BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF008L11

Length=761
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011034836.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    192   1e-89   Populus euphratica
ref|XP_011041188.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    191   2e-89   Populus euphratica
ref|XP_002300632.2|  hypothetical protein POPTR_0002s00840g             192   4e-89   
ref|XP_002307806.1|  glyceraldehyde-3-phosphate dehydrogenase fam...    191   6e-89   Populus trichocarpa [western balsam poplar]
ref|XP_010094540.1|  Glyceraldehyde-3-phosphate dehydrogenase B         191   8e-89   
ref|XP_006383783.1|  hypothetical protein POPTR_0005s27550g             191   1e-88   
ref|XP_007018105.1|  Glyceraldehyde-3-phosphate dehydrogenase B s...    192   1e-88   
ref|XP_010539030.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    191   5e-88   Tarenaya hassleriana [spider flower]
gb|KHG00663.1|  Glyceraldehyde-3-phosphate dehydrogenase B, chlor...    188   6e-88   Gossypium arboreum [tree cotton]
gb|KJB14201.1|  hypothetical protein B456_002G114000                    187   6e-88   Gossypium raimondii
emb|CDP07271.1|  unnamed protein product                                195   7e-88   Coffea canephora [robusta coffee]
ref|XP_006581071.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    192   1e-87   
gb|KHN20097.1|  Glyceraldehyde-3-phosphate dehydrogenase B, chlor...    192   1e-87   Glycine soja [wild soybean]
gb|ACU20783.1|  unknown                                                 191   1e-87   Glycine max [soybeans]
ref|NP_001237135.1|  glyceraldehyde-3-phosphate dehydrogenase B s...    192   1e-87   
gb|KHG26323.1|  Glyceraldehyde-3-phosphate dehydrogenase B, chlor...    192   1e-87   Gossypium arboreum [tree cotton]
ref|XP_004238446.2|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    193   2e-87   
gb|KJB57938.1|  hypothetical protein B456_009G186400                    191   3e-87   Gossypium raimondii
ref|XP_008346447.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    186   3e-87   Malus domestica [apple tree]
ref|XP_011034837.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    192   5e-87   Populus euphratica
ref|XP_009362871.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    186   5e-87   Pyrus x bretschneideri [bai li]
ref|XP_010500213.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    189   7e-87   Camelina sativa [gold-of-pleasure]
gb|KDP36765.1|  hypothetical protein JCGZ_08056                         192   7e-87   Jatropha curcas
ref|XP_006342156.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    192   8e-87   
ref|XP_006577850.1|  PREDICTED: uncharacterized protein LOC100806...    189   9e-87   Glycine max [soybeans]
gb|AFG28405.1|  glyceraldehyde-3-phosphate dehydrogenase B              186   1e-86   Pyrus x bretschneideri [bai li]
ref|NP_001240080.1|  uncharacterized protein LOC100806482               189   1e-86   Glycine max [soybeans]
ref|XP_011074072.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    190   1e-86   Sesamum indicum [beniseed]
ref|XP_009629570.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    188   1e-86   Nicotiana tomentosiformis
ref|XP_009780936.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    187   1e-86   Nicotiana sylvestris
ref|XP_010918353.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    191   2e-86   Elaeis guineensis
ref|XP_002891244.1|  glyceraldehyde-3-phosphate dehydrogenase B s...    189   2e-86   
ref|NP_001289237.1|  glyceraldehyde-3-phosphate dehydrogenase B, ...    186   2e-86   Pyrus x bretschneideri [bai li]
ref|XP_002510706.1|  glyceraldehyde 3-phosphate dehydrogenase, pu...    187   4e-86   Ricinus communis
ref|XP_006307502.1|  hypothetical protein CARUB_v10009127mg             187   4e-86   Capsella rubella
ref|XP_009786329.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    186   4e-86   Nicotiana sylvestris
ref|XP_007135965.1|  hypothetical protein PHAVU_009G006600g             188   5e-86   Phaseolus vulgaris [French bean]
ref|NP_174996.1|  glyceraldehyde-3-phosphate dehydrogenase B            189   5e-86   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009595874.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    186   5e-86   Nicotiana tomentosiformis
gb|KFK29151.1|  hypothetical protein AALP_AA7G095400                    185   8e-86   Arabis alpina [alpine rockcress]
ref|XP_004300121.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    186   9e-86   Fragaria vesca subsp. vesca
gb|AAD10210.1|  glyceraldehyde 3-phosphate dehydrogenase B subunit      188   9e-86   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010478986.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    189   1e-85   Camelina sativa [gold-of-pleasure]
ref|XP_002273754.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    186   1e-85   Vitis vinifera
emb|CAN69459.1|  hypothetical protein VITISV_021576                     186   1e-85   Vitis vinifera
gb|AEO45784.1|  glyceraldehyde-3-phosphate dehydrogenase B              186   1e-85   Scoparia dulcis [escobilla]
ref|XP_009107645.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    184   2e-85   Brassica rapa
ref|XP_010478985.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    189   2e-85   Camelina sativa [gold-of-pleasure]
ref|XP_003603851.1|  Glyceraldehyde-3-phosphate dehydrogenase           188   4e-85   Medicago truncatula
emb|CDY69523.1|  BnaC08g46180D                                          184   4e-85   Brassica napus [oilseed rape]
ref|XP_008786670.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    189   5e-85   Phoenix dactylifera
ref|XP_006395998.1|  hypothetical protein EUTSA_v10004217mg             184   6e-85   Eutrema salsugineum [saltwater cress]
ref|XP_004500847.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    187   7e-85   Cicer arietinum [garbanzo]
emb|CBL43264.1|  glyceraldehyde-3-phosphate dehydrogenase               184   8e-85   Solanum tuberosum [potatoes]
sp|P12859.2|G3PB_PEA  RecName: Full=Glyceraldehyde-3-phosphate de...    186   1e-84   Pisum sativum [garden pea]
ref|XP_006342537.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    182   2e-84   Solanum tuberosum [potatoes]
gb|AES74101.2|  glyceraldehyde-3-phosphate dehydrogenase B              187   2e-84   Medicago truncatula
gb|AIU56855.1|  glyceraldehyde-3-phosphate dehydrogenase B              184   2e-84   Brassica rapa subsp. chinensis [bok-choy]
ref|XP_009362872.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    186   3e-84   
ref|XP_004253122.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    184   3e-84   Solanum lycopersicum
gb|ACJ84309.1|  unknown                                                 188   4e-84   Medicago truncatula
gb|EPS70760.1|  hypothetical protein M569_03997                         186   5e-84   Genlisea aurea
ref|XP_004145550.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    186   2e-83   Cucumis sativus [cucumbers]
ref|XP_008452997.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    185   2e-83   
ref|XP_008452998.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    185   2e-83   Cucumis melo [Oriental melon]
emb|CAA33262.1|  unnamed protein product                                182   2e-83   Pisum sativum [garden pea]
dbj|BAJ86633.1|  predicted protein                                      186   4e-83   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002981126.1|  hypothetical protein SELMODRAFT_271457             189   5e-83   
ref|XP_002982608.1|  hypothetical protein SELMODRAFT_179517             189   5e-83   Selaginella moellendorffii
ref|XP_006649326.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    181   6e-83   
ref|NP_001048847.1|  Os03g0129300                                       180   8e-83   
dbj|BAJ87214.1|  predicted protein                                      185   9e-83   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMS49604.1|  Glyceraldehyde-3-phosphate dehydrogenase B, chlor...    184   9e-83   Triticum urartu
gb|ABF93789.1|  Glyceraldehyde-3-phosphate dehydrogenase B, chlor...    179   2e-82   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010061201.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    182   3e-82   Eucalyptus grandis [rose gum]
ref|XP_010686856.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    183   1e-81   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006855683.1|  hypothetical protein AMTR_s00044p00131190          187   1e-81   
ref|XP_003558903.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    177   2e-81   
ref|XP_003603850.1|  Glyceraldehyde-3-phosphate dehydrogenase           188   2e-78   
sp|P12860.1|G3PB_SPIOL  RecName: Full=Glyceraldehyde-3-phosphate ...    181   3e-78   Spinacia oleracea
pdb|2PKQ|O  Chain O, Crystal Structure Of The Photosynthetic A2b2...    180   9e-78   Spinacia oleracea
emb|CAC80378.2|  glyceraldehyde-3-phosphate dehydrogenase               176   9e-77   Chara vulgaris
gb|ABK24645.1|  unknown                                                 184   2e-76   Picea sitchensis
gb|ACN40006.1|  unknown                                                 184   2e-76   Picea sitchensis
gb|ACN40526.1|  unknown                                                 184   2e-76   Picea sitchensis
gb|EMT30317.1|  Glyceraldehyde-3-phosphate dehydrogenase B, chlor...    185   8e-76   
gb|ABD37965.1|  glyceraldehyde-3-phosphate dehydrogenase subunit B      169   3e-72   Mesostigma viride
pdb|2PKR|O  Chain O, Crystal Structure Of (a+cte)4 Chimeric Form ...    161   5e-72   Spinacia oleracea
gb|ABK00057.1|  chloroplast glyceraldehyde-3-phosphate dehydrogenase    169   8e-71   Mesostigma viride
ref|XP_004985859.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    184   3e-69   Setaria italica
gb|KGN49135.1|  hypothetical protein Csa_6G514950                       150   2e-66   Cucumis sativus [cucumbers]
ref|XP_002540513.1|  glyceraldehyde 3-phosphate dehydrogenase, pu...    157   9e-65   Ricinus communis
gb|AES74103.2|  glyceraldehyde-3-phosphate dehydrogenase B              188   1e-62   Medicago truncatula
pir||DESPGA  glyceraldehyde-3-phosphate dehydrogenase (NADP)  (ph...    164   3e-62
gb|ABF74607.1|  chloroplast glyceraldehyde-3-phosphate dehydrogen...    153   3e-62   Agave tequilana
ref|XP_009148557.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    164   3e-62   
pdb|1JN0|O  Chain O, Crystal Structure Of The Non-regulatory A4 I...    164   4e-62   Spinacia oleracea
ref|XP_009362873.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    186   4e-62   
ref|XP_002985183.1|  hypothetical protein SELMODRAFT_181561             162   4e-62   Selaginella moellendorffii
ref|NP_001077529.1|  glyceraldehyde 3-phosphate dehydrogenase GAPA2     164   4e-62   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010476270.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    164   5e-62   Camelina sativa [gold-of-pleasure]
ref|XP_010494750.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    163   7e-62   Camelina sativa [gold-of-pleasure]
dbj|BAP91041.1|  glyceraldehyde 3-phosphate dehydrogenase-A             164   9e-62   Nicotiana benthamiana
sp|P19866.2|G3PA_SPIOL  RecName: Full=Glyceraldehyde-3-phosphate ...    162   9e-62   Spinacia oleracea
ref|XP_002970103.1|  hypothetical protein SELMODRAFT_270825             161   1e-61   Selaginella moellendorffii
ref|XP_009800449.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    164   1e-61   Nicotiana sylvestris
ref|XP_009631078.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    164   1e-61   Nicotiana tomentosiformis
sp|P09672.1|G3PA_SINAL  RecName: Full=Glyceraldehyde-3-phosphate ...    163   1e-61   Sinapis alba [bai jie]
ref|XP_010476269.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    162   1e-61   Camelina sativa [gold-of-pleasure]
ref|XP_010494747.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    163   1e-61   Camelina sativa [gold-of-pleasure]
pdb|1NBO|O  Chain O, The Dual Coenzyme Specificity Of Photosynthe...    162   1e-61   Spinacia oleracea
pdb|1RM3|O  Chain O, Crystal Structure Of Mutant T33a Of Photosyn...    162   1e-61   Spinacia oleracea
ref|NP_172750.1|  glyceraldehyde 3-phosphate dehydrogenase GAPA2        163   1e-61   Arabidopsis thaliana [mouse-ear cress]
gb|EPS59235.1|  hypothetical protein M569_15573                         162   1e-61   Genlisea aurea
ref|XP_002892719.1|  GAPA-2                                             162   2e-61   Arabidopsis lyrata subsp. lyrata
pdb|1RM5|O  Chain O, Crystal Structure Of Mutant S188a Of Photosy...    162   2e-61   Spinacia oleracea
ref|XP_006304985.1|  hypothetical protein CARUB_v10009349mg             162   2e-61   
ref|XP_009148556.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    162   2e-61   Brassica rapa
emb|CDY19412.1|  BnaC05g09210D                                          162   2e-61   Brassica napus [oilseed rape]
ref|XP_006417177.1|  hypothetical protein EUTSA_v10007809mg             162   2e-61   Eutrema salsugineum [saltwater cress]
ref|XP_010425376.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    162   2e-61   Camelina sativa [gold-of-pleasure]
ref|XP_010502598.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    162   2e-61   Camelina sativa [gold-of-pleasure]
ref|XP_009118049.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    162   2e-61   Brassica rapa
ref|NP_001117276.1|  glyceraldehyde 3-phosphate dehydrogenase GAPA2     162   3e-61   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006417176.1|  hypothetical protein EUTSA_v10007809mg             162   4e-61   
gb|KHN46369.1|  Glyceraldehyde-3-phosphate dehydrogenase A, chlor...    161   4e-61   Glycine soja [wild soybean]
emb|CDY16038.1|  BnaC08g40850D                                          161   4e-61   Brassica napus [oilseed rape]
gb|KHN46819.1|  Glyceraldehyde-3-phosphate dehydrogenase A, chlor...    161   4e-61   Glycine soja [wild soybean]
ref|NP_001238484.1|  glyceraldehyde-3-phosphate dehydrogenase A s...    161   4e-61   
ref|XP_010694632.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    161   5e-61   Beta vulgaris subsp. vulgaris [field beet]
emb|CDY26599.1|  BnaA09g46780D                                          161   5e-61   Brassica napus [oilseed rape]
ref|XP_010028899.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    159   5e-61   Eucalyptus grandis [rose gum]
ref|XP_003579898.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    163   5e-61   Brachypodium distachyon [annual false brome]
gb|KFK43560.1|  hypothetical protein AALP_AA1G142100                    161   5e-61   Arabis alpina [alpine rockcress]
ref|XP_006395535.1|  hypothetical protein EUTSA_v10004349mg             160   5e-61   Eutrema salsugineum [saltwater cress]
gb|AIU56856.1|  glyceraldehyde-3-phosphate dehydrogenase A              161   6e-61   Brassica rapa subsp. chinensis [bok-choy]
gb|KFK33590.1|  hypothetical protein AALP_AA5G033500                    160   6e-61   Arabis alpina [alpine rockcress]
ref|XP_010425375.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    161   7e-61   Camelina sativa [gold-of-pleasure]
ref|XP_010502597.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    161   7e-61   Camelina sativa [gold-of-pleasure]
emb|CDX83635.1|  BnaC07g23750D                                          160   8e-61   
ref|XP_009152035.1|  PREDICTED: LOW QUALITY PROTEIN: glyceraldehy...    160   1e-60   Brassica rapa
ref|XP_009118048.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    161   1e-60   Brassica rapa
ref|XP_006359279.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    159   1e-60   Solanum tuberosum [potatoes]
ref|XP_003548805.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    160   1e-60   
ref|XP_004231523.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    160   1e-60   Solanum lycopersicum
gb|ACU21011.1|  unknown                                                 161   1e-60   Glycine max [soybeans]
ref|XP_007161788.1|  hypothetical protein PHAVU_001G098100g             159   1e-60   Phaseolus vulgaris [French bean]
dbj|BAK02737.1|  predicted protein                                      162   1e-60   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010250427.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    160   2e-60   Nelumbo nucifera [Indian lotus]
gb|KDP41897.1|  hypothetical protein JCGZ_26915                         160   2e-60   Jatropha curcas
gb|AHZ58488.1|  glyceraldehyde-3-phosphate dehydrogenase                157   2e-60   Syntrichia caninervis
emb|CDY13649.1|  BnaA06g32740D                                          159   2e-60   Brassica napus [oilseed rape]
ref|XP_010514317.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    160   2e-60   
dbj|BAJ90530.1|  predicted protein                                      160   2e-60   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_566796.2|  glyceraldehyde-3-phosphate dehydrogenase A subunit    161   2e-60   Arabidopsis thaliana [mouse-ear cress]
dbj|BAH57068.1|  AT1G12900                                              162   2e-60   Arabidopsis thaliana [mouse-ear cress]
dbj|BAJ90885.1|  predicted protein                                      160   2e-60   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AAA32793.1|  glyceraldehyde 3-phosphate dehydrogenase                161   2e-60   Arabidopsis thaliana [mouse-ear cress]
emb|CDY28536.1|  BnaC02g36240D                                          159   2e-60   Brassica napus [oilseed rape]
dbj|BAJ10475.1|  glyceraldehyde-3-phosphate dehydrogenase               161   2e-60   Brassica rapa subsp. chinensis [bok-choy]
ref|XP_002875330.1|  gapa                                               161   2e-60   Arabidopsis lyrata subsp. lyrata
gb|KJB11770.1|  hypothetical protein B456_001G276400                    160   3e-60   Gossypium raimondii
gb|EMT31124.1|  Glyceraldehyde-3-phosphate dehydrogenase A, chlor...    160   3e-60   
ref|XP_006652372.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    159   3e-60   
gb|AAD10209.1|  glyceraldehyde 3-phosphate dehydrogenase A subunit      161   3e-60   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006652373.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    158   4e-60   Oryza brachyantha
ref|XP_001771246.1|  predicted protein                                  154   4e-60   
ref|XP_001771209.1|  predicted protein                                  154   4e-60   
pdb|3K2B|A  Chain A, Crystal Structure Of Photosynthetic A4 Isofo...    160   5e-60   Arabidopsis thaliana [mouse-ear cress]
dbj|BAG68209.1|  glyceraldehyde-3-phosphate dehydrogenase               160   5e-60   Brassica rapa subsp. chinensis [bok-choy]
ref|XP_006291258.1|  hypothetical protein CARUB_v10017390mg             160   7e-60   Capsella rubella
gb|KJB11771.1|  hypothetical protein B456_001G276400                    159   7e-60   Gossypium raimondii
ref|XP_008797069.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    158   8e-60   
ref|XP_004304578.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    158   1e-59   Fragaria vesca subsp. vesca
ref|XP_001779769.1|  predicted protein                                  154   1e-59   
dbj|BAJ34149.1|  unnamed protein product                                156   1e-59   Eutrema halophilum
emb|CAC80374.1|  glyceraldehyde-3-phosphate dehydrogenase               184   1e-59   Capsicum annuum
ref|XP_001779753.1|  predicted protein                                  154   1e-59   
ref|XP_001753934.1|  predicted protein                                  153   2e-59   
ref|XP_004975847.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    157   2e-59   Setaria italica
gb|ABD37962.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A1     153   2e-59   Physcomitrella patens
gb|AEH04452.1|  glyceraldehyde-3-phosphate dehydrogenase                157   3e-59   Arachis hypogaea [goober]
emb|CDY48981.1|  BnaA02g28150D                                          156   3e-59   Brassica napus [oilseed rape]
ref|XP_001766703.1|  predicted protein                                  154   4e-59   
ref|XP_011399143.1|  Glyceraldehyde-3-phosphate dehydrogenase A, ...    159   5e-59   Auxenochlorella protothecoides
ref|XP_007032095.1|  Glyceraldehyde 3-phosphate dehydrogenase A s...    155   5e-59   Theobroma cacao [chocolate]
tpg|DAA37469.1|  TPA: glyceraldehyde-3-phosphate dehydrogenase1         158   6e-59   
ref|XP_008379036.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    155   6e-59   Malus domestica [apple tree]
ref|NP_001105414.1|  glyceraldehyde-3-phosphate dehydrogenase A, ...    157   6e-59   Zea mays [maize]
gb|ABD37963.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A2     154   6e-59   Physcomitrella patens
ref|XP_009378071.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    155   7e-59   Pyrus x bretschneideri [bai li]
ref|XP_007217883.1|  hypothetical protein PRUPE_ppa006610mg             155   7e-59   Prunus persica
gb|AAG23800.1|  chloroplast NADP-dependent glyceraldehyde 3-phosp...    183   8e-59   Cucurbita pepo
ref|XP_008362077.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    155   8e-59   Malus domestica [apple tree]
ref|XP_008231212.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    155   8e-59   Prunus mume [ume]
emb|CAA30152.1|  GADPH (383 AA)                                         157   9e-59   Zea mays [maize]
ref|XP_009378072.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    155   9e-59   Pyrus x bretschneideri [bai li]
gb|AFC88822.1|  glyceraldehyde-3-phosphate dehydrogenase-like pro...    157   1e-58   Miscanthus sinensis
ref|NP_001052984.1|  Os04g0459500                                       157   1e-58   
ref|XP_010090946.1|  Glyceraldehyde-3-phosphate dehydrogenase A         154   2e-58   Morus notabilis
ref|XP_003624553.1|  Glyceraldehyde-3-phosphate dehydrogenase A         153   4e-58   Medicago truncatula
gb|ACV32597.1|  putative glyceraldehyde-3-phosphate dehydrogenase       153   4e-58   Medicago sativa [alfalfa]
ref|XP_004493116.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    154   4e-58   Cicer arietinum [garbanzo]
gb|ACT21568.1|  glyceraldehyde-3-phosphate dehydrogenase                154   5e-58   Bruguiera gymnorhiza [Burma mangrove]
ref|XP_007510189.1|  glyceraldehyde-3-phosphate dehydrogenase           157   5e-58   Bathycoccus prasinos
emb|CAA33264.1|  unnamed protein product                                153   7e-58   Pisum sativum [garden pea]
gb|ADH43199.1|  glyceraldehyde-3-phosphate dehydrogenase                186   7e-58   Vicia sativa [spring vetch]
sp|P12858.2|G3PA_PEA  RecName: Full=Glyceraldehyde-3-phosphate de...    153   7e-58   Pisum sativum [garden pea]
ref|NP_001289256.1|  glyceraldehyde-3-phosphate dehydrogenase A, ...    152   8e-58   Pyrus x bretschneideri [bai li]
gb|AHA84230.1|  glyceraldehyde-3-phosphate dehydrogenase A              148   3e-57   Phaseolus vulgaris [French bean]
emb|CAC80390.1|  glyceraldehyde-3-phosphate dehydrogenase               171   6e-57   Coleochaete scutata
gb|ABG85190.1|  chloroplast glyceraldehyde-3-phosphate dehydrogen...    153   6e-57   Ostreococcus sp. 'lucimarinus'
ref|XP_001420043.1|  predicted protein                                  153   1e-56   Ostreococcus lucimarinus CCE9901
gb|ABS72003.1|  putative chloroplast glyceradehyde-3-phosphate de...    153   4e-56   Olea europaea
ref|XP_010528120.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    163   5e-56   Tarenaya hassleriana [spider flower]
gb|AEO45783.1|  glyceraldehyde-3-phosphate dehydrogenase A              162   5e-56   Scoparia dulcis [escobilla]
gb|ABD37954.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A      150   6e-56   Cyanophora paradoxa
ref|XP_010528117.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    163   7e-56   Tarenaya hassleriana [spider flower]
ref|XP_011070460.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    163   7e-56   Sesamum indicum [beniseed]
gb|EYU35565.1|  hypothetical protein MIMGU_mgv1a005886mg                163   9e-56   Erythranthe guttata [common monkey flower]
ref|XP_005644071.1|  glyceraldehyde-3-phosphate dehydrogenase           153   1e-55   Coccomyxa subellipsoidea C-169
gb|AHZ94971.1|  glyceraldehyde-3-phosphate dehydrogenase                163   2e-55   Lilium regale
ref|XP_009420999.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    160   2e-55   Musa acuminata subsp. malaccensis [pisang utan]
gb|ABW89099.1|  glyceraldehyde-3-phosphate dehydrogenase                162   2e-55   Helianthus annuus
gb|ACN40537.1|  unknown                                                 160   3e-55   Picea sitchensis
gb|AAA33780.1|  glyceraldehyde-phosphate dehydrogenase                  160   3e-55   Pinus sylvestris [Scotch pine]
gb|ADX97321.1|  glyceraldehyde-3-phosphate dehydrogenase                160   3e-55   Mangifera indica
gb|ABG35250.1|  glyceraldehyde-3-phosphate dehydrogenase                161   3e-55   Helianthus annuus
gb|ABK25233.1|  unknown                                                 160   3e-55   Picea sitchensis
gb|ABW89104.1|  glyceraldehyde-3-phosphate dehydrogenase                161   3e-55   Helianthus annuus
gb|ABG35254.1|  glyceraldehyde-3-phosphate dehydrogenase                160   4e-55   Helianthus annuus
gb|KDO63479.1|  hypothetical protein CISIN_1g013492mg                   161   4e-55   Citrus sinensis [apfelsine]
ref|XP_004236849.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    159   5e-55   Solanum lycopersicum
ref|XP_006446865.1|  hypothetical protein CICLE_v10015476mg             161   6e-55   Citrus clementina [clementine]
ref|XP_006468948.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    161   6e-55   Citrus sinensis [apfelsine]
ref|XP_010249379.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    159   7e-55   Nelumbo nucifera [Indian lotus]
ref|XP_009404713.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    159   7e-55   Musa acuminata subsp. malaccensis [pisang utan]
gb|ACN39951.1|  unknown                                                 159   7e-55   Picea sitchensis
sp|P09043.1|G3PA_TOBAC  RecName: Full=Glyceraldehyde-3-phosphate ...    141   1e-54   Nicotiana tabacum [American tobacco]
gb|ACN40000.1|  unknown                                                 158   1e-54   Picea sitchensis
gb|ABK24313.1|  unknown                                                 160   1e-54   Picea sitchensis
gb|ABG35267.1|  glyceraldehyde-3-phosphate dehydrogenase                161   1e-54   Helianthus annuus
gb|ABK96725.1|  unknown                                                 155   1e-54   Populus trichocarpa x Populus deltoides
ref|XP_010942312.1|  PREDICTED: LOW QUALITY PROTEIN: glyceraldehy...    157   2e-54   
emb|CCF55355.1|  Glyceraldehyde-3-phosphate dehydrogenase A             158   3e-54   Cucumis sativus [cucumbers]
ref|XP_002321065.2|  hypothetical protein POPTR_0014s13660g             157   4e-54   Populus trichocarpa [western balsam poplar]
ref|XP_011033706.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    157   4e-54   Populus euphratica
ref|XP_002278352.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    155   5e-54   Vitis vinifera
ref|XP_004161334.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    158   5e-54   
ref|XP_010660642.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    155   5e-54   
emb|CAN78872.1|  hypothetical protein VITISV_021726                     155   5e-54   Vitis vinifera
ref|XP_004145622.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    157   6e-54   
ref|XP_008449974.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    157   9e-54   Cucumis melo [Oriental melon]
gb|KJB57936.1|  hypothetical protein B456_009G186400                    191   1e-53   Gossypium raimondii
gb|AGJ50596.1|  GAPDH                                                   157   1e-53   Pericallis cruenta
ref|XP_008449975.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    157   1e-53   Cucumis melo [Oriental melon]
sp|P09044.1|G3PB_TOBAC  RecName: Full=Glyceraldehyde-3-phosphate ...    189   4e-53   Nicotiana tabacum [American tobacco]
ref|XP_010929533.1|  PREDICTED: LOW QUALITY PROTEIN: glyceraldehy...    154   4e-53   
ref|WP_042151414.1|  glyceraldehyde-3-phosphate dehydrogenase           148   1e-52   Planktothrix agardhii
ref|WP_026787014.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...    148   1e-52   Planktothrix
gb|AGW80488.1|  glyceraldehyde 3 phosphate dehydrogenase                146   2e-52   Planktothrix agardhii NIVA-CYA 68
gb|ELS46726.1|  glyceraldehyde-3-phosphate dehydrogenase 2              142   3e-52   Microcystis aeruginosa DIANCHI905
gb|ABD37966.1|  glyceraldehyde-3-phosphate dehydrogenase subunit B      183   4e-52   Spirogyra sp. SAG 170.80
ref|WP_007307714.1|  glyceraldehyde-3-phosphate dehydrogenase           143   4e-52   Crocosphaera watsonii
ref|XP_008663258.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    142   4e-52   
ref|WP_002731954.1|  glyceraldehyde-3-phosphate dehydrogenase           142   4e-52   Microcystis
dbj|GAL93645.1|  NADPH-dependent glyceraldehyde-3-phosphate dehyd...    142   4e-52   Microcystis aeruginosa NIES-44
gb|KDO63477.1|  hypothetical protein CISIN_1g013492mg                   151   4e-52   Citrus sinensis [apfelsine]
ref|WP_002780388.1|  Glyceraldehyde-3-phosphate dehydrogenase 2         142   5e-52   Microcystis aeruginosa
ref|WP_012265625.1|  glyceraldehyde-3-phosphate dehydrogenase           142   5e-52   Microcystis aeruginosa
ref|WP_015116915.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    147   5e-52   Rivularia sp. PCC 7116
ref|WP_015954248.1|  glyceraldehyde-3-phosphate dehydrogenase           141   5e-52   Cyanothece sp. PCC 7424
emb|CCH91489.1|  Glyceraldehyde-3-phosphate dehydrogenase 2             142   5e-52   Microcystis aeruginosa PCC 9432
emb|CCI19184.1|  Glyceraldehyde-3-phosphate dehydrogenase 2             142   5e-52   Microcystis aeruginosa PCC 9807
emb|CCH97953.1|  Glyceraldehyde-3-phosphate dehydrogenase 2             141   5e-52   Microcystis aeruginosa PCC 9717
ref|WP_016876187.1|  glyceraldehyde-3-phosphate dehydrogenase           145   6e-52   Chlorogloeopsis fritschii
ref|WP_040932844.1|  glyceraldehyde-3-phosphate dehydrogenase           143   7e-52   
ref|WP_008231341.1|  NADPH-dependent glyceraldehyde-3-phosphate d...    145   7e-52   Richelia intracellularis
ref|WP_015141410.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...    145   7e-52   Nostoc sp. PCC 7524
emb|CAC80372.1|  glyceraldehyde-3-phosphate dehydrogenase               159   1e-51   
ref|XP_008663264.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    141   1e-51   
ref|XP_009384599.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    185   1e-51   
ref|WP_035985041.1|  glyceraldehyde-3-phosphate dehydrogenase           139   1e-51   
ref|XP_009384600.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    185   1e-51   
ref|WP_039900510.1|  glyceraldehyde-3-phosphate dehydrogenase           143   1e-51   
ref|WP_026103380.1|  glyceraldehyde-3-phosphate dehydrogenase           144   1e-51   
ref|XP_010270515.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    185   1e-51   
emb|CCI33980.1|  Glyceraldehyde-3-phosphate dehydrogenase 2             143   1e-51   
ref|WP_026731665.1|  glyceraldehyde-3-phosphate dehydrogenase           146   2e-51   
ref|WP_002799040.1|  glyceraldehyde-3-phosphate dehydrogenase           142   2e-51   
ref|WP_013324586.1|  glyceraldehyde-3-phosphate dehydrogenase           143   2e-51   
ref|XP_008237955.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    185   2e-51   
gb|AHJ31016.1|  NADPH-dependent glyceraldehyde-3-phosphate dehydr...    145   2e-51   
ref|WP_004268080.1|  glyceraldehyde-3-phosphate dehydrogenase           142   2e-51   
ref|WP_036481597.1|  glyceraldehyde-3-phosphate dehydrogenase           140   2e-51   
gb|KDO85174.1|  hypothetical protein CISIN_1g012940mg                   184   2e-51   
gb|AFZ13204.1|  glyceraldehyde 3-phosphate dehydrogenase (NADP+)        149   2e-51   
ref|WP_009544928.1|  glyceraldehyde-3-phosphate dehydrogenase           140   2e-51   
ref|WP_026100517.1|  glyceraldehyde-3-phosphate dehydrogenase           147   2e-51   
ref|WP_041226596.1|  glyceraldehyde-3-phosphate dehydrogenase           149   2e-51   
gb|EMS61784.1|  Glyceraldehyde-3-phosphate dehydrogenase A, chlor...    132   2e-51   
ref|WP_011319102.1|  glyceraldehyde-3-phosphate dehydrogenase           146   2e-51   
ref|XP_007211185.1|  hypothetical protein PRUPE_ppa005598mg             184   3e-51   
ref|WP_015168952.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...    145   3e-51   
ref|WP_026099703.1|  glyceraldehyde-3-phosphate dehydrogenase           144   3e-51   
ref|XP_008664191.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    140   3e-51   
gb|AFW58485.1|  hypothetical protein ZEAMMB73_956640                    140   3e-51   
ref|WP_006197155.1|  glyceraldehyde-3-phosphate dehydrogenase           144   3e-51   
ref|WP_016865320.1|  glyceraldehyde-3-phosphate dehydrogenase           144   3e-51   
ref|WP_009459769.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...    144   4e-51   
ref|WP_019493013.1|  glyceraldehyde-3-phosphate dehydrogenase           145   4e-51   
ref|WP_012595832.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...    144   4e-51   
ref|WP_015145817.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...    142   4e-51   
ref|WP_026079517.1|  glyceraldehyde-3-phosphate dehydrogenase           143   4e-51   
ref|WP_010999188.1|  glyceraldehyde-3-phosphate dehydrogenase           146   5e-51   
ref|WP_017320834.1|  glyceraldehyde-3-phosphate dehydrogenase           142   5e-51   
ref|XP_006473831.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    184   5e-51   
ref|XP_005715477.1|  glyceraldehyde-3-phosphate dehydrogenase           144   5e-51   
sp|P34919.1|G3PA_CHOCR  RecName: Full=Glyceraldehyde-3-phosphate ...    144   5e-51   
ref|WP_015220848.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    145   7e-51   
ref|XP_003548929.2|  PREDICTED: LOW QUALITY PROTEIN: glyceraldehy...    136   8e-51   
ref|WP_009626155.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    140   9e-51   
ref|WP_015182060.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...    146   1e-50   
ref|WP_006528243.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...    145   1e-50   
gb|KIJ84331.1|  glyceraldehyde-3-phosphate dehydrogenase                147   1e-50   
gb|AAA21996.1|  glyceraldehyde-3-phosphate dehydrogenase                144   1e-50   
ref|WP_019504971.1|  glyceraldehyde-3-phosphate dehydrogenase           146   1e-50   
ref|XP_009382077.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    183   1e-50   
emb|CAC80389.2|  glyceraldehyde-3-phosphate dehydrogenase               183   1e-50   
ref|WP_008276272.1|  glyceraldehyde-3-phosphate dehydrogenase           138   1e-50   
ref|WP_006634268.1|  glyceraldehyde-3-phosphate dehydrogenase           143   1e-50   
ref|WP_006279110.1|  glyceraldehyde-3-phosphate dehydrogenase           142   1e-50   
ref|XP_006435406.1|  hypothetical protein CICLE_v10001114mg             182   1e-50   
ref|WP_007358062.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...    145   1e-50   
gb|ABK00053.1|  chloroplast glyceraldehyde-3-phosphate dehydrogenase    181   1e-50   
sp|P30724.1|G3PA_GRAGA  RecName: Full=Glyceraldehyde-3-phosphate ...    140   2e-50   
ref|WP_015156647.1|  MULTISPECIES: glyceraldehyde 3-phosphate deh...    147   2e-50   
ref|WP_015113093.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    144   2e-50   
ref|WP_009555393.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    146   2e-50   
ref|WP_009343864.1|  glyceraldehyde-3-phosphate dehydrogenase           142   2e-50   
ref|WP_017293448.1|  glyceraldehyde-3-phosphate dehydrogenase           141   2e-50   
ref|WP_044205566.1|  glyceraldehyde-3-phosphate dehydrogenase           141   3e-50   
ref|WP_017312563.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...    142   3e-50   
ref|WP_016860363.1|  glyceraldehyde-3-phosphate dehydrogenase           142   3e-50   
ref|WP_015178398.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    142   3e-50   
ref|WP_036001291.1|  glyceraldehyde-3-phosphate dehydrogenase           142   3e-50   
sp|Q8VXQ9.1|G3PA_SCEVA  RecName: Full=Glyceraldehyde-3-phosphate ...    152   3e-50   
gb|EDX77136.1|  glyceraldehyde-3-phosphate dehydrogenase, type I        141   3e-50   
ref|WP_026719817.1|  glyceraldehyde-3-phosphate dehydrogenase           142   4e-50   
sp|P80505.3|G3P2_SYNY3  RecName: Full=Glyceraldehyde-3-phosphate ...    137   5e-50   
emb|CAA58550.1|  glyceraldehyde-3-phosphate dehydrogenase (NADP+)...    137   5e-50   
emb|CAC80373.1|  glyceraldehyde-3-phosphate dehydrogenase               159   5e-50   
ref|WP_041036790.1|  glyceraldehyde-3-phosphate dehydrogenase           144   6e-50   
ref|WP_013190254.1|  glyceraldehyde-3-phosphate dehydrogenase           142   6e-50   
ref|WP_023075014.1|  glyceraldehyde 3-phosphate dehydrogenase (na...    139   6e-50   
ref|WP_026072888.1|  glyceraldehyde-3-phosphate dehydrogenase           136   8e-50   
gb|EDX87031.1|  glyceraldehyde-3-phosphate dehydrogenase, type I        134   8e-50   
ref|WP_015210633.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    142   8e-50   
ref|WP_010874115.1|  glyceraldehyde-3-phosphate dehydrogenase           135   1e-49   
ref|WP_038015315.1|  glyceraldehyde-3-phosphate dehydrogenase           133   1e-49   
ref|WP_028949102.1|  glyceraldehyde-3-phosphate dehydrogenase           135   1e-49   
ref|WP_015189930.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    140   2e-49   
ref|WP_026082358.1|  glyceraldehyde-3-phosphate dehydrogenase           142   2e-49   
ref|WP_015212526.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    142   2e-49   
gb|KDO63476.1|  hypothetical protein CISIN_1g013492mg                   142   3e-49   
ref|XP_008650588.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    179   4e-49   
ref|WP_015132368.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    135   4e-49   
emb|CDP18560.1|  unnamed protein product                                162   6e-49   
ref|WP_024545764.1|  glyceraldehyde-3-phosphate dehydrogenase           137   1e-48   
ref|WP_036532393.1|  glyceraldehyde-3-phosphate dehydrogenase           139   1e-48   
ref|WP_016951733.1|  glyceraldehyde-3-phosphate dehydrogenase           137   1e-48   
emb|CAC80394.1|  glyceraldehyde-3-phosphate dehydrogenase               163   1e-48   
ref|WP_006510998.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...    137   1e-48   
ref|WP_012305745.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...    135   1e-48   
ref|WP_017742837.1|  glyceraldehyde-3-phosphate dehydrogenase           137   1e-48   
gb|KIE07728.1|  glyceraldehyde-3-phosphate dehydrogenase                139   2e-48   
ref|WP_015109880.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...    141   3e-48   
ref|WP_012626430.1|  glyceraldehyde-3-phosphate dehydrogenase           135   5e-48   
ref|WP_037218187.1|  glyceraldehyde-3-phosphate dehydrogenase           148   6e-48   
gb|ABD37964.1|  glyceraldehyde-3-phosphate dehydrogenase subunit B      176   6e-48   
dbj|BAN09110.1|  glyceraldehyde-3-phosphate dehydrogenase               158   7e-48   
ref|XP_007515295.1|  glyceraldehyde-3-phosphate dehydrogenase           174   8e-48   
ref|WP_039728353.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...    131   1e-47   
gb|KHG29734.1|  Glyceraldehyde-3-phosphate dehydrogenase A, chlor...    117   1e-47   
ref|WP_006515538.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    134   2e-47   
ref|WP_008311916.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...    131   3e-47   
gb|ADB81489.1|  glyceraldehyde-3-phosphate dehydrogenase                157   3e-47   
ref|WP_023172550.1|  glyceraldehyde-3-phosphate dehydrogenase           130   3e-47   
ref|WP_011378166.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...    132   4e-47   
ref|WP_011244659.1|  glyceraldehyde-3-phosphate dehydrogenase           132   4e-47   
ref|XP_001415434.1|  predicted protein                                  172   5e-47   
ref|XP_005534792.1|  glyceraldehyde-3-phosphate dehydrogenase           143   6e-47   
ref|WP_015163373.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...    126   7e-47   
ref|WP_035830661.1|  glyceraldehyde-3-phosphate dehydrogenase           139   1e-46   
ref|WP_015228987.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...    132   1e-46   
emb|CEF96577.1|  Glyceraldehyde 3-phosphate dehydrogenase, NAD(P)...    171   1e-46   
ref|WP_015224818.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    133   2e-46   
ref|WP_011140533.1|  glyceraldehyde-3-phosphate dehydrogenase           127   3e-46   
ref|XP_003074208.1|  NADP-glyceraldehyde-3-phosphate dehydrogenas...    171   3e-46   
gb|ABG85191.1|  chloroplast glyceraldehyde-3-phosphate dehydrogen...    171   4e-46   
pdb|2D2I|A  Chain A, Crystal Structure Of Nadp-Dependent Glyceral...    132   5e-46   
gb|ABK00067.1|  chloroplast glyceraldehyde-3-phosphate dehydrogenase    167   6e-46   
ref|WP_006911098.1|  glyceraldehyde-3-phosphate dehydrogenase           135   6e-46   
ref|XP_002507103.1|  glyceraldehyde-3-phosphate dehydrogenase B         169   6e-46   
gb|AAG23799.1|  chloroplast NADP-dependent glyceraldehyde 3-phosp...    155   1e-45   
gb|ADU04754.1|  glyceraldehyde-3-phosphate dehydrogenase                166   1e-45   
gb|AAP32469.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A      143   1e-45   
emb|CAC80393.1|  glyceraldehyde-3-phosphate dehydrogenase               166   1e-45   
gb|ABK00056.1|  chloroplast glyceraldehyde-3-phosphate dehydrogenase    166   2e-45   
gb|ABD37959.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A      167   2e-45   
ref|WP_021281480.1|  glyceraldehyde-3-phosphate dehydrogenase           149   2e-45   
ref|WP_021384519.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...    144   2e-45   
ref|WP_034439122.1|  glyceraldehyde-3-phosphate dehydrogenase           145   2e-45   
gb|ADB81491.1|  glyceraldehyde-3-phosphate dehydrogenase                154   3e-45   
emb|CAC80392.1|  glyceraldehyde-3-phosphate dehydrogenase               165   3e-45   
ref|XP_003056194.1|  hypothetical protein MICPUCDRAFT_25339             167   3e-45   
ref|WP_041384819.1|  glyceraldehyde-3-phosphate dehydrogenase           134   4e-45   
emb|CDN42684.1|  Glyceraldehyde-3-phosphate dehydrogenase 1             142   4e-45   
gb|ABD37961.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A      165   5e-45   
gb|ADD54591.1|  putative glyceraldehyde-3-phosphate dehydrogenase       161   5e-45   
gb|ADU04755.1|  glyceraldehyde-3-phosphate dehydrogenase                164   5e-45   
gb|ADB81487.1|  glyceraldehyde-3-phosphate dehydrogenase                163   5e-45   
ref|WP_039634088.1|  glyceraldehyde-3-phosphate dehydrogenase           148   6e-45   
ref|WP_022382428.1|  glyceraldehyde-3-phosphate dehydrogenase type I    128   6e-45   
ref|WP_017416743.1|  glyceraldehyde-3-phosphate dehydrogenase           147   6e-45   
ref|WP_012164673.1|  glyceraldehyde-3-phosphate dehydrogenase           129   6e-45   
ref|WP_041059444.1|  glyceraldehyde-3-phosphate dehydrogenase           142   6e-45   
emb|CAC81001.1|  NAD(P)-dependent glyceraldehyde-3-phosphate dehy...    145   7e-45   
dbj|BAD93961.1|  glyceraldehyde 3-phosphate dehydrogenase A subunit     110   7e-45   
ref|WP_035294382.1|  glyceraldehyde-3-phosphate dehydrogenase           140   7e-45   
emb|CAE20203.1|  Glyceraldehyde 3-phosphate dehydrogenase(NADP+; ...    134   8e-45   
ref|XP_002955293.1|  hypothetical protein VOLCADRAFT_76662              165   9e-45   
ref|WP_033099846.1|  glyceraldehyde-3-phosphate dehydrogenase           139   1e-44   
ref|WP_007556447.1|  glyceraldehyde-3-phosphate dehydrogenase           127   1e-44   
ref|WP_035304849.1|  glyceraldehyde-3-phosphate dehydrogenase           145   1e-44   
gb|ADB81484.1|  glyceraldehyde-3-phosphate dehydrogenase                162   1e-44   
dbj|BAK05515.1|  predicted protein                                      131   1e-44   
ref|WP_007101108.1|  glyceraldehyde-3-phosphate dehydrogenase           136   1e-44   
ref|WP_010475353.1|  glyceraldehyde-3-phosphate dehydrogenase           128   1e-44   
ref|XP_001689871.1|  glyceraldehyde-3-phosphate dehydrogenase           165   1e-44   
ref|WP_012194579.1|  glyceraldehyde-3-phosphate dehydrogenase           133   1e-44   
ref|WP_003423731.1|  glyceraldehyde-3-phosphate dehydrogenase           142   1e-44   
ref|WP_009889722.1|  glyceraldehyde-3-phosphate dehydrogenase           142   1e-44   
ref|WP_003430259.1|  glyceraldehyde-3-phosphate dehydrogenase           142   1e-44   
gb|ABD37960.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A      163   2e-44   
ref|WP_039260564.1|  glyceraldehyde-3-phosphate dehydrogenase           142   2e-44   
ref|WP_010312655.1|  glyceraldehyde-3-phosphate dehydrogenase           134   2e-44   
gb|EQE50035.1|  glyceraldehyde-3-phosphate dehydrogenase, type I        142   2e-44   
ref|WP_023437217.1|  glyceraldehyde 3-phosphate dehydrogenase           142   2e-44   
ref|WP_011861329.1|  glyceraldehyde-3-phosphate dehydrogenase           142   2e-44   
ref|WP_021366683.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...    142   2e-44   
ref|WP_021375375.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...    142   2e-44   
emb|CAC80391.2|  glyceraldehyde-3-phosphate dehydrogenase               155   2e-44   
ref|WP_021387925.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...    142   2e-44   
gb|ABK00052.1|  chloroplast glyceraldehyde-3-phosphate dehydrogenase    164   2e-44   
ref|WP_009353531.1|  glyceraldehyde-3-phosphate dehydrogenase           144   2e-44   
ref|WP_021396121.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...    142   2e-44   
ref|WP_003248107.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...    140   2e-44   
gb|ABD37958.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A      163   2e-44   
pdb|3DBV|O  Chain O, Glyceraldehyde-3-Phosphate Dehydrogenase Mut...    140   3e-44   
gb|AAM68969.1|AF406629_1  glyceraldehyde-3-phosphate dehydrogenase      127   3e-44   
pdb|1DBV|O  Chain O, Glyceraldehyde-3-Phosphate Dehydrogenase Mut...    140   3e-44   
gb|ADB81492.1|  glyceraldehyde-3-phosphate dehydrogenase                162   3e-44   
ref|WP_011098686.1|  glyceraldehyde-3-phosphate dehydrogenase           142   3e-44   
ref|WP_025965118.1|  glyceraldehyde-3-phosphate dehydrogenase           130   3e-44   
gb|ABD37953.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A      162   3e-44   
ref|WP_010294251.1|  glyceraldehyde-3-phosphate dehydrogenase           142   3e-44   
ref|WP_043905994.1|  glyceraldehyde-3-phosphate dehydrogenase           142   4e-44   
gb|ABA01156.1|  chloroplast glyceraldehyde-3-phosphate dehydrogenase    163   4e-44   
ref|WP_036901860.1|  glyceraldehyde-3-phosphate dehydrogenase           130   4e-44   
ref|WP_021363565.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...    142   4e-44   
emb|CAC85938.1|  NAD(P)-dependent glyceraldehyde-3-phosphate dehy...    143   4e-44   
gb|ABA01125.1|  chloroplast glyceraldehyde-3-phosphate dehydrogenase    163   4e-44   
gb|AAM68968.1|AF406628_1  glyceraldehyde-3-phosphate dehydrogenase      127   4e-44   
ref|WP_026487157.1|  glyceraldehyde-3-phosphate dehydrogenase           138   4e-44   
emb|CAC80388.1|  glyceraldehyde-3-phosphate dehydrogenase               164   4e-44   
ref|WP_032523054.1|  glyceraldehyde-3-phosphate dehydrogenase           130   5e-44   
ref|WP_011124178.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...    133   5e-44   
ref|WP_036896288.1|  glyceraldehyde-3-phosphate dehydrogenase           133   5e-44   
ref|WP_017435717.1|  glyceraldehyde-3-phosphate dehydrogenase           140   5e-44   
gb|ADB81483.1|  glyceraldehyde-3-phosphate dehydrogenase                157   5e-44   
dbj|BAD72793.1|  glyceraldehyde-3-phosphate dehydrogenase               159   5e-44   
ref|WP_021359263.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...    140   6e-44   
ref|WP_033015082.1|  glyceraldehyde-3-phosphate dehydrogenase           139   6e-44   
pdb|1GD1|O  Chain O, Structure Of Holo-Glyceraldehyde-3-Phosphate...    139   6e-44   
gb|AHB87911.1|  NAD(P)-dependent glyceraldehyde-3-phosphate dehyd...    129   6e-44   
ref|WP_009351659.1|  glyceraldehyde-3-phosphate dehydrogenase           137   6e-44   
ref|WP_041429017.1|  glyceraldehyde-3-phosphate dehydrogenase           129   6e-44   
ref|WP_011057306.1|  glyceraldehyde-3-phosphate dehydrogenase           129   7e-44   
ref|WP_027409933.1|  glyceraldehyde-3-phosphate dehydrogenase           139   7e-44   
ref|WP_007554130.1|  glyceraldehyde-3-phosphate dehydrogenase           127   7e-44   
ref|WP_035132381.1|  glyceraldehyde-3-phosphate dehydrogenase           134   7e-44   
ref|WP_008859280.1|  glyceraldehyde-3-phosphate dehydrogenase           129   7e-44   
pdb|3ZCX|A  Chain A, Structure Of Gapdh From Thermosynechococcus ...    129   7e-44   
ref|WP_012576013.1|  glyceraldehyde-3-phosphate dehydrogenase           140   7e-44   
ref|WP_025900197.1|  glyceraldehyde-3-phosphate dehydrogenase           129   8e-44   
ref|WP_002844711.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...    148   8e-44   
gb|ADB81488.1|  glyceraldehyde-3-phosphate dehydrogenase                160   8e-44   
ref|WP_036916314.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...    132   9e-44   
ref|WP_021381095.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...    140   9e-44   



