BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF008L04

Length=751
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006341557.1|  PREDICTED: guanine nucleotide-binding protei...    373   4e-126   
ref|XP_009611065.1|  PREDICTED: guanine nucleotide-binding protei...    371   2e-125   Nicotiana tomentosiformis
ref|XP_009776114.1|  PREDICTED: guanine nucleotide-binding protei...    369   1e-124   Nicotiana sylvestris
ref|XP_009780116.1|  PREDICTED: guanine nucleotide-binding protei...    369   1e-124   Nicotiana sylvestris
gb|ABB86277.1|  ArcA2 protein-like                                      369   1e-124   Solanum tuberosum [potatoes]
gb|AJE63428.1|  transcription factor ArcA1                              369   1e-124   Capsicum annuum
emb|CAA96528.1|  G protein beta-subunit-like protein                    368   3e-124   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
ref|XP_009600162.1|  PREDICTED: guanine nucleotide-binding protei...    367   1e-123   Nicotiana tomentosiformis
ref|NP_001233881.1|  ArcA2 protein                                      366   2e-123   
gb|ABB02625.1|  G protein beta subunit-like protein                     363   4e-123   Solanum tuberosum [potatoes]
ref|XP_004252270.1|  PREDICTED: guanine nucleotide-binding protei...    365   4e-123   Solanum lycopersicum
gb|EYU40229.1|  hypothetical protein MIMGU_mgv1a008949mg                366   6e-123   Erythranthe guttata [common monkey flower]
ref|XP_009624187.1|  PREDICTED: guanine nucleotide-binding protei...    364   9e-123   Nicotiana tomentosiformis
ref|XP_006353816.1|  PREDICTED: guanine nucleotide-binding protei...    363   2e-122   Solanum tuberosum [potatoes]
ref|XP_011072970.1|  PREDICTED: guanine nucleotide-binding protei...    363   4e-122   Sesamum indicum [beniseed]
gb|EYU17645.1|  hypothetical protein MIMGU_mgv1a009858mg                361   2e-121   Erythranthe guttata [common monkey flower]
ref|XP_003631071.1|  Guanine nucleotide-binding protein subunit b...    361   2e-121   Medicago truncatula
ref|XP_009778426.1|  PREDICTED: guanine nucleotide-binding protei...    360   3e-121   Nicotiana sylvestris
ref|XP_006365404.1|  PREDICTED: guanine nucleotide-binding protei...    360   5e-121   Solanum tuberosum [potatoes]
sp|P49026.1|GBLP_TOBAC  RecName: Full=Guanine nucleotide-binding ...    360   7e-121   Nicotiana tabacum [American tobacco]
ref|NP_001233876.1|  ArcA1 protein                                      359   9e-121   
gb|KHN21658.1|  Guanine nucleotide-binding protein subunit beta-l...    355   1e-120   Glycine soja [wild soybean]
sp|P93340.1|GBLP_NICPL  RecName: Full=Guanine nucleotide-binding ...    359   1e-120   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
gb|EPS70887.1|  hypothetical protein M569_03871                         358   2e-120   Genlisea aurea
gb|AFK36580.1|  unknown                                                 358   2e-120   Medicago truncatula
sp|O24076.1|GBLP_MEDSA  RecName: Full=Guanine nucleotide-binding ...    358   2e-120   Medicago sativa [alfalfa]
gb|KHN00175.1|  Guanine nucleotide-binding protein subunit beta-l...    354   4e-120   Glycine soja [wild soybean]
gb|KJB37175.1|  hypothetical protein B456_006G192600                    357   8e-120   Gossypium raimondii
emb|CDO98381.1|  unnamed protein product                                384   8e-120   Coffea canephora [robusta coffee]
gb|KHG00880.1|  Guanine nucleotide-binding protein subunit beta-l...    356   1e-119   Gossypium arboreum [tree cotton]
gb|ACR77528.1|  heterotrimeric G protein beta 1 subunit                 356   2e-119   Nicotiana benthamiana
ref|XP_004299548.1|  PREDICTED: guanine nucleotide-binding protei...    356   2e-119   Fragaria vesca subsp. vesca
ref|NP_001241455.1|  uncharacterized protein LOC100778205               356   2e-119   Glycine max [soybeans]
gb|KJB53022.1|  hypothetical protein B456_008G288800                    355   4e-119   Gossypium raimondii
ref|XP_002529557.1|  receptor for activated protein kinase C, put...    355   5e-119   Ricinus communis
ref|XP_006451669.1|  hypothetical protein CICLE_v10008909mg             354   9e-119   Citrus clementina [clementine]
ref|XP_008453452.1|  PREDICTED: guanine nucleotide-binding protei...    354   1e-118   Cucumis melo [Oriental melon]
ref|XP_004137327.1|  PREDICTED: guanine nucleotide-binding protei...    354   1e-118   Cucumis sativus [cucumbers]
ref|NP_001235369.1|  guanine nucleotide-binding protein subunit b...    354   1e-118   Glycine max [soybeans]
gb|KDO62873.1|  hypothetical protein CISIN_1g048118mg                   353   1e-118   Citrus sinensis [apfelsine]
gb|ACJ24167.1|  Rack                                                    353   1e-118   Phaseolus vulgaris [French bean]
ref|XP_007160506.1|  hypothetical protein PHAVU_002G327500g             353   1e-118   Phaseolus vulgaris [French bean]
gb|KHG17882.1|  Guanine nucleotide-binding protein subunit beta-l...    353   3e-118   Gossypium arboreum [tree cotton]
ref|XP_007036696.1|  Transducin/WD40 repeat-like superfamily protein    352   6e-118   Theobroma cacao [chocolate]
gb|KFK43977.1|  guanine nucleotide-binding protein subunit beta-l...    351   2e-117   Arabis alpina [alpine rockcress]
ref|XP_010032559.1|  PREDICTED: guanine nucleotide-binding protei...    350   6e-117   Eucalyptus grandis [rose gum]
ref|XP_009110365.1|  PREDICTED: guanine nucleotide-binding protei...    350   6e-117   Brassica rapa
gb|KHG29145.1|  Guanine nucleotide-binding protein subunit beta-l...    350   6e-117   Gossypium arboreum [tree cotton]
ref|XP_006416642.1|  hypothetical protein EUTSA_v10008183mg             349   7e-117   Eutrema salsugineum [saltwater cress]
ref|XP_009117627.1|  PREDICTED: guanine nucleotide-binding protei...    348   1e-116   Brassica rapa
ref|XP_010678120.1|  PREDICTED: guanine nucleotide-binding protei...    348   2e-116   Beta vulgaris subsp. vulgaris [field beet]
gb|KDP37901.1|  hypothetical protein JCGZ_05340                         348   2e-116   Jatropha curcas
ref|XP_009149259.1|  PREDICTED: guanine nucleotide-binding protei...    348   2e-116   Brassica rapa
ref|XP_002894122.1|  hypothetical protein ARALYDRAFT_474002             348   2e-116   
ref|XP_002890259.1|  hypothetical protein ARALYDRAFT_889221             348   3e-116   Arabidopsis lyrata subsp. lyrata
gb|KJB08186.1|  hypothetical protein B456_001G069800                    347   4e-116   Gossypium raimondii
ref|XP_002281279.1|  PREDICTED: guanine nucleotide-binding protei...    347   7e-116   Vitis vinifera
ref|XP_006305354.1|  hypothetical protein CARUB_v10009733mg             347   1e-115   Capsella rubella
emb|CAA06154.1|  arcA 3                                                 345   1e-115   Nicotiana tabacum [American tobacco]
ref|NP_173248.1|  guanine nucleotide-binding protein subunit beta...    346   1e-115   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010036939.1|  PREDICTED: guanine nucleotide-binding protei...    346   2e-115   Eucalyptus grandis [rose gum]
ref|NP_188441.1|  receptor for activated C kinase 1C                    346   2e-115   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009360100.1|  PREDICTED: guanine nucleotide-binding protei...    346   2e-115   Pyrus x bretschneideri [bai li]
gb|AAB82647.1|  WD-40 repeat protein                                    345   3e-115   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010540016.1|  PREDICTED: guanine nucleotide-binding protei...    345   3e-115   Tarenaya hassleriana [spider flower]
ref|XP_010537487.1|  PREDICTED: guanine nucleotide-binding protei...    345   4e-115   Tarenaya hassleriana [spider flower]
ref|XP_010097592.1|  Guanine nucleotide-binding protein subunit b...    345   4e-115   Morus notabilis
ref|XP_010498185.1|  PREDICTED: guanine nucleotide-binding protei...    345   6e-115   Camelina sativa [gold-of-pleasure]
ref|XP_008393404.1|  PREDICTED: guanine nucleotide-binding protei...    344   7e-115   Malus domestica [apple tree]
ref|XP_010506450.1|  PREDICTED: guanine nucleotide-binding protei...    344   7e-115   Camelina sativa [gold-of-pleasure]
gb|AGV54321.1|  RACK1                                                   344   8e-115   Phaseolus vulgaris [French bean]
ref|XP_008374821.1|  PREDICTED: LOW QUALITY PROTEIN: guanine nucl...    344   8e-115   Malus domestica [apple tree]
ref|XP_006305339.1|  hypothetical protein CARUB_v10009720mg             344   8e-115   Capsella rubella
ref|XP_002318528.1|  GTP-binding protein beta chain                     344   1e-114   Populus trichocarpa [western balsam poplar]
ref|XP_010476972.1|  PREDICTED: guanine nucleotide-binding protei...    344   1e-114   Camelina sativa [gold-of-pleasure]
ref|XP_011039103.1|  PREDICTED: guanine nucleotide-binding protei...    344   1e-114   Populus euphratica
ref|XP_008240184.1|  PREDICTED: guanine nucleotide-binding protei...    344   1e-114   Prunus mume [ume]
ref|XP_007209348.1|  hypothetical protein PRUPE_ppa008536mg             344   1e-114   Prunus persica
ref|NP_175296.1|  receptor for activated C kinase 1B                    343   1e-114   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011039104.1|  PREDICTED: guanine nucleotide-binding protei...    343   2e-114   Populus euphratica
ref|XP_010487724.1|  PREDICTED: guanine nucleotide-binding protei...    343   3e-114   Camelina sativa [gold-of-pleasure]
emb|CDY64888.1|  BnaC06g40840D                                          341   5e-114   Brassica napus [oilseed rape]
gb|KFK39137.1|  guanine nucleotide-binding protein subunit beta-l...    342   7e-114   Arabis alpina [alpine rockcress]
ref|XP_010500401.1|  PREDICTED: guanine nucleotide-binding protei...    342   7e-114   Camelina sativa [gold-of-pleasure]
ref|XP_006393380.1|  hypothetical protein EUTSA_v10011646mg             342   8e-114   Eutrema salsugineum [saltwater cress]
gb|AAM65407.1|  guanine nucleotide-binding protein, putative            341   1e-113   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010465892.1|  PREDICTED: guanine nucleotide-binding protei...    341   1e-113   Camelina sativa [gold-of-pleasure]
ref|XP_006297909.1|  hypothetical protein CARUB_v10013951mg             343   1e-113   
sp|Q39336.1|GBLP_BRANA  RecName: Full=Guanine nucleotide-binding ...    341   2e-113   Brassica napus [oilseed rape]
ref|XP_010479287.1|  PREDICTED: guanine nucleotide-binding protei...    340   2e-113   Camelina sativa [gold-of-pleasure]
ref|XP_010461692.1|  PREDICTED: guanine nucleotide-binding protei...    340   3e-113   Camelina sativa [gold-of-pleasure]
ref|XP_010549078.1|  PREDICTED: guanine nucleotide-binding protei...    340   3e-113   Tarenaya hassleriana [spider flower]
ref|XP_006406649.1|  hypothetical protein EUTSA_v10021128mg             339   6e-113   Eutrema salsugineum [saltwater cress]
ref|XP_010549077.1|  PREDICTED: guanine nucleotide-binding protei...    339   7e-113   Tarenaya hassleriana [spider flower]
ref|XP_009147950.1|  PREDICTED: LOW QUALITY PROTEIN: guanine nucl...    339   1e-112   Brassica rapa
ref|XP_009145001.1|  PREDICTED: guanine nucleotide-binding protei...    338   2e-112   Brassica rapa
ref|XP_004503304.1|  PREDICTED: guanine nucleotide-binding protei...    338   2e-112   Cicer arietinum [garbanzo]
ref|XP_002885240.1|  guanine nucleotide-binding family protein          338   2e-112   Arabidopsis lyrata subsp. lyrata
pdb|3DM0|A  Chain A, Maltose Binding Protein Fusion With Rack1 Fr...    350   3e-112   Escherichia coli K-12
ref|XP_009113515.1|  PREDICTED: guanine nucleotide-binding protei...    337   4e-112   Brassica rapa
emb|CDY18497.1|  BnaA01g26980D                                          337   5e-112   Brassica napus [oilseed rape]
ref|XP_010551145.1|  PREDICTED: guanine nucleotide-binding protei...    336   1e-111   Tarenaya hassleriana [spider flower]
emb|CDX95554.1|  BnaC01g34460D                                          336   2e-111   
ref|XP_011000479.1|  PREDICTED: guanine nucleotide-binding protei...    335   2e-111   Populus euphratica
emb|CDY44104.1|  BnaA01g13120D                                          334   2e-111   Brassica napus [oilseed rape]
ref|XP_009145932.1|  PREDICTED: guanine nucleotide-binding protei...    335   4e-111   Brassica rapa
emb|CDX92200.1|  BnaA05g22070D                                          335   4e-111   
emb|CDX95784.1|  BnaC05g35350D                                          333   1e-110   
ref|XP_002321505.1|  GTP-binding protein beta chain                     333   2e-110   Populus trichocarpa [western balsam poplar]
ref|XP_011084467.1|  PREDICTED: LOW QUALITY PROTEIN: guanine nucl...    332   4e-110   Sesamum indicum [beniseed]
ref|XP_010256121.1|  PREDICTED: guanine nucleotide-binding protei...    328   1e-108   Nelumbo nucifera [Indian lotus]
ref|XP_010243791.1|  PREDICTED: guanine nucleotide-binding protei...    326   8e-108   Nelumbo nucifera [Indian lotus]
ref|XP_010916329.1|  PREDICTED: guanine nucleotide-binding protei...    325   3e-107   Elaeis guineensis
ref|XP_010430893.1|  PREDICTED: guanine nucleotide-binding protei...    319   1e-105   
ref|XP_006837182.1|  hypothetical protein AMTR_s00105p00058690          320   1e-105   Amborella trichopoda
ref|XP_010924141.1|  PREDICTED: guanine nucleotide-binding protei...    320   1e-105   Elaeis guineensis
ref|XP_009405003.1|  PREDICTED: guanine nucleotide-binding protei...    320   3e-105   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010495439.1|  PREDICTED: guanine nucleotide-binding protei...    318   5e-105   
emb|CAC09579.1|  gbf1 protein                                           317   8e-105   Fagus sylvatica
ref|XP_009400497.1|  PREDICTED: guanine nucleotide-binding protei...    316   9e-104   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008803271.1|  PREDICTED: guanine nucleotide-binding protei...    315   2e-103   Phoenix dactylifera
ref|XP_010923802.1|  PREDICTED: guanine nucleotide-binding protei...    315   2e-103   Elaeis guineensis
gb|AFV60006.1|  heterotrimeric guanine nucleotide-binding protein...    313   9e-103   Eschscholzia californica
ref|XP_009380503.1|  PREDICTED: guanine nucleotide-binding protei...    313   9e-103   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004252271.1|  PREDICTED: guanine nucleotide-binding protei...    310   1e-101   Solanum lycopersicum
gb|ABK25010.1|  unknown                                                 308   6e-101   Picea sitchensis
gb|ACN41093.1|  unknown                                                 308   8e-101   Picea sitchensis
ref|XP_008812615.1|  PREDICTED: guanine nucleotide-binding protei...    308   2e-100   
gb|ABK26798.1|  unknown                                                 304   3e-99    Picea sitchensis
ref|NP_001136800.1|  guanine nucleotide-binding protein beta subu...    301   5e-98    Zea mays [maize]
gb|ACL54313.1|  unknown                                                 301   6e-98    Zea mays [maize]
ref|NP_001146976.1|  LOC100280585                                       301   7e-98    Zea mays [maize]
ref|XP_002440202.1|  hypothetical protein SORBIDRAFT_09g027690          301   1e-97    Sorghum bicolor [broomcorn]
ref|XP_001780288.1|  predicted protein                                  298   8e-97    
ref|XP_002945887.1|  hypothetical protein VOLCADRAFT_78914              298   9e-97    Volvox carteri f. nagariensis
ref|XP_008811978.1|  PREDICTED: LOW QUALITY PROTEIN: guanine nucl...    298   1e-96    Phoenix dactylifera
ref|XP_001779496.1|  predicted protein                                  296   2e-96    
ref|XP_001698065.1|  receptor of activated protein kinase C 1           296   4e-96    Chlamydomonas reinhardtii
ref|XP_001754916.1|  predicted protein                                  296   5e-96    
ref|XP_004969582.1|  PREDICTED: guanine nucleotide-binding protei...    296   5e-96    Setaria italica
gb|ACJ85349.1|  unknown                                                 294   8e-96    Medicago truncatula
ref|XP_006644561.1|  PREDICTED: LOW QUALITY PROTEIN: guanine nucl...    295   3e-95    Oryza brachyantha
ref|XP_004961307.1|  PREDICTED: guanine nucleotide-binding protei...    294   5e-95    Setaria italica
ref|NP_001043910.1|  Os01g0686800                                       294   6e-95    
ref|XP_005847990.1|  hypothetical protein CHLNCDRAFT_31033              293   7e-95    Chlorella variabilis
emb|CEG00110.1|  G-protein beta WD-40 repeat                            292   1e-94    Ostreococcus tauri
gb|EMS52917.1|  Guanine nucleotide-binding protein subunit beta-l...    293   2e-94    Triticum urartu
dbj|BAJ90663.1|  predicted protein                                      292   2e-94    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003567944.1|  PREDICTED: guanine nucleotide-binding protei...    292   3e-94    Brachypodium distachyon [annual false brome]
ref|XP_001421096.1|  Receptor of activated protein kinase C 1A, c...    290   1e-93    Ostreococcus lucimarinus CCE9901
ref|XP_003082627.1|  GTP-binding regulatory protein beta chain ho...    295   2e-93    
ref|NP_001056254.1|  Os05g0552300                                       290   2e-93    
gb|AEF79971.1|  receptor of activated protein kinase C 1                289   3e-93    Dunaliella salina
ref|XP_002456166.1|  hypothetical protein SORBIDRAFT_03g031520          289   5e-93    Sorghum bicolor [broomcorn]
ref|XP_006654750.1|  PREDICTED: guanine nucleotide-binding protei...    289   5e-93    Oryza brachyantha
gb|AEO44580.1|  receptor for activated C kinase 1                       287   1e-92    Dunaliella salina
gb|EMT00770.1|  hypothetical protein F775_19376                         296   2e-92    
ref|XP_002502835.1|  predicted protein                                  287   2e-92    Micromonas commoda
ref|XP_003060952.1|  predicted protein                                  286   3e-92    Micromonas pusilla CCMP1545
ref|XP_010480509.1|  PREDICTED: guanine nucleotide-binding protei...    282   6e-92    
ref|XP_002967499.1|  hypothetical protein SELMODRAFT_144795             282   9e-91    Selaginella moellendorffii
ref|XP_005652002.1|  WD40 repeat-like protein                           281   2e-90    Coccomyxa subellipsoidea C-169
ref|XP_003569582.1|  PREDICTED: guanine nucleotide-binding protei...    280   1e-89    Brachypodium distachyon [annual false brome]
ref|XP_002960209.1|  hypothetical protein SELMODRAFT_266532             279   2e-89    
gb|KIY98327.1|  Guanine nucleotide-binding protein subunit beta-l...    279   2e-89    Monoraphidium neglectum
ref|XP_005711409.1|  receptor for activated protein kinase C            277   1e-88    Chondrus crispus [carageen]
dbj|BAJ98167.1|  predicted protein                                      277   2e-88    Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDM83867.1|  unnamed protein product                                276   3e-88    Triticum aestivum [Canadian hard winter wheat]
gb|KDD72035.1|  hypothetical protein H632_c3969p0                       273   7e-88    Helicosporidium sp. ATCC 50920
ref|XP_007508318.1|  predicted protein                                  275   1e-87    Bathycoccus prasinos
ref|XP_010926201.1|  PREDICTED: guanine nucleotide-binding protei...    269   1e-85    Elaeis guineensis
ref|XP_002903189.1|  guanine nucleotide-binding protein subunit b...    269   2e-85    Phytophthora infestans T30-4
ref|XP_009836542.1|  guanine nucleotide-binding protein subunit b...    268   3e-85    Aphanomyces astaci
gb|ETM44908.1|  guanine nucleotide-binding protein subunit beta-l...    269   4e-85    Phytophthora parasitica
ref|XP_009531042.1|  hypothetical protein PHYSODRAFT_355000             268   5e-85    Phytophthora sojae
ref|XP_011397272.1|  Guanine nucleotide-binding protein subunit b...    266   1e-84    Auxenochlorella protothecoides
gb|KDO19117.1|  guanine nucleotide-binding protein subunit beta-2...    267   1e-84    Saprolegnia parasitica CBS 223.65
ref|XP_008608530.1|  guanine nucleotide-binding protein subunit b...    266   2e-84    Saprolegnia diclina VS20
ref|XP_004343796.1|  guanine nucleotide-binding protein                 265   5e-84    Capsaspora owczarzaki ATCC 30864
emb|CCI48432.1|  unnamed protein product                                265   5e-84    Albugo candida
emb|CCA26420.1|  guanine nucleotidebinding protein subunit beta2l...    265   5e-84    Albugo laibachii Nc14
ref|XP_009037831.1|  hypothetical protein AURANDRAFT_37768              264   1e-83    Aureococcus anophagefferens
gb|ETI45096.1|  guanine nucleotide-binding protein subunit beta-l...    267   2e-83    Phytophthora parasitica P1569
gb|ACQ83470.1|  receptor of activated protein kinase C                  263   3e-83    Platynereis dumerilii
ref|XP_002286095.1|  guanine nucleotide binding protein beta subu...    263   4e-83    Thalassiosira pseudonana CCMP1335
emb|CEG76293.1|  Putative Guanine nucleotide-binding protein subu...    261   4e-83    Rhizopus microsporus
ref|XP_005795376.1|  PREDICTED: guanine nucleotide-binding protei...    263   6e-83    Xiphophorus maculatus
ref|XP_004696065.1|  PREDICTED: LOW QUALITY PROTEIN: guanine nucl...    261   7e-83    
ref|XP_004073369.1|  PREDICTED: guanine nucleotide-binding protei...    262   9e-83    Oryzias latipes [Japanese rice fish]
ref|XP_004540947.1|  PREDICTED: guanine nucleotide-binding protei...    262   9e-83    Maylandia zebra
ref|NP_001266445.1|  guanine nucleotide-binding protein subunit b...    262   1e-82    Oreochromis niloticus
gb|EJT47727.1|  G protein beta subunit-like protein Rkp1                261   1e-82    Trichosporon asahii var. asahii CBS 2479
ref|XP_007527211.1|  PREDICTED: guanine nucleotide-binding protei...    260   2e-82    Erinaceus europaeus [common hedgehog]
gb|KFM07186.1|  Guanine nucleotide-binding protein subunit beta-2...    258   2e-82    Aptenodytes forsteri
gb|EAW53697.1|  guanine nucleotide binding protein (G protein), b...    258   2e-82    Homo sapiens [man]
ref|XP_006746631.1|  PREDICTED: guanine nucleotide-binding protei...    259   2e-82    Leptonychotes weddellii
ref|XP_005977784.1|  PREDICTED: guanine nucleotide-binding protei...    259   2e-82    Pantholops hodgsonii [Tibetan antelope]
gb|EWM27643.1|  guanine nucleotide binding protein                      261   2e-82    Nannochloropsis gaditana
ref|XP_009277073.1|  PREDICTED: guanine nucleotide-binding protei...    258   2e-82    
gb|ETP42980.1|  guanine nucleotide-binding protein subunit beta-l...    265   2e-82    Phytophthora parasitica P10297
ref|XP_005891160.1|  PREDICTED: guanine nucleotide-binding protei...    259   2e-82    Bos mutus
gb|EDL33790.1|  guanine nucleotide binding protein (G protein), b...    258   2e-82    Mus musculus [mouse]
gb|ERE68979.1|  guanine nucleotide-binding protein subunit beta-2...    258   2e-82    Cricetulus griseus [Chinese hamsters]
gb|AAR24619.1|  proliferation-inducing gene 21                          259   2e-82    Homo sapiens [man]
gb|EPQ05298.1|  Guanine nucleotide-binding protein subunit beta-2...    259   2e-82    Myotis brandtii
ref|XP_004657524.1|  PREDICTED: guanine nucleotide-binding protei...    259   2e-82    Jaculus jaculus
gb|ABY75292.1|  putative guanine nucleotide binding protein beta ...    258   2e-82    Ovis aries [domestic sheep]
ref|XP_009576203.1|  PREDICTED: guanine nucleotide-binding protei...    258   2e-82    Fulmarus glacialis
gb|ELK03178.1|  Guanine nucleotide-binding protein subunit beta-2...    259   2e-82    Pteropus alecto
gb|EIE78732.1|  guanine nucleotide-binding protein subunit beta-2...    261   3e-82    Rhizopus delemar RA 99-880
ref|XP_005703361.1|  hypothetical protein Gasu_55280                    261   3e-82    Galdieria sulphuraria
ref|XP_007548404.1|  PREDICTED: guanine nucleotide-binding protei...    261   3e-82    Poecilia formosa
ref|NP_571519.1|  guanine nucleotide-binding protein subunit beta...    261   3e-82    Danio rerio [leopard danio]
ref|XP_008063710.1|  PREDICTED: guanine nucleotide-binding protei...    259   3e-82    Carlito syrichta
ref|XP_005989393.1|  PREDICTED: guanine nucleotide-binding protei...    260   4e-82    Latimeria chalumnae
dbj|BAE39095.1|  unnamed protein product                                258   4e-82    Mus musculus [mouse]
dbj|BAG53102.1|  unnamed protein product                                259   4e-82    Homo sapiens [man]
ref|XP_002804718.1|  PREDICTED: guanine nucleotide-binding protei...    259   4e-82    
ref|XP_002181732.1|  predicted protein                                  260   4e-82    Phaeodactylum tricornutum CCAP 1055/1
emb|CEG67117.1|  Putative Guanine nucleotide-binding protein subu...    260   4e-82    Rhizopus microsporus
gb|AAX94566.1|  Gpa1 interacting G protein subunit                      257   5e-82    Cryptococcus neoformans var. grubii
ref|XP_007244608.1|  PREDICTED: guanine nucleotide-binding protei...    260   5e-82    Astyanax mexicanus [blind cave fish]
gb|ADO27998.1|  guanine nucleotide-binding protein subunit beta-2...    260   7e-82    Ictalurus furcatus
gb|AAI50408.1|  Guanine nucleotide binding protein (G protein), b...    259   7e-82    Danio rerio [leopard danio]
ref|XP_006147504.1|  PREDICTED: guanine nucleotide-binding protei...    258   8e-82    
gb|KFP96911.1|  Guanine nucleotide-binding protein subunit beta-2...    258   9e-82    Haliaeetus albicilla
ref|NP_001187435.1|  guanine nucleotide-binding protein subunit b...    259   9e-82    Ictalurus punctatus
ref|XP_009080129.1|  PREDICTED: guanine nucleotide-binding protei...    256   9e-82    Acanthisitta chloris
gb|KFQ89059.1|  Guanine nucleotide-binding protein subunit beta-2...    258   1e-81    Phoenicopterus ruber ruber
ref|XP_009922131.1|  PREDICTED: guanine nucleotide-binding protei...    258   1e-81    Haliaeetus albicilla
gb|EDL33792.1|  guanine nucleotide binding protein (G protein), b...    258   1e-81    Mus musculus [mouse]
gb|KFP61115.1|  Guanine nucleotide-binding protein subunit beta-2...    259   1e-81    Cariama cristata
ref|XP_007070338.1|  PREDICTED: guanine nucleotide-binding protei...    258   1e-81    
dbj|BAB28114.1|  unnamed protein product                                258   1e-81    Mus musculus [mouse]
gb|KFP58388.1|  Guanine nucleotide-binding protein subunit beta-2...    258   1e-81    Cathartes aura
ref|XP_009701898.1|  PREDICTED: guanine nucleotide-binding protei...    259   1e-81    Cariama cristata
dbj|BAE40068.1|  unnamed protein product                                259   1e-81    Mus musculus [mouse]
ref|XP_009462428.1|  PREDICTED: guanine nucleotide-binding protei...    259   1e-81    Nipponia nippon
gb|KFQ99079.1|  Guanine nucleotide-binding protein subunit beta-2...    258   1e-81    Opisthocomus hoazin [hoatzin]
gb|AEW43729.1|  activated protein kinase C receptor                     258   1e-81    Epinephelus coioides [estuary cod]
gb|EPB90862.1|  guanine nucleotide-binding protein subunit beta-2...    259   1e-81    Mucor circinelloides f. circinelloides 1006PhL
ref|XP_009448630.1|  PREDICTED: guanine nucleotide-binding protei...    258   1e-81    
ref|XP_006037851.1|  PREDICTED: guanine nucleotide-binding protei...    259   1e-81    
ref|XP_005658294.1|  PREDICTED: guanine nucleotide binding protei...    259   1e-81    
ref|XP_010296751.1|  PREDICTED: guanine nucleotide-binding protei...    258   1e-81    Balearica regulorum gibbericeps
ref|XP_009489930.1|  PREDICTED: guanine nucleotide-binding protei...    258   1e-81    Pelecanus crispus
ref|XP_004387229.1|  PREDICTED: guanine nucleotide-binding protei...    259   1e-81    Trichechus manatus latirostris
gb|KFQ96249.1|  Guanine nucleotide-binding protein subunit beta-2...    258   1e-81    Nipponia nippon
dbj|BAE40059.1|  unnamed protein product                                259   1e-81    Mus musculus [mouse]
gb|AAI02287.2|  GNB2L1 protein                                          259   1e-81    Bos taurus [bovine]
ref|XP_005234127.1|  PREDICTED: LOW QUALITY PROTEIN: guanine nucl...    259   1e-81    Falco peregrinus [peregrine]
emb|CDY59680.1|  BnaA05g36460D                                          256   1e-81    Brassica napus [oilseed rape]
ref|NP_006089.1|  guanine nucleotide-binding protein subunit beta...    259   2e-81    Homo sapiens [man]
gb|KFO08948.1|  Guanine nucleotide-binding protein subunit beta-2...    258   2e-81    Balearica regulorum gibbericeps
gb|KFO20808.1|  Guanine nucleotide-binding protein subunit beta-2...    259   2e-81    Fukomys damarensis [Damara mole rat]
gb|EHB05258.1|  Guanine nucleotide-binding protein subunit beta-2...    259   2e-81    Heterocephalus glaber [naked mole rat]
ref|XP_572317.1|  cytoplasm protein                                     259   2e-81    Cryptococcus neoformans var. neoformans JEC21
ref|XP_005758143.1|  receptor of activated protein kinase C             259   2e-81    Emiliania huxleyi CCMP1516
gb|AAW82329.1|  guanine nucleotide binding 12.3                         259   2e-81    Gallus gallus [bantam]
ref|XP_006631768.1|  PREDICTED: guanine nucleotide-binding protei...    259   2e-81    Lepisosteus oculatus
ref|XP_009329421.1|  PREDICTED: guanine nucleotide-binding protei...    257   2e-81    Pygoscelis adeliae
gb|KFQ66729.1|  Guanine nucleotide-binding protein subunit beta-2...    258   2e-81    Pelecanus crispus
ref|XP_009995617.1|  PREDICTED: guanine nucleotide-binding protei...    258   2e-81    Chaetura pelagica
gb|AAP36938.1|  Homo sapiens guanine nucleotide binding protein (...    259   2e-81    synthetic construct
ref|XP_005435183.1|  PREDICTED: guanine nucleotide-binding protei...    258   2e-81    Falco cherrug
dbj|BAF47116.1|  G protein beta-subunit-like protein                    253   2e-81    Nicotiana tabacum [American tobacco]
ref|XP_010391434.1|  PREDICTED: guanine nucleotide-binding protei...    257   2e-81    
gb|EAW53699.1|  guanine nucleotide binding protein (G protein), b...    260   2e-81    Homo sapiens [man]
ref|XP_007431363.1|  PREDICTED: guanine nucleotide-binding protei...    259   2e-81    Python bivittatus
pdb|4AOW|A  Chain A, Crystal Structure Of The Human Rack1 Protein...    259   2e-81    Homo sapiens [man]
gb|KFW72146.1|  Guanine nucleotide-binding protein subunit beta-2...    258   2e-81    Pygoscelis adeliae
ref|XP_008630825.1|  PREDICTED: guanine nucleotide-binding protei...    257   2e-81    
ref|XP_005018374.1|  PREDICTED: guanine nucleotide-binding protei...    259   2e-81    
ref|XP_005534099.1|  PREDICTED: guanine nucleotide-binding protei...    258   2e-81    Pseudopodoces humilis [Tibetan ground-jay]
gb|KFO58265.1|  Guanine nucleotide-binding protein subunit beta-2...    257   2e-81    Corvus brachyrhynchos
gb|KFQ81036.1|  Guanine nucleotide-binding protein subunit beta-2...    258   2e-81    Phaethon lepturus
ref|XP_009931788.1|  PREDICTED: LOW QUALITY PROTEIN: guanine nucl...    259   2e-81    Opisthocomus hoazin [hoatzin]
gb|KFO76552.1|  Guanine nucleotide-binding protein subunit beta-2...    258   3e-81    Cuculus canorus
ref|XP_010291551.1|  PREDICTED: guanine nucleotide-binding protei...    258   3e-81    Phaethon lepturus
gb|AAA18951.1|  protein kinase C receptor                               258   3e-81    
emb|CCQ18636.1|  G protein beta subunit-like protein                    258   3e-81    
ref|XP_007229955.1|  PREDICTED: guanine nucleotide-binding protei...    258   3e-81    
ref|XP_008873892.1|  guanine nucleotide-binding protein subunit b...    258   3e-81    
ref|XP_006105825.1|  PREDICTED: LOW QUALITY PROTEIN: guanine nucl...    260   3e-81    
emb|CEP13972.1|  hypothetical protein                                   258   3e-81    
gb|EPY85923.1|  guanine nucleotide binding protein, beta polypept...    258   3e-81    
gb|AAO21313.1|  lung cancer oncogene 7                                  259   3e-81    
ref|XP_003197003.1|  G protein beta subunit-like protein Rkp1           258   3e-81    
ref|XP_004468645.1|  PREDICTED: guanine nucleotide-binding protei...    258   4e-81    
ref|XP_008325350.1|  PREDICTED: guanine nucleotide-binding protei...    258   4e-81    
gb|ACV53651.1|  guanine nucleotide-binding protein beta polypepti...    258   4e-81    
emb|CEP08121.1|  hypothetical protein                                   258   4e-81    
ref|XP_006766909.1|  PREDICTED: guanine nucleotide-binding protei...    259   4e-81    
ref|XP_005862397.1|  PREDICTED: guanine nucleotide-binding protei...    259   4e-81    
ref|XP_008681951.1|  PREDICTED: guanine nucleotide-binding protei...    259   4e-81    
gb|EAW53696.1|  guanine nucleotide binding protein (G protein), b...    259   4e-81    
gb|ESA03866.1|  hypothetical protein GLOINDRAFT_336518                  258   5e-81    
dbj|BAD96208.1|  guanine nucleotide binding protein (G protein), ...    258   5e-81    
ref|XP_008156879.1|  PREDICTED: guanine nucleotide-binding protei...    259   5e-81    
gb|ACH70647.1|  guanine nucleotide binding protein (G protein) be...    258   5e-81    
ref|NP_001118140.1|  RACK1                                              258   5e-81    
ref|XP_009884754.1|  PREDICTED: guanine nucleotide-binding protei...    256   5e-81    
gb|EPB88453.1|  guanine nucleotide-binding protein subunit beta-2...    258   6e-81    
gb|AAM88904.1|  guanine nucleotide-binding protein                      257   6e-81    
dbj|BAE93065.1|  guanine nucleotide binding protein beta polypept...    257   6e-81    
gb|AAS49532.1|  guanine nucleotide binding protein beta polypepti...    256   7e-81    
gb|KIR44237.1|  guanine nucleotide-binding protein subunit beta-l...    257   7e-81    
ref|XP_008955153.1|  PREDICTED: guanine nucleotide-binding protei...    259   7e-81    
gb|AAT35603.1|  receptor for activated protein kinase C                 257   8e-81    
gb|AHG98116.1|  guanine nucleotide-binding protein subunit beta-2...    257   8e-81    
ref|NP_001274728.1|  guanine nucleotide-binding protein subunit b...    257   8e-81    
gb|ABX90099.1|  receptor for activated C kinase 1                       257   8e-81    
ref|XP_008013783.1|  PREDICTED: guanine nucleotide-binding protei...    259   9e-81    
gb|AHG98119.1|  guanine nucleotide-binding protein subunit beta-2...    256   9e-81    
ref|XP_006679085.1|  hypothetical protein BATDEDRAFT_33248              256   1e-80    
ref|XP_006898235.1|  PREDICTED: guanine nucleotide-binding protei...    254   1e-80    
ref|XP_007408997.1|  hypothetical protein MELLADRAFT_116221             256   1e-80    
ref|XP_006270088.1|  PREDICTED: guanine nucleotide-binding protei...    256   1e-80    
gb|AAF22119.1|AF124742_1  guanine nucleotide-binding protein            256   1e-80    
ref|XP_007899557.1|  PREDICTED: guanine nucleotide-binding protei...    256   1e-80    
dbj|BAA06185.1|  G protein beta subuit like                             256   1e-80    
ref|NP_001279416.1|  guanine nucleotide-binding protein subunit b...    256   1e-80    
ref|XP_001105066.1|  PREDICTED: guanine nucleotide-binding protei...    259   1e-80    
gb|EAW53694.1|  guanine nucleotide binding protein (G protein), b...    259   1e-80    
dbj|BAE35378.1|  unnamed protein product                                256   1e-80    
ref|XP_003900707.2|  PREDICTED: guanine nucleotide-binding protei...    259   1e-80    
ref|XP_010780163.1|  PREDICTED: guanine nucleotide-binding protei...    256   1e-80    
gb|ACQ58047.1|  Guanine nucleotide-binding protein subunit beta-2...    256   1e-80    
gb|AAD42045.1|AF105259_1  activated protein kinase C receptor           256   2e-80    
ref|NP_001086465.1|  uncharacterized protein LOC446289                  256   2e-80    
gb|AHG98209.1|  guanine nucleotide-binding protein subunit beta-2...    256   2e-80    
gb|ETE60795.1|  Guanine nucleotide-binding protein subunit beta-2...    258   2e-80    
ref|XP_010223334.1|  PREDICTED: guanine nucleotide-binding protei...    254   2e-80    
ref|XP_010124278.1|  PREDICTED: LOW QUALITY PROTEIN: guanine nucl...    252   2e-80    
gb|EGV96576.1|  Guanine nucleotide-binding protein subunit beta-2...    254   3e-80    
ref|XP_002834824.3|  PREDICTED: guanine nucleotide-binding protei...    259   3e-80    
gb|AHG98118.1|  guanine nucleotide-binding protein subunit beta-2...    255   3e-80    
ref|NP_001004946.1|  guanine nucleotide binding protein (G protei...    256   3e-80    
ref|XP_008282647.1|  PREDICTED: guanine nucleotide-binding protei...    256   3e-80    
emb|CDY71917.1|  BnaCnng75080D                                          253   3e-80    
dbj|BAF47119.1|  G protein beta-subunit-like protein                    249   3e-80    
ref|XP_002735015.1|  PREDICTED: guanine nucleotide-binding protei...    255   3e-80    
ref|XP_007083117.1|  PREDICTED: guanine nucleotide-binding protei...    258   4e-80    
ref|XP_007642752.1|  PREDICTED: guanine nucleotide-binding protei...    255   4e-80    
ref|XP_004341795.1|  guanine nucleotide-binding protein beta subu...    255   4e-80    
gb|EAW53700.1|  guanine nucleotide binding protein (G protein), b...    259   4e-80    
gb|ACJ06767.1|  receptor for activated C-kinase                         255   4e-80    
gb|ACO09909.1|  Guanine nucleotide-binding protein subunit beta 2...    255   5e-80    
ref|XP_003970442.1|  PREDICTED: guanine nucleotide-binding protei...    255   6e-80    
emb|CDH49812.1|  guanine nucleotide binding protein beta subunit        254   7e-80    
ref|NP_001279371.1|  uncharacterized protein LOC103175775               254   8e-80    
gb|KIJ49590.1|  hypothetical protein M422DRAFT_205027                   254   9e-80    
gb|KDQ57687.1|  hypothetical protein JAAARDRAFT_35372                   254   1e-79    
gb|AAP04406.1|  G-protein beta subunit like-protein                     254   1e-79    
emb|CCA74715.1|  probable CPC2 protein, guanine nucleotide-bindin...    254   1e-79    
emb|CAL48986.1|  Receptor of Activated Kinase C 1                       254   1e-79    
ref|NP_001291025.1|  guanine nucleotide binding protein (G protei...    254   1e-79    
gb|AFK73701.1|  receptor of activated kinase C                          254   1e-79    
ref|XP_006958593.1|  WD40 repeat-like protein                           254   1e-79    
ref|XP_010733915.1|  PREDICTED: guanine nucleotide-binding protei...    254   1e-79    
gb|EIE91439.1|  guanine nucleotide-binding protein subunit beta-l...    253   2e-79    
emb|CAG01204.1|  unnamed protein product                                254   2e-79    
ref|XP_009267143.1|  Guanine nucleotide-binding protein subunit b...    253   2e-79    
gb|EIE76651.1|  guanine nucleotide-binding protein subunit beta-2...    253   2e-79    
dbj|BAC56715.1|  receptor for activated protein kinase C homolog        253   3e-79    
gb|KFH73669.1|  guanine nucleotide-binding protein subunit beta-l...    253   3e-79    
ref|XP_007864562.1|  WD40 repeat-like protein                           253   4e-79    
ref|XP_010020213.1|  PREDICTED: guanine nucleotide-binding protei...    249   4e-79    
gb|ABA01128.1|  G protein beta subunit-like polypeptide                 251   5e-79    
ref|XP_011445926.1|  PREDICTED: guanine nucleotide-binding protei...    252   6e-79    
ref|XP_009983622.1|  PREDICTED: guanine nucleotide-binding protei...    251   6e-79    
gb|AFV81452.1|  receptor for activated protein kinase C                 252   7e-79    
gb|AGN75114.1|  receptor for activated C kinase 1                       252   7e-79    
gb|AAZ29606.1|  activated C kinase 1 receptor                           252   8e-79    
gb|ACU33969.1|  receptor of activated kinase C                          252   8e-79    
gb|KHJ35931.1|  putative guanine nucleotide-binding protein subun...    252   9e-79    
gb|AAZ29605.1|  activated C kinase 1 receptor                           252   9e-79    
emb|CDH49357.1|  guanine nucleotide binding protein beta subunit        252   9e-79    
emb|CDS03837.1|  Putative Guanine nucleotide-binding proteinFT su...    251   1e-78    
ref|XP_008034536.1|  guanine nucleotide binding protein beta subunit    251   1e-78    
emb|CCF48119.1|  probable CPC2 protein, guanine nucleotide-bindin...    251   2e-78    
dbj|BAD52259.1|  receptor for activated protein kinase C homolog        251   2e-78    
gb|KFU89350.1|  Guanine nucleotide-binding protein subunit beta-2...    249   2e-78    
gb|EMS22902.1|  G-protein complex beta subunit                          251   2e-78    
ref|XP_007362000.1|  guanine nucleotide binding protein beta subunit    250   3e-78    
dbj|BAM17717.1|  receptor of activated protein kinase C 1               250   3e-78    
ref|XP_007877264.1|  hypothetical protein PFL1_01563                    251   3e-78    
gb|KIM24190.1|  hypothetical protein M408DRAFT_331939                   250   4e-78    
emb|CCX15458.1|  Similar to Guanine nucleotide-binding protein su...    251   4e-78    
ref|XP_008494697.1|  PREDICTED: guanine nucleotide-binding protei...    249   4e-78    
gb|KIO09923.1|  hypothetical protein M404DRAFT_995909                   250   4e-78    
ref|XP_009547379.1|  hypothetical protein HETIRDRAFT_418643             250   4e-78    
gb|AEB26318.1|  receptor for activated protein kinase C                 250   4e-78    
ref|XP_007007889.1|  hypothetical protein TREMEDRAFT_45853              250   5e-78    
gb|ELW66848.1|  Guanine nucleotide-binding protein subunit beta-2...    259   5e-78    
gb|ADO33039.1|  receptor for activated protein kinase C RACK isof...    250   5e-78    
emb|CBQ71151.1|  probable CPC2 protein, guanine nucleotide-bindin...    249   6e-78    
gb|KEI37942.1|  hypothetical protein L969DRAFT_89179                    249   6e-78    
gb|EMP25897.1|  Guanine nucleotide-binding protein subunit beta-2...    261   6e-78    
gb|AAM88905.1|  guanine nucleotide-binding protein                      249   6e-78    
gb|KII92153.1|  hypothetical protein PLICRDRAFT_104409                  249   7e-78    
ref|XP_011388829.1|  putative guanine nucleotide-binding protein ...    249   7e-78    
ref|XP_007308233.1|  guanine nucleotide binding protein beta subunit    249   9e-78    
ref|XP_973579.1|  PREDICTED: guanine nucleotide-binding protein s...    249   1e-77    
gb|KDQ21830.1|  hypothetical protein BOTBODRAFT_123721                  249   1e-77    
gb|ETS62557.1|  hypothetical protein PaG_03192                          250   1e-77    
emb|CEG70024.1|  Putative Guanine nucleotide-binding protein subu...    248   1e-77    
gb|AAS59422.1|  G-protein beta subunit like-protein                     244   1e-77    
dbj|GAC98631.1|  hypothetical protein PHSY_006225                       251   1e-77    
ref|XP_003664641.1|  hypothetical protein MYCTH_2307651                 249   1e-77    
emb|CEJ02996.1|  Putative Guanine nucleotide-binding protein subu...    248   1e-77    
emb|CDI55376.1|  probable CPC2 protein, guanine nucleotide-bindin...    249   1e-77    
ref|NP_001041703.1|  receptor for activated protein kinase C RACK...    249   2e-77    
ref|XP_006695086.1|  putative guanine nucleotide-binding protein        248   2e-77    
gb|ACR19030.1|  receptor for activated protein kinase C                 249   2e-77    
emb|CEG70023.1|  Putative Guanine nucleotide-binding protein subu...    248   2e-77    
ref|XP_006665983.1|  guanine nucleotide-binding protein beta subu...    248   2e-77    
gb|AAU84924.1|  putative activated protein kinase C receptor            248   2e-77    
gb|KIH90457.1|  guanine nucleotide-binding protein subunit beta-2...    247   2e-77    
ref|XP_007799385.1|  putative guanine nucleotide-binding protein ...    248   2e-77    
dbj|BAK78892.1|  receptor of activated protein kinase C1                245   2e-77    
gb|ABX55886.1|  activated C kinase 1 receptor                           248   2e-77    
gb|AAP13580.2|AF407335_1  guanine nucleotide binding protein beta...    248   2e-77    
gb|AEE62785.1|  unknown                                                 248   2e-77    
ref|XP_002850965.1|  G-protein complex beta subunit CpcB                248   3e-77    
emb|CCM01124.1|  predicted protein                                      248   3e-77    
ref|XP_008600266.1|  WD domain-containing protein                       248   3e-77    
ref|NP_001280259.1|  guanine nucleotide-binding protein subunit b...    248   3e-77    
gb|EMD37863.1|  guanine nucleotide binding protein beta subunit         248   3e-77    
gb|ERS97367.1|  guanine nucleotide-binding protein subunit beta-l...    248   3e-77    
gb|KIY65838.1|  guanine nucleotide binding protein beta subunit         246   4e-77    
gb|ENN71239.1|  hypothetical protein YQE_12166                          249   4e-77    
ref|XP_661767.1|  GBLP_NEUCR Guanine nucleotide-binding protein b...    247   4e-77    
gb|KIJ67868.1|  hypothetical protein HYDPIDRAFT_25333                   247   5e-77    
gb|EST05924.1|  putative CPC2 protein, guanine nucleotide-binding...    248   5e-77    
gb|KIK68892.1|  hypothetical protein GYMLUDRAFT_236781                  247   5e-77    
gb|ACO15464.1|  Guanine nucleotide-binding protein subunit beta-2...    247   5e-77    
ref|XP_009160336.1|  guanine nucleotide-binding protein subunit b...    249   6e-77    
gb|KGL84405.1|  Guanine nucleotide-binding protein subunit beta-2...    246   6e-77    
gb|KIV82161.1|  guanine nucleotide-binding protein subunit beta-l...    247   6e-77    
ref|XP_007397219.1|  hypothetical protein PHACADRAFT_258442             247   6e-77    
gb|KDE05309.1|  guanine nucleotide-binding protein subunit beta-l...    247   6e-77    
ref|XP_007849688.1|  g-protein comlpex beta subunit                     247   7e-77    
gb|EHK21487.1|  cross-pathway control WD-repeat protein cpc2            247   7e-77    
gb|KIK28004.1|  hypothetical protein PISMIDRAFT_148977                  247   8e-77    
gb|ACN10148.1|  Guanine nucleotide-binding protein subunit beta-2...    247   8e-77    
gb|KFP02898.1|  Guanine nucleotide-binding protein subunit beta-2...    246   8e-77    
ref|XP_004780256.1|  PREDICTED: guanine nucleotide-binding protei...    247   8e-77    
ref|XP_007287787.1|  g-protein beta subunit                             246   9e-77    
ref|XP_001830441.1|  guanine nucleotide binding protein beta subunit    246   9e-77    
gb|KIW62858.1|  guanine nucleotide-binding protein subunit beta-l...    246   9e-77    
sp|Q93134.1|GBLP_BIOGL  RecName: Full=Guanine nucleotide-binding ...    246   9e-77    
gb|KIM69177.1|  hypothetical protein SCLCIDRAFT_1208600                 246   9e-77    
ref|XP_003176836.1|  G-protein comlpex beta subunit CpcB                246   1e-76    
gb|KDN52294.1|  putative CPC2 protein                                   246   1e-76    
gb|KIX03579.1|  guanine nucleotide-binding protein subunit beta-l...    246   1e-76    
dbj|GAE00026.1|  hypothetical protein PVAR5_8757                        246   1e-76    
gb|KDR18184.1|  Guanine nucleotide-binding protein subunit beta-l...    246   1e-76    
gb|KIW10778.1|  guanine nucleotide-binding protein subunit beta-l...    246   1e-76    
gb|EQB48545.1|  hypothetical protein CGLO_12231                         246   1e-76    
ref|XP_003051079.1|  predicted protein                                  246   1e-76    
ref|XP_007723621.1|  guanine nucleotide-binding protein subunit b...    246   1e-76    
gb|EPT05016.1|  hypothetical protein FOMPIDRAFT_1045684                 246   1e-76    
gb|EXX68230.1|  Asc1p                                                   246   1e-76    
gb|ABU41071.1|  receptor for activated protein kinase C-like protein    246   1e-76    
ref|XP_002613759.1|  hypothetical protein BRAFLDRAFT_84515              246   1e-76    
ref|XP_001226350.1|  guanine nucleotide-binding protein beta subu...    246   1e-76    
ref|XP_001631784.1|  predicted protein                                  246   1e-76    
gb|KFH46842.1|  Guanine nucleotide-binding protein subunit beta-l...    246   1e-76    
ref|XP_003651077.1|  hypothetical protein THITE_2169762                 246   2e-76    
gb|KIK47181.1|  hypothetical protein CY34DRAFT_799718                   246   2e-76    
ref|XP_007761319.1|  guanine nucleotide-binding protein subunit b...    246   2e-76    
ref|XP_006962578.1|  cross-pathway control WD-repeat-containing p...    246   2e-76    
ref|XP_007339269.1|  guanine nucleotide binding protein beta subunit    246   2e-76    
emb|CCO34704.1|  Guanine nucleotide-binding protein subunit beta-...    246   2e-76    
gb|KIW40911.1|  guanine nucleotide-binding protein subunit beta-l...    246   2e-76    
gb|AAM88903.1|  guanine nucleotide-binding protein                      245   2e-76    
ref|XP_008052288.1|  PREDICTED: LOW QUALITY PROTEIN: guanine nucl...    246   2e-76    
gb|ABR23464.1|  G protein beta subunit-like protein                     246   2e-76    
ref|XP_009261603.1|  FGB1                                               245   2e-76    
ref|XP_001537609.1|  hypothetical protein HCAG_07031                    245   3e-76    
ref|XP_001212378.1|  hypothetical protein ATEG_03200                    244   3e-76    
ref|XP_005818516.1|  small subunit ribosomal protein RACK1, cytop...    246   3e-76    
gb|KIP05099.1|  hypothetical protein PHLGIDRAFT_74762                   245   3e-76    
ref|XP_007730120.1|  guanine nucleotide-binding protein subunit b...    245   3e-76    
gb|ABI63548.1|  receptor for activated protein kinase C-like            245   3e-76    
gb|KDN41366.1|  Guanine nucleotide-binding protein subunit beta-l...    245   3e-76    
gb|ENH83707.1|  g-protein beta subunit                                  245   3e-76    
ref|XP_001903663.1|  hypothetical protein                               245   3e-76    
ref|XP_007602725.1|  guanine nucleotide-binding protein subunit b...    245   3e-76    
emb|CEJ92213.1|  Putative Pc22g03140 protein                            245   4e-76    
ref|XP_007839961.1|  Guanine nucleotide-binding protein subunit b...    245   4e-76    
gb|KIO29426.1|  hypothetical protein M407DRAFT_242642                   245   4e-76    
gb|ABA33785.1|  RACK1-like protein                                      245   4e-76    
gb|KDB16187.1|  G-protein beta subunit                                  244   4e-76    
gb|AHW80379.1|  guanine nucleotide-binding protein                      245   4e-76    
ref|XP_002791085.1|  G-protein comlpex beta subunit CpcB                245   4e-76    
gb|KGB35723.1|  Guanine nucleotide-binding protein subunit beta-2...    245   5e-76    
ref|XP_010756949.1|  guanine nucleotide-binding protein subunit b...    245   5e-76    
ref|XP_001239490.1|  hypothetical protein CIMG_09111                    244   5e-76    



