BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF008M15

Length=719
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004230529.1|  PREDICTED: probable helicase MAGATAMA 3          60.8    3e-07   Solanum lycopersicum
ref|XP_009783829.1|  PREDICTED: probable helicase MAGATAMA 3 isof...  60.1    4e-07   Nicotiana sylvestris
ref|XP_009615515.1|  PREDICTED: probable helicase MAGATAMA 3 isof...  59.7    5e-07   Nicotiana tomentosiformis
ref|XP_009783831.1|  PREDICTED: probable helicase MAGATAMA 3 isof...  59.7    5e-07   Nicotiana sylvestris
ref|XP_009615516.1|  PREDICTED: probable helicase MAGATAMA 3 isof...  59.7    6e-07   Nicotiana tomentosiformis
ref|XP_006351830.1|  PREDICTED: probable helicase MAGATAMA 3-like     57.0    5e-06   Solanum tuberosum [potatoes]
ref|XP_002323787.1|  hypothetical protein POPTR_0017s08350g           54.3    2e-05   
gb|KDP29174.1|  hypothetical protein JCGZ_16563                       54.7    2e-05   Jatropha curcas
emb|CBI39734.3|  unnamed protein product                              54.7    3e-05   Vitis vinifera
ref|XP_010644570.1|  PREDICTED: probable helicase MAGATAMA 3 isof...  54.3    4e-05   Vitis vinifera
ref|XP_010644569.1|  PREDICTED: probable helicase MAGATAMA 3 isof...  54.3    4e-05   Vitis vinifera
ref|XP_011041921.1|  PREDICTED: probable helicase MAGATAMA 3 isof...  53.9    5e-05   Populus euphratica
ref|XP_011041920.1|  PREDICTED: probable helicase MAGATAMA 3 isof...  53.9    5e-05   Populus euphratica
emb|CDO97507.1|  unnamed protein product                              53.1    8e-05   Coffea canephora [robusta coffee]
gb|KDO50645.1|  hypothetical protein CISIN_1g003388mg                 53.1    9e-05   Citrus sinensis [apfelsine]
ref|XP_006491855.1|  PREDICTED: probable helicase MAGATAMA 3-like...  53.1    9e-05   Citrus sinensis [apfelsine]
ref|XP_006432288.1|  hypothetical protein CICLE_v10000289mg           53.1    9e-05   Citrus clementina [clementine]
ref|XP_006491853.1|  PREDICTED: probable helicase MAGATAMA 3-like...  53.1    9e-05   Citrus sinensis [apfelsine]
ref|XP_006432289.1|  hypothetical protein CICLE_v10000289mg           53.1    9e-05   Citrus clementina [clementine]
ref|XP_010267333.1|  PREDICTED: probable helicase MAGATAMA 3 isof...  52.8    1e-04   Nelumbo nucifera [Indian lotus]
ref|XP_010267332.1|  PREDICTED: probable helicase MAGATAMA 3 isof...  52.8    1e-04   Nelumbo nucifera [Indian lotus]
ref|XP_006491856.1|  PREDICTED: probable helicase MAGATAMA 3-like...  52.4    2e-04   Citrus sinensis [apfelsine]
gb|KJB32757.1|  hypothetical protein B456_005G259800                  51.6    3e-04   Gossypium raimondii
gb|KHG02943.1|  putative helicase                                     51.6    3e-04   Gossypium arboreum [tree cotton]
ref|XP_007041575.1|  P-loop containing nucleoside triphosphate hy...  51.2    4e-04   
ref|XP_008343429.1|  PREDICTED: probable helicase MAGATAMA 3          48.5    5e-04   
ref|XP_010098440.1|  hypothetical protein L484_012155                 50.8    6e-04   
ref|XP_010524514.1|  PREDICTED: LOW QUALITY PROTEIN: probable hel...  50.4    7e-04   Tarenaya hassleriana [spider flower]
ref|XP_004169688.1|  PREDICTED: probable helicase MAGATAMA 3-like     50.1    7e-04   
ref|XP_008218818.1|  PREDICTED: probable helicase MAGATAMA 3 isof...  50.1    9e-04   Prunus mume [ume]
ref|XP_008218817.1|  PREDICTED: probable helicase MAGATAMA 3 isof...  50.1    9e-04   Prunus mume [ume]
ref|XP_004134910.1|  PREDICTED: probable helicase MAGATAMA 3-like     50.1    0.001   
ref|XP_007226234.1|  hypothetical protein PRUPE_ppa017425mg           50.1    0.001   