>ref|XP_011034836.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
isoform X1 [Populus euphratica]
Length=452

 Score =   192 bits (489),  Expect(2) = 1e-89, Method: Compositional matrix adjust.
 Identities = 132/138 (96%), Positives = 137/138 (99%), Gaps = 0/138 (0%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  234  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  293

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKG+TAEDVNAAFRKA+
Sbjct  294  PTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGITAEDVNAAFRKAA  353

Query  401  DGPLKGVLDVCDAPLVSL  348
            +GPLKGVLDVCD PLVS+
Sbjct  354  EGPLKGVLDVCDVPLVSV  371


 Score =   165 bits (418),  Expect(2) = 1e-89, Method: Compositional matrix adjust.
 Identities = 76/86 (88%), Positives = 80/86 (93%), Gaps = 0/86 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVA  184
            P    DFRCSDVSSTIDSSLTMVMGDDM+KVVAWYDNEWGYSQRVVDLAHLVASKWPGVA
Sbjct  367  PLVSVDFRCSDVSSTIDSSLTMVMGDDMIKVVAWYDNEWGYSQRVVDLAHLVASKWPGVA  426

Query  183  VAGSGDPLEDYCKTNPGDKECKVFEA  106
             AGSGDPLED+CKTNP D+ECKV+EA
Sbjct  427  AAGSGDPLEDFCKTNPADEECKVYEA  452



>ref|XP_011041188.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Populus euphratica]
Length=452

 Score =   191 bits (485),  Expect(2) = 2e-89, Method: Compositional matrix adjust.
 Identities = 130/138 (94%), Positives = 136/138 (99%), Gaps = 0/138 (0%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  234  ISNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  293

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKG+TAEDVN AFRKA+
Sbjct  294  PTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGITAEDVNGAFRKAA  353

Query  401  DGPLKGVLDVCDAPLVSL  348
            +GPLKGVLDVCD PLVS+
Sbjct  354  EGPLKGVLDVCDVPLVSV  371


 Score =   166 bits (419),  Expect(2) = 2e-89, Method: Compositional matrix adjust.
 Identities = 76/86 (88%), Positives = 80/86 (93%), Gaps = 0/86 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVA  184
            P    DFRCSDVSSTIDSSLTMVMGDDM+KVVAWYDNEWGYSQRVVDLAHLVASKWPGVA
Sbjct  367  PLVSVDFRCSDVSSTIDSSLTMVMGDDMIKVVAWYDNEWGYSQRVVDLAHLVASKWPGVA  426

Query  183  VAGSGDPLEDYCKTNPGDKECKVFEA  106
             AGSGDPLED+CKTNP D+ECKV+EA
Sbjct  427  AAGSGDPLEDFCKTNPADEECKVYEA  452



>ref|XP_002300632.2| hypothetical protein POPTR_0002s00840g [Populus trichocarpa]
 gb|EEE79905.2| hypothetical protein POPTR_0002s00840g [Populus trichocarpa]
Length=474

 Score =   192 bits (489),  Expect(2) = 4e-89, Method: Compositional matrix adjust.
 Identities = 132/138 (96%), Positives = 137/138 (99%), Gaps = 0/138 (0%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  256  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  315

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKG+TAEDVNAAFRKA+
Sbjct  316  PTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGITAEDVNAAFRKAA  375

Query  401  DGPLKGVLDVCDAPLVSL  348
            +GPLKGVLDVCD PLVS+
Sbjct  376  EGPLKGVLDVCDVPLVSV  393


 Score =   163 bits (413),  Expect(2) = 4e-89, Method: Compositional matrix adjust.
 Identities = 75/86 (87%), Positives = 79/86 (92%), Gaps = 0/86 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVA  184
            P    DFRCSDVSSTIDSSLTMVMGDDM+KVVAWYDNEWGYSQRVVDL HLVASKWPGVA
Sbjct  389  PLVSVDFRCSDVSSTIDSSLTMVMGDDMIKVVAWYDNEWGYSQRVVDLGHLVASKWPGVA  448

Query  183  VAGSGDPLEDYCKTNPGDKECKVFEA  106
             AGSGDPLED+CKTNP D+ECKV+EA
Sbjct  449  AAGSGDPLEDFCKTNPADEECKVYEA  474



>ref|XP_002307806.1| glyceraldehyde-3-phosphate dehydrogenase family protein [Populus 
trichocarpa]
 gb|EEE94802.1| glyceraldehyde-3-phosphate dehydrogenase family protein [Populus 
trichocarpa]
Length=452

 Score =   191 bits (484),  Expect(2) = 6e-89, Method: Compositional matrix adjust.
 Identities = 130/138 (94%), Positives = 136/138 (99%), Gaps = 0/138 (0%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  234  ISNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  293

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKG+TAEDVN AFRKA+
Sbjct  294  PTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGITAEDVNGAFRKAA  353

Query  401  DGPLKGVLDVCDAPLVSL  348
            +GPLKGVLDVCD PLVS+
Sbjct  354  EGPLKGVLDVCDVPLVSV  371


 Score =   164 bits (416),  Expect(2) = 6e-89, Method: Compositional matrix adjust.
 Identities = 75/86 (87%), Positives = 80/86 (93%), Gaps = 0/86 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVA  184
            P    DFRCSDVSSTIDSSLTMVMGDDM+KVVAWYDNEWGYSQRVVDLAHLVA+KWPGVA
Sbjct  367  PLVSVDFRCSDVSSTIDSSLTMVMGDDMIKVVAWYDNEWGYSQRVVDLAHLVANKWPGVA  426

Query  183  VAGSGDPLEDYCKTNPGDKECKVFEA  106
             AGSGDPLED+CKTNP D+ECKV+EA
Sbjct  427  AAGSGDPLEDFCKTNPADEECKVYEA  452



>ref|XP_010094540.1| Glyceraldehyde-3-phosphate dehydrogenase B [Morus notabilis]
 gb|EXB56294.1| Glyceraldehyde-3-phosphate dehydrogenase B [Morus notabilis]
Length=1333

 Score =   191 bits (486),  Expect(2) = 8e-89, Method: Composition-based stats.
 Identities = 128/138 (93%), Positives = 136/138 (99%), Gaps = 0/138 (0%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            VSNASCTTNCLAPFVKV+DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  237  VSNASCTTNCLAPFVKVLDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  296

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLV+NV+KKG+TAEDVNAAFRK +
Sbjct  297  PTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVINVEKKGITAEDVNAAFRKEA  356

Query  401  DGPLKGVLDVCDAPLVSL  348
            +GPLKG+LDVCD PLVS+
Sbjct  357  EGPLKGILDVCDVPLVSV  374


 Score =   163 bits (413),  Expect(2) = 8e-89, Method: Composition-based stats.
 Identities = 74/92 (80%), Positives = 77/92 (84%), Gaps = 0/92 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVA  184
            P    DFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPG  
Sbjct  370  PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGSG  429

Query  183  VAGSGDPLEDYCKTNPGDKECKVFEA*FTTNF  88
              GSGDPLED+CKTNP D+ECK+  A F   F
Sbjct  430  TGGSGDPLEDFCKTNPADEECKIVIASFIGCF  461



>ref|XP_006383783.1| hypothetical protein POPTR_0005s27550g [Populus trichocarpa]
 gb|ERP61580.1| hypothetical protein POPTR_0005s27550g [Populus trichocarpa]
Length=421

 Score =   191 bits (484),  Expect(2) = 1e-88, Method: Compositional matrix adjust.
 Identities = 130/138 (94%), Positives = 136/138 (99%), Gaps = 0/138 (0%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  203  ISNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  262

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKG+TAEDVN AFRKA+
Sbjct  263  PTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGITAEDVNGAFRKAA  322

Query  401  DGPLKGVLDVCDAPLVSL  348
            +GPLKGVLDVCD PLVS+
Sbjct  323  EGPLKGVLDVCDVPLVSV  340


 Score =   164 bits (414),  Expect(2) = 1e-88, Method: Compositional matrix adjust.
 Identities = 75/86 (87%), Positives = 80/86 (93%), Gaps = 0/86 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVA  184
            P    DFRCSDVSSTIDSSLTMVMGDDM+KVVAWYDNEWGYSQRVVDLAHLVA+KWPGVA
Sbjct  336  PLVSVDFRCSDVSSTIDSSLTMVMGDDMIKVVAWYDNEWGYSQRVVDLAHLVANKWPGVA  395

Query  183  VAGSGDPLEDYCKTNPGDKECKVFEA  106
             AGSGDPLED+CKTNP D+ECKV+EA
Sbjct  396  AAGSGDPLEDFCKTNPADEECKVYEA  421



>ref|XP_007018105.1| Glyceraldehyde-3-phosphate dehydrogenase B subunit [Theobroma 
cacao]
 gb|EOY15330.1| Glyceraldehyde-3-phosphate dehydrogenase B subunit [Theobroma 
cacao]
Length=452

 Score =   192 bits (489),  Expect(2) = 1e-88, Method: Compositional matrix adjust.
 Identities = 132/138 (96%), Positives = 137/138 (99%), Gaps = 0/138 (0%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  234  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  293

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKG+TAEDVNAAFRKA+
Sbjct  294  PTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGITAEDVNAAFRKAA  353

Query  401  DGPLKGVLDVCDAPLVSL  348
            +GPLKGVLDVCD PLVS+
Sbjct  354  EGPLKGVLDVCDVPLVSV  371


 Score =   162 bits (409),  Expect(2) = 1e-88, Method: Compositional matrix adjust.
 Identities = 75/86 (87%), Positives = 78/86 (91%), Gaps = 0/86 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVA  184
            P    DFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGV 
Sbjct  367  PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVP  426

Query  183  VAGSGDPLEDYCKTNPGDKECKVFEA  106
             AGS DPLED+CKTNP D+ECKV+EA
Sbjct  427  AAGSADPLEDFCKTNPADEECKVYEA  452



>ref|XP_010539030.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPB, chloroplastic 
[Tarenaya hassleriana]
Length=453

 Score =   191 bits (484),  Expect(2) = 5e-88, Method: Compositional matrix adjust.
 Identities = 131/138 (95%), Positives = 135/138 (98%), Gaps = 0/138 (0%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  235  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  294

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKGLTAEDVNAAFRKA+
Sbjct  295  PTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGLTAEDVNAAFRKAA  354

Query  401  DGPLKGVLDVCDAPLVSL  348
             GPL G+LDVCD PLVS+
Sbjct  355  SGPLNGILDVCDVPLVSV  372


 Score =   162 bits (409),  Expect(2) = 5e-88, Method: Compositional matrix adjust.
 Identities = 75/86 (87%), Positives = 77/86 (90%), Gaps = 0/86 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVA  184
            P    DFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPG A
Sbjct  368  PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGAA  427

Query  183  VAGSGDPLEDYCKTNPGDKECKVFEA  106
               SGDPLED+C+TNP DKECKVFEA
Sbjct  428  AGSSGDPLEDFCETNPADKECKVFEA  453



>gb|KHG00663.1| Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic [Gossypium 
arboreum]
Length=454

 Score =   188 bits (478),  Expect(2) = 6e-88, Method: Compositional matrix adjust.
 Identities = 129/138 (93%), Positives = 137/138 (99%), Gaps = 0/138 (0%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPFVKV+DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  236  ISNASCTTNCLAPFVKVIDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  295

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKG+TAEDVNAAFRKA+
Sbjct  296  PTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGITAEDVNAAFRKAA  355

Query  401  DGPLKGVLDVCDAPLVSL  348
            +GPLKGVL+VCD PLVS+
Sbjct  356  EGPLKGVLEVCDIPLVSV  373


 Score =   164 bits (414),  Expect(2) = 6e-88, Method: Compositional matrix adjust.
 Identities = 76/86 (88%), Positives = 79/86 (92%), Gaps = 0/86 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVA  184
            P    DFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPG+ 
Sbjct  369  PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGMP  428

Query  183  VAGSGDPLEDYCKTNPGDKECKVFEA  106
            VAGSGDPLEDYCK NP D+ECKV+EA
Sbjct  429  VAGSGDPLEDYCKANPADEECKVYEA  454



>gb|KJB14201.1| hypothetical protein B456_002G114000 [Gossypium raimondii]
Length=454

 Score =   187 bits (474),  Expect(2) = 6e-88, Method: Compositional matrix adjust.
 Identities = 128/138 (93%), Positives = 137/138 (99%), Gaps = 0/138 (0%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPFVKV+DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  236  ISNASCTTNCLAPFVKVIDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  295

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKG+TAEDVNAAFRK++
Sbjct  296  PTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGITAEDVNAAFRKSA  355

Query  401  DGPLKGVLDVCDAPLVSL  348
            +GPLKGVL+VCD PLVS+
Sbjct  356  EGPLKGVLEVCDIPLVSV  373


 Score =   165 bits (418),  Expect(2) = 6e-88, Method: Compositional matrix adjust.
 Identities = 77/86 (90%), Positives = 80/86 (93%), Gaps = 0/86 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVA  184
            P    DFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPG+ 
Sbjct  369  PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGMP  428

Query  183  VAGSGDPLEDYCKTNPGDKECKVFEA  106
            VAGSGDPLEDYCKTNP D+ECKV+EA
Sbjct  429  VAGSGDPLEDYCKTNPADEECKVYEA  454



>emb|CDP07271.1| unnamed protein product [Coffea canephora]
Length=458

 Score =   195 bits (495),  Expect(2) = 7e-88, Method: Compositional matrix adjust.
 Identities = 132/138 (96%), Positives = 138/138 (100%), Gaps = 0/138 (0%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            VSNASCTTNCLAPFVKV+DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  240  VSNASCTTNCLAPFVKVLDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  299

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+K+GLTAEDVNAAFRKA+
Sbjct  300  PTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKRGLTAEDVNAAFRKAA  359

Query  401  DGPLKGVLDVCDAPLVSL  348
            DGPLKG+LDVCDAPLVS+
Sbjct  360  DGPLKGILDVCDAPLVSV  377


 Score =   157 bits (396),  Expect(2) = 7e-88, Method: Compositional matrix adjust.
 Identities = 72/87 (83%), Positives = 78/87 (90%), Gaps = 0/87 (0%)
 Frame = -3

Query  366  CPSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGV  187
             P    DF+C+DVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPG+
Sbjct  372  APLVSVDFKCTDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGL  431

Query  186  AVAGSGDPLEDYCKTNPGDKECKVFEA  106
             + GSGDPLEDYCKTN  D+ECKV+EA
Sbjct  432  FIDGSGDPLEDYCKTNAADEECKVYEA  458



>ref|XP_006581071.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B subunit 
isoform X1 [Glycine max]
Length=453

 Score =   192 bits (487),  Expect(2) = 1e-87, Method: Compositional matrix adjust.
 Identities = 130/138 (94%), Positives = 137/138 (99%), Gaps = 0/138 (0%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPFVK++DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  236  ISNASCTTNCLAPFVKILDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  295

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKGLTAEDVNAAFRKA+
Sbjct  296  PTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGLTAEDVNAAFRKAA  355

Query  401  DGPLKGVLDVCDAPLVSL  348
            +GPLKGVLDVCD PLVS+
Sbjct  356  EGPLKGVLDVCDVPLVSI  373


 Score =   159 bits (403),  Expect(2) = 1e-87, Method: Compositional matrix adjust.
 Identities = 73/85 (86%), Positives = 78/85 (92%), Gaps = 0/85 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVA  184
            P    DFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPG A
Sbjct  369  PLVSIDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGAA  428

Query  183  VAGSGDPLEDYCKTNPGDKECKVFE  109
             AGSGDPLE++C+TNP D+ECKV+E
Sbjct  429  KAGSGDPLEEFCETNPADEECKVYE  453



>gb|KHN20097.1| Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic [Glycine 
soja]
Length=452

 Score =   192 bits (487),  Expect(2) = 1e-87, Method: Compositional matrix adjust.
 Identities = 130/138 (94%), Positives = 137/138 (99%), Gaps = 0/138 (0%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPFVK++DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  235  ISNASCTTNCLAPFVKILDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  294

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKGLTAEDVNAAFRKA+
Sbjct  295  PTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGLTAEDVNAAFRKAA  354

Query  401  DGPLKGVLDVCDAPLVSL  348
            +GPLKGVLDVCD PLVS+
Sbjct  355  EGPLKGVLDVCDVPLVSI  372


 Score =   159 bits (403),  Expect(2) = 1e-87, Method: Compositional matrix adjust.
 Identities = 73/85 (86%), Positives = 78/85 (92%), Gaps = 0/85 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVA  184
            P    DFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPG A
Sbjct  368  PLVSIDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGAA  427

Query  183  VAGSGDPLEDYCKTNPGDKECKVFE  109
             AGSGDPLE++C+TNP D+ECKV+E
Sbjct  428  KAGSGDPLEEFCETNPADEECKVYE  452



>gb|ACU20783.1| unknown [Glycine max]
Length=452

 Score =   191 bits (486),  Expect(2) = 1e-87, Method: Compositional matrix adjust.
 Identities = 130/138 (94%), Positives = 137/138 (99%), Gaps = 0/138 (0%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPFVK++DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  235  ISNASCTTNCLAPFVKILDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  294

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKGLTAEDVNAAFRKA+
Sbjct  295  PTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGLTAEDVNAAFRKAA  354

Query  401  DGPLKGVLDVCDAPLVSL  348
            +GPLKGVLDVCD PLVS+
Sbjct  355  EGPLKGVLDVCDVPLVSI  372


 Score =   159 bits (403),  Expect(2) = 1e-87, Method: Compositional matrix adjust.
 Identities = 73/85 (86%), Positives = 78/85 (92%), Gaps = 0/85 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVA  184
            P    DFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPG A
Sbjct  368  PLVSIDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGTA  427

Query  183  VAGSGDPLEDYCKTNPGDKECKVFE  109
             AGSGDPLE++C+TNP D+ECKV+E
Sbjct  428  KAGSGDPLEEFCETNPADEECKVYE  452



>ref|NP_001237135.1| glyceraldehyde-3-phosphate dehydrogenase B subunit [Glycine max]
 gb|ABA86964.1| glyceraldehyde-3-phosphate dehydrogenase B subunit [Glycine max]
Length=451

 Score =   192 bits (487),  Expect(2) = 1e-87, Method: Compositional matrix adjust.
 Identities = 130/138 (94%), Positives = 137/138 (99%), Gaps = 0/138 (0%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPFVK++DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  234  ISNASCTTNCLAPFVKILDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  293

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKGLTAEDVNAAFRKA+
Sbjct  294  PTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGLTAEDVNAAFRKAA  353

Query  401  DGPLKGVLDVCDAPLVSL  348
            +GPLKGVLDVCD PLVS+
Sbjct  354  EGPLKGVLDVCDVPLVSI  371


 Score =   159 bits (403),  Expect(2) = 1e-87, Method: Compositional matrix adjust.
 Identities = 73/85 (86%), Positives = 78/85 (92%), Gaps = 0/85 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVA  184
            P    DFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPG A
Sbjct  367  PLVSIDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGAA  426

Query  183  VAGSGDPLEDYCKTNPGDKECKVFE  109
             AGSGDPLE++C+TNP D+ECKV+E
Sbjct  427  KAGSGDPLEEFCETNPADEECKVYE  451



>gb|KHG26323.1| Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic [Gossypium 
arboreum]
Length=455

 Score =   192 bits (488),  Expect(2) = 1e-87, Method: Compositional matrix adjust.
 Identities = 131/138 (95%), Positives = 137/138 (99%), Gaps = 0/138 (0%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  237  ISNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  296

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKG+TAEDVNAAFRKA+
Sbjct  297  PTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGITAEDVNAAFRKAA  356

Query  401  DGPLKGVLDVCDAPLVSL  348
            +GPLKGVLDVCD PLVS+
Sbjct  357  EGPLKGVLDVCDVPLVSV  374


 Score =   159 bits (401),  Expect(2) = 1e-87, Method: Compositional matrix adjust.
 Identities = 73/86 (85%), Positives = 77/86 (90%), Gaps = 0/86 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVA  184
            P    DFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPG+ 
Sbjct  370  PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGMP  429

Query  183  VAGSGDPLEDYCKTNPGDKECKVFEA  106
              GS DPLED+CKTNP D+ECKV+EA
Sbjct  430  AGGSSDPLEDFCKTNPADEECKVYEA  455



>ref|XP_004238446.2| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Solanum lycopersicum]
Length=450

 Score =   193 bits (490),  Expect(2) = 2e-87, Method: Compositional matrix adjust.
 Identities = 131/138 (95%), Positives = 137/138 (99%), Gaps = 0/138 (0%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPFVKVMDEE GIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  233  ISNASCTTNCLAPFVKVMDEELGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  292

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKG+TAEDVNAAFRKA+
Sbjct  293  PTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGITAEDVNAAFRKAA  352

Query  401  DGPLKGVLDVCDAPLVSL  348
            DGPLKG+LDVCDAPLVS+
Sbjct  353  DGPLKGILDVCDAPLVSV  370


 Score =   157 bits (397),  Expect(2) = 2e-87, Method: Compositional matrix adjust.
 Identities = 72/86 (84%), Positives = 78/86 (91%), Gaps = 0/86 (0%)
 Frame = -3

Query  366  CPSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGV  187
             P    DFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGV
Sbjct  365  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGV  424

Query  186  AVAGSGDPLEDYCKTNPGDKECKVFE  109
            A  GSGDPL+++C+TNP D+ECKV+E
Sbjct  425  AAPGSGDPLDEFCETNPSDEECKVYE  450



>gb|KJB57938.1| hypothetical protein B456_009G186400 [Gossypium raimondii]
Length=399

 Score =   191 bits (485),  Expect(2) = 3e-87, Method: Compositional matrix adjust.
 Identities = 131/138 (95%), Positives = 136/138 (99%), Gaps = 0/138 (0%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  181  ISNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  240

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKG+TAEDVNAAFRKA+
Sbjct  241  PTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGITAEDVNAAFRKAA  300

Query  401  DGPLKGVLDVCDAPLVSL  348
             GPLKGVLDVCD PLVS+
Sbjct  301  KGPLKGVLDVCDVPLVSV  318


 Score =   159 bits (401),  Expect(2) = 3e-87, Method: Compositional matrix adjust.
 Identities = 73/86 (85%), Positives = 77/86 (90%), Gaps = 0/86 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVA  184
            P    DFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPG+ 
Sbjct  314  PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGMP  373

Query  183  VAGSGDPLEDYCKTNPGDKECKVFEA  106
              GS DPLED+CKTNP D+ECKV+EA
Sbjct  374  AGGSSDPLEDFCKTNPADEECKVYEA  399



>ref|XP_008346447.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Malus domestica]
Length=452

 Score =   186 bits (472),  Expect(2) = 3e-87, Method: Compositional matrix adjust.
 Identities = 127/138 (92%), Positives = 135/138 (98%), Gaps = 0/138 (0%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            VSNASCTTNCLAPFVK++DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  234  VSNASCTTNCLAPFVKILDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  293

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLV+NV KKG++AEDVNAAFRKA+
Sbjct  294  PTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVINVAKKGISAEDVNAAFRKAA  353

Query  401  DGPLKGVLDVCDAPLVSL  348
            DGPLKG+L VCD PLVS+
Sbjct  354  DGPLKGILAVCDVPLVSV  371


 Score =   163 bits (413),  Expect(2) = 3e-87, Method: Compositional matrix adjust.
 Identities = 75/86 (87%), Positives = 80/86 (93%), Gaps = 0/86 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVA  184
            P    DFRC+DVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPG A
Sbjct  367  PLVSVDFRCTDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGAA  426

Query  183  VAGSGDPLEDYCKTNPGDKECKVFEA  106
            VAGSGDPLED+C+TNP D+ECKV+EA
Sbjct  427  VAGSGDPLEDFCQTNPADEECKVYEA  452



>ref|XP_011034837.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
isoform X2 [Populus euphratica]
Length=450

 Score =   192 bits (489),  Expect(2) = 5e-87, Method: Compositional matrix adjust.
 Identities = 132/138 (96%), Positives = 137/138 (99%), Gaps = 0/138 (0%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  234  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  293

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKG+TAEDVNAAFRKA+
Sbjct  294  PTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGITAEDVNAAFRKAA  353

Query  401  DGPLKGVLDVCDAPLVSL  348
            +GPLKGVLDVCD PLVS+
Sbjct  354  EGPLKGVLDVCDVPLVSV  371


 Score =   156 bits (394),  Expect(2) = 5e-87, Method: Compositional matrix adjust.
 Identities = 74/86 (86%), Positives = 78/86 (91%), Gaps = 2/86 (2%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVA  184
            P    DFRCSDVSSTIDSSLTMVMGDDM+KVVAWYDNEWGY  RVVDLAHLVASKWPGVA
Sbjct  367  PLVSVDFRCSDVSSTIDSSLTMVMGDDMIKVVAWYDNEWGY--RVVDLAHLVASKWPGVA  424

Query  183  VAGSGDPLEDYCKTNPGDKECKVFEA  106
             AGSGDPLED+CKTNP D+ECKV+EA
Sbjct  425  AAGSGDPLEDFCKTNPADEECKVYEA  450



>ref|XP_009362871.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
isoform X1 [Pyrus x bretschneideri]
Length=452

 Score =   186 bits (472),  Expect(2) = 5e-87, Method: Compositional matrix adjust.
 Identities = 128/138 (93%), Positives = 135/138 (98%), Gaps = 0/138 (0%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            VSNASCTTNCLAPFVKV+DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  234  VSNASCTTNCLAPFVKVLDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  293

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLV+NV KKG++AEDVNAAFRKA+
Sbjct  294  PTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVINVAKKGISAEDVNAAFRKAA  353

Query  401  DGPLKGVLDVCDAPLVSL  348
            DGPLKG+L VCD PLVS+
Sbjct  354  DGPLKGILAVCDVPLVSV  371


 Score =   162 bits (411),  Expect(2) = 5e-87, Method: Compositional matrix adjust.
 Identities = 75/86 (87%), Positives = 79/86 (92%), Gaps = 0/86 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVA  184
            P    DFRC+DVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPG A
Sbjct  367  PLVSVDFRCTDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGTA  426

Query  183  VAGSGDPLEDYCKTNPGDKECKVFEA  106
             AGSGDPLED+CKTNP D+ECKV+EA
Sbjct  427  QAGSGDPLEDFCKTNPADEECKVYEA  452



>ref|XP_010500213.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPB, chloroplastic-like 
[Camelina sativa]
Length=447

 Score =   189 bits (480),  Expect(2) = 7e-87, Method: Compositional matrix adjust.
 Identities = 127/138 (92%), Positives = 136/138 (99%), Gaps = 0/138 (0%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPF KV+DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  230  ISNASCTTNCLAPFAKVLDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  289

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLV+NV+KKGLTAEDVN AFRKA+
Sbjct  290  PTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVINVEKKGLTAEDVNEAFRKAA  349

Query  401  DGPLKGVLDVCDAPLVSL  348
            +GP+KG+LDVCDAPLVS+
Sbjct  350  NGPMKGILDVCDAPLVSV  367


 Score =   159 bits (403),  Expect(2) = 7e-87, Method: Compositional matrix adjust.
 Identities = 72/86 (84%), Positives = 77/86 (90%), Gaps = 0/86 (0%)
 Frame = -3

Query  366  CPSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGV  187
             P    DFRCSDVS+TIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPG 
Sbjct  362  APLVSVDFRCSDVSTTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGE  421

Query  186  AVAGSGDPLEDYCKTNPGDKECKVFE  109
               G+GDPLED+C+TNPGD+ECKVFE
Sbjct  422  KAVGTGDPLEDFCQTNPGDEECKVFE  447



>gb|KDP36765.1| hypothetical protein JCGZ_08056 [Jatropha curcas]
Length=452

 Score =   192 bits (489),  Expect(2) = 7e-87, Method: Compositional matrix adjust.
 Identities = 130/138 (94%), Positives = 137/138 (99%), Gaps = 0/138 (0%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            VSNASCTTNCLAPFVK++DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  234  VSNASCTTNCLAPFVKIIDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  293

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKG+TAEDVNAAFRKA+
Sbjct  294  PTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGITAEDVNAAFRKAA  353

Query  401  DGPLKGVLDVCDAPLVSL  348
            DGPLKG+LDVCD PLVS+
Sbjct  354  DGPLKGILDVCDVPLVSV  371


 Score =   155 bits (393),  Expect(2) = 7e-87, Method: Compositional matrix adjust.
 Identities = 70/86 (81%), Positives = 78/86 (91%), Gaps = 0/86 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVA  184
            P    DFRC+DVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVA++WPGVA
Sbjct  367  PLVSVDFRCTDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVANEWPGVA  426

Query  183  VAGSGDPLEDYCKTNPGDKECKVFEA  106
              GSGDPLE++C+ NP D+ECKV+EA
Sbjct  427  ATGSGDPLEEFCEKNPADEECKVYEA  452



>ref|XP_006342156.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Solanum tuberosum]
Length=450

 Score =   192 bits (489),  Expect(2) = 8e-87, Method: Compositional matrix adjust.
 Identities = 131/138 (95%), Positives = 137/138 (99%), Gaps = 0/138 (0%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPFVKVMDEE GIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  233  ISNASCTTNCLAPFVKVMDEELGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  292

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKG+TAEDVNAAFRKA+
Sbjct  293  PTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGITAEDVNAAFRKAA  352

Query  401  DGPLKGVLDVCDAPLVSL  348
            DGPLKG+LDVCDAPLVS+
Sbjct  353  DGPLKGILDVCDAPLVSV  370


 Score =   155 bits (393),  Expect(2) = 8e-87, Method: Compositional matrix adjust.
 Identities = 70/86 (81%), Positives = 78/86 (91%), Gaps = 0/86 (0%)
 Frame = -3

Query  366  CPSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGV  187
             P    DFRCSDVS+TIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLAHLVASKWPGV
Sbjct  365  APLVSVDFRCSDVSATIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLAHLVASKWPGV  424

Query  186  AVAGSGDPLEDYCKTNPGDKECKVFE  109
            A  GSGDPL+++C+TNP D+ECKV+E
Sbjct  425  AAPGSGDPLDEFCETNPSDEECKVYE  450



>ref|XP_006577850.1| PREDICTED: uncharacterized protein LOC100806482 isoform X1 [Glycine 
max]
Length=452

 Score =   189 bits (480),  Expect(2) = 9e-87, Method: Compositional matrix adjust.
 Identities = 129/138 (93%), Positives = 136/138 (99%), Gaps = 0/138 (0%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPFVK++D EFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  235  ISNASCTTNCLAPFVKILDAEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  294

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKGLTAEDVNAAFRKA+
Sbjct  295  PTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGLTAEDVNAAFRKAA  354

Query  401  DGPLKGVLDVCDAPLVSL  348
            +GPLKGVLDVCD PLVS+
Sbjct  355  EGPLKGVLDVCDVPLVSI  372


 Score =   159 bits (401),  Expect(2) = 9e-87, Method: Compositional matrix adjust.
 Identities = 73/85 (86%), Positives = 77/85 (91%), Gaps = 0/85 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVA  184
            P    DFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPG  
Sbjct  368  PLVSIDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGAP  427

Query  183  VAGSGDPLEDYCKTNPGDKECKVFE  109
             AGSGDPLED+C+TNP D+ECKV+E
Sbjct  428  KAGSGDPLEDFCETNPADEECKVYE  452



>gb|AFG28405.1| glyceraldehyde-3-phosphate dehydrogenase B [Pyrus x bretschneideri]
Length=452

 Score =   186 bits (472),  Expect(2) = 1e-86, Method: Compositional matrix adjust.
 Identities = 127/138 (92%), Positives = 135/138 (98%), Gaps = 0/138 (0%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            VSNASCTTNCLAPFVK++DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  234  VSNASCTTNCLAPFVKILDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  293

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLV+NV KKG++AEDVNAAFRKA+
Sbjct  294  PTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVINVAKKGISAEDVNAAFRKAA  353

