y+EEDLR +P LHGLEYP KP  D Q
Sbjct  255  RYDLGRKKNFEQVFGMDKRYWFIPGYTEEDLRRMPELHGLEYPSKPDFDSQ  305



>ref|XP_003579517.1| PREDICTED: probable protein S-acyltransferase 14 [Brachypodium 
distachyon]
Length=315

 Score = 90.9 bits (224),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 38/52 (73%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = -3

Query  725  YDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDGQEF  570
            YDLGRKRNF QVFG D++YWFIPAY+EEDLR +PALHGL+YP++  +DGQE 
Sbjct  264  YDLGRKRNFAQVFGNDKKYWFIPAYTEEDLRRMPALHGLDYPVRADLDGQEL  315



>ref|NP_001148846.1| palmitoyltransferase ZDHHC20 [Zea mays]
 gb|ACF83769.1| unknown [Zea mays]
 gb|ACG33116.1| palmitoyltransferase ZDHHC20 [Zea mays]
Length=316

 Score = 90.9 bits (224),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 40/52 (77%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = -3

Query  725  YDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDGQEF  570
            YDLGRKRNF QVFG DR+YWFIPAYSEEDLR  PAL GL+YP++P  DGQE 
Sbjct  265  YDLGRKRNFAQVFGNDRKYWFIPAYSEEDLRRTPALQGLDYPVRPDFDGQEL  316



>ref|XP_002446206.1| hypothetical protein SORBIDRAFT_06g004040 [Sorghum bicolor]
 gb|EES10534.1| hypothetical protein SORBIDRAFT_06g004040 [Sorghum bicolor]
Length=316

 Score = 90.9 bits (224),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 39/52 (75%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = -3

Query  725  YDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDGQEF  570
            YDLGRKRNF QVFG D++YWFIPAYSEEDLR +PAL GL+YP++P  DGQE 
Sbjct  265  YDLGRKRNFAQVFGNDKKYWFIPAYSEEDLRRIPALQGLDYPVRPDFDGQEL  316



>ref|XP_008232660.1| PREDICTED: probable protein S-acyltransferase 14 isoform X1 [Prunus 
mume]
Length=581

 Score = 92.8 bits (229),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 41/53 (77%), Positives = 47/53 (89%), Gaps = 0/53 (0%)
 Frame = -3

Query  728  RYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDGQEF  570
            RYDLGRK+NFEQVFGMD++YWFIPAYSEEDLR +PAL GLEYP +P  + QEF
Sbjct  529  RYDLGRKKNFEQVFGMDKRYWFIPAYSEEDLRRIPALQGLEYPSRPEFNSQEF  581



>ref|XP_011017489.1| PREDICTED: probable protein S-acyltransferase 14 [Populus euphratica]
Length=307

 Score = 90.5 bits (223),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 39/53 (74%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = -3

Query  728  RYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDGQEF  570
            RYDLGRK+NFEQVFG D++YWFIPAYS+ED R +PAL G+EYP KP  D QEF
Sbjct  255  RYDLGRKKNFEQVFGADKRYWFIPAYSDEDTRRMPALQGIEYPSKPDFDSQEF  307



>gb|ACU19432.1| unknown [Glycine max]
Length=307

 Score = 90.5 bits (223),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 38/53 (72%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = -3

Query  728  RYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDGQEF  570
            RYDLGR++NFEQVFGMD++YWFIPAYSEED+R +P L GLEYP  P  + QEF
Sbjct  255  RYDLGRRKNFEQVFGMDKRYWFIPAYSEEDIRRMPVLQGLEYPSTPDFNAQEF  307



>ref|XP_006587892.1| PREDICTED: probable protein S-acyltransferase 14-like [Glycine 
max]
Length=307

 Score = 90.1 bits (222),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 38/53 (72%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = -3

Query  728  RYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDGQEF  570
            RYDLGR++NFEQVFGMD++YWFIPAYSEED+R +P L GLEYP  P  + QEF
Sbjct  255  RYDLGRRKNFEQVFGMDKRYWFIPAYSEEDIRRMPVLQGLEYPSTPDFNAQEF  307



>gb|EMS35725.1| hypothetical protein TRIUR3_29953 [Triticum urartu]
 gb|EMS55127.1| hypothetical protein TRIUR3_00856 [Triticum urartu]
 gb|EMS65745.1| hypothetical protein TRIUR3_17126 [Triticum urartu]
Length=81

 Score = 85.9 bits (211),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 37/52 (71%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = -3

Query  725  YDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDGQEF  570
            YDLGRK+NF QVFG D++YWFIPAYSEEDLR +PAL GL+YP++  +DGQE 
Sbjct  30   YDLGRKKNFAQVFGNDKKYWFIPAYSEEDLRRMPALQGLDYPVRTDLDGQEL  81



>gb|KJB41110.1| hypothetical protein B456_007G090900 [Gossypium raimondii]
 gb|KJB41111.1| hypothetical protein B456_007G090900 [Gossypium raimondii]
Length=307

 Score = 90.1 bits (222),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 40/53 (75%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = -3

Query  728  RYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDGQEF  570
            RYDLGRK+NFEQVFG D+ YWFIP YS+EDLR +PAL GLEYP KP  D QEF
Sbjct  255  RYDLGRKKNFEQVFGTDKLYWFIPGYSDEDLRRMPALQGLEYPSKPDFDSQEF  307



>gb|KHG30156.1| hypothetical protein F383_14468 [Gossypium arboreum]
Length=314

 Score = 89.7 bits (221),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 40/53 (75%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = -3

Query  728  RYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDGQEF  570
            RYDLGRK+NFEQVFG D+ YWFIP YS+EDLR +PAL GLEYP KP  D QEF
Sbjct  262  RYDLGRKKNFEQVFGTDKLYWFIPGYSDEDLRRMPALQGLEYPSKPDFDSQEF  314



>ref|XP_009389071.1| PREDICTED: probable protein S-acyltransferase 14 [Musa acuminata 
subsp. malaccensis]
Length=315

 Score = 89.7 bits (221),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 38/51 (75%), Positives = 45/51 (88%), Gaps = 0/51 (0%)
 Frame = -3

Query  728  RYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDGQ  576
            +YDLGRK+NFEQVFG D++YWFIPAYSEEDLR +PAL GL+YP KP +D Q
Sbjct  265  KYDLGRKKNFEQVFGTDKKYWFIPAYSEEDLRRMPALQGLKYPTKPNLDVQ  315



>ref|XP_008343300.1| PREDICTED: probable protein S-acyltransferase 14 [Malus domestica]
Length=307

 Score = 89.0 bits (219),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 39/53 (74%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = -3

Query  728  RYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDGQEF  570
            RYDLGRK+NFEQVFG D++YWF+PAYS+EDLR +PAL GLEYP  P  D QEF
Sbjct  255  RYDLGRKKNFEQVFGTDKRYWFMPAYSDEDLRRIPALQGLEYPSNPEFDSQEF  307



>gb|KFK35280.1| hypothetical protein AALP_AA5G264300 [Arabis alpina]
Length=305

 Score = 89.0 bits (219),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 38/51 (75%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = -3

Query  728  RYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDGQ  576
            RYDLGRK+NFEQVFGMD++YWFIP Y+EEDLR +P L GLEYP KP  D Q
Sbjct  255  RYDLGRKKNFEQVFGMDKRYWFIPGYTEEDLRRMPELQGLEYPSKPNFDSQ  305



>ref|XP_010910428.1| PREDICTED: probable protein S-acyltransferase 14 [Elaeis guineensis]
Length=136

 Score = 86.3 bits (212),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 37/53 (70%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = -3

Query  728  RYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDGQEF  570
            +Y+LGRK+NFEQVFG DR+YWFIPAYSEEDL+  PAL GL+YP K     QEF
Sbjct  84   KYNLGRKKNFEQVFGADRRYWFIPAYSEEDLKKTPALQGLDYPTKADFSAQEF  136



>gb|AHA84213.1| palmitoyltransferase [Phaseolus vulgaris]
Length=304

 Score = 89.0 bits (219),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 45/51 (88%), Gaps = 0/51 (0%)
 Frame = -3

Query  728  RYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDGQ  576
            RYDLGR++NFEQVFGMD++YWFIPAYS+ED+R +PAL GL+YP KP  D Q
Sbjct  254  RYDLGRRKNFEQVFGMDKKYWFIPAYSDEDIRKMPALQGLDYPSKPDFDSQ  304



>ref|XP_003517050.1| PREDICTED: probable protein S-acyltransferase 14-like isoform 
1 [Glycine max]
 gb|KHN40156.1| Putative S-acyltransferase [Glycine soja]
Length=304

 Score = 89.0 bits (219),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 45/51 (88%), Gaps = 0/51 (0%)
 Frame = -3

Query  728  RYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDGQ  576
            RYDLGR++NFEQVFGMD++YWFIPAYS+ED+R +PAL GL+YP KP  D Q
Sbjct  254  RYDLGRRKNFEQVFGMDKKYWFIPAYSDEDIRKMPALQGLDYPSKPDFDSQ  304



>ref|XP_006402542.1| hypothetical protein EUTSA_v10006120mg [Eutrema salsugineum]
 gb|ESQ43995.1| hypothetical protein EUTSA_v10006120mg [Eutrema salsugineum]
Length=305

 Score = 89.0 bits (219),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 39/51 (76%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = -3

Query  728  RYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDGQ  576
            RYDLGRK+NFEQVFGMD++YWFIP YSEEDLR +P L GLEYP KP  D Q
Sbjct  255  RYDLGRKKNFEQVFGMDKKYWFIPGYSEEDLRRMPELQGLEYPSKPDFDSQ  305



>ref|XP_007134881.1| hypothetical protein PHAVU_010G083900g [Phaseolus vulgaris]
 gb|ESW06875.1| hypothetical protein PHAVU_010G083900g [Phaseolus vulgaris]
Length=304

 Score = 89.0 bits (219),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 45/51 (88%), Gaps = 0/51 (0%)
 Frame = -3

Query  728  RYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDGQ  576
            RYDLGR++NFEQVFGMD++YWFIPAYS+ED+R +PAL GL+YP KP  D Q
Sbjct  254  RYDLGRRKNFEQVFGMDKKYWFIPAYSDEDIRKMPALQGLDYPSKPDFDSQ  304



>emb|CDY51805.1| BnaC04g53110D [Brassica napus]
Length=309

 Score = 88.6 bits (218),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 39/52 (75%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = -3

Query  725  YDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDGQEF  570
            YDLGRK+NFEQVFGMD++YW IPAYSEEDLR +P L GLEYP KP  D Q+F
Sbjct  258  YDLGRKKNFEQVFGMDKKYWLIPAYSEEDLRRMPELQGLEYPSKPDFDSQDF  309



>ref|XP_003521795.1| PREDICTED: probable protein S-acyltransferase 14-like isoform 
X1 [Glycine max]
 gb|KHN35648.1| Putative S-acyltransferase [Glycine soja]
Length=304

 Score = 88.6 bits (218),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 45/51 (88%), Gaps = 0/51 (0%)
 Frame = -3

Query  728  RYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDGQ  576
            RYDLGR++NFEQVFGMD++YWFIPAYS+ED+R +PAL GL+YP KP  D Q
Sbjct  254  RYDLGRRKNFEQVFGMDKKYWFIPAYSDEDIRKMPALQGLDYPSKPDFDSQ  304



>emb|CDX74736.1| BnaA05g04820D [Brassica napus]
Length=309

 Score = 88.6 bits (218),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 39/52 (75%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = -3

Query  725  YDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDGQEF  570
            YDLGRK+NFEQVFGMD++YW IPAYSEEDLR +P L GLEYP KP  D Q+F
Sbjct  258  YDLGRKKNFEQVFGMDKKYWLIPAYSEEDLRRMPELQGLEYPSKPDFDSQDF  309



>emb|CDX71345.1| BnaC07g06240D [Brassica napus]
Length=300

 Score = 88.6 bits (218),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 39/51 (76%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = -3

Query  728  RYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDGQ  576
            RYDLGRK+NFEQVFGMD++YWFIP YSEEDLR +P L GLEYP KP  D Q
Sbjct  250  RYDLGRKKNFEQVFGMDKRYWFIPGYSEEDLRRMPELQGLEYPSKPDFDSQ  300



>ref|XP_009398464.1| PREDICTED: probable protein S-acyltransferase 14 [Musa acuminata 
subsp. malaccensis]
Length=314

 Score = 88.6 bits (218),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 38/51 (75%), Positives = 44/51 (86%), Gaps = 0/51 (0%)
 Frame = -3

Query  728  RYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDGQ  576
            +YDLGRK+NFEQVFG D++YWFIP YSEEDLR +PAL GLEYP KP +D Q
Sbjct  264  KYDLGRKKNFEQVFGADKRYWFIPLYSEEDLRRMPALQGLEYPTKPDLDAQ  314



>ref|XP_009143136.1| PREDICTED: probable protein S-acyltransferase 14 isoform X2 [Brassica 
rapa]
Length=309

 Score = 88.6 bits (218),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 39/52 (75%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = -3