>ref|XP_004230529.1| PREDICTED: probable helicase MAGATAMA 3 [Solanum lycopersicum]
 ref|XP_010315014.1| PREDICTED: probable helicase MAGATAMA 3 [Solanum lycopersicum]
Length=814

 Score = 60.8 bits (146),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 28/42 (67%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = -2

Query  244  YSDVDDYIANFEPLMFEEVKAQIIQGKKDDEGGNFFRFAFSV  119
            Y DV DY+A FEPL+FEEVKAQIIQGKKDDE    +  A +V
Sbjct  55   YKDVQDYLATFEPLLFEEVKAQIIQGKKDDEEETLWMKAVTV  96



>ref|XP_009783829.1| PREDICTED: probable helicase MAGATAMA 3 isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009783830.1| PREDICTED: probable helicase MAGATAMA 3 isoform X2 [Nicotiana 
sylvestris]
Length=823

 Score = 60.1 bits (144),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 28/42 (67%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = -2

Query  244  YSDVDDYIANFEPLMFEEVKAQIIQGKKDDEGGNFFRFAFSV  119
            Y DV+DYIA FEPL+FEEVKAQI+QGKKDDE    +  A +V
Sbjct  58   YKDVEDYIATFEPLLFEEVKAQIVQGKKDDEEDTQWMKAVTV  99



>ref|XP_009615515.1| PREDICTED: probable helicase MAGATAMA 3 isoform X1 [Nicotiana 
tomentosiformis]
Length=823

 Score = 59.7 bits (143),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 28/42 (67%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = -2

Query  244  YSDVDDYIANFEPLMFEEVKAQIIQGKKDDEGGNFFRFAFSV  119
            Y DV+DYIA FEPL+FEEVKAQI+QGKKDDE    +  A +V
Sbjct  58   YKDVEDYIATFEPLLFEEVKAQIVQGKKDDEEETQWMKAVTV  99



>ref|XP_009783831.1| PREDICTED: probable helicase MAGATAMA 3 isoform X3 [Nicotiana 
sylvestris]
Length=757

 Score = 59.7 bits (143),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 28/42 (67%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = -2

Query  244  YSDVDDYIANFEPLMFEEVKAQIIQGKKDDEGGNFFRFAFSV  119
            Y DV+DYIA FEPL+FEEVKAQI+QGKKDDE    +  A +V
Sbjct  58   YKDVEDYIATFEPLLFEEVKAQIVQGKKDDEEDTQWMKAVTV  99



>ref|XP_009615516.1| PREDICTED: probable helicase MAGATAMA 3 isoform X2 [Nicotiana 
tomentosiformis]
Length=757

 Score = 59.7 bits (143),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 28/42 (67%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = -2

Query  244  YSDVDDYIANFEPLMFEEVKAQIIQGKKDDEGGNFFRFAFSV  119
            Y DV+DYIA FEPL+FEEVKAQI+QGKKDDE    +  A +V
Sbjct  58   YKDVEDYIATFEPLLFEEVKAQIVQGKKDDEEETQWMKAVTV  99



>ref|XP_006351830.1| PREDICTED: probable helicase MAGATAMA 3-like [Solanum tuberosum]
Length=815