>ref|XP_006341557.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein-like [Solanum tuberosum]
Length=327

 Score =   373 bits (957),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 176/199 (88%), Positives = 191/199 (96%), Gaps = 0/199 (0%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            +IKLWNTLGECKYTIQDGD H++WVSCVRFSP+TLQPTIVSGSWDRTVK+WNL+NCKLRS
Sbjct  129  SIKLWNTLGECKYTIQDGDSHSDWVSCVRFSPNTLQPTIVSGSWDRTVKIWNLTNCKLRS  188

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
            TLAGH+GYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDA SIIH LCFSPNRY
Sbjct  189  TLAGHSGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDASSIIHTLCFSPNRY  248

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGS  210
            WLCAATE+SIKIWDLESK+IVVDLRVDLK ESEM+A  + TA KNK+I+CTSLSW+ADGS
Sbjct  249  WLCAATESSIKIWDLESKTIVVDLRVDLKHESEMAANESGTAPKNKVIYCTSLSWSADGS  308

Query  209  TLFSGYTDGVIRVWGIGRY  153
            TLFSGYTDG+IRVWGIGRY
Sbjct  309  TLFSGYTDGLIRVWGIGRY  327


 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 48/186 (26%), Positives = 80/186 (43%), Gaps = 27/186 (15%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKL-----RSTLAGHTGYVNTVAV  528
             H +WV+ +  +P      IV+ S D+++ VW+L+         R  L GH  +V  V +
Sbjct  14   AHTDWVTAIA-TPIDNSDMIVTSSRDKSIIVWSLTKDGAQYGVPRRRLTGHGHFVQDVVL  72

Query  527  SPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKI  354
            S DG    SG  DG + LWDL  G   + +      ++       NR  + A+ + SIK+
Sbjct  73   SSDGMFALSGSWDGELRLWDLQAGTTARRFVGHTKDVLSVAFSVDNRQIVSASRDKSIKL  132

Query  353  WDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  180
            W+   E K  + D              G+   + +  + C   S N    T+ SG  D  
Sbjct  133  WNTLGECKYTIQD--------------GD---SHSDWVSCVRFSPNTLQPTIVSGSWDRT  175

Query  179  IRVWGI  162
            +++W +
Sbjct  176  VKIWNL  181



>ref|XP_009611065.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Nicotiana tomentosiformis]
Length=325

 Score =   371 bits (953),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 180/199 (90%), Positives = 189/199 (95%), Gaps = 1/199 (1%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            TIKLWNTLGECKYTI DGD H+ WVSCVRFSP+ LQPTIVSGSWDRTVK+WNL+NCKLRS
Sbjct  128  TIKLWNTLGECKYTITDGDSHSNWVSCVRFSPNNLQPTIVSGSWDRTVKIWNLTNCKLRS  187

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
            TLAGH+GYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIH LCFSPNRY
Sbjct  188  TLAGHSGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHTLCFSPNRY  247

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGS  210
            WLCAATE+SIKIWDLESKSIVVDLRVDLKQESEMSAEG   AAKNKII+CT LSW+ADGS
Sbjct  248  WLCAATESSIKIWDLESKSIVVDLRVDLKQESEMSAEG-TAAAKNKIIYCTCLSWSADGS  306

Query  209  TLFSGYTDGVIRVWGIGRY  153
            TLF GYTDG+IRVWGIGRY
Sbjct  307  TLFGGYTDGLIRVWGIGRY  325


 Score = 53.1 bits (126),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 46/186 (25%), Positives = 78/186 (42%), Gaps = 27/186 (15%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSN-----CKLRSTLAGHTGYVNTVAV  528
             H +WV+ +  +P      IV+ S D+++ VW+L+         R  L GH  +V  V +
Sbjct  13   AHTDWVTAIA-TPIDNSDMIVTSSRDKSIIVWSLTKDGPQYGVPRRRLTGHGHFVQDVVL  71

Query  527  SPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKI  354
            S DG    SG  DG + LWDL  G   + +      ++       NR  + A+ + +IK+
Sbjct  72   SSDGMFALSGSWDGELRLWDLQAGTTARRFVGHTKDVLSVAFSVDNRQIVSASRDKTIKL  131

Query  353  WDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  180
            W+   E K  + D                   + +  + C   S N    T+ SG  D  
Sbjct  132  WNTLGECKYTITD-----------------GDSHSNWVSCVRFSPNNLQPTIVSGSWDRT  174

Query  179  IRVWGI  162
            +++W +
Sbjct  175  VKIWNL  180



>ref|XP_009776114.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Nicotiana sylvestris]
Length=328

 Score =   369 bits (948),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 177/200 (89%), Positives = 190/200 (95%), Gaps = 1/200 (1%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            TIKLWNTLGECKYTIQ+GD H++WVSCVRFSP+TLQPTIVSGSWDRTVK+WNL+NCKLRS
Sbjct  129  TIKLWNTLGECKYTIQEGDSHSDWVSCVRFSPNTLQPTIVSGSWDRTVKIWNLTNCKLRS  188

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
            TLAGH GYVNTVAVSPDGSLCASGGKDG ILLWDLAEGKKLYSLDAGSIIHALCFSPNRY
Sbjct  189  TLAGHAGYVNTVAVSPDGSLCASGGKDGTILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  248

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNN-TAAKNKIIFCTSLSWNADG  213
            WLCAATE SIKIWDLESKSIVVDL+VDLKQESEM+ EG   +A KNKI++CT LSW+ADG
Sbjct  249  WLCAATETSIKIWDLESKSIVVDLKVDLKQESEMATEGTTGSACKNKIMYCTCLSWSADG  308

Query  212  STLFSGYTDGVIRVWGIGRY  153
            STLFSGYTDG+IRVWGIGRY
Sbjct  309  STLFSGYTDGLIRVWGIGRY  328


 Score = 53.1 bits (126),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 46/184 (25%), Positives = 79/184 (43%), Gaps = 23/184 (13%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSN-----CKLRSTLAGHTGYVNTVAV  528
             H +WV+ +  +P      IV+ S D+++ VW+L+         R  L GH  +V  V +
Sbjct  14   AHTDWVTAIA-TPIDNSDMIVTSSRDKSLIVWSLTKDGPQYGVPRRRLTGHGHFVQDVVL  72

Query  527  SPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKI  354
            S DG    SG  DG + LWDL  G   + +      ++       NR  + A+ + +IK+
Sbjct  73   SSDGMFALSGSWDGELRLWDLQAGTTARRFVGHTKDVLSVAFSVDNRQIVSASRDKTIKL  132

Query  353  WDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIR  174
            W+             L +      EG+   + +  + C   S N    T+ SG  D  ++
Sbjct  133  WNT------------LGECKYTIQEGD---SHSDWVSCVRFSPNTLQPTIVSGSWDRTVK  177

Query  173  VWGI  162
            +W +
Sbjct  178  IWNL  181



>ref|XP_009780116.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Nicotiana sylvestris]
Length=325

 Score =   369 bits (948),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 178/199 (89%), Positives = 191/199 (96%), Gaps = 1/199 (1%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            TIKLWNTLGECKYTI DGD H++WVSCVRFSP+ LQPTIVSGSWDRTVK+WNL+NCKLRS
Sbjct  128  TIKLWNTLGECKYTITDGDSHSDWVSCVRFSPNNLQPTIVSGSWDRTVKIWNLTNCKLRS  187

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
            TLAGH+GYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSL+AGSIIH+LCFSPNRY
Sbjct  188  TLAGHSGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLEAGSIIHSLCFSPNRY  247

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGS  210
            WLCAATE+SIKIWDLESKSIVVDL+VDLKQESEMSAEG   AAKNKII+CT LSW+ADGS
Sbjct  248  WLCAATESSIKIWDLESKSIVVDLKVDLKQESEMSAEG-TAAAKNKIIYCTCLSWSADGS  306

Query  209  TLFSGYTDGVIRVWGIGRY  153
            TLF GYTDG+IRVWGIGRY
Sbjct  307  TLFGGYTDGLIRVWGIGRY  325


 Score = 52.8 bits (125),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 48/186 (26%), Positives = 80/186 (43%), Gaps = 27/186 (15%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSN-----CKLRSTLAGHTGYVNTVAV  528
             H +WV+ +  +P      IV+ S D+++ VW+L+         R  L GH  +V  V +
Sbjct  13   AHTDWVTAIA-TPIDNSDMIVTSSRDKSIIVWSLTKDGPQYGVPRRRLTGHGHFVQDVVL  71

Query  527  SPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSI-IHALCFS-PNRYWLCAATEASIKI  354
            S DG    SG  DG + LWDL  G         +  + ++ FS  NR  + A+ + +IK+
Sbjct  72   SSDGMFALSGSWDGELRLWDLQAGTTARRFVGHTKDVLSVAFSIDNRQIVSASRDKTIKL  131

Query  353  WDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  180
            W+   E K  + D                   + +  + C   S N    T+ SG  D  
Sbjct  132  WNTLGECKYTITD-----------------GDSHSDWVSCVRFSPNNLQPTIVSGSWDRT  174

Query  179  IRVWGI  162
            +++W +
Sbjct  175  VKIWNL  180



>gb|ABB86277.1| ArcA2 protein-like [Solanum tuberosum]
Length=327

 Score =   369 bits (948),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 175/199 (88%), Positives = 190/199 (95%), Gaps = 0/199 (0%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            +IKLWNTLGECKYTIQDGD H++WVSCVRFSP+TLQPTIVSGSWDRTVK+WNL+NCKLRS
Sbjct  129  SIKLWNTLGECKYTIQDGDSHSDWVSCVRFSPNTLQPTIVSGSWDRTVKIWNLTNCKLRS  188

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
            TLAGH+GYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDA SIIH LCFSPNRY
Sbjct  189  TLAGHSGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDASSIIHTLCFSPNRY  248

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGS  210
            WLCAATE+SIKIWDLESK+IVVDLRVDLKQESEM+A  + T  KNK+I+CTSLSW+ADGS
Sbjct  249  WLCAATESSIKIWDLESKTIVVDLRVDLKQESEMAATESGTGPKNKVIYCTSLSWSADGS  308

Query  209  TLFSGYTDGVIRVWGIGRY  153
            TL SGYTDG+IRVWGIGRY
Sbjct  309  TLSSGYTDGLIRVWGIGRY  327


 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 48/186 (26%), Positives = 80/186 (43%), Gaps = 27/186 (15%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKL-----RSTLAGHTGYVNTVAV  528
             H +WV+ +  +P      IV+ S D+++ VW+L+         R  L GH  +V  V +
Sbjct  14   AHTDWVTAIA-TPIDNSDMIVTSSRDKSIIVWSLTKDGAQYGVPRRRLTGHGHFVQDVVL  72

Query  527  SPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKI  354
            S DG    SG  DG + LWDL  G   + +      ++       NR  + A+ + SIK+
Sbjct  73   SSDGMFALSGSWDGELRLWDLQAGTTARRFVGHTKDVLSVAFSVDNRQIVSASRDKSIKL  132

Query  353  WDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  180
            W+   E K  + D              G+   + +  + C   S N    T+ SG  D  
Sbjct  133  WNTLGECKYTIQD--------------GD---SHSDWVSCVRFSPNTLQPTIVSGSWDRT  175

Query  179  IRVWGI  162
            +++W +
Sbjct  176  VKIWNL  181



>gb|AJE63428.1| transcription factor ArcA1 [Capsicum annuum]
Length=330

 Score =   369 bits (947),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 178/202 (88%), Positives = 190/202 (94%), Gaps = 3/202 (1%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            +IKLWNTLGECKYTIQDGD H++WVSCVRFSP+TLQPTIVSGSWDRTVK+WNL+NCKLRS
Sbjct  129  SIKLWNTLGECKYTIQDGDSHSDWVSCVRFSPNTLQPTIVSGSWDRTVKIWNLTNCKLRS  188

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
            TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIH LCFSPNRY
Sbjct  189  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHTLCFSPNRY  248

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSA---EGNNTAAKNKIIFCTSLSWNA  219
            WLCAATE+SIKIWDLESKSIVVDLRVDLKQESEM A   +G     KNKII+CTSLSW+A
Sbjct  249  WLCAATESSIKIWDLESKSIVVDLRVDLKQESEMLAATPDGGAAPVKNKIIYCTSLSWSA  308

Query  218  DGSTLFSGYTDGVIRVWGIGRY  153
            DGSTL+ GYTDG+IRVWGIGRY
Sbjct  309  DGSTLYRGYTDGLIRVWGIGRY  330


 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 50/186 (27%), Positives = 81/186 (44%), Gaps = 27/186 (15%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSN-----CKLRSTLAGHTGYVNTVAV  528
             H +WV+ +  +P      IV+ S D+++ VW+L+         R  L GH  +V  V +
Sbjct  14   AHTDWVTAIA-TPIDNSDMIVTSSRDKSIIVWSLTKDGPTYGVPRRRLTGHGHFVQDVVL  72

Query  527  SPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSI-IHALCFS-PNRYWLCAATEASIKI  354
            S DG    SG  DG + LWDL  G    S    +  + ++ FS  NR  + A+ + SIK+
Sbjct  73   SSDGMFALSGSWDGELRLWDLQAGTTARSFVGHTKDVLSVAFSVDNRQIVSASRDKSIKL  132

Query  353  WDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  180
            W+   E K  + D                   + +  + C   S N    T+ SG  D  
Sbjct  133  WNTLGECKYTIQD-----------------GDSHSDWVSCVRFSPNTLQPTIVSGSWDRT  175

Query  179  IRVWGI  162
            +++W +
Sbjct  176  VKIWNL  181



>emb|CAA96528.1| G protein beta-subunit-like protein [Nicotiana plumbaginifolia]
Length=328

 Score =   368 bits (945),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 176/200 (88%), Positives = 190/200 (95%), Gaps = 1/200 (1%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            +IKLWNTLGECKYTIQ+GD H++WVSCVRFSP+TLQPTIVSGSWDRTVK+WNL+NCKLRS
Sbjct  129  SIKLWNTLGECKYTIQEGDSHSDWVSCVRFSPNTLQPTIVSGSWDRTVKIWNLTNCKLRS  188

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
            TLAGH GYVNTVAVSPDGSLCASGGKDG ILLWDLAEGKKLYSLDAGSIIHALCFSPNRY
Sbjct  189  TLAGHAGYVNTVAVSPDGSLCASGGKDGTILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  248

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNN-TAAKNKIIFCTSLSWNADG  213
            WLCAATE SIKIWDLESKSIVVDL+VDLKQESEM+ EG   +A KNKI++CT LSW+ADG
Sbjct  249  WLCAATETSIKIWDLESKSIVVDLKVDLKQESEMATEGTTGSACKNKIMYCTCLSWSADG  308

Query  212  STLFSGYTDGVIRVWGIGRY  153
            STLFSGYTDG+IRVWGIGRY
Sbjct  309  STLFSGYTDGLIRVWGIGRY  328


 Score = 54.3 bits (129),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 47/184 (26%), Positives = 79/184 (43%), Gaps = 23/184 (13%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSN-----CKLRSTLAGHTGYVNTVAV  528
             H +WV+ +  +P      IV+ S D+++ VW+L+         R  L GH  +V  V +
Sbjct  14   AHTDWVTAIA-TPIDNSDMIVTSSRDKSLIVWSLTKDGPQYGVPRRRLTGHGHFVQDVVL  72

Query  527  SPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKI  354
            S DG    SG  DG + LWDL  G   + +      ++       NR  + A+ + SIK+
Sbjct  73   SSDGMFALSGSWDGELRLWDLQAGTTARRFVGHTKDVLSVAFSVDNRQIVSASRDKSIKL  132

Query  353  WDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIR  174
            W+             L +      EG+   + +  + C   S N    T+ SG  D  ++
Sbjct  133  WNT------------LGECKYTIQEGD---SHSDWVSCVRFSPNTLQPTIVSGSWDRTVK  177

Query  173  VWGI  162
            +W +
Sbjct  178  IWNL  181



>ref|XP_009600162.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Nicotiana tomentosiformis]
Length=328

 Score =   367 bits (942),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 175/200 (88%), Positives = 190/200 (95%), Gaps = 1/200 (1%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            +IKLWNTLGECKYTIQ+GD H++WVSCVRFSP+TLQPTIVSGSWDRTVK+WNL+NCKLRS
Sbjct  129  SIKLWNTLGECKYTIQEGDSHSDWVSCVRFSPNTLQPTIVSGSWDRTVKIWNLTNCKLRS  188

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
            TLAGH GYVNTVAVSPDGSLCASGGKDG ILLWDLAEGKKLYSLDAGSIIHALCFSPNRY
Sbjct  189  TLAGHGGYVNTVAVSPDGSLCASGGKDGTILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  248

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNN-TAAKNKIIFCTSLSWNADG  213
            WLCAATE SIKIWDLESKS+VVDL+VDLKQESEM+ EG   +A KNKI++CT LSW+ADG
Sbjct  249  WLCAATETSIKIWDLESKSVVVDLKVDLKQESEMATEGTTGSACKNKIMYCTCLSWSADG  308

Query  212  STLFSGYTDGVIRVWGIGRY  153
            STLFSGYTDG+IRVWGIGRY
Sbjct  309  STLFSGYTDGLIRVWGIGRY  328


 Score = 53.5 bits (127),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 47/184 (26%), Positives = 78/184 (42%), Gaps = 23/184 (13%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSN-----CKLRSTLAGHTGYVNTVAV  528
             H +WV+ +  +P      IV+ S D+++ VW L+         R  L GH  +V  V +
Sbjct  14   AHTDWVTAIA-TPIDNSDMIVTSSRDKSLIVWALTKDGPQYGVPRRRLTGHGHFVQDVVL  72

Query  527  SPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKI  354
            S DG    SG  DG + LWDL  G   + +      ++       NR  + A+ + SIK+
Sbjct  73   SSDGMFALSGSWDGELRLWDLQAGTTARRFVGHTKDVLSVAFSVDNRQIVSASRDKSIKL  132

Query  353  WDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIR  174
            W+             L +      EG+   + +  + C   S N    T+ SG  D  ++
Sbjct  133  WNT------------LGECKYTIQEGD---SHSDWVSCVRFSPNTLQPTIVSGSWDRTVK  177

Query  173  VWGI  162
            +W +
Sbjct  178  IWNL  181


 Score = 50.4 bits (119),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 50/187 (27%), Positives = 80/187 (43%), Gaps = 31/187 (17%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVNTVAVSPDGS  513
            GH  +V  V  S   +    +SGSWD  +++W+L          GHT  V +VA S D  
Sbjct  62   GHGHFVQDVVLSSDGMFA--LSGSWDGELRLWDLQAGTTARRFVGHTKDVLSVAFSVDNR  119

Query  512  LCASGGKDGVILLWD-LAEGKKLYSLDAGSI----IHALCFSPNRYW---LCAATEASIK  357
               S  +D  I LW+ L E K  Y++  G      +  + FSPN      +  + + ++K
Sbjct  120  QIVSASRDKSIKLWNTLGECK--YTIQEGDSHSDWVSCVRFSPNTLQPTIVSGSWDRTVK  177

Query  356  IWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVI  177
            IW+L           + K  S ++  G          +  +++ + DGS   SG  DG I
Sbjct  178  IWNL----------TNCKLRSTLAGHGG---------YVNTVAVSPDGSLCASGGKDGTI  218

Query  176  RVWGIGR  156
             +W +  
Sbjct  219  LLWDLAE  225



>ref|NP_001233881.1| ArcA2 protein [Solanum lycopersicum]
 dbj|BAA76896.1| LeArcA2 protein [Solanum lycopersicum]
Length=326

 Score =   366 bits (939),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 175/199 (88%), Positives = 190/199 (95%), Gaps = 1/199 (1%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            +IKLWNTLGECKYTIQDG  H++WVSCVRFSP+TLQPTIVSGSWDRTVK+WNL+NCKLRS
Sbjct  129  SIKLWNTLGECKYTIQDGHSHSDWVSCVRFSPNTLQPTIVSGSWDRTVKIWNLTNCKLRS  188

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
            TLAGH+GYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIH LCFSPNRY
Sbjct  189  TLAGHSGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHTLCFSPNRY  248

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGS  210
            WLCAATE+SIKIWDLESKSIVVDL+VDLK ESEM+ E + TA K K+I+CTSLSW+ADGS
Sbjct  249  WLCAATESSIKIWDLESKSIVVDLKVDLKHESEMANE-SGTAPKTKVIYCTSLSWSADGS  307

Query  209  TLFSGYTDGVIRVWGIGRY  153
            TLFSGYTDG+IRVWGIGRY
Sbjct  308  TLFSGYTDGLIRVWGIGRY  326


 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 47/186 (25%), Positives = 78/186 (42%), Gaps = 27/186 (15%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKL-----RSTLAGHTGYVNTVAV  528
             H +WV+ +  +P      IV+ S D+++ VW+L+         R  L GH  +V  V +
Sbjct  14   AHTDWVTAIA-TPIDNSDMIVTSSRDKSIIVWSLTKDGAQYGVPRRRLTGHGHFVQDVVL  72

Query  527  SPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKI  354
            S DG    SG  DG + LWDL  G   + +      ++       NR  + A+ + SIK+
Sbjct  73   SSDGMFALSGSWDGELRLWDLQAGTTARRFVGHTKDVLSVAFSVDNRQIVSASRDKSIKL  132

Query  353  WDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  180
            W+   E K  + D                   + +  + C   S N    T+ SG  D  
Sbjct  133  WNTLGECKYTIQD-----------------GHSHSDWVSCVRFSPNTLQPTIVSGSWDRT  175

Query  179  IRVWGI  162
            +++W +
Sbjct  176  VKIWNL  181



>gb|ABB02625.1| G protein beta subunit-like protein [Solanum tuberosum]
Length=261

 Score =   363 bits (931),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 174/201 (87%), Positives = 189/201 (94%), Gaps = 2/201 (1%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            +IKLWNTLGECKYTIQD D H++WVSCVRFSP+ LQPTIVSGSWDRTVK+WNLSNCKLR+
Sbjct  61   SIKLWNTLGECKYTIQDQDSHSDWVSCVRFSPNNLQPTIVSGSWDRTVKIWNLSNCKLRA  120

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
            TLAGHTGYVNT AVSPDGSLCASGGKDGVILLWDLAEGKKLYSLD+GSIIHALCFSPNRY
Sbjct  121  TLAGHTGYVNTAAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDSGSIIHALCFSPNRY  180

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTA--AKNKIIFCTSLSWNAD  216
            WLCAATE+SIKIWDLESKSIVVDLRVDLKQE+EM     +T+  AK K+I+CTSLSW+AD
Sbjct  181  WLCAATESSIKIWDLESKSIVVDLRVDLKQETEMFGNATSTSGNAKTKVIYCTSLSWSAD  240

Query  215  GSTLFSGYTDGVIRVWGIGRY  153
            GSTLFSGYTDG+IRVWGIGRY
Sbjct  241  GSTLFSGYTDGLIRVWGIGRY  261



>ref|XP_004252270.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein isoform X1 [Solanum lycopersicum]
Length=329

 Score =   365 bits (938),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 174/201 (87%), Positives = 190/201 (95%), Gaps = 2/201 (1%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            +IKLWNTLGECKYTIQD D H++WVSCVRFSP+ LQPTIVSGSWDRTVK+WNLSNCKLR+
Sbjct  129  SIKLWNTLGECKYTIQDQDSHSDWVSCVRFSPNNLQPTIVSGSWDRTVKIWNLSNCKLRA  188

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
            TLAGHTGYVNT AVSPDGSLCASGGKDGVILLWDLAEGKKLYSLD+GSIIHALCFSPNRY
Sbjct  189  TLAGHTGYVNTAAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDSGSIIHALCFSPNRY  248

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTA--AKNKIIFCTSLSWNAD  216
            WLCAATE+SIKIWDLESKSIVVDLRVDLKQE+EMS    +T+  +K K+I+CTSLSW+AD
Sbjct  249  WLCAATESSIKIWDLESKSIVVDLRVDLKQETEMSGNATSTSGNSKTKVIYCTSLSWSAD  308

Query  215  GSTLFSGYTDGVIRVWGIGRY  153
            GSTLFSGYTDG+IRVWGIGRY
Sbjct  309  GSTLFSGYTDGLIRVWGIGRY  329


 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 49/186 (26%), Positives = 80/186 (43%), Gaps = 27/186 (15%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSN-----CKLRSTLAGHTGYVNTVAV  528
             H +WV+ +  +P      IV+ S D+++ VW+L+         R  L GH  +V  V +
Sbjct  14   AHTDWVTAIA-TPIDNSDMIVTSSRDKSIIVWSLTKEGSQYGVPRRRLTGHGHFVQDVVL  72

Query  527  SPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKI  354
            S DG    SG  DG + LWDL  G   + +      ++       NR  + A+ + SIK+
Sbjct  73   SSDGMFALSGSWDGELRLWDLQAGTTARRFVGHTKDVLSVAFSVDNRQIVSASRDKSIKL  132

Query  353  WDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  180
            W+   E K  + D      Q+S            +  + C   S N    T+ SG  D  
Sbjct  133  WNTLGECKYTIQD------QDSH-----------SDWVSCVRFSPNNLQPTIVSGSWDRT  175

Query  179  IRVWGI  162
            +++W +
Sbjct  176  VKIWNL  181



>gb|EYU40229.1| hypothetical protein MIMGU_mgv1a008949mg [Erythranthe guttata]
Length=357

 Score =   366 bits (940),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 173/201 (86%), Positives = 191/201 (95%), Gaps = 2/201 (1%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            TIKLWNTLGECKYTIQD D H++WVSCVRFSP+TLQPTIVS SWD+TVK+WNL+NCKLRS
Sbjct  157  TIKLWNTLGECKYTIQDQDAHSDWVSCVRFSPNTLQPTIVSASWDKTVKIWNLTNCKLRS  216

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
            TLAGH+GYVNT AVSPDGSLCASGGKDGVILLWDLAEGK+LYSLDAGSII+ALCFSPNRY
Sbjct  217  TLAGHSGYVNTSAVSPDGSLCASGGKDGVILLWDLAEGKRLYSLDAGSIINALCFSPNRY  276

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEG--NNTAAKNKIIFCTSLSWNAD  216
            WLCAATEASIKIWDLESKS+VVDL+VDLK ESE++ EG   + AAKNK+I+CTSLSW+AD
Sbjct  277  WLCAATEASIKIWDLESKSVVVDLKVDLKHESEIAPEGATQSAAAKNKVIYCTSLSWSAD  336

Query  215  GSTLFSGYTDGVIRVWGIGRY  153
            GSTLFSGYTDGV+RVWGIGRY
Sbjct  337  GSTLFSGYTDGVVRVWGIGRY  357


 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 47/186 (25%), Positives = 80/186 (43%), Gaps = 27/186 (15%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAV  528
             H +WV+ +  +P      IV+ S D+++ +W+L+         R  L GH+ +V  V +
Sbjct  42   AHTDWVTAIA-TPIDNSDMIVTASRDKSIILWSLTKEDRTYGVARRRLTGHSHFVEDVVL  100

Query  527  SPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSI-IHALCFS-PNRYWLCAATEASIKI  354
            S DG    SG  DG + LWDL  G         +  + ++ FS  NR  + A+ + +IK+
Sbjct  101  SSDGQFALSGSWDGELRLWDLQTGNTARRFVGHTKDVLSVAFSIDNRQIVSASRDKTIKL  160

Query  353  WDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  180
            W+   E K  + D                   A +  + C   S N    T+ S   D  
Sbjct  161  WNTLGECKYTIQD-----------------QDAHSDWVSCVRFSPNTLQPTIVSASWDKT  203

Query  179  IRVWGI  162
            +++W +
Sbjct  204  VKIWNL  209


 Score = 50.1 bits (118),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 57/185 (31%), Positives = 81/185 (44%), Gaps = 27/185 (15%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVNTVAVSPDGS  513
            GH+ +V  V  S        +SGSWD  +++W+L          GHT  V +VA S D  
Sbjct  90   GHSHFVEDVVLSSD--GQFALSGSWDGELRLWDLQTGNTARRFVGHTKDVLSVAFSIDNR  147

Query  512  LCASGGKDGVILLWD-LAEGK-KLYSLDAGSI-IHALCFSPNRYW---LCAATEASIKIW  351
               S  +D  I LW+ L E K  +   DA S  +  + FSPN      + A+ + ++KIW
Sbjct  148  QIVSASRDKTIKLWNTLGECKYTIQDQDAHSDWVSCVRFSPNTLQPTIVSASWDKTVKIW  207

Query  350  DLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRV  171
            +L +      LR  L   S       NT+A +            DGS   SG  DGVI +
Sbjct  208  NLTN----CKLRSTLAGHSGYV----NTSAVSP-----------DGSLCASGGKDGVILL  248

Query  170  WGIGR  156
            W +  
Sbjct  249  WDLAE  253



>ref|XP_009624187.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Nicotiana tomentosiformis]
Length=326

 Score =   364 bits (935),  Expect = 9e-123, Method: Compositional matrix adjust.
 Identities = 172/199 (86%), Positives = 191/199 (96%), Gaps = 1/199 (1%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            +I+LWNTLGECKYTIQDGD H++WVSCVRFSP+ LQPTIVSGSWDRTVK+WNL+NCKLR+
Sbjct  129  SIRLWNTLGECKYTIQDGDSHSDWVSCVRFSPNNLQPTIVSGSWDRTVKIWNLTNCKLRA  188

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
            TLAGHTGYVNT AVSPDGSLCASGGKDGVILLWDLAEGKKLYSL++GSIIH+LCFSPNRY
Sbjct  189  TLAGHTGYVNTAAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLESGSIIHSLCFSPNRY  248

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGS  210
            WLCAATE+SIKIWDLESKSIV DL+VDLKQESEMS+EG   + KNK+I+CTSLSW+ADGS
Sbjct  249  WLCAATESSIKIWDLESKSIVDDLKVDLKQESEMSSEG-TASGKNKVIYCTSLSWSADGS  307

Query  209  TLFSGYTDGVIRVWGIGRY  153
            TLFSGYTDG+IRVWGIGRY
Sbjct  308  TLFSGYTDGLIRVWGIGRY  326


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 45/186 (24%), Positives = 78/186 (42%), Gaps = 27/186 (15%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSN-----CKLRSTLAGHTGYVNTVAV  528
             H +WV+ +  +P      IV+ S D+++ VW+++         R  L GH  +V  V +
Sbjct  14   AHTDWVTAIA-TPVDNSDMIVTSSRDKSIIVWSITKDGPQYGVPRRRLTGHGHFVQDVVL  72

Query  527  SPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKI  354
            S DG    SG  DG + LWDL  G   + +      ++       NR  + A+ + SI++
Sbjct  73   SSDGMFALSGSWDGELRLWDLQAGTTARRFVGHTKDVLSVAFSVDNRQIVSASRDKSIRL  132

Query  353  WDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  180
            W+   E K  + D                   + +  + C   S N    T+ SG  D  
Sbjct  133  WNTLGECKYTIQD-----------------GDSHSDWVSCVRFSPNNLQPTIVSGSWDRT  175

Query  179  IRVWGI  162
            +++W +
Sbjct  176  VKIWNL  181


 Score = 50.4 bits (119),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 59/205 (29%), Positives = 86/205 (42%), Gaps = 31/205 (15%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVNTVAVSPDGS  513
            GH  +V  V  S   +    +SGSWD  +++W+L          GHT  V +VA S D  
Sbjct  62   GHGHFVQDVVLSSDGMFA--LSGSWDGELRLWDLQAGTTARRFVGHTKDVLSVAFSVDNR  119

Query  512  LCASGGKDGVILLWD-LAEGKKLYSLDAGSI----IHALCFSPNRYW---LCAATEASIK  357
               S  +D  I LW+ L E K  Y++  G      +  + FSPN      +  + + ++K
Sbjct  120  QIVSASRDKSIRLWNTLGECK--YTIQDGDSHSDWVSCVRFSPNNLQPTIVSGSWDRTVK  177

Query  356  IWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVI  177
            IW+L +      LR  L   +       NTAA            + DGS   SG  DGVI
Sbjct  178  IWNLTN----CKLRATLAGHTGYV----NTAAV-----------SPDGSLCASGGKDGVI  218

Query  176  RVWGIGRY*MEEFRRSHMIIGHVCY  102
             +W +          S  II  +C+
Sbjct  219  LLWDLAEGKKLYSLESGSIIHSLCF  243



>ref|XP_006353816.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein-like [Solanum tuberosum]
Length=329

 Score =   363 bits (933),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 173/201 (86%), Positives = 189/201 (94%), Gaps = 2/201 (1%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            +IKLWNTLGECKYTIQD D H++WVSCVRFSP+ LQPTIVSGSWDRTVK+WNLSNCKLR+
Sbjct  129  SIKLWNTLGECKYTIQDQDSHSDWVSCVRFSPNNLQPTIVSGSWDRTVKIWNLSNCKLRA  188

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
            TLAGH GYVNT AVSPDGSLCASGGKDGVILLWDLAEGKKLYSLD+GSIIHALCFSPNRY
Sbjct  189  TLAGHAGYVNTAAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDSGSIIHALCFSPNRY  248

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTA--AKNKIIFCTSLSWNAD  216
            WLCAATE+SIKIWDLESKSIVVDLRVDLKQE+EMS    +T+  +K K+I+CTSLSW+AD
Sbjct  249  WLCAATESSIKIWDLESKSIVVDLRVDLKQETEMSGNATSTSGNSKTKVIYCTSLSWSAD  308

Query  215  GSTLFSGYTDGVIRVWGIGRY  153
            GSTLFSGYTDG+IRVWGIGRY
Sbjct  309  GSTLFSGYTDGLIRVWGIGRY  329


 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 49/186 (26%), Positives = 80/186 (43%), Gaps = 27/186 (15%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSN-----CKLRSTLAGHTGYVNTVAV  528
             H +WV+ +  +P      IV+ S D+++ VW+L+         R  L GH  +V  V +
Sbjct  14   AHTDWVTAIA-TPIDNSDMIVTSSRDKSIIVWSLTKEGSQYGVPRRRLTGHGHFVQDVVL  72

Query  527  SPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKI  354
            S DG    SG  DG + LWDL  G   + +      ++       NR  + A+ + SIK+
Sbjct  73   SSDGMFALSGSWDGELRLWDLQAGTTARRFVGHTKDVLSVAFSVDNRQIVSASRDKSIKL  132