Query  725  YDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDGQEF  570
            YDLGRK+NFEQVFGMD++YW IPAYSEEDLR +P L GLEYP KP  D Q+F
Sbjct  258  YDLGRKKNFEQVFGMDKKYWLIPAYSEEDLRRMPELQGLEYPSKPDFDSQDF  309



>ref|XP_009143135.1| PREDICTED: probable protein S-acyltransferase 14 isoform X1 [Brassica 
rapa]
Length=337

 Score = 89.0 bits (219),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 39/52 (75%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = -3

Query  725  YDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDGQEF  570
            YDLGRK+NFEQVFGMD++YW IPAYSEEDLR +P L GLEYP KP  D Q+F
Sbjct  286  YDLGRKKNFEQVFGMDKKYWLIPAYSEEDLRRMPELQGLEYPSKPDFDSQDF  337



>emb|CDX89079.1| BnaA04g01070D [Brassica napus]
Length=300

 Score = 88.6 bits (218),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 39/51 (76%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = -3

Query  728  RYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDGQ  576
            RYDLGRK+NFEQVFGMD++YWFIP YSEEDLR +P L GLEYP KP  D Q
Sbjct  250  RYDLGRKKNFEQVFGMDKRYWFIPGYSEEDLRRMPELQGLEYPSKPDFDSQ  300



>ref|XP_002882009.1| hypothetical protein ARALYDRAFT_903981 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58268.1| hypothetical protein ARALYDRAFT_903981 [Arabidopsis lyrata subsp. 
lyrata]
Length=308

 Score = 88.6 bits (218),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 39/52 (75%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = -3

Query  725  YDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDGQEF  570
            YDLGRK+NFEQVFGMD++YW IPAYSEEDLR +P L GLEYP KP  D Q+F
Sbjct  257  YDLGRKKNFEQVFGMDKRYWLIPAYSEEDLRRMPELQGLEYPSKPDFDSQDF  308



>ref|XP_010524364.1| PREDICTED: probable protein S-acyltransferase 14 [Tarenaya hassleriana]
Length=307

 Score = 88.6 bits (218),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 38/53 (72%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = -3

Query  728  RYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDGQEF  570
            RYDLGRK+NFEQVFGMD++YWF+P YSEEDLR +P L GL+YP KP  D +EF
Sbjct  255  RYDLGRKKNFEQVFGMDKRYWFLPTYSEEDLRRMPELQGLKYPSKPDFDSEEF  307



>gb|KHN40573.1| Putative S-acyltransferase [Glycine soja]
Length=371

 Score = 89.0 bits (219),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 37/53 (70%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = -3

Query  728  RYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDGQEF  570
             YDLGR++NFEQVFGMD+ YWFIPAYSEED+R +P L GLEYP  P  + QEF
Sbjct  319  HYDLGRRKNFEQVFGMDKGYWFIPAYSEEDIRRMPVLQGLEYPTTPDFNAQEF  371



>gb|KJB49336.1| hypothetical protein B456_008G114100 [Gossypium raimondii]
Length=257

 Score = 88.2 bits (217),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 38/53 (72%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = -3

Query  728  RYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDGQEF  570
            RYDLGRK+NFEQVFG D++YWFIPAYS+EDLR +PAL GLE+P  P  D +EF
Sbjct  205  RYDLGRKKNFEQVFGTDKRYWFIPAYSDEDLRRIPALQGLEFPSNPDFDSEEF  257



>ref|XP_009399491.1| PREDICTED: probable protein S-acyltransferase 14 [Musa acuminata 
subsp. malaccensis]
Length=315

 Score = 88.6 bits (218),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 38/51 (75%), Positives = 45/51 (88%), Gaps = 0/51 (0%)
 Frame = -3

Query  728  RYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDGQ  576
            ++DLGRK+NFEQVFG D++YWFIPAYSEEDLR +PAL GLEYP KP +D Q
Sbjct  265  KFDLGRKKNFEQVFGTDKRYWFIPAYSEEDLRRMPALRGLEYPTKPHLDVQ  315



>gb|KJB49335.1| hypothetical protein B456_008G114100 [Gossypium raimondii]
Length=307

 Score = 88.2 bits (217),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 38/53 (72%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = -3

Query  728  RYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDGQEF  570
            RYDLGRK+NFEQVFG D++YWFIPAYS+EDLR +PAL GLE+P  P  D +EF
Sbjct  255  RYDLGRKKNFEQVFGTDKRYWFIPAYSDEDLRRIPALQGLEFPSNPDFDSEEF  307



>ref|XP_006602748.1| PREDICTED: probable protein S-acyltransferase 14 isoform X2 [Glycine 
max]
Length=307

 Score = 88.2 bits (217),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 37/53 (70%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = -3

Query  728  RYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDGQEF  570
             YDLGR++NFEQVFGMD+ YWFIPAYSEED+R +P L GLEYP  P  + QEF
Sbjct  255  HYDLGRRKNFEQVFGMDKGYWFIPAYSEEDIRRMPVLQGLEYPTTPDFNAQEF  307



>ref|XP_003552340.1| PREDICTED: probable protein S-acyltransferase 14 isoform X1 [Glycine 
max]
Length=309

 Score = 88.2 bits (217),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 37/53 (70%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = -3

Query  728  RYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDGQEF  570
             YDLGR++NFEQVFGMD+ YWFIPAYSEED+R +P L GLEYP  P  + QEF
Sbjct  257  HYDLGRRKNFEQVFGMDKGYWFIPAYSEEDIRRMPVLQGLEYPTTPDFNAQEF  309



>gb|KHN29455.1| Putative S-acyltransferase [Glycine soja]
Length=307

 Score = 87.4 bits (215),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 37/53 (70%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = -3

Query  728  RYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDGQEF  570
            RYDLGR++NFEQVFGMD++YWFIPAYSEED+R +  L GLEYP  P  + QEF
Sbjct  255  RYDLGRRKNFEQVFGMDKRYWFIPAYSEEDIRRMAVLQGLEYPSTPDFNAQEF  307



>ref|XP_008798535.1| PREDICTED: probable protein S-acyltransferase 14 [Phoenix dactylifera]
Length=317

 Score = 87.4 bits (215),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 36/53 (68%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = -3

Query  728  RYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDGQEF  570
            +YDLGRK+NFEQVFG D+++WFIPAY+EEDLR +PAL GL+YP +P    QEF
Sbjct  265  KYDLGRKKNFEQVFGTDKRFWFIPAYTEEDLRKIPALQGLDYPTRPDFSTQEF  317



>ref|XP_004492612.1| PREDICTED: probable S-acyltransferase At3g60800-like [Cicer arietinum]
Length=307

 Score = 87.4 bits (215),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 36/53 (68%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = -3

Query  728  RYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDGQEF  570
            RY+LG ++N EQVFG D++YWFIPAYSEED+R +P L GLEYP +PG D QEF
Sbjct  255  RYNLGTRKNLEQVFGTDKRYWFIPAYSEEDIRRMPVLQGLEYPSRPGFDSQEF  307



>ref|XP_008776787.1| PREDICTED: probable protein S-acyltransferase 14 [Phoenix dactylifera]
Length=317

 Score = 87.4 bits (215),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 38/53 (72%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = -3

Query  728  RYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDGQEF  570
            +YDLGRK+NFEQVFG D++YWFIPAYSEEDLR  PAL GL+YP K     QEF
Sbjct  265  KYDLGRKKNFEQVFGTDKRYWFIPAYSEEDLRKTPALQGLDYPTKADFSAQEF  317



>ref|XP_006397719.1| hypothetical protein EUTSA_v10001560mg [Eutrema salsugineum]
 gb|ESQ39172.1| hypothetical protein EUTSA_v10001560mg [Eutrema salsugineum]
Length=308

 Score = 87.0 bits (214),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 38/52 (73%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = -3

Query  725  YDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDGQEF  570
            YDLGRK+NFEQVFGMD++YW IPAYSEEDLR +P L GL+YP KP  D Q+F
Sbjct  257  YDLGRKKNFEQVFGMDKRYWLIPAYSEEDLRRMPELQGLDYPSKPDFDSQDF  308



>ref|XP_010413515.1| PREDICTED: probable protein S-acyltransferase 14 [Camelina sativa]
Length=155

 Score = 85.1 bits (209),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 36/51 (71%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = -3

Query  728  RYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDGQ  576
            RYDLG+K+NFEQVFGMD++YW IP Y+EEDLR +P L GLEYP KP  D Q
Sbjct  105  RYDLGKKKNFEQVFGMDKRYWLIPGYTEEDLRRMPELQGLEYPSKPDFDSQ  155



>dbj|BAJ93966.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ89372.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=316

 Score = 87.0 bits (214),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 37/52 (71%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = -3

Query  725  YDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDGQEF  570
            YDLGRK+NF QVFG D++YWFIPAYSEEDLR +PAL GL+YP++  +DGQE 
Sbjct  265  YDLGRKKNFAQVFGNDKKYWFIPAYSEEDLRRMPALQGLDYPVRTDLDGQEL  316



>ref|XP_006851861.1| hypothetical protein AMTR_s00041p00097340 [Amborella trichopoda]
 gb|ERN13328.1| hypothetical protein AMTR_s00041p00097340 [Amborella trichopoda]
Length=305

 Score = 87.0 bits (214),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = -3

Query  728  RYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDGQ  576
            RYDLG ++NFEQVFG D+ YWFIP YSEEDLR +PAL GLEYP KP +D Q
Sbjct  255  RYDLGGRKNFEQVFGTDKAYWFIPTYSEEDLRRMPALQGLEYPCKPDLDAQ  305



>gb|EMT07089.1| Putative S-acyltransferase [Aegilops tauschii]
Length=308

 Score = 87.0 bits (214),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 37/52 (71%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = -3

Query  725  YDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDGQEF  570
            YDLGRK+NF QVFG D++YWFIPAYSEEDLR +PAL GL+YP++  +DGQE 
Sbjct  257  YDLGRKKNFAQVFGNDKKYWFIPAYSEEDLRRMPALQGLDYPVRTDLDGQEL  308



>ref|XP_006291552.1| hypothetical protein CARUB_v10017708mg [Capsella rubella]
 gb|EOA24450.1| hypothetical protein CARUB_v10017708mg [Capsella rubella]
Length=306

 Score = 86.7 bits (213),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = -3

Query  728  RYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDGQ  576
            RYDLG+K+NFEQVFGMD++YWFIP Y+EEDLR +P L GLEYP KP  D Q
Sbjct  256  RYDLGKKKNFEQVFGMDKRYWFIPGYTEEDLRRMPELQGLEYPSKPDFDSQ  306



>ref|XP_006652138.1| PREDICTED: probable protein S-acyltransferase 14-like [Oryza 
brachyantha]
Length=316

 Score = 86.7 bits (213),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/52 (71%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = -3

Query  725  YDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDGQEF  570
            YDLGRKRNF QVFG D++YWFIPAYSEEDLR +P L GL+YP++  +DGQE 
Sbjct  265  YDLGRKRNFVQVFGNDKRYWFIPAYSEEDLRRMPVLQGLDYPVRTDLDGQEL  316



>ref|XP_010508175.1| PREDICTED: probable protein S-acyltransferase 14 [Camelina sativa]
 ref|XP_010508176.1| PREDICTED: probable protein S-acyltransferase 14 [Camelina sativa]
Length=309

 Score = 86.3 bits (212),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/52 (73%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = -3

Query  725  YDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDGQEF  570
            YDLGRK+NFEQVFG D++YW IPAYSEEDLR +P L GLEYP KP  D Q+F
Sbjct  258  YDLGRKKNFEQVFGTDKRYWLIPAYSEEDLRRMPELQGLEYPSKPDFDSQDF  309



>ref|XP_010506482.1| PREDICTED: probable protein S-acyltransferase 14 [Camelina sativa]
Length=309

 Score = 85.9 bits (211),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/52 (73%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = -3

Query  725  YDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDGQEF  570
            YDLGRK+NFEQVFG D+ YW IPAYSEEDLR +P L GLEYP KP  D Q+F
Sbjct  258  YDLGRKKNFEQVFGTDKMYWLIPAYSEEDLRRMPELQGLEYPSKPDFDSQDF  309



>gb|KJB37584.1| hypothetical protein B456_006G211800 [Gossypium raimondii]
 gb|KJB37586.1| hypothetical protein B456_006G211800 [Gossypium raimondii]
Length=308

 Score = 85.9 bits (211),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 36/49 (73%), Positives = 44/49 (90%), Gaps = 0/49 (0%)
 Frame = -3

Query  728  RYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGID  582
            RYDLG K+NFEQVFG+D++YWFIPAYSE+DLR LPALHG EYP +P ++
Sbjct  255  RYDLGWKKNFEQVFGLDKKYWFIPAYSEDDLRRLPALHGFEYPTRPDLE  303



>ref|XP_010910146.1| PREDICTED: probable protein S-acyltransferase 14 [Elaeis guineensis]
Length=317

 Score = 85.9 bits (211),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 37/53 (70%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = -3

Query  728  RYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDGQEF  570
            +Y+LGRK+NFEQVFG DR+YWFIPAYSEEDL+  PAL GL+YP K     QEF
Sbjct  265  KYNLGRKKNFEQVFGADRRYWFIPAYSEEDLKKTPALQGLDYPTKADFSAQEF  317