 Score = 57.0 bits (136),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 25/31 (81%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = -2

Query  244  YSDVDDYIANFEPLMFEEVKAQIIQGKKDDE  152
            Y DV DY+A FEPL+FEEVKAQIIQGKKDD+
Sbjct  55   YKDVQDYLATFEPLLFEEVKAQIIQGKKDDD  85



>ref|XP_002323787.1| hypothetical protein POPTR_0017s08350g [Populus trichocarpa]
 gb|EEF03920.1| hypothetical protein POPTR_0017s08350g [Populus trichocarpa]
Length=308

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/31 (84%), Positives = 28/31 (90%), Gaps = 1/31 (3%)
 Frame = -2

Query  244  YSDVDDYIANFEPLMFEEVKAQIIQGKKDDE  152
            Y DVDDY+A FEPL+FEEVKAQIIQ KKDDE
Sbjct  57   YKDVDDYLATFEPLLFEEVKAQIIQ-KKDDE  86



>gb|KDP29174.1| hypothetical protein JCGZ_16563 [Jatropha curcas]
Length=805

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 24/31 (77%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = -2

Query  244  YSDVDDYIANFEPLMFEEVKAQIIQGKKDDE  152
            Y DVDDY+A FEPL+FEEVKAQIIQ K D+E
Sbjct  60   YKDVDDYLATFEPLLFEEVKAQIIQRKDDEE  90



>emb|CBI39734.3| unnamed protein product [Vitis vinifera]
Length=663

 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 34/40 (85%), Gaps = 1/40 (3%)
 Frame = -2

Query  244  YSDVDDYIANFEPLMFEEVKAQIIQGKKDDEGGNFFRFAF  125
            Y+D+DDY+A FEPL+FEEVKAQI+QG +D+E  + ++FA 
Sbjct  56   YTDIDDYLATFEPLLFEEVKAQIVQG-RDEEEVSEWKFAI  94



>ref|XP_010644570.1| PREDICTED: probable helicase MAGATAMA 3 isoform X2 [Vitis vinifera]
Length=829

 Score = 54.3 bits (129),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 34/40 (85%), Gaps = 1/40 (3%)
 Frame = -2

Query  244  YSDVDDYIANFEPLMFEEVKAQIIQGKKDDEGGNFFRFAF  125
            Y+D+DDY+A FEPL+FEEVKAQI+QG +D+E  + ++FA 
Sbjct  56   YTDIDDYLATFEPLLFEEVKAQIVQG-RDEEEVSEWKFAI  94



>ref|XP_010644569.1| PREDICTED: probable helicase MAGATAMA 3 isoform X1 [Vitis vinifera]
Length=831

 Score = 54.3 bits (129),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 34/40 (85%), Gaps = 1/40 (3%)
 Frame = -2

Query  244  YSDVDDYIANFEPLMFEEVKAQIIQGKKDDEGGNFFRFAF  125
            Y+D+DDY+A FEPL+FEEVKAQI+QG +D+E  + ++FA 
Sbjct  56   YTDIDDYLATFEPLLFEEVKAQIVQG-RDEEEVSEWKFAI  94



>ref|XP_011041921.1| PREDICTED: probable helicase MAGATAMA 3 isoform X2 [Populus euphratica]
Length=823

 Score = 53.9 bits (128),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 26/31 (84%), Positives = 28/31 (90%), Gaps = 1/31 (3%)
 Frame = -2

Query  244  YSDVDDYIANFEPLMFEEVKAQIIQGKKDDE  152
            Y DVDDY+A FEPL+FEEVKAQIIQ KKDDE
Sbjct  57   YKDVDDYLATFEPLLFEEVKAQIIQ-KKDDE  86



>ref|XP_011041920.1| PREDICTED: probable helicase MAGATAMA 3 isoform X1 [Populus euphratica]
Length=824