Query  401  DGPLKGVLDVCDAPLVSL  348
            DGPLKG+L VCD PLVS+
Sbjct  354  DGPLKGILAVCDVPLVSV  371


 Score =   162 bits (409),  Expect(2) = 1e-86, Method: Compositional matrix adjust.
 Identities = 74/86 (86%), Positives = 79/86 (92%), Gaps = 0/86 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVA  184
            P    DFRC+DVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPG A
Sbjct  367  PLVSVDFRCTDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGAA  426

Query  183  VAGSGDPLEDYCKTNPGDKECKVFEA  106
            V GSGDPLED+C+TNP D+ECKV+EA
Sbjct  427  VVGSGDPLEDFCQTNPADEECKVYEA  452



>ref|NP_001240080.1| uncharacterized protein LOC100806482 [Glycine max]
 gb|ACU18570.1| unknown [Glycine max]
 gb|KHN33783.1| Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic [Glycine 
soja]
Length=451

 Score =   189 bits (480),  Expect(2) = 1e-86, Method: Compositional matrix adjust.
 Identities = 129/138 (93%), Positives = 136/138 (99%), Gaps = 0/138 (0%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPFVK++D EFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  234  ISNASCTTNCLAPFVKILDAEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  293

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKGLTAEDVNAAFRKA+
Sbjct  294  PTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGLTAEDVNAAFRKAA  353

Query  401  DGPLKGVLDVCDAPLVSL  348
            +GPLKGVLDVCD PLVS+
Sbjct  354  EGPLKGVLDVCDVPLVSI  371


 Score =   159 bits (401),  Expect(2) = 1e-86, Method: Compositional matrix adjust.
 Identities = 73/85 (86%), Positives = 77/85 (91%), Gaps = 0/85 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVA  184
            P    DFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPG  
Sbjct  367  PLVSIDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGAP  426

Query  183  VAGSGDPLEDYCKTNPGDKECKVFE  109
             AGSGDPLED+C+TNP D+ECKV+E
Sbjct  427  KAGSGDPLEDFCETNPADEECKVYE  451



>ref|XP_011074072.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Sesamum indicum]
Length=452

 Score =   190 bits (482),  Expect(2) = 1e-86, Method: Compositional matrix adjust.
 Identities = 130/138 (94%), Positives = 136/138 (99%), Gaps = 0/138 (0%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  234  ISNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  293

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKG+TAEDVNAAFRKA+
Sbjct  294  PTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGITAEDVNAAFRKAA  353

Query  401  DGPLKGVLDVCDAPLVSL  348
            +GPL GVLDVCD PLVS+
Sbjct  354  EGPLAGVLDVCDVPLVSV  371


 Score =   158 bits (399),  Expect(2) = 1e-86, Method: Compositional matrix adjust.
 Identities = 72/86 (84%), Positives = 76/86 (88%), Gaps = 0/86 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVA  184
            P    DFRC+DVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVA KWPG  
Sbjct  367  PLVSVDFRCTDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVADKWPGAT  426

Query  183  VAGSGDPLEDYCKTNPGDKECKVFEA  106
              GSGDPLED+CKTNP D+ECKV+EA
Sbjct  427  AEGSGDPLEDFCKTNPADEECKVYEA  452



>ref|XP_009629570.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Nicotiana tomentosiformis]
Length=449

 Score =   188 bits (477),  Expect(2) = 1e-86, Method: Compositional matrix adjust.
 Identities = 129/138 (93%), Positives = 135/138 (98%), Gaps = 0/138 (0%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  232  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  291

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKG++AEDVNAAFRKA+
Sbjct  292  PTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGISAEDVNAAFRKAA  351

Query  401  DGPLKGVLDVCDAPLVSL  348
            DGPL G+L VCD PLVS+
Sbjct  352  DGPLNGILAVCDVPLVSV  369


 Score =   160 bits (404),  Expect(2) = 1e-86, Method: Compositional matrix adjust.
 Identities = 75/85 (88%), Positives = 77/85 (91%), Gaps = 0/85 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVA  184
            P    DFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPG +
Sbjct  365  PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGSS  424

Query  183  VAGSGDPLEDYCKTNPGDKECKVFE  109
            V GSGD LEDYCKTNP DKECKV+E
Sbjct  425  VEGSGDSLEDYCKTNPADKECKVYE  449



>ref|XP_009780936.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Nicotiana sylvestris]
Length=449

 Score =   187 bits (476),  Expect(2) = 1e-86, Method: Compositional matrix adjust.
 Identities = 128/138 (93%), Positives = 135/138 (98%), Gaps = 0/138 (0%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  232  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  291

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVN++KKG++AEDVNAAFRKA+
Sbjct  292  PTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNIEKKGISAEDVNAAFRKAA  351

Query  401  DGPLKGVLDVCDAPLVSL  348
            DGPL G+L VCD PLVS+
Sbjct  352  DGPLNGILAVCDVPLVSV  369


 Score =   160 bits (404),  Expect(2) = 1e-86, Method: Compositional matrix adjust.
 Identities = 75/85 (88%), Positives = 77/85 (91%), Gaps = 0/85 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVA  184
            P    DFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPG +
Sbjct  365  PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGSS  424

Query  183  VAGSGDPLEDYCKTNPGDKECKVFE  109
            V GSGD LEDYCKTNP DKECKV+E
Sbjct  425  VEGSGDALEDYCKTNPADKECKVYE  449



>ref|XP_010918353.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Elaeis guineensis]
Length=452

 Score =   191 bits (484),  Expect(2) = 2e-86, Method: Compositional matrix adjust.
 Identities = 130/138 (94%), Positives = 136/138 (99%), Gaps = 0/138 (0%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  234  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  293

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKG+TAEDVN AFRKA+
Sbjct  294  PTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGITAEDVNQAFRKAA  353

Query  401  DGPLKGVLDVCDAPLVSL  348
            +GPLKG+LDVCD PLVS+
Sbjct  354  NGPLKGILDVCDVPLVSV  371


 Score =   156 bits (394),  Expect(2) = 2e-86, Method: Compositional matrix adjust.
 Identities = 71/86 (83%), Positives = 78/86 (91%), Gaps = 0/86 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVA  184
            P    DFRC+DVSSTID+SLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPG+ 
Sbjct  367  PLVSVDFRCTDVSSTIDASLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGMP  426

Query  183  VAGSGDPLEDYCKTNPGDKECKVFEA  106
            V GSGDPLED+CKT+P  +ECKV+EA
Sbjct  427  VQGSGDPLEDFCKTSPATEECKVYEA  452



>ref|XP_002891244.1| glyceraldehyde-3-phosphate dehydrogenase B subunit [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH67503.1| glyceraldehyde-3-phosphate dehydrogenase B subunit [Arabidopsis 
lyrata subsp. lyrata]
Length=447

 Score =   189 bits (480),  Expect(2) = 2e-86, Method: Compositional matrix adjust.
 Identities = 127/138 (92%), Positives = 136/138 (99%), Gaps = 0/138 (0%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPF KV+DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  230  ISNASCTTNCLAPFAKVLDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  289

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLV+NV+KKGLTAEDVN AFRKA+
Sbjct  290  PTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVINVEKKGLTAEDVNEAFRKAA  349

Query  401  DGPLKGVLDVCDAPLVSL  348
            +GP+KG+LDVCDAPLVS+
Sbjct  350  NGPMKGILDVCDAPLVSV  367


 Score =   157 bits (398),  Expect(2) = 2e-86, Method: Compositional matrix adjust.
 Identities = 72/86 (84%), Positives = 76/86 (88%), Gaps = 0/86 (0%)
 Frame = -3

Query  366  CPSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGV  187
             P    DFRCSDVS+TIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPG 
Sbjct  362  APLVSVDFRCSDVSTTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGE  421

Query  186  AVAGSGDPLEDYCKTNPGDKECKVFE  109
               GSGDPLED+CKTNP D+ECKV+E
Sbjct  422  EAVGSGDPLEDFCKTNPADEECKVYE  447



>ref|NP_001289237.1| glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic [Pyrus 
x bretschneideri]
 gb|AHM26621.1| glyceraldehyde-3-phosphate dehydrogenase B [Pyrus x bretschneideri]
Length=452

 Score =   186 bits (472),  Expect(2) = 2e-86, Method: Compositional matrix adjust.
 Identities = 127/138 (92%), Positives = 135/138 (98%), Gaps = 0/138 (0%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            VSNASCTTNCLAPFVK++DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  234  VSNASCTTNCLAPFVKILDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  293

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLV+NV KKG++AEDVNAAFRKA+
Sbjct  294  PTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVINVAKKGISAEDVNAAFRKAA  353

Query  401  DGPLKGVLDVCDAPLVSL  348
            DGPLKG+L VCD PLVS+
Sbjct  354  DGPLKGILAVCDVPLVSV  371


 Score =   160 bits (406),  Expect(2) = 2e-86, Method: Compositional matrix adjust.
 Identities = 74/86 (86%), Positives = 78/86 (91%), Gaps = 0/86 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVA  184
            P    DFRC+DVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPG A
Sbjct  367  PLVSVDFRCTDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGAA  426

Query  183  VAGSGDPLEDYCKTNPGDKECKVFEA  106
              GSGDPLED+CKTNP D+ECKV+EA
Sbjct  427  EVGSGDPLEDFCKTNPADEECKVYEA  452



>ref|XP_002510706.1| glyceraldehyde 3-phosphate dehydrogenase, putative [Ricinus communis]
 gb|EEF52893.1| glyceraldehyde 3-phosphate dehydrogenase, putative [Ricinus communis]
Length=458

 Score =   187 bits (475),  Expect(2) = 4e-86, Method: Compositional matrix adjust.
 Identities = 132/144 (92%), Positives = 137/144 (95%), Gaps = 6/144 (4%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGD------Qrlldashrdlrrara  600
            VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGD      QRLLDASHRDLRRARA
Sbjct  234  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDXSYTGDQRLLDASHRDLRRARA  293

Query  599  aaLNIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNA  420
            AALNIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKGLTAEDVNA
Sbjct  294  AALNIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGLTAEDVNA  353

Query  419  AFRKASDGPLKGVLDVCDAPLVSL  348
            AFRKA++GPLKG+LDVCD PLVS+
Sbjct  354  AFRKAAEGPLKGILDVCDVPLVSV  377


 Score =   159 bits (402),  Expect(2) = 4e-86, Method: Compositional matrix adjust.
 Identities = 73/86 (85%), Positives = 78/86 (91%), Gaps = 0/86 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVA  184
            P    DFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVA+KWPG +
Sbjct  373  PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVAAKWPGAS  432

Query  183  VAGSGDPLEDYCKTNPGDKECKVFEA  106
             AGSGD LED+C+TNP DKECKVFE+
Sbjct  433  AAGSGDALEDFCETNPADKECKVFES  458



>ref|XP_006307502.1| hypothetical protein CARUB_v10009127mg [Capsella rubella]
 gb|EOA40400.1| hypothetical protein CARUB_v10009127mg [Capsella rubella]
Length=447

 Score =   187 bits (474),  Expect(2) = 4e-86, Method: Compositional matrix adjust.
 Identities = 125/138 (91%), Positives = 136/138 (99%), Gaps = 0/138 (0%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPF KV+DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  230  ISNASCTTNCLAPFAKVLDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  289

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLV+NV+KKG+TAE+VN AFRKA+
Sbjct  290  PTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVINVEKKGITAEEVNEAFRKAA  349

Query  401  DGPLKGVLDVCDAPLVSL  348
            +GP+KG+LDVCDAPLVS+
Sbjct  350  NGPMKGILDVCDAPLVSV  367


 Score =   159 bits (402),  Expect(2) = 4e-86, Method: Compositional matrix adjust.
 Identities = 72/86 (84%), Positives = 77/86 (90%), Gaps = 0/86 (0%)
 Frame = -3

Query  366  CPSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGV  187
             P    DFRCSDVS+TIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPG 
Sbjct  362  APLVSVDFRCSDVSTTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGE  421

Query  186  AVAGSGDPLEDYCKTNPGDKECKVFE  109
               GSGDPLED+C+TNPG++ECKVFE
Sbjct  422  KAVGSGDPLEDFCQTNPGEEECKVFE  447



>ref|XP_009786329.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Nicotiana sylvestris]
Length=449

 Score =   186 bits (473),  Expect(2) = 4e-86, Method: Compositional matrix adjust.
 Identities = 130/138 (94%), Positives = 134/138 (97%), Gaps = 0/138 (0%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPFVKVMDEE GIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  232  ISNASCTTNCLAPFVKVMDEELGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  291

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV KKG+TAEDVNAAFRKA+
Sbjct  292  PTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVAKKGITAEDVNAAFRKAA  351

Query  401  DGPLKGVLDVCDAPLVSL  348
            DGPLKGVL VCD PLVS+
Sbjct  352  DGPLKGVLAVCDEPLVSV  369


 Score =   159 bits (402),  Expect(2) = 4e-86, Method: Compositional matrix adjust.
 Identities = 73/85 (86%), Positives = 79/85 (93%), Gaps = 0/85 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVA  184
            P    DFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVA+KWPGVA
Sbjct  365  PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVANKWPGVA  424

Query  183  VAGSGDPLEDYCKTNPGDKECKVFE  109
            V GSGDPL+++CKTNP D+ECKV+E
Sbjct  425  VPGSGDPLDEFCKTNPADEECKVYE  449



>ref|XP_007135965.1| hypothetical protein PHAVU_009G006600g [Phaseolus vulgaris]
 gb|ESW07959.1| hypothetical protein PHAVU_009G006600g [Phaseolus vulgaris]
Length=451

 Score =   188 bits (478),  Expect(2) = 5e-86, Method: Compositional matrix adjust.
 Identities = 128/138 (93%), Positives = 136/138 (99%), Gaps = 0/138 (0%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPFVK++DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  234  ISNASCTTNCLAPFVKILDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  293

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAVSLVLP+LKGKLNGIALRVPTPNVSVVDLVVNV+KKGLTAEDVN AFRKA+
Sbjct  294  PTSTGAAKAVSLVLPKLKGKLNGIALRVPTPNVSVVDLVVNVEKKGLTAEDVNGAFRKAA  353

Query  401  DGPLKGVLDVCDAPLVSL  348
            +GPLKGVLDVCD PLVS+
Sbjct  354  EGPLKGVLDVCDVPLVSI  371


 Score =   157 bits (397),  Expect(2) = 5e-86, Method: Compositional matrix adjust.
 Identities = 72/85 (85%), Positives = 77/85 (91%), Gaps = 0/85 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVA  184
            P    DFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPG  
Sbjct  367  PLVSIDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGTP  426

Query  183  VAGSGDPLEDYCKTNPGDKECKVFE  109
             AGSGDPLE++C+TNP D+ECKV+E
Sbjct  427  KAGSGDPLEEFCETNPADEECKVYE  451



>ref|NP_174996.1| glyceraldehyde-3-phosphate dehydrogenase B [Arabidopsis thaliana]
 sp|P25857.2|G3PB_ARATH RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase GAPB, 
chloroplastic; AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase B; Flags: Precursor [Arabidopsis thaliana]
 gb|AAG51517.1|AC068324_5 glyceraldehyde-3-phosphate dehydrogenase [Arabidopsis thaliana]
 gb|AAA32795.1| glyceraldehyde-3-phosphate dehydrogenase [Arabidopsis thaliana]
 gb|AAK62594.1| At1g42970/F13A11_3 [Arabidopsis thaliana]
 gb|AAK64065.1| putative glyceraldehyde-3-phosphate dehydrogenase [Arabidopsis 
thaliana]
 gb|AAL85133.1| putative glyceraldehyde-3-phosphate dehydrogenase [Arabidopsis 
thaliana]
 gb|AAM19948.1| At1g42970/F13A11_3 [Arabidopsis thaliana]
 gb|AAM98232.1| unknown protein [Arabidopsis thaliana]
 gb|AAN72278.1| At1g42970/F13A11_3 [Arabidopsis thaliana]
 dbj|BAF02115.1| putative glyceraldehyde-3-phosphate dehydrogenase [Arabidopsis 
thaliana]
 gb|AEE31933.1| glyceraldehyde-3-phosphate dehydrogenase B [Arabidopsis thaliana]
Length=447

 Score =   189 bits (479),  Expect(2) = 5e-86, Method: Compositional matrix adjust.
 Identities = 127/138 (92%), Positives = 136/138 (99%), Gaps = 0/138 (0%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPF KV+DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  230  ISNASCTTNCLAPFAKVLDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  289

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLV+NV+KKGLTAEDVN AFRKA+
Sbjct  290  PTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVINVEKKGLTAEDVNEAFRKAA  349

Query  401  DGPLKGVLDVCDAPLVSL  348
            +GP+KG+LDVCDAPLVS+
Sbjct  350  NGPMKGILDVCDAPLVSV  367


 Score =   157 bits (396),  Expect(2) = 5e-86, Method: Compositional matrix adjust.
 Identities = 71/86 (83%), Positives = 76/86 (88%), Gaps = 0/86 (0%)
 Frame = -3

Query  366  CPSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGV  187
             P    DFRCSDVS+TIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPG 
Sbjct  362  APLVSVDFRCSDVSTTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGA  421

Query  186  AVAGSGDPLEDYCKTNPGDKECKVFE  109
               GSGDPLED+CKTNP D+ECKV++
Sbjct  422  EAVGSGDPLEDFCKTNPADEECKVYD  447



>ref|XP_009595874.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Nicotiana tomentosiformis]
Length=449

 Score =   186 bits (473),  Expect(2) = 5e-86, Method: Compositional matrix adjust.
 Identities = 130/138 (94%), Positives = 134/138 (97%), Gaps = 0/138 (0%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPFVKVMDEE GIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  232  ISNASCTTNCLAPFVKVMDEELGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  291

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV KKG+TAEDVNAAFRKA+
Sbjct  292  PTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVAKKGITAEDVNAAFRKAA  351

Query  401  DGPLKGVLDVCDAPLVSL  348
            DGPLKGVL VCD PLVS+
Sbjct  352  DGPLKGVLAVCDEPLVSV  369


 Score =   159 bits (402),  Expect(2) = 5e-86, Method: Compositional matrix adjust.
 Identities = 73/85 (86%), Positives = 79/85 (93%), Gaps = 0/85 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVA  184
            P    DFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVA+KWPGVA
Sbjct  365  PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVANKWPGVA  424

Query  183  VAGSGDPLEDYCKTNPGDKECKVFE  109
            V GSGDPL+++CKTNP D+ECKV+E
Sbjct  425  VPGSGDPLDEFCKTNPADEECKVYE  449



>gb|KFK29151.1| hypothetical protein AALP_AA7G095400 [Arabis alpina]
Length=448

 Score =   185 bits (470),  Expect(2) = 8e-86, Method: Compositional matrix adjust.
 Identities = 126/137 (92%), Positives = 133/137 (97%), Gaps = 0/137 (0%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPF KV+DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  230  ISNASCTTNCLAPFAKVLDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  289

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLV+NV+KKGLTAEDVN AFRKA+
Sbjct  290  PTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVINVEKKGLTAEDVNEAFRKAA  349

Query  401  DGPLKGVLDVCDAPLVS  351
             GP+KG+LDVCD PLVS
Sbjct  350  AGPMKGILDVCDTPLVS  366


 Score =   159 bits (403),  Expect(2) = 8e-86, Method: Compositional matrix adjust.
 Identities = 72/81 (89%), Positives = 77/81 (95%), Gaps = 0/81 (0%)
 Frame = -3

Query  348  DFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVAVAGSG  169
            DFRCSDVS+TIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVA+KWPG   AGSG
Sbjct  368  DFRCSDVSTTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVAAKWPGEVAAGSG  427

Query  168  DPLEDYCKTNPGDKECKVFEA  106
            DPLED+CKTNP D+ECKV+EA
Sbjct  428  DPLEDFCKTNPADEECKVYEA  448



>ref|XP_004300121.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Fragaria vesca subsp. vesca]
Length=452

 Score =   186 bits (473),  Expect(2) = 9e-86, Method: Compositional matrix adjust.
 Identities = 128/138 (93%), Positives = 134/138 (97%), Gaps = 0/138 (0%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            VSNASCTTNCLAPFVKV+DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  234  VSNASCTTNCLAPFVKVLDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  293

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLV+NV KKG+TAEDVN AFRKA+
Sbjct  294  PTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVINVAKKGITAEDVNGAFRKAA  353

Query  401  DGPLKGVLDVCDAPLVSL  348
            DGPLKG+L VCD PLVS+
Sbjct  354  DGPLKGILAVCDVPLVSV  371


 Score =   158 bits (400),  Expect(2) = 9e-86, Method: Compositional matrix adjust.
 Identities = 73/86 (85%), Positives = 77/86 (90%), Gaps = 0/86 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVA  184
            P    DFRC+DVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPG  
Sbjct  367  PLVSVDFRCTDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGTP  426

Query  183  VAGSGDPLEDYCKTNPGDKECKVFEA  106
            V GSGDPLED+CK NP D+ECKV+EA
Sbjct  427  VEGSGDPLEDFCKDNPADEECKVYEA  452



>gb|AAD10210.1| glyceraldehyde 3-phosphate dehydrogenase B subunit [Arabidopsis 
thaliana]
Length=402

 Score =   188 bits (478),  Expect(2) = 9e-86, Method: Compositional matrix adjust.
 Identities = 127/138 (92%), Positives = 136/138 (99%), Gaps = 0/138 (0%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPF KV+DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  185  ISNASCTTNCLAPFAKVLDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  244

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLV+NV+KKGLTAEDVN AFRKA+
Sbjct  245  PTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVINVEKKGLTAEDVNEAFRKAA  304

Query  401  DGPLKGVLDVCDAPLVSL  348
            +GP+KG+LDVCDAPLVS+
Sbjct  305  NGPMKGILDVCDAPLVSV  322


 Score =   156 bits (395),  Expect(2) = 9e-86, Method: Compositional matrix adjust.
 Identities = 71/86 (83%), Positives = 76/86 (88%), Gaps = 0/86 (0%)
 Frame = -3

Query  366  CPSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGV  187
             P    DFRCSDVS+TIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPG 
Sbjct  317  APLVSVDFRCSDVSTTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGA  376

Query  186  AVAGSGDPLEDYCKTNPGDKECKVFE  109
               GSGDPLED+CKTNP D+ECKV++
Sbjct  377  EAVGSGDPLEDFCKTNPADEECKVYD  402



>ref|XP_010478986.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPB, chloroplastic 
isoform X2 [Camelina sativa]
Length=445

 Score =   189 bits (480),  Expect(2) = 1e-85, Method: Compositional matrix adjust.
 Identities = 127/138 (92%), Positives = 136/138 (99%), Gaps = 0/138 (0%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPF KV+DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  228  ISNASCTTNCLAPFAKVLDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  287

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLV+NV+KKGLTAEDVN AFRKA+
Sbjct  288  PTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVINVEKKGLTAEDVNEAFRKAA  347

Query  401  DGPLKGVLDVCDAPLVSL  348
            +GP+KG+LDVCDAPLVS+
Sbjct  348  NGPMKGILDVCDAPLVSV  365


 Score =   155 bits (392),  Expect(2) = 1e-85, Method: Compositional matrix adjust.
 Identities = 70/86 (81%), Positives = 76/86 (88%), Gaps = 0/86 (0%)
 Frame = -3

Query  366  CPSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGV  187
             P    DFRCSDVS+TIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPG 
Sbjct  360  APLVSVDFRCSDVSTTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGE  419

Query  186  AVAGSGDPLEDYCKTNPGDKECKVFE  109
               GSGDPLED+C+TNP ++ECKV+E
Sbjct  420  KAVGSGDPLEDFCQTNPANEECKVYE  445



>ref|XP_002273754.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Vitis vinifera]
 emb|CBI40744.3| unnamed protein product [Vitis vinifera]
Length=453

 Score =   186 bits (471),  Expect(2) = 1e-85, Method: Compositional matrix adjust.
 Identities = 128/138 (93%), Positives = 135/138 (98%), Gaps = 0/138 (0%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            VSNASCTTNCLAPFVK++DEE GIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  235  VSNASCTTNCLAPFVKILDEELGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  294

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKG+TAEDVNAAFRKA+
Sbjct  295  PTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGITAEDVNAAFRKAA  354

Query  401  DGPLKGVLDVCDAPLVSL  348
            DGPLKG+L VCD PLVS+
Sbjct  355  DGPLKGILAVCDVPLVSV  372


 Score =   158 bits (400),  Expect(2) = 1e-85, Method: Compositional matrix adjust.
 Identities = 72/86 (84%), Positives = 78/86 (91%), Gaps = 0/86 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVA  184
            P    DF+CSDVSSTID+SLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVA+KWPG A
Sbjct  368  PLVSVDFKCSDVSSTIDASLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVAAKWPGFA  427

Query  183  VAGSGDPLEDYCKTNPGDKECKVFEA  106
              GSGDPLED+CKTNP D+ECKV+EA
Sbjct  428  AEGSGDPLEDFCKTNPADEECKVYEA  453



>emb|CAN69459.1| hypothetical protein VITISV_021576 [Vitis vinifera]
Length=453

 Score =   186 bits (471),  Expect(2) = 1e-85, Method: Compositional matrix adjust.
 Identities = 128/138 (93%), Positives = 135/138 (98%), Gaps = 0/138 (0%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            VSNASCTTNCLAPFVK++DEE GIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  235  VSNASCTTNCLAPFVKILDEELGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  294

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKG+TAEDVNAAFRKA+
Sbjct  295  PTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGITAEDVNAAFRKAA  354

Query  401  DGPLKGVLDVCDAPLVSL  348
            DGPLKG+L VCD PLVS+
Sbjct  355  DGPLKGILAVCDVPLVSV  372


 Score =   158 bits (400),  Expect(2) = 1e-85, Method: Compositional matrix adjust.
 Identities = 72/86 (84%), Positives = 78/86 (91%), Gaps = 0/86 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVA  184
            P    DF+CSDVSSTID+SLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVA+KWPG A
Sbjct  368  PLVSVDFKCSDVSSTIDASLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVAAKWPGFA  427

Query  183  VAGSGDPLEDYCKTNPGDKECKVFEA  106
              GSGDPLED+CKTNP D+ECKV+EA
Sbjct  428  AEGSGDPLEDFCKTNPADEECKVYEA  453



>gb|AEO45784.1| glyceraldehyde-3-phosphate dehydrogenase B [Scoparia dulcis]
Length=452

 Score =   186 bits (473),  Expect(2) = 1e-85, Method: Compositional matrix adjust.
 Identities = 127/138 (92%), Positives = 136/138 (99%), Gaps = 0/138 (0%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPFVK++DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  234  ISNASCTTNCLAPFVKILDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  293

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKG+TAEDVN+AFRKA+
Sbjct  294  PTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGITAEDVNSAFRKAA  353

Query  401  DGPLKGVLDVCDAPLVSL  348
            +GPL GVLDVCD PLVS+
Sbjct  354  NGPLAGVLDVCDVPLVSV  371


 Score =   157 bits (398),  Expect(2) = 1e-85, Method: Compositional matrix adjust.
 Identities = 72/85 (85%), Positives = 77/85 (91%), Gaps = 0/85 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVA  184
            P    DFRCSDVSSTIDSSLTMV+GDDMVKVVAWYDNEWGYSQRVVDLAHLVA KWPG  
Sbjct  367  PLVSVDFRCSDVSSTIDSSLTMVLGDDMVKVVAWYDNEWGYSQRVVDLAHLVAYKWPGAT  426

Query  183  VAGSGDPLEDYCKTNPGDKECKVFE  109
            V+GSGDPLED+CKTNP D+ECKV+E
Sbjct  427  VSGSGDPLEDFCKTNPADEECKVYE  451



>ref|XP_009107645.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPB, chloroplastic 
[Brassica rapa]
 emb|CDY35800.1| BnaA08g04610D [Brassica napus]
Length=448

 Score =   184 bits (468),  Expect(2) = 2e-85, Method: Compositional matrix adjust.
 Identities = 127/137 (93%), Positives = 133/137 (97%), Gaps = 0/137 (0%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPF KV+DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  230  ISNASCTTNCLAPFAKVLDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  289

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLV+NV+KKGLTAEDVN AFRKA+
Sbjct  290  PTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVINVEKKGLTAEDVNEAFRKAA  349

Query  401  DGPLKGVLDVCDAPLVS  351
             GPLKGVL+VCD PLVS
Sbjct  350  AGPLKGVLEVCDTPLVS  366


 Score =   159 bits (402),  Expect(2) = 2e-85, Method: Compositional matrix adjust.
 Identities = 72/81 (89%), Positives = 77/81 (95%), Gaps = 0/81 (0%)
 Frame = -3

Query  348  DFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVAVAGSG  169
            DFRCSDVS+TIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVA+KWPG   AGSG
Sbjct  368  DFRCSDVSTTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVAAKWPGEVAAGSG  427

Query  168  DPLEDYCKTNPGDKECKVFEA  106
            DPLED+CKTNP D+ECKV+EA
Sbjct  428  DPLEDFCKTNPADEECKVYEA  448



>ref|XP_010478985.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPB, chloroplastic 
isoform X1 [Camelina sativa]
Length=402

 Score =   189 bits (479),  Expect(2) = 2e-85, Method: Compositional matrix adjust.
 Identities = 127/138 (92%), Positives = 136/138 (99%), Gaps = 0/138 (0%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPF KV+DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  185  ISNASCTTNCLAPFAKVLDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  244

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLV+NV+KKGLTAEDVN AFRKA+
Sbjct  245  PTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVINVEKKGLTAEDVNEAFRKAA  304

Query  401  DGPLKGVLDVCDAPLVSL  348
            +GP+KG+LDVCDAPLVS+
Sbjct  305  NGPMKGILDVCDAPLVSV  322


 Score =   154 bits (390),  Expect(2) = 2e-85, Method: Compositional matrix adjust.
 Identities = 70/86 (81%), Positives = 76/86 (88%), Gaps = 0/86 (0%)
 Frame = -3

Query  366  CPSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGV  187
             P    DFRCSDVS+TIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPG 
Sbjct  317  APLVSVDFRCSDVSTTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGE  376

Query  186  AVAGSGDPLEDYCKTNPGDKECKVFE  109
               GSGDPLED+C+TNP ++ECKV+E
Sbjct  377  KAVGSGDPLEDFCQTNPANEECKVYE  402



>ref|XP_003603851.1| Glyceraldehyde-3-phosphate dehydrogenase [Medicago truncatula]
 gb|AES74102.1| glyceraldehyde-3-phosphate dehydrogenase B [Medicago truncatula]
Length=451

 Score =   188 bits (478),  Expect(2) = 4e-85, Method: Compositional matrix adjust.
 Identities = 128/138 (93%), Positives = 136/138 (99%), Gaps = 0/138 (0%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPFVK++DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  234  ISNASCTTNCLAPFVKILDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  293

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV KKG++AEDVNAAFRKA+
Sbjct  294  PTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVAKKGISAEDVNAAFRKAA  353

Query  401  DGPLKGVLDVCDAPLVSL  348
            +GPLKGVLDVCD PLVS+
Sbjct  354  EGPLKGVLDVCDVPLVSV  371


 Score =   154 bits (390),  Expect(2) = 4e-85, Method: Compositional matrix adjust.
 Identities = 71/85 (84%), Positives = 75/85 (88%), Gaps = 0/85 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVA  184
            P    DFRC+DVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVA+KWPG  
Sbjct  367  PLVSVDFRCTDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVANKWPGTP  426

Query  183  VAGSGDPLEDYCKTNPGDKECKVFE  109
             AGSGDPLED+C+TNP   ECKVFE
Sbjct  427  QAGSGDPLEDFCETNPSTDECKVFE  451



>emb|CDY69523.1| BnaC08g46180D, partial [Brassica napus]
Length=402

 Score =   184 bits (467),  Expect(2) = 4e-85, Method: Compositional matrix adjust.
 Identities = 127/137 (93%), Positives = 133/137 (97%), Gaps = 0/137 (0%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPF KV+DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  184  ISNASCTTNCLAPFAKVLDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  243

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLV+NV+KKGLTAEDVN AFRKA+
Sbjct  244  PTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVINVEKKGLTAEDVNEAFRKAA  303

Query  401  DGPLKGVLDVCDAPLVS  351
             GPLKGVL+VCD PLVS
Sbjct  304  AGPLKGVLEVCDTPLVS  320


 Score =   159 bits (401),  Expect(2) = 4e-85, Method: Compositional matrix adjust.
 Identities = 73/86 (85%), Positives = 78/86 (91%), Gaps = 0/86 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVA  184
            P    DFRCSDVS+TIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVA+KWPG  
Sbjct  317  PLVSCDFRCSDVSTTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVAAKWPGEV  376

Query  183  VAGSGDPLEDYCKTNPGDKECKVFEA  106
             AGSGDPLED+CKTNP D+ECKV+EA
Sbjct  377  AAGSGDPLEDFCKTNPADEECKVYEA  402



>ref|XP_008786670.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Phoenix dactylifera]
Length=452

 Score =   189 bits (479),  Expect(2) = 5e-85, Method: Compositional matrix adjust.
 Identities = 130/138 (94%), Positives = 135/138 (98%), Gaps = 0/138 (0%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  234  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  293

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKG+TAEDVN AFRKA+
Sbjct  294  PTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGITAEDVNQAFRKAA  353

Query  401  DGPLKGVLDVCDAPLVSL  348
            DGPLKG+L VCD PLVS+
Sbjct  354  DGPLKGILAVCDVPLVSV  371


 Score =   154 bits (388),  Expect(2) = 5e-85, Method: Compositional matrix adjust.
 Identities = 70/86 (81%), Positives = 78/86 (91%), Gaps = 0/86 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVA  184
            P    DFRC+DVSSTID+SLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPG+ 
Sbjct  367  PLVSVDFRCTDVSSTIDASLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGMP  426

Query  183  VAGSGDPLEDYCKTNPGDKECKVFEA  106
            V GSGDPLED+C+T+P  +ECKV+EA
Sbjct  427  VQGSGDPLEDFCQTSPDTEECKVYEA  452



>ref|XP_006395998.1| hypothetical protein EUTSA_v10004217mg [Eutrema salsugineum]
 dbj|BAJ34314.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ33284.1| hypothetical protein EUTSA_v10004217mg [Eutrema salsugineum]
Length=447

 Score =   184 bits (468),  Expect(2) = 6e-85, Method: Compositional matrix adjust.
 Identities = 129/137 (94%), Positives = 132/137 (96%), Gaps = 0/137 (0%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPF KV+DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  230  ISNASCTTNCLAPFAKVLDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  289

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV KKGLTAEDVN AFRKA+
Sbjct  290  PTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVAKKGLTAEDVNEAFRKAA  349

Query  401  DGPLKGVLDVCDAPLVS  351
            DGPLKGVL VCD PLVS
Sbjct  350  DGPLKGVLAVCDIPLVS  366


 Score =   157 bits (397),  Expect(2) = 6e-85, Method: Compositional matrix adjust.
 Identities = 71/80 (89%), Positives = 76/80 (95%), Gaps = 0/80 (0%)
 Frame = -3

Query  348  DFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVAVAGSG  169
            DFRCSDVS+TIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVA+KWPG   AGSG
Sbjct  368  DFRCSDVSTTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVANKWPGEVAAGSG  427

Query  168  DPLEDYCKTNPGDKECKVFE  109
            DPLED+CKTNP D+ECKV+E
Sbjct  428  DPLEDFCKTNPADEECKVYE  447



>ref|XP_004500847.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Cicer arietinum]
Length=525

 Score =   187 bits (476),  Expect(2) = 7e-85, Method: Compositional matrix adjust.
 Identities = 127/138 (92%), Positives = 136/138 (99%), Gaps = 0/138 (0%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPFVK++DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  308  ISNASCTTNCLAPFVKILDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  367

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLV+NV KKG++AEDVNAAFRKA+
Sbjct  368  PTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVINVAKKGISAEDVNAAFRKAA  427

Query  401  DGPLKGVLDVCDAPLVSL  348
            +GPLKGVLDVCD PLVS+
Sbjct  428  EGPLKGVLDVCDLPLVSV  445


 Score =   154 bits (389),  Expect(2) = 7e-85, Method: Compositional matrix adjust.
 Identities = 70/85 (82%), Positives = 75/85 (88%), Gaps = 0/85 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVA  184
            P    DFRC+DVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVA+KWPG  
Sbjct  441  PLVSVDFRCTDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVANKWPGTP  500

Query  183  VAGSGDPLEDYCKTNPGDKECKVFE  109
              GSGDPLED+C+TNP D ECKV+E
Sbjct  501  QKGSGDPLEDFCETNPADDECKVYE  525



>emb|CBL43264.1| glyceraldehyde-3-phosphate dehydrogenase [Solanum tuberosum]
Length=450

 Score =   184 bits (468),  Expect(2) = 8e-85, Method: Compositional matrix adjust.
 Identities = 126/138 (91%), Positives = 134/138 (97%), Gaps = 0/138 (0%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            VSNASCTTNCLAPF K++DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  233  VSNASCTTNCLAPFAKILDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  292

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLV+NV+KKGL+AEDVNAAFRKA+
Sbjct  293  PTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVINVEKKGLSAEDVNAAFRKAA  352

Query  401  DGPLKGVLDVCDAPLVSL  348
            DGPL G+L VCD PLVS+
Sbjct  353  DGPLNGILAVCDEPLVSV  370


 Score =   157 bits (397),  Expect(2) = 8e-85, Method: Compositional matrix adjust.
 Identities = 72/85 (85%), Positives = 76/85 (89%), Gaps = 0/85 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVA  184
            P    DFRCSDVS+TIDSSLTMVMGDDMVK+VAWYDNEWGYSQRVVDLAHLVA+KWPG A
Sbjct  366  PLVSVDFRCSDVSTTIDSSLTMVMGDDMVKIVAWYDNEWGYSQRVVDLAHLVANKWPGSA  425

Query  183  VAGSGDPLEDYCKTNPGDKECKVFE  109
              GSGD LEDYCKTNP DKECKV+E
Sbjct  426  AEGSGDALEDYCKTNPADKECKVYE  450



>sp|P12859.2|G3PB_PEA RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic; 
AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase subunit B; Flags: Precursor [Pisum sativum]
 gb|AAA84543.1| glyceraldehyde-3-phosphate dehydrogenase B subunit [Pisum sativum]
Length=451

 Score =   186 bits (472),  Expect(2) = 1e-84, Method: Compositional matrix adjust.
 Identities = 127/138 (92%), Positives = 135/138 (98%), Gaps = 0/138 (0%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPF KV+DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  234  ISNASCTTNCLAPFAKVLDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  293

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV KKG++AEDVNAAFRKA+
Sbjct  294  PTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVAKKGISAEDVNAAFRKAA  353

Query  401  DGPLKGVLDVCDAPLVSL  348
            +GPLKG+LDVCD PLVS+
Sbjct  354  EGPLKGILDVCDVPLVSV  371


 Score =   154 bits (390),  Expect(2) = 1e-84, Method: Compositional matrix adjust.
 Identities = 70/85 (82%), Positives = 76/85 (89%), Gaps = 0/85 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVA  184
            P    DFRCSDVS+TIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVA+KWPG  
Sbjct  367  PLVSVDFRCSDVSTTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVANKWPGTP  426

Query  183  VAGSGDPLEDYCKTNPGDKECKVFE  109
              GSGDPLED+C+TNP D+ECKV+E
Sbjct  427  KVGSGDPLEDFCETNPADEECKVYE  451



>ref|XP_006342537.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Solanum tuberosum]
Length=450

 Score =   182 bits (462),  Expect(2) = 2e-84, Method: Compositional matrix adjust.
 Identities = 125/138 (91%), Positives = 133/138 (96%), Gaps = 0/138 (0%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            VSNASCTTNCLAPF K++DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  233  VSNASCTTNCLAPFAKILDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  292

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLV+NV KKG++AEDVNAAFRKA+
Sbjct  293  PTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVINVAKKGISAEDVNAAFRKAA  352

Query  401  DGPLKGVLDVCDAPLVSL  348
            DGPL G+L VCD PLVS+
Sbjct  353  DGPLNGILAVCDEPLVSV  370


 Score =   158 bits (400),  Expect(2) = 2e-84, Method: Compositional matrix adjust.
 Identities = 73/85 (86%), Positives = 76/85 (89%), Gaps = 0/85 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVA  184
            P    DFRCSDVS+TIDSSLTMVMGDDMVK+VAWYDNEWGYSQRVVDLAHLVASKWPG A
Sbjct  366  PLVSVDFRCSDVSTTIDSSLTMVMGDDMVKIVAWYDNEWGYSQRVVDLAHLVASKWPGSA  425

Query  183  VAGSGDPLEDYCKTNPGDKECKVFE  109
              GSGD LEDYCKTNP DKECKV+E
Sbjct  426  AEGSGDALEDYCKTNPADKECKVYE  450



>gb|AES74101.2| glyceraldehyde-3-phosphate dehydrogenase B [Medicago truncatula]
Length=317

 Score =   187 bits (474),  Expect(2) = 2e-84, Method: Compositional matrix adjust.
 Identities = 128/138 (93%), Positives = 136/138 (99%), Gaps = 0/138 (0%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPFVK++DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  100  ISNASCTTNCLAPFVKILDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  159

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV KKG++AEDVNAAFRKA+
Sbjct  160  PTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVAKKGISAEDVNAAFRKAA  219

Query  401  DGPLKGVLDVCDAPLVSL  348
            +GPLKGVLDVCD PLVS+
Sbjct  220  EGPLKGVLDVCDVPLVSV  237


 Score =   153 bits (387),  Expect(2) = 2e-84, Method: Compositional matrix adjust.
 Identities = 71/85 (84%), Positives = 75/85 (88%), Gaps = 0/85 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVA  184
            P    DFRC+DVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVA+KWPG  
Sbjct  233  PLVSVDFRCTDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVANKWPGTP  292

Query  183  VAGSGDPLEDYCKTNPGDKECKVFE  109
             AGSGDPLED+C+TNP   ECKVFE
Sbjct  293  QAGSGDPLEDFCETNPSTDECKVFE  317



>gb|AIU56855.1| glyceraldehyde-3-phosphate dehydrogenase B, partial [Brassica 
rapa subsp. chinensis]
Length=367

 Score =   184 bits (466),  Expect(2) = 2e-84, Method: Compositional matrix adjust.
 Identities = 127/137 (93%), Positives = 133/137 (97%), Gaps = 0/137 (0%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPF KV+DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  150  ISNASCTTNCLAPFAKVLDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  209

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLV+NV+KKGLTAEDVN AFRKA+
Sbjct  210  PTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVINVEKKGLTAEDVNEAFRKAA  269

Query  401  DGPLKGVLDVCDAPLVS  351
             GPLKGVL+VCD PLVS
Sbjct  270  AGPLKGVLEVCDTPLVS  286


 Score =   156 bits (395),  Expect(2) = 2e-84, Method: Compositional matrix adjust.
 Identities = 72/85 (85%), Positives = 77/85 (91%), Gaps = 0/85 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVA  184
            P    DFRCSDVS+TIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVA+KWPG  
Sbjct  283  PLVSCDFRCSDVSTTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVAAKWPGEV  342

Query  183  VAGSGDPLEDYCKTNPGDKECKVFE  109
             AGSGDPLED+CKTNP D+ECKV+E
Sbjct  343  AAGSGDPLEDFCKTNPADEECKVYE  367



>ref|XP_009362872.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
isoform X2 [Pyrus x bretschneideri]
Length=450

 Score =   186 bits (472),  Expect(2) = 3e-84, Method: Compositional matrix adjust.
 Identities = 128/138 (93%), Positives = 135/138 (98%), Gaps = 0/138 (0%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            VSNASCTTNCLAPFVKV+DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  234  VSNASCTTNCLAPFVKVLDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  293

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLV+NV KKG++AEDVNAAFRKA+
Sbjct  294  PTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVINVAKKGISAEDVNAAFRKAA  353

Query  401  DGPLKGVLDVCDAPLVSL  348
            DGPLKG+L VCD PLVS+
Sbjct  354  DGPLKGILAVCDVPLVSV  371


 Score =   154 bits (388),  Expect(2) = 3e-84, Method: Compositional matrix adjust.
 Identities = 73/86 (85%), Positives = 77/86 (90%), Gaps = 2/86 (2%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVA  184
            P    DFRC+DVSSTIDSSLTMVMGDDMVKVVAWYDNEWGY  RVVDLAHLVASKWPG A
Sbjct  367  PLVSVDFRCTDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGY--RVVDLAHLVASKWPGTA  424

Query  183  VAGSGDPLEDYCKTNPGDKECKVFEA  106
             AGSGDPLED+CKTNP D+ECKV+EA
Sbjct  425  QAGSGDPLEDFCKTNPADEECKVYEA  450



>ref|XP_004253122.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Solanum lycopersicum]
Length=450

 Score =   184 bits (466),  Expect(2) = 3e-84, Method: Compositional matrix adjust.
 Identities = 125/138 (91%), Positives = 134/138 (97%), Gaps = 0/138 (0%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            VSNASCTTNCLAPF K++DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  233  VSNASCTTNCLAPFAKILDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  292

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLV+NV+KKG++AEDVNAAFRKA+
Sbjct  293  PTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVINVEKKGISAEDVNAAFRKAA  352

Query  401  DGPLKGVLDVCDAPLVSL  348
            DGPL G+L VCD PLVS+
Sbjct  353  DGPLNGILAVCDEPLVSV  370


 Score =   156 bits (394),  Expect(2) = 3e-84, Method: Compositional matrix adjust.
 Identities = 72/85 (85%), Positives = 75/85 (88%), Gaps = 0/85 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVA  184
            P    DFRCSDVS+TIDSSLTMVMGDDMVK+VAWYDNEWGYSQRVVDLAHLVA KWPG A
Sbjct  366  PLVSVDFRCSDVSTTIDSSLTMVMGDDMVKIVAWYDNEWGYSQRVVDLAHLVADKWPGSA  425

Query  183  VAGSGDPLEDYCKTNPGDKECKVFE  109
              GSGD LEDYCKTNP DKECKV+E
Sbjct  426  AEGSGDALEDYCKTNPADKECKVYE  450



>gb|ACJ84309.1| unknown [Medicago truncatula]
 gb|AFK44245.1| unknown [Medicago truncatula]
Length=451

 Score =   188 bits (477),  Expect(2) = 4e-84, Method: Compositional matrix adjust.
 Identities = 128/138 (93%), Positives = 136/138 (99%), Gaps = 0/138 (0%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPFVK++DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  234  ISNASCTTNCLAPFVKILDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  293

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV KKG++AEDVNAAFRKA+
Sbjct  294  PTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVAKKGISAEDVNAAFRKAA  353

Query  401  DGPLKGVLDVCDAPLVSL  348
            +GPLKGVLDVCD PLVS+
Sbjct  354  EGPLKGVLDVCDVPLVSV  371


 Score =   151 bits (381),  Expect(2) = 4e-84, Method: Compositional matrix adjust.
 Identities = 70/85 (82%), Positives = 74/85 (87%), Gaps = 0/85 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVA  184
            P    DFRC+DVSSTIDSSLTMVMGDDMVKVVAWYDNEW YSQRVVDLAHLVA+KWPG  
Sbjct  367  PLVSVDFRCTDVSSTIDSSLTMVMGDDMVKVVAWYDNEWDYSQRVVDLAHLVANKWPGTP  426

Query  183  VAGSGDPLEDYCKTNPGDKECKVFE  109
             AGSGDPLED+C+TNP   ECKVFE
Sbjct  427  QAGSGDPLEDFCETNPSTDECKVFE  451



>gb|EPS70760.1| hypothetical protein M569_03997, partial [Genlisea aurea]
Length=440

 Score =   186 bits (473),  Expect(2) = 5e-84, Method: Compositional matrix adjust.
 Identities = 127/138 (92%), Positives = 136/138 (99%), Gaps = 0/138 (0%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPFVKV+DEEFGI KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  222  ISNASCTTNCLAPFVKVLDEEFGIEKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  281

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKG+ AED+N+AFRKA+
Sbjct  282  PTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGIAAEDINSAFRKAA  341

Query  401  DGPLKGVLDVCDAPLVSL  348
            +GPLKGVLDVCDAPLVS+
Sbjct  342  EGPLKGVLDVCDAPLVSV  359


 Score =   152 bits (384),  Expect(2) = 5e-84, Method: Compositional matrix adjust.
 Identities = 72/87 (83%), Positives = 77/87 (89%), Gaps = 1/87 (1%)
 Frame = -3

Query  366  CPSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGV  187
             P    DFRC+DVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVA+KWPG 
Sbjct  354  APLVSVDFRCTDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVANKWPGA  413

Query  186  AVA-GSGDPLEDYCKTNPGDKECKVFE  109
              A GSGDPLEDYCKT+P D+ECKV+E
Sbjct  414  TPAEGSGDPLEDYCKTSPADEECKVYE  440



>ref|XP_004145550.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Cucumis sativus]
 ref|XP_004157068.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Cucumis sativus]
 gb|KGN55522.1| hypothetical protein Csa_4G664300 [Cucumis sativus]
Length=451

 Score =   186 bits (471),  Expect(2) = 2e-83, Method: Compositional matrix adjust.
 Identities = 127/138 (92%), Positives = 136/138 (99%), Gaps = 0/138 (0%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            VSNASCTTNCLAPFVK++DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  233  VSNASCTTNCLAPFVKIIDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  292

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVN++KKG++A+DVNAAFRKA+
Sbjct  293  PTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNIEKKGISADDVNAAFRKAA  352

Query  401  DGPLKGVLDVCDAPLVSL  348
            DGPLKGVL VCD PLVS+
Sbjct  353  DGPLKGVLAVCDIPLVSV  370


 Score =   151 bits (382),  Expect(2) = 2e-83, Method: Compositional matrix adjust.
 Identities = 68/86 (79%), Positives = 75/86 (87%), Gaps = 0/86 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVA  184
            P    DF+C+DVSSTIDSSLTMVMGDDM+KVVAWYDNEWGYSQRVVDLAHLVA KWPG  
Sbjct  366  PLVSVDFKCTDVSSTIDSSLTMVMGDDMLKVVAWYDNEWGYSQRVVDLAHLVADKWPGAG  425

Query  183  VAGSGDPLEDYCKTNPGDKECKVFEA  106
               SGDPLED+C+TNP D+ECKV+EA
Sbjct  426  SGKSGDPLEDFCQTNPADEECKVYEA  451



>ref|XP_008452997.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
isoform X1 [Cucumis melo]
Length=452

 Score =   185 bits (470),  Expect(2) = 2e-83, Method: Compositional matrix adjust.
 Identities = 126/138 (91%), Positives = 136/138 (99%), Gaps = 0/138 (0%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPFVK++DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  234  ISNASCTTNCLAPFVKIIDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  293

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVN++KKG++A+DVNAAFRKA+
Sbjct  294  PTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNIEKKGISADDVNAAFRKAA  353

Query  401  DGPLKGVLDVCDAPLVSL  348
            DGPLKGVL VCD PLVS+
Sbjct  354  DGPLKGVLAVCDIPLVSV  371


 Score =   152 bits (383),  Expect(2) = 2e-83, Method: Compositional matrix adjust.
 Identities = 68/86 (79%), Positives = 76/86 (88%), Gaps = 0/86 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVA  184
            P    DF+C+DVSSTIDSSLTMVMGDDM+KVVAWYDNEWGYSQRVVDLAHLVA+KWPG  
Sbjct  367  PLVSVDFKCTDVSSTIDSSLTMVMGDDMLKVVAWYDNEWGYSQRVVDLAHLVATKWPGAG  426

Query  183  VAGSGDPLEDYCKTNPGDKECKVFEA  106
               SGDPLED+C+TNP D+ECKV+EA
Sbjct  427  SGKSGDPLEDFCQTNPADEECKVYEA  452



>ref|XP_008452998.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
isoform X2 [Cucumis melo]
Length=451

 Score =   185 bits (470),  Expect(2) = 2e-83, Method: Compositional matrix adjust.
 Identities = 126/138 (91%), Positives = 136/138 (99%), Gaps = 0/138 (0%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPFVK++DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  233  ISNASCTTNCLAPFVKIIDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  292

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVN++KKG++A+DVNAAFRKA+
Sbjct  293  PTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNIEKKGISADDVNAAFRKAA  352

Query  401  DGPLKGVLDVCDAPLVSL  348
            DGPLKGVL VCD PLVS+
Sbjct  353  DGPLKGVLAVCDIPLVSV  370


 Score =   152 bits (383),  Expect(2) = 2e-83, Method: Compositional matrix adjust.
 Identities = 68/86 (79%), Positives = 76/86 (88%), Gaps = 0/86 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVA  184
            P    DF+C+DVSSTIDSSLTMVMGDDM+KVVAWYDNEWGYSQRVVDLAHLVA+KWPG  
Sbjct  366  PLVSVDFKCTDVSSTIDSSLTMVMGDDMLKVVAWYDNEWGYSQRVVDLAHLVATKWPGAG  425

Query  183  VAGSGDPLEDYCKTNPGDKECKVFEA  106
               SGDPLED+C+TNP D+ECKV+EA
Sbjct  426  SGKSGDPLEDFCQTNPADEECKVYEA  451



>emb|CAA33262.1| unnamed protein product [Pisum sativum]
Length=447

 Score =   182 bits (463),  Expect(2) = 2e-83, Method: Compositional matrix adjust.
 Identities = 126/138 (91%), Positives = 134/138 (97%), Gaps = 0/138 (0%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPF KV+DEE GIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  230  ISNASCTTNCLAPFAKVLDEESGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  289

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV KKG++AEDVNAAFRKA+
Sbjct  290  PTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVAKKGISAEDVNAAFRKAA  349

Query  401  DGPLKGVLDVCDAPLVSL  348
            +GPLKG+LDVCD PLVS+
Sbjct  350  EGPLKGILDVCDVPLVSV  367


 Score =   154 bits (390),  Expect(2) = 2e-83, Method: Compositional matrix adjust.
 Identities = 70/85 (82%), Positives = 76/85 (89%), Gaps = 0/85 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVA  184
            P    DFRCSDVS+TIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVA+KWPG  
Sbjct  363  PLVSVDFRCSDVSTTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVANKWPGTP  422

Query  183  VAGSGDPLEDYCKTNPGDKECKVFE  109
              GSGDPLED+C+TNP D+ECKV+E
Sbjct  423  KVGSGDPLEDFCETNPADEECKVYE  447



>dbj|BAJ86633.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=444

 Score =   186 bits (471),  Expect(2) = 4e-83, Method: Compositional matrix adjust.
 Identities = 124/138 (90%), Positives = 132/138 (96%), Gaps = 0/138 (0%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPF KV+DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAA LNIV
Sbjct  226  ISNASCTTNCLAPFAKVLDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAELNIV  285

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLV+N  K G+TA+DVNAAFRKA+
Sbjct  286  PTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVINTVKTGITADDVNAAFRKAA  345

Query  401  DGPLKGVLDVCDAPLVSL  348
            DGPLKG+LDVCD PLVS+
Sbjct  346  DGPLKGILDVCDEPLVSV  363


 Score =   150 bits (379),  Expect(2) = 4e-83, Method: Compositional matrix adjust.
 Identities = 68/85 (80%), Positives = 74/85 (87%), Gaps = 0/85 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVA  184
            P    DFRCSDVS++ID+SLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVA+KWPG  
Sbjct  359  PLVSVDFRCSDVSTSIDASLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVAAKWPGAG  418

Query  183  VAGSGDPLEDYCKTNPGDKECKVFE  109
              GSGDPLEDYCKT+P   ECKVF+
Sbjct  419  TGGSGDPLEDYCKTDPNAVECKVFD  443



>ref|XP_002981126.1| hypothetical protein SELMODRAFT_271457 [Selaginella moellendorffii]
 gb|EFJ17827.1| hypothetical protein SELMODRAFT_271457 [Selaginella moellendorffii]
Length=431

 Score =   189 bits (480),  Expect(2) = 5e-83, Method: Compositional matrix adjust.
 Identities = 131/138 (95%), Positives = 135/138 (98%), Gaps = 0/138 (0%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  213  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  272

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV KKG+TAEDVNAAFRKA+
Sbjct  273  PTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVDKKGMTAEDVNAAFRKAA  332

Query  401  DGPLKGVLDVCDAPLVSL  348
            DGPLKG+L VCD PLVS+
Sbjct  333  DGPLKGILAVCDIPLVSV  350


 Score =   146 bits (369),  Expect(2) = 5e-83, Method: Compositional matrix adjust.
 Identities = 68/86 (79%), Positives = 75/86 (87%), Gaps = 0/86 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVA  184
            P    DFRCSDVSST+D+SLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVA KWPG A
Sbjct  346  PLVSVDFRCSDVSSTVDASLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVAEKWPGGA  405

Query  183  VAGSGDPLEDYCKTNPGDKECKVFEA  106
             A SGDPL+++CKTNP   ECKV++A
Sbjct  406  PAPSGDPLDEFCKTNPDTDECKVYDA  431



>ref|XP_002982608.1| hypothetical protein SELMODRAFT_179517 [Selaginella moellendorffii]
 gb|EFJ16361.1| hypothetical protein SELMODRAFT_179517 [Selaginella moellendorffii]
Length=431

 Score =   189 bits (480),  Expect(2) = 5e-83, Method: Compositional matrix adjust.
 Identities = 131/138 (95%), Positives = 135/138 (98%), Gaps = 0/138 (0%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  213  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  272

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV KKG+TAEDVNAAFRKA+
Sbjct  273  PTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVDKKGMTAEDVNAAFRKAA  332

Query  401  DGPLKGVLDVCDAPLVSL  348
            DGPLKG+L VCD PLVS+
Sbjct  333  DGPLKGILAVCDIPLVSV  350


 Score =   146 bits (369),  Expect(2) = 5e-83, Method: Compositional matrix adjust.
 Identities = 67/86 (78%), Positives = 75/86 (87%), Gaps = 0/86 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVA  184
            P    DFRCSDVSST+D+SLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVA KWPG A
Sbjct  346  PLVSVDFRCSDVSSTVDASLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVADKWPGGA  405

Query  183  VAGSGDPLEDYCKTNPGDKECKVFEA  106
             A SGDPL+++CKTNP   EC+V++A
Sbjct  406  AAPSGDPLDEFCKTNPDTDECRVYDA  431



>ref|XP_006649326.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Oryza brachyantha]
Length=444

 Score =   181 bits (458),  Expect(2) = 6e-83, Method: Compositional matrix adjust.
 Identities = 122/138 (88%), Positives = 132/138 (96%), Gaps = 0/138 (0%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPFVK++DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  226  ISNASCTTNCLAPFVKILDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  285

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAV+LVLPQLKGKLNGIALRVPTPNVSVVDLV+N  K G+TA+DVNAAFRKA+
Sbjct  286  PTSTGAAKAVALVLPQLKGKLNGIALRVPTPNVSVVDLVINTVKTGITADDVNAAFRKAA  345

Query  401  DGPLKGVLDVCDAPLVSL  348
             GPL G+LDVCD PLVS+
Sbjct  346  SGPLNGILDVCDVPLVSV  363


 Score =   155 bits (391),  Expect(2) = 6e-83, Method: Compositional matrix adjust.
 Identities = 72/85 (85%), Positives = 75/85 (88%), Gaps = 0/85 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVA  184
            P    DFRCSDVSSTID+SLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVA
Sbjct  359  PLVSVDFRCSDVSSTIDASLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVA  418

Query  183  VAGSGDPLEDYCKTNPGDKECKVFE  109
              GSGDPLED+CK NP   ECKV+E
Sbjct  419  AQGSGDPLEDFCKDNPETDECKVYE  443



>ref|NP_001048847.1| Os03g0129300 [Oryza sativa Japonica Group]
 dbj|BAA85402.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|AAN17393.1| Putative glyceraldehyde-3-phosphate dehydrogenase [Oryza sativa 
Japonica Group]
 gb|ABF93788.1| Glyceraldehyde-3-phosphate dehydrogenase B, chloroplast precursor, 
putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF10761.1| Os03g0129300 [Oryza sativa Japonica Group]
 gb|EAY88378.1| hypothetical protein OsI_09835 [Oryza sativa Indica Group]
 gb|EAZ25455.1| hypothetical protein OsJ_09272 [Oryza sativa Japonica Group]
Length=444

 Score =   180 bits (457),  Expect(2) = 8e-83, Method: Compositional matrix adjust.
 Identities = 122/138 (88%), Positives = 132/138 (96%), Gaps = 0/138 (0%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPFVK++DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  226  ISNASCTTNCLAPFVKILDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  285

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAV+LVLPQLKGKLNGIALRVPTPNVSVVDLV+N  K G+TA+DVNAAFRKA+
Sbjct  286  PTSTGAAKAVALVLPQLKGKLNGIALRVPTPNVSVVDLVINTVKTGITADDVNAAFRKAA  345

Query  401  DGPLKGVLDVCDAPLVSL  348
             GPL G+LDVCD PLVS+
Sbjct  346  AGPLSGILDVCDVPLVSV  363


 Score =   155 bits (391),  Expect(2) = 8e-83, Method: Compositional matrix adjust.
 Identities = 72/85 (85%), Positives = 75/85 (88%), Gaps = 0/85 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVA  184
            P    DFRCSDVSSTID+SLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPG A
Sbjct  359  PLVSVDFRCSDVSSTIDASLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGAA  418

Query  183  VAGSGDPLEDYCKTNPGDKECKVFE  109
            V GSGDPLED+CK NP   ECKV+E
Sbjct  419  VQGSGDPLEDFCKDNPETDECKVYE  443



>dbj|BAJ87214.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=444

 Score =   185 bits (469),  Expect(2) = 9e-83, Method: Compositional matrix adjust.
 Identities = 125/138 (91%), Positives = 133/138 (96%), Gaps = 0/138 (0%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPF KV+DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  226  ISNASCTTNCLAPFAKVLDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  285

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLV+N  K G+TA+DVNAAFRKA+
Sbjct  286  PTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVINTVKTGITADDVNAAFRKAA  345

Query  401  DGPLKGVLDVCDAPLVSL  348
            DGPLKG+LDVCD PLVS+
Sbjct  346  DGPLKGILDVCDEPLVSV  363


 Score =   150 bits (378),  Expect(2) = 9e-83, Method: Compositional matrix adjust.
 Identities = 68/85 (80%), Positives = 74/85 (87%), Gaps = 0/85 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVA  184
            P    DFRCSDVS++ID+SLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVA+KWPG  
Sbjct  359  PLVSVDFRCSDVSTSIDASLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVAAKWPGAG  418

Query  183  VAGSGDPLEDYCKTNPGDKECKVFE  109
              GSGDPLEDYCKT+P   ECKVF+
Sbjct  419  TGGSGDPLEDYCKTDPNAVECKVFD  443



>gb|EMS49604.1| Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic [Triticum 
urartu]
Length=444

 Score =   184 bits (468),  Expect(2) = 9e-83, Method: Compositional matrix adjust.
 Identities = 125/138 (91%), Positives = 133/138 (96%), Gaps = 0/138 (0%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            VSNASCTTNCLAPF K++DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  226  VSNASCTTNCLAPFAKILDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  285

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLV+N  K G+TA+DVNAAFRKA+
Sbjct  286  PTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVINTVKTGITADDVNAAFRKAA  345

Query  401  DGPLKGVLDVCDAPLVSL  348
            DGPLKG+LDVCD PLVS+
Sbjct  346  DGPLKGILDVCDEPLVSV  363


 Score =   150 bits (378),  Expect(2) = 9e-83, Method: Compositional matrix adjust.
 Identities = 68/85 (80%), Positives = 74/85 (87%), Gaps = 0/85 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVA  184
            P    DFRCSDVS++ID+SLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVA+KWPG  
Sbjct  359  PLVSVDFRCSDVSTSIDASLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVAAKWPGAG  418

Query  183  VAGSGDPLEDYCKTNPGDKECKVFE  109
              GSGDPLEDYCKT+P   ECKVF+
Sbjct  419  TGGSGDPLEDYCKTDPNAVECKVFD  443



>gb|ABF93789.1| Glyceraldehyde-3-phosphate dehydrogenase B, chloroplast precursor, 
putative, expressed [Oryza sativa Japonica Group]
 dbj|BAG90581.1| unnamed protein product [Oryza sativa Japonica Group]
Length=318

 Score =   179 bits (455),  Expect(2) = 2e-82, Method: Compositional matrix adjust.
 Identities = 122/138 (88%), Positives = 132/138 (96%), Gaps = 0/138 (0%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPFVK++DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  100  ISNASCTTNCLAPFVKILDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  159

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAV+LVLPQLKGKLNGIALRVPTPNVSVVDLV+N  K G+TA+DVNAAFRKA+
Sbjct  160  PTSTGAAKAVALVLPQLKGKLNGIALRVPTPNVSVVDLVINTVKTGITADDVNAAFRKAA  219

Query  401  DGPLKGVLDVCDAPLVSL  348
             GPL G+LDVCD PLVS+
Sbjct  220  AGPLSGILDVCDVPLVSV  237


 Score =   154 bits (389),  Expect(2) = 2e-82, Method: Compositional matrix adjust.
 Identities = 72/85 (85%), Positives = 75/85 (88%), Gaps = 0/85 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVA  184
            P    DFRCSDVSSTID+SLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPG A
Sbjct  233  PLVSVDFRCSDVSSTIDASLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGAA  292

Query  183  VAGSGDPLEDYCKTNPGDKECKVFE  109
            V GSGDPLED+CK NP   ECKV+E
Sbjct  293  VQGSGDPLEDFCKDNPETDECKVYE  317



>ref|XP_010061201.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPB, chloroplastic 
[Eucalyptus grandis]
 gb|KCW68119.1| hypothetical protein EUGRSUZ_F01793 [Eucalyptus grandis]
Length=454

 Score =   182 bits (463),  Expect(2) = 3e-82, Method: Compositional matrix adjust.
 Identities = 127/138 (92%), Positives = 135/138 (98%), Gaps = 0/138 (0%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPFVKV+DE+FGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  235  ISNASCTTNCLAPFVKVLDEKFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  294

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKGLTAEDVNAAFR A+
Sbjct  295  PTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGLTAEDVNAAFRDAA  354

Query  401  DGPLKGVLDVCDAPLVSL  348
            +GPLKG+L VCD PLVS+
Sbjct  355  EGPLKGILAVCDDPLVSV  372


 Score =   150 bits (379),  Expect(2) = 3e-82, Method: Compositional matrix adjust.
 Identities = 70/86 (81%), Positives = 76/86 (88%), Gaps = 1/86 (1%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVA  184
            P    DFRCSDVSSTIDSSL+MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVA KWPG+ 
Sbjct  368  PLVSVDFRCSDVSSTIDSSLSMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVAVKWPGIE  427

Query  183  VAGS-GDPLEDYCKTNPGDKECKVFE  109
            + GS GDPLED+CK NP D+ECKV+E
Sbjct  428  IPGSTGDPLEDFCKKNPADEECKVYE  453



>ref|XP_010686856.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Beta vulgaris subsp. vulgaris]
Length=451

 Score =   183 bits (465),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 126/138 (91%), Positives = 134/138 (97%), Gaps = 0/138 (0%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPFVK+MDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  233  ISNASCTTNCLAPFVKIMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  292

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVN++KKG+TAEDVN AFRKA+
Sbjct  293  PTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNIEKKGITAEDVNNAFRKAA  352

Query  401  DGPLKGVLDVCDAPLVSL  348
             GP KGVL+VCD PLVS+
Sbjct  353  AGPSKGVLEVCDIPLVSV  370


 Score =   148 bits (373),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 70/86 (81%), Positives = 76/86 (88%), Gaps = 1/86 (1%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVA  184
            P    DFRC+DVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVA+KWPG+ 
Sbjct  366  PLVSVDFRCTDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVANKWPGME  425

Query  183  VA-GSGDPLEDYCKTNPGDKECKVFE  109
             A  SGDPLED+CK NP D+ECKV+E
Sbjct  426  GAISSGDPLEDFCKDNPADEECKVYE  451



>ref|XP_006855683.1| hypothetical protein AMTR_s00044p00131190 [Amborella trichopoda]
 gb|ERN17150.1| hypothetical protein AMTR_s00044p00131190 [Amborella trichopoda]
Length=413

 Score =   187 bits (475),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 129/138 (93%), Positives = 136/138 (99%), Gaps = 0/138 (0%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  196  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  255

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAVSLVLP+LKGKLNGIALRVPTPNVSVVDLVVNV+KKGLTAEDVNAAFRK++
Sbjct  256  PTSTGAAKAVSLVLPKLKGKLNGIALRVPTPNVSVVDLVVNVEKKGLTAEDVNAAFRKSA  315

Query  401  DGPLKGVLDVCDAPLVSL  348
            +GPLKG+L VCD PLVS+
Sbjct  316  EGPLKGILAVCDVPLVSV  333


 Score =   143 bits (361),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 69/86 (80%), Positives = 75/86 (87%), Gaps = 1/86 (1%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVA  184
            P    DFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW G A
Sbjct  329  PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWSGAA  388

Query  183  VAGSGDPLEDYCKTNPGDKECKVFEA  106
             +G GDPLE++C+T+P   ECKV+EA
Sbjct  389  KSG-GDPLEEFCQTSPETVECKVYEA  413



>ref|XP_003558903.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Brachypodium distachyon]
Length=446

 Score =   177 bits (450),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 123/138 (89%), Positives = 131/138 (95%), Gaps = 0/138 (0%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            VSNAS TTNCLAPFVKV+DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  229  VSNASWTTNCLAPFVKVLDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  288

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAV+LVLPQLKGKLNGIALRVPTPNVSVVDLV+N  K G+TA+DVNAAFRKA+
Sbjct  289  PTSTGAAKAVALVLPQLKGKLNGIALRVPTPNVSVVDLVINTAKTGITADDVNAAFRKAA  348

Query  401  DGPLKGVLDVCDAPLVSL  348
             GPL G+LDVCD PLVS+
Sbjct  349  AGPLNGILDVCDEPLVSV  366


 Score =   153 bits (386),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 71/85 (84%), Positives = 75/85 (88%), Gaps = 0/85 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVA  184
            P    DFRCSDVSSTID+SLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPG  
Sbjct  362  PLVSVDFRCSDVSSTIDASLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGSE  421

Query  183  VAGSGDPLEDYCKTNPGDKECKVFE  109
            V G+GDPLEDYCKTNP   ECKV++
Sbjct  422  VKGTGDPLEDYCKTNPETDECKVYD  446



>ref|XP_003603850.1| Glyceraldehyde-3-phosphate dehydrogenase [Medicago truncatula]
Length=490

 Score =   188 bits (478),  Expect(2) = 2e-78, Method: Compositional matrix adjust.
 Identities = 128/138 (93%), Positives = 136/138 (99%), Gaps = 0/138 (0%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPFVK++DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  234  ISNASCTTNCLAPFVKILDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  293

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV KKG++AEDVNAAFRKA+
Sbjct  294  PTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVAKKGISAEDVNAAFRKAA  353

Query  401  DGPLKGVLDVCDAPLVSL  348
            +GPLKGVLDVCD PLVS+
Sbjct  354  EGPLKGVLDVCDVPLVSV  371


 Score =   132 bits (331),  Expect(2) = 2e-78, Method: Compositional matrix adjust.
 Identities = 69/124 (56%), Positives = 75/124 (60%), Gaps = 39/124 (31%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWG--------------------  244
            P    DFRC+DVSSTIDSSLTMVMGDDMVKVVAWYDNEWG                    
Sbjct  367  PLVSVDFRCTDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGAHFVWAFSLMFLFSGRGYWQ  426

Query  243  -------------------YSQRVVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKEC  121
                               ++QRVVDLAHLVA+KWPG   AGSGDPLED+C+TNP   EC
Sbjct  427  ELIESIVWAHNKLKYKVCFHNQRVVDLAHLVANKWPGTPQAGSGDPLEDFCETNPSTDEC  486

Query  120  KVFE  109
            KVFE
Sbjct  487  KVFE  490



>sp|P12860.1|G3PB_SPIOL RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic; 
AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase subunit B; Flags: Precursor [Spinacia oleracea]
 emb|CAA33263.1| unnamed protein product [Spinacia oleracea]
 gb|AAD10218.1| NADP-dependent glyceraldehydephosphate dehydrogenase subunit 
B [Spinacia oleracea]
Length=451

 Score =   181 bits (458),  Expect(2) = 3e-78, Method: Compositional matrix adjust.
 Identities = 126/138 (91%), Positives = 133/138 (96%), Gaps = 0/138 (0%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPFVKV+DEE GIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  233  ISNASCTTNCLAPFVKVLDEELGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  292

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVN++K G+TAEDVN AFRKA+
Sbjct  293  PTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNIEKVGVTAEDVNNAFRKAA  352

Query  401  DGPLKGVLDVCDAPLVSL  348
             GPLKGVLDVCD PLVS+
Sbjct  353  AGPLKGVLDVCDIPLVSV  370


 Score =   139 bits (350),  Expect(2) = 3e-78, Method: Compositional matrix adjust.
 Identities = 66/86 (77%), Positives = 72/86 (84%), Gaps = 1/86 (1%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGV-  187
            P    DFRCSD SSTIDSSLTMVMG DMVKVVAWYDNEWGYSQRVVDLA LVA+KWPG+ 
Sbjct  366  PLVSVDFRCSDFSSTIDSSLTMVMGGDMVKVVAWYDNEWGYSQRVVDLADLVANKWPGLE  425

Query  186  AVAGSGDPLEDYCKTNPGDKECKVFE  109
                SGDPLED+CK NP D+ECK++E
Sbjct  426  GSVASGDPLEDFCKDNPADEECKLYE  451



>pdb|2PKQ|O Chain O, Crystal Structure Of The Photosynthetic A2b2-glyceraldehyde-3- 
Phosphate Dehydrogenase, Complexed With Nadp
 pdb|2PKQ|Q Chain Q, Crystal Structure Of The Photosynthetic A2b2-glyceraldehyde-3- 
Phosphate Dehydrogenase, Complexed With Nadp
 pdb|2PKQ|T Chain T, Crystal Structure Of The Photosynthetic A2b2-glyceraldehyde-3- 
Phosphate Dehydrogenase, Complexed With Nadp
Length=368

 Score =   180 bits (456),  Expect(2) = 9e-78, Method: Compositional matrix adjust.
 Identities = 126/138 (91%), Positives = 133/138 (96%), Gaps = 0/138 (0%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPFVKV+DEE GIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  150  ISNASCTTNCLAPFVKVLDEELGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  209

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVN++K G+TAEDVN AFRKA+
Sbjct  210  PTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNIEKVGVTAEDVNNAFRKAA  269

Query  401  DGPLKGVLDVCDAPLVSL  348
             GPLKGVLDVCD PLVS+
Sbjct  270  AGPLKGVLDVCDIPLVSV  287


 Score =   138 bits (347),  Expect(2) = 9e-78, Method: Compositional matrix adjust.
 Identities = 66/86 (77%), Positives = 72/86 (84%), Gaps = 1/86 (1%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGV-  187
            P    DFRCSD SSTIDSSLTMVMG DMVKVVAWYDNEWGYSQRVVDLA LVA+KWPG+ 
Sbjct  283  PLVSVDFRCSDFSSTIDSSLTMVMGGDMVKVVAWYDNEWGYSQRVVDLADLVANKWPGLE  342

Query  186  AVAGSGDPLEDYCKTNPGDKECKVFE  109
                SGDPLED+CK NP D+ECK++E
Sbjct  343  GSVASGDPLEDFCKDNPADEECKLYE  368



>emb|CAC80378.2| glyceraldehyde-3-phosphate dehydrogenase [Chara vulgaris]
Length=480

 Score =   176 bits (447),  Expect(2) = 9e-77, Method: Compositional matrix adjust.
 Identities = 124/138 (90%), Positives = 133/138 (96%), Gaps = 0/138 (0%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPFVKV+DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  260  ISNASCTTNCLAPFVKVLDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  319

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PT+TGAAKAV+LVLP+LKGKLNGIALRVPTPNVSVVDLVVNV+ KG TAEDVN AFRKA+
Sbjct  320  PTTTGAAKAVALVLPKLKGKLNGIALRVPTPNVSVVDLVVNVENKGCTAEDVNDAFRKAA  379

Query  401  DGPLKGVLDVCDAPLVSL  348
            +GPLKGVL VCD PLVS+
Sbjct  380  NGPLKGVLAVCDEPLVSV  397


 Score =   138 bits (348),  Expect(2) = 9e-77, Method: Compositional matrix adjust.
 Identities = 66/88 (75%), Positives = 72/88 (82%), Gaps = 3/88 (3%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVA  184
            P    DFRC+DVSST+DSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVA+KWPG  
Sbjct  393  PLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVAAKWPGAK  452

Query  183  VAGSG---DPLEDYCKTNPGDKECKVFE  109
             A  G   DPL  YC++NP D EC+VFE
Sbjct  453  PAPDGKDADPLGTYCESNPDDAECRVFE  480



>gb|ABK24645.1| unknown [Picea sitchensis]
Length=460

 Score =   184 bits (467),  Expect(2) = 2e-76, Method: Compositional matrix adjust.
 Identities = 127/138 (92%), Positives = 135/138 (98%), Gaps = 0/138 (0%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            VSNASCTTNCLAPFVKV+DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  242  VSNASCTTNCLAPFVKVLDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  301

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PT+TGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKG++AEDVNAAFR A+
Sbjct  302  PTTTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGISAEDVNAAFRSAA  361

Query  401  DGPLKGVLDVCDAPLVSL  348
            DGPLKG+L VCD PLVS+
Sbjct  362  DGPLKGILAVCDVPLVSV  379


 Score =   129 bits (325),  Expect(2) = 2e-76, Method: Compositional matrix adjust.
 Identities = 67/86 (78%), Positives = 74/86 (86%), Gaps = 0/86 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVA  184
            P    DFRCSDVSST+DSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVA+KWPG  
Sbjct  375  PLVSVDFRCSDVSSTVDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVAAKWPGAG  434

Query  183  VAGSGDPLEDYCKTNPGDKECKVFEA  106
              GS DPL+++CKTNP   EC+V+EA
Sbjct  435  KGGSDDPLDEFCKTNPATDECRVYEA  460



>gb|ACN40006.1| unknown [Picea sitchensis]
Length=460

 Score =   184 bits (467),  Expect(2) = 2e-76, Method: Compositional matrix adjust.
 Identities = 127/138 (92%), Positives = 135/138 (98%), Gaps = 0/138 (0%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            VSNASCTTNCLAPFVKV+DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  242  VSNASCTTNCLAPFVKVLDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  301

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PT+TGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKG++AEDVNAAFR A+
Sbjct  302  PTTTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGISAEDVNAAFRSAA  361

Query  401  DGPLKGVLDVCDAPLVSL  348
            DGPLKG+L VCD PLVS+
Sbjct  362  DGPLKGILAVCDVPLVSV  379


 Score =   129 bits (325),  Expect(2) = 2e-76, Method: Compositional matrix adjust.
 Identities = 67/86 (78%), Positives = 74/86 (86%), Gaps = 0/86 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVA  184
            P    DFRCSDVSST+DSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVA+KWPG  
Sbjct  375  PLVSVDFRCSDVSSTVDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVAAKWPGAG  434

Query  183  VAGSGDPLEDYCKTNPGDKECKVFEA  106
              GS DPL+++CKTNP   EC+V+EA
Sbjct  435  KGGSDDPLDEFCKTNPATDECRVYEA  460



>gb|ACN40526.1| unknown [Picea sitchensis]
Length=460

 Score =   184 bits (467),  Expect(2) = 2e-76, Method: Compositional matrix adjust.
 Identities = 127/138 (92%), Positives = 135/138 (98%), Gaps = 0/138 (0%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            VSNASCTTNCLAPFVKV+DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  242  VSNASCTTNCLAPFVKVLDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  301

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PT+TGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKG++AEDVNAAFR A+
Sbjct  302  PTTTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGISAEDVNAAFRSAA  361

Query  401  DGPLKGVLDVCDAPLVSL  348
            DGPLKG+L VCD PLVS+
Sbjct  362  DGPLKGILAVCDVPLVSV  379


 Score =   129 bits (325),  Expect(2) = 2e-76, Method: Compositional matrix adjust.
 Identities = 67/86 (78%), Positives = 74/86 (86%), Gaps = 0/86 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVA  184
            P    DFRCSDVSST+DSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVA+KWPG  
Sbjct  375  PLVSVDFRCSDVSSTVDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVAAKWPGAG  434

Query  183  VAGSGDPLEDYCKTNPGDKECKVFEA  106
              GS DPL+++CKTNP   EC+V+EA
Sbjct  435  KGGSDDPLDEFCKTNPATDECRVYEA  460



>gb|EMT30317.1| Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic [Aegilops 
tauschii]
Length=442

 Score =   185 bits (469),  Expect(2) = 8e-76, Method: Compositional matrix adjust.
 Identities = 125/138 (91%), Positives = 133/138 (96%), Gaps = 0/138 (0%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPF KV+DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  226  ISNASCTTNCLAPFAKVLDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  285

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLV+N  K G+TA+DVNAAFRKA+
Sbjct  286  PTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVINTVKTGITADDVNAAFRKAA  345

Query  401  DGPLKGVLDVCDAPLVSL  348
            DGPLKG+LDVCD PLVS+
Sbjct  346  DGPLKGILDVCDEPLVSV  363


 Score =   126 bits (317),  Expect(2) = 8e-76, Method: Compositional matrix adjust.
 Identities = 63/85 (74%), Positives = 69/85 (81%), Gaps = 2/85 (2%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVA  184
            P    DFRCSDVS++ID+SLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVA+KWPG  
Sbjct  359  PLVSVDFRCSDVSTSIDASLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVAAKWPGAG  418

Query  183  VAGSGDPLEDYCKTNPGDKECKVFE  109
              G     EDYCKT+P   ECKVF+
Sbjct  419  TGGG--GGEDYCKTDPNAVECKVFD  441



>gb|ABD37965.1| glyceraldehyde-3-phosphate dehydrogenase subunit B [Mesostigma 
viride]
Length=415

 Score =   169 bits (428),  Expect(2) = 3e-72, Method: Compositional matrix adjust.
 Identities = 118/138 (86%), Positives = 129/138 (93%), Gaps = 0/138 (0%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPF KV+DE FGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  197  ISNASCTTNCLAPFAKVLDENFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  256