>ref|XP_002302535.2| zinc finger family protein [Populus trichocarpa]
 gb|EEE81808.2| zinc finger family protein [Populus trichocarpa]
Length=310

 Score = 85.5 bits (210),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 40/56 (71%), Positives = 45/56 (80%), Gaps = 3/56 (5%)
 Frame = -3

Query  728  RYDLGRKRNFEQ---VFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDGQEF  570
            RYDLGRK+NFEQ   VFG D++YWFIPAYS+ED R +PAL GLEYP KP  D QEF
Sbjct  255  RYDLGRKKNFEQANYVFGADKRYWFIPAYSDEDTRRMPALQGLEYPSKPDFDSQEF  310



>gb|KFK37316.1| hypothetical protein AALP_AA4G241200 [Arabis alpina]
Length=307

 Score = 85.5 bits (210),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 38/52 (73%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = -3

Query  725  YDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDGQEF  570
            YDLGRK+NFEQVFGMD++YW IPAYSEEDLR +P L GLEYP KP    Q+F
Sbjct  256  YDLGRKKNFEQVFGMDKRYWLIPAYSEEDLRRMPELQGLEYPSKPDFGSQDF  307



>ref|NP_001051618.1| Os03g0804300 [Oryza sativa Japonica Group]
 gb|AAS07218.1| putative zinc finger protein [Oryza sativa Japonica Group]
 gb|ABF99420.1| DHHC zinc finger domain containing protein, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF13532.1| Os03g0804300 [Oryza sativa Japonica Group]
Length=316

 Score = 85.1 bits (209),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 36/52 (69%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = -3

Query  725  YDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDGQEF  570
            YD+GRKRNF QVFG D++YWFIPAYSEEDLR +P L GL+YP++  +DGQE 
Sbjct  265  YDIGRKRNFIQVFGNDKRYWFIPAYSEEDLRRMPVLQGLDYPVRTDLDGQEL  316



>gb|KHG01247.1| hypothetical protein F383_23406 [Gossypium arboreum]
Length=235

 Score = 84.3 bits (207),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 36/53 (68%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = -3

Query  728  RYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDGQEF  570
            RYDLG+K+NFEQVFG D++YWFIPAYS+EDLR + AL GLE+P  P  D +EF
Sbjct  183  RYDLGQKKNFEQVFGTDKRYWFIPAYSDEDLRRMAALQGLEFPSNPDFDSEEF  235



>ref|XP_010647607.1| PREDICTED: probable protein S-acyltransferase 14 [Vitis vinifera]
Length=136

 Score = 82.4 bits (202),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 45/54 (83%), Gaps = 1/54 (2%)
 Frame = -3

Query  728  RYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDG-QEF  570
            RYD+GRK+NFEQVFGMD+++W IPAYSEED+  +P L GLEYP +P +D  Q+F
Sbjct  83   RYDIGRKKNFEQVFGMDKRFWLIPAYSEEDILQMPELQGLEYPSRPNLDALQQF  136



>gb|EEC76365.1| hypothetical protein OsI_13959 [Oryza sativa Indica Group]
Length=308

 Score = 85.1 bits (209),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 36/52 (69%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = -3

Query  725  YDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDGQEF  570
            YD+GRKRNF QVFG D++YWFIPAYSEEDLR +P L GL+YP++  +DGQE 
Sbjct  257  YDIGRKRNFIQVFGNDKRYWFIPAYSEEDLRRMPVLQGLDYPVRTDLDGQEL  308



>gb|KHG16541.1| hypothetical protein F383_02611 [Gossypium arboreum]
Length=308

 Score = 85.1 bits (209),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 35/49 (71%), Positives = 44/49 (90%), Gaps = 0/49 (0%)
 Frame = -3

Query  728  RYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGID  582
            RYDLG K+NFEQVFG+D++YWFIPAYSE+DLR +PALHG EYP +P ++
Sbjct  255  RYDLGWKKNFEQVFGLDKKYWFIPAYSEDDLRRMPALHGFEYPTQPDLE  303



>emb|CAB82684.1| putative protein [Arabidopsis thaliana]
Length=273

 Score = 84.7 bits (208),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 36/51 (71%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = -3

Query  728  RYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDGQ  576
            RYDLG+K+NFEQVFGMD++YW IP Y+EEDLR +P L GLEYP KP  D Q
Sbjct  223  RYDLGKKKNFEQVFGMDKRYWLIPGYTEEDLRRMPELQGLEYPSKPDFDSQ  273



>ref|XP_002878349.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH54608.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
Length=306

 Score = 84.7 bits (208),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 36/51 (71%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = -3

Query  728  RYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDGQ  576
            RYDLG+K+NFEQVFGMD++YW IP Y+EEDLR +P L GLEYP KP  D Q
Sbjct  256  RYDLGKKKNFEQVFGMDKRYWLIPGYTEEDLRRMPELQGLEYPSKPDFDSQ  306



>ref|NP_191639.2| DHHC-type zinc finger family protein [Arabidopsis thaliana]
 sp|Q8VYP5.1|ZDH14_ARATH RecName: Full=Probable protein S-acyltransferase 14; AltName: 
Full=Probable palmitoyltransferase At3g60800; AltName: Full=Zinc 
finger DHHC domain-containing protein At3g60800 [Arabidopsis 
thaliana]
 gb|AAL49877.1| unknown protein [Arabidopsis thaliana]
 gb|AAM20224.1| unknown protein [Arabidopsis thaliana]
 dbj|BAF01138.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE80109.1| DHHC-type zinc finger family protein [Arabidopsis thaliana]
Length=307

 Score = 84.7 bits (208),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 36/51 (71%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = -3

Query  728  RYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDGQ  576
            RYDLG+K+NFEQVFGMD++YW IP Y+EEDLR +P L GLEYP KP  D Q
Sbjct  257  RYDLGKKKNFEQVFGMDKRYWLIPGYTEEDLRRMPELQGLEYPSKPDFDSQ  307



>ref|XP_010469144.1| PREDICTED: probable protein S-acyltransferase 14 [Camelina sativa]
Length=307

 Score = 84.7 bits (208),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 36/51 (71%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = -3

Query  728  RYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDGQ  576
            RYDLG+K+NFEQVFGMD++YW IP Y+EEDLR +P L GLEYP KP  D Q
Sbjct  257  RYDLGKKKNFEQVFGMDKRYWLIPGYTEEDLRRMPELQGLEYPSKPDFDSQ  307



>ref|XP_002535239.1| zinc finger protein, putative [Ricinus communis]
 gb|EEF27145.1| zinc finger protein, putative [Ricinus communis]
Length=261

 Score = 84.3 bits (207),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 43/49 (88%), Gaps = 0/49 (0%)
 Frame = -3

Query  728  RYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGID  582
            RYDLGRK+NFEQVFG+D++YW IPAYSE+DL+ +PAL G EYP +P +D
Sbjct  208  RYDLGRKKNFEQVFGIDKRYWLIPAYSEDDLKCMPALKGFEYPTRPNLD  256



>ref|XP_010413516.1| PREDICTED: probable protein S-acyltransferase 14 [Camelina sativa]
Length=307

 Score = 84.7 bits (208),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 36/51 (71%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = -3

Query  728  RYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDGQ  576
            RYDLG+K+NFEQVFGMD++YW IP Y+EEDLR +P L GLEYP KP  D Q
Sbjct  257  RYDLGKKKNFEQVFGMDKRYWLIPGYTEEDLRRMPELQGLEYPSKPDFDSQ  307



>ref|XP_010544651.1| PREDICTED: probable protein S-acyltransferase 14 [Tarenaya hassleriana]
Length=305

 Score = 84.3 bits (207),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 35/51 (69%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = -3

Query  728  RYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDGQ  576
            RYDLGRK+NFEQVFGMD++YW +P YSEEDLR +P LHGLE+P +P  D +
Sbjct  255  RYDLGRKKNFEQVFGMDKRYWLLPGYSEEDLRRMPELHGLEFPSRPDFDSE  305



>ref|XP_010518152.1| PREDICTED: probable protein S-acyltransferase 14 [Camelina sativa]
 ref|XP_010518153.1| PREDICTED: probable protein S-acyltransferase 14 [Camelina sativa]
Length=309

 Score = 84.0 bits (206),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 38/52 (73%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = -3

Query  725  YDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDGQEF  570
            YDLGRK+NFEQVFG D+ YW IPAYSEEDLR +P L GLEYP KP  D Q+F
Sbjct  258  YDLGRKKNFEQVFGPDKIYWLIPAYSEEDLRRMPELQGLEYPSKPDFDSQDF  309



>gb|EPS68199.1| hypothetical protein M569_06570, partial [Genlisea aurea]
Length=315

 Score = 84.0 bits (206),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 34/48 (71%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = -3

Query  728  RYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGI  585
            RYDLG+KRNFEQVFG+D++YWFIP+YS+EDL+ LPA+ GLEYP  P +
Sbjct  268  RYDLGKKRNFEQVFGLDKKYWFIPSYSKEDLKRLPAIQGLEYPTNPEV  315



>ref|XP_009138811.1| PREDICTED: probable protein S-acyltransferase 14 [Brassica rapa]
Length=300

 Score = 83.6 bits (205),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = -3

Query  728  RYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDGQ  576
            RYDLGRK+NFEQVFGMD++Y FIP Y+EEDLR +P L GLEYP KP  D Q
Sbjct  250  RYDLGRKKNFEQVFGMDKRYCFIPGYTEEDLRRMPELQGLEYPSKPDFDSQ  300



>ref|XP_007209402.1| hypothetical protein PRUPE_ppa009226mg [Prunus persica]
 gb|EMJ10601.1| hypothetical protein PRUPE_ppa009226mg [Prunus persica]
Length=301

 Score = 83.2 bits (204),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 34/52 (65%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = -3

Query  728  RYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDGQE  573
            +YDLGRK+NFEQVFG D+ YWFIPAYSEEDLR +PAL G++YP +P ++  +
Sbjct  248  QYDLGRKKNFEQVFGTDKWYWFIPAYSEEDLRQIPALQGIDYPTRPELNALQ  299



>gb|KJB37583.1| hypothetical protein B456_006G211800 [Gossypium raimondii]
Length=523

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 36/49 (73%), Positives = 44/49 (90%), Gaps = 0/49 (0%)
 Frame = -3

Query  728  RYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGID  582
            RYDLG K+NFEQVFG+D++YWFIPAYSE+DLR LPALHG EYP +P ++
Sbjct  470  RYDLGWKKNFEQVFGLDKKYWFIPAYSEDDLRRLPALHGFEYPTRPDLE  518



>ref|XP_010108133.1| putative S-acyltransferase [Morus notabilis]
 gb|EXC17865.1| putative S-acyltransferase [Morus notabilis]
Length=307

 Score = 82.8 bits (203),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 36/50 (72%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = -3

Query  728  RYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDG  579
             YDLGR  NFEQVFG D++YWFIPAYSEEDLR +PAL GLEYP KP ++ 
Sbjct  254  HYDLGRSINFEQVFGTDKRYWFIPAYSEEDLRRIPALQGLEYPTKPELNA  303



>ref|XP_008238650.1| PREDICTED: probable protein S-acyltransferase 14 [Prunus mume]
Length=301

 Score = 82.4 bits (202),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 34/52 (65%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = -3

Query  728  RYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDGQE  573
            +YDLGRK+NFEQVFG D+ YWFIPAYSEEDLR +PAL G++YP +P ++  +
Sbjct  248  QYDLGRKKNFEQVFGTDKWYWFIPAYSEEDLRRIPALQGIDYPTRPELNALQ  299



>ref|XP_004952412.1| PREDICTED: probable S-acyltransferase At3g60800-like isoform 
X1 [Setaria italica]
 ref|XP_004952413.1| PREDICTED: probable S-acyltransferase At3g60800-like isoform 
X2 [Setaria italica]
Length=317

 Score = 82.4 bits (202),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 35/51 (69%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = -3

Query  728  RYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDGQ  576
            +YDLGRKRNF QVFG ++ YWFIP+YSEEDLR +PAL GL+YP++   DGQ
Sbjct  265  KYDLGRKRNFAQVFGNNKWYWFIPSYSEEDLRIIPALQGLDYPVRSDFDGQ  315



>ref|XP_011033891.1| PREDICTED: probable protein S-acyltransferase 14 [Populus euphratica]
Length=318

 Score = 82.0 bits (201),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 34/52 (65%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = -3

Query  728  RYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDGQE  573
            RYDLGR++NFEQVFG+D++ WFIPAYSEEDL  +P L G EYP +P +DG +
Sbjct  265  RYDLGRRKNFEQVFGLDKRCWFIPAYSEEDLERMPVLRGFEYPTRPDLDGLQ  316



>ref|XP_010662159.1| PREDICTED: probable protein S-acyltransferase 14 [Vitis vinifera]
Length=310

 Score = 81.6 bits (200),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 45/54 (83%), Gaps = 1/54 (2%)
 Frame = -3