 Score = 53.9 bits (128),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 26/31 (84%), Positives = 28/31 (90%), Gaps = 1/31 (3%)
 Frame = -2

Query  244  YSDVDDYIANFEPLMFEEVKAQIIQGKKDDE  152
            Y DVDDY+A FEPL+FEEVKAQIIQ KKDDE
Sbjct  58   YKDVDDYLATFEPLLFEEVKAQIIQ-KKDDE  87



>emb|CDO97507.1| unnamed protein product [Coffea canephora]
Length=824

 Score = 53.1 bits (126),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 21/37 (57%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = -2

Query  244  YSDVDDYIANFEPLMFEEVKAQIIQGKKDDEGGNFFR  134
            Y D+++Y+A FEPL+FEEVKAQI+QGK D+E   + +
Sbjct  56   YKDIEEYLATFEPLLFEEVKAQIVQGKDDEEATEWMQ  92



>gb|KDO50645.1| hypothetical protein CISIN_1g003388mg [Citrus sinensis]
Length=824

 Score = 53.1 bits (126),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 23/31 (74%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = -2

Query  244  YSDVDDYIANFEPLMFEEVKAQIIQGKKDDE  152
            Y DVDDY+A FEPL+FEEVKAQIIQ K ++E
Sbjct  58   YKDVDDYLATFEPLLFEEVKAQIIQKKDEEE  88



>ref|XP_006491855.1| PREDICTED: probable helicase MAGATAMA 3-like isoform X3 [Citrus 
sinensis]
Length=801

 Score = 53.1 bits (126),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 23/31 (74%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = -2

Query  244  YSDVDDYIANFEPLMFEEVKAQIIQGKKDDE  152
            Y DVDDY+A FEPL+FEEVKAQIIQ K ++E
Sbjct  58   YKDVDDYLATFEPLLFEEVKAQIIQKKDEEE  88



>ref|XP_006432288.1| hypothetical protein CICLE_v10000289mg [Citrus clementina]
 gb|ESR45528.1| hypothetical protein CICLE_v10000289mg [Citrus clementina]
Length=801

 Score = 53.1 bits (126),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 23/31 (74%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = -2

Query  244  YSDVDDYIANFEPLMFEEVKAQIIQGKKDDE  152
            Y DVDDY+A FEPL+FEEVKAQIIQ K ++E
Sbjct  58   YKDVDDYLATFEPLLFEEVKAQIIQKKDEEE  88



>ref|XP_006491853.1| PREDICTED: probable helicase MAGATAMA 3-like isoform X1 [Citrus 
sinensis]
 ref|XP_006491854.1| PREDICTED: probable helicase MAGATAMA 3-like isoform X2 [Citrus 
sinensis]
Length=824

 Score = 53.1 bits (126),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 23/31 (74%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = -2

Query  244  YSDVDDYIANFEPLMFEEVKAQIIQGKKDDE  152
            Y DVDDY+A FEPL+FEEVKAQIIQ K ++E
Sbjct  58   YKDVDDYLATFEPLLFEEVKAQIIQKKDEEE  88



>ref|XP_006432289.1| hypothetical protein CICLE_v10000289mg [Citrus clementina]
 gb|ESR45529.1| hypothetical protein CICLE_v10000289mg [Citrus clementina]
Length=824

 Score = 53.1 bits (126),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 23/31 (74%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = -2

Query  244  YSDVDDYIANFEPLMFEEVKAQIIQGKKDDE  152
            Y DVDDY+A FEPL+FEEVKAQIIQ K ++E
Sbjct  58   YKDVDDYLATFEPLLFEEVKAQIIQKKDEEE  88



>ref|XP_010267333.1| PREDICTED: probable helicase MAGATAMA 3 isoform X2 [Nelumbo nucifera]
Length=823

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 21/35 (60%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = -2