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAVSLVLP+LKGKLNGIALRVPTPNVSVVDLV+N  KKG+TAE+VNAAFRK +
Sbjct  257  PTSTGAAKAVSLVLPKLKGKLNGIALRVPTPNVSVVDLVINTTKKGMTAEEVNAAFRKEA  316

Query  401  DGPLKGVLDVCDAPLVSL  348
            +G +KG+L V D PLVS+
Sbjct  317  NGAMKGILAVSDLPLVSI  334


 Score =   130 bits (328),  Expect(2) = 3e-72, Method: Compositional matrix adjust.
 Identities = 60/85 (71%), Positives = 66/85 (78%), Gaps = 0/85 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVA  184
            P    DFRCSDVS TIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLA +VA+ WPG+ 
Sbjct  330  PLVSIDFRCSDVSCTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLADIVANNWPGMV  389

Query  183  VAGSGDPLEDYCKTNPGDKECKVFE  109
                 DPLE +C TNP   EC+V+ 
Sbjct  390  QETGSDPLETFCNTNPDADECRVYN  414



>pdb|2PKR|O Chain O, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
 pdb|2PKR|R Chain R, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
 pdb|2PKR|P Chain P, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
 pdb|2PKR|Q Chain Q, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
 pdb|2PKR|A Chain A, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
 pdb|2PKR|B Chain B, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
 pdb|2PKR|C Chain C, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
 pdb|2PKR|D Chain D, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
 pdb|2PKR|H Chain H, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
 pdb|2PKR|I Chain I, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
 pdb|2PKR|L Chain L, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
 pdb|2PKR|M Chain M, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
Length=365

 Score =   161 bits (407),  Expect(2) = 5e-72, Method: Compositional matrix adjust.
 Identities = 115/138 (83%), Positives = 127/138 (92%), Gaps = 1/138 (1%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAA LNIV
Sbjct  148  ISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAACLNIV  207

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR+++
Sbjct  208  PTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRESA  266

Query  401  DGPLKGVLDVCDAPLVSL  348
            D  LKG+L VCD PLVS+
Sbjct  267  DNELKGILSVCDEPLVSI  284


 Score =   138 bits (347),  Expect(2) = 5e-72, Method: Compositional matrix adjust.
 Identities = 64/86 (74%), Positives = 73/86 (85%), Gaps = 1/86 (1%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGV-  187
            P    DFRC+DVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+KW G+ 
Sbjct  280  PLVSIDFRCTDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANKWQGLE  339

Query  186  AVAGSGDPLEDYCKTNPGDKECKVFE  109
                SGDPLED+CK NP D+ECK++E
Sbjct  340  GSVASGDPLEDFCKDNPADEECKLYE  365



>gb|ABK00057.1| chloroplast glyceraldehyde-3-phosphate dehydrogenase [Mesostigma 
viride]
Length=384

 Score =   169 bits (427),  Expect(2) = 8e-71, Method: Compositional matrix adjust.
 Identities = 117/138 (85%), Positives = 128/138 (93%), Gaps = 0/138 (0%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPF KV+DE FGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAA NIV
Sbjct  169  ISNASCTTNCLAPFAKVLDENFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAAFNIV  228

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAVSLVLP+LKGKLNGIALRVPTPNVSVVDLV+N  KKG+TAE+VNAAFRK +
Sbjct  229  PTSTGAAKAVSLVLPKLKGKLNGIALRVPTPNVSVVDLVINTTKKGMTAEEVNAAFRKEA  288

Query  401  DGPLKGVLDVCDAPLVSL  348
            +G +KG+L V D PLVS+
Sbjct  289  NGAMKGILAVSDLPLVSI  306


 Score =   126 bits (317),  Expect(2) = 8e-71, Method: Compositional matrix adjust.
 Identities = 59/83 (71%), Positives = 64/83 (77%), Gaps = 0/83 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVA  184
            P    DFRCSDVS TIDSSLTMVMGDDMVKVVAWY NEWGYSQRVVDLA +VA+ WPG+ 
Sbjct  302  PLVSIDFRCSDVSCTIDSSLTMVMGDDMVKVVAWYGNEWGYSQRVVDLADIVANNWPGMV  361

Query  183  VAGSGDPLEDYCKTNPGDKECKV  115
                 DPLE +C TNP   EC+V
Sbjct  362  QETGSDPLETFCNTNPDADECRV  384



>ref|XP_004985859.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Setaria italica]
Length=445

 Score =   184 bits (467),  Expect(2) = 3e-69, Method: Compositional matrix adjust.
 Identities = 125/138 (91%), Positives = 134/138 (97%), Gaps = 0/138 (0%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPFVKV+DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  226  ISNASCTTNCLAPFVKVLDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  285

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAV+LVLPQLKGKLNGIALRVPTPNVSVVDLV+N +KKG+TA+DVNAAFRKA+
Sbjct  286  PTSTGAAKAVALVLPQLKGKLNGIALRVPTPNVSVVDLVINTEKKGMTADDVNAAFRKAA  345

Query  401  DGPLKGVLDVCDAPLVSL  348
             GPLKGVL VCD PLVS+
Sbjct  346  AGPLKGVLQVCDEPLVSV  363


 Score =   105 bits (262),  Expect(2) = 3e-69, Method: Compositional matrix adjust.
 Identities = 67/87 (77%), Positives = 70/87 (80%), Gaps = 1/87 (1%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLV-ASKWPGV  187
            P    DFRCSDVSS+IDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLV A      
Sbjct  359  PLVSVDFRCSDVSSSIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVAAKWPGAA  418

Query  186  AVAGSGDPLEDYCKTNPGDKECKVFEA  106
            A  GSGDPLED+CK NP   ECKV+EA
Sbjct  419  AAGGSGDPLEDFCKDNPETDECKVYEA  445



>gb|KGN49135.1| hypothetical protein Csa_6G514950 [Cucumis sativus]
Length=191

 Score =   150 bits (378),  Expect(2) = 2e-66, Method: Compositional matrix adjust.
 Identities = 68/86 (79%), Positives = 75/86 (87%), Gaps = 0/86 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVA  184
            P    DF+C+DVSSTIDSSLTMVMGDDM+KVVAWYDNEWGYSQRVVDLAHLVA KWPG  
Sbjct  106  PLVSVDFKCTDVSSTIDSSLTMVMGDDMLKVVAWYDNEWGYSQRVVDLAHLVADKWPGAG  165

Query  183  VAGSGDPLEDYCKTNPGDKECKVFEA  106
               SGDPLED+C+TNP D+ECKV+EA
Sbjct  166  SGKSGDPLEDFCQTNPADEECKVYEA  191


 Score =   130 bits (326),  Expect(2) = 2e-66, Method: Compositional matrix adjust.
 Identities = 101/110 (92%), Positives = 108/110 (98%), Gaps = 0/110 (0%)
 Frame = -1

Query  677  MTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSLVLPQLKGKLNGIALRv  498
            MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSLVLPQLKGKLNGIALRV
Sbjct  1    MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSLVLPQLKGKLNGIALRV  60

Query  497  ptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCDAPLVSL  348
            PTPNVSVVDLVVN++KKG++A+DVNAAFRKA+DGPLKGVL VCD PLVS+
Sbjct  61   PTPNVSVVDLVVNIEKKGISADDVNAAFRKAADGPLKGVLAVCDIPLVSV  110



>ref|XP_002540513.1| glyceraldehyde 3-phosphate dehydrogenase, putative [Ricinus communis]
 gb|EEF21870.1| glyceraldehyde 3-phosphate dehydrogenase, putative [Ricinus communis]
Length=193

 Score =   157 bits (396),  Expect(2) = 9e-65, Method: Compositional matrix adjust.
 Identities = 73/86 (85%), Positives = 78/86 (91%), Gaps = 0/86 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVA  184
            P    DFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVA+KWPG +
Sbjct  108  PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVAAKWPGAS  167

Query  183  VAGSGDPLEDYCKTNPGDKECKVFEA  106
             AGSGD LED+C+TNP DKECKVFE+
Sbjct  168  AAGSGDALEDFCETNPADKECKVFES  193


 Score =   118 bits (295),  Expect(2) = 9e-65, Method: Compositional matrix adjust.
 Identities = 75/81 (93%), Positives = 80/81 (99%), Gaps = 0/81 (0%)
 Frame = -1

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKGLTAEDVNAAFR
Sbjct  32   NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGLTAEDVNAAFR  91

Query  410  KASDGPLKGVLDVCDAPLVSL  348
            KA++GPLKG+LDVCD PLVS+
Sbjct  92   KAAEGPLKGILDVCDVPLVSV  112



>gb|AES74103.2| glyceraldehyde-3-phosphate dehydrogenase B [Medicago truncatula]
Length=415

 Score =   188 bits (478),  Expect(2) = 1e-62, Method: Compositional matrix adjust.
 Identities = 128/138 (93%), Positives = 136/138 (99%), Gaps = 0/138 (0%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPFVK++DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  234  ISNASCTTNCLAPFVKILDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  293

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV KKG++AEDVNAAFRKA+
Sbjct  294  PTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVAKKGISAEDVNAAFRKAA  353

Query  401  DGPLKGVLDVCDAPLVSL  348
            +GPLKGVLDVCD PLVS+
Sbjct  354  EGPLKGVLDVCDVPLVSV  371


 Score = 79.7 bits (195),  Expect(2) = 1e-62, Method: Compositional matrix adjust.
 Identities = 36/41 (88%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGY  241
            P    DFRC+DVSSTIDSSLTMVMGDDMVKVVAWYDNEWGY
Sbjct  367  PLVSVDFRCTDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGY  407



>pir||DESPGA glyceraldehyde-3-phosphate dehydrogenase (NADP)  (phosphorylating) 
(EC 1.2.1.13) A, chloroplast - spinach
Length=337

 Score =   164 bits (415),  Expect(2) = 3e-62, Method: Compositional matrix adjust.
 Identities = 116/138 (84%), Positives = 128/138 (93%), Gaps = 1/138 (1%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAA LNIV
Sbjct  148  ISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAACLNIV  207

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAV+LVLPQLKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR+++
Sbjct  208  PTSTGAAKAVALVLPQLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRESA  266

Query  401  DGPLKGVLDVCDAPLVSL  348
            D  LKG+L VCD PLVS+
Sbjct  267  DNELKGILSVCDEPLVSI  284


 Score =   102 bits (254),  Expect(2) = 3e-62, Method: Compositional matrix adjust.
 Identities = 47/56 (84%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  196
            P    DFRC+DVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+KW
Sbjct  280  PLVSIDFRCTDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANKW  335



>gb|ABF74607.1| chloroplast glyceraldehyde-3-phosphate dehydrogenase B subunit 
[Agave tequilana]
Length=174

 Score =   153 bits (387),  Expect(2) = 3e-62, Method: Compositional matrix adjust.
 Identities = 71/88 (81%), Positives = 77/88 (88%), Gaps = 0/88 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVA  184
            P    DFRC+DVSSTID+SLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPG+ 
Sbjct  87   PLVSVDFRCTDVSSTIDASLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGMP  146

Query  183  VAGSGDPLEDYCKTNPGDKECKVFEA*F  100
              GS DPLED+CKTNP  +ECKV+EA F
Sbjct  147  AQGSSDPLEDFCKTNPETEECKVYEAGF  174


 Score =   113 bits (283),  Expect(2) = 3e-62, Method: Compositional matrix adjust.
 Identities = 73/81 (90%), Positives = 79/81 (98%), Gaps = 0/81 (0%)
 Frame = -1

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKG+TAEDVNAAFR
Sbjct  11   NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGITAEDVNAAFR  70

Query  410  KASDGPLKGVLDVCDAPLVSL  348
            KA++GPLKG+L VCD PLVS+
Sbjct  71   KAANGPLKGILAVCDVPLVSV  91



>ref|XP_009148557.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
isoform X2 [Brassica rapa]
Length=317

 Score =   164 bits (414),  Expect(2) = 3e-62, Method: Compositional matrix adjust.
 Identities = 117/138 (85%), Positives = 128/138 (93%), Gaps = 1/138 (1%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  129  ISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  188

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR A+
Sbjct  189  PTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRDAA  247

Query  401  DGPLKGVLDVCDAPLVSL  348
            +  LKG+LDVCD PLVS+
Sbjct  248  EKELKGILDVCDEPLVSV  265


 Score =   102 bits (255),  Expect(2) = 3e-62, Method: Compositional matrix adjust.
 Identities = 47/56 (84%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  196
            P    DFRCSDVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  261  PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  316



>pdb|1JN0|O Chain O, Crystal Structure Of The Non-regulatory A4 Isoform Of 
Spinach Chloroplast Glyceraldehyde-3-phosphate Dehydrogenase 
Complexed With Nadp
 pdb|1JN0|A Chain A, Crystal Structure Of The Non-regulatory A4 Isoform Of 
Spinach Chloroplast Glyceraldehyde-3-phosphate Dehydrogenase 
Complexed With Nadp
 pdb|1JN0|B Chain B, Crystal Structure Of The Non-regulatory A4 Isoform Of 
Spinach Chloroplast Glyceraldehyde-3-phosphate Dehydrogenase 
Complexed With Nadp
Length=335

 Score =   164 bits (414),  Expect(2) = 4e-62, Method: Compositional matrix adjust.
 Identities = 116/138 (84%), Positives = 128/138 (93%), Gaps = 1/138 (1%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAA LNIV
Sbjct  146  ISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAACLNIV  205

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAV+LVLPQLKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR+++
Sbjct  206  PTSTGAAKAVALVLPQLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRESA  264

Query  401  DGPLKGVLDVCDAPLVSL  348
            D  LKG+L VCD PLVS+
Sbjct  265  DQELKGILSVCDEPLVSI  282


 Score =   102 bits (255),  Expect(2) = 4e-62, Method: Compositional matrix adjust.
 Identities = 47/56 (84%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  196
            P    DFRC+DVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+KW
Sbjct  278  PLVSIDFRCTDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANKW  333



>ref|XP_009362873.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
isoform X3 [Pyrus x bretschneideri]
Length=408

 Score =   186 bits (473),  Expect(2) = 4e-62, Method: Compositional matrix adjust.
 Identities = 128/138 (93%), Positives = 135/138 (98%), Gaps = 0/138 (0%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            VSNASCTTNCLAPFVKV+DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  234  VSNASCTTNCLAPFVKVLDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  293

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLV+NV KKG++AEDVNAAFRKA+
Sbjct  294  PTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVINVAKKGISAEDVNAAFRKAA  353

Query  401  DGPLKGVLDVCDAPLVSL  348
            DGPLKG+L VCD PLVS+
Sbjct  354  DGPLKGILAVCDVPLVSV  371


 Score = 79.7 bits (195),  Expect(2) = 4e-62, Method: Compositional matrix adjust.
 Identities = 36/41 (88%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGY  241
            P    DFRC+DVSSTIDSSLTMVMGDDMVKVVAWYDNEWGY
Sbjct  367  PLVSVDFRCTDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGY  407



>ref|XP_002985183.1| hypothetical protein SELMODRAFT_181561 [Selaginella moellendorffii]
 gb|EFJ13677.1| hypothetical protein SELMODRAFT_181561 [Selaginella moellendorffii]
Length=402

 Score =   162 bits (411),  Expect(2) = 4e-62, Method: Compositional matrix adjust.
 Identities = 117/138 (85%), Positives = 129/138 (93%), Gaps = 1/138 (1%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPFVKV+DE+FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  214  ISNASCTTNCLAPFVKVLDEKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  273

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAV+LVLP+LKGKLNGIALRVPTPNVSVVDLVV V+KK   AE+VNAAFR+A+
Sbjct  274  PTSTGAAKAVALVLPKLKGKLNGIALRVPTPNVSVVDLVVQVEKKTF-AEEVNAAFREAA  332

Query  401  DGPLKGVLDVCDAPLVSL  348
            D  L G+L VCD PLVS+
Sbjct  333  DKALNGILAVCDEPLVSV  350


 Score =   103 bits (257),  Expect(2) = 4e-62, Method: Compositional matrix adjust.
 Identities = 48/56 (86%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  196
            P    DFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLA++VA +W
Sbjct  346  PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLANIVAEQW  401



>ref|NP_001077529.1| glyceraldehyde 3-phosphate dehydrogenase GAPA2 [Arabidopsis thaliana]
 gb|AEE28945.1| glyceraldehyde-3-phosphate dehydrogenase (NADP+) (phosphorylating) 
[Arabidopsis thaliana]
Length=317

 Score =   164 bits (414),  Expect(2) = 4e-62, Method: Compositional matrix adjust.
 Identities = 117/138 (85%), Positives = 128/138 (93%), Gaps = 1/138 (1%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  129  ISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  188

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR A+
Sbjct  189  PTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRDAA  247

Query  401  DGPLKGVLDVCDAPLVSL  348
            +  LKG+LDVCD PLVS+
Sbjct  248  EKELKGILDVCDEPLVSV  265


 Score =   102 bits (254),  Expect(2) = 4e-62, Method: Compositional matrix adjust.
 Identities = 47/56 (84%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  196
            P    DFRCSDVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  261  PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  316



>ref|XP_010476270.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
isoform X2 [Camelina sativa]
Length=317

 Score =   164 bits (414),  Expect(2) = 5e-62, Method: Compositional matrix adjust.
 Identities = 117/138 (85%), Positives = 128/138 (93%), Gaps = 1/138 (1%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  129  ISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  188

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR A+
Sbjct  189  PTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRDAA  247

Query  401  DGPLKGVLDVCDAPLVSL  348
            +  LKG+LDVCD PLVS+
Sbjct  248  EKELKGILDVCDEPLVSV  265


 Score =   102 bits (253),  Expect(2) = 5e-62, Method: Compositional matrix adjust.
 Identities = 47/56 (84%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  196
            P    DFRCSDVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  261  PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  316



>ref|XP_010494750.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
isoform X2 [Camelina sativa]
Length=317

 Score =   163 bits (413),  Expect(2) = 7e-62, Method: Compositional matrix adjust.
 Identities = 117/138 (85%), Positives = 128/138 (93%), Gaps = 1/138 (1%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  129  ISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  188

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR A+
Sbjct  189  PTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRDAA  247

Query  401  DGPLKGVLDVCDAPLVSL  348
            +  LKG+LDVCD PLVS+
Sbjct  248  EKELKGILDVCDEPLVSV  265


 Score =   102 bits (253),  Expect(2) = 7e-62, Method: Compositional matrix adjust.
 Identities = 47/56 (84%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  196
            P    DFRCSDVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  261  PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  316



>dbj|BAP91041.1| glyceraldehyde 3-phosphate dehydrogenase-A [Nicotiana benthamiana]
Length=401

 Score =   164 bits (416),  Expect(2) = 9e-62, Method: Compositional matrix adjust.
 Identities = 118/138 (86%), Positives = 129/138 (93%), Gaps = 1/138 (1%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  213  ISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  272

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR+A+
Sbjct  273  PTSTGAAKAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFREAA  331

Query  401  DGPLKGVLDVCDAPLVSL  348
            D  LKG+LDVCD PLVS+
Sbjct  332  DKELKGILDVCDEPLVSV  349


 Score =   100 bits (249),  Expect(2) = 9e-62, Method: Compositional matrix adjust.
 Identities = 45/56 (80%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  196
            P    DFRCSDVSST+D+SLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA++W
Sbjct  345  PLVSVDFRCSDVSSTVDASLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQW  400



>sp|P19866.2|G3PA_SPIOL RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic; 
AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase subunit A; Flags: Precursor [Spinacia oleracea]
 gb|AAD10217.1| NADP-dependent glyceraldehydephosphate dehydrogenase subunit 
A [Spinacia oleracea]
Length=401

 Score =   162 bits (409),  Expect(2) = 9e-62, Method: Compositional matrix adjust.
 Identities = 115/138 (83%), Positives = 127/138 (92%), Gaps = 1/138 (1%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAA LNIV
Sbjct  213  ISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAACLNIV  272

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR+++
Sbjct  273  PTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRESA  331

Query  401  DGPLKGVLDVCDAPLVSL  348
            D  LKG+L VCD PLVS+
Sbjct  332  DNELKGILSVCDEPLVSI  349


 Score =   102 bits (255),  Expect(2) = 9e-62, Method: Compositional matrix adjust.
 Identities = 47/56 (84%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  196
            P    DFRC+DVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+KW
Sbjct  345  PLVSIDFRCTDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANKW  400



>ref|XP_002970103.1| hypothetical protein SELMODRAFT_270825 [Selaginella moellendorffii]
 gb|EFJ29227.1| hypothetical protein SELMODRAFT_270825 [Selaginella moellendorffii]
Length=402

 Score =   161 bits (408),  Expect(2) = 1e-61, Method: Compositional matrix adjust.
 Identities = 116/138 (84%), Positives = 129/138 (93%), Gaps = 1/138 (1%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPFVKV+DE+FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  214  ISNASCTTNCLAPFVKVLDEKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  273

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAV+LVLP+LKGKLNGIALRVPTPNVSVVDLVV V+KK   AE+VNAAFR+++
Sbjct  274  PTSTGAAKAVALVLPKLKGKLNGIALRVPTPNVSVVDLVVQVEKKTF-AEEVNAAFRESA  332

Query  401  DGPLKGVLDVCDAPLVSL  348
            D  L G+L VCD PLVS+
Sbjct  333  DKALNGILAVCDEPLVSV  350


 Score =   103 bits (257),  Expect(2) = 1e-61, Method: Compositional matrix adjust.
 Identities = 48/56 (86%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  196
            P    DFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLA++VA +W
Sbjct  346  PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLANIVAEQW  401



>ref|XP_009800449.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Nicotiana sylvestris]
Length=401

 Score =   164 bits (416),  Expect(2) = 1e-61, Method: Compositional matrix adjust.
 Identities = 118/138 (86%), Positives = 129/138 (93%), Gaps = 1/138 (1%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  213  ISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  272

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR+A+
Sbjct  273  PTSTGAAKAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFREAA  331

Query  401  DGPLKGVLDVCDAPLVSL  348
            D  LKG+LDVCD PLVS+
Sbjct  332  DKELKGILDVCDEPLVSV  349


 Score =   100 bits (249),  Expect(2) = 1e-61, Method: Compositional matrix adjust.
 Identities = 45/56 (80%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  196
            P    DFRCSDVSST+D+SLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA++W
Sbjct  345  PLVSVDFRCSDVSSTVDASLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQW  400



>ref|XP_009631078.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Nicotiana tomentosiformis]
Length=401

 Score =   164 bits (415),  Expect(2) = 1e-61, Method: Compositional matrix adjust.
 Identities = 118/138 (86%), Positives = 129/138 (93%), Gaps = 1/138 (1%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  213  ISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  272

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR+A+
Sbjct  273  PTSTGAAKAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVTKKTF-AEEVNAAFREAA  331

Query  401  DGPLKGVLDVCDAPLVSL  348
            D  LKG+LDVCD PLVS+
Sbjct  332  DKELKGILDVCDEPLVSV  349


 Score =   100 bits (249),  Expect(2) = 1e-61, Method: Compositional matrix adjust.
 Identities = 45/56 (80%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  196
            P    DFRCSDVSST+D+SLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA++W
Sbjct  345  PLVSVDFRCSDVSSTVDASLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQW  400



>sp|P09672.1|G3PA_SINAL RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic; 
AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase subunit A, partial [Sinapis alba]
 emb|CAA27845.1| chloroplast GAPDH (233aa) [Sinapis alba]
Length=233

 Score =   163 bits (412),  Expect(2) = 1e-61, Method: Compositional matrix adjust.
 Identities = 117/138 (85%), Positives = 128/138 (93%), Gaps = 1/138 (1%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  45   ISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  104

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR A+
Sbjct  105  PTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRDAA  163

Query  401  DGPLKGVLDVCDAPLVSL  348
            +  LKG+LDVCD PLVS+
Sbjct  164  EKELKGILDVCDEPLVSV  181


 Score =   101 bits (251),  Expect(2) = 1e-61, Method: Compositional matrix adjust.
 Identities = 47/56 (84%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  196
            P    DFRCSDVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  177  PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  232



>ref|XP_010476269.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPA2, chloroplastic 
isoform X1 [Camelina sativa]
Length=399

 Score =   162 bits (411),  Expect(2) = 1e-61, Method: Compositional matrix adjust.
 Identities = 117/138 (85%), Positives = 128/138 (93%), Gaps = 1/138 (1%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  211  ISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  270

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR A+
Sbjct  271  PTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRDAA  329

Query  401  DGPLKGVLDVCDAPLVSL  348
            +  LKG+LDVCD PLVS+
Sbjct  330  EKELKGILDVCDEPLVSV  347


 Score =   101 bits (252),  Expect(2) = 1e-61, Method: Compositional matrix adjust.
 Identities = 47/56 (84%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  196
            P    DFRCSDVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  343  PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  398



>ref|XP_010494747.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPA2, chloroplastic 
isoform X1 [Camelina sativa]
Length=399

 Score =   163 bits (412),  Expect(2) = 1e-61, Method: Compositional matrix adjust.
 Identities = 117/138 (85%), Positives = 128/138 (93%), Gaps = 1/138 (1%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  211  ISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  270

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR A+
Sbjct  271  PTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRDAA  329

Query  401  DGPLKGVLDVCDAPLVSL  348
            +  LKG+LDVCD PLVS+
Sbjct  330  EKELKGILDVCDEPLVSV  347


 Score =   101 bits (252),  Expect(2) = 1e-61, Method: Compositional matrix adjust.
 Identities = 47/56 (84%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  196
            P    DFRCSDVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  343  PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  398



>pdb|1NBO|O Chain O, The Dual Coenzyme Specificity Of Photosynthetic Glyceraldehyde-3- 
Phosphate Dehydrogenase Interpreted By The Crystal 
Structure Of A4 Isoform Complexed With Nad
 pdb|1NBO|A Chain A, The Dual Coenzyme Specificity Of Photosynthetic Glyceraldehyde-3- 
Phosphate Dehydrogenase Interpreted By The Crystal 
Structure Of A4 Isoform Complexed With Nad
 pdb|1NBO|B Chain B, The Dual Coenzyme Specificity Of Photosynthetic Glyceraldehyde-3- 
Phosphate Dehydrogenase Interpreted By The Crystal 
Structure Of A4 Isoform Complexed With Nad
 pdb|1RM4|O Chain O, Crystal Structure Of Recombinant Photosynthetic Glyceraldehyde-3- 
Phosphate Dehydrogenase A4 Isoform, Complexed 
With Nadp
 pdb|1RM4|A Chain A, Crystal Structure Of Recombinant Photosynthetic Glyceraldehyde-3- 
Phosphate Dehydrogenase A4 Isoform, Complexed 
With Nadp
 pdb|1RM4|B Chain B, Crystal Structure Of Recombinant Photosynthetic Glyceraldehyde-3- 
Phosphate Dehydrogenase A4 Isoform, Complexed 
With Nadp
 pdb|2HKI|A Chain A, Crystal Structure Of Photosynthetic Glyceraldehyde-3-Phosphate 
Dehydrogenase A4 Isoform
 pdb|2PKQ|P Chain P, Crystal Structure Of The Photosynthetic A2b2-glyceraldehyde-3- 
Phosphate Dehydrogenase, Complexed With Nadp
 pdb|2PKQ|R Chain R, Crystal Structure Of The Photosynthetic A2b2-glyceraldehyde-3- 
Phosphate Dehydrogenase, Complexed With Nadp
 pdb|2PKQ|S Chain S, Crystal Structure Of The Photosynthetic A2b2-glyceraldehyde-3- 
Phosphate Dehydrogenase, Complexed With Nadp
Length=337

 Score =   162 bits (409),  Expect(2) = 1e-61, Method: Compositional matrix adjust.
 Identities = 115/138 (83%), Positives = 127/138 (92%), Gaps = 1/138 (1%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAA LNIV
Sbjct  148  ISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAACLNIV  207

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR+++
Sbjct  208  PTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRESA  266

Query  401  DGPLKGVLDVCDAPLVSL  348
            D  LKG+L VCD PLVS+
Sbjct  267  DNELKGILSVCDEPLVSI  284


 Score =   102 bits (254),  Expect(2) = 1e-61, Method: Compositional matrix adjust.
 Identities = 47/56 (84%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  196
            P    DFRC+DVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+KW
Sbjct  280  PLVSIDFRCTDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANKW  335



>pdb|1RM3|O Chain O, Crystal Structure Of Mutant T33a Of Photosynthetic Glyceraldehyde-3- 
Phosphate Dehydrogenase A4 Isoform, Complexed 
With Nadp
 pdb|1RM3|A Chain A, Crystal Structure Of Mutant T33a Of Photosynthetic Glyceraldehyde-3- 
Phosphate Dehydrogenase A4 Isoform, Complexed 
With Nadp
 pdb|1RM3|B Chain B, Crystal Structure Of Mutant T33a Of Photosynthetic Glyceraldehyde-3- 
Phosphate Dehydrogenase A4 Isoform, Complexed 
With Nadp
Length=337

 Score =   162 bits (409),  Expect(2) = 1e-61, Method: Compositional matrix adjust.
 Identities = 115/138 (83%), Positives = 127/138 (92%), Gaps = 1/138 (1%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAA LNIV
Sbjct  148  ISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAACLNIV  207

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR+++
Sbjct  208  PTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRESA  266

Query  401  DGPLKGVLDVCDAPLVSL  348
            D  LKG+L VCD PLVS+
Sbjct  267  DNELKGILSVCDEPLVSI  284


 Score =   102 bits (254),  Expect(2) = 1e-61, Method: Compositional matrix adjust.
 Identities = 47/56 (84%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  196
            P    DFRC+DVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+KW
Sbjct  280  PLVSIDFRCTDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANKW  335



>ref|NP_172750.1| glyceraldehyde 3-phosphate dehydrogenase GAPA2 [Arabidopsis thaliana]
 sp|Q9LPW0.1|G3PA2_ARATH RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase GAPA2, 
chloroplastic; AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase A subunit 2; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAF78494.1|AC012187_14 Strong similarity to GAPDH subunit A from Pisum sativum gb|X15190 
and contains a GAPDH PF|00044 domain. ESTs gb|T42920, gb|T43410, 
gb|T46101, gb|T04006, gb|T20630, gb|Z34677, gb|T46805, 
gb|N37754, gb|N37754, gb|Z26072, gb|H37169, gb|H76419, 
gb|T20834, gb|T21557, gb|AA713258, gb|T04005, gb|AI099909, gb|Z34793 
come from this gene [Arabidopsis thaliana]
 gb|AAP40454.1| putative calcium-binding protein, calreticulin [Arabidopsis thaliana]
 gb|AAU94430.1| At1g12900 [Arabidopsis thaliana]
 gb|AEE28944.1| glyceraldehyde-3-phosphate dehydrogenase (NADP+) (phosphorylating) 
[Arabidopsis thaliana]
Length=399

 Score =   163 bits (412),  Expect(2) = 1e-61, Method: Compositional matrix adjust.
 Identities = 117/138 (85%), Positives = 128/138 (93%), Gaps = 1/138 (1%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  211  ISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  270

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR A+
Sbjct  271  PTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRDAA  329

Query  401  DGPLKGVLDVCDAPLVSL  348
            +  LKG+LDVCD PLVS+
Sbjct  330  EKELKGILDVCDEPLVSV  347


 Score =   101 bits (251),  Expect(2) = 1e-61, Method: Compositional matrix adjust.
 Identities = 47/56 (84%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  196
            P    DFRCSDVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  343  PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  398



>gb|EPS59235.1| hypothetical protein M569_15573, partial [Genlisea aurea]
Length=395

 Score =   162 bits (411),  Expect(2) = 1e-61, Method: Compositional matrix adjust.
 Identities = 117/138 (85%), Positives = 129/138 (93%), Gaps = 1/138 (1%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPFVKV+DE+F I+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  207  ISNASCTTNCLAPFVKVLDEKFSIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  266

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAV+LVLPQLKGKLNGIALRVPTPNVSVVDLVV V+KK   AE+VNAAFR+++
Sbjct  267  PTSTGAAKAVALVLPQLKGKLNGIALRVPTPNVSVVDLVVQVEKKTF-AEEVNAAFRESA  325

Query  401  DGPLKGVLDVCDAPLVSL  348
            D  LKG+L VCD PLVS+
Sbjct  326  DKELKGILSVCDEPLVSV  343


 Score =   101 bits (252),  Expect(2) = 1e-61, Method: Compositional matrix adjust.
 Identities = 46/56 (82%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  196
            P    DFRC+DVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+KW
Sbjct  339  PLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANKW  394



>ref|XP_002892719.1| GAPA-2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH68978.1| GAPA-2 [Arabidopsis lyrata subsp. lyrata]
Length=399

 Score =   162 bits (411),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 117/138 (85%), Positives = 128/138 (93%), Gaps = 1/138 (1%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  211  ISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  270

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR A+
Sbjct  271  PTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRDAA  329

Query  401  DGPLKGVLDVCDAPLVSL  348
            +  LKG+LDVCD PLVS+
Sbjct  330  EKELKGILDVCDEPLVSV  347


 Score =   101 bits (252),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 47/56 (84%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  196
            P    DFRCSDVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  343  PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  398



>pdb|1RM5|O Chain O, Crystal Structure Of Mutant S188a Of Photosynthetic 
Glyceraldehyde-3- Phosphate Dehydrogenase A4 Isoform, Complexed 
With Nadp
 pdb|1RM5|A Chain A, Crystal Structure Of Mutant S188a Of Photosynthetic 
Glyceraldehyde-3- Phosphate Dehydrogenase A4 Isoform, Complexed 
With Nadp
 pdb|1RM5|B Chain B, Crystal Structure Of Mutant S188a Of Photosynthetic 
Glyceraldehyde-3- Phosphate Dehydrogenase A4 Isoform, Complexed 
With Nadp
Length=337

 Score =   162 bits (409),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 114/138 (83%), Positives = 127/138 (92%), Gaps = 1/138 (1%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDA+HRDLRRARAA LNIV
Sbjct  148  ISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDAAHRDLRRARAACLNIV  207

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR+++
Sbjct  208  PTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRESA  266

Query  401  DGPLKGVLDVCDAPLVSL  348
            D  LKG+L VCD PLVS+
Sbjct  267  DNELKGILSVCDEPLVSI  284


 Score =   102 bits (254),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 47/56 (84%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  196
            P    DFRC+DVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+KW
Sbjct  280  PLVSIDFRCTDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANKW  335



>ref|XP_006304985.1| hypothetical protein CARUB_v10009349mg [Capsella rubella]
 gb|EOA37883.1| hypothetical protein CARUB_v10009349mg [Capsella rubella]
Length=399

 Score =   162 bits (411),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 117/138 (85%), Positives = 128/138 (93%), Gaps = 1/138 (1%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  211  ISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  270

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR A+
Sbjct  271  PTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRDAA  329

Query  401  DGPLKGVLDVCDAPLVSL  348
            +  LKG+LDVCD PLVS+
Sbjct  330  EKELKGILDVCDEPLVSV  347


 Score =   101 bits (252),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 47/56 (84%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  196
            P    DFRCSDVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  343  PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  398



>ref|XP_009148556.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPA2, chloroplastic 
isoform X1 [Brassica rapa]
Length=399

 Score =   162 bits (411),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 117/138 (85%), Positives = 128/138 (93%), Gaps = 1/138 (1%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  211  ISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  270

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR A+
Sbjct  271  PTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRDAA  329

Query  401  DGPLKGVLDVCDAPLVSL  348
            +  LKG+LDVCD PLVS+
Sbjct  330  EKELKGILDVCDEPLVSV  347


 Score =   101 bits (251),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 47/56 (84%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  196
            P    DFRCSDVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  343  PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  398



>emb|CDY19412.1| BnaC05g09210D [Brassica napus]
 emb|CDX98028.1| BnaA06g07790D [Brassica napus]
Length=399

 Score =   162 bits (411),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 117/138 (85%), Positives = 128/138 (93%), Gaps = 1/138 (1%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  211  ISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  270

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR A+
Sbjct  271  PTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRDAA  329

Query  401  DGPLKGVLDVCDAPLVSL  348
            +  LKG+LDVCD PLVS+
Sbjct  330  EKELKGILDVCDEPLVSV  347


 Score =   101 bits (252),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 47/56 (84%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  196
            P    DFRCSDVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  343  PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  398



>ref|XP_006417177.1| hypothetical protein EUTSA_v10007809mg [Eutrema salsugineum]
 gb|ESQ35530.1| hypothetical protein EUTSA_v10007809mg [Eutrema salsugineum]
Length=399

 Score =   162 bits (411),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 117/138 (85%), Positives = 128/138 (93%), Gaps = 1/138 (1%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  211  ISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  270

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR A+
Sbjct  271  PTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRDAA  329

Query  401  DGPLKGVLDVCDAPLVSL  348
            +  LKG+LDVCD PLVS+
Sbjct  330  EKELKGILDVCDEPLVSV  347


 Score =   101 bits (252),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 47/56 (84%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  196
            P    DFRCSDVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  343  PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  398



>ref|XP_010425376.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
isoform X2 [Camelina sativa]
Length=317

 Score =   162 bits (411),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 116/138 (84%), Positives = 128/138 (93%), Gaps = 1/138 (1%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  129  ISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  188

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR ++
Sbjct  189  PTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRDSA  247

Query  401  DGPLKGVLDVCDAPLVSL  348
            +  LKG+LDVCD PLVS+
Sbjct  248  EKELKGILDVCDEPLVSV  265


 Score =   101 bits (251),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 46/56 (82%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  196
            P    DFRCSD S+TIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+KW
Sbjct  261  PLVSVDFRCSDYSTTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANKW  316



>ref|XP_010502598.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
isoform X2 [Camelina sativa]
Length=317

 Score =   162 bits (410),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 116/138 (84%), Positives = 128/138 (93%), Gaps = 1/138 (1%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  129  ISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  188

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR ++
Sbjct  189  PTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRDSA  247

Query  401  DGPLKGVLDVCDAPLVSL  348
            +  LKG+LDVCD PLVS+
Sbjct  248  EKELKGILDVCDEPLVSV  265


 Score =   101 bits (251),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 46/56 (82%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  196
            P    DFRCSD S+TIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+KW
Sbjct  261  PLVSVDFRCSDYSTTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANKW  316



>ref|XP_009118049.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
isoform X2 [Brassica rapa]
Length=317

 Score =   162 bits (411),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 117/138 (85%), Positives = 127/138 (92%), Gaps = 1/138 (1%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  129  ISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  188

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR A+
Sbjct  189  PTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRDAA  247

Query  401  DGPLKGVLDVCDAPLVSL  348
               LKG+LDVCD PLVS+
Sbjct  248  ANELKGILDVCDEPLVSV  265


 Score =   100 bits (250),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 46/56 (82%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  196
            P    DFRCSDVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDL+ +VA+ W
Sbjct  261  PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLSDIVANNW  316



>ref|NP_001117276.1| glyceraldehyde 3-phosphate dehydrogenase GAPA2 [Arabidopsis thaliana]
 ref|NP_001184977.1| glyceraldehyde 3-phosphate dehydrogenase GAPA2 [Arabidopsis thaliana]
 gb|AEE28946.1| glyceraldehyde-3-phosphate dehydrogenase (NADP+) (phosphorylating) 
[Arabidopsis thaliana]
 gb|AEE28947.1| glyceraldehyde-3-phosphate dehydrogenase (NADP+) (phosphorylating) 
[Arabidopsis thaliana]
Length=350

 Score =   162 bits (410),  Expect(2) = 3e-61, Method: Compositional matrix adjust.
 Identities = 117/138 (85%), Positives = 128/138 (93%), Gaps = 1/138 (1%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  162  ISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  221

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR A+
Sbjct  222  PTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRDAA  280

Query  401  DGPLKGVLDVCDAPLVSL  348
            +  LKG+LDVCD PLVS+
Sbjct  281  EKELKGILDVCDEPLVSV  298


 Score =   101 bits (251),  Expect(2) = 3e-61, Method: Compositional matrix adjust.
 Identities = 47/56 (84%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  196
            P    DFRCSDVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  294  PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  349



>ref|XP_006417176.1| hypothetical protein EUTSA_v10007809mg [Eutrema salsugineum]
 ref|XP_006417178.1| hypothetical protein EUTSA_v10007809mg [Eutrema salsugineum]
 gb|ESQ35529.1| hypothetical protein EUTSA_v10007809mg [Eutrema salsugineum]
 gb|ESQ35531.1| hypothetical protein EUTSA_v10007809mg [Eutrema salsugineum]
Length=350

 Score =   162 bits (409),  Expect(2) = 4e-61, Method: Compositional matrix adjust.
 Identities = 117/138 (85%), Positives = 128/138 (93%), Gaps = 1/138 (1%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  162  ISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  221

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR A+
Sbjct  222  PTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRDAA  280

Query  401  DGPLKGVLDVCDAPLVSL  348
            +  LKG+LDVCD PLVS+
Sbjct  281  EKELKGILDVCDEPLVSV  298


 Score =   101 bits (251),  Expect(2) = 4e-61, Method: Compositional matrix adjust.
 Identities = 47/56 (84%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  196
            P    DFRCSDVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  294  PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  349



>gb|KHN46369.1| Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic [Glycine 
soja]
Length=403

 Score =   161 bits (407),  Expect(2) = 4e-61, Method: Compositional matrix adjust.
 Identities = 116/138 (84%), Positives = 128/138 (93%), Gaps = 1/138 (1%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  215  ISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  274