Query  728  RYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDG-QEF  570
            RYD+GRK+NFEQVFGMD+++W IPAYSEED+  +P L GLEYP +P +D  Q+F
Sbjct  257  RYDIGRKKNFEQVFGMDKRFWLIPAYSEEDIIQMPELQGLEYPSRPNLDALQQF  310



>ref|NP_001169109.1| palmitoyltransferase ZDHHC20 [Zea mays]
 gb|ACN31678.1| unknown [Zea mays]
 tpg|DAA38384.1| TPA: palmitoyltransferase ZDHHC20 [Zea mays]
Length=312

 Score = 81.3 bits (199),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 35/44 (80%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = -3

Query  725  YDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLK  594
            YDLGRKRNF QVFG DR+YWFIPAYSEEDLR +PAL GL+YP+ 
Sbjct  265  YDLGRKRNFAQVFGNDRKYWFIPAYSEEDLRRIPALQGLDYPVS  308



>ref|XP_009362134.1| PREDICTED: probable protein S-acyltransferase 14 isoform X1 [Pyrus 
x bretschneideri]
Length=301

 Score = 80.9 bits (198),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 34/52 (65%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = -3

Query  728  RYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDGQE  573
            +YDLGRK+NFEQVFG D  YWFIPAYSEEDLR +PAL G++YP +P ++  +
Sbjct  248  QYDLGRKKNFEQVFGTDIWYWFIPAYSEEDLRRIPALQGIDYPTRPELNALQ  299



>ref|XP_008345376.1| PREDICTED: probable protein S-acyltransferase 14 [Malus domestica]
Length=334

 Score = 81.3 bits (199),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 34/52 (65%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = -3

Query  728  RYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDGQE  573
            +YDLGRK+NFEQVFG D  YWFIPAYSEEDLR +PAL G++YP +P ++  +
Sbjct  281  QYDLGRKKNFEQVFGTDMWYWFIPAYSEEDLRRIPALQGIDYPTRPELNALQ  332



>ref|XP_006368710.1| hypothetical protein POPTR_0001s08000g [Populus trichocarpa]
 gb|ERP65279.1| hypothetical protein POPTR_0001s08000g [Populus trichocarpa]
Length=304

 Score = 80.9 bits (198),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = -3

Query  728  RYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGID  582
             YDLGR++NFEQVFG D++YWFIPAYSEEDL  +P L G EYP +P +D
Sbjct  251  HYDLGRRKNFEQVFGTDKRYWFIPAYSEEDLECMPVLQGFEYPTRPDLD  299



>ref|XP_002304438.2| hypothetical protein POPTR_0003s11520g [Populus trichocarpa]
 gb|EEE79417.2| hypothetical protein POPTR_0003s11520g [Populus trichocarpa]
Length=318

 Score = 80.5 bits (197),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = -3

Query  728  RYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGID  582
            RYDLGR++NFEQVFG+D++ WFIPAYSEEDL  +P L G EYP +P +D
Sbjct  265  RYDLGRRKNFEQVFGVDKRCWFIPAYSEEDLECMPVLRGFEYPTRPDLD  313



>ref|XP_007039984.1| DHHC-type zinc finger family protein [Theobroma cacao]
 gb|EOY24485.1| DHHC-type zinc finger family protein [Theobroma cacao]
Length=312

 Score = 80.1 bits (196),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 33/46 (72%), Positives = 41/46 (89%), Gaps = 0/46 (0%)
 Frame = -3

Query  728  RYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKP  591
            RYDLG K+NFEQVFG ++++WFIPAYSEEDLR +P+L GLEYP +P
Sbjct  259  RYDLGWKKNFEQVFGTEKKFWFIPAYSEEDLRCMPSLQGLEYPTRP  304



>gb|KCW78273.1| hypothetical protein EUGRSUZ_D02456 [Eucalyptus grandis]
Length=235

 Score = 79.3 bits (194),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 33/53 (62%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = -3

Query  728  RYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDGQEF  570
             +DLGRKRNFEQVFG D+ YWFIPAY EED + +P L+GL+YP++P  D + F
Sbjct  183  HFDLGRKRNFEQVFGTDKLYWFIPAYLEEDKKRIPCLNGLDYPVRPEFDSEAF  235



>gb|KDP42560.1| hypothetical protein JCGZ_24334 [Jatropha curcas]
Length=316

 Score = 79.7 bits (195),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = -3

Query  728  RYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGID  582
            +YDLGRK+NFEQVFG D++YW IPAYSE+DL+ +P L G EYP++P +D
Sbjct  263  QYDLGRKKNFEQVFGTDKRYWLIPAYSEDDLKRMPVLRGFEYPIRPDLD  311



>ref|XP_002994078.1| hypothetical protein SELMODRAFT_449300 [Selaginella moellendorffii]
 gb|EFJ04865.1| hypothetical protein SELMODRAFT_449300 [Selaginella moellendorffii]
Length=313

 Score = 79.3 bits (194),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 31/53 (58%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = -3

Query  728  RYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDGQEF  570
            RYDLGR++NFEQVFG  + +WF+P Y+EED+R +P   GLEYP++  ++GQEF
Sbjct  261  RYDLGRRKNFEQVFGTKKLFWFLPMYAEEDVRRMPVFKGLEYPVRSDMEGQEF  313



>ref|XP_010053896.1| PREDICTED: probable protein S-acyltransferase 14 [Eucalyptus 
grandis]
 gb|KCW78271.1| hypothetical protein EUGRSUZ_D02456 [Eucalyptus grandis]
Length=307

 Score = 79.3 bits (194),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 33/53 (62%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = -3

Query  728  RYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDGQEF  570
             +DLGRKRNFEQVFG D+ YWFIPAY EED + +P L+GL+YP++P  D + F
Sbjct  255  HFDLGRKRNFEQVFGTDKLYWFIPAYLEEDKKRIPCLNGLDYPVRPEFDSEAF  307



>ref|XP_011463771.1| PREDICTED: probable protein S-acyltransferase 14 [Fragaria vesca 
subsp. vesca]
Length=310

 Score = 79.3 bits (194),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 33/46 (72%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = -3

Query  728  RYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKP  591
             YDLGRK+NFEQVFG ++ YWFIPAYSEEDLR +PAL G++YP +P
Sbjct  257  HYDLGRKQNFEQVFGTNKWYWFIPAYSEEDLRRMPALQGIDYPTRP  302



>ref|XP_002989117.1| hypothetical protein SELMODRAFT_184354 [Selaginella moellendorffii]
 gb|EFJ09911.1| hypothetical protein SELMODRAFT_184354 [Selaginella moellendorffii]
Length=314

 Score = 79.3 bits (194),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 31/53 (58%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = -3

Query  728  RYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDGQEF  570
            RYDLGR++NFEQVFG  + +WF+P Y+EED+R +P   GLEYP++  ++GQEF
Sbjct  262  RYDLGRRKNFEQVFGTKKLFWFLPMYAEEDVRRMPVFKGLEYPVRSDMEGQEF  314



>ref|XP_008437153.1| PREDICTED: probable protein S-acyltransferase 14 [Cucumis melo]
Length=310

 Score = 79.0 bits (193),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 43/49 (88%), Gaps = 0/49 (0%)
 Frame = -3

Query  728  RYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGID  582
             YDLGR++NFEQVFGMD++YWFIPAYS+ED++ +P L GLEYP++  ++
Sbjct  257  HYDLGRRKNFEQVFGMDKKYWFIPAYSQEDIKRMPNLQGLEYPMRSDLN  305



>emb|CDP08627.1| unnamed protein product [Coffea canephora]
Length=74

 Score = 73.9 bits (180),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 29/44 (66%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = -3

Query  728  RYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPL  597
            +YDLGRKRNFEQVFG  + +WF P +SEEDL+++PALHGL++P+
Sbjct  25   KYDLGRKRNFEQVFGTKKMFWFFPLFSEEDLKNIPALHGLDFPI  68



>ref|XP_004147573.1| PREDICTED: probable S-acyltransferase At3g60800-like [Cucumis 
sativus]
 ref|XP_004165772.1| PREDICTED: probable S-acyltransferase At3g60800-like [Cucumis 
sativus]
Length=310

 Score = 77.8 bits (190),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 30/49 (61%), Positives = 43/49 (88%), Gaps = 0/49 (0%)
 Frame = -3

Query  728  RYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGID  582
             YDLGR++NFEQVFGMD++YWFIPAYS++D++ +P L GLEYP++  ++
Sbjct  257  HYDLGRRKNFEQVFGMDKKYWFIPAYSQDDIKRMPNLQGLEYPMRSDLN  305



>gb|KGN50197.1| hypothetical protein Csa_5G158530 [Cucumis sativus]
Length=316

 Score = 77.8 bits (190),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 30/49 (61%), Positives = 43/49 (88%), Gaps = 0/49 (0%)
 Frame = -3

Query  728  RYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGID  582
             YDLGR++NFEQVFGMD++YWFIPAYS++D++ +P L GLEYP++  ++
Sbjct  263  HYDLGRRKNFEQVFGMDKKYWFIPAYSQDDIKRMPNLQGLEYPMRSDLN  311



>ref|XP_011029093.1| PREDICTED: probable protein S-acyltransferase 14 isoform X2 [Populus 
euphratica]
Length=271

 Score = 77.0 bits (188),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 38/49 (78%), Gaps = 0/49 (0%)
 Frame = -3

Query  728  RYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGID  582
             YDLGR++NFEQVFG D+ YWFIPAYSEEDL  +  L G EYP +P +D
Sbjct  218  HYDLGRRKNFEQVFGTDKIYWFIPAYSEEDLECMQVLQGFEYPTRPDLD  266



>ref|XP_011029092.1| PREDICTED: probable protein S-acyltransferase 14 isoform X1 [Populus 
euphratica]
Length=310

 Score = 77.0 bits (188),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 38/49 (78%), Gaps = 0/49 (0%)
 Frame = -3

Query  728  RYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGID  582
             YDLGR++NFEQVFG D+ YWFIPAYSEEDL  +  L G EYP +P +D
Sbjct  257  HYDLGRRKNFEQVFGTDKIYWFIPAYSEEDLECMQVLQGFEYPTRPDLD  305



>ref|XP_004515766.1| PREDICTED: probable S-acyltransferase At3g60800-like [Cicer arietinum]
Length=299

 Score = 76.3 bits (186),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = -3

Query  728  RYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDGQE  573
             Y+LG ++N+EQ+FG D++YW IPAYSEEDLR + ALHGLEYP+ P ++  +
Sbjct  246  HYNLGWRKNYEQIFGNDKRYWLIPAYSEEDLRQMTALHGLEYPIDPDLEALQ  297



>ref|XP_001781101.1| predicted protein [Physcomitrella patens]
 gb|EDQ54049.1| predicted protein, partial [Physcomitrella patens]
Length=306

 Score = 72.8 bits (177),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = -3

Query  725  YDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDGQEF  570
            +DLG KRNFEQVFG  + YWF+P Y +EDLR + AL+GL+YP++  ++GQE+
Sbjct  255  FDLGWKRNFEQVFGTRKLYWFLPLYDKEDLRKITALNGLDYPMRSDLEGQEY  306



>gb|ADE76560.1| unknown [Picea sitchensis]
Length=309

 Score = 72.8 bits (177),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = -3

Query  728  RYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDG  579
            RYD+GRK+NFEQVFG  +  W  P Y+EEDL +LP L+GL++P++P ++G
Sbjct  260  RYDMGRKKNFEQVFGKQKLCWLFPLYAEEDLETLPVLNGLDFPVRPDVEG  309



>ref|XP_010540019.1| PREDICTED: probable protein S-acyltransferase 13 [Tarenaya hassleriana]
Length=307

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 39/43 (91%), Gaps = 0/43 (0%)
 Frame = -3

Query  728  RYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYP  600
            R+DLGRK NF+QVFG D++YWF+PAY+E+D++ +PAL G+E+P
Sbjct  254  RFDLGRKENFKQVFGTDKRYWFVPAYTEDDMKRMPALRGVEFP  296



>gb|KHG08036.1| hypothetical protein F383_35334 [Gossypium arboreum]
Length=303

 Score = 70.9 bits (172),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 29/52 (56%), Positives = 39/52 (75%), Gaps = 0/52 (0%)
 Frame = -3

Query  728  RYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDGQE  573
            RYDLG K+N+EQVFG +++ W IP YS++D+R +PAL G EYP +P  D Q 
Sbjct  252  RYDLGWKKNYEQVFGTEKKLWLIPVYSKDDIRRMPALQGFEYPTRPNWDPQH  303



>ref|XP_010100672.1| putative S-acyltransferase [Morus notabilis]
 gb|EXB83834.1| putative S-acyltransferase [Morus notabilis]
Length=259

 Score = 70.1 bits (170),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 27/49 (55%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = -3

Query  728  RYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGID  582
            +YDLGRK+NFEQVFG  +  WF P +S++DL ++PALHGLE+P +  ++
Sbjct  210  QYDLGRKKNFEQVFGTKKTLWFFPLFSKDDLDNIPALHGLEFPTRADVE  258