Query  353  WDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  180
            W+   E K  + D      Q+S            +  + C   S N    T+ SG  D  
Sbjct  133  WNTLGECKYTIQD------QDSH-----------SDWVSCVRFSPNNLQPTIVSGSWDRT  175

Query  179  IRVWGI  162
            +++W +
Sbjct  176  VKIWNL  181



>ref|XP_011072970.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Sesamum indicum]
Length=329

 Score =   363 bits (932),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 171/201 (85%), Positives = 191/201 (95%), Gaps = 2/201 (1%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            TIKLWNTLGECKYTIQD D H++WVSCVRFSP+TLQPTIVSGSWD+TVKVWNL+NCKLRS
Sbjct  129  TIKLWNTLGECKYTIQDQDAHSDWVSCVRFSPNTLQPTIVSGSWDKTVKVWNLTNCKLRS  188

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
            TL+GH+GYVNTVAVSPDGSLCASGGKDGVILLWDLAEGK+LYSLDAGSIIHALCFSPNRY
Sbjct  189  TLSGHSGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKRLYSLDAGSIIHALCFSPNRY  248

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNN--TAAKNKIIFCTSLSWNAD  216
            WLCAATEASIKIWDLESKS+VVDL+VDLKQES+++ +G +   A K K+I+CT L+W+AD
Sbjct  249  WLCAATEASIKIWDLESKSVVVDLKVDLKQESDLAKDGTDQTAAVKTKVIYCTCLNWSAD  308

Query  215  GSTLFSGYTDGVIRVWGIGRY  153
            GSTLFSGYTDGV+RVWGIGRY
Sbjct  309  GSTLFSGYTDGVVRVWGIGRY  329


 Score = 56.6 bits (135),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 48/186 (26%), Positives = 78/186 (42%), Gaps = 27/186 (15%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAV  528
             H +WV+ +  +P      IV+ S D+++ +W L+  +      R  L GH  +V  V +
Sbjct  14   AHTDWVTAIA-TPIDNSDMIVTSSRDKSIILWALTKEEKSYGVARRRLTGHGHFVQDVVL  72

Query  527  SPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKI  354
            S DG    SG  DG + LWDL  G   + +      +I       NR  + A+ + +IK+
Sbjct  73   SSDGQFALSGSWDGELRLWDLQTGVTARRFVGHTKDVISVAFSVDNRQIVSASRDKTIKL  132

Query  353  WDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  180
            W+   E K  + D                   A +  + C   S N    T+ SG  D  
Sbjct  133  WNTLGECKYTIQD-----------------QDAHSDWVSCVRFSPNTLQPTIVSGSWDKT  175

Query  179  IRVWGI  162
            ++VW +
Sbjct  176  VKVWNL  181


 Score = 49.7 bits (117),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 51/185 (28%), Positives = 79/185 (43%), Gaps = 27/185 (15%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVNTVAVSPDGS  513
            GH  +V  V  S        +SGSWD  +++W+L          GHT  V +VA S D  
Sbjct  62   GHGHFVQDVVLSSD--GQFALSGSWDGELRLWDLQTGVTARRFVGHTKDVISVAFSVDNR  119

Query  512  LCASGGKDGVILLWD-LAEGK-KLYSLDAGSI-IHALCFSPNRYW---LCAATEASIKIW  351
               S  +D  I LW+ L E K  +   DA S  +  + FSPN      +  + + ++K+W
Sbjct  120  QIVSASRDKTIKLWNTLGECKYTIQDQDAHSDWVSCVRFSPNTLQPTIVSGSWDKTVKVW  179

Query  350  DLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRV  171
            +L           + K  S +S             +  +++ + DGS   SG  DGVI +
Sbjct  180  NL----------TNCKLRSTLSGHSG---------YVNTVAVSPDGSLCASGGKDGVILL  220

Query  170  WGIGR  156
            W +  
Sbjct  221  WDLAE  225



>gb|EYU17645.1| hypothetical protein MIMGU_mgv1a009858mg [Erythranthe guttata]
Length=329

 Score =   361 bits (927),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 172/201 (86%), Positives = 190/201 (95%), Gaps = 2/201 (1%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            TIKLWNTLGECKYTIQD DGH++WVSCVRFSP+ LQPTIVSGS D+TVK+WNL+NCKL+S
Sbjct  129  TIKLWNTLGECKYTIQDQDGHSDWVSCVRFSPNNLQPTIVSGSCDKTVKIWNLTNCKLKS  188

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
            TLAGH+GYVNTVAVSPDGSLCASGGKDG ILLWDLAEGKKLYSLDAGSI+HA+CFSPNRY
Sbjct  189  TLAGHSGYVNTVAVSPDGSLCASGGKDGFILLWDLAEGKKLYSLDAGSIVHAVCFSPNRY  248

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGN--NTAAKNKIIFCTSLSWNAD  216
            WLCAATEA IKIWDLESKS+VVDL+VDLKQESEM +EGN    A+KNKII+CT L+W+AD
Sbjct  249  WLCAATEAGIKIWDLESKSVVVDLKVDLKQESEMISEGNGQTAASKNKIIYCTCLNWSAD  308

Query  215  GSTLFSGYTDGVIRVWGIGRY  153
            GSTLFSGYTDGV+RVWGIGRY
Sbjct  309  GSTLFSGYTDGVVRVWGIGRY  329


 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 49/185 (26%), Positives = 78/185 (42%), Gaps = 27/185 (15%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVNTVAVSPDGS  513
            GH+ +V  V  S        +SGSWD  +++W+L          GHT  V +VA S D  
Sbjct  62   GHSHFVQDVVLSSDG--QFALSGSWDGELRLWDLQTGATTRRFVGHTKDVLSVAFSVDNR  119

Query  512  LCASGGKDGVILLWD-LAEGKKLYSLDAGSI--IHALCFSPNRYW---LCAATEASIKIW  351
               SG +D  I LW+ L E K       G    +  + FSPN      +  + + ++KIW
Sbjct  120  QIVSGSRDKTIKLWNTLGECKYTIQDQDGHSDWVSCVRFSPNNLQPTIVSGSCDKTVKIW  179

Query  350  DLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRV  171
            +L           + K +S ++             +  +++ + DGS   SG  DG I +
Sbjct  180  NL----------TNCKLKSTLAGHSG---------YVNTVAVSPDGSLCASGGKDGFILL  220

Query  170  WGIGR  156
            W +  
Sbjct  221  WDLAE  225



>ref|XP_003631071.1| Guanine nucleotide-binding protein subunit beta-like protein 
[Medicago truncatula]
 gb|AET05547.1| guanine nucleotide-binding protein beta subunit-like protein 
[Medicago truncatula]
Length=325

 Score =   361 bits (926),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 172/199 (86%), Positives = 189/199 (95%), Gaps = 1/199 (1%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            TIKLWNTLGECKYTIQDGD H++WVSCVRFSPSTLQPTIVS SWDRTVKVWNL+NCKLR+
Sbjct  128  TIKLWNTLGECKYTIQDGDAHSDWVSCVRFSPSTLQPTIVSASWDRTVKVWNLTNCKLRN  187

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
            TLAGH+GYVNTVAVSPDGSLCASGGKDGVILLWDLAEGK+LYSLDAGSIIHALCFSPNRY
Sbjct  188  TLAGHSGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKRLYSLDAGSIIHALCFSPNRY  247

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGS  210
            WLCAATE+SIKIWDLESKSIV DL+VDLK E++ +A G +T  K K+I+CTSL+W+ADGS
Sbjct  248  WLCAATESSIKIWDLESKSIVEDLKVDLKTEAD-AAIGGDTTTKKKVIYCTSLNWSADGS  306

Query  209  TLFSGYTDGVIRVWGIGRY  153
            TLFSGYTDGV+RVWGIGRY
Sbjct  307  TLFSGYTDGVVRVWGIGRY  325



>ref|XP_009778426.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Nicotiana sylvestris]
Length=326

 Score =   360 bits (925),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 170/199 (85%), Positives = 189/199 (95%), Gaps = 1/199 (1%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            +I+LWNTLGECKY IQDGD H++WVSCVRFSP+ LQPTIVSGSWDRTVK+WNL+NCKLR+
Sbjct  129  SIRLWNTLGECKYIIQDGDSHSDWVSCVRFSPNNLQPTIVSGSWDRTVKIWNLTNCKLRA  188

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
            TLAGHTGYVNT AVSPDGSLCASGGKDGVILLWDLAEGKKLYSL++GSIIH+LCFSPNRY
Sbjct  189  TLAGHTGYVNTTAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLESGSIIHSLCFSPNRY  248

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGS  210
            WLCAATE+SIKIWDLESK+IV DL+VDLKQESEMSAEG   + KNK+I+CTSL W+ADGS
Sbjct  249  WLCAATESSIKIWDLESKTIVDDLKVDLKQESEMSAEG-TASGKNKVIYCTSLGWSADGS  307

Query  209  TLFSGYTDGVIRVWGIGRY  153
            TLFSGYTDG+IRVWGIGRY
Sbjct  308  TLFSGYTDGLIRVWGIGRY  326


 Score = 55.8 bits (133),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 47/186 (25%), Positives = 80/186 (43%), Gaps = 27/186 (15%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSN-----CKLRSTLAGHTGYVNTVAV  528
             H +WV+ +  +P      IV+ S D+++ VW+L+         R  L GH  +V  V +
Sbjct  14   AHTDWVTAIA-TPVDNSDMIVTSSRDKSIIVWSLTKDGPQYGVPRRRLTGHGHFVQDVVL  72

Query  527  SPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKI  354
            S DG    SG  DG + LWDL  G   + +      ++     + NR  + A+ + SI++
Sbjct  73   SSDGMFALSGSWDGELRLWDLQAGTTARRFVGHTKDVLSVAFSADNRQIVSASRDKSIRL  132

Query  353  WDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  180
            W+   E K I+ D                   + +  + C   S N    T+ SG  D  
Sbjct  133  WNTLGECKYIIQD-----------------GDSHSDWVSCVRFSPNNLQPTIVSGSWDRT  175

Query  179  IRVWGI  162
            +++W +
Sbjct  176  VKIWNL  181


 Score = 49.7 bits (117),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 56/203 (28%), Positives = 82/203 (40%), Gaps = 27/203 (13%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVNTVAVSPDGS  513
            GH  +V  V  S   +    +SGSWD  +++W+L          GHT  V +VA S D  
Sbjct  62   GHGHFVQDVVLSSDGMFA--LSGSWDGELRLWDLQAGTTARRFVGHTKDVLSVAFSADNR  119

Query  512  LCASGGKDGVILLWDLAEGKKLYSLDAGSI---IHALCFSPNRYW---LCAATEASIKIW  351
               S  +D  I LW+     K    D  S    +  + FSPN      +  + + ++KIW
Sbjct  120  QIVSASRDKSIRLWNTLGECKYIIQDGDSHSDWVSCVRFSPNNLQPTIVSGSWDRTVKIW  179

Query  350  DLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRV  171
            +L +      LR  L             A     +  T++S   DGS   SG  DGVI +
Sbjct  180  NLTN----CKLRATL-------------AGHTGYVNTTAVS--PDGSLCASGGKDGVILL  220

Query  170  WGIGRY*MEEFRRSHMIIGHVCY  102
            W +          S  II  +C+
Sbjct  221  WDLAEGKKLYSLESGSIIHSLCF  243



>ref|XP_006365404.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein-like [Solanum tuberosum]
Length=326

 Score =   360 bits (924),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 172/199 (86%), Positives = 187/199 (94%), Gaps = 1/199 (1%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            TIKLWNTLGECKYTIQ+ D H++WVSCVRFSP+ LQPTIVSGSWDRTVK+WNL+NCKLRS
Sbjct  129  TIKLWNTLGECKYTIQEQDSHSDWVSCVRFSPNNLQPTIVSGSWDRTVKIWNLTNCKLRS  188

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
            TLAGH+GYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIH LCFSPNRY
Sbjct  189  TLAGHSGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHTLCFSPNRY  248

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGS  210
            WLCAATE+SIKIWDLESKS+VVDL+VDLKQESEM      T +K K+I+CTSLSW+ADGS
Sbjct  249  WLCAATESSIKIWDLESKSVVVDLKVDLKQESEMFGTA-ATDSKTKVIYCTSLSWSADGS  307

Query  209  TLFSGYTDGVIRVWGIGRY  153
            TLFSGYTDG+IRVWGIGRY
Sbjct  308  TLFSGYTDGLIRVWGIGRY  326


 Score = 53.1 bits (126),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 47/186 (25%), Positives = 80/186 (43%), Gaps = 27/186 (15%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSN-----CKLRSTLAGHTGYVNTVAV  528
             H +WV+ +  +P      IV+ S D+++ VW+L+         R  L GH  +V  V +
Sbjct  14   AHTDWVTAIA-TPIDNSDMIVTSSRDKSIIVWSLTKDGSHYGVPRRRLTGHGHFVEDVVL  72

Query  527  SPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKI  354
            S DG    SG  DG + LWDL  G   + +      ++       NR  + A+ + +IK+
Sbjct  73   SSDGMFALSGSWDGELRLWDLQAGTTARRFVGHTKDVLSVAFSVDNRQIVSASRDRTIKL  132

Query  353  WDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  180
            W+   E K  +        QE +         + +  + C   S N    T+ SG  D  
Sbjct  133  WNTLGECKYTI--------QEQD---------SHSDWVSCVRFSPNNLQPTIVSGSWDRT  175

Query  179  IRVWGI  162
            +++W +
Sbjct  176  VKIWNL  181



>sp|P49026.1|GBLP_TOBAC RecName: Full=Guanine nucleotide-binding protein subunit beta-like 
protein [Nicotiana tabacum]
 dbj|BAA04478.1| G protein beta subunit-like protein [Nicotiana tabacum]
Length=326

 Score =   360 bits (923),  Expect = 7e-121, Method: Compositional matrix adjust.
 Identities = 171/199 (86%), Positives = 189/199 (95%), Gaps = 1/199 (1%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            +I+LWNTLGECKYTIQDGD H++WVSCVRFSP+ LQPTIVSGSWDRTVK+WNL+NCKLR 
Sbjct  129  SIRLWNTLGECKYTIQDGDSHSDWVSCVRFSPNNLQPTIVSGSWDRTVKIWNLTNCKLRL  188

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
            TLAGHTGYVNT AVSPDGSLCASGGKDGVILLWDLAEGKKLYSL++GSIIH+LCFSPNRY
Sbjct  189  TLAGHTGYVNTPAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLESGSIIHSLCFSPNRY  248

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGS  210
            WLCAATE+SIKIWDLESKSIV DL+VDLKQESEMS+EG   + KNK+I+CTSLSW+ADGS
Sbjct  249  WLCAATESSIKIWDLESKSIVDDLKVDLKQESEMSSEG-TASGKNKVIYCTSLSWSADGS  307

Query  209  TLFSGYTDGVIRVWGIGRY  153
            TLFSGYTDG+IRVWGI RY
Sbjct  308  TLFSGYTDGLIRVWGIDRY  326



>ref|NP_001233876.1| ArcA1 protein [Solanum lycopersicum]
 dbj|BAA76895.1| LeArcA1 protein [Solanum lycopersicum]
Length=326

 Score =   359 bits (922),  Expect = 9e-121, Method: Compositional matrix adjust.
 Identities = 172/199 (86%), Positives = 186/199 (93%), Gaps = 1/199 (1%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            TIKLWNTLGECKYTIQ+ D H++WVSCVRFSP+ LQPTIVSGSWDRTVK+WNL+NCKLRS
Sbjct  129  TIKLWNTLGECKYTIQEQDSHSDWVSCVRFSPNNLQPTIVSGSWDRTVKIWNLTNCKLRS  188

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
            TLAGH+GYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIH  CFSPNRY
Sbjct  189  TLAGHSGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHTFCFSPNRY  248

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGS  210
            WLCAATE+SIKIWDLESKSIVVDL+VDLKQESEM      T +K K+I+CTSLSW+ADGS
Sbjct  249  WLCAATESSIKIWDLESKSIVVDLKVDLKQESEMFGTA-ATDSKTKVIYCTSLSWSADGS  307

Query  209  TLFSGYTDGVIRVWGIGRY  153
            TLFSGYTDG+IRVWGIGRY
Sbjct  308  TLFSGYTDGLIRVWGIGRY  326


 Score = 53.5 bits (127),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 47/186 (25%), Positives = 80/186 (43%), Gaps = 27/186 (15%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSN-----CKLRSTLAGHTGYVNTVAV  528
             H +WV+ +  +P      IV+ S D+++ VW+L+         R  L GH  +V  V +
Sbjct  14   AHTDWVTAIA-TPIDNSDMIVTSSRDKSIIVWSLTKDGSQYGVPRRRLTGHGHFVEDVVL  72

Query  527  SPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKI  354
            S DG    SG  DG + LWDL  G   + +      ++       NR  + A+ + +IK+
Sbjct  73   SSDGMFALSGSWDGELRLWDLQAGTTARRFVGHTKDVLSVAFSVDNRQIVSASRDKTIKL  132

Query  353  WDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  180
            W+   E K  +        QE +         + +  + C   S N    T+ SG  D  
Sbjct  133  WNTLGECKYTI--------QEQD---------SHSDWVSCVRFSPNNLQPTIVSGSWDRT  175

Query  179  IRVWGI  162
            +++W +
Sbjct  176  VKIWNL  181



>gb|KHN21658.1| Guanine nucleotide-binding protein subunit beta-like protein 
[Glycine soja]
Length=223

 Score =   355 bits (912),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 171/199 (86%), Positives = 186/199 (93%), Gaps = 1/199 (1%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            TIKLWNTLGECKYTIQDGD H++WVSCVRFSPSTLQPTIVS SWDRTVKVWNL+NCKLR+
Sbjct  26   TIKLWNTLGECKYTIQDGDAHSDWVSCVRFSPSTLQPTIVSASWDRTVKVWNLTNCKLRN  85

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
            TLAGH GYVNTVAVSPDGSLCASGGKDGVILLWDLAEGK+LYSLDAGSIIHALCFSPNRY
Sbjct  86   TLAGHNGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKRLYSLDAGSIIHALCFSPNRY  145

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGS  210
            WLCAATE SIKIWDLESKSIV DL+VDLK E++ ++ G N A K K+I+CTSL+W+ADGS
Sbjct  146  WLCAATEQSIKIWDLESKSIVEDLKVDLKTEADATSGGGN-ANKKKVIYCTSLNWSADGS  204

Query  209  TLFSGYTDGVIRVWGIGRY  153
            TLFSGYTDGV+RVW IGRY
Sbjct  205  TLFSGYTDGVVRVWAIGRY  223



>sp|P93340.1|GBLP_NICPL RecName: Full=Guanine nucleotide-binding protein subunit beta-like 
protein [Nicotiana plumbaginifolia]
 emb|CAA70705.1| G protein beta subunit [Nicotiana plumbaginifolia]
Length=326

 Score =   359 bits (922),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 169/199 (85%), Positives = 189/199 (95%), Gaps = 1/199 (1%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            +I+LWNTLGECKY IQDGD H++WVSCVRFSP+ LQPTIVSGSWDRTVK+WNL+NCKLR+
Sbjct  129  SIRLWNTLGECKYIIQDGDSHSDWVSCVRFSPNNLQPTIVSGSWDRTVKIWNLTNCKLRA  188

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
            TLAGHTGYVNT AVSPDGSLCASGGKDGVILLWDLAEGKKLYSL++GSIIH+LCFSPNRY
Sbjct  189  TLAGHTGYVNTTAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLESGSIIHSLCFSPNRY  248

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGS  210
            WLCAATE+SIKIWDLESK+IV DL+VDLKQESEMSAEG   + KNK+I+CTSL W+ADGS
Sbjct  249  WLCAATESSIKIWDLESKTIVDDLKVDLKQESEMSAEG-TASGKNKVIYCTSLGWSADGS  307

Query  209  TLFSGYTDGVIRVWGIGRY  153
            TLFSGYTDG+IRVWGIGR+
Sbjct  308  TLFSGYTDGLIRVWGIGRF  326


 Score = 55.8 bits (133),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 47/186 (25%), Positives = 80/186 (43%), Gaps = 27/186 (15%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSN-----CKLRSTLAGHTGYVNTVAV  528
             H +WV+ +  +P      IV+ S D+++ VW+L+         R  L GH  +V  V +
Sbjct  14   AHTDWVTAIA-TPVDNSDMIVTSSRDKSIIVWSLTKDGPQYGVPRRRLTGHGHFVQDVVL  72

Query  527  SPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKI  354
            S DG    SG  DG + LWDL  G   + +      ++     + NR  + A+ + SI++
Sbjct  73   SSDGMFALSGSWDGELRLWDLQAGTTARRFVGHTKDVLSVAFSADNRQIVSASRDKSIRL  132

Query  353  WDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  180
            W+   E K I+ D                   + +  + C   S N    T+ SG  D  
Sbjct  133  WNTLGECKYIIQD-----------------GDSHSDWVSCVRFSPNNLQPTIVSGSWDRT  175

Query  179  IRVWGI  162
            +++W +
Sbjct  176  VKIWNL  181


 Score = 49.7 bits (117),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 56/203 (28%), Positives = 82/203 (40%), Gaps = 27/203 (13%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVNTVAVSPDGS  513
            GH  +V  V  S   +    +SGSWD  +++W+L          GHT  V +VA S D  
Sbjct  62   GHGHFVQDVVLSSDGMFA--LSGSWDGELRLWDLQAGTTARRFVGHTKDVLSVAFSADNR  119

Query  512  LCASGGKDGVILLWDLAEGKKLYSLDAGSI---IHALCFSPNRYW---LCAATEASIKIW  351
               S  +D  I LW+     K    D  S    +  + FSPN      +  + + ++KIW
Sbjct  120  QIVSASRDKSIRLWNTLGECKYIIQDGDSHSDWVSCVRFSPNNLQPTIVSGSWDRTVKIW  179

Query  350  DLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRV  171
            +L +      LR  L             A     +  T++S   DGS   SG  DGVI +
Sbjct  180  NLTN----CKLRATL-------------AGHTGYVNTTAVS--PDGSLCASGGKDGVILL  220

Query  170  WGIGRY*MEEFRRSHMIIGHVCY  102
            W +          S  II  +C+
Sbjct  221  WDLAEGKKLYSLESGSIIHSLCF  243



>gb|EPS70887.1| hypothetical protein M569_03871 [Genlisea aurea]
Length=326

 Score =   358 bits (920),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 170/199 (85%), Positives = 187/199 (94%), Gaps = 1/199 (1%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            TIKLWNTLGECKYTIQD D H++WVSCVRFSP+T QPTIVSGSWD TVK+WNLSNCKLRS
Sbjct  129  TIKLWNTLGECKYTIQDQDSHSDWVSCVRFSPNTQQPTIVSGSWDSTVKIWNLSNCKLRS  188

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
            TLAGHTGYVN V+VSPDGSLCAS G+DGVILLWDLAEGK+LYSL+AGSI HALCFSPNRY
Sbjct  189  TLAGHTGYVNAVSVSPDGSLCASAGRDGVILLWDLAEGKRLYSLEAGSITHALCFSPNRY  248

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGS  210
            WLCAATEASIKIWDLESKS+VVDL+VDLKQESE++AE    + K+K+IFCTSL+W+ADGS
Sbjct  249  WLCAATEASIKIWDLESKSVVVDLKVDLKQESELAAE-ETASRKHKVIFCTSLNWSADGS  307

Query  209  TLFSGYTDGVIRVWGIGRY  153
            TLFSGYTDGVIRVWGIGRY
Sbjct  308  TLFSGYTDGVIRVWGIGRY  326


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 49/186 (26%), Positives = 82/186 (44%), Gaps = 27/186 (15%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKL-----RSTLAGHTGYVNTVAV  528
             H  WV+ +  +P      IV+ S D+++ +W L+         R  L GH+ YV  V +
Sbjct  14   AHTNWVTAI-ATPIDNSDMIVTASRDKSIILWALTKEDRTYGVPRRRLTGHSNYVQDVVL  72

Query  527  SPDGSLCASGGKDGVILLWDLAEGK--KLYSLDAGSIIHALCFSPNRYWLCAATEASIKI  354
            S DG    SG  DG + LWDL  G+  + ++     ++     S NR  + A+ + +IK+
Sbjct  73   SSDGQFALSGSWDGDLRLWDLQTGRSARRFAGHTKDVLSVAFSSDNRQIVSASRDKTIKL  132

Query  353  WDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  180
            W+   E K  + D      Q+S            +  + C   S N    T+ SG  D  
Sbjct  133  WNTLGECKYTIQD------QDSH-----------SDWVSCVRFSPNTQQPTIVSGSWDST  175

Query  179  IRVWGI  162
            +++W +
Sbjct  176  VKIWNL  181


 Score = 50.4 bits (119),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 51/184 (28%), Positives = 82/184 (45%), Gaps = 27/184 (15%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVNTVAVSPDGS  513
            GH+ +V  V  S        +SGSWD  +++W+L   +     AGHT  V +VA S D  
Sbjct  62   GHSNYVQDVVLSSDG--QFALSGSWDGDLRLWDLQTGRSARRFAGHTKDVLSVAFSSDNR  119

Query  512  LCASGGKDGVILLWD-LAEGK-KLYSLDAGSI-IHALCFSPNRYW---LCAATEASIKIW  351
               S  +D  I LW+ L E K  +   D+ S  +  + FSPN      +  + ++++KIW
Sbjct  120  QIVSASRDKTIKLWNTLGECKYTIQDQDSHSDWVSCVRFSPNTQQPTIVSGSWDSTVKIW  179

Query  350  DLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRV  171
            +L           + K  S ++             +  ++S + DGS   S   DGVI +
Sbjct  180  NLS----------NCKLRSTLAGHTG---------YVNAVSVSPDGSLCASAGRDGVILL  220

Query  170  WGIG  159
            W + 
Sbjct  221  WDLA  224



>gb|AFK36580.1| unknown [Medicago truncatula]
Length=325

 Score =   358 bits (920),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 171/199 (86%), Positives = 188/199 (94%), Gaps = 1/199 (1%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            TIKLWNTLGECKYTIQDGD H++WVSCVRFSPSTLQPTIVS SWDRTVKVWNL+NCKLR+
Sbjct  128  TIKLWNTLGECKYTIQDGDAHSDWVSCVRFSPSTLQPTIVSASWDRTVKVWNLTNCKLRN  187

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
            TLAGH+GYVNTVAVSPDGSLCASGGKDGVILLWDLAEGK+LYSLDAG IIHALCFSPNRY
Sbjct  188  TLAGHSGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKRLYSLDAGFIIHALCFSPNRY  247

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGS  210
            WLCAATE+SIKIWDLESKSIV DL+VDLK E++ +A G +T  K K+I+CTSL+W+ADGS
Sbjct  248  WLCAATESSIKIWDLESKSIVEDLKVDLKTEAD-AAIGGDTTTKKKVIYCTSLNWSADGS  306

Query  209  TLFSGYTDGVIRVWGIGRY  153
            TLFSGYTDGV+RVWGIGRY
Sbjct  307  TLFSGYTDGVVRVWGIGRY  325



>sp|O24076.1|GBLP_MEDSA RecName: Full=Guanine nucleotide-binding protein subunit beta-like 
protein [Medicago sativa]
 emb|CAA69934.1| G protein beta subunit-like [Medicago sativa subsp. x varia]
Length=325

 Score =   358 bits (920),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 171/199 (86%), Positives = 188/199 (94%), Gaps = 1/199 (1%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            TIKLWNTLGECKYTIQDGD H++WVSCVRFSPST QPTIVS SWDRTVKVWNL+NCKLR+
Sbjct  128  TIKLWNTLGECKYTIQDGDAHSDWVSCVRFSPSTPQPTIVSASWDRTVKVWNLTNCKLRN  187

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
            TLAGH+GYVNTVAVSPDGSLCASGGKDGVILLWDLAEGK+LYSLDAGSIIHALCFSPNRY
Sbjct  188  TLAGHSGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKRLYSLDAGSIIHALCFSPNRY  247

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGS  210
            WLCAATE+SIKIWDLESKSIV DL+VDLK E++ +A G +T  K K+I+CTSL+W+ADGS
Sbjct  248  WLCAATESSIKIWDLESKSIVEDLKVDLKTEAD-AAIGGDTTTKKKVIYCTSLNWSADGS  306

Query  209  TLFSGYTDGVIRVWGIGRY  153
            TLFSGYTDGV+RVWGIGRY
Sbjct  307  TLFSGYTDGVVRVWGIGRY  325


 Score = 49.7 bits (117),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 53/212 (25%), Positives = 91/212 (43%), Gaps = 35/212 (17%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAV  528
             H + V+ +  +P      IV+ S D+++ +W+L+         R  L GH+ +V  V +
Sbjct  13   AHTDVVTAIA-TPIDNSDMIVTASRDKSIILWHLTKEDKTYGVPRRRLTGHSHFVQDVVL  71

Query  527  SPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSI-IHALCFS-PNRYWLCAATEASIKI  354
            S DG    SG  DG + LWDL  G         +  + ++ FS  NR  + A+ + +IK+
Sbjct  72   SSDGQFALSGSWDGELRLWDLNAGTSARRFVGHTKDVLSVAFSIDNRQIVSASRDRTIKL  131

Query  353  WDL--ESKSIVVD------------LRVDLKQESEMSAEGNNTAA---------KNKII-  246
            W+   E K  + D                  Q + +SA  + T           +N +  
Sbjct  132  WNTLGECKYTIQDGDAHSDWVSCVRFSPSTPQPTIVSASWDRTVKVWNLTNCKLRNTLAG  191

Query  245  ---FCTSLSWNADGSTLFSGYTDGVIRVWGIG  159
               +  +++ + DGS   SG  DGVI +W + 
Sbjct  192  HSGYVNTVAVSPDGSLCASGGKDGVILLWDLA  223



>gb|KHN00175.1| Guanine nucleotide-binding protein subunit beta-like protein 
[Glycine soja]
Length=223

 Score =   354 bits (908),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 170/199 (85%), Positives = 185/199 (93%), Gaps = 1/199 (1%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            TIKLWNTLGECKYTIQDGD H++WVSCVRFSPSTLQPTIVS SWDRTVKVWNL+NCKLR+
Sbjct  26   TIKLWNTLGECKYTIQDGDAHSDWVSCVRFSPSTLQPTIVSASWDRTVKVWNLTNCKLRN  85

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
            TLAGH GYVNTVAVSPDGSLCASGGKDGVILLWDLAEGK+LYSLDAGSIIHALCFSPNRY
Sbjct  86   TLAGHNGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKRLYSLDAGSIIHALCFSPNRY  145

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGS  210
            WLCAATE SIKIWDLESKSIV DL+VDLK E++ +  G N   K K+I+CTSL+W++DGS
Sbjct  146  WLCAATEQSIKIWDLESKSIVEDLKVDLKTEADATTGGGN-PNKKKVIYCTSLNWSSDGS  204

Query  209  TLFSGYTDGVIRVWGIGRY  153
            TLFSGYTDGV+RVWGIGRY
Sbjct  205  TLFSGYTDGVVRVWGIGRY  223



>gb|KJB37175.1| hypothetical protein B456_006G192600 [Gossypium raimondii]
Length=327

 Score =   357 bits (916),  Expect = 8e-120, Method: Compositional matrix adjust.
 Identities = 169/199 (85%), Positives = 187/199 (94%), Gaps = 1/199 (1%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            TIKLWNTLGECKYTIQ+GD H +WVSCVRFSP+TLQPTIVS SWD+TVKVWNL+NCK+R+
Sbjct  130  TIKLWNTLGECKYTIQEGDAHTDWVSCVRFSPNTLQPTIVSASWDKTVKVWNLTNCKIRN  189

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
            TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSL+AG++IH+LCFSPNRY
Sbjct  190  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLEAGAVIHSLCFSPNRY  249

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGS  210
            WLCAATE SIKIWDLESKSIV DL+VDLK E+E SA  +N A K K+I+CTSL+W+ADGS
Sbjct  250  WLCAATEQSIKIWDLESKSIVEDLKVDLKAEAETSAATDN-ANKKKVIYCTSLNWSADGS  308

Query  209  TLFSGYTDGVIRVWGIGRY  153
            TLFSGYTDGVIRVWGIGRY
Sbjct  309  TLFSGYTDGVIRVWGIGRY  327


 Score = 52.8 bits (125),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 53/187 (28%), Positives = 84/187 (45%), Gaps = 31/187 (17%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVNTVAVSPDGS  513
            GH+ +V  V  S  +     +SGSWD  +++W+LS         GHT  V +VA S D  
Sbjct  63   GHSHFVQDVVLSSDS--QFALSGSWDGELRLWDLSAGTSARRFVGHTKDVLSVAFSIDNR  120

Query  512  LCASGGKDGVILLWD-LAEGKKLYSLDAGSI----IHALCFSPNRYW---LCAATEASIK  357
               S  +D  I LW+ L E K  Y++  G      +  + FSPN      + A+ + ++K
Sbjct  121  QIVSASRDRTIKLWNTLGECK--YTIQEGDAHTDWVSCVRFSPNTLQPTIVSASWDKTVK  178

Query  356  IWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVI  177
            +W+L +  I                   NT A +   +  +++ + DGS   SG  DGVI
Sbjct  179  VWNLTNCKI------------------RNTLAGH-TGYVNTVAVSPDGSLCASGGKDGVI  219

Query  176  RVWGIGR  156
             +W +  
Sbjct  220  LLWDLAE  226


 Score = 50.4 bits (119),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 46/184 (25%), Positives = 80/184 (43%), Gaps = 23/184 (13%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAV  528
             H + V+ +  +P      IV+ S D+++ +W+L+  +      R  L GH+ +V  V +
Sbjct  15   AHTDMVTAIA-TPIDNSDMIVTSSRDKSIILWHLTKDEKTYGVARRRLTGHSHFVQDVVL  73

Query  527  SPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSI-IHALCFS-PNRYWLCAATEASIKI  354
            S D     SG  DG + LWDL+ G         +  + ++ FS  NR  + A+ + +IK+
Sbjct  74   SSDSQFALSGSWDGELRLWDLSAGTSARRFVGHTKDVLSVAFSIDNRQIVSASRDRTIKL  133

Query  353  WDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIR  174
            W+             L +      EG+   A    + C   S N    T+ S   D  ++
Sbjct  134  WNT------------LGECKYTIQEGD---AHTDWVSCVRFSPNTLQPTIVSASWDKTVK  178

Query  173  VWGI  162
            VW +
Sbjct  179  VWNL  182



>emb|CDO98381.1| unnamed protein product [Coffea canephora]
Length=1395

 Score =   384 bits (985),  Expect = 8e-120, Method: Compositional matrix adjust.
 Identities = 181/202 (90%), Positives = 191/202 (95%), Gaps = 3/202 (1%)
 Frame = -3

Query  749   TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
             TIKLWNTLGECKYTIQD DGH +WVSCVRFSP+ LQPTIVSGSWDRTVK+WNLSNCK+R+
Sbjct  1194  TIKLWNTLGECKYTIQDADGHTDWVSCVRFSPNNLQPTIVSGSWDRTVKIWNLSNCKMRA  1253

Query  569   TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
             TLAGHTGYVNT AVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY
Sbjct  1254  TLAGHTGYVNTAAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  1313

Query  389   WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEG---NNTAAKNKIIFCTSLSWNA  219
             WLCAATEASIKIWDLESKSIVVDLRVDLKQESEM+AEG     T AKNK+I+CTSL+W+A
Sbjct  1314  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMAAEGTTVQTTGAKNKVIYCTSLNWSA  1373

Query  218   DGSTLFSGYTDGVIRVWGIGRY  153
             DGSTLFSGYTDGVIRVWGI RY
Sbjct  1374  DGSTLFSGYTDGVIRVWGIMRY  1395


 Score = 57.0 bits (136),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 53/208 (25%), Positives = 90/208 (43%), Gaps = 32/208 (15%)
 Frame = -3

Query  692   GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAV  528
              H +WV+ +  +P      IV+ S D+++ +W+L+         R  L GH+ +V  V +
Sbjct  1079  AHTDWVTAI-ATPIDNTDMIVTSSRDKSIILWSLTKEDKTYGVPRRRLTGHSHFVQDVVL  1137

Query  527   SPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSI-IHALCFS-PNRYWLCAATEASIKI  354
             S DG    SG  DG + LWDL  G         +  + ++ FS  NR  + A+ + +IK+
Sbjct  1138  SSDGQFALSGSWDGELRLWDLQSGTTARRFVGHTKDVLSVAFSIDNRQIVSASRDKTIKL  1197

Query  353   WDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  180
             W+   E K  + D            A+G+        + C   S N    T+ SG  D  
Sbjct  1198  WNTLGECKYTIQD------------ADGH-----TDWVSCVRFSPNNLQPTIVSGSWDRT  1240

Query  179   IRVWGIGRY*MEEFRRSHMIIGHVCYLS  96
             +++W +    M        + GH  Y++
Sbjct  1241  VKIWNLSNCKMRA-----TLAGHTGYVN  1263



>gb|KHG00880.1| Guanine nucleotide-binding protein subunit beta-like protein 
[Gossypium arboreum]
Length=327

 Score =   356 bits (914),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 168/199 (84%), Positives = 187/199 (94%), Gaps = 1/199 (1%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            TIKLWNTLGECKYTIQ+GD H +WVSCVRFSP+TLQPTIVS SWD+TVKVWNL+NCK+R+
Sbjct  130  TIKLWNTLGECKYTIQEGDAHTDWVSCVRFSPNTLQPTIVSASWDKTVKVWNLTNCKIRN  189

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
            TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSL+AG++IH+LCFSPNRY
Sbjct  190  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLEAGAVIHSLCFSPNRY  249

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGS  210
            WLCAATE SIKIWDLESKS+V DL+VDLK E+E SA  +N A K K+I+CTSL+W+ADGS
Sbjct  250  WLCAATEQSIKIWDLESKSVVEDLKVDLKAEAETSAATDN-ANKKKVIYCTSLNWSADGS  308

Query  209  TLFSGYTDGVIRVWGIGRY  153
            TLFSGYTDGVIRVWGIGRY
Sbjct  309  TLFSGYTDGVIRVWGIGRY  327


 Score = 52.8 bits (125),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 53/187 (28%), Positives = 84/187 (45%), Gaps = 31/187 (17%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVNTVAVSPDGS  513
            GH+ +V  V  S  +     +SGSWD  +++W+LS         GHT  V +VA S D  
Sbjct  63   GHSHFVQDVVLSSDS--QFALSGSWDGELRLWDLSAGTSARRFVGHTKDVLSVAFSIDNR  120

Query  512  LCASGGKDGVILLWD-LAEGKKLYSLDAGSI----IHALCFSPNRYW---LCAATEASIK  357
               S  +D  I LW+ L E K  Y++  G      +  + FSPN      + A+ + ++K
Sbjct  121  QIVSASRDRTIKLWNTLGECK--YTIQEGDAHTDWVSCVRFSPNTLQPTIVSASWDKTVK  178

Query  356  IWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVI  177
            +W+L +  I                   NT A +   +  +++ + DGS   SG  DGVI
Sbjct  179  VWNLTNCKI------------------RNTLAGH-TGYVNTVAVSPDGSLCASGGKDGVI  219

Query  176  RVWGIGR  156
             +W +  
Sbjct  220  LLWDLAE  226


 Score = 50.4 bits (119),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 46/184 (25%), Positives = 80/184 (43%), Gaps = 23/184 (13%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAV  528
             H + V+ +  +P      IV+ S D+++ +W+L+  +      R  L GH+ +V  V +
Sbjct  15   AHTDMVTAIA-TPIDNSDMIVTSSRDKSIILWHLTKDEKTYGVARRRLTGHSHFVQDVVL  73

Query  527  SPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSI-IHALCFS-PNRYWLCAATEASIKI  354
            S D     SG  DG + LWDL+ G         +  + ++ FS  NR  + A+ + +IK+
Sbjct  74   SSDSQFALSGSWDGELRLWDLSAGTSARRFVGHTKDVLSVAFSIDNRQIVSASRDRTIKL  133

Query  353  WDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIR  174
            W+             L +      EG+   A    + C   S N    T+ S   D  ++
Sbjct  134  WNT------------LGECKYTIQEGD---AHTDWVSCVRFSPNTLQPTIVSASWDKTVK  178

Query  173  VWGI  162
            VW +
Sbjct  179  VWNL  182



>gb|ACR77528.1| heterotrimeric G protein beta 1 subunit [Nicotiana benthamiana]
Length=326

 Score =   356 bits (914),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 166/199 (83%), Positives = 189/199 (95%), Gaps = 1/199 (1%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            +I+LWNTLGECK+ IQDGD H++WVSCVRFSP+ +QPTIVSGSWDRTVK+WNL+NCKLR+
Sbjct  129  SIRLWNTLGECKFIIQDGDSHSDWVSCVRFSPNNIQPTIVSGSWDRTVKIWNLTNCKLRA  188

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
            TLAGHTGYVNT AVSP+GSLCASGGKDGVILLWDLAEGKKLYSL++GSIIH+LCFSPNRY
Sbjct  189  TLAGHTGYVNTTAVSPEGSLCASGGKDGVILLWDLAEGKKLYSLESGSIIHSLCFSPNRY  248

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGS  210
            WLCAATE+SIKIWDLESK+IV DL+VDLKQE+EMSAEG   + KNK+I+CTSL W+ADGS
Sbjct  249  WLCAATESSIKIWDLESKTIVDDLKVDLKQETEMSAEG-TASGKNKVIYCTSLGWSADGS  307

Query  209  TLFSGYTDGVIRVWGIGRY  153
            TLFSGYTDG+IRVWGIGRY
Sbjct  308  TLFSGYTDGLIRVWGIGRY  326


 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 46/186 (25%), Positives = 80/186 (43%), Gaps = 27/186 (15%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSN-----CKLRSTLAGHTGYVNTVAV  528
             H +WV+ +  +P      IV+ S D+++ VW+++         R  L GH  +V  V +
Sbjct  14   AHTDWVTAIA-TPVDNSDMIVTSSRDKSIIVWSITKDGPLYGVPRRRLTGHGHFVQDVVL  72

Query  527  SPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKI  354
            S DG    SG  DG + LWDL  G   + +      ++     + NR  + A+ + SI++
Sbjct  73   SSDGMFALSGSWDGELRLWDLQAGTTARRFVGHTKDVLSVAFSADNRQIVSASRDKSIRL  132

Query  353  WDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  180
            W+   E K I+ D                   + +  + C   S N    T+ SG  D  
Sbjct  133  WNTLGECKFIIQD-----------------GDSHSDWVSCVRFSPNNIQPTIVSGSWDRT  175

Query  179  IRVWGI  162
            +++W +
Sbjct  176  VKIWNL  181



>ref|XP_004299548.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Fragaria vesca subsp. vesca]
Length=326

 Score =   356 bits (913),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 170/199 (85%), Positives = 185/199 (93%), Gaps = 1/199 (1%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            TIKLWNTLGECKYTIQ+ DGHN+WVSCVRFSP+TLQPTIVS SWDRTVKVWNL+NCKLR+
Sbjct  129  TIKLWNTLGECKYTIQEQDGHNDWVSCVRFSPNTLQPTIVSASWDRTVKVWNLTNCKLRN  188

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
            TL GH GYVNTVAVSPDGSLCASGGKDGVILLWDLAEGK+LYSLDAG+IIHALCFSPNRY
Sbjct  189  TLEGHNGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKRLYSLDAGAIIHALCFSPNRY  248

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGS  210
            WLCAATE SIKIWDLESKSIV DL+VDLK E+E + E   TA K K+I+CTSL+W+ADGS
Sbjct  249  WLCAATEQSIKIWDLESKSIVEDLKVDLKTEAEKTKE-TGTANKKKVIYCTSLNWSADGS  307

Query  209  TLFSGYTDGVIRVWGIGRY  153
            TLFSGYTDGVIRVWGIGR+
Sbjct  308  TLFSGYTDGVIRVWGIGRF  326


 Score = 55.8 bits (133),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 48/186 (26%), Positives = 79/186 (42%), Gaps = 27/186 (15%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAV  528
             H + V+ +   P      IVS S D+++ +W L+  +      R  L GH+ +V  V +
Sbjct  14   AHTDMVTAIAI-PIDNSEMIVSASRDKSIILWQLNKDENSYGVPRRRLTGHSHFVQDVVL  72