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR+++
Sbjct  275  PTSTGAAKAVALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRESA  333

Query  401  DGPLKGVLDVCDAPLVSL  348
            D  LKG+L VCD PLVS+
Sbjct  334  DNELKGILSVCDEPLVSV  351


 Score =   101 bits (252),  Expect(2) = 4e-61, Method: Compositional matrix adjust.
 Identities = 46/56 (82%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  196
            P    DFRC+DVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+KW
Sbjct  347  PLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANKW  402



>emb|CDY16038.1| BnaC08g40850D [Brassica napus]
Length=399

 Score =   161 bits (408),  Expect(2) = 4e-61, Method: Compositional matrix adjust.
 Identities = 117/138 (85%), Positives = 127/138 (92%), Gaps = 1/138 (1%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  211  ISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  270

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR A+
Sbjct  271  PTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRDAA  329

Query  401  DGPLKGVLDVCDAPLVSL  348
               LKG+LDVCD PLVS+
Sbjct  330  ANELKGILDVCDEPLVSV  347


 Score =   101 bits (251),  Expect(2) = 4e-61, Method: Compositional matrix adjust.
 Identities = 47/56 (84%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  196
            P    DFRCSDVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  343  PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  398



>gb|KHN46819.1| Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic [Glycine 
soja]
Length=403

 Score =   161 bits (407),  Expect(2) = 4e-61, Method: Compositional matrix adjust.
 Identities = 116/138 (84%), Positives = 128/138 (93%), Gaps = 1/138 (1%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  215  ISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  274

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR+++
Sbjct  275  PTSTGAAKAVALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRESA  333

Query  401  DGPLKGVLDVCDAPLVSL  348
            D  LKG+L VCD PLVS+
Sbjct  334  DNELKGILSVCDEPLVSV  351


 Score =   101 bits (252),  Expect(2) = 4e-61, Method: Compositional matrix adjust.
 Identities = 46/56 (82%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  196
            P    DFRC+DVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+KW
Sbjct  347  PLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANKW  402



>ref|NP_001238484.1| glyceraldehyde-3-phosphate dehydrogenase A subunit [Glycine max]
 gb|ABA86963.1| glyceraldehyde-3-phosphate dehydrogenase A subunit [Glycine max]
Length=403

 Score =   161 bits (407),  Expect(2) = 4e-61, Method: Compositional matrix adjust.
 Identities = 116/138 (84%), Positives = 128/138 (93%), Gaps = 1/138 (1%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  215  ISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  274

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR+++
Sbjct  275  PTSTGAAKAVALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRESA  333

Query  401  DGPLKGVLDVCDAPLVSL  348
            D  LKG+L VCD PLVS+
Sbjct  334  DNELKGILSVCDEPLVSV  351


 Score =   101 bits (252),  Expect(2) = 4e-61, Method: Compositional matrix adjust.
 Identities = 46/56 (82%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  196
            P    DFRC+DVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+KW
Sbjct  347  PLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANKW  402



>ref|XP_010694632.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Beta vulgaris subsp. vulgaris]
Length=401

 Score =   161 bits (408),  Expect(2) = 5e-61, Method: Compositional matrix adjust.
 Identities = 116/138 (84%), Positives = 128/138 (93%), Gaps = 1/138 (1%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  213  ISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  272

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR+++
Sbjct  273  PTSTGAAKAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVTKKTF-AEEVNAAFRESA  331

Query  401  DGPLKGVLDVCDAPLVSL  348
            D  LKG+L VCD PLVS+
Sbjct  332  DNELKGILSVCDEPLVSV  349


 Score =   101 bits (251),  Expect(2) = 5e-61, Method: Compositional matrix adjust.
 Identities = 46/56 (82%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  196
            P    DFRC+DVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA KW
Sbjct  345  PLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVADKW  400



>emb|CDY26599.1| BnaA09g46780D [Brassica napus]
Length=399

 Score =   161 bits (407),  Expect(2) = 5e-61, Method: Compositional matrix adjust.
 Identities = 117/138 (85%), Positives = 127/138 (92%), Gaps = 1/138 (1%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  211  ISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  270

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR A+
Sbjct  271  PTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRDAA  329

Query  401  DGPLKGVLDVCDAPLVSL  348
               LKG+LDVCD PLVS+
Sbjct  330  ANELKGILDVCDEPLVSV  347


 Score =   101 bits (251),  Expect(2) = 5e-61, Method: Compositional matrix adjust.
 Identities = 47/56 (84%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  196
            P    DFRCSDVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  343  PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  398



>ref|XP_010028899.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Eucalyptus grandis]
 gb|KCW55732.1| hypothetical protein EUGRSUZ_I01564 [Eucalyptus grandis]
Length=402

 Score =   159 bits (403),  Expect(2) = 5e-61, Method: Compositional matrix adjust.
 Identities = 115/138 (83%), Positives = 127/138 (92%), Gaps = 1/138 (1%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  214  ISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  273

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNA FR+++
Sbjct  274  PTSTGAAKAVALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAGFRESA  332

Query  401  DGPLKGVLDVCDAPLVSL  348
            D  LKG+L VCD PLVS+
Sbjct  333  DNELKGILSVCDEPLVSV  350


 Score =   103 bits (256),  Expect(2) = 5e-61, Method: Compositional matrix adjust.
 Identities = 46/56 (82%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  196
            P    DFRCSDVSST+D+SLTMVMGDDMVKV+AWYDNEWGYSQRVVDLAH+VA  W
Sbjct  346  PLVSVDFRCSDVSSTVDASLTMVMGDDMVKVIAWYDNEWGYSQRVVDLAHIVADNW  401



>ref|XP_003579898.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Brachypodium distachyon]
Length=403

 Score =   163 bits (412),  Expect(2) = 5e-61, Method: Compositional matrix adjust.
 Identities = 118/138 (86%), Positives = 128/138 (93%), Gaps = 1/138 (1%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  215  ISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  274

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK L AE+VNAAFR A+
Sbjct  275  PTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTL-AEEVNAAFRDAA  333

Query  401  DGPLKGVLDVCDAPLVSL  348
               LKG+LDVCD PLVS+
Sbjct  334  ANELKGILDVCDEPLVSV  351


 Score = 99.8 bits (247),  Expect(2) = 5e-61, Method: Compositional matrix adjust.
 Identities = 45/56 (80%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  196
            P    DFRCSDVSSTID+SL+MVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA++W
Sbjct  347  PLVSVDFRCSDVSSTIDASLSMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQW  402



>gb|KFK43560.1| hypothetical protein AALP_AA1G142100 [Arabis alpina]
Length=399

 Score =   161 bits (407),  Expect(2) = 5e-61, Method: Compositional matrix adjust.
 Identities = 116/138 (84%), Positives = 127/138 (92%), Gaps = 1/138 (1%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  211  ISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  270

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR A+
Sbjct  271  PTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRDAA  329

Query  401  DGPLKGVLDVCDAPLVSL  348
               +KG+LDVCD PLVS+
Sbjct  330  ANEMKGILDVCDEPLVSV  347


 Score =   101 bits (252),  Expect(2) = 5e-61, Method: Compositional matrix adjust.
 Identities = 47/56 (84%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  196
            P    DFRCSDVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  343  PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  398



>ref|XP_006395535.1| hypothetical protein EUTSA_v10004349mg [Eutrema salsugineum]
 gb|ESQ32821.1| hypothetical protein EUTSA_v10004349mg [Eutrema salsugineum]
Length=400

 Score =   160 bits (406),  Expect(2) = 5e-61, Method: Compositional matrix adjust.
 Identities = 116/138 (84%), Positives = 128/138 (93%), Gaps = 1/138 (1%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  212  ISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  271

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR A+
Sbjct  272  PTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRDAA  330

Query  401  DGPLKGVLDVCDAPLVSL  348
            +  LKG+L+VCD PLVS+
Sbjct  331  EKELKGILEVCDEPLVSV  348


 Score =   101 bits (252),  Expect(2) = 5e-61, Method: Compositional matrix adjust.
 Identities = 47/56 (84%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  196
            P    DFRCSDVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  344  PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  399



>gb|AIU56856.1| glyceraldehyde-3-phosphate dehydrogenase A, partial [Brassica 
rapa subsp. chinensis]
Length=336

 Score =   161 bits (408),  Expect(2) = 6e-61, Method: Compositional matrix adjust.
 Identities = 118/138 (86%), Positives = 127/138 (92%), Gaps = 1/138 (1%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            VSNASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  148  VSNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  207

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR A+
Sbjct  208  PTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRDAA  266

Query  401  DGPLKGVLDVCDAPLVSL  348
               LKG+LDVCD PLVS+
Sbjct  267  ANELKGILDVCDEPLVSV  284


 Score =   100 bits (250),  Expect(2) = 6e-61, Method: Compositional matrix adjust.
 Identities = 47/56 (84%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  196
            P    DFRCSDVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  280  PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  335



>gb|KFK33590.1| hypothetical protein AALP_AA5G033500 [Arabis alpina]
Length=400

 Score =   160 bits (405),  Expect(2) = 6e-61, Method: Compositional matrix adjust.
 Identities = 115/138 (83%), Positives = 129/138 (93%), Gaps = 1/138 (1%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  212  ISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  271

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR+++
Sbjct  272  PTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRESA  330

Query  401  DGPLKGVLDVCDAPLVSL  348
            +  LKG+L+VCD PLVS+
Sbjct  331  EKELKGILEVCDEPLVSV  348


 Score =   101 bits (252),  Expect(2) = 6e-61, Method: Compositional matrix adjust.
 Identities = 47/56 (84%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  196
            P    DFRCSDVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  344  PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  399



>ref|XP_010425375.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPA1, chloroplastic 
isoform X1 [Camelina sativa]
Length=400

 Score =   161 bits (408),  Expect(2) = 7e-61, Method: Compositional matrix adjust.
 Identities = 116/138 (84%), Positives = 128/138 (93%), Gaps = 1/138 (1%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  212  ISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  271

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR ++
Sbjct  272  PTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRDSA  330

Query  401  DGPLKGVLDVCDAPLVSL  348
            +  LKG+LDVCD PLVS+
Sbjct  331  EKELKGILDVCDEPLVSV  348


 Score =   100 bits (249),  Expect(2) = 7e-61, Method: Compositional matrix adjust.
 Identities = 46/56 (82%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  196
            P    DFRCSD S+TIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+KW
Sbjct  344  PLVSVDFRCSDYSTTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANKW  399



>ref|XP_010502597.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPA1, chloroplastic-like 
isoform X1 [Camelina sativa]
Length=400

 Score =   161 bits (408),  Expect(2) = 7e-61, Method: Compositional matrix adjust.
 Identities = 116/138 (84%), Positives = 128/138 (93%), Gaps = 1/138 (1%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  212  ISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  271

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR ++
Sbjct  272  PTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRDSA  330

Query  401  DGPLKGVLDVCDAPLVSL  348
            +  LKG+LDVCD PLVS+
Sbjct  331  EKELKGILDVCDEPLVSV  348


 Score =   100 bits (249),  Expect(2) = 7e-61, Method: Compositional matrix adjust.
 Identities = 46/56 (82%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  196
            P    DFRCSD S+TIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+KW
Sbjct  344  PLVSVDFRCSDYSTTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANKW  399



>emb|CDX83635.1| BnaC07g23750D [Brassica napus]
Length=380

 Score =   160 bits (405),  Expect(2) = 8e-61, Method: Compositional matrix adjust.
 Identities = 115/138 (83%), Positives = 129/138 (93%), Gaps = 1/138 (1%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  192  ISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  251

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR+++
Sbjct  252  PTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVTKKTF-AEEVNAAFRESA  310

Query  401  DGPLKGVLDVCDAPLVSL  348
            +  LKG+L+VCD PLVS+
Sbjct  311  EKELKGILEVCDEPLVSV  328


 Score =   101 bits (251),  Expect(2) = 8e-61, Method: Compositional matrix adjust.
 Identities = 47/56 (84%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  196
            P    DFRCSDVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  324  PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  379



>ref|XP_009152035.1| PREDICTED: LOW QUALITY PROTEIN: glyceraldehyde-3-phosphate dehydrogenase 
GAPA1, chloroplastic [Brassica rapa]
Length=400

 Score =   160 bits (404),  Expect(2) = 1e-60, Method: Compositional matrix adjust.
 Identities = 115/138 (83%), Positives = 129/138 (93%), Gaps = 1/138 (1%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  212  ISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  271

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR+++
Sbjct  272  PTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVTKKTF-AEEVNAAFRESA  330

Query  401  DGPLKGVLDVCDAPLVSL  348
            +  LKG+L+VCD PLVS+
Sbjct  331  EKELKGILEVCDEPLVSV  348


 Score =   101 bits (252),  Expect(2) = 1e-60, Method: Compositional matrix adjust.
 Identities = 47/56 (84%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  196
            P    DFRCSDVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  344  PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  399



>ref|XP_009118048.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPA2, chloroplastic 
isoform X1 [Brassica rapa]
Length=399

 Score =   161 bits (408),  Expect(2) = 1e-60, Method: Compositional matrix adjust.
 Identities = 117/138 (85%), Positives = 127/138 (92%), Gaps = 1/138 (1%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  211  ISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  270

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR A+
Sbjct  271  PTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRDAA  329

Query  401  DGPLKGVLDVCDAPLVSL  348
               LKG+LDVCD PLVS+
Sbjct  330  ANELKGILDVCDEPLVSV  347


 Score =   100 bits (248),  Expect(2) = 1e-60, Method: Compositional matrix adjust.
 Identities = 46/56 (82%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  196
            P    DFRCSDVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDL+ +VA+ W
Sbjct  343  PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLSDIVANNW  398



>ref|XP_006359279.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
[Solanum tuberosum]
Length=399

 Score =   159 bits (402),  Expect(2) = 1e-60, Method: Compositional matrix adjust.
 Identities = 116/138 (84%), Positives = 127/138 (92%), Gaps = 1/138 (1%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  211  ISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  270

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR+A+
Sbjct  271  PTSTGAAKAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVTKKTF-AEEVNAAFREAA  329

Query  401  DGPLKGVLDVCDAPLVSL  348
            D  L G+L VCD PLVS+
Sbjct  330  DKELNGILAVCDEPLVSV  347


 Score =   102 bits (254),  Expect(2) = 1e-60, Method: Compositional matrix adjust.
 Identities = 47/56 (84%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  196
            P    DFRCSDVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA++W
Sbjct  343  PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQW  398



>ref|XP_003548805.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
[Glycine max]
Length=403

 Score =   160 bits (404),  Expect(2) = 1e-60, Method: Compositional matrix adjust.
 Identities = 115/138 (83%), Positives = 128/138 (93%), Gaps = 1/138 (1%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  215  ISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  274

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR+++
Sbjct  275  PTSTGAAKAVALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRESA  333

Query  401  DGPLKGVLDVCDAPLVSL  348
            D  L+G+L VCD PLVS+
Sbjct  334  DNELQGILSVCDEPLVSV  351


 Score =   101 bits (252),  Expect(2) = 1e-60, Method: Compositional matrix adjust.
 Identities = 46/56 (82%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  196
            P    DFRC+DVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+KW
Sbjct  347  PLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANKW  402



>ref|XP_004231523.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
[Solanum lycopersicum]
Length=409

 Score =   160 bits (404),  Expect(2) = 1e-60, Method: Compositional matrix adjust.
 Identities = 115/138 (83%), Positives = 127/138 (92%), Gaps = 1/138 (1%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  221  ISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  280

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR+++
Sbjct  281  PTSTGAAKAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRESA  339

Query  401  DGPLKGVLDVCDAPLVSL  348
            D  L G+L VCD PLVS+
Sbjct  340  DNELAGILSVCDEPLVSV  357


 Score =   101 bits (252),  Expect(2) = 1e-60, Method: Compositional matrix adjust.
 Identities = 45/56 (80%), Positives = 52/56 (93%), Gaps = 0/56 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  196
            P    DFRCSDVSST+D+SLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA++VA++W
Sbjct  353  PLVSVDFRCSDVSSTVDASLTMVMGDDMVKVIAWYDNEWGYSQRVVDLANIVANQW  408



>gb|ACU21011.1| unknown [Glycine max]
Length=403

 Score =   161 bits (407),  Expect(2) = 1e-60, Method: Compositional matrix adjust.
 Identities = 116/138 (84%), Positives = 128/138 (93%), Gaps = 1/138 (1%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  215  ISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  274

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR+++
Sbjct  275  PTSTGAAKAVALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRESA  333

Query  401  DGPLKGVLDVCDAPLVSL  348
            D  LKG+L VCD PLVS+
Sbjct  334  DNELKGILSVCDEPLVSV  351


 Score =   100 bits (249),  Expect(2) = 1e-60, Method: Compositional matrix adjust.
 Identities = 45/56 (80%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  196
            P    DFRC+DVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQR VDLA +VA+KW
Sbjct  347  PLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRAVDLADIVANKW  402



>ref|XP_007161788.1| hypothetical protein PHAVU_001G098100g [Phaseolus vulgaris]
 gb|ESW33782.1| hypothetical protein PHAVU_001G098100g [Phaseolus vulgaris]
Length=403

 Score =   159 bits (402),  Expect(2) = 1e-60, Method: Compositional matrix adjust.
 Identities = 115/138 (83%), Positives = 128/138 (93%), Gaps = 1/138 (1%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  215  ISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  274

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR+++
Sbjct  275  PTSTGAAKAVALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRESA  333

Query  401  DGPLKGVLDVCDAPLVSL  348
            +  LKG+L VCD PLVS+
Sbjct  334  EKELKGILSVCDEPLVSV  351


 Score =   102 bits (253),  Expect(2) = 1e-60, Method: Compositional matrix adjust.
 Identities = 46/56 (82%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  196
            P    DFRC+DVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+KW
Sbjct  347  PLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANKW  402



>dbj|BAK02737.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=306

 Score =   162 bits (409),  Expect(2) = 1e-60, Method: Compositional matrix adjust.
 Identities = 117/138 (85%), Positives = 127/138 (92%), Gaps = 1/138 (1%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  118  ISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  177

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK L AE+VN AFR A+
Sbjct  178  PTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTL-AEEVNQAFRDAA  236

Query  401  DGPLKGVLDVCDAPLVSL  348
               LKG+LDVCD PLVS+
Sbjct  237  ANELKGILDVCDEPLVSV  254


 Score = 99.4 bits (246),  Expect(2) = 1e-60, Method: Compositional matrix adjust.
 Identities = 45/56 (80%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  196
            P    DFRCSDVSSTID+SL+MVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA++W
Sbjct  250  PLVSVDFRCSDVSSTIDASLSMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQW  305



>ref|XP_010250427.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Nelumbo nucifera]
Length=402

 Score =   160 bits (406),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 116/138 (84%), Positives = 128/138 (93%), Gaps = 1/138 (1%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  214  ISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  273

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR+++
Sbjct  274  PTSTGAAKAVALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRESA  332

Query  401  DGPLKGVLDVCDAPLVSL  348
            D  LKG+L VCD PLVS+
Sbjct  333  DKELKGILSVCDEPLVSV  350


 Score =   100 bits (248),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 45/56 (80%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  196
            P    DFRCSDVSST+D+SLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  346  PLVSVDFRCSDVSSTVDASLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  401



>gb|KDP41897.1| hypothetical protein JCGZ_26915 [Jatropha curcas]
Length=411

 Score =   160 bits (405),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 116/138 (84%), Positives = 128/138 (93%), Gaps = 1/138 (1%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  223  ISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  282

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR+++
Sbjct  283  PTSTGAAKAVALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRESA  341

Query  401  DGPLKGVLDVCDAPLVSL  348
            D  LKG+L VCD PLVS+
Sbjct  342  DKELKGILSVCDEPLVSV  359


 Score =   100 bits (249),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 45/56 (80%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  196
            P    DFRC+DVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  355  PLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  410



>gb|AHZ58488.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Syntrichia 
caninervis]
Length=377

 Score =   157 bits (396),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 116/139 (83%), Positives = 128/139 (92%), Gaps = 2/139 (1%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPFVKV+DE+FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  188  ISNASCTTNCLAPFVKVLDEKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  247

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAV+LVLP+LKGK+NGIALRVPTPNVSVVDLVV V+KK   AE+VN AFR A 
Sbjct  248  PTSTGAAKAVALVLPRLKGKINGIALRVPTPNVSVVDLVVQVEKKTF-AEEVNQAFRDAC  306

Query  401  DGP-LKGVLDVCDAPLVSL  348
            + P LKG+L VCD PLVS+
Sbjct  307  ETPQLKGILAVCDEPLVSV  325


 Score =   103 bits (258),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 48/56 (86%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  196
            P    DFRC+DVSST+DSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLA+LVA KW
Sbjct  321  PLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLANLVAEKW  376



>emb|CDY13649.1| BnaA06g32740D [Brassica napus]
Length=380

 Score =   159 bits (402),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 115/138 (83%), Positives = 128/138 (93%), Gaps = 1/138 (1%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  192  ISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  251

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR ++
Sbjct  252  PTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVTKKTF-AEEVNAAFRDSA  310

Query  401  DGPLKGVLDVCDAPLVSL  348
            +  LKG+L+VCD PLVS+
Sbjct  311  EKELKGILEVCDEPLVSV  328


 Score =   101 bits (251),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 47/56 (84%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  196
            P    DFRCSDVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  324  PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  379



>ref|XP_010514317.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPA1, chloroplastic-like 
isoform X1 [Camelina sativa]
 ref|XP_010514318.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPA1, chloroplastic-like 
isoform X2 [Camelina sativa]
 ref|XP_010514319.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPA1, chloroplastic-like 
isoform X3 [Camelina sativa]
Length=400

 Score =   160 bits (404),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 115/138 (83%), Positives = 128/138 (93%), Gaps = 1/138 (1%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  212  ISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  271

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR ++
Sbjct  272  PTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRDSA  330

Query  401  DGPLKGVLDVCDAPLVSL  348
            +  LKG+L+VCD PLVS+
Sbjct  331  EKELKGILEVCDEPLVSV  348


 Score =   100 bits (249),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 46/56 (82%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  196
            P    DFRCSD S+TIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+KW
Sbjct  344  PLVSVDFRCSDYSTTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANKW  399



>dbj|BAJ90530.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=401

 Score =   160 bits (406),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 117/138 (85%), Positives = 127/138 (92%), Gaps = 1/138 (1%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  213  ISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  272

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK L AE+VN AFR A+
Sbjct  273  PTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTL-AEEVNQAFRDAA  331

Query  401  DGPLKGVLDVCDAPLVSL  348
               LKG+LDVCD PLVS+
Sbjct  332  ANELKGILDVCDEPLVSV  349


 Score = 99.8 bits (247),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 45/56 (80%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  196
            P    DFRCSDVSSTID+SL+MVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA++W
Sbjct  345  PLVSVDFRCSDVSSTIDASLSMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQW  400



>ref|NP_566796.2| glyceraldehyde-3-phosphate dehydrogenase A subunit [Arabidopsis 
thaliana]
 sp|P25856.3|G3PA1_ARATH RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase GAPA1, 
chloroplastic; AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase A subunit 1; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAL16200.1|AF428431_1 AT3g26650/MLJ15_5 [Arabidopsis thaliana]
 dbj|BAB01730.1| glyceralehyde-3-phosphate dehydrogenase subunit [Arabidopsis 
thaliana]
 gb|AAL24215.1| AT3g26650/MLJ15_5 [Arabidopsis thaliana]
 gb|AAL25556.1| AT3g26650/MLJ15_5 [Arabidopsis thaliana]
 gb|AAL91645.1| AT3g26650/MLJ15_5 [Arabidopsis thaliana]
 gb|AAM98317.1| At3g26650/MLJ15_5 [Arabidopsis thaliana]
 gb|AEE77191.1| glyceraldehyde-3-phosphate dehydrogenase A subunit [Arabidopsis 
thaliana]
Length=396

 Score =   161 bits (408),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 116/138 (84%), Positives = 128/138 (93%), Gaps = 1/138 (1%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  208  ISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  267

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR ++
Sbjct  268  PTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRDSA  326

Query  401  DGPLKGVLDVCDAPLVSL  348
            +  LKG+LDVCD PLVS+
Sbjct  327  EKELKGILDVCDEPLVSV  344


 Score = 99.0 bits (245),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 45/56 (80%), Positives = 49/56 (88%), Gaps = 0/56 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  196
            P    DFRCSD S+TIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  340  PLVSVDFRCSDFSTTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  395



>dbj|BAH57068.1| AT1G12900 [Arabidopsis thaliana]
Length=350

 Score =   162 bits (410),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 117/138 (85%), Positives = 128/138 (93%), Gaps = 1/138 (1%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  162  ISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  221

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR A+
Sbjct  222  PTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRDAA  280

Query  401  DGPLKGVLDVCDAPLVSL  348
            +  LKG+LDVCD PLVS+
Sbjct  281  EKELKGILDVCDEPLVSV  298


 Score = 98.2 bits (243),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 46/56 (82%), Positives = 49/56 (88%), Gaps = 0/56 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  196
            P    DFRCSDVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQR VDLA +VA+ W
Sbjct  294  PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRDVDLADIVANNW  349



>dbj|BAJ90885.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK08149.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=401

 Score =   160 bits (406),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 117/138 (85%), Positives = 127/138 (92%), Gaps = 1/138 (1%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  213  ISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  272

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK L AE+VN AFR A+
Sbjct  273  PTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTL-AEEVNQAFRDAA  331

Query  401  DGPLKGVLDVCDAPLVSL  348
               LKG+LDVCD PLVS+
Sbjct  332  ANELKGILDVCDEPLVSV  349


 Score = 99.4 bits (246),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 45/56 (80%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  196
            P    DFRCSDVSSTID+SL+MVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA++W
Sbjct  345  PLVSVDFRCSDVSSTIDASLSMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQW  400



>gb|AAA32793.1| glyceraldehyde 3-phosphate dehydrogenase [Arabidopsis thaliana]
 emb|CAA66816.1| glyceraldehyde-3-phosphate dehydrogenase (NADP+) (phosphorylating) 
[Arabidopsis thaliana]
Length=396

 Score =   161 bits (408),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 116/138 (84%), Positives = 128/138 (93%), Gaps = 1/138 (1%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  208  ISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  267

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR ++
Sbjct  268  PTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRDSA  326

Query  401  DGPLKGVLDVCDAPLVSL  348
            +  LKG+LDVCD PLVS+
Sbjct  327  EKELKGILDVCDEPLVSV  344


 Score = 99.0 bits (245),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 45/56 (80%), Positives = 49/56 (88%), Gaps = 0/56 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  196
            P    DFRCSD S+TIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  340  PLVSVDFRCSDFSTTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  395



>emb|CDY28536.1| BnaC02g36240D [Brassica napus]
Length=380

 Score =   159 bits (401),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 114/138 (83%), Positives = 128/138 (93%), Gaps = 1/138 (1%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  192  ISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  251

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE++NAAFR ++
Sbjct  252  PTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVTKKTF-AEEINAAFRDSA  310

Query  401  DGPLKGVLDVCDAPLVSL  348
            +  LKG+L+VCD PLVS+
Sbjct  311  EKELKGILEVCDEPLVSV  328


 Score =   101 bits (251),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 47/56 (84%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  196
            P    DFRCSDVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  324  PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  379



>dbj|BAJ10475.1| glyceraldehyde-3-phosphate dehydrogenase [Brassica rapa subsp. 
chinensis]
Length=399

 Score =   161 bits (407),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 117/138 (85%), Positives = 127/138 (92%), Gaps = 1/138 (1%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  211  ISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  270

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR A+
Sbjct  271  PTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRGAA  329

Query  401  DGPLKGVLDVCDAPLVSL  348
               LKG+LDVCD PLVS+
Sbjct  330  ANELKGILDVCDEPLVSV  347


 Score = 99.4 bits (246),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 46/56 (82%), Positives = 49/56 (88%), Gaps = 0/56 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  196
            P     FRCSDVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  343  PLVSVGFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  398



>ref|XP_002875330.1| gapa [Arabidopsis lyrata subsp. lyrata]
 gb|EFH51589.1| gapa [Arabidopsis lyrata subsp. lyrata]
Length=396

 Score =   161 bits (408),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 116/138 (84%), Positives = 128/138 (93%), Gaps = 1/138 (1%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  208  ISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  267

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR ++
Sbjct  268  PTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRDSA  326

Query  401  DGPLKGVLDVCDAPLVSL  348
            +  LKG+LDVCD PLVS+
Sbjct  327  EKELKGILDVCDEPLVSV  344


 Score = 98.6 bits (244),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 45/56 (80%), Positives = 49/56 (88%), Gaps = 0/56 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  196
            P    DFRCSD S+TIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  340  PLVSVDFRCSDYSTTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  395



>gb|KJB11770.1| hypothetical protein B456_001G276400 [Gossypium raimondii]
Length=305

 Score =   160 bits (404),  Expect(2) = 3e-60, Method: Compositional matrix adjust.
 Identities = 115/138 (83%), Positives = 128/138 (93%), Gaps = 1/138 (1%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  117  ISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  176

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR+++
Sbjct  177  PTSTGAAKAVALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRESA  235

Query  401  DGPLKGVLDVCDAPLVSL  348
            +  LKG+L VCD PLVS+
Sbjct  236  EKELKGILSVCDEPLVSV  253


 Score =   100 bits (248),  Expect(2) = 3e-60, Method: Compositional matrix adjust.
 Identities = 45/56 (80%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  196
            P    DFRCSDVSST+D+SLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  249  PLVSVDFRCSDVSSTVDASLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  304



>gb|EMT31124.1| Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic [Aegilops 
tauschii]
Length=402

 Score =   160 bits (406),  Expect(2) = 3e-60, Method: Compositional matrix adjust.
 Identities = 117/138 (85%), Positives = 127/138 (92%), Gaps = 1/138 (1%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  214  ISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  273

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK L AE+VN AFR A+
Sbjct  274  PTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTL-AEEVNQAFRDAA  332

Query  401  DGPLKGVLDVCDAPLVSL  348
               LKG+LDVCD PLVS+
Sbjct  333  ANELKGILDVCDEPLVSV  350


 Score = 99.4 bits (246),  Expect(2) = 3e-60, Method: Compositional matrix adjust.
 Identities = 45/56 (80%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  196
            P    DFRCSDVSSTID+SL+MVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA++W
Sbjct  346  PLVSVDFRCSDVSSTIDASLSMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQW  401



>ref|XP_006652372.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
isoform X1 [Oryza brachyantha]
Length=403

 Score =   159 bits (401),  Expect(2) = 3e-60, Method: Compositional matrix adjust.
 Identities = 115/138 (83%), Positives = 128/138 (93%), Gaps = 1/138 (1%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  215  ISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  274

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK L AE+VNAAFR ++
Sbjct  275  PTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTL-AEEVNAAFRDSA  333

Query  401  DGPLKGVLDVCDAPLVSL  348
               L+G+L+VCD PLVS+
Sbjct  334  ANELQGILEVCDVPLVSV  351


 Score =   101 bits (251),  Expect(2) = 3e-60, Method: Compositional matrix adjust.
 Identities = 46/56 (82%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  196
            P    DFRCSDVSSTID+SLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA++W
Sbjct  347  PLVSVDFRCSDVSSTIDASLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQW  402



>gb|AAD10209.1| glyceraldehyde 3-phosphate dehydrogenase A subunit [Arabidopsis 
thaliana]
Length=350

 Score =   161 bits (407),  Expect(2) = 3e-60, Method: Compositional matrix adjust.
 Identities = 116/138 (84%), Positives = 128/138 (93%), Gaps = 1/138 (1%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  162  ISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  221

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR ++
Sbjct  222  PTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRDSA  280

Query  401  DGPLKGVLDVCDAPLVSL  348
            +  LKG+LDVCD PLVS+
Sbjct  281  EKELKGILDVCDEPLVSV  298


 Score = 98.6 bits (244),  Expect(2) = 3e-60, Method: Compositional matrix adjust.
 Identities = 45/56 (80%), Positives = 49/56 (88%), Gaps = 0/56 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  196
            P    DFRCSD S+TIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  294  PLVSVDFRCSDFSTTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  349



>ref|XP_006652373.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
isoform X2 [Oryza brachyantha]
Length=401

 Score =   158 bits (400),  Expect(2) = 4e-60, Method: Compositional matrix adjust.
 Identities = 115/138 (83%), Positives = 128/138 (93%), Gaps = 1/138 (1%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  213  ISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  272

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK L AE+VNAAFR ++
Sbjct  273  PTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTL-AEEVNAAFRDSA  331

Query  401  DGPLKGVLDVCDAPLVSL  348
               L+G+L+VCD PLVS+
Sbjct  332  ANELQGILEVCDVPLVSV  349


 Score =   101 bits (251),  Expect(2) = 4e-60, Method: Compositional matrix adjust.
 Identities = 46/56 (82%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  196
            P    DFRCSDVSSTID+SLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA++W
Sbjct  345  PLVSVDFRCSDVSSTIDASLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQW  400



>ref|XP_001771246.1| predicted protein [Physcomitrella patens]
 gb|EDQ63957.1| predicted protein [Physcomitrella patens]
Length=406

 Score =   154 bits (388),  Expect(2) = 4e-60, Method: Compositional matrix adjust.
 Identities = 116/139 (83%), Positives = 126/139 (91%), Gaps = 2/139 (1%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPFVKV+DE+FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  217  ISNASCTTNCLAPFVKVLDEKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  276

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA-  405
            PTSTGAAKAV+LVLP LKGK+NGIALRVPTPNVSVVDLVV V+KK   AE+VN AFR A 
Sbjct  277  PTSTGAAKAVALVLPNLKGKINGIALRVPTPNVSVVDLVVQVEKKTF-AEEVNQAFRDAC  335

Query  404  SDGPLKGVLDVCDAPLVSL  348
            +   LKGVL VCD PLVS+
Sbjct  336  ATEELKGVLAVCDEPLVSV  354


 Score =   105 bits (263),  Expect(2) = 4e-60, Method: Compositional matrix adjust.
 Identities = 48/56 (86%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  196
            P    DFRC+DVSST+DSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAH+VA KW
Sbjct  350  PLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHIVAEKW  405



>ref|XP_001771209.1| predicted protein [Physcomitrella patens]
 gb|EDQ63920.1| predicted protein [Physcomitrella patens]
Length=399

 Score =   154 bits (388),  Expect(2) = 4e-60, Method: Compositional matrix adjust.
 Identities = 116/139 (83%), Positives = 126/139 (91%), Gaps = 2/139 (1%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPFVKV+DE+FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  210  ISNASCTTNCLAPFVKVLDEKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  269

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA-  405
            PTSTGAAKAV+LVLP LKGK+NGIALRVPTPNVSVVDLVV V+KK   AE+VN AFR A 
Sbjct  270  PTSTGAAKAVALVLPNLKGKINGIALRVPTPNVSVVDLVVQVEKKTF-AEEVNQAFRDAC  328

Query  404  SDGPLKGVLDVCDAPLVSL  348
            +   LKGVL VCD PLVS+
Sbjct  329  ATEELKGVLAVCDEPLVSV  347


 Score =   105 bits (263),  Expect(2) = 4e-60, Method: Compositional matrix adjust.
 Identities = 48/56 (86%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  196
            P    DFRC+DVSST+DSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAH+VA KW
Sbjct  343  PLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHIVAEKW  398



>pdb|3K2B|A Chain A, Crystal Structure Of Photosynthetic A4 Isoform Glyceraldehyde-3- 
Phosphate Dehydrogenase Complexed With Nad, From 
Arabidopsis Thaliana
 pdb|3K2B|B Chain B, Crystal Structure Of Photosynthetic A4 Isoform Glyceraldehyde-3- 
Phosphate Dehydrogenase Complexed With Nad, From 
Arabidopsis Thaliana
 pdb|3K2B|C Chain C, Crystal Structure Of Photosynthetic A4 Isoform Glyceraldehyde-3- 
Phosphate Dehydrogenase Complexed With Nad, From 
Arabidopsis Thaliana
 pdb|3K2B|D Chain D, Crystal Structure Of Photosynthetic A4 Isoform Glyceraldehyde-3- 
Phosphate Dehydrogenase Complexed With Nad, From 
Arabidopsis Thaliana
 pdb|3K2B|E Chain E, Crystal Structure Of Photosynthetic A4 Isoform Glyceraldehyde-3- 
Phosphate Dehydrogenase Complexed With Nad, From 
Arabidopsis Thaliana
 pdb|3K2B|F Chain F, Crystal Structure Of Photosynthetic A4 Isoform Glyceraldehyde-3- 
Phosphate Dehydrogenase Complexed With Nad, From 
Arabidopsis Thaliana
 pdb|3K2B|G Chain G, Crystal Structure Of Photosynthetic A4 Isoform Glyceraldehyde-3- 
Phosphate Dehydrogenase Complexed With Nad, From 
Arabidopsis Thaliana
 pdb|3K2B|H Chain H, Crystal Structure Of Photosynthetic A4 Isoform Glyceraldehyde-3- 
Phosphate Dehydrogenase Complexed With Nad, From 
Arabidopsis Thaliana
 pdb|3K2B|O Chain O, Crystal Structure Of Photosynthetic A4 Isoform Glyceraldehyde-3- 
Phosphate Dehydrogenase Complexed With Nad, From 
Arabidopsis Thaliana
 pdb|3K2B|Q Chain Q, Crystal Structure Of Photosynthetic A4 Isoform Glyceraldehyde-3- 
Phosphate Dehydrogenase Complexed With Nad, From 
Arabidopsis Thaliana
 pdb|3QV1|A Chain A, Crystal Structure Of The Binary Complex Of Photosyntetic 
A4 Glyceraldehyde 3-phosphate Dehydrogenase (gapdh) With 
Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3QV1|B Chain B, Crystal Structure Of The Binary Complex Of Photosyntetic 
A4 Glyceraldehyde 3-phosphate Dehydrogenase (gapdh) With 
Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3QV1|C Chain C, Crystal Structure Of The Binary Complex Of Photosyntetic 
A4 Glyceraldehyde 3-phosphate Dehydrogenase (gapdh) With 
Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3QV1|D Chain D, Crystal Structure Of The Binary Complex Of Photosyntetic 
A4 Glyceraldehyde 3-phosphate Dehydrogenase (gapdh) With 
Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3QV1|E Chain E, Crystal Structure Of The Binary Complex Of Photosyntetic 
A4 Glyceraldehyde 3-phosphate Dehydrogenase (gapdh) With 
Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3QV1|F Chain F, Crystal Structure Of The Binary Complex Of Photosyntetic 
A4 Glyceraldehyde 3-phosphate Dehydrogenase (gapdh) With 
Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3RVD|A Chain A, Crystal Structure Of The Binary Complex, Obtained By 
Soaking, Of Photosyntetic A4 Glyceraldehyde 3-phosphate Dehydrogenase 
(gapdh) With Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3RVD|B Chain B, Crystal Structure Of The Binary Complex, Obtained By 
Soaking, Of Photosyntetic A4 Glyceraldehyde 3-phosphate Dehydrogenase 
(gapdh) With Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3RVD|C Chain C, Crystal Structure Of The Binary Complex, Obtained By 
Soaking, Of Photosyntetic A4 Glyceraldehyde 3-phosphate Dehydrogenase 
(gapdh) With Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3RVD|D Chain D, Crystal Structure Of The Binary Complex, Obtained By 
Soaking, Of Photosyntetic A4 Glyceraldehyde 3-phosphate Dehydrogenase 
(gapdh) With Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3RVD|E Chain E, Crystal Structure Of The Binary Complex, Obtained By 
Soaking, Of Photosyntetic A4 Glyceraldehyde 3-phosphate Dehydrogenase 
(gapdh) With Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3RVD|F Chain F, Crystal Structure Of The Binary Complex, Obtained By 
Soaking, Of Photosyntetic A4 Glyceraldehyde 3-phosphate Dehydrogenase 
(gapdh) With Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3RVD|G Chain G, Crystal Structure Of The Binary Complex, Obtained By 
Soaking, Of Photosyntetic A4 Glyceraldehyde 3-phosphate Dehydrogenase 
(gapdh) With Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3RVD|H Chain H, Crystal Structure Of The Binary Complex, Obtained By 
Soaking, Of Photosyntetic A4 Glyceraldehyde 3-phosphate Dehydrogenase 
(gapdh) With Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3RVD|O Chain O, Crystal Structure Of The Binary Complex, Obtained By 
Soaking, Of Photosyntetic A4 Glyceraldehyde 3-phosphate Dehydrogenase 
(gapdh) With Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3RVD|Q Chain Q, Crystal Structure Of The Binary Complex, Obtained By 
Soaking, Of Photosyntetic A4 Glyceraldehyde 3-phosphate Dehydrogenase 
(gapdh) With Cp12-2, Both From Arabidopsis Thaliana.
Length=337

 Score =   160 bits (406),  Expect(2) = 5e-60, Method: Compositional matrix adjust.
 Identities = 116/138 (84%), Positives = 128/138 (93%), Gaps = 1/138 (1%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  149  ISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  208

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR ++
Sbjct  209  PTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRDSA  267