>gb|AFK47432.1| unknown [Medicago truncatula]
Length=74

 Score = 65.9 bits (159),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 26/49 (53%), Positives = 36/49 (73%), Gaps = 0/49 (0%)
 Frame = -3

Query  728  RYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGID  582
            RYD+G K+NFEQVFG  +  W  P +SEEDL ++PAL G+E+P +  +D
Sbjct  25   RYDVGGKKNFEQVFGTKKALWLFPLFSEEDLENIPALKGIEFPTRSDVD  73



>gb|KJB25655.1| hypothetical protein B456_004G202600 [Gossypium raimondii]
Length=238

 Score = 68.9 bits (167),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 29/52 (56%), Positives = 38/52 (73%), Gaps = 0/52 (0%)
 Frame = -3

Query  728  RYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDGQE  573
            RYDLG K+N+EQVFG +++ W IP YS++D R +PAL G EYP +P  D Q 
Sbjct  187  RYDLGWKKNYEQVFGTEKKLWLIPVYSKDDKRRMPALQGFEYPTRPNWDPQH  238



>ref|XP_011039088.1| PREDICTED: probable protein S-acyltransferase 12 isoform X1 [Populus 
euphratica]
Length=307

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 39/50 (78%), Gaps = 0/50 (0%)
 Frame = -3

Query  728  RYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDG  579
            +YDLGRK+NFEQVFG  +  WF P +S+ED+  +PALHGL++P++  ++ 
Sbjct  258  KYDLGRKKNFEQVFGTKKALWFFPLFSKEDVDKIPALHGLDFPIRADLES  307



>gb|KJB09590.1| hypothetical protein B456_001G151300 [Gossypium raimondii]
Length=234

 Score = 68.6 bits (166),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 36/50 (72%), Gaps = 0/50 (0%)
 Frame = -3

Query  728  RYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDG  579
            +YDLGRK+NFEQVFG  +  W  P +SE+DL  +PAL GLE+P +  +D 
Sbjct  185  KYDLGRKKNFEQVFGTKKSLWLFPLFSEDDLEKIPALRGLEFPTRSDVDA  234



>ref|XP_011039097.1| PREDICTED: probable protein S-acyltransferase 12 isoform X2 [Populus 
euphratica]
Length=298

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 39/50 (78%), Gaps = 0/50 (0%)
 Frame = -3

Query  728  RYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDG  579
            +YDLGRK+NFEQVFG  +  WF P +S+ED+  +PALHGL++P++  ++ 
Sbjct  249  KYDLGRKKNFEQVFGTKKALWFFPLFSKEDVDKIPALHGLDFPIRADLES  298



>ref|XP_008437841.1| PREDICTED: probable protein S-acyltransferase 12 isoform X2 [Cucumis 
melo]
Length=306

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = -3

Query  728  RYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDG  579
            +YDLG+K+NFEQVFG     WF P +S+EDL  +PAL GLE+P++ G++ 
Sbjct  257  KYDLGKKKNFEQVFGTKAALWFFPLFSKEDLEKIPALRGLEFPIRTGMES  306



>ref|XP_006491350.1| PREDICTED: LOW QUALITY PROTEIN: probable protein S-acyltransferase 
12-like [Citrus sinensis]
Length=303

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = -3

Query  728  RYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYP  600
            +YDLGRK+NFEQVFG ++  WF P +S+ED  S+PALHGL++P
Sbjct  256  KYDLGRKKNFEQVFGTNKALWFFPLFSKEDSDSIPALHGLDFP  298



>ref|XP_006444753.1| hypothetical protein CICLE_v10021463mg [Citrus clementina]
 gb|ESR57993.1| hypothetical protein CICLE_v10021463mg [Citrus clementina]
Length=283

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = -3

Query  728  RYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYP  600
            +YDLGRK+NFEQVFG ++  WF P +S+ED  S+PALHGL++P
Sbjct  239  KYDLGRKKNFEQVFGTNKALWFFPLFSKEDSDSIPALHGLDFP  281



>gb|KDO86582.1| hypothetical protein CISIN_1g021385mg [Citrus sinensis]
Length=300

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = -3

Query  728  RYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYP  600
            +YDLGRK+NFEQVFG ++  WF P +S+ED  S+PALHGL++P
Sbjct  256  KYDLGRKKNFEQVFGTNKALWFFPLFSKEDSDSIPALHGLDFP  298



>ref|XP_006444756.1| hypothetical protein CICLE_v10021463mg [Citrus clementina]
 gb|ESR57996.1| hypothetical protein CICLE_v10021463mg [Citrus clementina]
Length=278

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = -3

Query  728  RYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYP  600
            +YDLGRK+NFEQVFG ++  WF P +S+ED  S+PALHGL++P
Sbjct  234  KYDLGRKKNFEQVFGTNKALWFFPLFSKEDSDSIPALHGLDFP  276



>ref|XP_002320223.1| hypothetical protein POPTR_0014s09980g [Populus trichocarpa]
 gb|EEE98538.1| hypothetical protein POPTR_0014s09980g [Populus trichocarpa]
Length=331

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 39/50 (78%), Gaps = 0/50 (0%)
 Frame = -3

Query  728  RYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDG  579
            +YDLGRK+NFEQVFG  +  WF P +S+ED+  +PALHGL++P++  ++ 
Sbjct  282  KYDLGRKKNFEQVFGTKKALWFFPLFSKEDVDKIPALHGLDFPIRADLES  331



>gb|KJB25653.1| hypothetical protein B456_004G202600 [Gossypium raimondii]
Length=285

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/52 (56%), Positives = 38/52 (73%), Gaps = 0/52 (0%)
 Frame = -3

Query  728  RYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDGQE  573
            RYDLG K+N+EQVFG +++ W IP YS++D R +PAL G EYP +P  D Q 
Sbjct  234  RYDLGWKKNYEQVFGTEKKLWLIPVYSKDDKRRMPALQGFEYPTRPNWDPQH  285



>ref|XP_003626591.1| Palmitoyltransferase PFA4 [Medicago truncatula]
 gb|AES82809.1| DHHC-type zinc finger protein [Medicago truncatula]
Length=307

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 27/49 (55%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = -3

Query  728  RYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGID  582
            RYD+GRK+NFEQVFG  +  W  P +SEEDL ++PAL G+E+P +  +D
Sbjct  258  RYDVGRKKNFEQVFGTKKALWLFPLFSEEDLENIPALRGIEFPTRSDVD  306



>gb|KJB25654.1| hypothetical protein B456_004G202600 [Gossypium raimondii]
Length=292

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/52 (56%), Positives = 38/52 (73%), Gaps = 0/52 (0%)
 Frame = -3

Query  728  RYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDGQE  573
            RYDLG K+N+EQVFG +++ W IP YS++D R +PAL G EYP +P  D Q 
Sbjct  241  RYDLGWKKNYEQVFGTEKKLWLIPVYSKDDKRRMPALQGFEYPTRPNWDPQH  292



>ref|XP_004240115.1| PREDICTED: probable protein S-acyltransferase 12 [Solanum lycopersicum]
Length=309

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = -3

Query  728  RYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGI  585
            RYD+G KRNFEQVFG ++  WF P +S++D+ S+PALHG+E+P +  +
Sbjct  260  RYDMGWKRNFEQVFGANKVLWFFPLFSKKDMESIPALHGMEFPTRSDV  307



>ref|XP_010919145.1| PREDICTED: probable protein S-acyltransferase 12 [Elaeis guineensis]
Length=315

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 26/49 (53%), Positives = 38/49 (78%), Gaps = 0/49 (0%)
 Frame = -3

Query  728  RYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGID  582
            +YDLG++RNFEQVFG  +  WF+P YS+EDL  +PAL GL++P +  ++
Sbjct  266  KYDLGKRRNFEQVFGTKKSLWFLPLYSQEDLEKMPALQGLDFPTRSDVE  314



>gb|KJB09587.1| hypothetical protein B456_001G151300 [Gossypium raimondii]
 gb|KJB09589.1| hypothetical protein B456_001G151300 [Gossypium raimondii]
Length=295

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 36/50 (72%), Gaps = 0/50 (0%)
 Frame = -3

Query  728  RYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDG  579
            +YDLGRK+NFEQVFG  +  W  P +SE+DL  +PAL GLE+P +  +D 
Sbjct  246  KYDLGRKKNFEQVFGTKKSLWLFPLFSEDDLEKIPALRGLEFPTRSDVDA  295



>emb|CDX94118.1| BnaC07g37520D [Brassica napus]
Length=305

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -3

Query  725  YDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEY  603
            YDLGRK NFEQVFG D+ YWF+P Y+EED++ LPAL GL++
Sbjct  252  YDLGRKANFEQVFGRDKMYWFVPLYTEEDMKRLPALGGLDF  292



>emb|CDX98764.1| BnaA03g45490D [Brassica napus]
Length=305

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -3

Query  725  YDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEY  603
            YDLGRK NFEQVFG D+ YWF+P Y+EED++ LPAL GL++
Sbjct  252  YDLGRKANFEQVFGRDKMYWFVPLYTEEDMKRLPALGGLDF  292



>ref|XP_007051453.1| DHHC-type zinc finger family protein [Theobroma cacao]
 gb|EOX95610.1| DHHC-type zinc finger family protein [Theobroma cacao]
Length=294

 Score = 68.6 bits (166),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 39/50 (78%), Gaps = 0/50 (0%)
 Frame = -3

Query  728  RYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDG  579
            +YDLGRK+NF+QVFG  +  WF P +SE+DL ++PALHG+++P +  ++ 
Sbjct  245  KYDLGRKKNFDQVFGTKKTLWFFPMFSEDDLDNIPALHGIDFPTRSDVEA  294



>ref|XP_004167123.1| PREDICTED: probable S-acyltransferase At4g00840-like [Cucumis 
sativus]
Length=306

 Score = 68.6 bits (166),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 27/49 (55%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = -3

Query  725  YDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDG  579
            YDLG+K+NFEQVFG     WF P +S+EDL  +PAL GLE+P++ G++ 
Sbjct  258  YDLGKKKNFEQVFGTKAALWFFPLFSKEDLEKIPALRGLEFPIRTGMES  306



>ref|XP_002263621.1| PREDICTED: probable protein S-acyltransferase 12 [Vitis vinifera]
 emb|CBI38696.3| unnamed protein product [Vitis vinifera]
Length=308

 Score = 68.6 bits (166),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 36/50 (72%), Gaps = 0/50 (0%)
 Frame = -3

Query  728  RYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDG  579
            +YDLGRK NFEQVFG  +  W  P YSE+D  S+PALHGL++P +  ++ 
Sbjct  259  KYDLGRKTNFEQVFGKKKALWLFPLYSEDDFSSIPALHGLDFPTRSDVEA  308



>ref|XP_008355759.1| PREDICTED: probable protein S-acyltransferase 12 [Malus domestica]
Length=155

 Score = 66.2 bits (160),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 26/43 (60%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = -3

Query  728  RYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYP  600
            +YDLGRK+NFEQVFG  +  W +P +S+EDL ++PAL GLE+P
Sbjct  106  KYDLGRKKNFEQVFGTKKALWLLPLFSKEDLDNVPALRGLEFP  148



>ref|XP_004494854.1| PREDICTED: probable S-acyltransferase At4g00840-like [Cicer arietinum]
Length=365

 Score = 68.9 bits (167),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 28/49 (57%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = -3

Query  728  RYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGID  582
            RYDLGRK+NFEQVFG  +  W  P +SEEDL ++PAL G+E+P +  +D
Sbjct  316  RYDLGRKKNFEQVFGTKKALWLFPLFSEEDLDNIPALRGIEFPTRSDVD  364



>ref|XP_004133790.1| PREDICTED: probable S-acyltransferase At4g00840-like [Cucumis 
sativus]
 gb|KGN56387.1| hypothetical protein Csa_3G118230 [Cucumis sativus]
Length=306

 Score = 68.6 bits (166),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 27/49 (55%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = -3

Query  725  YDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDG  579
            YDLG+K+NFEQVFG     WF P +S+EDL  +PAL GLE+P++ G++ 
Sbjct  258  YDLGKKKNFEQVFGTKAALWFFPLFSKEDLEKIPALRGLEFPIRSGMES  306



>ref|XP_009136121.1| PREDICTED: probable protein S-acyltransferase 13 [Brassica rapa]
Length=79

 Score = 64.3 bits (155),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -3

Query  725  YDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEY  603
            Y+LGRK+NFEQVFG D+ YWF+P Y+++D++ +PAL GL++
Sbjct  26   YNLGRKQNFEQVFGKDKLYWFVPLYTQDDMKRMPALRGLDF  66



>ref|XP_006440414.1| hypothetical protein CICLE_v10021242mg [Citrus clementina]
 gb|ESR53654.1| hypothetical protein CICLE_v10021242mg [Citrus clementina]
 gb|KDO63756.1| hypothetical protein CISIN_1g021223mg [Citrus sinensis]
Length=253

 Score = 67.4 bits (163),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 29/49 (59%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = -3

Query  728  RYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGID  582
            RYDLG K NFEQVFG +++YW IPAYS++DL  LP+   +EYP +P  D
Sbjct  203  RYDLGWKINFEQVFGKNKKYWLIPAYSKDDLEWLPSFQCVEYPTRPDSD  251