Query  527  SPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKI  354
            S DG    SG  DG + LWDLA+G   + +      ++       NR  + A+ + +IK+
Sbjct  73   SSDGQFALSGSWDGELRLWDLAQGVSARRFVGHTKDVLSVAFSIDNRQIVSASRDRTIKL  132

Query  353  WDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  180
            W+   E K  +        QE +           N  + C   S N    T+ S   D  
Sbjct  133  WNTLGECKYTI--------QEQD---------GHNDWVSCVRFSPNTLQPTIVSASWDRT  175

Query  179  IRVWGI  162
            ++VW +
Sbjct  176  VKVWNL  181



>ref|NP_001241455.1| uncharacterized protein LOC100778205 [Glycine max]
 gb|ACU23023.1| unknown [Glycine max]
Length=325

 Score =   356 bits (913),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 170/199 (85%), Positives = 185/199 (93%), Gaps = 1/199 (1%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            TIKLWNTLGECKYTIQDGD H++WVSCVRFSPSTLQPTIVS SWDRTVKVWNL+NCKLR+
Sbjct  128  TIKLWNTLGECKYTIQDGDAHSDWVSCVRFSPSTLQPTIVSASWDRTVKVWNLTNCKLRN  187

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
            TLAGH GYVNTVAVSPDGSLCASGGKDGVILLWDLAEGK+LYSLDAGSIIHALCFSPNRY
Sbjct  188  TLAGHNGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKRLYSLDAGSIIHALCFSPNRY  247

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGS  210
            WLCAATE SIKIWDLESKSIV DL+VDLK E++ +  G N   K K+I+CTSL+W++DGS
Sbjct  248  WLCAATEQSIKIWDLESKSIVEDLKVDLKTEADATTGGGN-PNKKKVIYCTSLNWSSDGS  306

Query  209  TLFSGYTDGVIRVWGIGRY  153
            TLFSGYTDGV+RVWGIGRY
Sbjct  307  TLFSGYTDGVVRVWGIGRY  325


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 54/212 (25%), Positives = 92/212 (43%), Gaps = 35/212 (17%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAV  528
             H + V+ +  +P      IV+ S D+++ +W+L+         R  L GH+ +V  V +
Sbjct  13   AHTDVVTAIA-TPIDNSDMIVTASRDKSIILWHLTKEDKTYGVPRRRLTGHSHFVQDVVL  71

Query  527  SPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSI-IHALCFS-PNRYWLCAATEASIKI  354
            S DG    SG  DG + LWDLA G         +  + ++ FS  NR  + A+ + +IK+
Sbjct  72   SSDGQFALSGSWDGELRLWDLAAGTSARRFVGHTKDVLSVAFSIDNRQIVSASRDRTIKL  131

Query  353  WDL--ESKSIVVD------------LRVDLKQESEMSAEGNNTAA---------KNKII-  246
            W+   E K  + D                  Q + +SA  + T           +N +  
Sbjct  132  WNTLGECKYTIQDGDAHSDWVSCVRFSPSTLQPTIVSASWDRTVKVWNLTNCKLRNTLAG  191

Query  245  ---FCTSLSWNADGSTLFSGYTDGVIRVWGIG  159
               +  +++ + DGS   SG  DGVI +W + 
Sbjct  192  HNGYVNTVAVSPDGSLCASGGKDGVILLWDLA  223



>gb|KJB53022.1| hypothetical protein B456_008G288800 [Gossypium raimondii]
Length=326

 Score =   355 bits (911),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 169/199 (85%), Positives = 186/199 (93%), Gaps = 1/199 (1%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            +IKLWNTLGECKYTIQDGD H +WVSCVRFSP+TLQPTIVS SWD+TVKVWNL+NCK+R+
Sbjct  129  SIKLWNTLGECKYTIQDGDAHTDWVSCVRFSPNTLQPTIVSASWDKTVKVWNLTNCKIRN  188

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
            TLAGH+GYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGS+IH+LCFSPNRY
Sbjct  189  TLAGHSGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSVIHSLCFSPNRY  248

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGS  210
            WLCAATE SIKIWDLESKSIV DL+VDLK E+E S   +N A K K+I+CTSL+W+ADGS
Sbjct  249  WLCAATEQSIKIWDLESKSIVEDLKVDLKAEAEKSDVTDN-ANKKKVIYCTSLNWSADGS  307

Query  209  TLFSGYTDGVIRVWGIGRY  153
            TLFSGYTDGVIRVWGIGRY
Sbjct  308  TLFSGYTDGVIRVWGIGRY  326


 Score = 50.1 bits (118),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 52/187 (28%), Positives = 84/187 (45%), Gaps = 31/187 (17%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVNTVAVSPDGS  513
            GH+ +V  V  S  +     +SGSWD  +++W+L+         GHT  V +VA S D  
Sbjct  62   GHSHFVQDVVLSFDS--QFALSGSWDGELRLWDLNAGTSARRFVGHTKDVLSVAFSIDNR  119

Query  512  LCASGGKDGVILLWD-LAEGKKLYSLDAGSI----IHALCFSPNRYW---LCAATEASIK  357
               S  +D  I LW+ L E K  Y++  G      +  + FSPN      + A+ + ++K
Sbjct  120  QIVSASRDRSIKLWNTLGECK--YTIQDGDAHTDWVSCVRFSPNTLQPTIVSASWDKTVK  177

Query  356  IWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVI  177
            +W+L +  I                   NT A +   +  +++ + DGS   SG  DGVI
Sbjct  178  VWNLTNCKI------------------RNTLAGHS-GYVNTVAVSPDGSLCASGGKDGVI  218

Query  176  RVWGIGR  156
             +W +  
Sbjct  219  LLWDLAE  225



>ref|XP_002529557.1| receptor for activated protein kinase C, putative [Ricinus communis]
 gb|EEF32826.1| receptor for activated protein kinase C, putative [Ricinus communis]
Length=328

 Score =   355 bits (911),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 172/201 (86%), Positives = 185/201 (92%), Gaps = 2/201 (1%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            TIKLWNTLGECKYTIQDGD HN+WVSCVRFSP+TLQPTIVS SWDRTVKVWNL+NCKLR 
Sbjct  128  TIKLWNTLGECKYTIQDGDAHNDWVSCVRFSPNTLQPTIVSASWDRTVKVWNLTNCKLRC  187

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
            TLAGH GYVNTVAVSPDGSLCASGGKDGVILLWDLAEGK+LY+LDAG++IHALCFSPNRY
Sbjct  188  TLAGHGGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKRLYNLDAGAVIHALCFSPNRY  247

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMS--AEGNNTAAKNKIIFCTSLSWNAD  216
            WLCAATE SIKIWDLESKSIV DL+VDLK E+E S  +   +T AK K I+CTSLSWNAD
Sbjct  248  WLCAATENSIKIWDLESKSIVEDLKVDLKAEAEKSDGSTVASTGAKKKNIYCTSLSWNAD  307

Query  215  GSTLFSGYTDGVIRVWGIGRY  153
            GSTLFSGYTDGVIRVWGIGR+
Sbjct  308  GSTLFSGYTDGVIRVWGIGRF  328


 Score = 50.4 bits (119),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 46/186 (25%), Positives = 76/186 (41%), Gaps = 27/186 (15%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAV  528
             H + V+ +  +P      IV+ S D+++ +W L   +         L GH+ +V  V +
Sbjct  13   AHTDQVTAIA-TPIDNSDMIVTASRDKSIILWKLIKDEKTYGVAHRRLTGHSHFVQDVVL  71

Query  527  SPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKI  354
            S DG    SG  DG + LWDLA G   + +      ++       NR  + A+ + +IK+
Sbjct  72   SSDGQFALSGSWDGELRLWDLAAGVSARRFVGHTKDVLSVAFSIDNRQIVSASRDRTIKL  131

Query  353  WDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  180
            W+   E K  + D                   A N  + C   S N    T+ S   D  
Sbjct  132  WNTLGECKYTIQD-----------------GDAHNDWVSCVRFSPNTLQPTIVSASWDRT  174

Query  179  IRVWGI  162
            ++VW +
Sbjct  175  VKVWNL  180



>ref|XP_006451669.1| hypothetical protein CICLE_v10008909mg [Citrus clementina]
 ref|XP_006490737.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein-like [Citrus sinensis]
 gb|ESR64909.1| hypothetical protein CICLE_v10008909mg [Citrus clementina]
Length=327

 Score =   354 bits (909),  Expect = 9e-119, Method: Compositional matrix adjust.
 Identities = 172/200 (86%), Positives = 183/200 (92%), Gaps = 1/200 (1%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            TIKLWNTLGECKYTIQ+GD H EWVSCVRFSP+TLQPTIVS SWDRTVKVWNLSNCKLR+
Sbjct  128  TIKLWNTLGECKYTIQEGDAHTEWVSCVRFSPNTLQPTIVSASWDRTVKVWNLSNCKLRA  187

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
            TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGK+LYSLDAG++IHALCFSPNRY
Sbjct  188  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKRLYSLDAGAVIHALCFSPNRY  247

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAA-KNKIIFCTSLSWNADG  213
            WLCAATE SIKIWDLESKSIV DL+VDLK E+E S     T   K K I+CTSL+W+ADG
Sbjct  248  WLCAATEQSIKIWDLESKSIVEDLKVDLKTEAEKSEATTATTTIKKKNIYCTSLNWSADG  307

Query  212  STLFSGYTDGVIRVWGIGRY  153
            STLFSGYTDGVIRVWGIGRY
Sbjct  308  STLFSGYTDGVIRVWGIGRY  327


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 51/184 (28%), Positives = 84/184 (46%), Gaps = 23/184 (13%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAV  528
             H + V+ +  +P      IV+ S D+++ VW+L+  +      R  L GH+ +V  V +
Sbjct  13   AHTDMVTAIA-TPIDNSDMIVTASRDKSIIVWHLTKEEKTYGVARRRLTGHSHFVQDVVL  71

Query  527  SPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSI-IHALCFS-PNRYWLCAATEASIKI  354
            S DG    SG  DG + LWDLAEGK        +  + ++ FS  NR  + A+ + +IK+
Sbjct  72   SSDGQFALSGSWDGELRLWDLAEGKSARRFVGHTKDVLSVAFSIDNRQIVSASRDRTIKL  131

Query  353  WDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIR  174
            W+             L +      EG+   A  + + C   S N    T+ S   D  ++
Sbjct  132  WNT------------LGECKYTIQEGD---AHTEWVSCVRFSPNTLQPTIVSASWDRTVK  176

Query  173  VWGI  162
            VW +
Sbjct  177  VWNL  180



>ref|XP_008453452.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Cucumis melo]
Length=327

 Score =   354 bits (909),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 170/200 (85%), Positives = 186/200 (93%), Gaps = 1/200 (1%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            TIKLWNTLGECKYTIQDGD H++WVSCVRFSP+TLQPTIVS SWD+TVKVWNL+NCKLR 
Sbjct  128  TIKLWNTLGECKYTIQDGDAHSDWVSCVRFSPNTLQPTIVSASWDKTVKVWNLTNCKLRV  187

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
            TLAGH GYVNTVAVSPDGSLCASGGKDGVILLWDLAEGK+LYSLDAGSIIHALCFSPNRY
Sbjct  188  TLAGHAGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKRLYSLDAGSIIHALCFSPNRY  247

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGN-NTAAKNKIIFCTSLSWNADG  213
            WLCAATE+SIKIWDLESKSIV DL+VDLK E+E + + +  TA K K+I+CTSLSW+ADG
Sbjct  248  WLCAATESSIKIWDLESKSIVEDLKVDLKTEAEKTDDTHAATANKIKVIYCTSLSWSADG  307

Query  212  STLFSGYTDGVIRVWGIGRY  153
            STLF GYTDGV+RVWGIGRY
Sbjct  308  STLFGGYTDGVVRVWGIGRY  327


 Score = 50.1 bits (118),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 46/186 (25%), Positives = 81/186 (44%), Gaps = 27/186 (15%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKL-----RSTLAGHTGYVNTVAV  528
             H + V+ +  +P      IV+ S D+++ +W L+  +      +  L GH+ +V  V +
Sbjct  13   AHTDMVTAIA-TPIDNSDMIVTSSRDKSIILWRLTKEEKTYGVPQRRLNGHSHFVQDVVL  71

Query  527  SPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKI  354
            S DG    SG  DG + LWDLA G   + +   +  ++       NR  + A+ + +IK+
Sbjct  72   SSDGQFALSGSWDGELRLWDLATGLTSRRFVGHSKDVLSVAFSIDNRQIVSASRDRTIKL  131

Query  353  WDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  180
            W+   E K  + D              G+   A +  + C   S N    T+ S   D  
Sbjct  132  WNTLGECKYTIQD--------------GD---AHSDWVSCVRFSPNTLQPTIVSASWDKT  174

Query  179  IRVWGI  162
            ++VW +
Sbjct  175  VKVWNL  180



>ref|XP_004137327.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein-like [Cucumis sativus]
 ref|XP_004160431.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein-like [Cucumis sativus]
 gb|KGN63851.1| hypothetical protein Csa_1G024830 [Cucumis sativus]
Length=327

 Score =   354 bits (909),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 170/200 (85%), Positives = 186/200 (93%), Gaps = 1/200 (1%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            TIKLWNTLGECKYTIQDGD H++WVSCVRFSP+TLQPTIVS SWD+TVKVWNL+NCKLR 
Sbjct  128  TIKLWNTLGECKYTIQDGDAHSDWVSCVRFSPNTLQPTIVSASWDKTVKVWNLTNCKLRV  187

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
            TLAGH GYVNTVAVSPDGSLCASGGKDGVILLWDLAEGK+LYSLDAGSIIHALCFSPNRY
Sbjct  188  TLAGHAGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKRLYSLDAGSIIHALCFSPNRY  247

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGN-NTAAKNKIIFCTSLSWNADG  213
            WLCAATE+SIKIWDLESKSIV DL+VDLK E+E + + +  TA K K+I+CTSLSW+ADG
Sbjct  248  WLCAATESSIKIWDLESKSIVEDLKVDLKTEAEKTDDTHAATANKIKVIYCTSLSWSADG  307

Query  212  STLFSGYTDGVIRVWGIGRY  153
            STLF GYTDGV+RVWGIGRY
Sbjct  308  STLFGGYTDGVVRVWGIGRY  327


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 51/188 (27%), Positives = 84/188 (45%), Gaps = 31/188 (16%)
 Frame = -3

Query  695  DGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVNTVAVSPDG  516
            +GH+ +V  V  S        +SGSWD  +++W+L+         GH+  V +VA S D 
Sbjct  60   NGHSHFVQDVVLSSD--GQFALSGSWDGELRLWDLATGNTSRRFVGHSKDVLSVAFSIDN  117

Query  515  SLCASGGKDGVILLWD-LAEGKKLYSLDAGSI----IHALCFSPNRYW---LCAATEASI  360
                S  +D  I LW+ L E K  Y++  G      +  + FSPN      + A+ + ++
Sbjct  118  RQIVSASRDRTIKLWNTLGECK--YTIQDGDAHSDWVSCVRFSPNTLQPTIVSASWDKTV  175

Query  359  KIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  180
            K+W+L +      LRV L   +                +  +++ + DGS   SG  DGV
Sbjct  176  KVWNLTN----CKLRVTLAGHAG---------------YVNTVAVSPDGSLCASGGKDGV  216

Query  179  IRVWGIGR  156
            I +W +  
Sbjct  217  ILLWDLAE  224



>ref|NP_001235369.1| guanine nucleotide-binding protein subunit beta-like protein 
[Glycine max]
 sp|Q39836.1|GBLP_SOYBN RecName: Full=Guanine nucleotide-binding protein subunit beta-like 
protein [Glycine max]
 gb|AAB05941.1| G beta-like protein [Glycine max]
Length=325

 Score =   354 bits (908),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 170/199 (85%), Positives = 185/199 (93%), Gaps = 1/199 (1%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            TIKLWNTLGECKYTIQDGD H++WVSCVRFSPSTLQPTIVS SWDRTVKVWNL+NCKLR+
Sbjct  128  TIKLWNTLGECKYTIQDGDAHSDWVSCVRFSPSTLQPTIVSASWDRTVKVWNLTNCKLRN  187

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
            TLAGH GYVNTVAVSPDGSLCASGGKDGVILLWDLAEGK+LYSLDAGSIIHALCFSP+RY
Sbjct  188  TLAGHNGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKRLYSLDAGSIIHALCFSPSRY  247

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGS  210
            WLCAATE SIKIWDLESKSIV DL+VDLK E++ ++ G N A K K+I+CTSL+W+ADGS
Sbjct  248  WLCAATEQSIKIWDLESKSIVEDLKVDLKTEADATSGGGN-ANKKKVIYCTSLNWSADGS  306

Query  209  TLFSGYTDGVIRVWGIGRY  153
            TLFSGYTDGV RVW IGRY
Sbjct  307  TLFSGYTDGVARVWAIGRY  325


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 55/212 (26%), Positives = 92/212 (43%), Gaps = 35/212 (17%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKL-----RSTLAGHTGYVNTVAV  528
             H + V+ +  +P      IV+ S DR++ +W+L+         R  L GH+ +V  V +
Sbjct  13   AHTDVVTAIA-TPIDNSDMIVTASRDRSIILWHLTKEDKTYGVPRRRLTGHSHFVQDVVL  71

Query  527  SPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSI-IHALCFS-PNRYWLCAATEASIKI  354
            S DG    SG  DG + LWDLA G         +  + ++ FS  NR  + A+ + +IK+
Sbjct  72   SSDGQFALSGSWDGELRLWDLAAGTSARRFVGHTKDVLSVAFSIDNRQIVSASRDRTIKL  131

Query  353  WDL--ESKSIVVD------------LRVDLKQESEMSAEGNNTAA---------KNKII-  246
            W+   E K  + D                  Q + +SA  + T           +N +  
Sbjct  132  WNTLGECKYTIQDGDAHSDWVSCVRFSPSTLQPTIVSASWDRTVKVWNLTNCKLRNTLAG  191

Query  245  ---FCTSLSWNADGSTLFSGYTDGVIRVWGIG  159
               +  +++ + DGS   SG  DGVI +W + 
Sbjct  192  HNGYVNTVAVSPDGSLCASGGKDGVILLWDLA  223



>gb|KDO62873.1| hypothetical protein CISIN_1g048118mg [Citrus sinensis]
Length=303

 Score =   353 bits (906),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 171/200 (86%), Positives = 182/200 (91%), Gaps = 1/200 (1%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            TIKLWNTLGECKYTIQ+GD H EWVSCVRFSP+TLQPTIVS SWDRTVKVWNLSNCKLR+
Sbjct  104  TIKLWNTLGECKYTIQEGDAHTEWVSCVRFSPNTLQPTIVSASWDRTVKVWNLSNCKLRA  163

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
            TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGK+LYSLDAG++IHALCFSPNRY
Sbjct  164  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKRLYSLDAGAVIHALCFSPNRY  223

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAA-KNKIIFCTSLSWNADG  213
            WLCAATE SIKIWDLESKSIV DL+VDLK E+E S     T   K K I+CTSL+W+ DG
Sbjct  224  WLCAATEQSIKIWDLESKSIVEDLKVDLKTEAEKSEATTATTTIKKKNIYCTSLNWSVDG  283

Query  212  STLFSGYTDGVIRVWGIGRY  153
            STLFSGYTDGVIRVWGIGRY
Sbjct  284  STLFSGYTDGVIRVWGIGRY  303



>gb|ACJ24167.1| Rack [Phaseolus vulgaris]
Length=324

 Score =   353 bits (907),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 169/199 (85%), Positives = 184/199 (92%), Gaps = 2/199 (1%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            TIKLWNTLGECKYTIQD D H++WVSCVRFSPSTLQPTIVS SWDRTVKVWNL+NCKLR+
Sbjct  128  TIKLWNTLGECKYTIQDSDAHSDWVSCVRFSPSTLQPTIVSASWDRTVKVWNLTNCKLRN  187

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
            TLAGH+GYVNTVAVSPDGSLCASGGKDGVILLWDLAEGK+LYSLDAGSIIHALCFSPNRY
Sbjct  188  TLAGHSGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKRLYSLDAGSIIHALCFSPNRY  247

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGS  210
            WLCAATE SIKIWDLESKSIV DL+VDLK E++ +  GN    K K+I+CTSL+W+ADGS
Sbjct  248  WLCAATEQSIKIWDLESKSIVEDLKVDLKTEADGTTGGNTN--KKKVIYCTSLNWSADGS  305

Query  209  TLFSGYTDGVIRVWGIGRY  153
            TLFSGYTDGV+RVW IGRY
Sbjct  306  TLFSGYTDGVVRVWAIGRY  324


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 54/212 (25%), Positives = 91/212 (43%), Gaps = 35/212 (17%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKL-----RSTLAGHTGYVNTVAV  528
             H + V+ +  +P      IV+ S D+++ +W L+         R  L GH+ +V  V +
Sbjct  13   AHTDVVTAIA-TPIDNSDMIVTASRDKSIILWQLTKEDKTYGVPRRRLTGHSHFVQDVVL  71

Query  527  SPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSI-IHALCFS-PNRYWLCAATEASIKI  354
            S DG    SG  DG + LWDLA G         +  + ++ FS  NR  + A+ + +IK+
Sbjct  72   SSDGQFALSGSWDGELRLWDLAAGTSARRFVGHTKDVLSVAFSIDNRQIVSASRDRTIKL  131

Query  353  WDL--ESKSIVVD------------LRVDLKQESEMSAEGNNTAA---------KNKII-  246
            W+   E K  + D                  Q + +SA  + T           +N +  
Sbjct  132  WNTLGECKYTIQDSDAHSDWVSCVRFSPSTLQPTIVSASWDRTVKVWNLTNCKLRNTLAG  191

Query  245  ---FCTSLSWNADGSTLFSGYTDGVIRVWGIG  159
               +  +++ + DGS   SG  DGVI +W + 
Sbjct  192  HSGYVNTVAVSPDGSLCASGGKDGVILLWDLA  223



>ref|XP_007160506.1| hypothetical protein PHAVU_002G327500g [Phaseolus vulgaris]
 gb|ACV72060.1| RACK1 [Phaseolus vulgaris]
 gb|ESW32500.1| hypothetical protein PHAVU_002G327500g [Phaseolus vulgaris]
Length=324

 Score =   353 bits (907),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 169/199 (85%), Positives = 184/199 (92%), Gaps = 2/199 (1%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            TIKLWNTLGECKYTIQD D H++WVSCVRFSPSTLQPTIVS SWDRTVKVWNL+NCKLR+
Sbjct  128  TIKLWNTLGECKYTIQDSDAHSDWVSCVRFSPSTLQPTIVSASWDRTVKVWNLTNCKLRN  187

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
            TLAGH+GYVNTVAVSPDGSLCASGGKDGVILLWDLAEGK+LYSLDAGSIIHALCFSPNRY
Sbjct  188  TLAGHSGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKRLYSLDAGSIIHALCFSPNRY  247

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGS  210
            WLCAATE SIKIWDLESKSIV DL+VDLK E++ +  GN    K K+I+CTSL+W+ADGS
Sbjct  248  WLCAATEQSIKIWDLESKSIVEDLKVDLKTEADGTTGGNTN--KKKVIYCTSLNWSADGS  305

Query  209  TLFSGYTDGVIRVWGIGRY  153
            TLFSGYTDGV+RVW IGRY
Sbjct  306  TLFSGYTDGVVRVWAIGRY  324


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 54/212 (25%), Positives = 91/212 (43%), Gaps = 35/212 (17%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKL-----RSTLAGHTGYVNTVAV  528
             H + V+ +  +P      IV+ S D+++ +W L+         R  L GH+ +V  V +
Sbjct  13   AHTDVVTAIA-TPIDNSDMIVTASRDKSIILWQLTKEDKTYGVPRRRLTGHSHFVQDVVL  71

Query  527  SPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSI-IHALCFS-PNRYWLCAATEASIKI  354
            S DG    SG  DG + LWDLA G         +  + ++ FS  NR  + A+ + +IK+
Sbjct  72   SSDGQFALSGSWDGELRLWDLAAGTSARRFVGHTKDVLSVAFSIDNRQIVSASRDRTIKL  131

Query  353  WDL--ESKSIVVD------------LRVDLKQESEMSAEGNNTAA---------KNKII-  246
            W+   E K  + D                  Q + +SA  + T           +N +  
Sbjct  132  WNTLGECKYTIQDSDAHSDWVSCVRFSPSTLQPTIVSASWDRTVKVWNLTNCKLRNTLAG  191

Query  245  ---FCTSLSWNADGSTLFSGYTDGVIRVWGIG  159
               +  +++ + DGS   SG  DGVI +W + 
Sbjct  192  HSGYVNTVAVSPDGSLCASGGKDGVILLWDLA  223



>gb|KHG17882.1| Guanine nucleotide-binding protein subunit beta-like protein 
[Gossypium arboreum]
Length=326

 Score =   353 bits (906),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 168/199 (84%), Positives = 185/199 (93%), Gaps = 1/199 (1%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            +IKLWNTLGECKYTIQDGD H +WVSCVRFSP+ LQPTIVS SWD+TVKVWNL+NCK+R+
Sbjct  129  SIKLWNTLGECKYTIQDGDAHTDWVSCVRFSPNNLQPTIVSASWDKTVKVWNLTNCKIRN  188

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
            TLAGH+GYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGS+IH+LCFSPNRY
Sbjct  189  TLAGHSGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSVIHSLCFSPNRY  248

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGS  210
            WLCAATE SIKIWDLESKSIV DL+VDLK E+E S   +N A K K+I+CTSL+W+ADGS
Sbjct  249  WLCAATEQSIKIWDLESKSIVEDLKVDLKAEAEKSDVTDN-ANKKKVIYCTSLNWSADGS  307

Query  209  TLFSGYTDGVIRVWGIGRY  153
            TLFSGYTDGVIRVWGIGRY
Sbjct  308  TLFSGYTDGVIRVWGIGRY  326


 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 52/187 (28%), Positives = 84/187 (45%), Gaps = 31/187 (17%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVNTVAVSPDGS  513
            GH+ +V  V  S  +     +SGSWD  +++W+L+         GHT  V +VA S D  
Sbjct  62   GHSHFVQDVVLSSDS--QFALSGSWDGELRLWDLNAGTSARRFVGHTKDVLSVAFSIDNR  119

Query  512  LCASGGKDGVILLWD-LAEGKKLYSLDAGSI----IHALCFSPNRYW---LCAATEASIK  357
               S  +D  I LW+ L E K  Y++  G      +  + FSPN      + A+ + ++K
Sbjct  120  QIVSASRDRSIKLWNTLGECK--YTIQDGDAHTDWVSCVRFSPNNLQPTIVSASWDKTVK  177

Query  356  IWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVI  177
            +W+L +  I                   NT A +   +  +++ + DGS   SG  DGVI
Sbjct  178  VWNLTNCKI------------------RNTLAGHS-GYVNTVAVSPDGSLCASGGKDGVI  218

Query  176  RVWGIGR  156
             +W +  
Sbjct  219  LLWDLAE  225



>ref|XP_007036696.1| Transducin/WD40 repeat-like superfamily protein [Theobroma cacao]
 gb|EOY21197.1| Transducin/WD40 repeat-like superfamily protein [Theobroma cacao]
Length=327

 Score =   352 bits (904),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 166/199 (83%), Positives = 186/199 (93%), Gaps = 1/199 (1%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            TIKLWNTLGECKYTIQDG+ H +WVSCVRFSP+TLQPTIVS SWD+TVKVWNL+NCK+R+
Sbjct  130  TIKLWNTLGECKYTIQDGEAHTDWVSCVRFSPNTLQPTIVSASWDKTVKVWNLTNCKIRN  189

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
            TL GH+GYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG++IH+LCFSPNRY
Sbjct  190  TLTGHSGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGAVIHSLCFSPNRY  249

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGS  210
            WLCAATE SIKIWDLESKSIV DL+VDLK E+E S +  +TA K K+I+CTSL+W+ADGS
Sbjct  250  WLCAATEQSIKIWDLESKSIVEDLKVDLKAEAEKS-DVTDTANKKKVIYCTSLNWSADGS  308

Query  209  TLFSGYTDGVIRVWGIGRY  153
            TLFSGYTDGVIRVWGIGR+
Sbjct  309  TLFSGYTDGVIRVWGIGRF  327


 Score = 50.4 bits (119),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 52/187 (28%), Positives = 83/187 (44%), Gaps = 31/187 (17%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVNTVAVSPDGS  513
            GH+ +V  V  S  +     +SGSWD  +++W+L+         GHT  V +VA S D  
Sbjct  63   GHSHFVQDVVLSSDS--QFALSGSWDGELRLWDLNAGTSARRFVGHTKDVLSVAFSIDNR  120

Query  512  LCASGGKDGVILLWD-LAEGKKLYSLDAGSI----IHALCFSPNRYW---LCAATEASIK  357
               S  +D  I LW+ L E K  Y++  G      +  + FSPN      + A+ + ++K
Sbjct  121  QIVSASRDRTIKLWNTLGECK--YTIQDGEAHTDWVSCVRFSPNTLQPTIVSASWDKTVK  178

Query  356  IWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVI  177
            +W+L +  I    R  L   S                +  +++ + DGS   SG  DGVI
Sbjct  179  VWNLTNCKI----RNTLTGHSG---------------YVNTVAVSPDGSLCASGGKDGVI  219

Query  176  RVWGIGR  156
             +W +  
Sbjct  220  LLWDLAE  226



>gb|KFK43977.1| guanine nucleotide-binding protein subunit beta-like protein 
[Arabis alpina]
Length=327

 Score =   351 bits (900),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 168/200 (84%), Positives = 183/200 (92%), Gaps = 1/200 (1%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDG-DGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLR  573
            TIKLWNTLGECKYTIQ+G +GH EWVSCVRFSP+TLQPTIVS SWD+TVKVWNLSNCKLR
Sbjct  128  TIKLWNTLGECKYTIQEGGEGHTEWVSCVRFSPNTLQPTIVSASWDKTVKVWNLSNCKLR  187

Query  572  STLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNR  393
            STLAGHTGYV+TVAVSPDGSLCASGGKDGV+LLWDLAEGKKLYSL+A S+IHALCFSPNR
Sbjct  188  STLAGHTGYVSTVAVSPDGSLCASGGKDGVVLLWDLAEGKKLYSLEANSVIHALCFSPNR  247

Query  392  YWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADG  213
            YWLCAATE  IKIWDLESKSIV DL+VDLK E+E S      A K K+I+CTSL+W+ADG
Sbjct  248  YWLCAATEQGIKIWDLESKSIVEDLKVDLKAEAEKSDGSGTAATKKKVIYCTSLNWSADG  307

Query  212  STLFSGYTDGVIRVWGIGRY  153
            STLFSGYTDGVIRVWGIGR+
Sbjct  308  STLFSGYTDGVIRVWGIGRF  327


 Score = 52.8 bits (125),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 52/209 (25%), Positives = 88/209 (42%), Gaps = 33/209 (16%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAV  528
             H + V+ +  +P      IVS S D+++ +W L+         +  L GH+ +V  V +
Sbjct  13   AHTDMVTAIA-TPIDNADIIVSASRDKSIILWKLTKDDKAYGVAQRRLTGHSHFVEDVVL  71

Query  527  SPDGSLCASGGKDGVILLWDLAEGKKL-----YSLDAGSIIHALCFSPNRYWLCAATEAS  363
            S DG    SG  DG + LWDLA G        ++ D  S+  +L    NR  + A+ + +
Sbjct  72   SSDGQFALSGSWDGELRLWDLAAGVSTRRFVGHTKDVLSVAFSL---DNRQIVSASRDRT  128

Query  362  IKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDG  183
            IK+W+            + K   +   EG+      + + C   S N    T+ S   D 
Sbjct  129  IKLWNTLG---------ECKYTIQEGGEGH-----TEWVSCVRFSPNTLQPTIVSASWDK  174

Query  182  VIRVWGIGRY*MEEFRRSHMIIGHVCYLS  96
             ++VW      +   +    + GH  Y+S
Sbjct  175  TVKVWN-----LSNCKLRSTLAGHTGYVS  198



>ref|XP_010032559.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Eucalyptus grandis]
 gb|KCW83972.1| hypothetical protein EUGRSUZ_B00856 [Eucalyptus grandis]
Length=327

 Score =   350 bits (897),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 167/200 (84%), Positives = 184/200 (92%), Gaps = 1/200 (1%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            TIKLWNTLGECKYTIQ+G+ HN+WVSCVRFSP+TLQPTIVS SWDRTVKVWNL+NCKLR+
Sbjct  128  TIKLWNTLGECKYTIQEGEAHNDWVSCVRFSPNTLQPTIVSASWDRTVKVWNLTNCKLRN  187

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
            TL GH+GYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSL+AG+IIH+LCFSPNRY
Sbjct  188  TLQGHSGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLEAGAIIHSLCFSPNRY  247

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKN-KIIFCTSLSWNADG  213
            WLCAATE SIKIWDLESKSIV DLRVDLK E++MS       + N K+I+CTSL+W+ADG
Sbjct  248  WLCAATENSIKIWDLESKSIVEDLRVDLKNEADMSDGTTGAMSSNKKVIYCTSLNWSADG  307

Query  212  STLFSGYTDGVIRVWGIGRY  153
            STLFSGY DGVIRVWGIGRY
Sbjct  308  STLFSGYNDGVIRVWGIGRY  327


 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 49/186 (26%), Positives = 79/186 (42%), Gaps = 27/186 (15%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKL-----RSTLAGHTGYVNTVAV  528
             H + V+ +   P      IV+ S D+++ +W+L+         R  L GH+ +V  V +
Sbjct  13   AHTDMVTAIAV-PIDNADMIVTSSRDKSIILWHLTKEDKVYGVPRRRLTGHSHFVQDVVL  71

Query  527  SPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKI  354
            S DG    SG  DG + LWDLA G   + +      ++       NR  + A+ + +IK+
Sbjct  72   SSDGQFALSGSWDGELRLWDLATGVSARRFVGHTKDVLSVAFSIDNRQIVSASRDRTIKL  131

Query  353  WDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  180
            W+   E K  +        QE E         A N  + C   S N    T+ S   D  
Sbjct  132  WNTLGECKYTI--------QEGE---------AHNDWVSCVRFSPNTLQPTIVSASWDRT  174

Query  179  IRVWGI  162
            ++VW +
Sbjct  175  VKVWNL  180



>ref|XP_009110365.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein A [Brassica rapa]
Length=327

 Score =   350 bits (897),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 168/200 (84%), Positives = 181/200 (91%), Gaps = 1/200 (1%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDG-DGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLR  573
            TIKLWNTLGECKYTI +G +GH +WVSCVRFSP+TLQPTIVS SWD+TVKVWNLSNCKLR
Sbjct  128  TIKLWNTLGECKYTIAEGGEGHGDWVSCVRFSPNTLQPTIVSASWDKTVKVWNLSNCKLR  187

Query  572  STLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNR  393
            STLAGHTGYVNTVAVSPDGSLCASGGKDGV+LLWDLAEGKKLYSL+A S+IHALCFSPNR
Sbjct  188  STLAGHTGYVNTVAVSPDGSLCASGGKDGVVLLWDLAEGKKLYSLEANSVIHALCFSPNR  247

Query  392  YWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADG  213
            YWLCAATE  IKIWDLESKS+V DL+VDLK E+E S        K K+I+CTSLSWNADG
Sbjct  248  YWLCAATEQGIKIWDLESKSVVEDLKVDLKAEAEKSDGSGTAGNKKKVIYCTSLSWNADG  307

Query  212  STLFSGYTDGVIRVWGIGRY  153
            STLFSGYTDGVIRVWGIGRY
Sbjct  308  STLFSGYTDGVIRVWGIGRY  327


 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 52/208 (25%), Positives = 86/208 (41%), Gaps = 33/208 (16%)
 Frame = -3

Query  689  HNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAVS  525
            H + V+ +  +P      IVS S D+++ +W L+         +  L GH+ +V  V +S
Sbjct  14   HTDQVTAIA-TPIDNSDIIVSASRDKSIILWKLTKDDKSYGVAQRRLTGHSHFVEDVVLS  72

Query  524  PDGSLCASGGKDGVILLWDLAEGKKL-----YSLDAGSIIHALCFSPNRYWLCAATEASI  360
             DG    SG  DG + LWDLA G        ++ D  S+  +L    NR  + A+ + +I
Sbjct  73   SDGQFALSGSWDGKLRLWDLAAGVSTRRFVGHTKDVLSVAFSL---DNRQIVSASRDRTI  129

Query  359  KIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  180
            K+W+             L +     AEG         + C   S N    T+ S   D  
Sbjct  130  KLWNT------------LGECKYTIAEGGE--GHGDWVSCVRFSPNTLQPTIVSASWDKT  175

Query  179  IRVWGIGRY*MEEFRRSHMIIGHVCYLS  96
            ++VW      +   +    + GH  Y++
Sbjct  176  VKVWN-----LSNCKLRSTLAGHTGYVN  198



>gb|KHG29145.1| Guanine nucleotide-binding protein subunit beta-like protein 
[Gossypium arboreum]
Length=327

 Score =   350 bits (897),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 166/199 (83%), Positives = 184/199 (92%), Gaps = 1/199 (1%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            TIKLWNTLGECKYTIQ+GD H +WVSCVRFSP+TLQPTIVS SWD+TVKVWNL+NCK+R+
Sbjct  130  TIKLWNTLGECKYTIQEGDAHTDWVSCVRFSPNTLQPTIVSASWDKTVKVWNLTNCKIRN  189

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
            TLAGH+GYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGS+IH+LCFSPNRY
Sbjct  190  TLAGHSGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSVIHSLCFSPNRY  249

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGS  210
            WLCAATE  IKIWDLESKSIV DL+VDLK E+E S +  +   K K+I+CTSL+W+ADGS
Sbjct  250  WLCAATEQGIKIWDLESKSIVEDLKVDLKAEAEKS-DVTDIGNKKKVIYCTSLNWSADGS  308

Query  209  TLFSGYTDGVIRVWGIGRY  153
            TLFSGYTDGVIRVWGIGRY
Sbjct  309  TLFSGYTDGVIRVWGIGRY  327


 Score = 53.1 bits (126),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 53/187 (28%), Positives = 84/187 (45%), Gaps = 31/187 (17%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVNTVAVSPDGS  513
            GH+ +V  V  S  +     +SGSWD  +++W+LS         GHT  V +VA S D  
Sbjct  63   GHSHFVQDVVLSSDS--QFALSGSWDGELRLWDLSAGTSARRFVGHTKDVLSVAFSIDNR  120

Query  512  LCASGGKDGVILLWD-LAEGKKLYSLDAGSI----IHALCFSPNRYW---LCAATEASIK  357
               S  +D  I LW+ L E K  Y++  G      +  + FSPN      + A+ + ++K
Sbjct  121  QIVSASRDRTIKLWNTLGECK--YTIQEGDAHTDWVSCVRFSPNTLQPTIVSASWDKTVK  178

Query  356  IWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVI  177
            +W+L +  I                   NT A +   +  +++ + DGS   SG  DGVI
Sbjct  179  VWNLTNCKI------------------RNTLAGHS-GYVNTVAVSPDGSLCASGGKDGVI  219

Query  176  RVWGIGR  156
             +W +  
Sbjct  220  LLWDLAE  226


 Score = 50.1 bits (118),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 46/184 (25%), Positives = 80/184 (43%), Gaps = 23/184 (13%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKL-----RSTLAGHTGYVNTVAV  528
             H + V+ +  +P      IV+ S D+++ +W+L+  +      R  L GH+ +V  V +
Sbjct  15   AHTDMVTAIA-TPIDNSDMIVTSSRDKSIILWHLTKDEKTYGVPRRRLTGHSHFVQDVVL  73

Query  527  SPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSI-IHALCFS-PNRYWLCAATEASIKI  354
            S D     SG  DG + LWDL+ G         +  + ++ FS  NR  + A+ + +IK+
Sbjct  74   SSDSQFALSGSWDGELRLWDLSAGTSARRFVGHTKDVLSVAFSIDNRQIVSASRDRTIKL  133

Query  353  WDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIR  174
            W+             L +      EG+   A    + C   S N    T+ S   D  ++
Sbjct  134  WNT------------LGECKYTIQEGD---AHTDWVSCVRFSPNTLQPTIVSASWDKTVK  178

Query  173  VWGI  162
            VW +
Sbjct  179  VWNL  182



>ref|XP_006416642.1| hypothetical protein EUTSA_v10008183mg [Eutrema salsugineum]
 gb|ESQ34995.1| hypothetical protein EUTSA_v10008183mg [Eutrema salsugineum]
Length=328

 Score =   349 bits (896),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 168/201 (84%), Positives = 183/201 (91%), Gaps = 2/201 (1%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDG--DGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKL  576
            TIKLWNTLGECKYTI +G  +GHN+WVSCVRFSP+TLQPTIVS SWD+TVKVWNLSNCKL
Sbjct  128  TIKLWNTLGECKYTISEGGSEGHNDWVSCVRFSPNTLQPTIVSASWDKTVKVWNLSNCKL  187

Query  575  RSTLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPN  396
            RSTLAGHTGYV+TVAVSPDGSLCASGGKDGV+LLWDLAEGKKLYSL+A S+IHALCFSPN
Sbjct  188  RSTLAGHTGYVSTVAVSPDGSLCASGGKDGVVLLWDLAEGKKLYSLEANSVIHALCFSPN  247

Query  395  RYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNAD  216
            RYWLCAATE  IKIWDLESKSIV DL+VDLK E+E S      A K K+I+CTSL+W+AD
Sbjct  248  RYWLCAATEQGIKIWDLESKSIVEDLKVDLKAEAEKSDGSGTAATKKKVIYCTSLNWSAD  307

Query  215  GSTLFSGYTDGVIRVWGIGRY  153
            GSTLFSGYTDGVIRVWGIGRY
Sbjct  308  GSTLFSGYTDGVIRVWGIGRY  328


 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 56/211 (27%), Positives = 91/211 (43%), Gaps = 36/211 (17%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAV  528
             H + V+ +  +P      IVS S D+++ +W L+         +  L GH+ +V  V +
Sbjct  13   AHTDMVTAIA-TPIDNADIIVSASRDKSIILWKLTKDDKAYGVAQRRLTGHSHFVEDVVL  71

Query  527  SPDGSLCASGGKDGVILLWDLAEGKKL-----YSLDAGSIIHALCFSPNRYWLCAATEAS  363
            S DG    SG  DG + LWDLA G        ++ D  S+  +L    NR  + A+ + +
Sbjct  72   SSDGQFALSGSWDGELRLWDLAAGISTRRFVGHNKDVLSVAFSL---DNRQIVSASRDRT  128

Query  362  IKIWDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYT  189
            IK+W+   E K  +          SE  +EG+     N  + C   S N    T+ S   
Sbjct  129  IKLWNTLGECKYTI----------SEGGSEGH-----NDWVSCVRFSPNTLQPTIVSASW  173

Query  188  DGVIRVWGIGRY*MEEFRRSHMIIGHVCYLS  96
            D  ++VW      +   +    + GH  Y+S
Sbjct  174  DKTVKVWN-----LSNCKLRSTLAGHTGYVS  199



>ref|XP_009117627.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Brassica rapa]
Length=327

 Score =   348 bits (894),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 167/200 (84%), Positives = 182/200 (91%), Gaps = 1/200 (1%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDG-DGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLR  573
            TIKLWNTLGECKYTI +G +GH +WVSCVRFSP+TLQPTIVS SWD+TVKVWNLSNCKLR
Sbjct  128  TIKLWNTLGECKYTISEGGEGHRDWVSCVRFSPNTLQPTIVSASWDKTVKVWNLSNCKLR  187

Query  572  STLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNR  393
            STLAGHTGYV+TVAVSPDGSLCASGGKDGV+LLWDLAEGKKLYSL+A S+IHALCFSPNR
Sbjct  188  STLAGHTGYVSTVAVSPDGSLCASGGKDGVVLLWDLAEGKKLYSLEANSVIHALCFSPNR  247

Query  392  YWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADG  213
            YWLCAATE  IKIWDLESKS+V DL+VDLK E+E S      A K K+I+CTSLSW+ADG
Sbjct  248  YWLCAATEQGIKIWDLESKSVVEDLKVDLKAEAEKSDGSGTAATKRKVIYCTSLSWSADG  307