Query  244  YSDVDDYIANFEPLMFEEVKAQIIQGKKDDEGGNF  140
            Y DV++YI  FEPL+FEEVKAQ++QGK D+E   +
Sbjct  53   YKDVNEYIGTFEPLLFEEVKAQVVQGKDDEEASEW  87



>ref|XP_010267332.1| PREDICTED: probable helicase MAGATAMA 3 isoform X1 [Nelumbo nucifera]
Length=824

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 21/35 (60%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = -2

Query  244  YSDVDDYIANFEPLMFEEVKAQIIQGKKDDEGGNF  140
            Y DV++YI  FEPL+FEEVKAQ++QGK D+E   +
Sbjct  54   YKDVNEYIGTFEPLLFEEVKAQVVQGKDDEEASEW  88



>ref|XP_006491856.1| PREDICTED: probable helicase MAGATAMA 3-like isoform X4 [Citrus 
sinensis]
Length=704

 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/31 (81%), Positives = 28/31 (90%), Gaps = 1/31 (3%)
 Frame = -2

Query  244  YSDVDDYIANFEPLMFEEVKAQIIQGKKDDE  152
            Y DVDDY+A FEPL+FEEVKAQIIQ KKD+E
Sbjct  58   YKDVDDYLATFEPLLFEEVKAQIIQ-KKDEE  87



>gb|KJB32757.1| hypothetical protein B456_005G259800 [Gossypium raimondii]
Length=817

 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = -2

Query  244  YSDVDDYIANFEPLMFEEVKAQIIQGKKDDEGGNF  140
            Y DVDDY+A FEPL+FEEVKAQI+Q K ++E  ++
Sbjct  52   YKDVDDYLATFEPLLFEEVKAQIVQRKDEEEVADW  86



>gb|KHG02943.1| putative helicase [Gossypium arboreum]
Length=819

 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 22/31 (71%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = -2

Query  244  YSDVDDYIANFEPLMFEEVKAQIIQGKKDDE  152
            Y DVDDY+A FEPL+FEEVKAQI+Q K ++E
Sbjct  52   YKDVDDYLATFEPLLFEEVKAQIVQRKDEEE  82



>ref|XP_007041575.1| P-loop containing nucleoside triphosphate hydrolases superfamily 
protein isoform 1 [Theobroma cacao]
 ref|XP_007041576.1| P-loop containing nucleoside triphosphate hydrolases superfamily 
protein isoform 1 [Theobroma cacao]
 ref|XP_007041577.1| P-loop containing nucleoside triphosphate hydrolases superfamily 
protein isoform 1 [Theobroma cacao]
 gb|EOX97406.1| P-loop containing nucleoside triphosphate hydrolases superfamily 
protein isoform 1 [Theobroma cacao]
 gb|EOX97407.1| P-loop containing nucleoside triphosphate hydrolases superfamily 
protein isoform 1 [Theobroma cacao]
 gb|EOX97408.1| P-loop containing nucleoside triphosphate hydrolases superfamily 
protein isoform 1 [Theobroma cacao]
Length=818

 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 22/31 (71%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = -2

Query  244  YSDVDDYIANFEPLMFEEVKAQIIQGKKDDE  152
            Y DVDDY+A FEPL+FEEVKAQI+Q K ++E
Sbjct  52   YKDVDDYLATFEPLLFEEVKAQIVQRKDEEE  82



>ref|XP_008343429.1| PREDICTED: probable helicase MAGATAMA 3 [Malus domestica]
Length=145

 Score = 48.5 bits (114),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 22/31 (71%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = -2

Query  244  YSDVDDYIANFEPLMFEEVKAQIIQGKKDDE  152
            Y DVDDYI+ +EPL+FEEVKAQI+Q K  DE
Sbjct  62   YKDVDDYISTYEPLLFEEVKAQILQEKDMDE  92



>ref|XP_010098440.1| hypothetical protein L484_012155 [Morus notabilis]
 gb|EXB75031.1| hypothetical protein L484_012155 [Morus notabilis]
Length=965