>ref|XP_006602749.1| PREDICTED: probable protein S-acyltransferase 14 isoform X3 [Glycine 
max]
Length=287

 Score = 67.8 bits (164),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 28/42 (67%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = -3

Query  695  QVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDGQEF  570
            +VFGMD+ YWFIPAYSEED+R +P L GLEYP  P  + QEF
Sbjct  246  EVFGMDKGYWFIPAYSEEDIRRMPVLQGLEYPTTPDFNAQEF  287



>ref|XP_009804295.1| PREDICTED: probable protein S-acyltransferase 12 [Nicotiana sylvestris]
Length=160

 Score = 65.9 bits (159),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 25/45 (56%), Positives = 38/45 (84%), Gaps = 0/45 (0%)
 Frame = -3

Query  728  RYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLK  594
            +YDLG KRNFEQVFG ++  WF+P +S++DL ++PAL+G+E+P +
Sbjct  111  KYDLGWKRNFEQVFGANKALWFLPMFSKKDLENIPALYGVEFPTR  155



>ref|XP_008779828.1| PREDICTED: probable protein S-acyltransferase 12 isoform X2 [Phoenix 
dactylifera]
Length=315

 Score = 68.2 bits (165),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 26/49 (53%), Positives = 38/49 (78%), Gaps = 0/49 (0%)
 Frame = -3

Query  728  RYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGID  582
            +YDLG++RNFEQVFG  +  WF+P YS+EDL  +PAL GL++P +  ++
Sbjct  266  KYDLGKRRNFEQVFGTKKLLWFLPLYSQEDLEKMPALQGLDFPTRSDVE  314



>gb|KFK30666.1| hypothetical protein AALP_AA6G012100 [Arabis alpina]
Length=289

 Score = 67.8 bits (164),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 26/49 (53%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = -3

Query  728  RYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGID  582
            +YDLG+K+NFEQVFG  + +W +P YS++DL ++ +LHGLE+P +  ID
Sbjct  240  KYDLGKKKNFEQVFGKKKVFWLLPLYSKDDLDNMTSLHGLEFPTRSDID  288



>emb|CDY41296.1| BnaA01g12430D [Brassica napus]
Length=125

 Score = 64.7 bits (156),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -3

Query  725  YDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEY  603
            Y+LGRK+NFEQVFG D+ YWF+P Y+++D++ +PAL GL++
Sbjct  72   YNLGRKQNFEQVFGKDKLYWFVPLYTQDDMKRMPALRGLDF  112



>ref|XP_002462839.1| hypothetical protein SORBIDRAFT_02g032840 [Sorghum bicolor]
 gb|EER99360.1| hypothetical protein SORBIDRAFT_02g032840 [Sorghum bicolor]
Length=293

 Score = 67.4 bits (163),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 27/45 (60%), Positives = 35/45 (78%), Gaps = 0/45 (0%)
 Frame = -3

Query  728  RYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLK  594
            +YDLG KRN EQVFG  + +WF+P YS EDL ++PAL GLE+P +
Sbjct  244  KYDLGWKRNLEQVFGTKKLFWFVPMYSTEDLHNIPALQGLEFPTR  288



>ref|XP_008779824.1| PREDICTED: probable protein S-acyltransferase 12 isoform X1 [Phoenix 
dactylifera]
Length=339

 Score = 67.8 bits (164),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 26/49 (53%), Positives = 38/49 (78%), Gaps = 0/49 (0%)
 Frame = -3

Query  728  RYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGID  582
            +YDLG++RNFEQVFG  +  WF+P YS+EDL  +PAL GL++P +  ++
Sbjct  290  KYDLGKRRNFEQVFGTKKLLWFLPLYSQEDLEKMPALQGLDFPTRSDVE  338



>gb|KFK28858.1| hypothetical protein AALP_AA7G057700 [Arabis alpina]
Length=304

 Score = 67.4 bits (163),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -3

Query  725  YDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEY  603
            YDLGRK NFEQVFG D+ YWFIP Y+E D++ LPAL GL++
Sbjct  251  YDLGRKTNFEQVFGRDKMYWFIPLYTEVDMKRLPALRGLDF  291



>gb|KDP28430.1| hypothetical protein JCGZ_14201 [Jatropha curcas]
Length=309

 Score = 67.4 bits (163),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = -3

Query  728  RYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDG  579
            +YD+GRK NFEQVFG  +  W +P +S+EDL ++PALHGL++P +  ++ 
Sbjct  260  KYDMGRKNNFEQVFGAKKTLWLLPLFSKEDLDNIPALHGLDFPTRSDVEA  309



>gb|KDO63753.1| hypothetical protein CISIN_1g021223mg [Citrus sinensis]
 gb|KDO63754.1| hypothetical protein CISIN_1g021223mg [Citrus sinensis]
Length=316

 Score = 67.4 bits (163),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 29/49 (59%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = -3

Query  728  RYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGID  582
            RYDLG K NFEQVFG +++YW IPAYS++DL  LP+   +EYP +P  D
Sbjct  266  RYDLGWKINFEQVFGKNKKYWLIPAYSKDDLEWLPSFQCVEYPTRPDSD  314



>ref|XP_006440415.1| hypothetical protein CICLE_v10021242mg [Citrus clementina]
 ref|XP_006440416.1| hypothetical protein CICLE_v10021242mg [Citrus clementina]
 gb|ESR53655.1| hypothetical protein CICLE_v10021242mg [Citrus clementina]
 gb|ESR53656.1| hypothetical protein CICLE_v10021242mg [Citrus clementina]
Length=315

 Score = 67.4 bits (163),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 29/49 (59%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = -3

Query  728  RYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGID  582
            RYDLG K NFEQVFG +++YW IPAYS++DL  LP+   +EYP +P  D
Sbjct  265  RYDLGWKINFEQVFGKNKKYWLIPAYSKDDLEWLPSFQCVEYPTRPDSD  313



>ref|XP_006477282.1| PREDICTED: probable protein S-acyltransferase 14-like isoform 
X1 [Citrus sinensis]
 ref|XP_006477283.1| PREDICTED: probable protein S-acyltransferase 14-like isoform 
X2 [Citrus sinensis]
Length=316

 Score = 67.4 bits (163),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 29/49 (59%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = -3

Query  728  RYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGID  582
            RYDLG K NFEQVFG +++YW IPAYS++DL  LP+   +EYP +P  D
Sbjct  266  RYDLGWKINFEQVFGKNKKYWLIPAYSKDDLEWLPSFQCVEYPTRPDSD  314



>emb|CDX74374.1| BnaA03g26730D [Brassica napus]
Length=291

 Score = 67.0 bits (162),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 26/49 (53%), Positives = 38/49 (78%), Gaps = 0/49 (0%)
 Frame = -3

Query  728  RYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGID  582
            +YDLG+K+NFEQVFG  + +W +P YS++DL S+ +L GLE+P +  ID
Sbjct  242  KYDLGKKKNFEQVFGKKKAFWLLPLYSKDDLHSITSLQGLEFPTRSDID  290



>emb|CDX91862.1| BnaC03g31640D [Brassica napus]
Length=291

 Score = 67.0 bits (162),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 26/49 (53%), Positives = 38/49 (78%), Gaps = 0/49 (0%)
 Frame = -3

Query  728  RYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGID  582
            +YDLG+K+NFEQVFG  + +W +P YS++DL S+ +L GLE+P +  ID
Sbjct  242  KYDLGKKKNFEQVFGKKKAFWLLPLYSKDDLHSITSLQGLEFPTRSDID  290



>ref|XP_010054971.1| PREDICTED: probable protein S-acyltransferase 12 [Eucalyptus 
grandis]
 gb|KCW71455.1| hypothetical protein EUGRSUZ_E00018 [Eucalyptus grandis]
Length=306

 Score = 67.4 bits (163),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 36/50 (72%), Gaps = 0/50 (0%)
 Frame = -3

Query  728  RYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDG  579
            +YDLGR++NFEQVFG  +  W  P  SEEDL  +PALHGLE+P +  ++ 
Sbjct  257  KYDLGRRKNFEQVFGTKKALWLFPLLSEEDLGKIPALHGLEFPTRSDVEA  306



>gb|KJB41112.1| hypothetical protein B456_007G090900 [Gossypium raimondii]
Length=285

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/42 (69%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = -3

Query  695  QVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDGQEF  570
            +VFG D+ YWFIP YS+EDLR +PAL GLEYP KP  D QEF
Sbjct  244  EVFGTDKLYWFIPGYSDEDLRRMPALQGLEYPSKPDFDSQEF  285



>ref|XP_009137276.1| PREDICTED: probable protein S-acyltransferase 13 [Brassica rapa]
Length=305

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -3

Query  725  YDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEY  603
            YDLGRK NFEQVFG D+ YW +P Y+EED++ LPAL GL++
Sbjct  252  YDLGRKANFEQVFGRDKMYWLVPLYTEEDMKRLPALGGLDF  292



>ref|XP_010448848.1| PREDICTED: probable protein S-acyltransferase 13 [Camelina sativa]
Length=304

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = -3

Query  725  YDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLE  606
            Y+LGRK NFEQVFG D+ YWF+P Y+EED++ LPA+ GL+
Sbjct  252  YNLGRKTNFEQVFGSDKMYWFVPLYTEEDMKKLPAVGGLD  291



>ref|XP_009134494.1| PREDICTED: probable protein S-acyltransferase 12 [Brassica rapa]
Length=291

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 26/49 (53%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = -3

Query  728  RYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGID  582
            +YDLG+K+NFEQVFG  + +W  P YS++DL S+ +L GLE+P +  ID
Sbjct  242  KYDLGKKKNFEQVFGKKKAFWLFPLYSKDDLHSITSLQGLEFPTRSDID  290



>dbj|BAJ34112.1| unnamed protein product [Thellungiella halophila]
Length=304

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -3

Query  725  YDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEY  603
            Y+LGRK NFEQVFG D+ YWF+P Y+E+D++ LPAL GL++
Sbjct  251  YNLGRKTNFEQVFGRDKMYWFVPLYTEDDMKRLPALRGLDF  291



>ref|XP_006830293.1| hypothetical protein AMTR_s00121p00069490, partial [Amborella 
trichopoda]
 gb|ERM97709.1| hypothetical protein AMTR_s00121p00069490, partial [Amborella 
trichopoda]
Length=367

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = -3

Query  728  RYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGI  585
            +YDLGR++NFEQVFG  + YW IP  S EDL ++PAL GL++P++  +
Sbjct  320  KYDLGRRKNFEQVFGTKKAYWMIPVLSTEDLVNVPALRGLDFPIRSDV  367



>emb|CDY07150.1| BnaCnng01650D [Brassica napus]
Length=289

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 25/49 (51%), Positives = 38/49 (78%), Gaps = 0/49 (0%)
 Frame = -3

Query  728  RYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGID  582
            +YDLG+K+NFEQVFG  + +W +P YS++DL ++ +L GLE+P +  ID
Sbjct  240  KYDLGKKKNFEQVFGKKKAFWLLPLYSKDDLHNITSLQGLEFPTRSDID  288



>ref|XP_008233069.1| PREDICTED: probable protein S-acyltransferase 12 [Prunus mume]
 ref|XP_008233070.1| PREDICTED: probable protein S-acyltransferase 12 [Prunus mume]
 ref|XP_008233071.1| PREDICTED: probable protein S-acyltransferase 12 [Prunus mume]
Length=308

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = -3

Query  728  RYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYP  600
            +YDLGRK+NFEQVFG  +  WF P  S+EDL ++PAL GLE+P
Sbjct  259  KYDLGRKKNFEQVFGTKKALWFFPLVSKEDLNNIPALRGLEFP  301



>ref|XP_004506505.1| PREDICTED: probable S-acyltransferase At3g60800-like [Cicer arietinum]
Length=305

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/51 (61%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -3

Query  728  RYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDGQ  576
            RYDLGR++NFEQV+  D       AYSEED+R +PAL GLEYP KP  D Q
Sbjct  255  RYDLGRRKNFEQVYFFDXXXXXXXAYSEEDIRRMPALQGLEYPSKPDFDSQ  305



>ref|XP_010267431.1| PREDICTED: probable protein S-acyltransferase 12 isoform X2 [Nelumbo 
nucifera]
Length=296

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = -3

Query  728  RYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDG  579
            +YDLG K+NFEQVFG  + +WF P +S+EDL  + ALHGL++P +  ++ 
Sbjct  247  KYDLGWKKNFEQVFGTKKVFWFFPLFSKEDLEKITALHGLDFPTRSDVEA  296



>ref|XP_010267425.1| PREDICTED: probable protein S-acyltransferase 12 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010267426.1| PREDICTED: probable protein S-acyltransferase 12 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010267427.1| PREDICTED: probable protein S-acyltransferase 12 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010267428.1| PREDICTED: probable protein S-acyltransferase 12 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010267429.1| PREDICTED: probable protein S-acyltransferase 12 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010267430.1| PREDICTED: probable protein S-acyltransferase 12 isoform X1 [Nelumbo 
nucifera]
Length=306