Query  212  STLFSGYTDGVIRVWGIGRY  153
            STLFSGYTDGVIRVWGIGRY
Sbjct  308  STLFSGYTDGVIRVWGIGRY  327


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 54/209 (26%), Positives = 87/209 (42%), Gaps = 33/209 (16%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAV  528
             H + V+ +  +P     TIVS S D+++ VW L+         +  L GH+ +V  V +
Sbjct  13   AHTDMVTAIA-TPIDNSDTIVSASRDKSIIVWKLTKDDKSYGVAQRRLTGHSHFVEDVVL  71

Query  527  SPDGSLCASGGKDGVILLWDLAEGKKL-----YSLDAGSIIHALCFSPNRYWLCAATEAS  363
            S DG    SG  DG + LWDLA G        ++ D  S+  +L    NR  + A+ + +
Sbjct  72   SSDGQFALSGSWDGELRLWDLAAGVSTRRFVGHTKDVLSVAFSL---DNRQIVSASRDRT  128

Query  362  IKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDG  183
            IK+W+             L +     +EG         + C   S N    T+ S   D 
Sbjct  129  IKLWNT------------LGECKYTISEGGE--GHRDWVSCVRFSPNTLQPTIVSASWDK  174

Query  182  VIRVWGIGRY*MEEFRRSHMIIGHVCYLS  96
             ++VW      +   +    + GH  Y+S
Sbjct  175  TVKVWN-----LSNCKLRSTLAGHTGYVS  198



>ref|XP_010678120.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Beta vulgaris subsp. vulgaris]
Length=326

 Score =   348 bits (894),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 162/199 (81%), Positives = 181/199 (91%), Gaps = 0/199 (0%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            TIKLWNTLGECKYTIQD DGH +WVSCVRFSP+T+QPTIVS SWD+TVK+WNLSNCKLR+
Sbjct  128  TIKLWNTLGECKYTIQDSDGHTDWVSCVRFSPNTMQPTIVSASWDKTVKIWNLSNCKLRA  187

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
            TLAGH GYVNTVAVSPDGSLCASGGKD VILLWDLAEGK+LYSLDAG+IIHALCFSPNRY
Sbjct  188  TLAGHNGYVNTVAVSPDGSLCASGGKDSVILLWDLAEGKRLYSLDAGTIIHALCFSPNRY  247

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGS  210
            WLCAATE+ IKIWDLESKS+V DL+VDLK E++       TA+K K+I+CTSLSW+ADG 
Sbjct  248  WLCAATESGIKIWDLESKSVVEDLKVDLKTEADHLEGSGTTASKKKVIYCTSLSWSADGQ  307

Query  209  TLFSGYTDGVIRVWGIGRY  153
            TLFSGYTDGV+RV+GI RY
Sbjct  308  TLFSGYTDGVVRVYGIARY  326



>gb|KDP37901.1| hypothetical protein JCGZ_05340 [Jatropha curcas]
Length=329

 Score =   348 bits (893),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 167/201 (83%), Positives = 183/201 (91%), Gaps = 2/201 (1%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            TIKLWNTLGECKYTIQDGD H++WVSCVRFSP+T QPTIVS SWDRTVKVWNL+NCKLR 
Sbjct  129  TIKLWNTLGECKYTIQDGDAHSDWVSCVRFSPNTHQPTIVSASWDRTVKVWNLTNCKLRC  188

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
            TLAGH GYVNTVAVSPDGSLCASGGKDGVILLWDLAEGK+LY+LDAG++IHALCFSPNRY
Sbjct  189  TLAGHNGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKRLYNLDAGAVIHALCFSPNRY  248

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMS--AEGNNTAAKNKIIFCTSLSWNAD  216
            WLCAATE SIKIWDLESKSIV DL+VDLK E+E S  +    T+ K K I+CTSL+W+AD
Sbjct  249  WLCAATEHSIKIWDLESKSIVEDLKVDLKAEAEKSEGSTATGTSIKKKNIYCTSLNWSAD  308

Query  215  GSTLFSGYTDGVIRVWGIGRY  153
            GSTLFSGYTDGV+RVWGIGRY
Sbjct  309  GSTLFSGYTDGVVRVWGIGRY  329


 Score = 53.1 bits (126),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 54/212 (25%), Positives = 92/212 (43%), Gaps = 35/212 (17%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKL-----RSTLAGHTGYVNTVAV  528
             H + V+ +  +P      IV+ S D+++ +W+L+  +      R  L GH+ +V  V +
Sbjct  14   AHTDQVTAIA-TPIDNSDMIVTSSRDKSIILWHLTKEEKTYGVPRRRLTGHSHFVQDVVL  72

Query  527  SPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKI  354
            S DG    SG  DG + LWDLA G   + +      ++       NR  + A+ + +IK+
Sbjct  73   SSDGQFALSGSWDGELRLWDLAAGVSARRFVGHTKDVLSVAFSIDNRQIVSASRDRTIKL  132

Query  353  WDL--ESKSIVVD------------LRVDLKQESEMSAEGNNTAA----KNKIIFCT---  237
            W+   E K  + D               +  Q + +SA  + T       N  + CT   
Sbjct  133  WNTLGECKYTIQDGDAHSDWVSCVRFSPNTHQPTIVSASWDRTVKVWNLTNCKLRCTLAG  192

Query  236  ------SLSWNADGSTLFSGYTDGVIRVWGIG  159
                  +++ + DGS   SG  DGVI +W + 
Sbjct  193  HNGYVNTVAVSPDGSLCASGGKDGVILLWDLA  224



>ref|XP_009149259.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Brassica rapa]
Length=328

 Score =   348 bits (893),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 167/201 (83%), Positives = 182/201 (91%), Gaps = 2/201 (1%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDG--DGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKL  576
            TIKLWNTLGECKYTI +G  +GH +WVSCVRFSP+TLQPTIVS SWD+TVKVWNLSNCKL
Sbjct  128  TIKLWNTLGECKYTIAEGGGEGHRDWVSCVRFSPNTLQPTIVSASWDKTVKVWNLSNCKL  187

Query  575  RSTLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPN  396
            RSTLAGHTGYVNTVAVSPDGSLCASGGKDGV+LLWDLAEGKKLYSL+A S+IHALCFSPN
Sbjct  188  RSTLAGHTGYVNTVAVSPDGSLCASGGKDGVVLLWDLAEGKKLYSLEANSVIHALCFSPN  247

Query  395  RYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNAD  216
            RYWLCAATE  IKIWDLESKS+V DL+VDLK E+E S      A K K+I+CTSL+W+AD
Sbjct  248  RYWLCAATEQGIKIWDLESKSVVEDLKVDLKAEAEKSDGSGTAATKRKVIYCTSLNWSAD  307

Query  215  GSTLFSGYTDGVIRVWGIGRY  153
            GSTLFSGYTDGVIRVWGIGRY
Sbjct  308  GSTLFSGYTDGVIRVWGIGRY  328


 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 53/209 (25%), Positives = 87/209 (42%), Gaps = 32/209 (15%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAV  528
             H + V+ +        P IVS S D+++ VW L+         +  L GH+ +V  V +
Sbjct  13   AHTDMVTAIATPIDNSDP-IVSASRDKSIIVWKLTKDDKSYGVAQRRLTGHSHFVEDVVL  71

Query  527  SPDGSLCASGGKDGVILLWDLAEGKKL-----YSLDAGSIIHALCFSPNRYWLCAATEAS  363
            S DG    SG  DG + LWDLA G        ++ D  S+  +L    NR  + A+ + +
Sbjct  72   SSDGQFALSGSWDGELRLWDLAAGVSTRRFVGHTKDVLSVAFSL---DNRQIVSASRDRT  128

Query  362  IKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDG  183
            IK+W+             L +     AEG     ++  + C   S N    T+ S   D 
Sbjct  129  IKLWNT------------LGECKYTIAEGGGEGHRD-WVSCVRFSPNTLQPTIVSASWDK  175

Query  182  VIRVWGIGRY*MEEFRRSHMIIGHVCYLS  96
             ++VW      +   +    + GH  Y++
Sbjct  176  TVKVWN-----LSNCKLRSTLAGHTGYVN  199



>ref|XP_002894122.1| hypothetical protein ARALYDRAFT_474002 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH70381.1| hypothetical protein ARALYDRAFT_474002 [Arabidopsis lyrata subsp. 
lyrata]
Length=326

 Score =   348 bits (893),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 165/199 (83%), Positives = 181/199 (91%), Gaps = 0/199 (0%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            TIKLWNTLGECKYTI + DGH EWVSCVRFSP+TL PTIVS SWD+TVKVWNL NCKLR+
Sbjct  128  TIKLWNTLGECKYTISEADGHKEWVSCVRFSPNTLVPTIVSASWDKTVKVWNLQNCKLRN  187

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
            TLAGH+GY+NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSL+AGSIIH+LCFSPNRY
Sbjct  188  TLAGHSGYLNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLEAGSIIHSLCFSPNRY  247

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGS  210
            WLCAATE SI+IWDLESKS+V DL+VDLK E+E S     T  K K+I+CTSL+W+ADGS
Sbjct  248  WLCAATENSIRIWDLESKSVVEDLKVDLKTEAEKSDVSTGTGNKTKVIYCTSLNWSADGS  307

Query  209  TLFSGYTDGVIRVWGIGRY  153
            TLFSGYTDGVIRVWGIGRY
Sbjct  308  TLFSGYTDGVIRVWGIGRY  326


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 48/208 (23%), Positives = 91/208 (44%), Gaps = 32/208 (15%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAV  528
             H + V+ +  +P      IV+ S D+++ +W L+         +  + GH+ +V  V +
Sbjct  13   AHTDMVTAIA-TPVDNSDVIVTSSRDKSIILWKLTKEDKSYGVAQRRMTGHSHFVQDVVL  71

Query  527  SPDGSLCASGGKDGVILLWDLAEGK--KLYSLDAGSIIHALCFSPNRYWLCAATEASIKI  354
            S DG    SG  DG + LWDLA G+  + +      ++     + NR  + A+ + +IK+
Sbjct  72   SSDGQFALSGSWDGELRLWDLATGESTRRFVGHTKDVLSVAFSTDNRQIVSASRDRTIKL  131

Query  353  WDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  180
            W+   E K  + +            A+G+      + + C   S N    T+ S   D  
Sbjct  132  WNTLGECKYTISE------------ADGH-----KEWVSCVRFSPNTLVPTIVSASWDKT  174

Query  179  IRVWGIGRY*MEEFRRSHMIIGHVCYLS  96
            ++VW      ++  +  + + GH  YL+
Sbjct  175  VKVWN-----LQNCKLRNTLAGHSGYLN  197


 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 53/185 (29%), Positives = 81/185 (44%), Gaps = 27/185 (15%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVNTVAVSPDGS  513
            GH+ +V  V  S        +SGSWD  +++W+L+  +      GHT  V +VA S D  
Sbjct  61   GHSHFVQDVVLSSD--GQFALSGSWDGELRLWDLATGESTRRFVGHTKDVLSVAFSTDNR  118

Query  512  LCASGGKDGVILLWD-LAEGKKLYSLDAGSIIHALC--FSPNRY---WLCAATEASIKIW  351
               S  +D  I LW+ L E K   S   G      C  FSPN      + A+ + ++K+W
Sbjct  119  QIVSASRDRTIKLWNTLGECKYTISEADGHKEWVSCVRFSPNTLVPTIVSASWDKTVKVW  178

Query  350  DLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRV  171
            +L++      LR  L   S                +  +++ + DGS   SG  DGVI +
Sbjct  179  NLQN----CKLRNTLAGHSG---------------YLNTVAVSPDGSLCASGGKDGVILL  219

Query  170  WGIGR  156
            W +  
Sbjct  220  WDLAE  224



>ref|XP_002890259.1| hypothetical protein ARALYDRAFT_889221 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66518.1| hypothetical protein ARALYDRAFT_889221 [Arabidopsis lyrata subsp. 
lyrata]
Length=327

 Score =   348 bits (892),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 167/200 (84%), Positives = 182/200 (91%), Gaps = 1/200 (1%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDG-DGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLR  573
            TIKLWNTLGECKYTI +G +GH +WVSCVRFSP+TLQPTIVS SWD+TVKVWNLSNCKLR
Sbjct  128  TIKLWNTLGECKYTISEGGEGHRDWVSCVRFSPNTLQPTIVSASWDKTVKVWNLSNCKLR  187

Query  572  STLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNR  393
            STLAGHTGYV+TVAVSPDGSLCASGGKDGV+LLWDLAEGKKLYSL+A S+IHALCFSPNR
Sbjct  188  STLAGHTGYVSTVAVSPDGSLCASGGKDGVVLLWDLAEGKKLYSLEANSVIHALCFSPNR  247

Query  392  YWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADG  213
            YWLCAATE  IKIWDLESKSIV DL+VDLK E+E S      A K K+I+CTSL+W+ADG
Sbjct  248  YWLCAATEQGIKIWDLESKSIVEDLKVDLKAEAEKSDNSGPAATKRKVIYCTSLNWSADG  307

Query  212  STLFSGYTDGVIRVWGIGRY  153
            STLFSGYTDGVIRVWGIGRY
Sbjct  308  STLFSGYTDGVIRVWGIGRY  327


 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 52/209 (25%), Positives = 86/209 (41%), Gaps = 33/209 (16%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAV  528
             H + V+ +  +P      IVS S D+++ +W L+         +  L GH+ +V  V +
Sbjct  13   AHTDMVTAIA-TPIDNADIIVSASRDKSIILWKLTKDDKAYGVAQRRLTGHSHFVEDVVL  71

Query  527  SPDGSLCASGGKDGVILLWDLAEGKKL-----YSLDAGSIIHALCFSPNRYWLCAATEAS  363
            S DG    SG  DG + LWDLA G        ++ D  S+  +L    NR  + A+ + +
Sbjct  72   SSDGQFALSGSWDGELRLWDLAAGVSTRRFVGHTKDVLSVAFSL---DNRQIVSASRDRT  128

Query  362  IKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDG  183
            IK+W+             L +     +EG         + C   S N    T+ S   D 
Sbjct  129  IKLWNT------------LGECKYTISEGGE--GHRDWVSCVRFSPNTLQPTIVSASWDK  174

Query  182  VIRVWGIGRY*MEEFRRSHMIIGHVCYLS  96
             ++VW      +   +    + GH  Y+S
Sbjct  175  TVKVWN-----LSNCKLRSTLAGHTGYVS  198



>gb|KJB08186.1| hypothetical protein B456_001G069800 [Gossypium raimondii]
Length=327

 Score =   347 bits (891),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 164/199 (82%), Positives = 184/199 (92%), Gaps = 1/199 (1%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            TI+LWNTLGECKYTIQ+GD H +WVSCVRFSP+T+QPTIVS SWD+TVKVWNL+NCK+R+
Sbjct  130  TIRLWNTLGECKYTIQEGDAHTDWVSCVRFSPNTVQPTIVSASWDKTVKVWNLTNCKIRN  189

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
            TLAGH+GYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGS+IH+LCFSPNRY
Sbjct  190  TLAGHSGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSVIHSLCFSPNRY  249

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGS  210
            WLCAATE  IKIWDLESKSIV DL+VDLK E+E S +  +   K K+I+CTSL+W+ADGS
Sbjct  250  WLCAATEQGIKIWDLESKSIVEDLKVDLKAEAEKS-DVTDIGNKKKVIYCTSLNWSADGS  308

Query  209  TLFSGYTDGVIRVWGIGRY  153
            TLFSGYTDGVIRVWGIGRY
Sbjct  309  TLFSGYTDGVIRVWGIGRY  327


 Score = 53.1 bits (126),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 53/187 (28%), Positives = 84/187 (45%), Gaps = 31/187 (17%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVNTVAVSPDGS  513
            GH+ +V  V  S  +     +SGSWD  +++W+LS         GHT  V +VA S D  
Sbjct  63   GHSHFVQDVVLSSDS--QFALSGSWDGELRLWDLSAGTSARRFVGHTKDVLSVAFSIDNR  120

Query  512  LCASGGKDGVILLWD-LAEGKKLYSLDAGSI----IHALCFSPNRYW---LCAATEASIK  357
               S  +D  I LW+ L E K  Y++  G      +  + FSPN      + A+ + ++K
Sbjct  121  QIVSASRDRTIRLWNTLGECK--YTIQEGDAHTDWVSCVRFSPNTVQPTIVSASWDKTVK  178

Query  356  IWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVI  177
            +W+L +  I                   NT A +   +  +++ + DGS   SG  DGVI
Sbjct  179  VWNLTNCKI------------------RNTLAGHS-GYVNTVAVSPDGSLCASGGKDGVI  219

Query  176  RVWGIGR  156
             +W +  
Sbjct  220  LLWDLAE  226



>ref|XP_002281279.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Vitis vinifera]
 emb|CAN61810.1| hypothetical protein VITISV_026180 [Vitis vinifera]
Length=327

 Score =   347 bits (890),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 169/200 (85%), Positives = 182/200 (91%), Gaps = 1/200 (1%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            TIKLWNTLGECKYTIQD D H++WVSCVRFSP+ LQPTIVS SWDRTVKVWNL+NCKLR+
Sbjct  128  TIKLWNTLGECKYTIQDADAHSDWVSCVRFSPNNLQPTIVSASWDRTVKVWNLTNCKLRA  187

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
            TLAGH GYVNTVAVSPDGSLCASGGKDGVILLWDLAEGK+LYSLDAG+IIHALCFSPNRY
Sbjct  188  TLAGHGGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKRLYSLDAGAIIHALCFSPNRY  247

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAE-GNNTAAKNKIIFCTSLSWNADG  213
            WLCAATE SIKIWDLESKSIV DL+VDLK E+E S +       K KII+CTSLSW+ADG
Sbjct  248  WLCAATEQSIKIWDLESKSIVEDLKVDLKTEAEKSEDTTTTAKKKGKIIYCTSLSWSADG  307

Query  212  STLFSGYTDGVIRVWGIGRY  153
            STLFSGYTDGV+RVWGIGRY
Sbjct  308  STLFSGYTDGVVRVWGIGRY  327


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 48/186 (26%), Positives = 80/186 (43%), Gaps = 27/186 (15%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAV  528
             H + V+ +  +P      IV+ S D+++ +W+L+         R  L GH+ +V  V +
Sbjct  13   AHTDMVTAIA-TPIDNSDMIVTSSRDKSIILWHLTKDDKTYGVPRRRLTGHSHFVQDVVL  71

Query  527  SPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSI-IHALCFS-PNRYWLCAATEASIKI  354
            S DG    SG  DG + LWDLA G         +  + ++ FS  NR  + A+ + +IK+
Sbjct  72   SSDGQFALSGSWDGELRLWDLAAGTSARRFVGHTKDVLSVAFSVDNRQIVSASRDRTIKL  131

Query  353  WDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  180
            W+   E K  + D                   A +  + C   S N    T+ S   D  
Sbjct  132  WNTLGECKYTIQD-----------------ADAHSDWVSCVRFSPNNLQPTIVSASWDRT  174

Query  179  IRVWGI  162
            ++VW +
Sbjct  175  VKVWNL  180



>ref|XP_006305354.1| hypothetical protein CARUB_v10009733mg [Capsella rubella]
 gb|EOA38252.1| hypothetical protein CARUB_v10009733mg [Capsella rubella]
Length=326

 Score =   347 bits (889),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 163/199 (82%), Positives = 183/199 (92%), Gaps = 0/199 (0%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            TIKLWNTLGECKYTI +GDGH++WVSCVRFSP+T +PTIVS SWDRTVKVWNL NCKLR+
Sbjct  128  TIKLWNTLGECKYTISEGDGHSDWVSCVRFSPNTHEPTIVSASWDRTVKVWNLQNCKLRN  187

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
            TLAGH+GY+NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSL+AGSIIH+LCFSPNRY
Sbjct  188  TLAGHSGYLNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLEAGSIIHSLCFSPNRY  247

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGS  210
            WLCAATE SI+IWDLESKS+V DL+VDLK E+E S     T  K K+I+CTSL+W+ADG+
Sbjct  248  WLCAATENSIRIWDLESKSVVEDLKVDLKVEAEKSDGAVGTGNKTKVIYCTSLNWSADGN  307

Query  209  TLFSGYTDGVIRVWGIGRY  153
            TLFSGYTDG+IRVWGIGRY
Sbjct  308  TLFSGYTDGIIRVWGIGRY  326


 Score = 54.3 bits (129),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 47/206 (23%), Positives = 89/206 (43%), Gaps = 28/206 (14%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAV  528
             H + V+ +  +P      IV+ S D+++ +W L+         +  + GH+ +V  V +
Sbjct  13   AHTDMVTAIA-TPVDNSDVIVTSSRDKSIILWKLTKEDKSYGVAQRRMTGHSHFVEDVVL  71

Query  527  SPDGSLCASGGKDGVILLWDLAEGK--KLYSLDAGSIIHALCFSPNRYWLCAATEASIKI  354
            S DG    SG  DG + LWDLA G+  + +      ++     + NR  + A+ + +IK+
Sbjct  72   SSDGQFALSGSWDGELRLWDLATGESTRRFVGHKKDVLSVAFSTDNRQIVSASRDRTIKL  131

Query  353  WDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIR  174
            W+             L +     +EG+     +  + C   S N    T+ S   D  ++
Sbjct  132  WNT------------LGECKYTISEGD---GHSDWVSCVRFSPNTHEPTIVSASWDRTVK  176

Query  173  VWGIGRY*MEEFRRSHMIIGHVCYLS  96
            VW      ++  +  + + GH  YL+
Sbjct  177  VWN-----LQNCKLRNTLAGHSGYLN  197


 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 51/185 (28%), Positives = 82/185 (44%), Gaps = 27/185 (15%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVNTVAVSPDGS  513
            GH+ +V  V  S        +SGSWD  +++W+L+  +      GH   V +VA S D  
Sbjct  61   GHSHFVEDVVLSSD--GQFALSGSWDGELRLWDLATGESTRRFVGHKKDVLSVAFSTDNR  118

Query  512  LCASGGKDGVILLWD-LAEGKKLYSLDAGSI--IHALCFSPNRY---WLCAATEASIKIW  351
               S  +D  I LW+ L E K   S   G    +  + FSPN +    + A+ + ++K+W
Sbjct  119  QIVSASRDRTIKLWNTLGECKYTISEGDGHSDWVSCVRFSPNTHEPTIVSASWDRTVKVW  178

Query  350  DLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRV  171
            +L++      LR  L   S                +  +++ + DGS   SG  DGVI +
Sbjct  179  NLQN----CKLRNTLAGHSG---------------YLNTVAVSPDGSLCASGGKDGVILL  219

Query  170  WGIGR  156
            W +  
Sbjct  220  WDLAE  224



>emb|CAA06154.1| arcA 3 [Nicotiana tabacum]
Length=290

 Score =   345 bits (885),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 171/199 (86%), Positives = 185/199 (93%), Gaps = 2/199 (1%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            TIKLWNTLGECKYTI DGD H++WVSCVRFSP+ LQPTIVSGSWDRTVK+WNL+NCKLRS
Sbjct  94   TIKLWNTLGECKYTITDGDSHSDWVSCVRFSPNNLQPTIVSGSWDRTVKIWNLTNCKLRS  153

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
            TLAGH+GYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSL+AGSIIH+LCFSPNRY
Sbjct  154  TLAGHSGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLEAGSIIHSLCFSPNRY  213

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGS  210
            WLCAATE+SIKIWDLESKSIVVDL+VDLKQESEMSAEG   AAKNKII+CT LSW+ADGS
Sbjct  214  WLCAATESSIKIWDLESKSIVVDLKVDLKQESEMSAEG-TAAAKNKIIYCTCLSWSADGS  272

Query  209  TLFSGYTDGVIRVWGIGRY  153
            TLF G T  V+  +G GRY
Sbjct  273  TLFGG-TQMVLIEYGDGRY  290


 Score = 49.7 bits (117),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 53/205 (26%), Positives = 86/205 (42%), Gaps = 31/205 (15%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVNTVAVSPDGS  513
            GH  +V  V  S   +    +SGSWD  +++W+L          GHT  V +VA S D  
Sbjct  27   GHGHFVQDVVLSSDGMFA--LSGSWDGELRLWDLQAGTTARRFVGHTKDVLSVAFSIDNR  84

Query  512  LCASGGKDGVILLWD-LAEGKKLYSLDAGSI----IHALCFSPNRYW---LCAATEASIK  357
               S  +D  I LW+ L E K  Y++  G      +  + FSPN      +  + + ++K
Sbjct  85   QIVSASRDKTIKLWNTLGECK--YTITDGDSHSDWVSCVRFSPNNLQPTIVSGSWDRTVK  142

Query  356  IWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVI  177
            IW+L           + K  S ++             +  +++ + DGS   SG  DGVI
Sbjct  143  IWNL----------TNCKLRSTLAGHSG---------YVNTVAVSPDGSLCASGGKDGVI  183

Query  176  RVWGIGRY*MEEFRRSHMIIGHVCY  102
             +W +          +  II  +C+
Sbjct  184  LLWDLAEGKKLYSLEAGSIIHSLCF  208



>ref|NP_173248.1| guanine nucleotide-binding protein subunit beta-like protein 
A [Arabidopsis thaliana]
 sp|O24456.2|GBLPA_ARATH RecName: Full=Guanine nucleotide-binding protein subunit beta-like 
protein A; AltName: Full=Receptor for activated C kinase 
1A; AltName: Full=WD-40 repeat auxin-dependent protein ARCA 
[Arabidopsis thaliana]
 gb|AAF78369.1|AC069551_2 T10O22.6 [Arabidopsis thaliana]
 gb|AAF97825.1|AC034107_8 Identical to WD-40 repeat protein (AtArcA) from Arabidopsis thaliana 
gb|U77381 and contains multiple WD (G-beta repeat) PF|00400 
domains. ESTs gb|Z17972, gb|AI099926, gb|T42961, gb|R30131, 
gb|AV541608, gb|AV532234, gb|AV543299, gb|AV440652 come 
from this gene [Arabidopsis thaliana]
 gb|AAK59512.1| putative WD-40 repeat protein [Arabidopsis thaliana]
 gb|AAL34190.1| putative WD-40 repeat protein [Arabidopsis thaliana]
 gb|AAM66016.1| WD-40 repeat protein [Arabidopsis thaliana]
 gb|AEE29673.1| WD-40 repeat ArcA-like protein [Arabidopsis thaliana]
Length=327

 Score =   346 bits (888),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 166/200 (83%), Positives = 182/200 (91%), Gaps = 1/200 (1%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDG-DGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLR  573
            TIKLWNTLGECKYTI +G +GH +WVSCVRFSP+TLQPTIVS SWD+TVKVWNLSNCKLR
Sbjct  128  TIKLWNTLGECKYTISEGGEGHRDWVSCVRFSPNTLQPTIVSASWDKTVKVWNLSNCKLR  187

Query  572  STLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNR  393
            STLAGHTGYV+TVAVSPDGSLCASGGKDGV+LLWDLAEGKKLYSL+A S+IHALCFSPNR
Sbjct  188  STLAGHTGYVSTVAVSPDGSLCASGGKDGVVLLWDLAEGKKLYSLEANSVIHALCFSPNR  247

Query  392  YWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADG  213
            YWLCAATE  IKIWDLESKSIV DL+VDLK E+E +      A K K+I+CTSL+W+ADG
Sbjct  248  YWLCAATEHGIKIWDLESKSIVEDLKVDLKAEAEKADNSGPAATKRKVIYCTSLNWSADG  307

Query  212  STLFSGYTDGVIRVWGIGRY  153
            STLFSGYTDGVIRVWGIGRY
Sbjct  308  STLFSGYTDGVIRVWGIGRY  327


 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 52/209 (25%), Positives = 86/209 (41%), Gaps = 33/209 (16%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAV  528
             H + V+ +  +P      IVS S D+++ +W L+         +  L GH+ +V  V +
Sbjct  13   AHTDMVTAIA-TPIDNADIIVSASRDKSIILWKLTKDDKAYGVAQRRLTGHSHFVEDVVL  71

Query  527  SPDGSLCASGGKDGVILLWDLAEGKKL-----YSLDAGSIIHALCFSPNRYWLCAATEAS  363
            S DG    SG  DG + LWDLA G        ++ D  S+  +L    NR  + A+ + +
Sbjct  72   SSDGQFALSGSWDGELRLWDLAAGVSTRRFVGHTKDVLSVAFSL---DNRQIVSASRDRT  128

Query  362  IKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDG  183
            IK+W+             L +     +EG         + C   S N    T+ S   D 
Sbjct  129  IKLWNT------------LGECKYTISEGGE--GHRDWVSCVRFSPNTLQPTIVSASWDK  174

Query  182  VIRVWGIGRY*MEEFRRSHMIIGHVCYLS  96
             ++VW      +   +    + GH  Y+S
Sbjct  175  TVKVWN-----LSNCKLRSTLAGHTGYVS  198



>ref|XP_010036939.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Eucalyptus grandis]
 gb|KCW48591.1| hypothetical protein EUGRSUZ_K02261 [Eucalyptus grandis]
Length=326

 Score =   346 bits (887),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 165/200 (83%), Positives = 185/200 (93%), Gaps = 2/200 (1%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            TIKLWNTLGECKYTIQ+G+ H +WVSCVRFSP+TLQPTIVS SWDRT+KVWNL+NCKLR+
Sbjct  128  TIKLWNTLGECKYTIQEGEAHTDWVSCVRFSPNTLQPTIVSASWDRTIKVWNLTNCKLRN  187

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
            TLAGH GYVNTVAVSPDGSLCASGGKDGVILLWDLAEGK+LY+L+AG+IIH+LCFSPNRY
Sbjct  188  TLAGHNGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKRLYNLEAGAIIHSLCFSPNRY  247

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKN-KIIFCTSLSWNADG  213
            WLCAATE SIKIWDLESKSIV DLRVDLK E++ + +G  TAA N K+I+CTSL+W+ADG
Sbjct  248  WLCAATENSIKIWDLESKSIVEDLRVDLKNEADKT-DGTTTAASNKKVIYCTSLNWSADG  306

Query  212  STLFSGYTDGVIRVWGIGRY  153
            STLFSGY DGVIRVWG GRY
Sbjct  307  STLFSGYNDGVIRVWGTGRY  326


 Score = 53.9 bits (128),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 48/186 (26%), Positives = 79/186 (42%), Gaps = 27/186 (15%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKL-----RSTLAGHTGYVNTVAV  528
             H + V+ +   P      +V+ S D+++ +W+L+  +      R  L GH+ +V  V +
Sbjct  13   AHTDMVTAIAI-PIDNSDMVVTSSRDKSIILWHLTKEEKVYGVPRRRLTGHSHFVQDVVL  71

Query  527  SPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKI  354
            S DG    SG  DG + LWDLA G   + +      ++       NR  + A+ + +IK+
Sbjct  72   SSDGQFALSGSWDGELRLWDLATGVSARRFVGHTKDVLSVAFSIDNRQIVSASRDRTIKL  131

Query  353  WDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  180
            W+   E K  +        QE E         A    + C   S N    T+ S   D  
Sbjct  132  WNTLGECKYTI--------QEGE---------AHTDWVSCVRFSPNTLQPTIVSASWDRT  174

Query  179  IRVWGI  162
            I+VW +
Sbjct  175  IKVWNL  180



>ref|NP_188441.1| receptor for activated C kinase 1C [Arabidopsis thaliana]
 sp|Q9LV28.1|GPLPC_ARATH RecName: Full=Guanine nucleotide-binding protein subunit beta-like 
protein C; AltName: Full=Receptor for activated C kinase 
1C [Arabidopsis thaliana]
 dbj|BAB02025.1| guanine nucleotide-binding protein; activated protein kinase 
C receptor; RACK1 [Arabidopsis thaliana]
 gb|AAK91355.1| AT3g18130/MRC8_11 [Arabidopsis thaliana]
 gb|AAM26650.1| AT3g18130/MRC8_11 [Arabidopsis thaliana]
 gb|AEE76051.1| receptor for activated C kinase 1C [Arabidopsis thaliana]
Length=326

 Score =   346 bits (887),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 162/199 (81%), Positives = 182/199 (91%), Gaps = 0/199 (0%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            TIKLWNTLGECKYTI +GDGH EWVSCVRFSP+TL PTIVS SWD+TVKVWNL NCKLR+
Sbjct  128  TIKLWNTLGECKYTISEGDGHKEWVSCVRFSPNTLVPTIVSASWDKTVKVWNLQNCKLRN  187

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
            +L GH+GY+NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSL+AGSIIH+LCFSPNRY
Sbjct  188  SLVGHSGYLNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLEAGSIIHSLCFSPNRY  247

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGS  210
            WLCAATE SI+IWDLESKS+V DL+VDLK E+E +  G  T  + K+I+CTSL+W+ADGS
Sbjct  248  WLCAATENSIRIWDLESKSVVEDLKVDLKSEAEKNEGGVGTGNQKKVIYCTSLNWSADGS  307

Query  209  TLFSGYTDGVIRVWGIGRY  153
            TLFSGYTDGV+RVWGIGRY
Sbjct  308  TLFSGYTDGVVRVWGIGRY  326


 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 48/206 (23%), Positives = 90/206 (44%), Gaps = 28/206 (14%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAV  528
             H + V+ +  +P      IV+ S D+++ +W L+         +  L GH+ +V  V +
Sbjct  13   AHTDIVTAIA-TPIDNSDIIVTASRDKSIILWKLTKDDKSYGVAQRRLTGHSHFVEDVVL  71

Query  527  SPDGSLCASGGKDGVILLWDLAEGK--KLYSLDAGSIIHALCFSPNRYWLCAATEASIKI  354
            S DG    SG  DG + LWDLA G+  + +      ++     + NR  + A+ + +IK+
Sbjct  72   SSDGQFALSGSWDGELRLWDLATGETTRRFVGHTKDVLSVAFSTDNRQIVSASRDRTIKL  131

Query  353  WDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIR  174
            W+             L +     +EG+      + + C   S N    T+ S   D  ++
Sbjct  132  WNT------------LGECKYTISEGD---GHKEWVSCVRFSPNTLVPTIVSASWDKTVK  176

Query  173  VWGIGRY*MEEFRRSHMIIGHVCYLS  96
            VW      ++  +  + ++GH  YL+
Sbjct  177  VWN-----LQNCKLRNSLVGHSGYLN  197


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 51/189 (27%), Positives = 81/189 (43%), Gaps = 35/189 (19%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVNTVAVSPDGS  513
            GH+ +V  V  S        +SGSWD  +++W+L+  +      GHT  V +VA S D  
Sbjct  61   GHSHFVEDVVLSSD--GQFALSGSWDGELRLWDLATGETTRRFVGHTKDVLSVAFSTDNR  118

Query  512  LCASGGKDGVILLWD-LAEGKKLYSLDAGSIIHALC--FSPNRY---WLCAATEASIKIW  351
               S  +D  I LW+ L E K   S   G      C  FSPN      + A+ + ++K+W
Sbjct  119  QIVSASRDRTIKLWNTLGECKYTISEGDGHKEWVSCVRFSPNTLVPTIVSASWDKTVKVW  178

Query  350  DLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKII----FCTSLSWNADGSTLFSGYTDG  183
            +L+                       N   +N ++    +  +++ + DGS   SG  DG
Sbjct  179  NLQ-----------------------NCKLRNSLVGHSGYLNTVAVSPDGSLCASGGKDG  215

Query  182  VIRVWGIGR  156
            VI +W +  
Sbjct  216  VILLWDLAE  224



>ref|XP_009360100.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Pyrus x bretschneideri]
Length=326

 Score =   346 bits (887),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 165/199 (83%), Positives = 183/199 (92%), Gaps = 1/199 (1%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            TIKLWNTLGECK+TIQD DGH +WVSCVRFSPST+QPTIVS SWD+TVKVWNLSNCKLR+
Sbjct  128  TIKLWNTLGECKFTIQDQDGHGDWVSCVRFSPSTMQPTIVSASWDKTVKVWNLSNCKLRN  187

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
            TL GH GYVNTVAVSPDGSLCASGGKDGVILLWDLAEGK+LY L+AGSIIHALCFSPNRY
Sbjct  188  TLEGHNGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKRLYHLEAGSIIHALCFSPNRY  247

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGN-NTAAKNKIIFCTSLSWNADG  213
            WLCAATE SIKIWDLESKSIV +L+VDLK E+E + + +  T+ K K+I+CTSL+W+ADG
Sbjct  248  WLCAATEQSIKIWDLESKSIVEELKVDLKTEAEKTEDTHAATSYKKKVIYCTSLNWSADG  307

Query  212  STLFSGYTDGVIRVWGIGR  156
            STLFSGYTDGVIRVWGIGR
Sbjct  308  STLFSGYTDGVIRVWGIGR  326


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 57/231 (25%), Positives = 97/231 (42%), Gaps = 39/231 (17%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKL-----RSTLAGHTGYVNTVAV  528
             H + V+ +   P      IVS S D+++ +W+L+  +      R  L GH+ +V  V +
Sbjct  13   AHTDMVTAIAI-PIDNSEMIVSASRDKSIILWHLNKDEKTYGVPRRRLTGHSHFVEDVVL  71

Query  527  SPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKI  354
            S DG    SG  DG + LWDLA G   + +      ++       NR  + A+ + +IK+
Sbjct  72   SSDGQFALSGSWDGELRLWDLALGVSARRFVGHTKDVLSVAFSIDNRQIVSASRDRTIKL  131

Query  353  WDL--ESKSIVVD------------LRVDLKQESEMSAEGNNTAA---------KNKII-  246
            W+   E K  + D                  Q + +SA  + T           +N +  
Sbjct  132  WNTLGECKFTIQDQDGHGDWVSCVRFSPSTMQPTIVSASWDKTVKVWNLSNCKLRNTLEG  191

Query  245  ---FCTSLSWNADGSTLFSGYTDGVIRVWGIGRY*MEEFRRSHMIIGHVCY  102
               +  +++ + DGS   SG  DGVI +W +     E  R  H+  G + +
Sbjct  192  HNGYVNTVAVSPDGSLCASGGKDGVILLWDLA----EGKRLYHLEAGSIIH  238



>gb|AAB82647.1| WD-40 repeat protein [Arabidopsis thaliana]
Length=327

 Score =   345 bits (886),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 165/200 (83%), Positives = 182/200 (91%), Gaps = 1/200 (1%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDG-DGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLR  573
            TIKLWNTLGECKYTI +G +GH +WVSCVRFSP+TLQPTIVS SWD+TVK+WNLSNCKLR
Sbjct  128  TIKLWNTLGECKYTISEGGEGHRDWVSCVRFSPNTLQPTIVSASWDKTVKMWNLSNCKLR  187

Query  572  STLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNR  393
            STLAGHTGYV+TVAVSPDGSLCASGGKDGV+LLWDLAEGKKLYSL+A S+IHALCFSPNR
Sbjct  188  STLAGHTGYVSTVAVSPDGSLCASGGKDGVVLLWDLAEGKKLYSLEANSVIHALCFSPNR  247

Query  392  YWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADG  213
            YWLCAATE  IKIWDLESKSIV DL+VDLK E+E +      A K K+I+CTSL+W+ADG
Sbjct  248  YWLCAATEHGIKIWDLESKSIVEDLKVDLKAEAEKADNSGPAATKRKVIYCTSLNWSADG  307

Query  212  STLFSGYTDGVIRVWGIGRY  153
            STLFSGYTDGVIRVWGIGRY
Sbjct  308  STLFSGYTDGVIRVWGIGRY  327


 Score = 50.1 bits (118),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 37/125 (30%), Positives = 61/125 (49%), Gaps = 14/125 (11%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAV  528
             H + V+ +  +P      IVS S D+++ +W L+         +  L GH+ +V  V +
Sbjct  13   AHTDMVTAIA-TPIDNADIIVSASRDKSIILWKLTKDDKAYGVAQRRLTGHSHFVEDVVL  71

Query  527  SPDGSLCASGGKDGVILLWDLAEGKKL-----YSLDAGSIIHALCFSPNRYWLCAATEAS  363
            S DG    SG  DG + LWDLA G        ++ D  S+  +L    NR  + A+ + +
Sbjct  72   SSDGQFALSGSWDGELRLWDLAAGVSTRRFVGHTKDVLSVAFSL---DNRQIVSASRDRT  128

Query  362  IKIWD  348
            IK+W+
Sbjct  129  IKLWN  133



>ref|XP_010540016.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein A [Tarenaya hassleriana]
Length=328

 Score =   345 bits (886),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 164/201 (82%), Positives = 184/201 (92%), Gaps = 2/201 (1%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDG--DGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKL  576
            +IKLWNTLGECKYTI +G  +GH +WVSCVRFSP+TLQPTIVS SWD+TVKVWNLSNCKL
Sbjct  128  SIKLWNTLGECKYTIAEGAGEGHRDWVSCVRFSPNTLQPTIVSASWDKTVKVWNLSNCKL  187

Query  575  RSTLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPN  396
            RSTL GHTGYV+TVAVSPDGSLCASGGKDGV+LLWDLAEGKKLYSL+AG++IH+LCFSPN
Sbjct  188  RSTLVGHTGYVSTVAVSPDGSLCASGGKDGVVLLWDLAEGKKLYSLEAGAVIHSLCFSPN  247

Query  395  RYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNAD  216
            RYWLCAATE SIKIWDLESKSIV DL+VDLK E+E S    + A K K+I+CTSL+W+AD
Sbjct  248  RYWLCAATEQSIKIWDLESKSIVEDLKVDLKAEAEKSDGAGSAATKTKVIYCTSLNWSAD  307

Query  215  GSTLFSGYTDGVIRVWGIGRY  153
            G+TLFSGYTDGVIRVWGIGRY
Sbjct  308  GNTLFSGYTDGVIRVWGIGRY  328


 Score = 59.3 bits (142),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 57/209 (27%), Positives = 90/209 (43%), Gaps = 32/209 (15%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKL-----RSTLAGHTGYVNTVAV  528
             H + V+ +  +P     TIVS S D++V +W L+         +  L GH+ +V  V +
Sbjct  13   AHTDMVTAIA-TPIDNADTIVSSSRDKSVILWKLTKDDKAYGVPQRRLTGHSHFVEDVVL  71

Query  527  SPDGSLCASGGKDGVILLWDLAEGKKL-----YSLDAGSIIHALCFSPNRYWLCAATEAS  363
            S DG    SG  DG + LWDLA G        +S D  S+  +L    NR  + A+ + S
Sbjct  72   SSDGQFALSGSWDGELRLWDLATGTSTRRFVGHSKDVLSVAFSL---DNRQIVSASRDRS  128

Query  362  IKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDG  183
            IK+W+             L +     AEG     ++  + C   S N    T+ S   D 
Sbjct  129  IKLWNT------------LGECKYTIAEGAGEGHRD-WVSCVRFSPNTLQPTIVSASWDK  175

Query  182  VIRVWGIGRY*MEEFRRSHMIIGHVCYLS  96
             ++VW      +   +    ++GH  Y+S
Sbjct  176  TVKVWN-----LSNCKLRSTLVGHTGYVS  199



>ref|XP_010537487.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein A [Tarenaya hassleriana]
Length=328

 Score =   345 bits (885),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 166/201 (83%), Positives = 183/201 (91%), Gaps = 2/201 (1%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDG--DGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKL  576
            +IKLWNTLGECKYTI +G  +GH +WVSCVRFSP+TLQPTIVS SWD+TVKVWNL NCKL
Sbjct  128  SIKLWNTLGECKYTIAEGAGEGHRDWVSCVRFSPNTLQPTIVSASWDKTVKVWNLLNCKL  187

Query  575  RSTLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPN  396
            RSTL GHTGYV+TVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSL+AG++IHALCFSPN
Sbjct  188  RSTLVGHTGYVSTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLEAGAVIHALCFSPN  247

Query  395  RYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNAD  216
            RYWLCAATE SIKIWDLESKSIV DL+VDLK E+E S     TA K K+I+CTSL+W+AD
Sbjct  248  RYWLCAATEQSIKIWDLESKSIVEDLKVDLKAEAEKSDGAGATANKKKVIYCTSLNWSAD  307

Query  215  GSTLFSGYTDGVIRVWGIGRY  153
            G+TLFSGYTDGVIRVWGIGRY
Sbjct  308  GNTLFSGYTDGVIRVWGIGRY  328


 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 52/206 (25%), Positives = 87/206 (42%), Gaps = 26/206 (13%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKL-----RSTLAGHTGYVNTVAV  528
             H + V+ +  +P      IVS S D+++ +W L+  +      +  L GH+ +V  V +
Sbjct  13   AHTDEVTAIA-TPIDNADIIVSSSRDKSIVLWKLTKDEKAYGVPQRRLTGHSHFVQDVVL  71