 Score = 50.8 bits (120),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 23/31 (74%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = -2

Query  247  EYSDVDDYIANFEPLMFEEVKAQIIQGKKDD  155
             Y DVDDYI+ FEPL+FEEVKAQI Q K DD
Sbjct  56   RYKDVDDYISTFEPLLFEEVKAQISQKKDDD  86



>ref|XP_010524514.1| PREDICTED: LOW QUALITY PROTEIN: probable helicase MAGATAMA 3 
[Tarenaya hassleriana]
Length=821

 Score = 50.4 bits (119),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 22/32 (69%), Positives = 25/32 (78%), Gaps = 0/32 (0%)
 Frame = -2

Query  244  YSDVDDYIANFEPLMFEEVKAQIIQGKKDDEG  149
            Y DVDDY+  FEPL+FEEVKAQI+Q K  DE 
Sbjct  52   YEDVDDYLETFEPLLFEEVKAQIVQRKDSDEA  83



>ref|XP_004169688.1| PREDICTED: probable helicase MAGATAMA 3-like, partial [Cucumis 
sativus]
Length=497

 Score = 50.1 bits (118),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 23/44 (52%), Positives = 30/44 (68%), Gaps = 1/44 (2%)
 Frame = -2

Query  244  YSDVDDYIANFEPLMFEEVKAQIIQGKKDDEGGNF-FRFAFSVS  116
            Y DVDDY + FEPL+ EE+KAQIIQ  +D+E  ++ FR     S
Sbjct  55   YKDVDDYTSTFEPLLLEEIKAQIIQRNEDEEASDWKFRAIMECS  98



>ref|XP_008218818.1| PREDICTED: probable helicase MAGATAMA 3 isoform X2 [Prunus mume]
Length=826

 Score = 50.1 bits (118),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = -2

Query  244  YSDVDDYIANFEPLMFEEVKAQIIQGKKDDEGGNFFR  134
            Y DVDDYI+ +EPL+FEEVKAQIIQ K +++  N  R
Sbjct  61   YKDVDDYISTYEPLLFEEVKAQIIQSKDENQLLNPKR  97



>ref|XP_008218817.1| PREDICTED: probable helicase MAGATAMA 3 isoform X1 [Prunus mume]
Length=827

 Score = 50.1 bits (118),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = -2

Query  244  YSDVDDYIANFEPLMFEEVKAQIIQGKKDDEGGNFFR  134
            Y DVDDYI+ +EPL+FEEVKAQIIQ K +++  N  R
Sbjct  61   YKDVDDYISTYEPLLFEEVKAQIIQSKDENQLLNPKR  97



>ref|XP_004134910.1| PREDICTED: probable helicase MAGATAMA 3-like [Cucumis sativus]
Length=841

 Score = 50.1 bits (118),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 23/44 (52%), Positives = 30/44 (68%), Gaps = 1/44 (2%)
 Frame = -2

Query  244  YSDVDDYIANFEPLMFEEVKAQIIQGKKDDEGGNF-FRFAFSVS  116
            Y DVDDY + FEPL+ EE+KAQIIQ  +D+E  ++ FR     S
Sbjct  55   YKDVDDYTSTFEPLLLEEIKAQIIQRNEDEEASDWKFRAIMECS  98



>ref|XP_007226234.1| hypothetical protein PRUPE_ppa017425mg [Prunus persica]
 gb|EMJ27433.1| hypothetical protein PRUPE_ppa017425mg [Prunus persica]
Length=826

 Score = 50.1 bits (118),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 21/31 (68%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = -2

Query  244  YSDVDDYIANFEPLMFEEVKAQIIQGKKDDE  152
            Y DVDDYI+ +EPL+FEEVKAQIIQ K +++
Sbjct  62   YKDVDDYISTYEPLLFEEVKAQIIQSKDENQ  92



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1260188911410