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = -3

Query  728  RYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDG  579
            +YDLG K+NFEQVFG  + +WF P +S+EDL  + ALHGL++P +  ++ 
Sbjct  257  KYDLGWKKNFEQVFGTKKVFWFFPLFSKEDLEKITALHGLDFPTRSDVEA  306



>ref|XP_010433998.1| PREDICTED: probable protein S-acyltransferase 13 [Camelina sativa]
Length=305

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = -3

Query  725  YDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLE  606
            Y+LGRK NFEQVFG ++ YWF+P Y+EED++ LPAL GL+
Sbjct  253  YNLGRKTNFEQVFGSNKMYWFVPLYTEEDMKKLPALGGLD  292



>ref|XP_006360644.1| PREDICTED: probable protein S-acyltransferase 12-like [Solanum 
tuberosum]
Length=309

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 24/45 (53%), Positives = 37/45 (82%), Gaps = 0/45 (0%)
 Frame = -3

Query  728  RYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLK  594
            +YD+G KRNFEQVFG ++  WF P +S++D+ ++PALHG+E+P +
Sbjct  260  KYDMGWKRNFEQVFGANKVLWFFPLFSKKDMENIPALHGMEFPTR  304



>ref|XP_010439292.1| PREDICTED: probable protein S-acyltransferase 13 [Camelina sativa]
Length=305

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = -3

Query  725  YDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLE  606
            Y+LGRK NFEQVFG D+ YWF+P Y EED++ LPAL GL+
Sbjct  253  YNLGRKTNFEQVFGSDKMYWFVPLYIEEDMKKLPALGGLD  292



>ref|XP_009366621.1| PREDICTED: LOW QUALITY PROTEIN: probable protein S-acyltransferase 
12 [Pyrus x bretschneideri]
Length=303

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 26/43 (60%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = -3

Query  728  RYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYP  600
            +YDLGRK+NFEQVFG  +  W +P +S+EDL ++PAL GLE+P
Sbjct  254  KYDLGRKKNFEQVFGTKKALWLLPLFSKEDLDNVPALRGLEFP  296



>ref|XP_008376192.1| PREDICTED: probable protein S-acyltransferase 12 [Malus domestica]
Length=308

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 27/49 (55%), Positives = 36/49 (73%), Gaps = 0/49 (0%)
 Frame = -3

Query  728  RYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGID  582
            +YDLGRK+NFEQVFG  +  W +P +S+EDL ++PAL GLE+P     D
Sbjct  259  KYDLGRKKNFEQVFGTKKALWLLPLFSKEDLDNVPALRGLEFPTLSDTD  307



>ref|XP_009607103.1| PREDICTED: probable protein S-acyltransferase 12, partial [Nicotiana 
tomentosiformis]
Length=277

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 25/45 (56%), Positives = 38/45 (84%), Gaps = 0/45 (0%)
 Frame = -3

Query  728  RYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLK  594
            +YDLG KRNFEQVFG ++  WF+P +S++DL ++PAL+G+E+P +
Sbjct  228  KYDLGWKRNFEQVFGANKALWFLPLFSKKDLENIPALYGVEFPTR  272



>ref|XP_006288366.1| hypothetical protein CARUB_v10001614mg [Capsella rubella]
 gb|EOA21264.1| hypothetical protein CARUB_v10001614mg [Capsella rubella]
Length=291

 Score = 65.5 bits (158),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 25/49 (51%), Positives = 38/49 (78%), Gaps = 0/49 (0%)
 Frame = -3

Query  728  RYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGID  582
            +YDLG+K+NFEQVFG  + +W +P YS++DL ++ +L GLE+P +  ID
Sbjct  242  KYDLGKKKNFEQVFGRKKAFWLLPLYSKDDLENITSLQGLEFPTRSDID  290



>ref|XP_004306624.1| PREDICTED: probable protein S-acyltransferase 12 [Fragaria vesca 
subsp. vesca]
 ref|XP_011468902.1| PREDICTED: probable protein S-acyltransferase 12 [Fragaria vesca 
subsp. vesca]
 ref|XP_011468903.1| PREDICTED: probable protein S-acyltransferase 12 [Fragaria vesca 
subsp. vesca]
Length=308

 Score = 65.5 bits (158),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 26/43 (60%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = -3

Query  728  RYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYP  600
            +YDLGRK+NFEQVFG  +  WF P  S+ED+ ++PAL GLE+P
Sbjct  259  KYDLGRKKNFEQVFGTKKALWFFPLLSKEDIDNIPALRGLEFP  301



>gb|KJB49337.1| hypothetical protein B456_008G114100 [Gossypium raimondii]
Length=285

 Score = 65.1 bits (157),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 27/42 (64%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = -3

Query  695  QVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDGQEF  570
            +VFG D++YWFIPAYS+EDLR +PAL GLE+P  P  D +EF
Sbjct  244  EVFGTDKRYWFIPAYSDEDLRRIPALQGLEFPSNPDFDSEEF  285



>ref|XP_002872926.1| zinc ion binding protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49185.1| zinc ion binding protein [Arabidopsis lyrata subsp. lyrata]
Length=291

 Score = 65.1 bits (157),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 25/49 (51%), Positives = 38/49 (78%), Gaps = 0/49 (0%)
 Frame = -3

Query  728  RYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGID  582
            +YDLG+K+NFE+VFG  + +W +P YS+EDL ++ +L GLE+P +  ID
Sbjct  242  KYDLGKKKNFEEVFGKKKAFWLLPLYSKEDLDNMTSLQGLEFPTRSDID  290



>ref|XP_010456165.1| PREDICTED: probable protein S-acyltransferase 12 [Camelina sativa]
Length=291

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 25/49 (51%), Positives = 38/49 (78%), Gaps = 0/49 (0%)
 Frame = -3

Query  728  RYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGID  582
            +YDLG+K+NFEQVFG  + +W +P YS++DL ++ +L GLE+P +  ID
Sbjct  242  KYDLGKKKNFEQVFGKKKAFWLLPLYSKDDLDNITSLQGLEFPTRSDID  290



>ref|XP_009111388.1| PREDICTED: LOW QUALITY PROTEIN: probable protein S-acyltransferase 
12 [Brassica rapa]
Length=292

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 24/49 (49%), Positives = 38/49 (78%), Gaps = 0/49 (0%)
 Frame = -3

Query  728  RYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGID  582
            +YDLG+++NFEQVFG  + +W +P YS++DL ++ +L GLE+P +  ID
Sbjct  243  KYDLGKRKNFEQVFGKKKAFWLLPLYSKDDLHNITSLQGLEFPTRSDID  291



>ref|XP_010422733.1| PREDICTED: probable protein S-acyltransferase 12 [Camelina sativa]
Length=291

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 25/49 (51%), Positives = 38/49 (78%), Gaps = 0/49 (0%)
 Frame = -3

Query  728  RYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGID  582
            +YDLG+K+NFEQVFG  + +W +P YS++DL ++ +L GLE+P +  ID
Sbjct  242  KYDLGKKKNFEQVFGKKKAFWLLPLYSKDDLDNITSLQGLEFPTRSDID  290



>ref|XP_010428132.1| PREDICTED: probable protein S-acyltransferase 12 [Camelina sativa]
Length=292

 Score = 64.7 bits (156),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 25/49 (51%), Positives = 38/49 (78%), Gaps = 0/49 (0%)
 Frame = -3

Query  728  RYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGID  582
            +YDLG+K+NFEQVFG  + +W +P YS++DL ++ +L GLE+P +  ID
Sbjct  243  KYDLGKKKNFEQVFGKKKAFWLLPLYSKDDLDNITSLQGLEFPTRSDID  291



>emb|CDY51717.1| BnaA09g52040D [Brassica napus]
Length=289

 Score = 64.7 bits (156),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 24/49 (49%), Positives = 38/49 (78%), Gaps = 0/49 (0%)
 Frame = -3

Query  728  RYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGID  582
            +YDLG+++NFEQVFG  + +W +P YS++DL ++ +L GLE+P +  ID
Sbjct  240  KYDLGKRKNFEQVFGKKKAFWLLPLYSKDDLHNITSLQGLEFPTRSDID  288



>ref|XP_006657678.1| PREDICTED: probable protein S-acyltransferase 12-like isoform 
X2 [Oryza brachyantha]
Length=235

 Score = 63.9 bits (154),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 26/45 (58%), Positives = 34/45 (76%), Gaps = 0/45 (0%)
 Frame = -3

Query  728  RYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLK  594
            +YDLG ++N EQVFG  R  WF+P YS EDL ++ ALHGLE+P +
Sbjct  186  KYDLGWRKNLEQVFGTKRLLWFLPLYSTEDLHNISALHGLEFPTR  230



>ref|XP_006413626.1| hypothetical protein EUTSA_v10024722mg [Eutrema salsugineum]
 gb|ESQ55079.1| hypothetical protein EUTSA_v10024722mg [Eutrema salsugineum]
Length=599

 Score = 65.5 bits (158),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -3

Query  725  YDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEY  603
            Y+LGRK NFEQVFG D+ YWF+P Y+E+D++ LPAL GL++
Sbjct  546  YNLGRKTNFEQVFGRDKMYWFVPLYTEDDMKRLPALRGLDF  586



>ref|XP_004957652.1| PREDICTED: probable S-acyltransferase At4g00840-like [Setaria 
italica]
Length=292

 Score = 64.7 bits (156),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 26/45 (58%), Positives = 35/45 (78%), Gaps = 0/45 (0%)
 Frame = -3

Query  728  RYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLK  594
            +YDLG +RN EQVFG  + +WF+P YS EDL ++PAL GLE+P +
Sbjct  243  KYDLGWRRNLEQVFGTKKLFWFVPLYSAEDLHNIPALGGLEFPTR  287



>ref|XP_010238650.1| PREDICTED: probable protein S-acyltransferase 12 isoform X1 [Brachypodium 
distachyon]
Length=298

 Score = 64.7 bits (156),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = -3

Query  728  RYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPG  588
            +YDLG ++N EQVFG  + +WF+P +S EDL ++PAL GL +P +PG
Sbjct  249  QYDLGWRKNLEQVFGTKKLFWFLPVHSSEDLHNIPALQGLGFPARPG  295



>tpg|DAA40774.1| TPA: hypothetical protein ZEAMMB73_782285 [Zea mays]
Length=258

 Score = 63.9 bits (154),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 26/45 (58%), Positives = 34/45 (76%), Gaps = 0/45 (0%)
 Frame = -3

Query  728  RYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLK  594
            +YDLG KRN EQVFG  +  WF+P YS EDL ++PAL G+E+P +
Sbjct  209  KYDLGWKRNLEQVFGTKKLLWFVPLYSTEDLHNIPALRGMEFPTR  253



>ref|XP_003560239.2| PREDICTED: probable protein S-acyltransferase 12 isoform X2 [Brachypodium 
distachyon]
Length=312

 Score = 64.7 bits (156),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = -3

Query  728  RYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPG  588
            +YDLG ++N EQVFG  + +WF+P +S EDL ++PAL GL +P +PG
Sbjct  263  QYDLGWRKNLEQVFGTKKLFWFLPVHSSEDLHNIPALQGLGFPARPG  309



>ref|XP_009136109.1| PREDICTED: probable protein S-acyltransferase 13 [Brassica rapa]
Length=301

 Score = 64.7 bits (156),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -3

Query  725  YDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEY  603
            Y+LGRK+NFEQVFG D+ YWF+P Y+++D++ +PAL GL++
Sbjct  248  YNLGRKQNFEQVFGKDKLYWFVPLYTQDDMKRMPALRGLDF  288



>ref|XP_006283414.1| hypothetical protein CARUB_v10004463mg [Capsella rubella]
 gb|EOA16312.1| hypothetical protein CARUB_v10004463mg [Capsella rubella]
Length=574

 Score = 65.1 bits (157),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = -3

Query  725  YDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLE  606
            Y+LGRK NFEQVFG D+ YWF+P Y+EED++ LP+L GL+
Sbjct  522  YNLGRKTNFEQVFGRDKMYWFVPLYTEEDMKKLPSLGGLD  561



>ref|NP_567668.1| DHHC-type zinc finger family protein [Arabidopsis thaliana]
 sp|Q94C49.1|ZDH18_ARATH RecName: Full=Probable protein S-acyltransferase 13; AltName: 
Full=Probable palmitoyltransferase At4g22750; AltName: Full=Zinc 
finger DHHC domain-containing protein At4g22750 [Arabidopsis 
thaliana]
 gb|AAK59683.1| unknown protein [Arabidopsis thaliana]
 gb|AAL33803.1| unknown protein [Arabidopsis thaliana]
 gb|AEE84651.1| DHHC-type zinc finger family protein [Arabidopsis thaliana]
Length=302

 Score = 64.3 bits (155),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -3

Query  725  YDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEY  603
            Y++GRK NFEQVFG D+ YWF+P Y+E+D + LPAL GL++
Sbjct  248  YNVGRKTNFEQVFGSDKMYWFVPLYTEDDKKKLPALGGLDF  288