Query  527  SPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKI  354
            S DG    SG  DG + LWDLA G   + +      +I       NR  + A+ + SIK+
Sbjct  72   SSDGQFALSGSWDGELRLWDLATGTSTRRFVGHTKDVISVAFSIDNRQIVSASRDRSIKL  131

Query  353  WDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIR  174
            W+             L +     AEG     ++  + C   S N    T+ S   D  ++
Sbjct  132  WNT------------LGECKYTIAEGAGEGHRD-WVSCVRFSPNTLQPTIVSASWDKTVK  178

Query  173  VWGIGRY*MEEFRRSHMIIGHVCYLS  96
            VW      +   +    ++GH  Y+S
Sbjct  179  VWN-----LLNCKLRSTLVGHTGYVS  199



>ref|XP_010097592.1| Guanine nucleotide-binding protein subunit beta-like protein 
[Morus notabilis]
 gb|EXB69124.1| Guanine nucleotide-binding protein subunit beta-like protein 
[Morus notabilis]
Length=330

 Score =   345 bits (885),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 169/202 (84%), Positives = 184/202 (91%), Gaps = 3/202 (1%)
 Frame = -3

Query  749  TIKLWNTLGECKYTI--QDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKL  576
            TIKLWNTLGECKYTI    G+ H++WVSCVRFSPS LQPTIVS SWDRTVKVWNLSNCKL
Sbjct  129  TIKLWNTLGECKYTISGDGGEAHSDWVSCVRFSPSNLQPTIVSASWDRTVKVWNLSNCKL  188

Query  575  RSTLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPN  396
            R+TL+GH GYVNTVAVSPDGSLCASGGKDGVILLWDLAEGK+LYSLDAG+IIHALCFSPN
Sbjct  189  RNTLSGHGGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKRLYSLDAGAIIHALCFSPN  248

Query  395  RYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGN-NTAAKNKIIFCTSLSWNA  219
            RYWLCAATE SIKIWDLESKSIV DL+VDLK E+E + + +  TA K K+I+CTSLSW+A
Sbjct  249  RYWLCAATENSIKIWDLESKSIVEDLKVDLKTEAEKTEDTHAATANKKKVIYCTSLSWSA  308

Query  218  DGSTLFSGYTDGVIRVWGIGRY  153
            DGSTLFSGYTDGVIRVWGIGRY
Sbjct  309  DGSTLFSGYTDGVIRVWGIGRY  330


 Score = 53.9 bits (128),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 51/186 (27%), Positives = 83/186 (45%), Gaps = 29/186 (16%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVNTVAVSPDGS  513
            GH+ +V  V  S  +     +SGSWD  +++W+L+         GHT  V +VA S D  
Sbjct  62   GHSHFVEDVVLSSDS--QFALSGSWDGELRLWDLAAGVSARRFVGHTKDVLSVAFSIDNR  119

Query  512  LCASGGKDGVILLWD-LAEGKKLYSLDAGSI----IHALCFSPNRYW---LCAATEASIK  357
               S  +D  I LW+ L E K   S D G      +  + FSP+      + A+ + ++K
Sbjct  120  QIVSASRDRTIKLWNTLGECKYTISGDGGEAHSDWVSCVRFSPSNLQPTIVSASWDRTVK  179

Query  356  IWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVI  177
            +W+L           + K  + +S  G          +  +++ + DGS   SG  DGVI
Sbjct  180  VWNLS----------NCKLRNTLSGHGG---------YVNTVAVSPDGSLCASGGKDGVI  220

Query  176  RVWGIG  159
             +W + 
Sbjct  221  LLWDLA  226


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 43/184 (23%), Positives = 78/184 (42%), Gaps = 21/184 (11%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKL-----RSTLAGHTGYVNTVAV  528
             H + V+ +  +P      IV+ S D+++ +W+L+         R  L GH+ +V  V +
Sbjct  14   AHTDMVTAIA-TPIDNSDIIVTASRDKSIILWHLTKEDKAYGVPRRRLTGHSHFVEDVVL  72

Query  527  SPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKI  354
            S D     SG  DG + LWDLA G   + +      ++       NR  + A+ + +IK+
Sbjct  73   SSDSQFALSGSWDGELRLWDLAAGVSARRFVGHTKDVLSVAFSIDNRQIVSASRDRTIKL  132

Query  353  WDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIR  174
            W+                E + +  G+   A +  + C   S +    T+ S   D  ++
Sbjct  133  WNTLG-------------ECKYTISGDGGEAHSDWVSCVRFSPSNLQPTIVSASWDRTVK  179

Query  173  VWGI  162
            VW +
Sbjct  180  VWNL  183



>ref|XP_010498185.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein A [Camelina sativa]
Length=328

 Score =   345 bits (884),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 164/201 (82%), Positives = 182/201 (91%), Gaps = 2/201 (1%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDG--DGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKL  576
            TIKLWNTLGECKYTI +G  +GH +WVSCVRFSP+TLQPTIVS SWD+TVKVWNLSNCKL
Sbjct  128  TIKLWNTLGECKYTISEGGGEGHRDWVSCVRFSPNTLQPTIVSASWDKTVKVWNLSNCKL  187

Query  575  RSTLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPN  396
            RSTLAGHTGYV+TVAVSPDGSLCASGGKDGV+LLWDLAEGKKLYSL+A S+IHA+CFSPN
Sbjct  188  RSTLAGHTGYVSTVAVSPDGSLCASGGKDGVVLLWDLAEGKKLYSLEANSVIHAVCFSPN  247

Query  395  RYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNAD  216
            RYWLCAATE  IKIWDLESK+IV DL+VDLK E+E +      A K K+I+CTSL+W+AD
Sbjct  248  RYWLCAATEQGIKIWDLESKTIVEDLKVDLKAEAEKADNSGPAATKKKVIYCTSLNWSAD  307

Query  215  GSTLFSGYTDGVIRVWGIGRY  153
            GSTLFSGYTDGVIRVWGIGRY
Sbjct  308  GSTLFSGYTDGVIRVWGIGRY  328


 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 55/211 (26%), Positives = 90/211 (43%), Gaps = 36/211 (17%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAV  528
             H + V+ +  +P      IVS S D+++ +W L+  +      +  L GH+ +V  V +
Sbjct  13   AHTDMVTAIA-TPIDNADIIVSASRDKSIILWKLTKDEKSYGVAQRRLTGHSHFVEDVVL  71

Query  527  SPDGSLCASGGKDGVILLWDLAEGKKL-----YSLDAGSIIHALCFSPNRYWLCAATEAS  363
            S DG    SG  DG + LWDLA G        ++ D  S+  +L    NR  + A+ + +
Sbjct  72   SSDGQFALSGSWDGELRLWDLAAGVSTRRFVGHTKDVLSVAFSL---DNRQIVSASRDRT  128

Query  362  IKIWDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYT  189
            IK+W+   E K  +          SE   EG+        + C   S N    T+ S   
Sbjct  129  IKLWNTLGECKYTI----------SEGGGEGH-----RDWVSCVRFSPNTLQPTIVSASW  173

Query  188  DGVIRVWGIGRY*MEEFRRSHMIIGHVCYLS  96
            D  ++VW      +   +    + GH  Y+S
Sbjct  174  DKTVKVWN-----LSNCKLRSTLAGHTGYVS  199



>ref|XP_008393404.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Malus domestica]
Length=326

 Score =   344 bits (883),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 164/199 (82%), Positives = 183/199 (92%), Gaps = 1/199 (1%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            TIKLWNTLGECK+TIQD DGH +WVSCVRFSP+T+QPTIVS SWD+TVKVWNLSNCKLR+
Sbjct  128  TIKLWNTLGECKFTIQDQDGHGDWVSCVRFSPNTMQPTIVSASWDKTVKVWNLSNCKLRN  187

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
            TL GH GYVNTVAVSPDGSLCASGGKDGVILLWDLAEGK+LY L+AGSIIHALCFSPNRY
Sbjct  188  TLEGHNGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKRLYHLEAGSIIHALCFSPNRY  247

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGN-NTAAKNKIIFCTSLSWNADG  213
            WLCAATE SIKIWDLESKSIV +L+VDLK E+E + + +  T+ K K+I+CTSL+W+ADG
Sbjct  248  WLCAATEQSIKIWDLESKSIVEELKVDLKTEAEKTEDTHAATSYKKKVIYCTSLNWSADG  307

Query  212  STLFSGYTDGVIRVWGIGR  156
            STLFSGYTDGVIRVWGIGR
Sbjct  308  STLFSGYTDGVIRVWGIGR  326


 Score = 53.5 bits (127),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 57/231 (25%), Positives = 98/231 (42%), Gaps = 39/231 (17%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKL-----RSTLAGHTGYVNTVAV  528
             H + V+ +   P      IVS S D+++ +W+L+  +      R  L GH+ +V  V +
Sbjct  13   AHTDMVTAIAI-PIDNSEMIVSASRDKSIILWHLNKDEKTYGVPRRRLTGHSHFVEDVVL  71

Query  527  SPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKI  354
            S DG    SG  DG + LWDLA G   + +      ++       NR  + A+ + +IK+
Sbjct  72   SSDGQFALSGSWDGELRLWDLALGVSARRFVGHTKDVLSVAFSIDNRQIVSASRDRTIKL  131

Query  353  WDL--ESKSIVVD------------LRVDLKQESEMSAEGNNTAA---------KNKII-  246
            W+   E K  + D               +  Q + +SA  + T           +N +  
Sbjct  132  WNTLGECKFTIQDQDGHGDWVSCVRFSPNTMQPTIVSASWDKTVKVWNLSNCKLRNTLEG  191

Query  245  ---FCTSLSWNADGSTLFSGYTDGVIRVWGIGRY*MEEFRRSHMIIGHVCY  102
               +  +++ + DGS   SG  DGVI +W +     E  R  H+  G + +
Sbjct  192  HNGYVNTVAVSPDGSLCASGGKDGVILLWDLA----EGKRLYHLEAGSIIH  238



>ref|XP_010506450.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein C [Camelina sativa]
Length=326

 Score =   344 bits (883),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 161/199 (81%), Positives = 181/199 (91%), Gaps = 0/199 (0%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            TIKLWNTLGECKYTI +GDGH EW+SCVRFSP+TL PTIVS SWD TVKVWNL NCKL++
Sbjct  128  TIKLWNTLGECKYTISEGDGHKEWISCVRFSPNTLVPTIVSASWDHTVKVWNLQNCKLKN  187

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
            +L GHTGY+NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSL+AGSIIH+LCFSPNRY
Sbjct  188  SLVGHTGYLNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLEAGSIIHSLCFSPNRY  247

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGS  210
            WLCAATE SIKIWDLESK++V DL+VDLK E+E +  G  T  + K+I+CTSL+W+ADGS
Sbjct  248  WLCAATENSIKIWDLESKTVVEDLKVDLKAEAEKADGGVGTGNQKKVIYCTSLNWSADGS  307

Query  209  TLFSGYTDGVIRVWGIGRY  153
            TLFSGYTDGV+RVWGIGRY
Sbjct  308  TLFSGYTDGVVRVWGIGRY  326


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 49/206 (24%), Positives = 88/206 (43%), Gaps = 28/206 (14%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAV  528
             H + V+ +  +P      IV+ S D+++ +W L+         +  L GH+ +V  V +
Sbjct  13   AHTDMVTAIA-TPIDNSDIIVTASRDKSIILWKLTKDDKSYGVAQRRLTGHSHFVEDVVL  71

Query  527  SPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKI  354
            S DG    SG  DG + LWDLA G   + +      ++       NR  + A+ + +IK+
Sbjct  72   SSDGQFALSGSWDGELRLWDLATGVSTRRFVGHTKDVLSVAFSVDNRQIVSASRDRTIKL  131

Query  353  WDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIR  174
            W+             L +     +EG+      + I C   S N    T+ S   D  ++
Sbjct  132  WNT------------LGECKYTISEGD---GHKEWISCVRFSPNTLVPTIVSASWDHTVK  176

Query  173  VWGIGRY*MEEFRRSHMIIGHVCYLS  96
            VW      ++  +  + ++GH  YL+
Sbjct  177  VWN-----LQNCKLKNSLVGHTGYLN  197


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 52/189 (28%), Positives = 81/189 (43%), Gaps = 35/189 (19%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVNTVAVSPDGS  513
            GH+ +V  V  S        +SGSWD  +++W+L+         GHT  V +VA S D  
Sbjct  61   GHSHFVEDVVLSSD--GQFALSGSWDGELRLWDLATGVSTRRFVGHTKDVLSVAFSVDNR  118

Query  512  LCASGGKDGVILLWD-LAEGKKLYSLDAGSI--IHALCFSPNRY---WLCAATEASIKIW  351
               S  +D  I LW+ L E K   S   G    I  + FSPN      + A+ + ++K+W
Sbjct  119  QIVSASRDRTIKLWNTLGECKYTISEGDGHKEWISCVRFSPNTLVPTIVSASWDHTVKVW  178

Query  350  DLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKII----FCTSLSWNADGSTLFSGYTDG  183
            +L+                       N   KN ++    +  +++ + DGS   SG  DG
Sbjct  179  NLQ-----------------------NCKLKNSLVGHTGYLNTVAVSPDGSLCASGGKDG  215

Query  182  VIRVWGIGR  156
            VI +W +  
Sbjct  216  VILLWDLAE  224



>gb|AGV54321.1| RACK1 [Phaseolus vulgaris]
Length=324

 Score =   344 bits (883),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 165/199 (83%), Positives = 182/199 (91%), Gaps = 2/199 (1%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            TIKLWNTLGECKYTIQD D H++WVSCVRFSPSTLQPTIVS SWDRT KVWNL+NCKL++
Sbjct  128  TIKLWNTLGECKYTIQDSDAHSDWVSCVRFSPSTLQPTIVSASWDRTGKVWNLTNCKLKN  187

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
            TLAG++GYVN VAVSPDGSLCASGGKDGVILLWDLAEGK+LYSLDAGSIIHALCFSPNRY
Sbjct  188  TLAGNSGYVNNVAVSPDGSLCASGGKDGVILLWDLAEGKRLYSLDAGSIIHALCFSPNRY  247

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGS  210
            WLCAATE SIKIWDLESKSIV DL+VDLK E++ +  GN    K K+I+CTSL+W+ADGS
Sbjct  248  WLCAATEQSIKIWDLESKSIVEDLKVDLKTEADGTTGGNTN--KKKVIYCTSLNWSADGS  305

Query  209  TLFSGYTDGVIRVWGIGRY  153
            TLFSGYTDGV+RVW IGRY
Sbjct  306  TLFSGYTDGVVRVWAIGRY  324


 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 55/213 (26%), Positives = 91/213 (43%), Gaps = 35/213 (16%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKL-----RSTLAGHTGYVNTVAV  528
             H + V+ +  +P      IV+ S D+++ +W L+         R  L GH+ +V  V +
Sbjct  13   AHTDVVTAIA-TPIDNSDMIVTASRDKSIILWQLTKEDKTYGVPRRRLTGHSHFVQDVVL  71

Query  527  SPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSI-IHALCFS-PNRYWLCAATEASIKI  354
            S DG    SG  DG + LWDLA G         +  + ++ FS  NR  + A+ + +IK+
Sbjct  72   SSDGQFALSGSWDGELRLWDLAAGTSARRFVGHTKDVLSVAFSIDNRQIVSASRDRTIKL  131

Query  353  WDL--ESKSIVVD------------LRVDLKQESEMSAEGNNTAA---------KNKII-  246
            W+   E K  + D                  Q + +SA  + T           KN +  
Sbjct  132  WNTLGECKYTIQDSDAHSDWVSCVRFSPSTLQPTIVSASWDRTGKVWNLTNCKLKNTLAG  191

Query  245  ---FCTSLSWNADGSTLFSGYTDGVIRVWGIGR  156
               +  +++ + DGS   SG  DGVI +W +  
Sbjct  192  NSGYVNNVAVSPDGSLCASGGKDGVILLWDLAE  224



>ref|XP_008374821.1| PREDICTED: LOW QUALITY PROTEIN: guanine nucleotide-binding protein 
subunit beta-like protein [Malus domestica]
 ref|XP_008364648.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Malus domestica]
 ref|XP_009347770.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Pyrus x bretschneideri]
Length=326

 Score =   344 bits (883),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 164/199 (82%), Positives = 183/199 (92%), Gaps = 1/199 (1%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            TIKLWNTLGECK+TIQD DGH +WVSCVRFSP+T+QPTIVS SWD+TVKVWNLSNCKLR+
Sbjct  128  TIKLWNTLGECKFTIQDQDGHGDWVSCVRFSPNTMQPTIVSASWDKTVKVWNLSNCKLRN  187

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
            TL GH GYVNTVAVSPDGSLCASGGKDGVILLWDLAEGK+LY L+AGSIIHALCFSPNRY
Sbjct  188  TLEGHNGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKRLYHLEAGSIIHALCFSPNRY  247

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGN-NTAAKNKIIFCTSLSWNADG  213
            WLCAATE SIKIWDLESKSIV +L+VDLK E+E + + +  T+ K K+I+CTSL+W+ADG
Sbjct  248  WLCAATEQSIKIWDLESKSIVEELKVDLKTEAEKTEDTHAATSYKKKVIYCTSLNWSADG  307

Query  212  STLFSGYTDGVIRVWGIGR  156
            STLFSGYTDGVIRVWGIGR
Sbjct  308  STLFSGYTDGVIRVWGIGR  326


 Score = 53.5 bits (127),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 57/231 (25%), Positives = 98/231 (42%), Gaps = 39/231 (17%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKL-----RSTLAGHTGYVNTVAV  528
             H + V+ +   P      IVS S D+++ +W+L+  +      R  L GH+ +V  V +
Sbjct  13   AHTDMVTAIAI-PIDNSEMIVSASRDKSIILWHLNKDEKTYGVPRRRLTGHSHFVQDVVL  71

Query  527  SPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKI  354
            S DG    SG  DG + LWDLA G   + +      ++       NR  + A+ + +IK+
Sbjct  72   SSDGQFALSGSWDGELRLWDLALGVSARRFVGHTKDVLSVAFSIDNRQIVSASRDRTIKL  131

Query  353  WDL--ESKSIVVD------------LRVDLKQESEMSAEGNNTAA---------KNKII-  246
            W+   E K  + D               +  Q + +SA  + T           +N +  
Sbjct  132  WNTLGECKFTIQDQDGHGDWVSCVRFSPNTMQPTIVSASWDKTVKVWNLSNCKLRNTLEG  191

Query  245  ---FCTSLSWNADGSTLFSGYTDGVIRVWGIGRY*MEEFRRSHMIIGHVCY  102
               +  +++ + DGS   SG  DGVI +W +     E  R  H+  G + +
Sbjct  192  HNGYVNTVAVSPDGSLCASGGKDGVILLWDLA----EGKRLYHLEAGSIIH  238



>ref|XP_006305339.1| hypothetical protein CARUB_v10009720mg [Capsella rubella]
 gb|EOA38237.1| hypothetical protein CARUB_v10009720mg [Capsella rubella]
Length=328

 Score =   344 bits (883),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 165/201 (82%), Positives = 181/201 (90%), Gaps = 2/201 (1%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDG--DGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKL  576
            TIKLWNTLGECKYTI +G  +GH +WVSCVRFSP+TL PTIVS SWD+TVKVWNLSNCKL
Sbjct  128  TIKLWNTLGECKYTISEGGGEGHRDWVSCVRFSPNTLHPTIVSASWDKTVKVWNLSNCKL  187

Query  575  RSTLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPN  396
            RSTLAGHTGYV+TVAVSPDGSLCASGGKDGV+LLWDLAEGKKLYSL+A S+IHALCFSPN
Sbjct  188  RSTLAGHTGYVSTVAVSPDGSLCASGGKDGVVLLWDLAEGKKLYSLEANSVIHALCFSPN  247

Query  395  RYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNAD  216
            RYWLCAATE  IKIWDLESKSIV DL+VDLK E+E +      A K K+I+CTSL+W+AD
Sbjct  248  RYWLCAATEQGIKIWDLESKSIVEDLKVDLKAEAEKADNSGPAATKRKVIYCTSLNWSAD  307

Query  215  GSTLFSGYTDGVIRVWGIGRY  153
            GSTLFSGYTDGVIRVWGIGRY
Sbjct  308  GSTLFSGYTDGVIRVWGIGRY  328


 Score = 53.5 bits (127),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 55/211 (26%), Positives = 89/211 (42%), Gaps = 36/211 (17%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAV  528
             H + V+ +  +P      IVS S D+++ +W L+         +  L GH+ +V  V +
Sbjct  13   AHTDMVTAIA-TPIDNADIIVSASRDKSIILWKLTKDDKAYGVAQRRLTGHSHFVEDVVL  71

Query  527  SPDGSLCASGGKDGVILLWDLAEGKKL-----YSLDAGSIIHALCFSPNRYWLCAATEAS  363
            S DG    SG  DG + LWDLA G        ++ D  S+  +L    NR  + A+ + +
Sbjct  72   SSDGQFALSGSWDGELRLWDLAAGVSTRRFVGHTKDVLSVAFSL---DNRQIVSASRDRT  128

Query  362  IKIWDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYT  189
            IK+W+   E K  +          SE   EG+        + C   S N    T+ S   
Sbjct  129  IKLWNTLGECKYTI----------SEGGGEGH-----RDWVSCVRFSPNTLHPTIVSASW  173

Query  188  DGVIRVWGIGRY*MEEFRRSHMIIGHVCYLS  96
            D  ++VW      +   +    + GH  Y+S
Sbjct  174  DKTVKVWN-----LSNCKLRSTLAGHTGYVS  199



>ref|XP_002318528.1| GTP-binding protein beta chain [Populus trichocarpa]
 gb|EEE96748.1| GTP-binding protein beta chain [Populus trichocarpa]
Length=328

 Score =   344 bits (882),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 165/200 (83%), Positives = 182/200 (91%), Gaps = 1/200 (1%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            TIKLWNTLGECKYTIQ+ + H +WVSCVRFSPSTLQPTIVS SWD+TVKVWNL+NCKLRS
Sbjct  129  TIKLWNTLGECKYTIQEAESHTDWVSCVRFSPSTLQPTIVSASWDKTVKVWNLTNCKLRS  188

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
            TLAGH+GYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG++I+ALCFSPNRY
Sbjct  189  TLAGHSGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGAVINALCFSPNRY  248

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTA-AKNKIIFCTSLSWNADG  213
            WLCAATE SIKIWDLESK +V DL+VDLK E+E S     TA +  K I+CTSL+W+ADG
Sbjct  249  WLCAATENSIKIWDLESKMVVDDLKVDLKAEAEKSEGTTATAVSTKKKIYCTSLNWSADG  308

Query  212  STLFSGYTDGVIRVWGIGRY  153
            STLFSGYTDGVIRVWG+GRY
Sbjct  309  STLFSGYTDGVIRVWGVGRY  328


 Score = 53.9 bits (128),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 37/123 (30%), Positives = 61/123 (50%), Gaps = 10/123 (8%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAV  528
             H + V+ +  +P      IVS S D+++ +W+L+  +      R  L GH+ +V  V +
Sbjct  14   AHTDQVTAIA-TPIDNTDMIVSASRDKSIILWHLTKDEKTYGVARRRLTGHSHFVQDVVL  72

Query  527  SPDGSLCASGGKDGVILLWDLAEG---KKLYSLDAGSIIHALCFSPNRYWLCAATEASIK  357
            S DG    SG  DG + LWDLA G   ++        +  A  F  NR  + A+ + +IK
Sbjct  73   SSDGQFALSGSWDGELRLWDLATGVSARRFVGHTKDVLSVAFSFD-NRQIVSASRDKTIK  131

Query  356  IWD  348
            +W+
Sbjct  132  LWN  134



>ref|XP_010476972.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein A [Camelina sativa]
Length=328

 Score =   344 bits (882),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 164/201 (82%), Positives = 181/201 (90%), Gaps = 2/201 (1%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDG--DGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKL  576
            TIKLWNTLGECKYTI +G  +GH +WVSCVRFSP+TLQPTIVS SWD+TVKVWNLSNCKL
Sbjct  128  TIKLWNTLGECKYTISEGGGEGHRDWVSCVRFSPNTLQPTIVSASWDKTVKVWNLSNCKL  187

Query  575  RSTLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPN  396
            RSTLAGHTGYV+TVAVSPDGSLCASGGKDGV+LLWDLAEGKKLYS +A S+IHALCFSPN
Sbjct  188  RSTLAGHTGYVSTVAVSPDGSLCASGGKDGVVLLWDLAEGKKLYSFEANSVIHALCFSPN  247

Query  395  RYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNAD  216
            RYWLCAATE  IKIWDLESK+IV DL+VDLK E+E +      A K K+I+CTSL+W+AD
Sbjct  248  RYWLCAATEQGIKIWDLESKTIVEDLKVDLKAEAEKADNSGPAATKRKVIYCTSLNWSAD  307

Query  215  GSTLFSGYTDGVIRVWGIGRY  153
            GSTLFSGYTDGVIRVWGIGRY
Sbjct  308  GSTLFSGYTDGVIRVWGIGRY  328


 Score = 53.5 bits (127),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 55/211 (26%), Positives = 89/211 (42%), Gaps = 36/211 (17%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAV  528
             H + V+ +  +P      IVS S D+++ +W L+         +  L GH+ +V  V +
Sbjct  13   AHTDMVTAIA-TPIDNADIIVSASRDKSIILWKLTKDDKSYGVAQRRLTGHSHFVEDVVL  71

Query  527  SPDGSLCASGGKDGVILLWDLAEGKKL-----YSLDAGSIIHALCFSPNRYWLCAATEAS  363
            S DG    SG  DG + LWDLA G        ++ D  S+  +L    NR  + A+ + +
Sbjct  72   SSDGQFALSGSWDGELRLWDLAAGVSTRRFVGHTKDVLSVAFSL---DNRQIVSASRDRT  128

Query  362  IKIWDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYT  189
            IK+W+   E K  +          SE   EG+        + C   S N    T+ S   
Sbjct  129  IKLWNTLGECKYTI----------SEGGGEGH-----RDWVSCVRFSPNTLQPTIVSASW  173

Query  188  DGVIRVWGIGRY*MEEFRRSHMIIGHVCYLS  96
            D  ++VW      +   +    + GH  Y+S
Sbjct  174  DKTVKVWN-----LSNCKLRSTLAGHTGYVS  199



>ref|XP_011039103.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Populus euphratica]
Length=328

 Score =   344 bits (882),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 165/200 (83%), Positives = 182/200 (91%), Gaps = 1/200 (1%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            TIKLWNTLGECKYTIQ+ + H +WVSCVRFSPSTLQPTIVS SWD+TVKVWNL+NCKLRS
Sbjct  129  TIKLWNTLGECKYTIQEAESHTDWVSCVRFSPSTLQPTIVSASWDKTVKVWNLTNCKLRS  188

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
            TLAGH+GYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG++I+ALCFSPNRY
Sbjct  189  TLAGHSGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGAVINALCFSPNRY  248

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTA-AKNKIIFCTSLSWNADG  213
            WLCAATE SIKIWDLESK +V DL+VDLK E+E S     TA +  K I+CTSL+W+ADG
Sbjct  249  WLCAATENSIKIWDLESKMVVDDLKVDLKAEAEKSEGTTATAVSTKKKIYCTSLNWSADG  308

Query  212  STLFSGYTDGVIRVWGIGRY  153
            STLFSGYTDGVIRVWG+GRY
Sbjct  309  STLFSGYTDGVIRVWGVGRY  328


 Score = 53.5 bits (127),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 37/123 (30%), Positives = 61/123 (50%), Gaps = 10/123 (8%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAV  528
             H + V+ +  +P      IVS S D+++ +W+L+  +      R  L GH+ +V  V +
Sbjct  14   AHTDQVTAIA-TPIDNTDMIVSSSRDKSIILWHLTKDEKTYGVARRRLTGHSHFVQDVVL  72

Query  527  SPDGSLCASGGKDGVILLWDLAEG---KKLYSLDAGSIIHALCFSPNRYWLCAATEASIK  357
            S DG    SG  DG + LWDLA G   ++        +  A  F  NR  + A+ + +IK
Sbjct  73   SSDGQFALSGSWDGELRLWDLATGVSARRFVGHTKDVLSVAFSFD-NRQIVSASRDKTIK  131

Query  356  IWD  348
            +W+
Sbjct  132  LWN  134



>ref|XP_008240184.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Prunus mume]
Length=327

 Score =   344 bits (882),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 165/200 (83%), Positives = 181/200 (91%), Gaps = 1/200 (1%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            TIKLWNTLGECK+TIQD DGH +WVSCVRFSP+TLQPTIVS SWD+TVKVWNL+NCKLR 
Sbjct  128  TIKLWNTLGECKFTIQDQDGHGDWVSCVRFSPNTLQPTIVSASWDKTVKVWNLTNCKLRC  187

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
            TL GH GYVNTVAVSPDGSLCASGGKDGVILLWDLAEGK LYSL AG+IIHALCFSPNRY
Sbjct  188  TLEGHNGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKMLYSLGAGAIIHALCFSPNRY  247

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGN-NTAAKNKIIFCTSLSWNADG  213
            WLCAATE SIKIWDLESK IV DL+VDLK E+E + + +  TA K K+I+CTSL+W+ADG
Sbjct  248  WLCAATEQSIKIWDLESKQIVEDLKVDLKTEAEKTEDTHAATAYKKKVIYCTSLNWSADG  307

Query  212  STLFSGYTDGVIRVWGIGRY  153
            STLFSGY+DGVIRVWGIGRY
Sbjct  308  STLFSGYSDGVIRVWGIGRY  327


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 59/231 (26%), Positives = 98/231 (42%), Gaps = 35/231 (15%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKL-----RSTLAGHTGYVNTVAV  528
             H + V+ +   P      IVS S D+++ +W+L+  +      R  L GH+ +V  V +
Sbjct  13   AHTDMVTAIAI-PIDNSEMIVSASRDKSIILWHLTKDEKTYGVPRRRLTGHSHFVQDVVL  71

Query  527  SPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKI  354
            S DG    SG  DG + LWDLA G   + +      ++       NR  + A+ + +IK+
Sbjct  72   SSDGQFALSGSWDGELRLWDLALGVSARRFVGHTKDVLSVAFSIDNRQIVSASRDRTIKL  131

Query  353  WDL--ESKSIVVD------------LRVDLKQESEMSAEGNNTAA----KNKIIFCT---  237
            W+   E K  + D               +  Q + +SA  + T       N  + CT   
Sbjct  132  WNTLGECKFTIQDQDGHGDWVSCVRFSPNTLQPTIVSASWDKTVKVWNLTNCKLRCTLEG  191

Query  236  ------SLSWNADGSTLFSGYTDGVIRVWGIGRY*MEEFRRSHMIIGHVCY  102
                  +++ + DGS   SG  DGVI +W +    M     +  II  +C+
Sbjct  192  HNGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKMLYSLGAGAIIHALCF  242



>ref|XP_007209348.1| hypothetical protein PRUPE_ppa008536mg [Prunus persica]
 gb|EMJ10547.1| hypothetical protein PRUPE_ppa008536mg [Prunus persica]
Length=327

 Score =   344 bits (882),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 165/200 (83%), Positives = 181/200 (91%), Gaps = 1/200 (1%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            TIKLWNTLGECK+TIQD DGH +WVSCVRFSP+TLQPTIVS SWD+TVKVWNL+NCKLR 
Sbjct  128  TIKLWNTLGECKFTIQDQDGHGDWVSCVRFSPNTLQPTIVSASWDKTVKVWNLTNCKLRC  187

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
            TL GH GYVNTVAVSPDGSLCASGGKDGVILLWDLAEGK LYSL AG+IIHALCFSPNRY
Sbjct  188  TLEGHNGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKMLYSLGAGAIIHALCFSPNRY  247

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGN-NTAAKNKIIFCTSLSWNADG  213
            WLCAATE SIKIWDLESK IV DL+VDLK E+E + + +  TA K K+I+CTSL+W+ADG
Sbjct  248  WLCAATEQSIKIWDLESKQIVEDLKVDLKTEAEKTEDTHAATAYKKKVIYCTSLNWSADG  307

Query  212  STLFSGYTDGVIRVWGIGRY  153
            STLFSGY+DGVIRVWGIGRY
Sbjct  308  STLFSGYSDGVIRVWGIGRY  327


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 59/231 (26%), Positives = 98/231 (42%), Gaps = 35/231 (15%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKL-----RSTLAGHTGYVNTVAV  528
             H + V+ +   P      IVS S D+++ +W+L+  +      R  L GH+ +V  V +
Sbjct  13   AHTDMVTAIAI-PIDNSEMIVSASRDKSIILWHLTKDEKTYGVPRRRLTGHSHFVQDVVL  71

Query  527  SPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKI  354
            S DG    SG  DG + LWDLA G   + +      ++       NR  + A+ + +IK+
Sbjct  72   SSDGQFALSGSWDGELRLWDLALGVSARRFVGHTKDVLSVAFSIDNRQIVSASRDRTIKL  131

Query  353  WDL--ESKSIVVD------------LRVDLKQESEMSAEGNNTAA----KNKIIFCT---  237
            W+   E K  + D               +  Q + +SA  + T       N  + CT   
Sbjct  132  WNTLGECKFTIQDQDGHGDWVSCVRFSPNTLQPTIVSASWDKTVKVWNLTNCKLRCTLEG  191

Query  236  ------SLSWNADGSTLFSGYTDGVIRVWGIGRY*MEEFRRSHMIIGHVCY  102
                  +++ + DGS   SG  DGVI +W +    M     +  II  +C+
Sbjct  192  HNGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKMLYSLGAGAIIHALCF  242



>ref|NP_175296.1| receptor for activated C kinase 1B [Arabidopsis thaliana]
 sp|Q9C4Z6.1|GPLPB_ARATH RecName: Full=Guanine nucleotide-binding protein subunit beta-like 
protein B; AltName: Full=Receptor for activated C kinase 
1B [Arabidopsis thaliana]
 gb|AAG50846.1|AC074308_2 guanine nucleotide-binding protein, putative [Arabidopsis thaliana]
 gb|AAG60127.1|AC073555_11 guanine nucleotide-binding protein, putative [Arabidopsis thaliana]
 gb|AAL24080.1| putative guanine nucleotide-binding protein [Arabidopsis thaliana]
 gb|AAM14291.1| putative guanine nucleotide-binding protein [Arabidopsis thaliana]
 gb|AEE32329.1| receptor for activated C kinase 1B [Arabidopsis thaliana]
Length=326

 Score =   343 bits (881),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 162/199 (81%), Positives = 180/199 (90%), Gaps = 0/199 (0%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            TIKLWNTLGECKYTI + DGH EWVSCVRFSP+TL PTIVS SWD+TVKVWNL NCKLR+
Sbjct  128  TIKLWNTLGECKYTISEADGHKEWVSCVRFSPNTLVPTIVSASWDKTVKVWNLQNCKLRN  187

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
            TLAGH+GY+NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSL+AGSIIH+LCFSPNRY
Sbjct  188  TLAGHSGYLNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLEAGSIIHSLCFSPNRY  247

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGS  210
            WLCAATE SI+IWDLESKS+V DL+VDLK E+E +        K K+I+CTSL+W+ADG+
Sbjct  248  WLCAATENSIRIWDLESKSVVEDLKVDLKAEAEKTDGSTGIGNKTKVIYCTSLNWSADGN  307

Query  209  TLFSGYTDGVIRVWGIGRY  153
            TLFSGYTDGVIRVWGIGRY
Sbjct  308  TLFSGYTDGVIRVWGIGRY  326


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 48/208 (23%), Positives = 91/208 (44%), Gaps = 32/208 (15%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAV  528
             H + V+ +  +P      IV+ S D+++ +W L+         +  + GH+ +V  V +
Sbjct  13   AHTDMVTAIA-TPVDNSDVIVTSSRDKSIILWKLTKEDKSYGVAQRRMTGHSHFVQDVVL  71

Query  527  SPDGSLCASGGKDGVILLWDLAEGK--KLYSLDAGSIIHALCFSPNRYWLCAATEASIKI  354
            S DG    SG  DG + LWDLA G+  + +      ++     + NR  + A+ + +IK+
Sbjct  72   SSDGQFALSGSWDGELRLWDLATGESTRRFVGHTKDVLSVAFSTDNRQIVSASRDRTIKL  131

Query  353  WDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  180
            W+   E K  + +            A+G+      + + C   S N    T+ S   D  
Sbjct  132  WNTLGECKYTISE------------ADGH-----KEWVSCVRFSPNTLVPTIVSASWDKT  174

Query  179  IRVWGIGRY*MEEFRRSHMIIGHVCYLS  96
            ++VW      ++  +  + + GH  YL+
Sbjct  175  VKVWN-----LQNCKLRNTLAGHSGYLN  197


 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 53/185 (29%), Positives = 81/185 (44%), Gaps = 27/185 (15%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVNTVAVSPDGS  513
            GH+ +V  V  S        +SGSWD  +++W+L+  +      GHT  V +VA S D  
Sbjct  61   GHSHFVQDVVLSSD--GQFALSGSWDGELRLWDLATGESTRRFVGHTKDVLSVAFSTDNR  118

Query  512  LCASGGKDGVILLWD-LAEGKKLYSLDAGSIIHALC--FSPNRY---WLCAATEASIKIW  351
               S  +D  I LW+ L E K   S   G      C  FSPN      + A+ + ++K+W
Sbjct  119  QIVSASRDRTIKLWNTLGECKYTISEADGHKEWVSCVRFSPNTLVPTIVSASWDKTVKVW  178

Query  350  DLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRV  171
            +L++      LR  L   S                +  +++ + DGS   SG  DGVI +
Sbjct  179  NLQN----CKLRNTLAGHSG---------------YLNTVAVSPDGSLCASGGKDGVILL  219

Query  170  WGIGR  156
            W +  
Sbjct  220  WDLAE  224



>ref|XP_011039104.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Populus euphratica]
Length=328

 Score =   343 bits (881),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 165/200 (83%), Positives = 182/200 (91%), Gaps = 1/200 (1%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            TIKLWNTLGECKYTIQ+ + H +WVSCVRFSPSTLQPTIVS SWD+TVKVWNL+NCKLRS
Sbjct  129  TIKLWNTLGECKYTIQEAESHTDWVSCVRFSPSTLQPTIVSASWDKTVKVWNLTNCKLRS  188

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
            TLAGH+GYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG++I+ALCFSPNRY
Sbjct  189  TLAGHSGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGAVINALCFSPNRY  248

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTA-AKNKIIFCTSLSWNADG  213
            WLCAATE SIKIWDLESK +V DL+VDLK E+E S     TA +  K I+CTSL+W+ADG
Sbjct  249  WLCAATENSIKIWDLESKLVVDDLKVDLKAEAEKSEGTTATAVSTKKKIYCTSLNWSADG  308

Query  212  STLFSGYTDGVIRVWGIGRY  153
            STLFSGYTDGVIRVWG+GRY
Sbjct  309  STLFSGYTDGVIRVWGVGRY  328


 Score = 53.5 bits (127),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 37/123 (30%), Positives = 61/123 (50%), Gaps = 10/123 (8%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAV  528
             H + V+ +  +P      IVS S D+++ +W+L+  +      R  L GH+ +V  V +
Sbjct  14   AHTDQVTAIA-TPIDNTDMIVSSSRDKSIILWHLTKDEKTYGVARRRLTGHSHFVQDVVL  72

Query  527  SPDGSLCASGGKDGVILLWDLAEG---KKLYSLDAGSIIHALCFSPNRYWLCAATEASIK  357
            S DG    SG  DG + LWDLA G   ++        +  A  F  NR  + A+ + +IK
Sbjct  73   SSDGQFALSGSWDGELRLWDLATGVSARRFVGHTKDVLSVAFSFD-NRQIVSASRDKTIK  131

Query  356  IWD  348
            +W+
Sbjct  132  LWN  134



>ref|XP_010487724.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein C [Camelina sativa]
Length=326

 Score =   343 bits (879),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 161/199 (81%), Positives = 180/199 (90%), Gaps = 0/199 (0%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            TIKLWNTLGECKYTI +GDGH EW+SCVRFSP+TL PTIVS SWD TVKVWNL NCKL++
Sbjct  128  TIKLWNTLGECKYTISEGDGHKEWISCVRFSPNTLVPTIVSASWDHTVKVWNLQNCKLKN  187

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
            +L GHTGY+NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSL+AGSIIH+LCFSPNRY
Sbjct  188  SLVGHTGYLNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLEAGSIIHSLCFSPNRY  247

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGS  210
            WLCAATE SIKIWDLESK +V DL+VDLK E+E +  G  T  + K+I+CTSL+W+ADGS
Sbjct  248  WLCAATENSIKIWDLESKLVVEDLKVDLKAEAEKADGGVGTGNQKKVIYCTSLNWSADGS  307

Query  209  TLFSGYTDGVIRVWGIGRY  153
            TLFSGYTDGV+RVWGIGRY
Sbjct  308  TLFSGYTDGVVRVWGIGRY  326


 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 49/206 (24%), Positives = 88/206 (43%), Gaps = 28/206 (14%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAV  528
             H + V+ +  +P      IV+ S D+++ +W L+         +  L GH+ +V  V +
Sbjct  13   AHTDMVTAIA-TPIDNSDIIVTASRDKSIILWKLTKDDKSYGVAQRRLTGHSHFVEDVVL  71

Query  527  SPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKI  354
            S DG    SG  DG + LWDLA G   + +      ++       NR  + A+ + +IK+
Sbjct  72   SSDGQFALSGSWDGELRLWDLATGVSTRRFVGHTKDVLSVAFSVDNRQIVSASRDRTIKL  131

Query  353  WDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIR  174
            W+             L +     +EG+      + I C   S N    T+ S   D  ++
Sbjct  132  WNT------------LGECKYTISEGD---GHKEWISCVRFSPNTLVPTIVSASWDHTVK  176

Query  173  VWGIGRY*MEEFRRSHMIIGHVCYLS  96
            VW      ++  +  + ++GH  YL+
Sbjct  177  VWN-----LQNCKLKNSLVGHTGYLN  197


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 52/189 (28%), Positives = 81/189 (43%), Gaps = 35/189 (19%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVNTVAVSPDGS  513
            GH+ +V  V  S        +SGSWD  +++W+L+         GHT  V +VA S D  
Sbjct  61   GHSHFVEDVVLSSD--GQFALSGSWDGELRLWDLATGVSTRRFVGHTKDVLSVAFSVDNR  118

Query  512  LCASGGKDGVILLWD-LAEGKKLYSLDAGSI--IHALCFSPNRY---WLCAATEASIKIW  351
               S  +D  I LW+ L E K   S   G    I  + FSPN      + A+ + ++K+W
Sbjct  119  QIVSASRDRTIKLWNTLGECKYTISEGDGHKEWISCVRFSPNTLVPTIVSASWDHTVKVW  178

Query  350  DLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKII----FCTSLSWNADGSTLFSGYTDG  183
            +L+                       N   KN ++    +  +++ + DGS   SG  DG
Sbjct  179  NLQ-----------------------NCKLKNSLVGHTGYLNTVAVSPDGSLCASGGKDG  215

Query  182  VIRVWGIGR  156
            VI +W +  
Sbjct  216  VILLWDLAE  224



>emb|CDY64888.1| BnaC06g40840D [Brassica napus]
Length=299

 Score =   341 bits (875),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 163/202 (81%), Positives = 182/202 (90%), Gaps = 3/202 (1%)
 Frame = -3

Query  749  TIKLWNTLGECKYTI---QDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK  579
            TIKLWNTLGECKYTI   Q GDGH +WVSCVRFSP+TL PTIVS SWD+TVKVWNL NCK
Sbjct  98   TIKLWNTLGECKYTIGSDQGGDGHKQWVSCVRFSPNTLVPTIVSASWDQTVKVWNLQNCK  157

Query  578  LRSTLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSP  399
            LR+TLAGH+GY+NTVAVSPDGSLCASGGKDG ILLWDLAEGKKLYSL+AG+IIH+LCFSP
Sbjct  158  LRNTLAGHSGYLNTVAVSPDGSLCASGGKDGAILLWDLAEGKKLYSLEAGAIIHSLCFSP  217

Query  398  NRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNA  219
            NRYWLCAATE SI+IWDLESKS+V DL+VDLK E+EMS     T  K K+I+CTSL+W+A
Sbjct  218  NRYWLCAATENSIRIWDLESKSVVEDLKVDLKAEAEMSDASVGTGNKTKVIYCTSLNWSA  277