Query  401  DGPLKGVLDVCDAPLVSL  348
            +  LKG+LDVCD PLVS+
Sbjct  268  EKELKGILDVCDEPLVSV  285


 Score = 98.6 bits (244),  Expect(2) = 5e-60, Method: Compositional matrix adjust.
 Identities = 45/56 (80%), Positives = 49/56 (88%), Gaps = 0/56 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  196
            P    DFRCSD S+TIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  281  PLVSVDFRCSDFSTTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  336



>dbj|BAG68209.1| glyceraldehyde-3-phosphate dehydrogenase [Brassica rapa subsp. 
chinensis]
Length=328

 Score =   160 bits (405),  Expect(2) = 5e-60, Method: Compositional matrix adjust.
 Identities = 117/138 (85%), Positives = 127/138 (92%), Gaps = 1/138 (1%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  140  ISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  199

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR A+
Sbjct  200  PTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRGAA  258

Query  401  DGPLKGVLDVCDAPLVSL  348
               LKG+LDVCD PLVS+
Sbjct  259  ANELKGILDVCDEPLVSV  276


 Score = 98.6 bits (244),  Expect(2) = 5e-60, Method: Compositional matrix adjust.
 Identities = 46/56 (82%), Positives = 49/56 (88%), Gaps = 0/56 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  196
            P     FRCSDVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  272  PLVSVGFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  327



>ref|XP_006291258.1| hypothetical protein CARUB_v10017390mg [Capsella rubella]
 gb|EOA24156.1| hypothetical protein CARUB_v10017390mg [Capsella rubella]
Length=400

 Score =   160 bits (404),  Expect(2) = 7e-60, Method: Compositional matrix adjust.
 Identities = 115/138 (83%), Positives = 128/138 (93%), Gaps = 1/138 (1%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  212  ISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  271

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR ++
Sbjct  272  PTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRDSA  330

Query  401  DGPLKGVLDVCDAPLVSL  348
            +  LKG+L+VCD PLVS+
Sbjct  331  EKELKGILEVCDEPLVSV  348


 Score = 99.0 bits (245),  Expect(2) = 7e-60, Method: Compositional matrix adjust.
 Identities = 45/56 (80%), Positives = 49/56 (88%), Gaps = 0/56 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  196
            P    DFRCSD S+TIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  344  PLVSVDFRCSDFSTTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  399



>gb|KJB11771.1| hypothetical protein B456_001G276400 [Gossypium raimondii]
Length=403

 Score =   159 bits (401),  Expect(2) = 7e-60, Method: Compositional matrix adjust.
 Identities = 115/138 (83%), Positives = 128/138 (93%), Gaps = 1/138 (1%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  215  ISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  274

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR+++
Sbjct  275  PTSTGAAKAVALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRESA  333

Query  401  DGPLKGVLDVCDAPLVSL  348
            +  LKG+L VCD PLVS+
Sbjct  334  EKELKGILSVCDEPLVSV  351


 Score =   100 bits (248),  Expect(2) = 7e-60, Method: Compositional matrix adjust.
 Identities = 45/56 (80%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  196
            P    DFRCSDVSST+D+SLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  347  PLVSVDFRCSDVSSTVDASLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  402



>ref|XP_008797069.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Phoenix dactylifera]
 ref|XP_008797070.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Phoenix dactylifera]
Length=445

 Score =   158 bits (399),  Expect(2) = 8e-60, Method: Compositional matrix adjust.
 Identities = 115/138 (83%), Positives = 126/138 (91%), Gaps = 1/138 (1%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  257  ISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  316

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR  +
Sbjct  317  PTSTGAAKAVALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRDTA  375

Query  401  DGPLKGVLDVCDAPLVSL  348
            +  LKG+L VCD PLVS+
Sbjct  376  EKELKGILSVCDEPLVSV  393


 Score =   100 bits (249),  Expect(2) = 8e-60, Method: Compositional matrix adjust.
 Identities = 45/56 (80%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  196
            P    DFRC+DVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  389  PLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  444



>ref|XP_004304578.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Fragaria vesca subsp. vesca]
Length=404

 Score =   158 bits (400),  Expect(2) = 1e-59, Method: Compositional matrix adjust.
 Identities = 115/138 (83%), Positives = 127/138 (92%), Gaps = 1/138 (1%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  216  ISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  275

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR+++
Sbjct  276  PTSTGAAKAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVTKKTF-AEEVNAAFRESA  334

Query  401  DGPLKGVLDVCDAPLVSL  348
            D  L G+L VCD PLVS+
Sbjct  335  DKELAGILSVCDEPLVSV  352


 Score = 99.8 bits (247),  Expect(2) = 1e-59, Method: Compositional matrix adjust.
 Identities = 45/56 (80%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  196
            P    DFRC+DVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  348  PLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  403



>ref|XP_001779769.1| predicted protein [Physcomitrella patens]
 gb|EDQ55453.1| predicted protein [Physcomitrella patens]
Length=400

 Score =   154 bits (388),  Expect(2) = 1e-59, Method: Compositional matrix adjust.
 Identities = 116/139 (83%), Positives = 126/139 (91%), Gaps = 2/139 (1%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPFVKV+DE+FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  211  ISNASCTTNCLAPFVKVLDEKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  270

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAV+LVLP LKGK+NGIALRVPTPNVSVVDLVV V+KK   AE+VN AFR A 
Sbjct  271  PTSTGAAKAVALVLPNLKGKINGIALRVPTPNVSVVDLVVQVEKKTF-AEEVNQAFRDAC  329

Query  401  DGP-LKGVLDVCDAPLVSL  348
            +   LKGVL VCD PLVS+
Sbjct  330  ETEQLKGVLAVCDEPLVSV  348


 Score =   104 bits (259),  Expect(2) = 1e-59, Method: Compositional matrix adjust.
 Identities = 48/56 (86%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  196
            P    DFRC+DVSST+DSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLA+LVA KW
Sbjct  344  PLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLANLVAEKW  399



>dbj|BAJ34149.1| unnamed protein product [Thellungiella halophila]
Length=400

 Score =   156 bits (395),  Expect(2) = 1e-59, Method: Compositional matrix adjust.
 Identities = 115/138 (83%), Positives = 127/138 (92%), Gaps = 1/138 (1%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPFVKV+D++FGI+KGTMTTT SYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  212  ISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTPSYTGDQRLLDASHRDLRRARAAALNIV  271

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR A+
Sbjct  272  PTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRDAA  330

Query  401  DGPLKGVLDVCDAPLVSL  348
            +  LKG+L+VCD PLVS+
Sbjct  331  EKELKGILEVCDEPLVSV  348


 Score =   101 bits (252),  Expect(2) = 1e-59, Method: Compositional matrix adjust.
 Identities = 47/56 (84%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  196
            P    DFRCSDVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  344  PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  399



>emb|CAC80374.1| glyceraldehyde-3-phosphate dehydrogenase [Capsicum annuum]
Length=317

 Score =   184 bits (467),  Expect(2) = 1e-59, Method: Compositional matrix adjust.
 Identities = 125/138 (91%), Positives = 134/138 (97%), Gaps = 0/138 (0%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            VSNASCTTNCLAPF K++DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  145  VSNASCTTNCLAPFAKILDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  204

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLV+NV+KKG+TAEDVNAAFRK++
Sbjct  205  PTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVINVEKKGITAEDVNAAFRKSA  264

Query  401  DGPLKGVLDVCDAPLVSL  348
            DGPL G+L VCD PLVS+
Sbjct  265  DGPLNGILAVCDVPLVSV  282


 Score = 73.9 bits (180),  Expect(2) = 1e-59, Method: Compositional matrix adjust.
 Identities = 33/39 (85%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEW  247
            P    DFRCSDVS+TIDSSLTMVMGDDMVK+VAWYDNEW
Sbjct  278  PLVSVDFRCSDVSTTIDSSLTMVMGDDMVKIVAWYDNEW  316



>ref|XP_001779753.1| predicted protein [Physcomitrella patens]
 gb|EDQ55437.1| predicted protein [Physcomitrella patens]
Length=406

 Score =   154 bits (388),  Expect(2) = 1e-59, Method: Compositional matrix adjust.
 Identities = 116/139 (83%), Positives = 126/139 (91%), Gaps = 2/139 (1%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPFVKV+DE+FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  217  ISNASCTTNCLAPFVKVLDEKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  276

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAV+LVLP LKGK+NGIALRVPTPNVSVVDLVV V+KK   AE+VN AFR A 
Sbjct  277  PTSTGAAKAVALVLPNLKGKINGIALRVPTPNVSVVDLVVQVEKKTF-AEEVNQAFRDAC  335

Query  401  DGP-LKGVLDVCDAPLVSL  348
            +   LKGVL VCD PLVS+
Sbjct  336  ETEQLKGVLAVCDEPLVSV  354


 Score =   104 bits (259),  Expect(2) = 1e-59, Method: Compositional matrix adjust.
 Identities = 48/56 (86%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  196
            P    DFRC+DVSST+DSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLA+LVA KW
Sbjct  350  PLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLANLVAEKW  405



>ref|XP_001753934.1| predicted protein [Physcomitrella patens]
 gb|EDQ81256.1| predicted protein [Physcomitrella patens]
Length=406

 Score =   153 bits (386),  Expect(2) = 2e-59, Method: Compositional matrix adjust.
 Identities = 116/139 (83%), Positives = 125/139 (90%), Gaps = 2/139 (1%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPFVKV+DE+FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  217  ISNASCTTNCLAPFVKVLDEKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  276

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA-  405
            PTSTGAAKAV+LVLP LKGK+NGIALRVPTPNVSVVDLVV V+KK   AE+VN AFR A 
Sbjct  277  PTSTGAAKAVALVLPNLKGKINGIALRVPTPNVSVVDLVVQVEKKTF-AEEVNQAFRDAC  335

Query  404  SDGPLKGVLDVCDAPLVSL  348
                LKGVL VCD PLVS+
Sbjct  336  QTEQLKGVLAVCDEPLVSV  354


 Score =   104 bits (259),  Expect(2) = 2e-59, Method: Compositional matrix adjust.
 Identities = 48/56 (86%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  196
            P    DFRC+DVSST+DSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLA+LVA KW
Sbjct  350  PLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLANLVAEKW  405



>ref|XP_004975847.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
[Setaria italica]
Length=401

 Score =   157 bits (396),  Expect(2) = 2e-59, Method: Compositional matrix adjust.
 Identities = 115/138 (83%), Positives = 127/138 (92%), Gaps = 1/138 (1%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  213  ISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  272

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK L AE+VN AFR ++
Sbjct  273  PTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTL-AEEVNQAFRDSA  331

Query  401  DGPLKGVLDVCDAPLVSL  348
               L G+L+VCDAPLVS+
Sbjct  332  ANELAGILEVCDAPLVSV  349


 Score =   100 bits (248),  Expect(2) = 2e-59, Method: Compositional matrix adjust.
 Identities = 45/57 (79%), Positives = 50/57 (88%), Gaps = 0/57 (0%)
 Frame = -3

Query  366  CPSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  196
             P    DFRCSDVSST+D+SLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  344  APLVSVDFRCSDVSSTVDASLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  400



>gb|ABD37962.1| glyceraldehyde-3-phosphate dehydrogenase subunit A1, partial 
[Physcomitrella patens]
Length=378

 Score =   153 bits (386),  Expect(2) = 2e-59, Method: Compositional matrix adjust.
 Identities = 116/139 (83%), Positives = 125/139 (90%), Gaps = 2/139 (1%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPFVKV+DE+FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  189  ISNASCTTNCLAPFVKVLDEKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  248

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA-  405
            PTSTGAAKAV+LVLP LKGK+NGIALRVPTPNVSVVDLVV V+KK   AE+VN AFR A 
Sbjct  249  PTSTGAAKAVALVLPNLKGKINGIALRVPTPNVSVVDLVVQVEKKTF-AEEVNQAFRDAC  307

Query  404  SDGPLKGVLDVCDAPLVSL  348
                LKGVL VCD PLVS+
Sbjct  308  QTEQLKGVLAVCDEPLVSV  326


 Score =   103 bits (258),  Expect(2) = 2e-59, Method: Compositional matrix adjust.
 Identities = 48/56 (86%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  196
            P    DFRC+DVSST+DSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLA+LVA KW
Sbjct  322  PLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLANLVAEKW  377



>gb|AEH04452.1| glyceraldehyde-3-phosphate dehydrogenase [Arachis hypogaea]
Length=405

 Score =   157 bits (396),  Expect(2) = 3e-59, Method: Compositional matrix adjust.
 Identities = 114/138 (83%), Positives = 127/138 (92%), Gaps = 1/138 (1%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  217  ISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  276

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR+++
Sbjct  277  PTSTGAAKAVALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRESA  335

Query  401  DGPLKGVLDVCDAPLVSL  348
            +  L G+L VCD PLVS+
Sbjct  336  EKELNGILSVCDEPLVSV  353


 Score = 99.8 bits (247),  Expect(2) = 3e-59, Method: Compositional matrix adjust.
 Identities = 45/56 (80%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  196
            P    DFRC+DVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  349  PLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANSW  404



>emb|CDY48981.1| BnaA02g28150D [Brassica napus]
Length=368

 Score =   156 bits (395),  Expect(2) = 3e-59, Method: Compositional matrix adjust.
 Identities = 114/138 (83%), Positives = 126/138 (91%), Gaps = 1/138 (1%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  180  ISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  239

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAV+LVLP LKGK NGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR ++
Sbjct  240  PTSTGAAKAVALVLPNLKGKHNGIALRVPTPNVSVVDLVVQVTKKTF-AEEVNAAFRNSA  298

Query  401  DGPLKGVLDVCDAPLVSL  348
            +  LKG+L VCD PLVS+
Sbjct  299  EKELKGILKVCDEPLVSV  316


 Score =   100 bits (248),  Expect(2) = 3e-59, Method: Compositional matrix adjust.
 Identities = 46/56 (82%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  196
            P    DF+CSDVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  312  PLVSVDFKCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  367



>ref|XP_001766703.1| predicted protein [Physcomitrella patens]
 gb|EDQ68556.1| predicted protein [Physcomitrella patens]
Length=376

 Score =   154 bits (388),  Expect(2) = 4e-59, Method: Compositional matrix adjust.
 Identities = 116/139 (83%), Positives = 127/139 (91%), Gaps = 2/139 (1%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPFVKV+DE+FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  187  ISNASCTTNCLAPFVKVLDEKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  246

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAV+LVLP LKGK+NGIALRVPTPNVSVVDLVV V+KK  +AE+VN AFR A 
Sbjct  247  PTSTGAAKAVALVLPNLKGKINGIALRVPTPNVSVVDLVVQVEKK-TSAEEVNQAFRDAC  305

Query  401  D-GPLKGVLDVCDAPLVSL  348
            +   LKGVL VCD PLVS+
Sbjct  306  NTDQLKGVLAVCDEPLVSV  324


 Score =   102 bits (254),  Expect(2) = 4e-59, Method: Compositional matrix adjust.
 Identities = 47/56 (84%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  196
            P    DFRC+DVSST+DSSLTMVMG+DMVKVVAWYDNEWGYSQRVVDLA+LVA KW
Sbjct  320  PLVSVDFRCTDVSSTVDSSLTMVMGEDMVKVVAWYDNEWGYSQRVVDLANLVAEKW  375



>ref|XP_011399143.1| Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic [Auxenochlorella 
protothecoides]
 gb|KFM26247.1| Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic [Auxenochlorella 
protothecoides]
Length=412

 Score =   159 bits (403),  Expect(2) = 5e-59, Method: Compositional matrix adjust.
 Identities = 112/137 (82%), Positives = 126/137 (92%), Gaps = 1/137 (1%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPFVKV+++ FGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  224  ISNASCTTNCLAPFVKVLNDRFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  283

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PT+TGAAKAV+LVLPQLKGKLNG+ALRVPTP VSVVDLV+  +KK  T E+VN+AFR+AS
Sbjct  284  PTTTGAAKAVALVLPQLKGKLNGVALRVPTPTVSVVDLVIQTEKKTFT-EEVNSAFREAS  342

Query  401  DGPLKGVLDVCDAPLVS  351
            +G LKG+L V D PLVS
Sbjct  343  EGYLKGILAVSDEPLVS  359


 Score = 96.3 bits (238),  Expect(2) = 5e-59, Method: Compositional matrix adjust.
 Identities = 44/56 (79%), Positives = 49/56 (88%), Gaps = 0/56 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  196
            P    D+R +DVSSTID++LTMVMGDDMVKV+AWYDNEWGYSQRVVDLA LVA KW
Sbjct  356  PLVSCDYRMTDVSSTIDAALTMVMGDDMVKVIAWYDNEWGYSQRVVDLAELVAQKW  411



>ref|XP_007032095.1| Glyceraldehyde 3-phosphate dehydrogenase A subunit 2 [Theobroma 
cacao]
 gb|EOY03021.1| Glyceraldehyde 3-phosphate dehydrogenase A subunit 2 [Theobroma 
cacao]
Length=404

 Score =   155 bits (393),  Expect(2) = 5e-59, Method: Compositional matrix adjust.
 Identities = 114/138 (83%), Positives = 126/138 (91%), Gaps = 1/138 (1%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  216  ISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  275

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR ++
Sbjct  276  PTSTGAAKAVALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRDSA  334

Query  401  DGPLKGVLDVCDAPLVSL  348
            +  L G+L VCD PLVS+
Sbjct  335  EKELNGILSVCDEPLVSV  352


 Score = 99.8 bits (247),  Expect(2) = 5e-59, Method: Compositional matrix adjust.
 Identities = 45/56 (80%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  196
            P    DFRCSDVSST+D+SLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  348  PLVSVDFRCSDVSSTVDASLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  403



>tpg|DAA37469.1| TPA: glyceraldehyde-3-phosphate dehydrogenase1 [Zea mays]
Length=403

 Score =   158 bits (399),  Expect(2) = 6e-59, Method: Compositional matrix adjust.
 Identities = 116/138 (84%), Positives = 126/138 (91%), Gaps = 1/138 (1%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  215  ISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  274

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAVSLVLP LKGKLNGIALRVPTPNVSVVDLVV V KK L AE+VN AFR A+
Sbjct  275  PTSTGAAKAVSLVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTL-AEEVNQAFRDAA  333

Query  401  DGPLKGVLDVCDAPLVSL  348
               L G+L+VCD PLVS+
Sbjct  334  ANELTGILEVCDVPLVSV  351


 Score = 97.8 bits (242),  Expect(2) = 6e-59, Method: Compositional matrix adjust.
 Identities = 44/56 (79%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  196
            P    DFRCSDVSSTID+SLTMVMGDDMVKV++WYDNEWGYSQRVVDLA + A++W
Sbjct  347  PLVSVDFRCSDVSSTIDASLTMVMGDDMVKVISWYDNEWGYSQRVVDLADICANQW  402



>ref|XP_008379036.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Malus domestica]
Length=403

 Score =   155 bits (393),  Expect(2) = 6e-59, Method: Compositional matrix adjust.
 Identities = 114/138 (83%), Positives = 126/138 (91%), Gaps = 1/138 (1%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  215  ISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  274

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR ++
Sbjct  275  PTSTGAAKAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVTKKTF-AEEVNAAFRDSA  333

Query  401  DGPLKGVLDVCDAPLVSL  348
            +  L G+L VCD PLVS+
Sbjct  334  EKELAGILSVCDEPLVSV  351


 Score = 99.8 bits (247),  Expect(2) = 6e-59, Method: Compositional matrix adjust.
 Identities = 45/56 (80%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  196
            P    DFRC+DVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  347  PLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  402



>ref|NP_001105414.1| glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic precursor 
[Zea mays]
 sp|P09315.1|G3PA_MAIZE RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic; 
AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase subunit A; Flags: Precursor [Zea mays]
 gb|AAA33464.1| glyceraldehyde-3-phosphate dehydrogenase [Zea mays]
 emb|CAA33455.1| glyceraldehyde-3-phosphate dehydrogenase [Zea mays]
Length=403

 Score =   157 bits (398),  Expect(2) = 6e-59, Method: Compositional matrix adjust.
 Identities = 116/138 (84%), Positives = 126/138 (91%), Gaps = 1/138 (1%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  215  ISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  274

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAVSLVLP LKGKLNGIALRVPTPNVSVVDLVV V KK L AE+VN AFR A+
Sbjct  275  PTSTGAAKAVSLVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTL-AEEVNQAFRDAA  333

Query  401  DGPLKGVLDVCDAPLVSL  348
               L G+L+VCD PLVS+
Sbjct  334  ANELTGILEVCDVPLVSV  351


 Score = 97.8 bits (242),  Expect(2) = 6e-59, Method: Compositional matrix adjust.
 Identities = 44/56 (79%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  196
            P    DFRCSDVSSTID+SLTMVMGDDMVKV++WYDNEWGYSQRVVDLA + A++W
Sbjct  347  PLVSVDFRCSDVSSTIDASLTMVMGDDMVKVISWYDNEWGYSQRVVDLADICANQW  402



>gb|ABD37963.1| glyceraldehyde-3-phosphate dehydrogenase subunit A2 [Physcomitrella 
patens]
Length=323

 Score =   154 bits (388),  Expect(2) = 6e-59, Method: Compositional matrix adjust.
 Identities = 116/139 (83%), Positives = 127/139 (91%), Gaps = 2/139 (1%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPFVKV+DE+FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  134  ISNASCTTNCLAPFVKVLDEKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  193

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAV+LVLP LKGK+NGIALRVPTPNVSVVDLVV V+KK  +AE+VN AFR A 
Sbjct  194  PTSTGAAKAVALVLPNLKGKINGIALRVPTPNVSVVDLVVQVEKK-TSAEEVNQAFRDAC  252

Query  401  D-GPLKGVLDVCDAPLVSL  348
            +   LKGVL VCD PLVS+
Sbjct  253  NTDQLKGVLAVCDEPLVSV  271


 Score =   102 bits (253),  Expect(2) = 6e-59, Method: Compositional matrix adjust.
 Identities = 47/56 (84%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  196
            P    DFRC+DVSST+DSSLTMVMG+DMVKVVAWYDNEWGYSQRVVDLA+LVA KW
Sbjct  267  PLVSVDFRCTDVSSTVDSSLTMVMGEDMVKVVAWYDNEWGYSQRVVDLANLVAEKW  322



>ref|XP_009378071.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
isoform X1 [Pyrus x bretschneideri]
Length=403

 Score =   155 bits (392),  Expect(2) = 7e-59, Method: Compositional matrix adjust.
 Identities = 114/138 (83%), Positives = 126/138 (91%), Gaps = 1/138 (1%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  215  ISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  274

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR ++
Sbjct  275  PTSTGAAKAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVTKKTF-AEEVNAAFRDSA  333

Query  401  DGPLKGVLDVCDAPLVSL  348
            +  L G+L VCD PLVS+
Sbjct  334  EKELAGILSVCDEPLVSV  351


 Score = 99.8 bits (247),  Expect(2) = 7e-59, Method: Compositional matrix adjust.
 Identities = 45/56 (80%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  196
            P    DFRC+DVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  347  PLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  402



>ref|XP_007217883.1| hypothetical protein PRUPE_ppa006610mg [Prunus persica]
 gb|EMJ19082.1| hypothetical protein PRUPE_ppa006610mg [Prunus persica]
Length=403

 Score =   155 bits (392),  Expect(2) = 7e-59, Method: Compositional matrix adjust.
 Identities = 115/138 (83%), Positives = 125/138 (91%), Gaps = 1/138 (1%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  215  ISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  274

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR +S
Sbjct  275  PTSTGAAKAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVTKKTF-AEEVNAAFRDSS  333

Query  401  DGPLKGVLDVCDAPLVSL  348
               L G+L VCD PLVS+
Sbjct  334  AKELAGILSVCDEPLVSV  351


 Score = 99.8 bits (247),  Expect(2) = 7e-59, Method: Compositional matrix adjust.
 Identities = 45/56 (80%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  196
            P    DFRC+DVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  347  PLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  402



>gb|AAG23800.1| chloroplast NADP-dependent glyceraldehyde 3-phosphate dehydrogenase 
B subunit [Cucurbita pepo]
Length=171

 Score =   183 bits (465),  Expect(2) = 8e-59, Method: Compositional matrix adjust.
 Identities = 125/136 (92%), Positives = 134/136 (99%), Gaps = 0/136 (0%)
 Frame = -1

Query  755  NASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPT  576
            NASCTTNCLAPFVK++DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPT
Sbjct  1    NASCTTNCLAPFVKIIDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPT  60

Query  575  STGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDG  396
            STGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVN++KKG++A+DVNAAFRKA+DG
Sbjct  61   STGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNIEKKGISADDVNAAFRKAADG  120

Query  395  PLKGVLDVCDAPLVSL  348
            PLKGVL VCD PLVS+
Sbjct  121  PLKGVLAVCDIPLVSV  136


 Score = 71.6 bits (174),  Expect(2) = 8e-59, Method: Compositional matrix adjust.
 Identities = 32/40 (80%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWG  244
            P    DF+C+DVSSTIDSSLTMVMGDDM+KVVAWYDN+WG
Sbjct  132  PLVSVDFKCTDVSSTIDSSLTMVMGDDMLKVVAWYDNDWG  171



>ref|XP_008362077.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Malus domestica]
Length=403

 Score =   155 bits (393),  Expect(2) = 8e-59, Method: Compositional matrix adjust.
 Identities = 114/138 (83%), Positives = 126/138 (91%), Gaps = 1/138 (1%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  215  ISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  274

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR ++
Sbjct  275  PTSTGAAKAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVTKKTF-AEEVNAAFRDSA  333

Query  401  DGPLKGVLDVCDAPLVSL  348
            +  L G+L VCD PLVS+
Sbjct  334  EKELAGILSVCDEPLVSV  351


 Score = 99.8 bits (247),  Expect(2) = 8e-59, Method: Compositional matrix adjust.
 Identities = 45/56 (80%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  196
            P    DFRC+DVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  347  PLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  402



>ref|XP_008231212.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Prunus mume]
Length=403

 Score =   155 bits (392),  Expect(2) = 8e-59, Method: Compositional matrix adjust.
 Identities = 115/138 (83%), Positives = 125/138 (91%), Gaps = 1/138 (1%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  215  ISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  274

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR +S
Sbjct  275  PTSTGAAKAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVTKKTF-AEEVNAAFRDSS  333

Query  401  DGPLKGVLDVCDAPLVSL  348
               L G+L VCD PLVS+
Sbjct  334  AKELAGILSVCDEPLVSV  351


 Score = 99.8 bits (247),  Expect(2) = 8e-59, Method: Compositional matrix adjust.
 Identities = 45/56 (80%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  196
            P    DFRC+DVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  347  PLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  402



>emb|CAA30152.1| GADPH (383 AA) [Zea mays]
Length=383

 Score =   157 bits (398),  Expect(2) = 9e-59, Method: Compositional matrix adjust.
 Identities = 116/138 (84%), Positives = 126/138 (91%), Gaps = 1/138 (1%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  195  ISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  254

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAVSLVLP LKGKLNGIALRVPTPNVSVVDLVV V KK L AE+VN AFR A+
Sbjct  255  PTSTGAAKAVSLVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTL-AEEVNQAFRDAA  313

Query  401  DGPLKGVLDVCDAPLVSL  348
               L G+L+VCD PLVS+
Sbjct  314  ANELTGILEVCDVPLVSV  331


 Score = 97.4 bits (241),  Expect(2) = 9e-59, Method: Compositional matrix adjust.
 Identities = 44/56 (79%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  196
            P    DFRCSDVSSTID+SLTMVMGDDMVKV++WYDNEWGYSQRVVDLA + A++W
Sbjct  327  PLVSVDFRCSDVSSTIDASLTMVMGDDMVKVISWYDNEWGYSQRVVDLADICANQW  382



>ref|XP_009378072.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
isoform X2 [Pyrus x bretschneideri]
Length=355

 Score =   155 bits (392),  Expect(2) = 9e-59, Method: Compositional matrix adjust.
 Identities = 114/138 (83%), Positives = 126/138 (91%), Gaps = 1/138 (1%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  167  ISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  226

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR ++
Sbjct  227  PTSTGAAKAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVTKKTF-AEEVNAAFRDSA  285

Query  401  DGPLKGVLDVCDAPLVSL  348
            +  L G+L VCD PLVS+
Sbjct  286  EKELAGILSVCDEPLVSV  303


 Score = 99.8 bits (247),  Expect(2) = 9e-59, Method: Compositional matrix adjust.
 Identities = 45/56 (80%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  196
            P    DFRC+DVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  299  PLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  354



>gb|AFC88822.1| glyceraldehyde-3-phosphate dehydrogenase-like protein, partial 
[Miscanthus sinensis]
Length=316

 Score =   157 bits (397),  Expect(2) = 1e-58, Method: Compositional matrix adjust.
 Identities = 116/138 (84%), Positives = 126/138 (91%), Gaps = 1/138 (1%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  128  ISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  187

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAVSLVLP LKGKLNGIALRVPTPNVSVVDLVV V KK L AE+VN AFR A+
Sbjct  188  PTSTGAAKAVSLVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTL-AEEVNQAFRDAA  246

Query  401  DGPLKGVLDVCDAPLVSL  348
               L G+L+VCD PLVS+
Sbjct  247  ANELIGILEVCDVPLVSV  264


 Score = 97.8 bits (242),  Expect(2) = 1e-58, Method: Compositional matrix adjust.
 Identities = 45/56 (80%), Positives = 49/56 (88%), Gaps = 0/56 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  196
            P    DFRCSDVSSTID+SLTMVMGDDMVKV++WYDNEWGYSQRVVDLA + A KW
Sbjct  260  PLVSVDFRCSDVSSTIDASLTMVMGDDMVKVISWYDNEWGYSQRVVDLADICAIKW  315



>ref|NP_001052984.1| Os04g0459500 [Oryza sativa Japonica Group]
 emb|CAD40906.1| OSJNBa0036B21.24 [Oryza sativa Japonica Group]
 emb|CAE01532.1| OSJNBa0072F16.1 [Oryza sativa Japonica Group]
 dbj|BAF14898.1| Os04g0459500 [Oryza sativa Japonica Group]
 emb|CAH67076.1| OSIGBa0097P08.6 [Oryza sativa Indica Group]
 emb|CAH67444.1| H0219H12.1 [Oryza sativa Indica Group]
 gb|EAY94393.1| hypothetical protein OsI_16160 [Oryza sativa Indica Group]
 gb|EAZ30968.1| hypothetical protein OsJ_15048 [Oryza sativa Japonica Group]
 dbj|BAG92628.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96321.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96327.1| unnamed protein product [Oryza sativa Japonica Group]
 emb|CBW45779.1| ORW1943Ba0077G13.7 [Oryza rufipogon]
Length=402

 Score =   157 bits (397),  Expect(2) = 1e-58, Method: Compositional matrix adjust.
 Identities = 114/138 (83%), Positives = 127/138 (92%), Gaps = 1/138 (1%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPFVK++D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  214  ISNASCTTNCLAPFVKILDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  273

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK L AE+VN AFR ++
Sbjct  274  PTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTL-AEEVNQAFRDSA  332

Query  401  DGPLKGVLDVCDAPLVSL  348
               LKG+L+VCD PLVS+
Sbjct  333  ANELKGILEVCDVPLVSV  350


 Score = 97.4 bits (241),  Expect(2) = 1e-58, Method: Compositional matrix adjust.
 Identities = 44/56 (79%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  196
            P    DFRCSDVS TID+SL+MVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA++W
Sbjct  346  PLVSVDFRCSDVSCTIDASLSMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQW  401



>ref|XP_010090946.1| Glyceraldehyde-3-phosphate dehydrogenase A [Morus notabilis]
 gb|EXB41431.1| Glyceraldehyde-3-phosphate dehydrogenase A [Morus notabilis]
Length=404

 Score =   154 bits (390),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 113/138 (82%), Positives = 126/138 (91%), Gaps = 1/138 (1%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPFVKV+D++F I+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  216  ISNASCTTNCLAPFVKVLDQKFSIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  275

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR+++
Sbjct  276  PTSTGAAKAVALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRESA  334

Query  401  DGPLKGVLDVCDAPLVSL  348
            +  L G+L VCD PLVS+
Sbjct  335  EKELNGILSVCDEPLVSV  352


 Score = 99.0 bits (245),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 44/56 (79%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  196
            P    DFRC+DVSST+D+SLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  348  PLVSVDFRCTDVSSTVDASLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  403



>ref|XP_003624553.1| Glyceraldehyde-3-phosphate dehydrogenase A [Medicago truncatula]
 gb|AES80771.1| glyceraldehyde-3-phosphate dehydrogenase [Medicago truncatula]
Length=404

 Score =   153 bits (387),  Expect(2) = 4e-58, Method: Compositional matrix adjust.
 Identities = 113/138 (82%), Positives = 124/138 (90%), Gaps = 1/138 (1%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  216  ISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  275

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VN AFR ++
Sbjct  276  PTSTGAAKAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNEAFRDSA  334

Query  401  DGPLKGVLDVCDAPLVSL  348
               L G+L VCD PLVS+
Sbjct  335  AKELSGILSVCDEPLVSV  352


 Score = 99.8 bits (247),  Expect(2) = 4e-58, Method: Compositional matrix adjust.
 Identities = 45/56 (80%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  196
            P    DFRC+DVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  348  PLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  403



>gb|ACV32597.1| putative glyceraldehyde-3-phosphate dehydrogenase [Medicago sativa]
Length=404

 Score =   153 bits (386),  Expect(2) = 4e-58, Method: Compositional matrix adjust.
 Identities = 113/138 (82%), Positives = 124/138 (90%), Gaps = 1/138 (1%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  216  ISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  275

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VN AFR ++
Sbjct  276  PTSTGAAKAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNEAFRDSA  334

Query  401  DGPLKGVLDVCDAPLVSL  348
               L G+L VCD PLVS+
Sbjct  335  AKELSGILSVCDEPLVSV  352


 Score = 99.8 bits (247),  Expect(2) = 4e-58, Method: Compositional matrix adjust.
 Identities = 45/56 (80%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  196
            P    DFRC+DVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  348  PLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  403



>ref|XP_004493116.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
[Cicer arietinum]
Length=405

 Score =   154 bits (388),  Expect(2) = 4e-58, Method: Compositional matrix adjust.
 Identities = 113/138 (82%), Positives = 125/138 (91%), Gaps = 1/138 (1%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  217  ISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  276

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VN AFR+++
Sbjct  277  PTSTGAAKAVALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVTKKTF-AEEVNEAFRESA  335

Query  401  DGPLKGVLDVCDAPLVSL  348
               L G+L VCD PLVS+
Sbjct  336  ANELNGILSVCDEPLVSV  353


 Score = 99.0 bits (245),  Expect(2) = 4e-58, Method: Compositional matrix adjust.
 Identities = 44/56 (79%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  196
            P    DFRC+DVSST+DSSLTMVMGDD+VKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  349  PLVSVDFRCTDVSSTVDSSLTMVMGDDLVKVIAWYDNEWGYSQRVVDLADIVANNW  404



>gb|ACT21568.1| glyceraldehyde-3-phosphate dehydrogenase [Bruguiera gymnorhiza]
Length=405

 Score =   154 bits (390),  Expect(2) = 5e-58, Method: Compositional matrix adjust.
 Identities = 113/138 (82%), Positives = 126/138 (91%), Gaps = 1/138 (1%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPFVKV+D++ GI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  217  ISNASCTTNCLAPFVKVLDQKSGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  276

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAK V+LVLP L+GKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR+++
Sbjct  277  PTSTGAAKPVALVLPTLRGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRESA  335

Query  401  DGPLKGVLDVCDAPLVSL  348
            D  LKG+L VCD PLVS+
Sbjct  336  DKELKGILSVCDEPLVSV  353


 Score = 98.2 bits (243),  Expect(2) = 5e-58, Method: Compositional matrix adjust.
 Identities = 45/56 (80%), Positives = 48/56 (86%), Gaps = 0/56 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  196
            P    DFRC DVSST+DSSLTMVMGDDMVKV+AWYDNEWGY QRVVDLA +VA KW
Sbjct  349  PLVSVDFRCRDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYFQRVVDLADVVAEKW  404



>ref|XP_007510189.1| glyceraldehyde-3-phosphate dehydrogenase [Bathycoccus prasinos]
 emb|CCO18534.1| glyceraldehyde-3-phosphate dehydrogenase [Bathycoccus prasinos]
Length=379

 Score =   157 bits (396),  Expect(2) = 5e-58, Method: Compositional matrix adjust.
 Identities = 110/138 (80%), Positives = 128/138 (93%), Gaps = 1/138 (1%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTN LAPFVKV++++FG+VKG MTTTHSYTGDQ++LDASHRDLRRARAAALNIV
Sbjct  191  ISNASCTTNGLAPFVKVLNDKFGLVKGLMTTTHSYTGDQKILDASHRDLRRARAAALNIV  250

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAV+LVLP+LKGKLNGIALRVPTPNVSVVDLV+   KK +TAE+VN AFR+++
Sbjct  251  PTSTGAAKAVALVLPELKGKLNGIALRVPTPNVSVVDLVIQTSKK-VTAEEVNNAFRESA  309

Query  401  DGPLKGVLDVCDAPLVSL  348
             GPLKG+L VCD PLVS+
Sbjct  310  AGPLKGILSVCDEPLVSV  327


 Score = 95.5 bits (236),  Expect(2) = 5e-58, Method: Compositional matrix adjust.
 Identities = 42/56 (75%), Positives = 48/56 (86%), Gaps = 0/56 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  196
            P    DFRC+D S+TIDS+LTMV+GDDM+KVVAWYDNEWGYSQRVVDLA L A+ W
Sbjct  323  PLVSVDFRCTDQSTTIDSALTMVIGDDMLKVVAWYDNEWGYSQRVVDLAELTAANW  378



>emb|CAA33264.1| unnamed protein product [Pisum sativum]
Length=405

 Score =   153 bits (387),  Expect(2) = 7e-58, Method: Compositional matrix adjust.
 Identities = 113/138 (82%), Positives = 125/138 (91%), Gaps = 1/138 (1%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  217  ISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  276

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VN AFR+++
Sbjct  277  PTSTGAAKAVALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNEAFRESA  335

Query  401  DGPLKGVLDVCDAPLVSL  348
               L G+L VCD PLVS+
Sbjct  336  AKELTGILSVCDEPLVSV  353


 Score = 98.6 bits (244),  Expect(2) = 7e-58, Method: Compositional matrix adjust.
 Identities = 44/56 (79%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  196
            P    DFRC+DVSST+DSSLTMVMGDD+VKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  349  PLVSVDFRCTDVSSTVDSSLTMVMGDDLVKVIAWYDNEWGYSQRVVDLADIVANNW  404



>gb|ADH43199.1| glyceraldehyde-3-phosphate dehydrogenase [Vicia sativa]
Length=380

 Score =   186 bits (471),  Expect(2) = 7e-58, Method: Compositional matrix adjust.
 Identities = 127/138 (92%), Positives = 135/138 (98%), Gaps = 0/138 (0%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPF KV+DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  212  ISNASCTTNCLAPFAKVLDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  271

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV KKG++AEDVNAAFRKA+
Sbjct  272  PTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVAKKGISAEDVNAAFRKAA  331

Query  401  DGPLKGVLDVCDAPLVSL  348
            +GPLKG+LDVCD PLVS+
Sbjct  332  EGPLKGILDVCDVPLVSV  349


 Score = 66.2 bits (160),  Expect(2) = 7e-58, Method: Compositional matrix adjust.
 Identities = 31/36 (86%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYD  256
            P    DFRCSDVS+TIDSSLTMVMGDDMVKVVAWYD
Sbjct  345  PLVSVDFRCSDVSTTIDSSLTMVMGDDMVKVVAWYD  380



>sp|P12858.2|G3PA_PEA RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic; 
AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase subunit A; Flags: Precursor [Pisum sativum]
 emb|CAA36396.1| glyceraldehyde-3-phosphate dehydrogenase [Pisum sativum]
Length=405

 Score =   153 bits (387),  Expect(2) = 7e-58, Method: Compositional matrix adjust.
 Identities = 113/138 (82%), Positives = 125/138 (91%), Gaps = 1/138 (1%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  217  ISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  276

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VN AFR+++
Sbjct  277  PTSTGAAKAVALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNEAFRESA  335

Query  401  DGPLKGVLDVCDAPLVSL  348
               L G+L VCD PLVS+
Sbjct  336  AKELTGILSVCDEPLVSV  353


 Score = 98.6 bits (244),  Expect(2) = 7e-58, Method: Compositional matrix adjust.
 Identities = 44/56 (79%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  196
            P    DFRC+DVSST+DSSLTMVMGDD+VKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  349  PLVSVDFRCTDVSSTVDSSLTMVMGDDLVKVIAWYDNEWGYSQRVVDLADIVANNW  404



>ref|NP_001289256.1| glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic [Pyrus 
x bretschneideri]
 gb|AFG28404.1| glyceraldehyde-3-phosphate dehydrogenase A [Pyrus x bretschneideri]
Length=403

 Score =   152 bits (385),  Expect(2) = 8e-58, Method: Compositional matrix adjust.
 Identities = 113/138 (82%), Positives = 125/138 (91%), Gaps = 1/138 (1%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  215  ISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  274

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR ++
Sbjct  275  PTSTGAAKAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVTKKTF-AEEVNAAFRDSA  333