>gb|ACF85839.1| unknown [Zea mays]
 gb|ACG46105.1| transposon protein [Zea mays]
 tpg|DAA40776.1| TPA: Transposon protein [Zea mays]
Length=293

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 26/45 (58%), Positives = 34/45 (76%), Gaps = 0/45 (0%)
 Frame = -3

Query  728  RYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLK  594
            +YDLG KRN EQVFG  +  WF+P YS EDL ++PAL G+E+P +
Sbjct  244  KYDLGWKRNLEQVFGTKKLLWFVPLYSTEDLHNIPALRGMEFPTR  288



>ref|XP_009401747.1| PREDICTED: probable protein S-acyltransferase 12 [Musa acuminata 
subsp. malaccensis]
Length=313

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 24/49 (49%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = -3

Query  728  RYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGID  582
            +YDLG+++NFEQVFG  +  WF+P +S EDL  +PAL GL++P +  ++
Sbjct  264  KYDLGKRKNFEQVFGTKKLLWFLPLFSAEDLEKIPALKGLDFPTRSDVE  312



>gb|AAM65313.1| unknown [Arabidopsis thaliana]
Length=302

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -3

Query  725  YDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEY  603
            Y++GRK NFEQVFG D+ YWF+P Y+E+D + LPAL GL++
Sbjct  248  YNVGRKTNFEQVFGSDKMYWFVPLYTEDDKKKLPALGGLDF  288



>ref|NP_001154264.1| DHHC-type zinc finger family protein [Arabidopsis thaliana]
 gb|AEE84652.1| DHHC-type zinc finger family protein [Arabidopsis thaliana]
Length=324

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -3

Query  725  YDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEY  603
            Y++GRK NFEQVFG D+ YWF+P Y+E+D + LPAL GL++
Sbjct  270  YNVGRKTNFEQVFGSDKMYWFVPLYTEDDKKKLPALGGLDF  310



>ref|XP_006396329.1| hypothetical protein EUTSA_v10028856mg [Eutrema salsugineum]
 gb|ESQ37782.1| hypothetical protein EUTSA_v10028856mg [Eutrema salsugineum]
Length=290

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 24/49 (49%), Positives = 38/49 (78%), Gaps = 0/49 (0%)
 Frame = -3

Query  728  RYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGID  582
            +YDLG+++NFEQVFG  + +W +P YS++DL ++ +L GLE+P +  ID
Sbjct  241  KYDLGKRKNFEQVFGKKKAFWLLPLYSKDDLDNITSLQGLEFPTRSDID  289



>ref|XP_010556619.1| PREDICTED: probable protein S-acyltransferase 12 [Tarenaya hassleriana]
Length=293

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = -3

Query  728  RYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDG  579
            +YDLG+K+NFEQVFG  +  W +P YS+ED  S+ AL G+ +P +  ID 
Sbjct  244  KYDLGKKKNFEQVFGKSKALWLLPLYSKEDAESITALRGVNFPTRSDIDA  293



>ref|XP_003521821.1| PREDICTED: probable protein S-acyltransferase 12-like [Glycine 
max]
 gb|KHN16412.1| Putative S-acyltransferase [Glycine soja]
Length=314

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 35/48 (73%), Gaps = 0/48 (0%)
 Frame = -3

Query  725  YDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGID  582
            YDLG KRNFEQVFG  +  W  P +S+EDL ++PAL G+E+P +  +D
Sbjct  266  YDLGWKRNFEQVFGTKKALWLFPLFSKEDLDNIPALRGIEFPTRSDVD  313



>ref|NP_567193.2| putative S-acyltransferase [Arabidopsis thaliana]
 sp|Q5M757.1|ZDH15_ARATH RecName: Full=Probable protein S-acyltransferase 12; AltName: 
Full=Probable palmitoyltransferase At4g00840; AltName: Full=Zinc 
finger DHHC domain-containing protein At4g00840 [Arabidopsis 
thaliana]
 gb|AAV91337.1| At4g00840 [Arabidopsis thaliana]
 gb|AAW39012.1| At4g00840 [Arabidopsis thaliana]
 dbj|BAF01156.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE81944.1| putative S-acyltransferase [Arabidopsis thaliana]
Length=291

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 24/49 (49%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = -3

Query  728  RYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGID  582
            +YDLG+K+NFEQVFG  + +W +P YS++D+ ++ +L GLE+P    ID
Sbjct  242  KYDLGKKKNFEQVFGKKKAFWLLPLYSKDDIDNITSLEGLEFPTCSDID  290



>emb|CAA16560.1| predicted protein [Arabidopsis thaliana]
 emb|CAB79230.1| predicted protein [Arabidopsis thaliana]
Length=820

 Score = 63.5 bits (153),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 25/41 (61%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -3

Query  725  YDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEY  603
            Y++GRK NFEQVFG D+ YWF+P Y+E+D + LPAL GL++
Sbjct  766  YNVGRKTNFEQVFGSDKMYWFVPLYTEDDKKKLPALGGLDF  806



>gb|EMT22691.1| hypothetical protein F775_15921 [Aegilops tauschii]
Length=163

 Score = 60.8 bits (146),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 22/42 (52%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = -3

Query  725  YDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYP  600
            YDLG ++N EQVFG ++  WF+P Y  EDL+++P + GLE+P
Sbjct  115  YDLGWRKNLEQVFGTNKLLWFLPMYCTEDLQNIPTIQGLEFP  156



>ref|NP_001190801.1| sterol 4-alpha methyl oxidase 1-3 [Arabidopsis thaliana]
 gb|AEE84650.1| sterol 4-alpha methyl oxidase 1-3 [Arabidopsis thaliana]
Length=581

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -3

Query  725  YDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEY  603
            Y++GRK NFEQVFG D+ YWF+P Y+E+D + LPAL GL++
Sbjct  527  YNVGRKTNFEQVFGSDKMYWFVPLYTEDDKKKLPALGGLDF  567



>ref|XP_002867753.1| hypothetical protein ARALYDRAFT_329352 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44012.1| hypothetical protein ARALYDRAFT_329352 [Arabidopsis lyrata subsp. 
lyrata]
Length=777

 Score = 63.5 bits (153),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 25/41 (61%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -3

Query  725  YDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEY  603
            Y++GRK NFEQVFG D+ YWF+P Y+E+D + LPAL GL++
Sbjct  723  YNVGRKTNFEQVFGSDKMYWFVPLYTEDDKKKLPALGGLDF  763



>ref|XP_006598426.1| PREDICTED: uncharacterized protein LOC100817234 [Glycine max]
Length=691

 Score = 63.2 bits (152),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/64 (47%), Positives = 39/64 (61%), Gaps = 3/64 (5%)
 Frame = -3

Query  692  VFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDGQEF*GALSRKAFPW--DQLYCI  519
            VFGMD++ WFIPAYSEED+R +  L GLEYP  P  +  EF G +S+ +  W   Q  C 
Sbjct  28   VFGMDKRCWFIPAYSEEDIRRMAVLQGLEYPSTPDFNAPEFLGLISQDSH-WLRSQQCCT  86

Query  518  QDVR  507
              + 
Sbjct  87   SKIN  90



>dbj|BAK01014.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=330

 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 25/44 (57%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = -3

Query  725  YDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLK  594
            YDLG ++N EQVFG  +  WF+P YS EDLR++PA+ GLE+P +
Sbjct  282  YDLGWRKNLEQVFGTKKLLWFLPMYSAEDLRNIPAIRGLEFPTR  325



>ref|XP_007147347.1| hypothetical protein PHAVU_006G116400g [Phaseolus vulgaris]
 gb|ESW19341.1| hypothetical protein PHAVU_006G116400g [Phaseolus vulgaris]
Length=293

 Score = 62.0 bits (149),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 35/48 (73%), Gaps = 0/48 (0%)
 Frame = -3

Query  725  YDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGID  582
            YDLG KRNFEQVFG  +  W  P +S+EDL ++PAL G+++P +  +D
Sbjct  245  YDLGWKRNFEQVFGTKKALWLFPMFSKEDLDNIPALRGIDFPTRSDVD  292



>gb|EEC81995.1| hypothetical protein OsI_25930 [Oryza sativa Indica Group]
Length=304

 Score = 61.6 bits (148),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 25/45 (56%), Positives = 34/45 (76%), Gaps = 0/45 (0%)
 Frame = -3

Query  728  RYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLK  594
            +YDLG ++N EQVFG  +  WF+P YS EDL ++ ALHGLE+P +
Sbjct  255  KYDLGWRKNLEQVFGTKKLLWFLPLYSAEDLHNIGALHGLEFPTR  299



>gb|EEE67131.1| hypothetical protein OsJ_24176 [Oryza sativa Japonica Group]
Length=303

 Score = 61.6 bits (148),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 25/45 (56%), Positives = 34/45 (76%), Gaps = 0/45 (0%)
 Frame = -3

Query  728  RYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLK  594
            +YDLG ++N EQVFG  +  WF+P YS EDL ++ ALHGLE+P +
Sbjct  254  KYDLGWRKNLEQVFGTKKLLWFLPLYSAEDLHNIGALHGLEFPTR  298



>ref|XP_009136132.1| PREDICTED: probable protein S-acyltransferase 13 [Brassica rapa]
Length=302

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 24/42 (57%), Positives = 36/42 (86%), Gaps = 1/42 (2%)
 Frame = -3

Query  725  YDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSL-PALHGLEY  603
            Y+LGRK+NFEQVFG D+ YWF+P Y+++D++ + PAL GL++
Sbjct  248  YNLGRKQNFEQVFGKDKLYWFVPLYTQDDMKRMPPALRGLDF  289



>ref|XP_010691320.1| PREDICTED: probable protein S-acyltransferase 12 [Beta vulgaris 
subsp. vulgaris]
Length=310

 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 22/45 (49%), Positives = 35/45 (78%), Gaps = 0/45 (0%)
 Frame = -3

Query  728  RYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLK  594
            +YDLG K+NFEQVFGM +  WF P ++++DL ++P+L G  +P++
Sbjct  261  KYDLGWKQNFEQVFGMKKALWFFPLFAKDDLDNVPSLQGTYFPVR  305



>gb|EMS59025.1| hypothetical protein TRIUR3_20383 [Triticum urartu]
Length=250

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 21/45 (47%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = -3

Query  728  RYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLK  594
             YDLG ++N EQVFG ++  WF+P Y  EDL+++  + GLE+P +
Sbjct  201  EYDLGWRKNLEQVFGTNKLLWFLPMYCTEDLQNIATIQGLEFPTR  245



>ref|XP_006657677.1| PREDICTED: probable protein S-acyltransferase 12-like isoform 
X1 [Oryza brachyantha]
Length=248

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 34/58 (59%), Gaps = 13/58 (22%)
 Frame = -3

Query  728  RYDLGRKRNFEQVF-------------GMDRQYWFIPAYSEEDLRSLPALHGLEYPLK  594
            +YDLG ++N EQVF             G  R  WF+P YS EDL ++ ALHGLE+P +
Sbjct  186  KYDLGWRKNLEQVFFTAFCTLIISLVFGTKRLLWFLPLYSTEDLHNISALHGLEFPTR  243



>ref|XP_011082343.1| PREDICTED: probable protein S-acyltransferase 12 isoform X2 [Sesamum 
indicum]
Length=292

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/49 (45%), Positives = 34/49 (69%), Gaps = 0/49 (0%)
 Frame = -3

Query  728  RYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGID  582
            +YDLG ++N EQVFG  +  W  P +S+EDL  +PAL G+++P +  I+
Sbjct  243  KYDLGWRKNIEQVFGTRKALWPFPLFSKEDLEQVPALRGIDFPTRSDIN  291



>ref|XP_011082342.1| PREDICTED: probable protein S-acyltransferase 12 isoform X1 [Sesamum 
indicum]
Length=306

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/49 (45%), Positives = 34/49 (69%), Gaps = 0/49 (0%)
 Frame = -3

Query  728  RYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGID  582
            +YDLG ++N EQVFG  +  W  P +S+EDL  +PAL G+++P +  I+
Sbjct  257  KYDLGWRKNIEQVFGTRKALWPFPLFSKEDLEQVPALRGIDFPTRSDIN  305



>gb|EYU32291.1| hypothetical protein MIMGU_mgv1a010611mg [Erythranthe guttata]
Length=307

 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 22/49 (45%), Positives = 33/49 (67%), Gaps = 0/49 (0%)
 Frame = -3

Query  728  RYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGID  582
            +YDLG K+N EQVFG ++  W  P  S++DL  +PAL GL +P +  ++
Sbjct  258  KYDLGWKKNIEQVFGTEKLMWPFPLLSKQDLEKVPALDGLNFPTRSDVN  306



>emb|CBI22146.3| unnamed protein product [Vitis vinifera]
Length=407

 Score = 53.5 bits (127),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 22/46 (48%), Positives = 32/46 (70%), Gaps = 0/46 (0%)
 Frame = -3

Query  683  MDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDGQEF*GALSRKA  546
            MD+++W IPAYSEED+  +P L GLEYP +P +D  +  G  +R +
Sbjct  1    MDKRFWLIPAYSEEDIIQMPELQGLEYPSRPNLDALQQVGEDTRNS  46



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1313813971470