Query  218  DGSTLFSGYTDGVIRVWGIGRY  153
            DGSTLFSGYTDGVIRVWG+GR+
Sbjct  278  DGSTLFSGYTDGVIRVWGLGRF  299


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 56/206 (27%), Positives = 87/206 (42%), Gaps = 30/206 (15%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVNTVAVSPDGS  513
            GH+ +V  V  S        +SGSWD  +++W+L+         GHT  V +VA S D  
Sbjct  31   GHSHFVEDVALSSD--GQFALSGSWDGELRLWDLATGVSTRRFVGHTKDVLSVAFSTDNR  88

Query  512  LCASGGKDGVILLWD-LAEGKKLYSLDAGSIIHA-----LCFSPNRY---WLCAATEASI  360
               S  +DG I LW+ L E K     D G   H      + FSPN      + A+ + ++
Sbjct  89   QIVSASRDGTIKLWNTLGECKYTIGSDQGGDGHKQWVSCVRFSPNTLVPTIVSASWDQTV  148

Query  359  KIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  180
            K+W+L++      LR  L   S                +  +++ + DGS   SG  DG 
Sbjct  149  KVWNLQN----CKLRNTLAGHSG---------------YLNTVAVSPDGSLCASGGKDGA  189

Query  179  IRVWGIGRY*MEEFRRSHMIIGHVCY  102
            I +W +          +  II  +C+
Sbjct  190  ILLWDLAEGKKLYSLEAGAIIHSLCF  215



>gb|KFK39137.1| guanine nucleotide-binding protein subunit beta-like protein 
[Arabis alpina]
Length=327

 Score =   342 bits (876),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 163/200 (82%), Positives = 181/200 (91%), Gaps = 1/200 (1%)
 Frame = -3

Query  749  TIKLWNTLGECKYTI-QDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLR  573
            TIKLWNTLGECKYTI + GDGH EW+SCVRFSP+TL PTIVS SWD TVKVWNL NCKLR
Sbjct  128  TIKLWNTLGECKYTISEQGDGHKEWISCVRFSPNTLVPTIVSASWDHTVKVWNLQNCKLR  187

Query  572  STLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNR  393
            ++LAGH+GY+NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSL+AGSIIH+LCFSPNR
Sbjct  188  NSLAGHSGYLNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLEAGSIIHSLCFSPNR  247

Query  392  YWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADG  213
            YWLCAATE SIKIWDLESKS+V DL+VDLK E+E S  G     + K+I+CTSL+W+ADG
Sbjct  248  YWLCAATENSIKIWDLESKSVVEDLKVDLKAEAEKSDGGVGMGNQKKVIYCTSLNWSADG  307

Query  212  STLFSGYTDGVIRVWGIGRY  153
            STLFSGYTDGV+RVWGIGRY
Sbjct  308  STLFSGYTDGVVRVWGIGRY  327


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 49/206 (24%), Positives = 88/206 (43%), Gaps = 27/206 (13%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNL-----SNCKLRSTLAGHTGYVNTVAV  528
             H + V+ +  +P      IV+ S D+++ +W L     S    +  L GH+ +V  V +
Sbjct  13   AHTDQVTAIA-TPIDNSDIIVTASRDKSIILWKLNKDDKSYGVAQRRLTGHSHFVEDVVL  71

Query  527  SPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKI  354
            S DG    SG  DG + LWDLA G   + +      ++       NR  + A+ + +IK+
Sbjct  72   SSDGQFALSGSWDGELRLWDLATGLTTRRFVGHTKDVLSVAFSVDNRQIVSASRDRTIKL  131

Query  353  WDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIR  174
            W+   +            +  +S +G+      + I C   S N    T+ S   D  ++
Sbjct  132  WNTLGEC-----------KYTISEQGD---GHKEWISCVRFSPNTLVPTIVSASWDHTVK  177

Query  173  VWGIGRY*MEEFRRSHMIIGHVCYLS  96
            VW      ++  +  + + GH  YL+
Sbjct  178  VWN-----LQNCKLRNSLAGHSGYLN  198


 Score = 50.1 bits (118),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 52/186 (28%), Positives = 80/186 (43%), Gaps = 28/186 (15%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVNTVAVSPDGS  513
            GH+ +V  V  S        +SGSWD  +++W+L+         GHT  V +VA S D  
Sbjct  61   GHSHFVEDVVLSSD--GQFALSGSWDGELRLWDLATGLTTRRFVGHTKDVLSVAFSVDNR  118

Query  512  LCASGGKDGVILLWD-LAEGKKLYSLDAGSI---IHALCFSPNRY---WLCAATEASIKI  354
               S  +D  I LW+ L E K   S         I  + FSPN      + A+ + ++K+
Sbjct  119  QIVSASRDRTIKLWNTLGECKYTISEQGDGHKEWISCVRFSPNTLVPTIVSASWDHTVKV  178

Query  353  WDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIR  174
            W+L++      LR  L   S                +  +++ + DGS   SG  DGVI 
Sbjct  179  WNLQN----CKLRNSLAGHSG---------------YLNTVAVSPDGSLCASGGKDGVIL  219

Query  173  VWGIGR  156
            +W +  
Sbjct  220  LWDLAE  225



>ref|XP_010500401.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein B [Camelina sativa]
Length=326

 Score =   342 bits (876),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 160/199 (80%), Positives = 182/199 (91%), Gaps = 0/199 (0%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            TIKLWNTLGECKYTI +GDGH++WVSCVRFSP+TL PTIVS SWD+TVKVWNL NCKLR+
Sbjct  128  TIKLWNTLGECKYTITEGDGHSDWVSCVRFSPNTLVPTIVSASWDKTVKVWNLQNCKLRN  187

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
            TLAGH+GY+NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSL+AGS+IH+LCFSPNRY
Sbjct  188  TLAGHSGYLNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLEAGSVIHSLCFSPNRY  247

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGS  210
            WLCAATE SI+IWDLESK++V DL+VDLK E+E S        K K+I+CTSL+W+ADG+
Sbjct  248  WLCAATENSIRIWDLESKTVVEDLKVDLKVEAEKSDGAVGIGNKTKVIYCTSLNWSADGN  307

Query  209  TLFSGYTDGVIRVWGIGRY  153
            TLFSGYTDG+IRVWGIGRY
Sbjct  308  TLFSGYTDGIIRVWGIGRY  326


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 47/206 (23%), Positives = 88/206 (43%), Gaps = 28/206 (14%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAV  528
             H + V+ +  +P      IV+ S D+++ +W L+         +  + GH+ +V  V +
Sbjct  13   AHTDMVTAIA-TPIDNSDVIVTSSRDKSIILWKLTKEDKSYGVAQRRMTGHSHFVQDVVL  71

Query  527  SPDGSLCASGGKDGVILLWDLAEGK--KLYSLDAGSIIHALCFSPNRYWLCAATEASIKI  354
            S DG    SG  DG + LWDLA G+  + +      ++     + NR  + A+ + +IK+
Sbjct  72   SSDGQFALSGSWDGELRLWDLATGESTRRFVGHTKDVLSVAFSTDNRQIVSASRDRTIKL  131

Query  353  WDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIR  174
            W+             L +      EG+     +  + C   S N    T+ S   D  ++
Sbjct  132  WNT------------LGECKYTITEGD---GHSDWVSCVRFSPNTLVPTIVSASWDKTVK  176

Query  173  VWGIGRY*MEEFRRSHMIIGHVCYLS  96
            VW      ++  +  + + GH  YL+
Sbjct  177  VWN-----LQNCKLRNTLAGHSGYLN  197


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 52/187 (28%), Positives = 84/187 (45%), Gaps = 31/187 (17%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVNTVAVSPDGS  513
            GH+ +V  V  S        +SGSWD  +++W+L+  +      GHT  V +VA S D  
Sbjct  61   GHSHFVQDVVLSSD--GQFALSGSWDGELRLWDLATGESTRRFVGHTKDVLSVAFSTDNR  118

Query  512  LCASGGKDGVILLWD-LAEGKKLYSLDAGSI----IHALCFSPNRY---WLCAATEASIK  357
               S  +D  I LW+ L E K  Y++  G      +  + FSPN      + A+ + ++K
Sbjct  119  QIVSASRDRTIKLWNTLGECK--YTITEGDGHSDWVSCVRFSPNTLVPTIVSASWDKTVK  176

Query  356  IWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVI  177
            +W+L++      LR  L   S                +  +++ + DGS   SG  DGVI
Sbjct  177  VWNLQN----CKLRNTLAGHSG---------------YLNTVAVSPDGSLCASGGKDGVI  217

Query  176  RVWGIGR  156
             +W +  
Sbjct  218  LLWDLAE  224



>ref|XP_006393380.1| hypothetical protein EUTSA_v10011646mg [Eutrema salsugineum]
 gb|ESQ30666.1| hypothetical protein EUTSA_v10011646mg [Eutrema salsugineum]
Length=327

 Score =   342 bits (876),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 163/200 (82%), Positives = 181/200 (91%), Gaps = 1/200 (1%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQD-GDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLR  573
            TIKLWNTLGECKYTI D GDGH EWVSCVRFSP+ L PTIVS SWD TVKVWNL NCKL+
Sbjct  128  TIKLWNTLGECKYTISDQGDGHKEWVSCVRFSPNMLVPTIVSASWDHTVKVWNLQNCKLK  187

Query  572  STLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNR  393
            +TLAGH+GY+NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSL+AGS+IH+LCFSPNR
Sbjct  188  NTLAGHSGYLNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLEAGSVIHSLCFSPNR  247

Query  392  YWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADG  213
            YWLCAATE+SI+IWDLESKS+V DL+VDLK E+E S     T  K K+I+CTSL+W+ADG
Sbjct  248  YWLCAATESSIRIWDLESKSVVEDLKVDLKAEAEKSDGSAGTGNKTKVIYCTSLNWSADG  307

Query  212  STLFSGYTDGVIRVWGIGRY  153
            +TLFSGYTDGVIRVWGIGRY
Sbjct  308  NTLFSGYTDGVIRVWGIGRY  327


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 49/208 (24%), Positives = 90/208 (43%), Gaps = 31/208 (15%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAV  528
             H + V+ +  +P      IV+ S D+++ +W L+         +  L GH+ +V  V +
Sbjct  13   AHTDMVTAIA-TPIDNSDIIVTSSRDKSIILWKLTKEDKSYGVAQRRLTGHSHFVEDVVL  71

Query  527  SPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKI  354
            S DG    SG  DG + LWDLA G   + +   +  ++     + NR  + A+ + +IK+
Sbjct  72   SSDGQFALSGSWDGELRLWDLATGVSTRRFVGHSKDVLSVAFSADNRQIVSASRDRTIKL  131

Query  353  WDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  180
            W+   E K  + D             +G+      + + C   S N    T+ S   D  
Sbjct  132  WNTLGECKYTISD-------------QGD---GHKEWVSCVRFSPNMLVPTIVSASWDHT  175

Query  179  IRVWGIGRY*MEEFRRSHMIIGHVCYLS  96
            ++VW      ++  +  + + GH  YL+
Sbjct  176  VKVWN-----LQNCKLKNTLAGHSGYLN  198



>gb|AAM65407.1| guanine nucleotide-binding protein, putative [Arabidopsis thaliana]
Length=326

 Score =   341 bits (875),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 161/199 (81%), Positives = 179/199 (90%), Gaps = 0/199 (0%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            TIKLWNTLGECKYTI + DGH EWVSCVRFSP+TL PTIVS SWD+TVKVWNL NCKLR+
Sbjct  128  TIKLWNTLGECKYTISEADGHKEWVSCVRFSPNTLVPTIVSASWDKTVKVWNLQNCKLRN  187

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
            TLAGH+GY+NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSL+AGSIIH+LCFSPNRY
Sbjct  188  TLAGHSGYLNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLEAGSIIHSLCFSPNRY  247

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGS  210
            WLCAATE SI+IWDLESKS+V DL+VDLK E+E +        K K+I+CTSL+W+ADG+
Sbjct  248  WLCAATENSIRIWDLESKSVVEDLKVDLKAEAEKTDGSTGIGNKTKVIYCTSLNWSADGN  307

Query  209  TLFSGYTDGVIRVWGIGRY  153
            TLFSGYT GVIRVWGIGRY
Sbjct  308  TLFSGYTHGVIRVWGIGRY  326


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 48/208 (23%), Positives = 91/208 (44%), Gaps = 32/208 (15%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAV  528
             H + V+ +  +P      IV+ S D+++ +W L+         +  + GH+ +V  V +
Sbjct  13   AHTDMVTAIA-TPVDNSDVIVTSSRDKSIILWKLTKEDKSYGVAQRRMTGHSHFVQDVVL  71

Query  527  SPDGSLCASGGKDGVILLWDLAEGK--KLYSLDAGSIIHALCFSPNRYWLCAATEASIKI  354
            S DG    SG  DG + LWDLA G+  + +      ++     + NR  + A+ + +IK+
Sbjct  72   SSDGQFALSGSWDGELRLWDLATGESTRRFVGHTKDVLSVAFSTDNRQIVSASRDRTIKL  131

Query  353  WDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  180
            W+   E K  + +            A+G+      + + C   S N    T+ S   D  
Sbjct  132  WNTLGECKYTISE------------ADGH-----KEWVSCVRFSPNTLVPTIVSASWDKT  174

Query  179  IRVWGIGRY*MEEFRRSHMIIGHVCYLS  96
            ++VW      ++  +  + + GH  YL+
Sbjct  175  VKVWN-----LQNCKLRNTLAGHSGYLN  197


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 53/185 (29%), Positives = 81/185 (44%), Gaps = 27/185 (15%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVNTVAVSPDGS  513
            GH+ +V  V  S        +SGSWD  +++W+L+  +      GHT  V +VA S D  
Sbjct  61   GHSHFVQDVVLSSD--GQFALSGSWDGELRLWDLATGESTRRFVGHTKDVLSVAFSTDNR  118

Query  512  LCASGGKDGVILLWD-LAEGKKLYSLDAGSIIHALC--FSPNRY---WLCAATEASIKIW  351
               S  +D  I LW+ L E K   S   G      C  FSPN      + A+ + ++K+W
Sbjct  119  QIVSASRDRTIKLWNTLGECKYTISEADGHKEWVSCVRFSPNTLVPTIVSASWDKTVKVW  178

Query  350  DLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRV  171
            +L++      LR  L   S                +  +++ + DGS   SG  DGVI +
Sbjct  179  NLQN----CKLRNTLAGHSG---------------YLNTVAVSPDGSLCASGGKDGVILL  219

Query  170  WGIGR  156
            W +  
Sbjct  220  WDLAE  224



>ref|XP_010465892.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein C [Camelina sativa]
Length=326

 Score =   341 bits (875),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 160/199 (80%), Positives = 180/199 (90%), Gaps = 0/199 (0%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            TIKLWNTLGECKYTI +GDGH EW+SCVRFSP+T  PTIVS SWD TVKVWNL NCKL++
Sbjct  128  TIKLWNTLGECKYTISEGDGHKEWISCVRFSPNTHVPTIVSASWDHTVKVWNLQNCKLKN  187

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
            +L GHTGY+NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSL+AGSIIH+LCFSPNRY
Sbjct  188  SLVGHTGYLNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLEAGSIIHSLCFSPNRY  247

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGS  210
            WLCAATE SIKIWDLESK++V DL+VDLK E+E +  G  T  + K+I+CTSL+W+ADGS
Sbjct  248  WLCAATENSIKIWDLESKTVVEDLKVDLKAEAEKADGGVGTGNQKKVIYCTSLNWSADGS  307

Query  209  TLFSGYTDGVIRVWGIGRY  153
            TLFSGYTDGV+RVWGIGRY
Sbjct  308  TLFSGYTDGVVRVWGIGRY  326


 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 49/206 (24%), Positives = 88/206 (43%), Gaps = 28/206 (14%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAV  528
             H + V+ +  +P      IV+ S D+++ +W L+         +  L GH+ +V  V +
Sbjct  13   AHTDMVTAIA-TPIDNSDIIVTASRDKSIILWKLTKDDKSYGVAQRRLTGHSHFVEDVVL  71

Query  527  SPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKI  354
            S DG    SG  DG + LWDLA G   + +      ++       NR  + A+ + +IK+
Sbjct  72   SSDGQFALSGSWDGELRLWDLATGVSTRRFVGHTKDVLSVAFSVDNRQIVSASRDCTIKL  131

Query  353  WDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIR  174
            W+             L +     +EG+      + I C   S N    T+ S   D  ++
Sbjct  132  WNT------------LGECKYTISEGD---GHKEWISCVRFSPNTHVPTIVSASWDHTVK  176

Query  173  VWGIGRY*MEEFRRSHMIIGHVCYLS  96
            VW      ++  +  + ++GH  YL+
Sbjct  177  VWN-----LQNCKLKNSLVGHTGYLN  197


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 52/189 (28%), Positives = 82/189 (43%), Gaps = 35/189 (19%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVNTVAVSPDGS  513
            GH+ +V  V  S        +SGSWD  +++W+L+         GHT  V +VA S D  
Sbjct  61   GHSHFVEDVVLSSD--GQFALSGSWDGELRLWDLATGVSTRRFVGHTKDVLSVAFSVDNR  118

Query  512  LCASGGKDGVILLWD-LAEGKKLYSLDAGSI--IHALCFSPNRY---WLCAATEASIKIW  351
               S  +D  I LW+ L E K   S   G    I  + FSPN +    + A+ + ++K+W
Sbjct  119  QIVSASRDCTIKLWNTLGECKYTISEGDGHKEWISCVRFSPNTHVPTIVSASWDHTVKVW  178

Query  350  DLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKII----FCTSLSWNADGSTLFSGYTDG  183
            +L+                       N   KN ++    +  +++ + DGS   SG  DG
Sbjct  179  NLQ-----------------------NCKLKNSLVGHTGYLNTVAVSPDGSLCASGGKDG  215

Query  182  VIRVWGIGR  156
            VI +W +  
Sbjct  216  VILLWDLAE  224



>ref|XP_006297909.1| hypothetical protein CARUB_v10013951mg, partial [Capsella rubella]
 gb|EOA30807.1| hypothetical protein CARUB_v10013951mg, partial [Capsella rubella]
Length=380

 Score =   343 bits (880),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 161/199 (81%), Positives = 180/199 (90%), Gaps = 0/199 (0%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            TIKLWNTLGECKYTI +GDGH EW+SCVRFSP+T  PTIVS SWD TVKVWNL NCKL++
Sbjct  182  TIKLWNTLGECKYTISEGDGHKEWISCVRFSPNTNVPTIVSASWDHTVKVWNLQNCKLKN  241

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
            +L GHTGY+NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSL+AGSIIH+LCFSPNRY
Sbjct  242  SLVGHTGYLNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLEAGSIIHSLCFSPNRY  301

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGS  210
            WLCAATE SIKIWDLESKS+V DL+VDLK E+E +  G  T  + K+I+CTSL+W+ADGS
Sbjct  302  WLCAATENSIKIWDLESKSVVEDLKVDLKAEAEKADGGVGTGNQKKVIYCTSLNWSADGS  361

Query  209  TLFSGYTDGVIRVWGIGRY  153
            TLFSGYTDGV+RVWGIGRY
Sbjct  362  TLFSGYTDGVVRVWGIGRY  380


 Score = 56.2 bits (134),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 49/206 (24%), Positives = 89/206 (43%), Gaps = 28/206 (14%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAV  528
             H + V+ +  +P      IV+ S D+++ +W L+         +  L GH+ +V  V +
Sbjct  67   AHTDMVTAIA-TPIDNSDIIVTASRDKSIILWKLTKDDKSYGVAQRRLTGHSHFVEDVVL  125

Query  527  SPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKI  354
            S DG    SG  DG + LWDLA G   + +      ++       NR  + A+ + +IK+
Sbjct  126  SSDGQFALSGSWDGELRLWDLATGVSTRRFVGHTKDVLSVAFSVDNRQIVSASRDRTIKL  185

Query  353  WDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIR  174
            W+             L +     +EG+      + I C   S N +  T+ S   D  ++
Sbjct  186  WNT------------LGECKYTISEGD---GHKEWISCVRFSPNTNVPTIVSASWDHTVK  230

Query  173  VWGIGRY*MEEFRRSHMIIGHVCYLS  96
            VW      ++  +  + ++GH  YL+
Sbjct  231  VWN-----LQNCKLKNSLVGHTGYLN  251


 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 52/189 (28%), Positives = 81/189 (43%), Gaps = 35/189 (19%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVNTVAVSPDGS  513
            GH+ +V  V  S        +SGSWD  +++W+L+         GHT  V +VA S D  
Sbjct  115  GHSHFVEDVVLSSD--GQFALSGSWDGELRLWDLATGVSTRRFVGHTKDVLSVAFSVDNR  172

Query  512  LCASGGKDGVILLWD-LAEGKKLYSLDAGSI--IHALCFSPNR---YWLCAATEASIKIW  351
               S  +D  I LW+ L E K   S   G    I  + FSPN      + A+ + ++K+W
Sbjct  173  QIVSASRDRTIKLWNTLGECKYTISEGDGHKEWISCVRFSPNTNVPTIVSASWDHTVKVW  232

Query  350  DLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKII----FCTSLSWNADGSTLFSGYTDG  183
            +L+                       N   KN ++    +  +++ + DGS   SG  DG
Sbjct  233  NLQ-----------------------NCKLKNSLVGHTGYLNTVAVSPDGSLCASGGKDG  269

Query  182  VIRVWGIGR  156
            VI +W +  
Sbjct  270  VILLWDLAE  278



>sp|Q39336.1|GBLP_BRANA RecName: Full=Guanine nucleotide-binding protein subunit beta-like 
protein [Brassica napus]
 emb|CAA83924.1| guanine nucleotide regulatory protein [Brassica napus]
Length=327

 Score =   341 bits (874),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 163/200 (82%), Positives = 181/200 (91%), Gaps = 1/200 (1%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDG-DGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLR  573
            TIKLWNTLGECKYTI +G +GH +WVSCVRFSP+TLQPTIVS S D+TVKVWNLSNCKLR
Sbjct  128  TIKLWNTLGECKYTISEGGEGHRDWVSCVRFSPNTLQPTIVSASCDKTVKVWNLSNCKLR  187

Query  572  STLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNR  393
            STLAGHTGYV+TVAVSPDGSLCASGGKDGV+LLWDLAEGKKLYSL+A S+IHALCF+PNR
Sbjct  188  STLAGHTGYVSTVAVSPDGSLCASGGKDGVVLLWDLAEGKKLYSLEANSVIHALCFTPNR  247

Query  392  YWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADG  213
            YWLCAATE  IKIWDLESK++V DL+VDLK E+E S      A K K+I+CTSL+W+ADG
Sbjct  248  YWLCAATEQGIKIWDLESKTVVEDLKVDLKAEAEKSDGSGTAATKRKVIYCTSLNWSADG  307

Query  212  STLFSGYTDGVIRVWGIGRY  153
            STLFSGYTDGVIRVWGIGRY
Sbjct  308  STLFSGYTDGVIRVWGIGRY  327


 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 54/209 (26%), Positives = 87/209 (42%), Gaps = 33/209 (16%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAV  528
             H + V+ +  +P     TIVS S D+++ VW L+         +  L GH+ +V  V +
Sbjct  13   AHTDMVTAIA-TPIDNSDTIVSASRDKSIIVWKLTKDDKSYGVRQRRLTGHSHFVEDVVL  71

Query  527  SPDGSLCASGGKDGVILLWDLAEGKKL-----YSLDAGSIIHALCFSPNRYWLCAATEAS  363
            S DG    SG  DG + LWDLA G        ++ D  S+  +L    NR  + A+ + +
Sbjct  72   SSDGQFALSGSWDGELRLWDLAAGVSTRRFVGHTKDVLSVAFSL---DNRQIVSASRDRT  128

Query  362  IKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDG  183
            IK+W+             L +     +EG         + C   S N    T+ S   D 
Sbjct  129  IKLWNT------------LGECKYTISEGGE--GHRDWVSCVRFSPNTLQPTIVSASCDK  174

Query  182  VIRVWGIGRY*MEEFRRSHMIIGHVCYLS  96
             ++VW      +   +    + GH  Y+S
Sbjct  175  TVKVWN-----LSNCKLRSTLAGHTGYVS  198



>ref|XP_010479287.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein B [Camelina sativa]
Length=326

 Score =   340 bits (873),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 159/199 (80%), Positives = 182/199 (91%), Gaps = 0/199 (0%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            TIKLWNTLGECKYTI +GDGH++WVSCVRFSP+TL PTIVS SWD+TVKVWNL NCKLR+
Sbjct  128  TIKLWNTLGECKYTITEGDGHSDWVSCVRFSPNTLVPTIVSASWDKTVKVWNLQNCKLRN  187

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
            TLAGH+GY+NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSL+AGS+IH+LCFSPNRY
Sbjct  188  TLAGHSGYLNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLEAGSVIHSLCFSPNRY  247

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGS  210
            WLCAATE SI+IWDLESK++V DL+VDLK E+E S        K K+I+CTSL+W+ADG+
Sbjct  248  WLCAATENSIRIWDLESKTVVEDLKVDLKVEAEKSDGAVGIGNKTKVIYCTSLNWSADGN  307

Query  209  TLFSGYTDGVIRVWGIGRY  153
            TLFSGYTDG+IRVWGIGR+
Sbjct  308  TLFSGYTDGIIRVWGIGRF  326


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 47/206 (23%), Positives = 88/206 (43%), Gaps = 28/206 (14%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAV  528
             H + V+ +  +P      IV+ S D+++ +W L+         +  + GH+ +V  V +
Sbjct  13   AHTDMVTAIA-TPIDNSDVIVTSSRDKSIILWKLTKEDKSYGVAQRRMTGHSHFVQDVVL  71

Query  527  SPDGSLCASGGKDGVILLWDLAEGK--KLYSLDAGSIIHALCFSPNRYWLCAATEASIKI  354
            S DG    SG  DG + LWDLA G+  + +      ++     + NR  + A+ + +IK+
Sbjct  72   SSDGQFALSGSWDGELRLWDLATGESTRRFVGHTKDVLSVAFSTDNRQIVSASRDRTIKL  131

Query  353  WDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIR  174
            W+             L +      EG+     +  + C   S N    T+ S   D  ++
Sbjct  132  WNT------------LGECKYTITEGD---GHSDWVSCVRFSPNTLVPTIVSASWDKTVK  176

Query  173  VWGIGRY*MEEFRRSHMIIGHVCYLS  96
            VW      ++  +  + + GH  YL+
Sbjct  177  VWN-----LQNCKLRNTLAGHSGYLN  197


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 52/187 (28%), Positives = 84/187 (45%), Gaps = 31/187 (17%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVNTVAVSPDGS  513
            GH+ +V  V  S        +SGSWD  +++W+L+  +      GHT  V +VA S D  
Sbjct  61   GHSHFVQDVVLSSD--GQFALSGSWDGELRLWDLATGESTRRFVGHTKDVLSVAFSTDNR  118

Query  512  LCASGGKDGVILLWD-LAEGKKLYSLDAGSI----IHALCFSPNRY---WLCAATEASIK  357
               S  +D  I LW+ L E K  Y++  G      +  + FSPN      + A+ + ++K
Sbjct  119  QIVSASRDRTIKLWNTLGECK--YTITEGDGHSDWVSCVRFSPNTLVPTIVSASWDKTVK  176

Query  356  IWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVI  177
            +W+L++      LR  L   S                +  +++ + DGS   SG  DGVI
Sbjct  177  VWNLQN----CKLRNTLAGHSG---------------YLNTVAVSPDGSLCASGGKDGVI  217

Query  176  RVWGIGR  156
             +W +  
Sbjct  218  LLWDLAE  224



>ref|XP_010461692.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein B [Camelina sativa]
Length=326

 Score =   340 bits (873),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 160/199 (80%), Positives = 181/199 (91%), Gaps = 0/199 (0%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            TIKLWNTLGECKYTI +GDGH++WVSCVRFSP+TL PTIVS SWD+TVKVWNL NCKLR+
Sbjct  128  TIKLWNTLGECKYTITEGDGHSDWVSCVRFSPNTLVPTIVSASWDKTVKVWNLQNCKLRN  187

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
            TLAGH+GY+NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSL+AGS+IH+LCFSPNRY
Sbjct  188  TLAGHSGYLNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLEAGSVIHSLCFSPNRY  247

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGS  210
            WLCAATE SI+IWDLESK +V DL+VDLK E+E S        K K+I+CTSL+W+ADG+
Sbjct  248  WLCAATENSIRIWDLESKIVVEDLKVDLKVEAEKSDGAVGIGNKTKVIYCTSLNWSADGN  307

Query  209  TLFSGYTDGVIRVWGIGRY  153
            TLFSGYTDG+IRVWGIGRY
Sbjct  308  TLFSGYTDGIIRVWGIGRY  326


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 47/206 (23%), Positives = 88/206 (43%), Gaps = 28/206 (14%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAV  528
             H + V+ +  +P      IV+ S D+++ +W L+         +  + GH+ +V  V +
Sbjct  13   AHTDMVTAIA-TPIDNSDVIVTSSRDKSIILWKLTKEDKSYGVAQRRMTGHSHFVQDVVL  71

Query  527  SPDGSLCASGGKDGVILLWDLAEGK--KLYSLDAGSIIHALCFSPNRYWLCAATEASIKI  354
            S DG    SG  DG + LWDLA G+  + +      ++     + NR  + A+ + +IK+
Sbjct  72   SSDGQFALSGSWDGELRLWDLATGESTRRFVGHTKDVLSVAFSTDNRQIVSASRDRTIKL  131

Query  353  WDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIR  174
            W+             L +      EG+     +  + C   S N    T+ S   D  ++
Sbjct  132  WNT------------LGECKYTITEGD---GHSDWVSCVRFSPNTLVPTIVSASWDKTVK  176

Query  173  VWGIGRY*MEEFRRSHMIIGHVCYLS  96
            VW      ++  +  + + GH  YL+
Sbjct  177  VWN-----LQNCKLRNTLAGHSGYLN  197


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 52/187 (28%), Positives = 84/187 (45%), Gaps = 31/187 (17%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVNTVAVSPDGS  513
            GH+ +V  V  S        +SGSWD  +++W+L+  +      GHT  V +VA S D  
Sbjct  61   GHSHFVQDVVLSSD--GQFALSGSWDGELRLWDLATGESTRRFVGHTKDVLSVAFSTDNR  118

Query  512  LCASGGKDGVILLWD-LAEGKKLYSLDAGSI----IHALCFSPNRY---WLCAATEASIK  357
               S  +D  I LW+ L E K  Y++  G      +  + FSPN      + A+ + ++K
Sbjct  119  QIVSASRDRTIKLWNTLGECK--YTITEGDGHSDWVSCVRFSPNTLVPTIVSASWDKTVK  176

Query  356  IWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVI  177
            +W+L++      LR  L   S                +  +++ + DGS   SG  DGVI
Sbjct  177  VWNLQN----CKLRNTLAGHSG---------------YLNTVAVSPDGSLCASGGKDGVI  217

Query  176  RVWGIGR  156
             +W +  
Sbjct  218  LLWDLAE  224



>ref|XP_010549078.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein B [Tarenaya hassleriana]
Length=327

 Score =   340 bits (872),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 163/200 (82%), Positives = 178/200 (89%), Gaps = 1/200 (1%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQD-GDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLR  573
            TIKLWNTLGECKYTI D  +GH EWVSCVRFSP+TL PTIVS SWD TVKVWNL NCKLR
Sbjct  128  TIKLWNTLGECKYTISDQSEGHREWVSCVRFSPNTLVPTIVSASWDHTVKVWNLQNCKLR  187

Query  572  STLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNR  393
            +TL GH+GY+NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG++IH+LCFSPNR
Sbjct  188  NTLVGHSGYLNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGAVIHSLCFSPNR  247

Query  392  YWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADG  213
            YWLCAATE  IKIWDLESKSIV DL+VDLK E+E S      A K K+I+CTSLSW+ADG
Sbjct  248  YWLCAATEHGIKIWDLESKSIVEDLKVDLKAEAEKSDGDTGAANKQKVIYCTSLSWSADG  307

Query  212  STLFSGYTDGVIRVWGIGRY  153
            +TLFSGYTDG+IRVWGIGRY
Sbjct  308  NTLFSGYTDGIIRVWGIGRY  327


 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 51/208 (25%), Positives = 90/208 (43%), Gaps = 31/208 (15%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKL-----RSTLAGHTGYVNTVAV  528
             H + V+ +  +P      IVS S D+++ +W L+         +  L GH+ +V  V +
Sbjct  13   AHTDAVTAIA-TPVDNADFIVSSSRDKSIVLWKLTKDDKSYGVPQRRLTGHSHFVQDVVL  71

Query  527  SPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKI  354
            S DG    SG  DG + LWDLA G   + +      ++       NR  + A+ + +IK+
Sbjct  72   SSDGQFALSGSWDGELRLWDLATGVSTRRFVGHTKDVLSVAFSVDNRQIVSASRDRTIKL  131

Query  353  WDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  180
            W+   E K  + D            +EG+      + + C   S N    T+ S   D  
Sbjct  132  WNTLGECKYTISD-----------QSEGH-----REWVSCVRFSPNTLVPTIVSASWDHT  175

Query  179  IRVWGIGRY*MEEFRRSHMIIGHVCYLS  96
            ++VW      ++  +  + ++GH  YL+
Sbjct  176  VKVWN-----LQNCKLRNTLVGHSGYLN  198



>ref|XP_006406649.1| hypothetical protein EUTSA_v10021128mg [Eutrema salsugineum]
 gb|ESQ48102.1| hypothetical protein EUTSA_v10021128mg [Eutrema salsugineum]
Length=327

 Score =   339 bits (870),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 162/200 (81%), Positives = 181/200 (91%), Gaps = 1/200 (1%)
 Frame = -3

Query  749  TIKLWNTLGECKYTI-QDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLR  573
            TIKLWNTLGECKYTI + GDGH EW+SCVRFSP+TL PTIVS SWD TVKVWNL NCKL+
Sbjct  128  TIKLWNTLGECKYTISEQGDGHKEWISCVRFSPNTLVPTIVSASWDHTVKVWNLQNCKLK  187

Query  572  STLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNR  393
            ++LAGH+GY+NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSL+AGSIIH+LCFSPNR
Sbjct  188  NSLAGHSGYLNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLEAGSIIHSLCFSPNR  247

Query  392  YWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADG  213
            YWLCAATE SIKIWDLESKS+V DL+VDLK E+E S  G  T  + K+ +CTSL+W+ADG
Sbjct  248  YWLCAATENSIKIWDLESKSVVEDLKVDLKAEAEKSDGGVGTGNQKKVNYCTSLNWSADG  307

Query  212  STLFSGYTDGVIRVWGIGRY  153
            STLFSGYTDGV+RVWGIGRY
Sbjct  308  STLFSGYTDGVVRVWGIGRY  327


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 48/206 (23%), Positives = 89/206 (43%), Gaps = 27/206 (13%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAV  528
             H + V+ +  +P      IV+ S D+++ +W L+  +      +  L GH+ +V  V +
Sbjct  13   AHTDMVTAIA-TPIDNSDIIVTASRDKSIILWKLTKDEKSYGYAQRRLTGHSHFVEDVVL  71

Query  527  SPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKI  354
            S DG    SG  DG + LWDLA G   + +      ++       NR  + A+ + +IK+
Sbjct  72   SSDGQFALSGSWDGELRLWDLATGVSTRRFVGHTKDVLSVAFSVDNRQIVSASRDRTIKL  131

Query  353  WDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIR  174
            W+   +            +  +S +G+      + I C   S N    T+ S   D  ++
Sbjct  132  WNTLGEC-----------KYTISEQGD---GHKEWISCVRFSPNTLVPTIVSASWDHTVK  177

Query  173  VWGIGRY*MEEFRRSHMIIGHVCYLS  96
            VW      ++  +  + + GH  YL+
Sbjct  178  VWN-----LQNCKLKNSLAGHSGYLN  198



>ref|XP_010549077.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein B [Tarenaya hassleriana]
Length=327

 Score =   339 bits (870),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 163/200 (82%), Positives = 177/200 (89%), Gaps = 1/200 (1%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQD-GDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLR  573
            TIKLWNTLGECKYTI D  +GH EWVSCVRFSP+ L PTIVS SWD TVKVWNL NCKLR
Sbjct  128  TIKLWNTLGECKYTISDQSEGHREWVSCVRFSPNMLVPTIVSASWDHTVKVWNLHNCKLR  187

Query  572  STLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNR  393
            +TL GH+GYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG++IH+LCFSPNR
Sbjct  188  NTLVGHSGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGAVIHSLCFSPNR  247

Query  392  YWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADG  213
            YWLCAATE  IKIWDLESKSIV DL+VDLK E+E S      A K K+I+CTSLSW+ADG
Sbjct  248  YWLCAATEHGIKIWDLESKSIVEDLKVDLKTEAEKSDGDTGAANKQKVIYCTSLSWSADG  307

Query  212  STLFSGYTDGVIRVWGIGRY  153
            +TLFSGYTDG+IRVWGIGRY
Sbjct  308  NTLFSGYTDGIIRVWGIGRY  327


 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 50/197 (25%), Positives = 84/197 (43%), Gaps = 30/197 (15%)
 Frame = -3

Query  659  SPSTLQPTIVSGSWDRTVKVWNLSNCKL-----RSTLAGHTGYVNTVAVSPDGSLCASGG  495
            +P      IVS S D+++ VW LS         +  L GH+ +V  V +S DG    SG 
Sbjct  23   TPVDNADFIVSSSRDKSIVVWKLSKDDKSYGVPQRRLTGHSHFVQDVVLSSDGQFALSGS  82

Query  494  KDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDL--ESKSIV  327
             DG + LWDLA G   + +      ++       NR  + A+ + +IK+W+   E K  +
Sbjct  83   WDGELRLWDLATGVSTRRFVGHTKDVLSVAFSVDNRQIVSASRDRTIKLWNTLGECKYTI  142

Query  326  VDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY*M  147
             D            +EG+      + + C   S N    T+ S   D  ++VW      +
Sbjct  143  SD-----------QSEGH-----REWVSCVRFSPNMLVPTIVSASWDHTVKVWN-----L  181

Query  146  EEFRRSHMIIGHVCYLS  96
               +  + ++GH  Y++
Sbjct  182  HNCKLRNTLVGHSGYVN  198



>ref|XP_009147950.1| PREDICTED: LOW QUALITY PROTEIN: guanine nucleotide-binding protein 
subunit beta-like protein B [Brassica rapa]
Length=328

 Score =   339 bits (869),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 161/201 (80%), Positives = 181/201 (90%), Gaps = 2/201 (1%)
 Frame = -3

Query  749  TIKLWNTLGECKYTI--QDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKL  576
            TIKLWNTLGECKYTI    GDGH +WVSCVRFSP+TL PTIVSGSWD+TVKVWNL NCK+
Sbjct  128  TIKLWNTLGECKYTIGSDHGDGHKQWVSCVRFSPNTLVPTIVSGSWDQTVKVWNLQNCKI  187

Query  575  RSTLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPN  396
            R+TLAGH+GY+NTVAVSPDGSLCASGGKDG ILLWDLAEGKKLYSL+AG+IIH+LCFSPN
Sbjct  188  RNTLAGHSGYLNTVAVSPDGSLCASGGKDGAILLWDLAEGKKLYSLEAGAIIHSLCFSPN  247

Query  395  RYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNAD  216
            RYWLCAATE SI+IWDLESKS+V DL+VDLK E+E S     T  K K+I+CTSL+W+AD
Sbjct  248  RYWLCAATENSIRIWDLESKSVVEDLKVDLKAEAEKSDASVGTGNKTKVIYCTSLNWSAD  307

Query  215  GSTLFSGYTDGVIRVWGIGRY  153
            GSTLFSGYTDGVIRVWG+GR+
Sbjct  308  GSTLFSGYTDGVIRVWGLGRF  328


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 54/205 (26%), Positives = 87/205 (42%), Gaps = 29/205 (14%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVNTVAVSPDGS  513
            GH+ +V  V  S        +SGSWD  +++W+L+         GHT  V +VA S D  
Sbjct  61   GHSHFVEDVALSSD--GQFALSGSWDDELRLWDLATGVSTRRFVGHTKDVLSVAFSTDNR  118

Query  512  LCASGGKDGVILLWD-LAEGKKLYSLDAG----SIIHALCFSPNRY---WLCAATEASIK  357
               S  +DG I LW+ L E K     D G      +  + FSPN      +  + + ++K
Sbjct  119  QIVSASRDGTIKLWNTLGECKYTIGSDHGDGHKQWVSCVRFSPNTLVPTIVSGSWDQTVK  178

Query  356  IWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVI  177
            +W+L++  I                   NT A +   +  +++ + DGS   SG  DG I
Sbjct  179  VWNLQNCKI------------------RNTLAGHS-GYLNTVAVSPDGSLCASGGKDGAI  219

Query  176  RVWGIGRY*MEEFRRSHMIIGHVCY  102
             +W +          +  II  +C+
Sbjct  220  LLWDLAEGKKLYSLEAGAIIHSLCF  244


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 47/206 (23%), Positives = 88/206 (43%), Gaps = 26/206 (13%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAV  528
             H + V+ +  +P     TIV+ S D+++ +  L+         +  L GH+ +V  VA+
Sbjct  13   AHTDMVTAIA-TPIDSSDTIVTSSRDKSIILXKLTKDDKSYGVAQRRLTGHSHFVEDVAL  71

Query  527  SPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKI  354
            S DG    SG  D  + LWDLA G   + +      ++     + NR  + A+ + +IK+
Sbjct  72   SSDGQFALSGSWDDELRLWDLATGVSTRRFVGHTKDVLSVAFSTDNRQIVSASRDGTIKL  131

Query  353  WDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIR  174
            W+                E + +   ++     + + C   S N    T+ SG  D  ++
Sbjct  132  WNTLG-------------ECKYTIGSDHGDGHKQWVSCVRFSPNTLVPTIVSGSWDQTVK  178

Query  173  VWGIGRY*MEEFRRSHMIIGHVCYLS  96
            VW      ++  +  + + GH  YL+
Sbjct  179  VWN-----LQNCKIRNTLAGHSGYLN  199



>ref|XP_009145001.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein B [Brassica rapa]
Length=327

 Score =   338 bits (867),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 162/200 (81%), Positives = 180/200 (90%), Gaps = 1/200 (1%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQD-GDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLR  573
            TIKLWNTLGECKYTI D G+GH +WVSCVRFSP+TL PTIVS SWD TVKVWNL+NCKLR
Sbjct  128  TIKLWNTLGECKYTISDQGEGHKQWVSCVRFSPNTLVPTIVSASWDHTVKVWNLANCKLR  187

Query  572  STLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNR  393
            +TLAGH+GY+NTVAVSPDGSLCASGGKDG ILLWDLAEGKKLYSL+AGSIIH+LCFSPNR
Sbjct  188  NTLAGHSGYLNTVAVSPDGSLCASGGKDGAILLWDLAEGKKLYSLEAGSIIHSLCFSPNR  247

Query  392  YWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADG  213
            YWLCAATE SI+IWDLESKS+V DL+VDLK E+E S     T  K K+I+CTSL+W+ADG
Sbjct  248  YWLCAATENSIRIWDLESKSVVEDLKVDLKAEAEKSDVSAATGNKTKVIYCTSLNWSADG  307

Query  212  STLFSGYTDGVIRVWGIGRY  153
            +TLFSGYTDGVIRVWGIG Y
Sbjct  308  NTLFSGYTDGVIRVWGIGHY  327


 Score = 53.5 bits (127),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 50/208 (24%), Positives = 89/208 (43%), Gaps = 31/208 (15%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAV  528
             H + V+ +  +P      IV+ S D+++ +W L+  +      +  L GH+ +V  V +
Sbjct  13   AHTDMVTAIA-TPVDNSDMIVTSSRDKSIILWKLNRDEKSYGVAQRRLTGHSHFVEDVVL  71

Query  527  SPDGSLCASGGKDGVILLWDLAEGK--KLYSLDAGSIIHALCFSPNRYWLCAATEASIKI  354
            S DG    SG  DG + LWDLA G   + +      ++     + NR  + A+ + +IK+
Sbjct  72   SSDGQFALSGSWDGELRLWDLATGASTRRFVGHTKDVLSVAFSTDNRQIVSASRDGTIKL  131