Query  401  DGPLKGVLDVCDAPLVSL  348
            +  L G+L VCD  LVS+
Sbjct  334  EKELAGILSVCDESLVSV  351


 Score = 99.4 bits (246),  Expect(2) = 8e-58, Method: Compositional matrix adjust.
 Identities = 44/51 (86%), Positives = 49/51 (96%), Gaps = 0/51 (0%)
 Frame = -3

Query  348  DFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  196
            DFRC+DVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  352  DFRCTDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  402



>gb|AHA84230.1| glyceraldehyde-3-phosphate dehydrogenase A [Phaseolus vulgaris]
Length=402

 Score =   148 bits (373),  Expect(2) = 3e-57, Method: Compositional matrix adjust.
 Identities = 110/138 (80%), Positives = 124/138 (90%), Gaps = 2/138 (1%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPFVKV+D++FGI+KGTMTTT SYTGD+  LDASHRDLRRARAAALNIV
Sbjct  215  ISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTPSYTGDR-ALDASHRDLRRARAAALNIV  273

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR+++
Sbjct  274  PTSTGAAKAVALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRESA  332

Query  401  DGPLKGVLDVCDAPLVSL  348
            +  LKG+L VCD P VS+
Sbjct  333  EKELKGILSVCDEPFVSV  350


 Score =   102 bits (253),  Expect(2) = 3e-57, Method: Compositional matrix adjust.
 Identities = 46/56 (82%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  196
            P    DFRC+DVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+KW
Sbjct  346  PFVSVDFRCTDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANKW  401



>emb|CAC80390.1| glyceraldehyde-3-phosphate dehydrogenase [Coleochaete scutata]
Length=317

 Score =   171 bits (434),  Expect(2) = 6e-57, Method: Compositional matrix adjust.
 Identities = 121/138 (88%), Positives = 128/138 (93%), Gaps = 0/138 (0%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPFVK+MD EFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  144  ISNASCTTNCLAPFVKIMDAEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  203

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAV+LVLPQLKGKLNGIALRVPTPNVSVVDLVVN  KKG TAEDVN AFR A+
Sbjct  204  PTSTGAAKAVALVLPQLKGKLNGIALRVPTPNVSVVDLVVNTVKKGFTAEDVNTAFRNAA  263

Query  401  DGPLKGVLDVCDAPLVSL  348
            +G LKG+L V D PLVS+
Sbjct  264  NGSLKGILGVSDLPLVSI  281


 Score = 77.4 bits (189),  Expect(2) = 6e-57, Method: Compositional matrix adjust.
 Identities = 35/41 (85%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGY  241
            P    DFRCSD SSTIDSSLTMVMGDDM+KVVAWYDNEWGY
Sbjct  277  PLVSIDFRCSDESSTIDSSLTMVMGDDMLKVVAWYDNEWGY  317



>gb|ABG85190.1| chloroplast glyceraldehyde-3-phosphate dehydrogenase subunit 
A [Ostreococcus 'lucimarinus']
Length=380

 Score =   153 bits (387),  Expect(2) = 6e-57, Method: Compositional matrix adjust.
 Identities = 113/137 (82%), Positives = 124/137 (91%), Gaps = 1/137 (1%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            VSNASCTTN LAPFVKV+D+ FGIVKG MTTTHSYTGDQR+LDASHRDLRRARAAALNIV
Sbjct  192  VSNASCTTNGLAPFVKVLDDRFGIVKGLMTTTHSYTGDQRILDASHRDLRRARAAALNIV  251

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAV+LVLPQLKGKLNGIALRVPTPNVSVVDLV+   KK +TA++VNAAFR+ +
Sbjct  252  PTSTGAAKAVALVLPQLKGKLNGIALRVPTPNVSVVDLVIQTSKK-VTADEVNAAFREEA  310

Query  401  DGPLKGVLDVCDAPLVS  351
             G LKG+L V D PLVS
Sbjct  311  AGKLKGILAVADEPLVS  327


 Score = 95.5 bits (236),  Expect(2) = 6e-57, Method: Compositional matrix adjust.
 Identities = 42/56 (75%), Positives = 49/56 (88%), Gaps = 0/56 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  196
            P    DF+CSDVS++ID++LTMVMGDDM+KVVAWYDNEWGYSQRVVDLA L A+ W
Sbjct  324  PLVSCDFKCSDVSTSIDAALTMVMGDDMLKVVAWYDNEWGYSQRVVDLAELCAANW  379



>ref|XP_001420043.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO98336.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=341

 Score =   153 bits (386),  Expect(2) = 1e-56, Method: Compositional matrix adjust.
 Identities = 113/137 (82%), Positives = 124/137 (91%), Gaps = 1/137 (1%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            VSNASCTTN LAPFVKV+D+ FGIVKG MTTTHSYTGDQR+LDASHRDLRRARAAALNIV
Sbjct  153  VSNASCTTNGLAPFVKVLDDRFGIVKGLMTTTHSYTGDQRILDASHRDLRRARAAALNIV  212

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAV+LVLPQLKGKLNGIALRVPTPNVSVVDLV+   KK +TA++VNAAFR+ +
Sbjct  213  PTSTGAAKAVALVLPQLKGKLNGIALRVPTPNVSVVDLVIQTSKK-VTADEVNAAFREEA  271

Query  401  DGPLKGVLDVCDAPLVS  351
             G LKG+L V D PLVS
Sbjct  272  AGKLKGILAVADEPLVS  288


 Score = 94.7 bits (234),  Expect(2) = 1e-56, Method: Compositional matrix adjust.
 Identities = 42/56 (75%), Positives = 49/56 (88%), Gaps = 0/56 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  196
            P    DF+CSDVS++ID++LTMVMGDDM+KVVAWYDNEWGYSQRVVDLA L A+ W
Sbjct  285  PLVSCDFKCSDVSTSIDAALTMVMGDDMLKVVAWYDNEWGYSQRVVDLAELCAANW  340



>gb|ABS72003.1| putative chloroplast glyceradehyde-3-phosphate dehydrogenase 
subunit B [Olea europaea]
Length=149

 Score =   153 bits (387),  Expect(2) = 4e-56, Method: Compositional matrix adjust.
 Identities = 71/86 (83%), Positives = 77/86 (90%), Gaps = 0/86 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVA  184
            P    DFRC+DVS+TIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVA KWPG+A
Sbjct  64   PLVSVDFRCTDVSATIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVAYKWPGMA  123

Query  183  VAGSGDPLEDYCKTNPGDKECKVFEA  106
               SGDPLED+CKTNP D+ECKV+EA
Sbjct  124  AQESGDPLEDFCKTNPADEECKVYEA  149


 Score = 92.8 bits (229),  Expect(2) = 4e-56, Method: Compositional matrix adjust.
 Identities = 61/68 (90%), Positives = 66/68 (97%), Gaps = 0/68 (0%)
 Frame = -1

Query  551  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  372
            SLVLPQLKGKLNGIALRVPTPNVSVVDLVVN++KKG+TAEDVNAAFRKA+DGPLKGVL V
Sbjct  1    SLVLPQLKGKLNGIALRVPTPNVSVVDLVVNIEKKGITAEDVNAAFRKAADGPLKGVLAV  60

Query  371  CDAPLVSL  348
            CD PLVS+
Sbjct  61   CDVPLVSV  68



>ref|XP_010528120.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
isoform X2 [Tarenaya hassleriana]
Length=280

 Score =   163 bits (413),  Expect(2) = 5e-56, Method: Compositional matrix adjust.
 Identities = 116/138 (84%), Positives = 129/138 (93%), Gaps = 1/138 (1%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPFVK++D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  92   ISNASCTTNCLAPFVKILDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  151

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR+A+
Sbjct  152  PTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFREAA  210

Query  401  DGPLKGVLDVCDAPLVSL  348
            D  LKG+L+VCD PLVS+
Sbjct  211  DNELKGILEVCDEPLVSV  228


 Score = 82.4 bits (202),  Expect(2) = 5e-56, Method: Compositional matrix adjust.
 Identities = 46/56 (82%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  196
            P    DFRCSDVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  224  PLVSVDFRCSDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  279



>gb|AEO45783.1| glyceraldehyde-3-phosphate dehydrogenase A [Scoparia dulcis]
Length=398

 Score =   162 bits (409),  Expect(2) = 5e-56, Method: Compositional matrix adjust.
 Identities = 116/138 (84%), Positives = 128/138 (93%), Gaps = 1/138 (1%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  210  ISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  269

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAV+LVLPQLKGKLNGIALRVPTPNVSVVDLVV V+KK   AE+VNAAFR+ +
Sbjct  270  PTSTGAAKAVALVLPQLKGKLNGIALRVPTPNVSVVDLVVQVEKKTF-AEEVNAAFRETA  328

Query  401  DGPLKGVLDVCDAPLVSL  348
            D  L G+L VCD PLVS+
Sbjct  329  DKELNGILSVCDEPLVSV  346


 Score = 84.0 bits (206),  Expect(2) = 5e-56, Method: Compositional matrix adjust.
 Identities = 47/56 (84%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  196
            P    DFRCSDVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+KW
Sbjct  342  PLVSVDFRCSDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANKW  397



>gb|ABD37954.1| glyceraldehyde-3-phosphate dehydrogenase subunit A [Cyanophora 
paradoxa]
Length=412

 Score =   150 bits (379),  Expect(2) = 6e-56, Method: Compositional matrix adjust.
 Identities = 112/137 (82%), Positives = 125/137 (91%), Gaps = 1/137 (1%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            VSNASCTTNCLAPFVKV+DE+F I+KGTMTTTHSYTGDQRLLDASHRDLRRARAAA+NIV
Sbjct  225  VSNASCTTNCLAPFVKVLDEKFKIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAAMNIV  284

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAV+LVLP LKGKLNG+ALRVPTPNVS+VDLVV V+KK   A++VNAA R+A+
Sbjct  285  PTSTGAAKAVALVLPNLKGKLNGLALRVPTPNVSIVDLVVQVEKKTF-ADEVNAALREAA  343

Query  401  DGPLKGVLDVCDAPLVS  351
            +  LKGVL V D PLVS
Sbjct  344  NTDLKGVLVVSDEPLVS  360


 Score = 95.1 bits (235),  Expect(2) = 6e-56, Method: Compositional matrix adjust.
 Identities = 44/53 (83%), Positives = 48/53 (91%), Gaps = 2/53 (4%)
 Frame = -3

Query  360  SCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVAS  202
            SC  DFRC+D SSTID+SLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA 
Sbjct  360  SC--DFRCTDQSSTIDASLTMVMGDDMVKVIAWYDNEWGYSQRVVDLAEIVAQ  410



>ref|XP_010528117.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
isoform X1 [Tarenaya hassleriana]
Length=402

 Score =   163 bits (412),  Expect(2) = 7e-56, Method: Compositional matrix adjust.
 Identities = 116/138 (84%), Positives = 129/138 (93%), Gaps = 1/138 (1%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPFVK++D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  214  ISNASCTTNCLAPFVKILDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  273

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR+A+
Sbjct  274  PTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFREAA  332

Query  401  DGPLKGVLDVCDAPLVSL  348
            D  LKG+L+VCD PLVS+
Sbjct  333  DNELKGILEVCDEPLVSV  350


 Score = 82.4 bits (202),  Expect(2) = 7e-56, Method: Compositional matrix adjust.
 Identities = 46/56 (82%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  196
            P    DFRCSDVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  346  PLVSVDFRCSDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  401



>ref|XP_011070460.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Sesamum indicum]
Length=399

 Score =   163 bits (412),  Expect(2) = 7e-56, Method: Compositional matrix adjust.
 Identities = 117/138 (85%), Positives = 129/138 (93%), Gaps = 1/138 (1%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  211  ISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  270

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAV+LVLPQLKGKLNGIALRVPTPNVSVVDLVV V+KK   AE+VNAAFR+A+
Sbjct  271  PTSTGAAKAVALVLPQLKGKLNGIALRVPTPNVSVVDLVVQVEKKTF-AEEVNAAFREAA  329

Query  401  DGPLKGVLDVCDAPLVSL  348
            D  L G+L VCD PLVS+
Sbjct  330  DKELNGILSVCDEPLVSV  347


 Score = 82.0 bits (201),  Expect(2) = 7e-56, Method: Compositional matrix adjust.
 Identities = 46/56 (82%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  196
            P    DFRCSDVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  343  PLVSVDFRCSDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  398



>gb|EYU35565.1| hypothetical protein MIMGU_mgv1a005886mg [Erythranthe guttata]
Length=466

 Score =   163 bits (412),  Expect(2) = 9e-56, Method: Compositional matrix adjust.
 Identities = 117/138 (85%), Positives = 129/138 (93%), Gaps = 1/138 (1%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  278  ISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  337

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAV+LVLPQLKGKLNGIALRVPTPNVSVVDLVV V+KK   AE+VNAAFR+A+
Sbjct  338  PTSTGAAKAVALVLPQLKGKLNGIALRVPTPNVSVVDLVVQVEKKTF-AEEVNAAFREAA  396

Query  401  DGPLKGVLDVCDAPLVSL  348
            D  L G+L VCD PLVS+
Sbjct  397  DNELSGILAVCDEPLVSV  414


 Score = 82.0 bits (201),  Expect(2) = 9e-56, Method: Compositional matrix adjust.
 Identities = 46/56 (82%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  196
            P    DFRCSDVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  410  PLVSVDFRCSDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  465



>ref|XP_005644071.1| glyceraldehyde-3-phosphate dehydrogenase [Coccomyxa subellipsoidea 
C-169]
 gb|EIE19527.1| glyceraldehyde-3-phosphate dehydrogenase [Coccomyxa subellipsoidea 
C-169]
Length=393

 Score =   153 bits (386),  Expect(2) = 1e-55, Method: Compositional matrix adjust.
 Identities = 113/137 (82%), Positives = 124/137 (91%), Gaps = 1/137 (1%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPF KV+ E+FGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  206  ISNASCTTNCLAPFAKVLHEKFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  265

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PT+TGAAKAV+LVLP+LKGKLNGIALRVPTPNVSVVDLV+ V+KK L AE+VN AFR A+
Sbjct  266  PTTTGAAKAVALVLPELKGKLNGIALRVPTPNVSVVDLVIQVEKKTL-AEEVNEAFRNAA  324

Query  401  DGPLKGVLDVCDAPLVS  351
               LKG+L V D PLVS
Sbjct  325  ANELKGILAVSDVPLVS  341


 Score = 92.0 bits (227),  Expect(2) = 1e-55, Method: Compositional matrix adjust.
 Identities = 44/53 (83%), Positives = 46/53 (87%), Gaps = 0/53 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVA  205
            P    DF  +DVS+TIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLA LVA
Sbjct  338  PLVSRDFALTDVSTTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAELVA  390



>gb|AHZ94971.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Lilium regale]
Length=344

 Score =   163 bits (412),  Expect(2) = 2e-55, Method: Compositional matrix adjust.
 Identities = 117/138 (85%), Positives = 129/138 (93%), Gaps = 1/138 (1%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  156  ISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  215

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR+++
Sbjct  216  PTSTGAAKAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRESA  274

Query  401  DGPLKGVLDVCDAPLVSL  348
            DG LKG+L VCD PLVS+
Sbjct  275  DGELKGILSVCDEPLVSV  292


 Score = 80.9 bits (198),  Expect(2) = 2e-55, Method: Compositional matrix adjust.
 Identities = 45/56 (80%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  196
            P    DFRCSDVSST+DSSLT+VMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  288  PLVSVDFRCSDVSSTVDSSLTLVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  343



>ref|XP_009420999.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Musa acuminata subsp. malaccensis]
Length=402

 Score =   160 bits (406),  Expect(2) = 2e-55, Method: Compositional matrix adjust.
 Identities = 116/138 (84%), Positives = 127/138 (92%), Gaps = 1/138 (1%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPFVK++D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  214  ISNASCTTNCLAPFVKILDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  273

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR A+
Sbjct  274  PTSTGAAKAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRDAA  332

Query  401  DGPLKGVLDVCDAPLVSL  348
            D  LKG+L VCD PLVS+
Sbjct  333  DKELKGILSVCDEPLVSV  350


 Score = 82.8 bits (203),  Expect(2) = 2e-55, Method: Compositional matrix adjust.
 Identities = 46/56 (82%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  196
            P    DFRCSDVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA++W
Sbjct  346  PLVSVDFRCSDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQW  401



>gb|ABW89099.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABW89100.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABW89101.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABW89102.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABW89103.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABW89105.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABW89106.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABW89107.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABW89108.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABW89109.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABW89110.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABW89111.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABW89112.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABW89113.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABW89114.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABW89115.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABW89116.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABW89117.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
Length=206

 Score =   162 bits (409),  Expect(2) = 2e-55, Method: Compositional matrix adjust.
 Identities = 116/138 (84%), Positives = 127/138 (92%), Gaps = 1/138 (1%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  18   ISNASCTTNCLAPFVKVIDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  77

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR+A+
Sbjct  78   PTSTGAAKAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFREAA  136

Query  401  DGPLKGVLDVCDAPLVSL  348
            D  L G+L VCD PLVS+
Sbjct  137  DNELNGILSVCDEPLVSV  154


 Score = 82.0 bits (201),  Expect(2) = 2e-55, Method: Compositional matrix adjust.
 Identities = 46/56 (82%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  196
            P    DFRCSDVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  150  PLVSVDFRCSDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  205



>gb|ACN40537.1| unknown [Picea sitchensis]
Length=410

 Score =   160 bits (405),  Expect(2) = 3e-55, Method: Compositional matrix adjust.
 Identities = 115/138 (83%), Positives = 128/138 (93%), Gaps = 1/138 (1%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  221  ISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  280

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V+KK   AE+VNAAFR+++
Sbjct  281  PTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVEKKTF-AEEVNAAFRESA  339

Query  401  DGPLKGVLDVCDAPLVSL  348
            D  L G+L VCD PLVS+
Sbjct  340  DKELNGILAVCDEPLVSI  357


 Score = 83.2 bits (204),  Expect(2) = 3e-55, Method: Compositional matrix adjust.
 Identities = 47/56 (84%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  196
            P    DFRCSDVSST+DSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLA +VA+ W
Sbjct  353  PLVSIDFRCSDVSSTVDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLADIVANNW  408



>gb|AAA33780.1| glyceraldehyde-phosphate dehydrogenase [Pinus sylvestris]
Length=411

 Score =   160 bits (406),  Expect(2) = 3e-55, Method: Compositional matrix adjust.
 Identities = 116/138 (84%), Positives = 128/138 (93%), Gaps = 1/138 (1%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  222  ISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  281

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V+KK   AE+VNAAFR+ +
Sbjct  282  PTSTGAAKAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVEKKTF-AEEVNAAFRETA  340

Query  401  DGPLKGVLDVCDAPLVSL  348
            D  LKG+L VCD PLVS+
Sbjct  341  DKELKGILAVCDEPLVSI  358


 Score = 82.8 bits (203),  Expect(2) = 3e-55, Method: Compositional matrix adjust.
 Identities = 47/56 (84%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  196
            P    DFRCSDVSST+DSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLA +VA+ W
Sbjct  354  PLVSIDFRCSDVSSTVDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLADIVANNW  409



>gb|ADX97321.1| glyceraldehyde-3-phosphate dehydrogenase [Mangifera indica]
Length=401

 Score =   160 bits (405),  Expect(2) = 3e-55, Method: Compositional matrix adjust.
 Identities = 116/138 (84%), Positives = 128/138 (93%), Gaps = 1/138 (1%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  213  ISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  272

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR+++
Sbjct  273  PTSTGAAKAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRESA  331

Query  401  DGPLKGVLDVCDAPLVSL  348
            D  LKG+L VCD PLVS+
Sbjct  332  DKELKGILSVCDEPLVSV  349


 Score = 83.2 bits (204),  Expect(2) = 3e-55, Method: Compositional matrix adjust.
 Identities = 46/56 (82%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  196
            P    DFRCSDVSST+DSSLT+VMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+KW
Sbjct  345  PLVSVDFRCSDVSSTVDSSLTLVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANKW  400



>gb|ABG35250.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35251.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35252.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35253.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35256.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35257.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35258.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35259.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35260.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35261.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35262.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35263.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35264.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35265.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35266.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35268.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35269.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35270.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35271.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35272.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35273.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35274.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35275.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35276.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35277.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35278.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35279.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35280.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35281.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35282.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35283.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35284.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35285.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35286.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35287.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35288.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35289.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35290.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35291.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35292.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35293.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35294.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35295.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35296.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35297.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35298.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35299.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35300.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35301.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35302.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35303.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35304.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35305.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35306.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35307.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35308.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35309.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35310.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35311.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35312.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35313.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
Length=224

 Score =   161 bits (407),  Expect(2) = 3e-55, Method: Compositional matrix adjust.
 Identities = 116/138 (84%), Positives = 127/138 (92%), Gaps = 1/138 (1%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  36   ISNASCTTNCLAPFVKVIDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  95

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR+A+
Sbjct  96   PTSTGAAKAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFREAA  154

Query  401  DGPLKGVLDVCDAPLVSL  348
            D  L G+L VCD PLVS+
Sbjct  155  DNELNGILSVCDEPLVSV  172


 Score = 82.4 bits (202),  Expect(2) = 3e-55, Method: Compositional matrix adjust.
 Identities = 46/56 (82%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  196
            P    DFRCSDVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  168  PLVSVDFRCSDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  223



>gb|ABK25233.1| unknown [Picea sitchensis]
 gb|ABK26169.1| unknown [Picea sitchensis]
 gb|ACN40026.1| unknown [Picea sitchensis]
 gb|ACN40459.1| unknown [Picea sitchensis]
Length=410

 Score =   160 bits (405),  Expect(2) = 3e-55, Method: Compositional matrix adjust.
 Identities = 115/138 (83%), Positives = 128/138 (93%), Gaps = 1/138 (1%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  221  ISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  280

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V+KK   AE+VNAAFR+++
Sbjct  281  PTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVEKKTF-AEEVNAAFRESA  339

Query  401  DGPLKGVLDVCDAPLVSL  348
            D  L G+L VCD PLVS+
Sbjct  340  DKELNGILAVCDEPLVSI  357


 Score = 83.2 bits (204),  Expect(2) = 3e-55, Method: Compositional matrix adjust.
 Identities = 47/56 (84%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  196
            P    DFRCSDVSST+DSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLA +VA+ W
Sbjct  353  PLVSIDFRCSDVSSTVDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLADIVANNW  408



>gb|ABW89104.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
Length=195

 Score =   161 bits (408),  Expect(2) = 3e-55, Method: Compositional matrix adjust.
 Identities = 116/138 (84%), Positives = 127/138 (92%), Gaps = 1/138 (1%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  7    ISNASCTTNCLAPFVKVIDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  66

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR+A+
Sbjct  67   PTSTGAAKAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFREAA  125

Query  401  DGPLKGVLDVCDAPLVSL  348
            D  L G+L VCD PLVS+
Sbjct  126  DNELNGILSVCDEPLVSV  143


 Score = 81.6 bits (200),  Expect(2) = 3e-55, Method: Compositional matrix adjust.
 Identities = 46/56 (82%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  196
            P    DFRCSDVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  139  PLVSVDFRCSDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  194



>gb|ABG35254.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35255.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
Length=224

 Score =   160 bits (406),  Expect(2) = 4e-55, Method: Compositional matrix adjust.
 Identities = 116/138 (84%), Positives = 127/138 (92%), Gaps = 1/138 (1%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  36   ISNASCTTNCLAPFVKVIDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  95

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR+A+
Sbjct  96   PTSTGAAKAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFREAA  154

Query  401  DGPLKGVLDVCDAPLVSL  348
            D  L G+L VCD PLVS+
Sbjct  155  DNELNGILSVCDEPLVSV  172


 Score = 82.0 bits (201),  Expect(2) = 4e-55, Method: Compositional matrix adjust.
 Identities = 46/56 (82%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  196
            P    DFRCSDVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  168  PLVSVDFRCSDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  223



>gb|KDO63479.1| hypothetical protein CISIN_1g013492mg [Citrus sinensis]
Length=293

 Score =   161 bits (408),  Expect(2) = 4e-55, Method: Compositional matrix adjust.
 Identities = 116/138 (84%), Positives = 128/138 (93%), Gaps = 1/138 (1%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  105  ISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  164

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR+++
Sbjct  165  PTSTGAAKAVALVLPALKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRESA  223

Query  401  DGPLKGVLDVCDAPLVSL  348
            D  LKG+L VCD PLVS+
Sbjct  224  DNELKGILSVCDEPLVSV  241


 Score = 81.3 bits (199),  Expect(2) = 4e-55, Method: Compositional matrix adjust.
 Identities = 45/56 (80%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  196
            P    DFRCSDVSST+DSSLT+VMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  237  PLVSVDFRCSDVSSTVDSSLTLVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  292



>ref|XP_004236849.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Solanum lycopersicum]
Length=399

 Score =   159 bits (403),  Expect(2) = 5e-55, Method: Compositional matrix adjust.
 Identities = 116/138 (84%), Positives = 127/138 (92%), Gaps = 1/138 (1%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  211  ISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  270

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR+A+
Sbjct  271  PTSTGAAKAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVTKKTF-AEEVNAAFREAA  329

Query  401  DGPLKGVLDVCDAPLVSL  348
            D  L G+L VCD PLVS+
Sbjct  330  DKELNGILSVCDEPLVSV  347


 Score = 82.8 bits (203),  Expect(2) = 5e-55, Method: Compositional matrix adjust.
 Identities = 46/56 (82%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  196
            P    DFRCSDVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA++W
Sbjct  343  PLVSVDFRCSDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQW  398



>ref|XP_006446865.1| hypothetical protein CICLE_v10015476mg [Citrus clementina]
 gb|ESR60105.1| hypothetical protein CICLE_v10015476mg [Citrus clementina]
Length=403

 Score =   161 bits (407),  Expect(2) = 6e-55, Method: Compositional matrix adjust.
 Identities = 116/138 (84%), Positives = 128/138 (93%), Gaps = 1/138 (1%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  215  ISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  274

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR+++
Sbjct  275  PTSTGAAKAVALVLPALKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRESA  333

Query  401  DGPLKGVLDVCDAPLVSL  348
            D  LKG+L VCD PLVS+
Sbjct  334  DNELKGILSVCDEPLVSV  351


 Score = 81.3 bits (199),  Expect(2) = 6e-55, Method: Compositional matrix adjust.
 Identities = 45/56 (80%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  196
            P    DFRCSDVSST+DSSLT+VMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  347  PLVSVDFRCSDVSSTVDSSLTLVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  402



>ref|XP_006468948.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
[Citrus sinensis]
 gb|KDO63478.1| hypothetical protein CISIN_1g013492mg [Citrus sinensis]
Length=403

 Score =   161 bits (407),  Expect(2) = 6e-55, Method: Compositional matrix adjust.
 Identities = 116/138 (84%), Positives = 128/138 (93%), Gaps = 1/138 (1%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  215  ISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  274

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR+++
Sbjct  275  PTSTGAAKAVALVLPALKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRESA  333

Query  401  DGPLKGVLDVCDAPLVSL  348
            D  LKG+L VCD PLVS+
Sbjct  334  DNELKGILSVCDEPLVSV  351


 Score = 81.3 bits (199),  Expect(2) = 6e-55, Method: Compositional matrix adjust.
 Identities = 45/56 (80%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  196
            P    DFRCSDVSST+DSSLT+VMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  347  PLVSVDFRCSDVSSTVDSSLTLVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  402



>ref|XP_010249379.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
[Nelumbo nucifera]
Length=402

 Score =   159 bits (403),  Expect(2) = 7e-55, Method: Compositional matrix adjust.
 Identities = 116/138 (84%), Positives = 127/138 (92%), Gaps = 1/138 (1%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  214  ISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  273

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR+A+
Sbjct  274  PTSTGAAKAVALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFREAA  332

Query  401  DGPLKGVLDVCDAPLVSL  348
            D  L G+L VCD PLVS+
Sbjct  333  DKELNGILSVCDEPLVSV  350


 Score = 82.4 bits (202),  Expect(2) = 7e-55, Method: Compositional matrix adjust.
 Identities = 46/56 (82%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  196
            P    DFRCSDVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  346  PLVSVDFRCSDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  401



>ref|XP_009404713.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=404

 Score =   159 bits (402),  Expect(2) = 7e-55, Method: Compositional matrix adjust.
 Identities = 116/138 (84%), Positives = 127/138 (92%), Gaps = 1/138 (1%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  216  ISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  275

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK L AE+VNAAFR A+
Sbjct  276  PTSTGAAKAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVSKKTL-AEEVNAAFRNAA  334

Query  401  DGPLKGVLDVCDAPLVSL  348
            +  L G+L VCD PLVS+
Sbjct  335  EKELNGILSVCDEPLVSV  352


 Score = 82.8 bits (203),  Expect(2) = 7e-55, Method: Compositional matrix adjust.
 Identities = 46/56 (82%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  196
            P    DFRCSDVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA++W
Sbjct  348  PLVSVDFRCSDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQW  403



>gb|ACN39951.1| unknown [Picea sitchensis]
Length=330

 Score =   159 bits (402),  Expect(2) = 7e-55, Method: Compositional matrix adjust.
 Identities = 115/138 (83%), Positives = 128/138 (93%), Gaps = 1/138 (1%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  141  ISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  200

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V+KK   AE+VNAAFR+++
Sbjct  201  PTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVEKKTF-AEEVNAAFRESA  259

Query  401  DGPLKGVLDVCDAPLVSL  348
            D  L G+L VCD PLVS+
Sbjct  260  DKELNGILAVCDEPLVSI  277


 Score = 82.4 bits (202),  Expect(2) = 7e-55, Method: Compositional matrix adjust.
 Identities = 47/56 (84%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  196
            P    DFRCSDVSST+DSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLA +VA+ W
Sbjct  273  PLVSIDFRCSDVSSTVDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLADIVANNW  328



>sp|P09043.1|G3PA_TOBAC RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic; 
AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase subunit A; Flags: Precursor, partial [Nicotiana 
tabacum]
 gb|AAA34075.1| glyceraldehyde-3-phosphate dehydrogenase A-subunit precursor, 
partial [Nicotiana tabacum]
Length=392

 Score =   141 bits (356),  Expect(2) = 1e-54, Method: Compositional matrix adjust.
 Identities = 108/138 (78%), Positives = 121/138 (88%), Gaps = 1/138 (1%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  204  ISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  263

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAV+L    L+G    + LRVPTPNVSVVDLVV V KK   AE+VNAAFR+A+
Sbjct  264  PTSTGAAKAVALSSQALRGSSMALPLRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFREAA  322

Query  401  DGPLKGVLDVCDAPLVSL  348
            D  LKG+LDVCD PLVS+
Sbjct  323  DKELKGILDVCDEPLVSV  340


 Score =   100 bits (248),  Expect(2) = 1e-54, Method: Compositional matrix adjust.
 Identities = 45/56 (80%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  196
            P    DFRCSDVSST+D+SLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA++W
Sbjct  336  PLVSVDFRCSDVSSTVDASLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQW  391



>gb|ACN40000.1| unknown [Picea sitchensis]
Length=410

 Score =   158 bits (399),  Expect(2) = 1e-54, Method: Compositional matrix adjust.
 Identities = 114/138 (83%), Positives = 127/138 (92%), Gaps = 1/138 (1%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPFVKV+D++FGI+ GTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  221  ISNASCTTNCLAPFVKVLDQKFGIINGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  280

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V+KK   AE+VNAAFR+++
Sbjct  281  PTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVEKKTF-AEEVNAAFRESA  339

Query  401  DGPLKGVLDVCDAPLVSL  348
            D  L G+L VCD PLVS+
Sbjct  340  DKELNGILAVCDEPLVSI  357


 Score = 83.2 bits (204),  Expect(2) = 1e-54, Method: Compositional matrix adjust.
 Identities = 47/56 (84%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  196
            P    DFRCSDVSST+DSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLA +VA+ W
Sbjct  353  PLVSIDFRCSDVSSTVDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLADIVANNW  408



>gb|ABK24313.1| unknown [Picea sitchensis]
Length=410

 Score =   160 bits (404),  Expect(2) = 1e-54, Method: Compositional matrix adjust.
 Identities = 115/138 (83%), Positives = 128/138 (93%), Gaps = 1/138 (1%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  221  ISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  280

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V+KK   AE+VNAAFR+++
Sbjct  281  PTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVEKKTF-AEEVNAAFRESA  339

Query  401  DGPLKGVLDVCDAPLVSL  348
            D  L G+L VCD PLVS+
Sbjct  340  DKELNGILAVCDEPLVSI  357


 Score = 81.3 bits (199),  Expect(2) = 1e-54, Method: Compositional matrix adjust.
 Identities = 46/56 (82%), Positives = 49/56 (88%), Gaps = 0/56 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  196
            P    DFRCSDVSST+DSSLTMVMGDDMV VVAWYDNEWGYSQRVVDLA +VA+ W
Sbjct  353  PLVSIDFRCSDVSSTVDSSLTMVMGDDMVNVVAWYDNEWGYSQRVVDLADIVANNW  408



>gb|ABG35267.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
Length=224

 Score =   161 bits (407),  Expect(2) = 1e-54, Method: Compositional matrix adjust.
 Identities = 116/138 (84%), Positives = 127/138 (92%), Gaps = 1/138 (1%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  36   ISNASCTTNCLAPFVKVIDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  95

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR+A+
Sbjct  96   PTSTGAAKAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFREAA  154

Query  401  DGPLKGVLDVCDAPLVSL  348
            D  L G+L VCD PLVS+
Sbjct  155  DNELNGILSVCDEPLVSV  172


 Score = 80.1 bits (196),  Expect(2) = 1e-54, Method: Compositional matrix adjust.
 Identities = 45/56 (80%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  196
            P    DFRCSDVSST+DSSLTMVMGDDMVKV+AWYD+EWGYSQRVVDLA +VA+ W
Sbjct  168  PLVSVDFRCSDVSSTVDSSLTMVMGDDMVKVIAWYDHEWGYSQRVVDLADIVANNW  223



>gb|ABK96725.1| unknown [Populus trichocarpa x Populus deltoides]
Length=404

 Score =   155 bits (391),  Expect(2) = 1e-54, Method: Compositional matrix adjust.
 Identities = 113/138 (82%), Positives = 126/138 (91%), Gaps = 1/138 (1%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  216  ISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  275

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VN  FR+++
Sbjct  276  PTSTGAAKAVALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNLGFRESA  334

Query  401  DGPLKGVLDVCDAPLVSL  348
            +  LKG+L VCD PLVS+
Sbjct  335  EKELKGILSVCDEPLVSV  352


 Score = 85.9 bits (211),  Expect(2) = 1e-54, Method: Compositional matrix adjust.
 Identities = 47/56 (84%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  196
            P    DFRCSDVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLAH+VA +W
Sbjct  348  PLVSVDFRCSDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLAHIVADQW  403



>ref|XP_010942312.1| PREDICTED: LOW QUALITY PROTEIN: glyceraldehyde-3-phosphate dehydrogenase 
A, chloroplastic-like [Elaeis guineensis]
Length=445

 Score =   157 bits (398),  Expect(2) = 2e-54, Method: Compositional matrix adjust.
 Identities = 115/138 (83%), Positives = 126/138 (91%), Gaps = 1/138 (1%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  257  ISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  316

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR  +
Sbjct  317  PTSTGAAKAVALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRDTA  375

Query  401  DGPLKGVLDVCDAPLVSL  348
            +  LKG+L VCD PLVS+
Sbjct  376  EKELKGILSVCDEPLVSV  393


 Score = 82.4 bits (202),  Expect(2) = 2e-54, Method: Compositional matrix adjust.
 Identities = 46/56 (82%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  196
            P    DFRCSDVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  389  PLVSVDFRCSDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  444



>emb|CCF55355.1| Glyceraldehyde-3-phosphate dehydrogenase A [Cucumis sativus]
Length=403

 Score =   158 bits (400),  Expect(2) = 3e-54, Method: Compositional matrix adjust.
 Identities = 113/138 (82%), Positives = 126/138 (91%), Gaps = 1/138 (1%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  215  ISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  274

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAV+LVLP LKGKLNGIALRVPTPN SVVDLVV V KK   AE+VNAAFR+++
Sbjct  275  PTSTGAAKAVALVLPSLKGKLNGIALRVPTPNASVVDLVVQVSKKTF-AEEVNAAFRESA  333

Query  401  DGPLKGVLDVCDAPLVSL  348
            +  L G+L VCD PLVS+
Sbjct  334  EKELNGILSVCDEPLVSV  351


 Score = 81.3 bits (199),  Expect(2) = 3e-54, Method: Compositional matrix adjust.
 Identities = 45/56 (80%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  196
            P    DFRCSDVSST+DSSLTMVMGDD+VKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  347  PLVSVDFRCSDVSSTVDSSLTMVMGDDLVKVIAWYDNEWGYSQRVVDLADIVANNW  402



>ref|XP_002321065.2| hypothetical protein POPTR_0014s13660g [Populus trichocarpa]
 gb|ABK96062.1| unknown [Populus trichocarpa]
 gb|ABK96120.1| unknown [Populus trichocarpa]
 gb|EEE99380.2| hypothetical protein POPTR_0014s13660g [Populus trichocarpa]
Length=404

 Score =   157 bits (397),  Expect(2) = 4e-54, Method: Compositional matrix adjust.
 Identities = 114/138 (83%), Positives = 127/138 (92%), Gaps = 1/138 (1%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  216  ISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  275

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR+++
Sbjct  276  PTSTGAAKAVALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRESA  334

Query  401  DGPLKGVLDVCDAPLVSL  348
            +  L G+L VCD PLVS+
Sbjct  335  EKELNGILSVCDEPLVSV  352


 Score = 82.4 bits (202),  Expect(2) = 4e-54, Method: Compositional matrix adjust.
 Identities = 46/56 (82%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  196
            P    DFRCSDVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  348  PLVSVDFRCSDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  403



>ref|XP_011033706.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Populus euphratica]
Length=404

 Score =   157 bits (396),  Expect(2) = 4e-54, Method: Compositional matrix adjust.
 Identities = 114/138 (83%), Positives = 127/138 (92%), Gaps = 1/138 (1%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  216  ISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  275

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR+++
Sbjct  276  PTSTGAAKAVALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRESA  334

Query  401  DGPLKGVLDVCDAPLVSL  348
            +  L G+L VCD PLVS+
Sbjct  335  EKELNGILSVCDEPLVSV  352


 Score = 82.4 bits (202),  Expect(2) = 4e-54, Method: Compositional matrix adjust.
 Identities = 46/56 (82%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  196
            P    DFRCSDVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  348  PLVSVDFRCSDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  403



>ref|XP_002278352.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
isoform X1 [Vitis vinifera]
Length=404

 Score =   155 bits (391),  Expect(2) = 5e-54, Method: Compositional matrix adjust.
 Identities = 113/138 (82%), Positives = 126/138 (91%), Gaps = 1/138 (1%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  216  ISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  275

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNA FR ++
Sbjct  276  PTSTGAAKAVALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAGFRDSA  334

Query  401  DGPLKGVLDVCDAPLVSL  348
            +  L+G+L VCD PLVS+
Sbjct  335  EKELQGILSVCDEPLVSV  352


 Score = 84.0 bits (206),  Expect(2) = 5e-54, Method: Compositional matrix adjust.
 Identities = 47/56 (84%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  196
            P    DFRCSDVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+KW
Sbjct  348  PLVSVDFRCSDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANKW  403



>ref|XP_004161334.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
[Cucumis sativus]
Length=403

 Score =   158 bits (399),  Expect(2) = 5e-54, Method: Compositional matrix adjust.
 Identities = 114/138 (83%), Positives = 127/138 (92%), Gaps = 1/138 (1%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  215  ISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  274

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR+++
Sbjct  275  PTSTGAAKAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRESA  333

Query  401  DGPLKGVLDVCDAPLVSL  348
            +  L G+L VCD PLVS+
Sbjct  334  EKELNGILSVCDEPLVSV  351


 Score = 81.3 bits (199),  Expect(2) = 5e-54, Method: Compositional matrix adjust.
 Identities = 45/56 (80%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  196
            P    DFRCSDVSST+DSSLTMVMGDD+VKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  347  PLVSVDFRCSDVSSTVDSSLTMVMGDDLVKVIAWYDNEWGYSQRVVDLADIVANNW  402



>ref|XP_010660642.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
isoform X2 [Vitis vinifera]
Length=403

 Score =   155 bits (391),  Expect(2) = 5e-54, Method: Compositional matrix adjust.
 Identities = 113/138 (82%), Positives = 126/138 (91%), Gaps = 1/138 (1%)
 Frame = -1

Query  761  VSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIV  582
            +SNASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV
Sbjct  215  ISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIV  274

Query  581  PTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKAS  402
            PTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNA FR ++
Sbjct  275  PTSTGAAKAVALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAGFRDSA  333

Query  401  DGPLKGVLDVCDAPLVSL  348
            +  L+G+L VCD PLVS+
Sbjct  334  EKELQGILSVCDEPLVSV  351


 Score = 84.0 bits (206),  Expect(2) = 5e-54, Method: Compositional matrix adjust.
 Identities = 47/56 (84%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = -3

Query  363  PSCVFDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  196
            P    DFRCSDVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+KW
Sbjct  347  PLVSVDFRCSDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANKW  402



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1427696849470