Query  353  WDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  180
            W+   E K  + D             EG+      + + C   S N    T+ S   D  
Sbjct  132  WNTLGECKYTISD-----------QGEGH-----KQWVSCVRFSPNTLVPTIVSASWDHT  175

Query  179  IRVWGIGRY*MEEFRRSHMIIGHVCYLS  96
            ++VW +        +  + + GH  YL+
Sbjct  176  VKVWNLA-----NCKLRNTLAGHSGYLN  198


 Score = 50.1 bits (118),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 53/187 (28%), Positives = 81/187 (43%), Gaps = 30/187 (16%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVNTVAVSPDGS  513
            GH+ +V  V  S        +SGSWD  +++W+L+         GHT  V +VA S D  
Sbjct  61   GHSHFVEDVVLSSD--GQFALSGSWDGELRLWDLATGASTRRFVGHTKDVLSVAFSTDNR  118

Query  512  LCASGGKDGVILLWD-LAEGKKLYSLDAGSI----IHALCFSPNRY---WLCAATEASIK  357
               S  +DG I LW+ L E K   S D G      +  + FSPN      + A+ + ++K
Sbjct  119  QIVSASRDGTIKLWNTLGECKYTIS-DQGEGHKQWVSCVRFSPNTLVPTIVSASWDHTVK  177

Query  356  IWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVI  177
            +W+L +      LR  L   S                +  +++ + DGS   SG  DG I
Sbjct  178  VWNLAN----CKLRNTLAGHSG---------------YLNTVAVSPDGSLCASGGKDGAI  218

Query  176  RVWGIGR  156
             +W +  
Sbjct  219  LLWDLAE  225



>ref|XP_004503304.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein-like [Cicer arietinum]
Length=317

 Score =   338 bits (866),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 165/199 (83%), Positives = 178/199 (89%), Gaps = 9/199 (5%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            TIKLWNTLGECKYTIQDGD H++WVSCVRFSPSTLQPTIVS SWDRTVKVWNL+NCKLR+
Sbjct  128  TIKLWNTLGECKYTIQDGDAHSDWVSCVRFSPSTLQPTIVSASWDRTVKVWNLTNCKLRN  187

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
            TLAGH+GYVNTVAVSPDGSLCASGGKDGVILLWDLAEG       AGSIIHALCFSPNRY
Sbjct  188  TLAGHSGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGNY-----AGSIIHALCFSPNRY  242

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGS  210
            WLCAATE SIKIWDLESKSIV DL+VDLK E+E  +E      K K+I+CTSL+W+ADGS
Sbjct  243  WLCAATETSIKIWDLESKSIVEDLKVDLKAEAESGSE----TTKKKVIYCTSLNWSADGS  298

Query  209  TLFSGYTDGVIRVWGIGRY  153
            TLFSGYTDGV+RVWGIGRY
Sbjct  299  TLFSGYTDGVVRVWGIGRY  317



>ref|XP_002885240.1| guanine nucleotide-binding family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH61499.1| guanine nucleotide-binding family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=327

 Score =   338 bits (867),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 161/200 (81%), Positives = 180/200 (90%), Gaps = 1/200 (1%)
 Frame = -3

Query  749  TIKLWNTLGECKYTI-QDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLR  573
            TIKLWNTLGECKYTI + GDGH EW+SCVRFSP+TL PTIVS SWD TVKVWNL NCKLR
Sbjct  128  TIKLWNTLGECKYTISEQGDGHKEWISCVRFSPNTLVPTIVSASWDHTVKVWNLQNCKLR  187

Query  572  STLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNR  393
            ++L GH+GY+NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSL+AGSIIH+LCFSPNR
Sbjct  188  NSLVGHSGYLNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLEAGSIIHSLCFSPNR  247

Query  392  YWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADG  213
            YWLCAATE SIKIWDLESKS+V DL+VDLK E+E +  G  T  + K+ +CTSL+W+ADG
Sbjct  248  YWLCAATENSIKIWDLESKSVVEDLKVDLKAEAEKTDGGVGTGNQKKVNYCTSLNWSADG  307

Query  212  STLFSGYTDGVIRVWGIGRY  153
            STLFSGYTDGV+RVWGIGRY
Sbjct  308  STLFSGYTDGVVRVWGIGRY  327


 Score = 53.5 bits (127),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 48/206 (23%), Positives = 89/206 (43%), Gaps = 27/206 (13%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAV  528
             H + V+ +  +P      IV+ S D+++ +W L+         +  L GH+ +V  V +
Sbjct  13   AHTDMVTAIA-TPIDNSDIIVTASRDKSIILWKLTKDDKSYGVAQRRLTGHSHFVEDVVL  71

Query  527  SPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKI  354
            S DG    SG  DG + LWDLA G   + +      ++       NR  + A+ + +IK+
Sbjct  72   SSDGQFALSGSWDGELRLWDLATGVSTRRFVGHTKDVLSVAFSVDNRQIVSASRDRTIKL  131

Query  353  WDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIR  174
            W+   +            +  +S +G+      + I C   S N    T+ S   D  ++
Sbjct  132  WNTLGEC-----------KYTISEQGD---GHKEWISCVRFSPNTLVPTIVSASWDHTVK  177

Query  173  VWGIGRY*MEEFRRSHMIIGHVCYLS  96
            VW      ++  +  + ++GH  YL+
Sbjct  178  VWN-----LQNCKLRNSLVGHSGYLN  198



>pdb|3DM0|A Chain A, Maltose Binding Protein Fusion With Rack1 From A. Thaliana
Length=694

 Score =   350 bits (897),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 166/200 (83%), Positives = 182/200 (91%), Gaps = 1/200 (1%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDG-DGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLR  573
            TIKLWNTLGECKYTI +G +GH +WVSCVRFSP+TLQPTIVS SWD+TVKVWNLSNCKLR
Sbjct  495  TIKLWNTLGECKYTISEGGEGHRDWVSCVRFSPNTLQPTIVSASWDKTVKVWNLSNCKLR  554

Query  572  STLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNR  393
            STLAGHTGYV+TVAVSPDGSLCASGGKDGV+LLWDLAEGKKLYSL+A S+IHALCFSPNR
Sbjct  555  STLAGHTGYVSTVAVSPDGSLCASGGKDGVVLLWDLAEGKKLYSLEANSVIHALCFSPNR  614

Query  392  YWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADG  213
            YWLCAATE  IKIWDLESKSIV DL+VDLK E+E +      A K K+I+CTSL+W+ADG
Sbjct  615  YWLCAATEHGIKIWDLESKSIVEDLKVDLKAEAEKADNSGPAATKRKVIYCTSLNWSADG  674

Query  212  STLFSGYTDGVIRVWGIGRY  153
            STLFSGYTDGVIRVWGIGRY
Sbjct  675  STLFSGYTDGVIRVWGIGRY  694


 Score = 50.8 bits (120),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 52/209 (25%), Positives = 86/209 (41%), Gaps = 33/209 (16%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAV  528
             H + V+ +  +P      IVS S D+++ +W L+         +  L GH+ +V  V +
Sbjct  380  AHTDMVTAIA-TPIDNADIIVSASRDKSIILWKLTKDDKAYGVAQRRLTGHSHFVEDVVL  438

Query  527  SPDGSLCASGGKDGVILLWDLAEGKKL-----YSLDAGSIIHALCFSPNRYWLCAATEAS  363
            S DG    SG  DG + LWDLA G        ++ D  S+  +L    NR  + A+ + +
Sbjct  439  SSDGQFALSGSWDGELRLWDLAAGVSTRRFVGHTKDVLSVAFSL---DNRQIVSASRDRT  495

Query  362  IKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDG  183
            IK+W+            + K       EG+        + C   S N    T+ S   D 
Sbjct  496  IKLWNTLG---------ECKYTISEGGEGH-----RDWVSCVRFSPNTLQPTIVSASWDK  541

Query  182  VIRVWGIGRY*MEEFRRSHMIIGHVCYLS  96
             ++VW      +   +    + GH  Y+S
Sbjct  542  TVKVWN-----LSNCKLRSTLAGHTGYVS  565



>ref|XP_009113515.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein C [Brassica rapa]
Length=326

 Score =   337 bits (865),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 158/199 (79%), Positives = 180/199 (90%), Gaps = 0/199 (0%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            TIKLWNTLGECKYTI + DGH +W+SCVRFSP+TL PTIVS SWD+TVKVWNL NCKL+S
Sbjct  128  TIKLWNTLGECKYTISEADGHKDWISCVRFSPNTLVPTIVSASWDKTVKVWNLQNCKLKS  187

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
            +LAGH+GY+NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSL+ GSIIH+LCFSPNRY
Sbjct  188  SLAGHSGYLNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLEGGSIIHSLCFSPNRY  247

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGS  210
            WLCAATE+SIKIWDLESKS+V +L+VDLK E+E    G  T  + K+ +CTSL+W+ADGS
Sbjct  248  WLCAATESSIKIWDLESKSVVDELKVDLKAEAEKCDGGVGTGNQKKVNYCTSLNWSADGS  307

Query  209  TLFSGYTDGVIRVWGIGRY  153
            TLFSGYTDGV+RVWGIGRY
Sbjct  308  TLFSGYTDGVVRVWGIGRY  326


 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 53/185 (29%), Positives = 85/185 (46%), Gaps = 27/185 (15%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVNTVAVSPDGS  513
            GH+ +V  V  SP+      +SGSWD  +++W+L+         GHT YV +VA S    
Sbjct  61   GHSHFVEDVVLSPA--GQFALSGSWDGELRLWDLATGVSTRRFVGHTKYVLSVAFSVANR  118

Query  512  LCASGGKDGVILLWD-LAEGKKLYSLDAGSI--IHALCFSPNRY---WLCAATEASIKIW  351
              AS  +D  I LW+ L E K   S   G    I  + FSPN      + A+ + ++K+W
Sbjct  119  QIASASRDRTIKLWNTLGECKYTISEADGHKDWISCVRFSPNTLVPTIVSASWDKTVKVW  178

Query  350  DLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRV  171
            +L+          + K +S ++             +  +++ + DGS   SG  DGVI +
Sbjct  179  NLQ----------NCKLKSSLAGHSG---------YLNTVAVSPDGSLCASGGKDGVILL  219

Query  170  WGIGR  156
            W +  
Sbjct  220  WDLAE  224


 Score = 50.1 bits (118),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 52/208 (25%), Positives = 89/208 (43%), Gaps = 32/208 (15%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAV  528
             H + V+ +  +P      IV+ S D+++ +W L+  +      +  L GH+ +V  V +
Sbjct  13   AHTDMVTAIA-TPIDNSDIIVTSSRDKSIILWKLTKDEKSYGVAQRRLTGHSHFVEDVVL  71

Query  527  SPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGS-IIHALCFS-PNRYWLCAATEASIKI  354
            SP G    SG  DG + LWDLA G         +  + ++ FS  NR    A+ + +IK+
Sbjct  72   SPAGQFALSGSWDGELRLWDLATGVSTRRFVGHTKYVLSVAFSVANRQIASASRDRTIKL  131

Query  353  WDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  180
            W+   E K  + +            A+G+        I C   S N    T+ S   D  
Sbjct  132  WNTLGECKYTISE------------ADGH-----KDWISCVRFSPNTLVPTIVSASWDKT  174

Query  179  IRVWGIGRY*MEEFRRSHMIIGHVCYLS  96
            ++VW      ++  +    + GH  YL+
Sbjct  175  VKVWN-----LQNCKLKSSLAGHSGYLN  197



>emb|CDY18497.1| BnaA01g26980D [Brassica napus]
Length=326

 Score =   337 bits (864),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 158/199 (79%), Positives = 180/199 (90%), Gaps = 0/199 (0%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            TIKLWNTLGECKYTI + DGH +W+SCVRFSP+TL PTIVS SWD+TVKVWNL NCKL+S
Sbjct  128  TIKLWNTLGECKYTISEADGHKDWISCVRFSPNTLVPTIVSASWDKTVKVWNLQNCKLKS  187

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
            +LAGH+GY+NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSL+ GSIIH+LCFSPNRY
Sbjct  188  SLAGHSGYLNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLEGGSIIHSLCFSPNRY  247

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGS  210
            WLCAATE+SIKIWDLESKS+V +L+VDLK E+E    G  T  + K+ +CTSL+W+ADGS
Sbjct  248  WLCAATESSIKIWDLESKSVVDELKVDLKAEAEKCDGGVGTGNQKKVNYCTSLNWSADGS  307

Query  209  TLFSGYTDGVIRVWGIGRY  153
            TLFSGYTDGV+RVWGIGRY
Sbjct  308  TLFSGYTDGVVRVWGIGRY  326


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 51/185 (28%), Positives = 82/185 (44%), Gaps = 27/185 (15%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVNTVAVSPDGS  513
            GH+ +V  V  S        +SGSWD  +++W+L+         GHT  V +VA S D  
Sbjct  61   GHSHFVEDVVLSSD--GQFALSGSWDGELRLWDLATGVSTRRFVGHTKDVLSVAFSVDNR  118

Query  512  LCASGGKDGVILLWD-LAEGKKLYSLDAGSI--IHALCFSPNRY---WLCAATEASIKIW  351
               S  +D  I LW+ L E K   S   G    I  + FSPN      + A+ + ++K+W
Sbjct  119  QIVSASRDRTIKLWNTLGECKYTISEADGHKDWISCVRFSPNTLVPTIVSASWDKTVKVW  178

Query  350  DLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRV  171
            +L+          + K +S ++             +  +++ + DGS   SG  DGVI +
Sbjct  179  NLQ----------NCKLKSSLAGHSG---------YLNTVAVSPDGSLCASGGKDGVILL  219

Query  170  WGIGR  156
            W +  
Sbjct  220  WDLAE  224


 Score = 50.1 bits (118),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 50/208 (24%), Positives = 88/208 (42%), Gaps = 32/208 (15%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAV  528
             H + V+ +  +P      IV+ S D+++ +W L+  +      +  L GH+ +V  V +
Sbjct  13   AHTDMVTAIA-TPIDNSDIIVTSSRDKSIILWKLTKDEKSYGVAQRRLTGHSHFVEDVVL  71

Query  527  SPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKI  354
            S DG    SG  DG + LWDLA G   + +      ++       NR  + A+ + +IK+
Sbjct  72   SSDGQFALSGSWDGELRLWDLATGVSTRRFVGHTKDVLSVAFSVDNRQIVSASRDRTIKL  131

Query  353  WDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  180
            W+   E K  + +            A+G+        I C   S N    T+ S   D  
Sbjct  132  WNTLGECKYTISE------------ADGH-----KDWISCVRFSPNTLVPTIVSASWDKT  174

Query  179  IRVWGIGRY*MEEFRRSHMIIGHVCYLS  96
            ++VW      ++  +    + GH  YL+
Sbjct  175  VKVWN-----LQNCKLKSSLAGHSGYLN  197



>ref|XP_010551145.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein B [Tarenaya hassleriana]
Length=327

 Score =   336 bits (862),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 159/200 (80%), Positives = 178/200 (89%), Gaps = 1/200 (1%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQD-GDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLR  573
            TIKLWNTLGECKYTI D  +GH EWVSCVRFSP+TL PTIVS SWD TVKVWNL NCKLR
Sbjct  128  TIKLWNTLGECKYTISDQSEGHREWVSCVRFSPNTLVPTIVSASWDHTVKVWNLQNCKLR  187

Query  572  STLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNR  393
            +TL GH+GY+NTVAVSPDGSLCASGGKDG+ILLWDLAEGKKLYSLDAG +IH+LCFSPNR
Sbjct  188  NTLVGHSGYLNTVAVSPDGSLCASGGKDGMILLWDLAEGKKLYSLDAGDVIHSLCFSPNR  247

Query  392  YWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADG  213
            YWLCAATE SIKIWDLESKS+V DL+VDLK E+E S      A K K+I+CTSL+W+ADG
Sbjct  248  YWLCAATEQSIKIWDLESKSVVEDLKVDLKAEAEKSDGDTGAANKQKVIYCTSLNWSADG  307

Query  212  STLFSGYTDGVIRVWGIGRY  153
            +TLFSGY+DG+IRVWGIGR+
Sbjct  308  NTLFSGYSDGIIRVWGIGRF  327


 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 49/189 (26%), Positives = 84/189 (44%), Gaps = 30/189 (16%)
 Frame = -3

Query  635  IVSGSWDRTVKVWNLSNCKL-----RSTLAGHTGYVNTVAVSPDGSLCASGGKDGVILLW  471
            IVS S D+++ +W L+         +  L GH+ +V  VA+S DG    SG  DG + LW
Sbjct  31   IVSSSRDKSIVLWKLTKEDKSYGVPQRRLTGHSHFVQDVALSSDGQFALSGSWDGELRLW  90

Query  470  DLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDL--ESKSIVVDLRVDLK  303
            DLA G   + +      ++       NR  + A+ + +IK+W+   E K  + D      
Sbjct  91   DLATGVSSRRFVGHTKDVLSVAFSVDNRQIVSASRDRTIKLWNTLGECKYTISD------  144

Query  302  QESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY*MEEFRRSHM  123
                  +EG+      + + C   S N    T+ S   D  ++VW      ++  +  + 
Sbjct  145  -----QSEGH-----REWVSCVRFSPNTLVPTIVSASWDHTVKVWN-----LQNCKLRNT  189

Query  122  IIGHVCYLS  96
            ++GH  YL+
Sbjct  190  LVGHSGYLN  198



>emb|CDX95554.1| BnaC01g34460D [Brassica napus]
Length=326

 Score =   336 bits (861),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 157/199 (79%), Positives = 180/199 (90%), Gaps = 0/199 (0%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            TIKLWNTLGECKYTI + DGH +W+SCVRFSP+T+ PTIVS SWD+TVKVWNL NCKL+S
Sbjct  128  TIKLWNTLGECKYTISEADGHKDWISCVRFSPNTVVPTIVSASWDKTVKVWNLQNCKLKS  187

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
            +LAGH+GY+NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSL+ GSIIH+LCFSPNRY
Sbjct  188  SLAGHSGYLNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLEGGSIIHSLCFSPNRY  247

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGS  210
            WLCAATE+SIKIWDLESKS+V +L+VDLK E+E    G  T  + K+ +CTSL+W+ADGS
Sbjct  248  WLCAATESSIKIWDLESKSVVDELKVDLKAEAEKCDGGVGTGNQKKVNYCTSLNWSADGS  307

Query  209  TLFSGYTDGVIRVWGIGRY  153
            TLFSGYTDGV+RVWGIGRY
Sbjct  308  TLFSGYTDGVVRVWGIGRY  326


 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 51/185 (28%), Positives = 82/185 (44%), Gaps = 27/185 (15%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVNTVAVSPDGS  513
            GH+ +V  V  S        +SGSWD  +++W+L+         GHT  V +VA S D  
Sbjct  61   GHSHFVEDVVLSSD--GQFALSGSWDGELRLWDLATGVSTRRFVGHTKDVLSVAFSVDNR  118

Query  512  LCASGGKDGVILLWD-LAEGKKLYSLDAGSI--IHALCFSPNRY---WLCAATEASIKIW  351
               S  +D  I LW+ L E K   S   G    I  + FSPN      + A+ + ++K+W
Sbjct  119  QIVSASRDRTIKLWNTLGECKYTISEADGHKDWISCVRFSPNTVVPTIVSASWDKTVKVW  178

Query  350  DLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRV  171
            +L+          + K +S ++             +  +++ + DGS   SG  DGVI +
Sbjct  179  NLQ----------NCKLKSSLAGHSG---------YLNTVAVSPDGSLCASGGKDGVILL  219

Query  170  WGIGR  156
            W +  
Sbjct  220  WDLAE  224


 Score = 50.1 bits (118),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 50/208 (24%), Positives = 88/208 (42%), Gaps = 32/208 (15%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAV  528
             H + V+ +  +P      IV+ S D+++ +W L+  +      +  L GH+ +V  V +
Sbjct  13   AHTDMVTAIA-TPIDNSDIIVTSSRDKSIILWKLTKDEKSYGVAQRRLTGHSHFVEDVVL  71

Query  527  SPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKI  354
            S DG    SG  DG + LWDLA G   + +      ++       NR  + A+ + +IK+
Sbjct  72   SSDGQFALSGSWDGELRLWDLATGVSTRRFVGHTKDVLSVAFSVDNRQIVSASRDRTIKL  131

Query  353  WDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  180
            W+   E K  + +            A+G+        I C   S N    T+ S   D  
Sbjct  132  WNTLGECKYTISE------------ADGH-----KDWISCVRFSPNTVVPTIVSASWDKT  174

Query  179  IRVWGIGRY*MEEFRRSHMIIGHVCYLS  96
            ++VW      ++  +    + GH  YL+
Sbjct  175  VKVWN-----LQNCKLKSSLAGHSGYLN  197



>ref|XP_011000479.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Populus euphratica]
Length=328

 Score =   335 bits (860),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 165/201 (82%), Positives = 182/201 (91%), Gaps = 3/201 (1%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            TIKLWNTLGECKYTIQ+ + H +WVSCVRFSP+TLQPTIVS SWD+TVKVWNL+NCKLRS
Sbjct  129  TIKLWNTLGECKYTIQEAESHTDWVSCVRFSPNTLQPTIVSASWDKTVKVWNLTNCKLRS  188

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
            TLAGH GYVNTVAVSPDGSLCASGGKDGVILLWDLAEGK+LYSLDAG++I+ALCFSPNRY
Sbjct  189  TLAGHGGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKRLYSLDAGAVINALCFSPNRY  248

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEG--NNTAAKNKIIFCTSLSWNAD  216
            WLCAATE SIKIWDLESK +V DL+VDLK E+E S EG     A+  K I+CTSL+W+AD
Sbjct  249  WLCAATENSIKIWDLESKLVVDDLKVDLKAEAEKS-EGTTATAASTTKKIYCTSLNWSAD  307

Query  215  GSTLFSGYTDGVIRVWGIGRY  153
            GSTLFSGYTDGVIRVWGIGRY
Sbjct  308  GSTLFSGYTDGVIRVWGIGRY  328


 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 48/186 (26%), Positives = 81/186 (44%), Gaps = 27/186 (15%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAV  528
             H + V+ +  +P      IVS S D+++ +W+L+  +      R  L GH+ +V  V +
Sbjct  14   AHTDQVTAIA-TPIDNSDMIVSSSRDKSIILWSLTKDEKTYGVARRRLTGHSHFVQDVVL  72

Query  527  SPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKI  354
            S DG    SG  DG + LWDLA G   + +      ++       NR  + A+ + +IK+
Sbjct  73   SSDGQFALSGSWDGELRLWDLATGVSARRFVGHTKDVLSVAFSIDNRQIVSASRDKTIKL  132

Query  353  WDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  180
            W+   E K  +        QE+E         +    + C   S N    T+ S   D  
Sbjct  133  WNTLGECKYTI--------QEAE---------SHTDWVSCVRFSPNTLQPTIVSASWDKT  175

Query  179  IRVWGI  162
            ++VW +
Sbjct  176  VKVWNL  181



>emb|CDY44104.1| BnaA01g13120D [Brassica napus]
 emb|CDX93686.1| BnaA06g03620D [Brassica napus]
 emb|CDX86074.1| BnaC03g55890D [Brassica napus]
Length=298

 Score =   334 bits (857),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 161/201 (80%), Positives = 180/201 (90%), Gaps = 2/201 (1%)
 Frame = -3

Query  749  TIKLWNTLGECKYTI--QDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKL  576
            TIKLWNTLGECKYTI    GDGH +WVSCVRFSP+TL PTIVSGSWD+TVKVWNL NCK+
Sbjct  98   TIKLWNTLGECKYTIGSDHGDGHKQWVSCVRFSPNTLVPTIVSGSWDQTVKVWNLQNCKI  157

Query  575  RSTLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPN  396
            R+TLAGH+GY+NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSL+AG+IIH+LCFSPN
Sbjct  158  RNTLAGHSGYLNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLEAGAIIHSLCFSPN  217

Query  395  RYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNAD  216
            RYWLCAATE SI+IWDLESKS+V DL+VDLK E+E S     T  K K+I CTSL+W+AD
Sbjct  218  RYWLCAATENSIRIWDLESKSVVEDLKVDLKAEAEKSDASVGTGNKTKVICCTSLNWSAD  277

Query  215  GSTLFSGYTDGVIRVWGIGRY  153
            GSTLF GYTDGVIRVWG+GR+
Sbjct  278  GSTLFGGYTDGVIRVWGLGRF  298



>ref|XP_009145932.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein C [Brassica rapa]
Length=325

 Score =   335 bits (858),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 157/199 (79%), Positives = 180/199 (90%), Gaps = 1/199 (1%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            TIKLWNTLGECKYTI + DGH +W+SCVRFSP+TL PTIVS SWD+TVKVWNL NCKL+S
Sbjct  128  TIKLWNTLGECKYTISEADGHKDWISCVRFSPNTLVPTIVSASWDKTVKVWNLQNCKLKS  187

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
            +LAGH+GY+NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSL+ GSIIH+LCFSPNRY
Sbjct  188  SLAGHSGYLNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLEGGSIIHSLCFSPNRY  247

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGS  210
            WLCAATE+SIKIWDLESK++V +L+VDLK E+E    G  T  + K+ +CTSL+W+ADGS
Sbjct  248  WLCAATESSIKIWDLESKTVVDELKVDLKAEAEKDG-GAGTGNQKKVNYCTSLNWSADGS  306

Query  209  TLFSGYTDGVIRVWGIGRY  153
            TLFSGYTDGV+RVWGIGRY
Sbjct  307  TLFSGYTDGVVRVWGIGRY  325



>emb|CDX92200.1| BnaA05g22070D [Brassica napus]
Length=325

 Score =   335 bits (858),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 157/199 (79%), Positives = 180/199 (90%), Gaps = 1/199 (1%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            TIKLWNTLGECKYTI + DGH +W+SCVRFSP+TL PTIVS SWD+TVKVWNL NCKL+S
Sbjct  128  TIKLWNTLGECKYTISEADGHKDWISCVRFSPNTLVPTIVSASWDKTVKVWNLQNCKLKS  187

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
            +LAGH+GY+NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSL+ GSIIH+LCFSPNRY
Sbjct  188  SLAGHSGYLNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLEGGSIIHSLCFSPNRY  247

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGS  210
            WLCAATE+SIKIWDLESK++V +L+VDLK E+E    G  T  + K+ +CTSL+W+ADGS
Sbjct  248  WLCAATESSIKIWDLESKTVVDELKVDLKAEAEKDG-GAGTGNQKKVNYCTSLNWSADGS  306

Query  209  TLFSGYTDGVIRVWGIGRY  153
            TLFSGYTDGV+RVWGIGRY
Sbjct  307  TLFSGYTDGVVRVWGIGRY  325


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 51/185 (28%), Positives = 82/185 (44%), Gaps = 27/185 (15%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVNTVAVSPDGS  513
            GH+ +V  V  S        +SGSWD  +++W+L+         GHT  V +VA S D  
Sbjct  61   GHSHFVEDVVLSSD--GQFALSGSWDGELRLWDLATGVSTRRFVGHTKDVLSVAFSVDNR  118

Query  512  LCASGGKDGVILLWD-LAEGKKLYSLDAGSI--IHALCFSPNRY---WLCAATEASIKIW  351
               S  +D  I LW+ L E K   S   G    I  + FSPN      + A+ + ++K+W
Sbjct  119  QIVSASRDRTIKLWNTLGECKYTISEADGHKDWISCVRFSPNTLVPTIVSASWDKTVKVW  178

Query  350  DLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRV  171
            +L+          + K +S ++             +  +++ + DGS   SG  DGVI +
Sbjct  179  NLQ----------NCKLKSSLAGHSG---------YLNTVAVSPDGSLCASGGKDGVILL  219

Query  170  WGIGR  156
            W +  
Sbjct  220  WDLAE  224


 Score = 49.7 bits (117),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 50/208 (24%), Positives = 87/208 (42%), Gaps = 32/208 (15%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAV  528
             H + V+ +  +P      IV+ S D+++ +W L+         +  L GH+ +V  V +
Sbjct  13   AHTDMVTAIA-TPIDNSDIIVTSSRDKSIILWKLTKDDKSYGVAQRRLTGHSHFVEDVVL  71

Query  527  SPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKI  354
            S DG    SG  DG + LWDLA G   + +      ++       NR  + A+ + +IK+
Sbjct  72   SSDGQFALSGSWDGELRLWDLATGVSTRRFVGHTKDVLSVAFSVDNRQIVSASRDRTIKL  131

Query  353  WDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  180
            W+   E K  + +            A+G+        I C   S N    T+ S   D  
Sbjct  132  WNTLGECKYTISE------------ADGH-----KDWISCVRFSPNTLVPTIVSASWDKT  174

Query  179  IRVWGIGRY*MEEFRRSHMIIGHVCYLS  96
            ++VW      ++  +    + GH  YL+
Sbjct  175  VKVWN-----LQNCKLKSSLAGHSGYLN  197



>emb|CDX95784.1| BnaC05g35350D [Brassica napus]
Length=325

 Score =   333 bits (854),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 157/199 (79%), Positives = 179/199 (90%), Gaps = 1/199 (1%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            TIKLWNTLGECKYTI + DGH +W+SCVRFSP+TL PTIVS SWD+TVKVWNL NCKL+S
Sbjct  128  TIKLWNTLGECKYTISEADGHKDWISCVRFSPNTLVPTIVSASWDKTVKVWNLQNCKLKS  187

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
            +LAGH GY+NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSL+ GSIIH+LCFSPNRY
Sbjct  188  SLAGHLGYLNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLEGGSIIHSLCFSPNRY  247

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGS  210
            WLCAATE+SIKIWDLESK++V +L+VDLK E+E    G  T  + K+ +CTSL+W+ADGS
Sbjct  248  WLCAATESSIKIWDLESKTVVDELKVDLKAEAEKDG-GAGTGNQKKVNYCTSLNWSADGS  306

Query  209  TLFSGYTDGVIRVWGIGRY  153
            TLFSGYTDGV+RVWGIGRY
Sbjct  307  TLFSGYTDGVVRVWGIGRY  325


 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 51/185 (28%), Positives = 83/185 (45%), Gaps = 27/185 (15%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVNTVAVSPDGS  513
            GH+ +V  V  S        +SGSWD  +++W+L+         GHT  V +VA S D  
Sbjct  61   GHSHFVEDVVLSSD--GQFALSGSWDGELRLWDLATGVSTRRFVGHTKDVLSVAFSVDNR  118

Query  512  LCASGGKDGVILLWD-LAEGKKLYSLDAGSI--IHALCFSPNRY---WLCAATEASIKIW  351
               S  +D  I LW+ L E K   S   G    I  + FSPN      + A+ + ++K+W
Sbjct  119  QIVSASRDRTIKLWNTLGECKYTISEADGHKDWISCVRFSPNTLVPTIVSASWDKTVKVW  178

Query  350  DLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRV  171
            +L+          + K +S ++           + +  +++ + DGS   SG  DGVI +
Sbjct  179  NLQ----------NCKLKSSLAGH---------LGYLNTVAVSPDGSLCASGGKDGVILL  219

Query  170  WGIGR  156
            W +  
Sbjct  220  WDLAE  224


 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 50/208 (24%), Positives = 88/208 (42%), Gaps = 32/208 (15%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAV  528
             H + V+ +  +P      IV+ S D+++ +W L+         +  L GH+ +V  V +
Sbjct  13   AHTDMVTAIA-TPIDNSDIIVTSSRDKSIILWKLTKDDKSYGVAQRRLTGHSHFVEDVVL  71

Query  527  SPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKI  354
            S DG    SG  DG + LWDLA G   + +      ++       NR  + A+ + +IK+
Sbjct  72   SSDGQFALSGSWDGELRLWDLATGVSTRRFVGHTKDVLSVAFSVDNRQIVSASRDRTIKL  131

Query  353  WDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  180
            W+   E K  + +            A+G+        I C   S N    T+ S   D  
Sbjct  132  WNTLGECKYTISE------------ADGH-----KDWISCVRFSPNTLVPTIVSASWDKT  174

Query  179  IRVWGIGRY*MEEFRRSHMIIGHVCYLS  96
            ++VW      ++  +    + GH+ YL+
Sbjct  175  VKVWN-----LQNCKLKSSLAGHLGYLN  197



>ref|XP_002321505.1| GTP-binding protein beta chain [Populus trichocarpa]
 gb|ABK92879.1| unknown [Populus trichocarpa]
 gb|EEF05632.1| GTP-binding protein beta chain [Populus trichocarpa]
Length=328

 Score =   333 bits (853),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 162/200 (81%), Positives = 179/200 (90%), Gaps = 1/200 (1%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            TIKLWNTLGECKYTIQ+ + H +WVSCVRFSP+TLQPTIVS SWD+TVKVWNL+NCKLRS
Sbjct  129  TIKLWNTLGECKYTIQEAESHTDWVSCVRFSPNTLQPTIVSASWDKTVKVWNLTNCKLRS  188

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
            TLAGH GYVNTVAVSPDGSLCASGGKDGVILLWDLAEGK+LYSLDAG++I+ALCFSPNRY
Sbjct  189  TLAGHGGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKRLYSLDAGAVINALCFSPNRY  248

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMS-AEGNNTAAKNKIIFCTSLSWNADG  213
            WLCAATE SIKIWDLESK +V DL+VDLK E+E S       A+  K I+CT L+W+ADG
Sbjct  249  WLCAATENSIKIWDLESKLVVDDLKVDLKAEAEKSEGTTGTAASTTKKIYCTCLNWSADG  308

Query  212  STLFSGYTDGVIRVWGIGRY  153
            STLFSGYTDGVIRVWGIGRY
Sbjct  309  STLFSGYTDGVIRVWGIGRY  328


 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 48/186 (26%), Positives = 81/186 (44%), Gaps = 27/186 (15%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAV  528
             H + V+ +  +P      IVS S D+++ +W+L+  +      R  L GH+ +V  V +
Sbjct  14   AHTDQVTAIA-TPIDNSDMIVSSSRDKSIILWSLTKDEKTYGVARRRLTGHSHFVQDVVL  72

Query  527  SPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKI  354
            S DG    SG  DG + LWDLA G   + +      ++       NR  + A+ + +IK+
Sbjct  73   SSDGQFALSGSWDGELRLWDLATGVSARRFVGHTKDVLSVAFSIDNRQIVSASRDKTIKL  132

Query  353  WDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  180
            W+   E K  +        QE+E         +    + C   S N    T+ S   D  
Sbjct  133  WNTLGECKYTI--------QEAE---------SHTDWVSCVRFSPNTLQPTIVSASWDKT  175

Query  179  IRVWGI  162
            ++VW +
Sbjct  176  VKVWNL  181



>ref|XP_011084467.1| PREDICTED: LOW QUALITY PROTEIN: guanine nucleotide-binding protein 
subunit beta-like protein [Sesamum indicum]
Length=318

 Score =   332 bits (851),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 161/200 (81%), Positives = 179/200 (90%), Gaps = 11/200 (6%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            TIKLWNTLGECKYTIQD D H++WVSCVRFSP+TLQPTIVSGSWDRTVK+WNL+NCKLRS
Sbjct  129  TIKLWNTLGECKYTIQDQDAHSDWVSCVRFSPNTLQPTIVSGSWDRTVKIWNLTNCKLRS  188

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
            TLAGH+GYVNTVAVSPDGSLCASGGKDGVI              DAGSII+ALCFSPNRY
Sbjct  189  TLAGHSGYVNTVAVSPDGSLCASGGKDGVI----------XXXXDAGSIINALCFSPNRY  238

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGN-NTAAKNKIIFCTSLSWNADG  213
            WLCAATE+SIKIWDLESKS+VVDL+VDLKQESE++ EG   T+ KNK+I+CTSL+W+ADG
Sbjct  239  WLCAATESSIKIWDLESKSVVVDLKVDLKQESELATEGTAPTSGKNKVIYCTSLNWSADG  298

Query  212  STLFSGYTDGVIRVWGIGRY  153
            STLFSGYTDGV+RVWGIGRY
Sbjct  299  STLFSGYTDGVVRVWGIGRY  318


 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 46/186 (25%), Positives = 78/186 (42%), Gaps = 27/186 (15%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAV  528
             H +WV+ +  +P      IV+ S D+++ +W L+         R  L GH+ +V  V +
Sbjct  14   AHTDWVTAIA-TPIDNSDMIVTSSRDKSIILWALTKEDKTYGVARRRLNGHSHFVQDVVL  72

Query  527  SPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKI  354
            S DG    SG  DG + LWDL  G   + +      ++       NR  + A+ + +IK+
Sbjct  73   SSDGQFALSGSWDGELRLWDLQTGVTARRFVGHTKDVLSVAFSVDNRQIVSASRDKTIKL  132

Query  353  WDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  180
            W+   E K  + D                   A +  + C   S N    T+ SG  D  
Sbjct  133  WNTLGECKYTIQD-----------------QDAHSDWVSCVRFSPNTLQPTIVSGSWDRT  175

Query  179  IRVWGI  162
            +++W +
Sbjct  176  VKIWNL  181



>ref|XP_010256121.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Nelumbo nucifera]
Length=314

 Score =   328 bits (841),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 157/199 (79%), Positives = 172/199 (86%), Gaps = 12/199 (6%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            TIKLWNTLGECKYTIQD D H  WVSCVRFSP+T QPTIVSGSWDRTVKVWNL+NCKLR 
Sbjct  128  TIKLWNTLGECKYTIQDADSHTNWVSCVRFSPNTFQPTIVSGSWDRTVKVWNLTNCKLRC  187

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
            TLAGH GYVNTVAVSPDGSLCASGGKDGV LLWDLAEGK+LYSLDAG+IIHALCFSPNRY
Sbjct  188  TLAGHGGYVNTVAVSPDGSLCASGGKDGVTLLWDLAEGKRLYSLDAGAIIHALCFSPNRY  247

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGS  210
            WLCAAT+ S+KIWDLESKSIV DL+ +  Q             KN++++CTSLSW++DGS
Sbjct  248  WLCAATQDSVKIWDLESKSIVQDLKPEATQ------------GKNQMLYCTSLSWSSDGS  295

Query  209  TLFSGYTDGVIRVWGIGRY  153
            TLF+GYTDG IRVWGIGRY
Sbjct  296  TLFTGYTDGSIRVWGIGRY  314


 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 50/186 (27%), Positives = 81/186 (44%), Gaps = 27/186 (15%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAV  528
            GH++ V+ +  +P      IVS S D++V VW+L+  +      R  L GH+ +V  V +
Sbjct  13   GHSDMVTAIA-TPIDNSDMIVSSSRDKSVLVWHLTKEEGIYGVPRRRLTGHSHFVQDVVL  71

Query  527  SPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSI-IHALCFS-PNRYWLCAATEASIKI  354
            S DG    SG  D  + LWDL  G         +  + ++ FS  NR  + A+ + +IK+
Sbjct  72   SSDGQFALSGSWDSELRLWDLNTGATTRRFVGHTKDVLSVAFSIDNRQIVSASRDRTIKL  131

Query  353  WDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  180
            W+   E K  + D                   +    + C   S N    T+ SG  D  
Sbjct  132  WNTLGECKYTIQD-----------------ADSHTNWVSCVRFSPNTFQPTIVSGSWDRT  174

Query  179  IRVWGI  162
            ++VW +
Sbjct  175  VKVWNL  180


 Score = 50.1 bits (118),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 47/185 (25%), Positives = 78/185 (42%), Gaps = 27/185 (15%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVNTVAVSPDGS  513
            GH+ +V  V  S        +SGSWD  +++W+L+         GHT  V +VA S D  
Sbjct  61   GHSHFVQDVVLSSD--GQFALSGSWDSELRLWDLNTGATTRRFVGHTKDVLSVAFSIDNR  118

Query  512  LCASGGKDGVILLWDLAEGKKLYSLDAGSI---IHALCFSPNRYW---LCAATEASIKIW  351
               S  +D  I LW+     K    DA S    +  + FSPN +    +  + + ++K+W
Sbjct  119  QIVSASRDRTIKLWNTLGECKYTIQDADSHTNWVSCVRFSPNTFQPTIVSGSWDRTVKVW  178

Query  350  DLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRV  171
            +L           + K    ++  G          +  +++ + DGS   SG  DGV  +
Sbjct  179  NL----------TNCKLRCTLAGHGG---------YVNTVAVSPDGSLCASGGKDGVTLL  219

Query  170  WGIGR  156
            W +  
Sbjct  220  WDLAE  224



>ref|XP_010243791.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Nelumbo nucifera]
Length=314

 Score =   326 bits (835),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 155/199 (78%), Positives = 171/199 (86%), Gaps = 12/199 (6%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            TIKLWNTLGECKYTIQD D H  WVSCVRFSP+T QPTIVSGSWDRTVKVWNL+NCKLR 
Sbjct  128  TIKLWNTLGECKYTIQDADSHTNWVSCVRFSPNTFQPTIVSGSWDRTVKVWNLTNCKLRC  187

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
            TL GH GYVNTVAVSPDGSLCASGGKDGV LLWDLAEGK+LYSLDAG+IIH+LCFSPNRY
Sbjct  188  TLTGHGGYVNTVAVSPDGSLCASGGKDGVTLLWDLAEGKRLYSLDAGAIIHSLCFSPNRY  247

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGS  210
            WLCAAT+ S+KIWDLESKSIV DL+ +  Q             KN++++CTSLSW++DGS
Sbjct  248  WLCAATQDSVKIWDLESKSIVQDLKPEATQ------------GKNQMLYCTSLSWSSDGS  295

Query  209  TLFSGYTDGVIRVWGIGRY  153
            TLF+GYTDG IRVWGIGRY
Sbjct  296  TLFTGYTDGAIRVWGIGRY  314


 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 48/186 (26%), Positives = 79/186 (42%), Gaps = 27/186 (15%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAV  528
            GH++ V+ +  +P      IVS S D++V VW+L+  +      R  L GH+ +V  V +
Sbjct  13   GHSDMVTAIA-TPIDNSDMIVSSSRDKSVLVWHLTKEEGTYGVPRRRLTGHSHFVQDVVL  71

Query  527  SPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKI  354
            S DG    SG  D  + LWDL  G   + +      ++       NR  + A+ + +IK+
Sbjct  72   SSDGQFALSGSWDSELRLWDLNTGVTTRRFVGHTKDVLSVAFSIDNRQIVSASRDRTIKL  131

Query  353  WDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  180
            W+   E K  + D                   +    + C   S N    T+ SG  D  
Sbjct  132  WNTLGECKYTIQD-----------------ADSHTNWVSCVRFSPNTFQPTIVSGSWDRT  174

Query  179  IRVWGI  162
            ++VW +
Sbjct  175  VKVWNL  180



>ref|XP_010916329.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein A [Elaeis guineensis]
Length=324

 Score =   325 bits (833),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 158/199 (79%), Positives = 172/199 (86%), Gaps = 12/199 (6%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            TIKLWNTLGECKYTIQD D H  WVSCVRFSP+T QPTIVSGSWDRTVKVWNL+NCKLRS
Sbjct  138  TIKLWNTLGECKYTIQDADAHTNWVSCVRFSPNTFQPTIVSGSWDRTVKVWNLTNCKLRS  197

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
            TL GH GYVN VAVSPDGSLCASGGKDGV LLWDLAEGK+LYSLDAG+II+ALCFSPNRY
Sbjct  198  TLTGHGGYVNAVAVSPDGSLCASGGKDGVTLLWDLAEGKRLYSLDAGAIIYALCFSPNRY  257

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGS  210
            WLCAAT+ S+KIWDLESKSIV     DLK E+  S        KN+I++CTSL+W+ADGS
Sbjct  258  WLCAATQDSVKIWDLESKSIV----QDLKPETPTS--------KNQILYCTSLNWSADGS  305

Query  209  TLFSGYTDGVIRVWGIGRY  153
            TLF+GYTDGVIRVWGI RY
Sbjct  306  TLFTGYTDGVIRVWGISRY  324


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 52/196 (27%), Positives = 81/196 (41%), Gaps = 37/196 (19%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKL---------------RSTLAG  558
            GH+  V+ +  +P      +VS S D++V VW+L+                   R  L G
Sbjct  13   GHSGAVTAIA-APLDNSDMVVSSSRDKSVLVWHLTKDSPAAAAGEPGGSAYGVPRRRLTG  71

Query  557  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSI-IHALCFS-PNRYWL  384
            H+ +V  V +S DG    SG  DG + LWDLA G         +  + ++ FS  NR  +
Sbjct  72   HSHFVQDVVLSSDGQFALSGSWDGELRLWDLATGATTRRFVGHTKDVLSVAFSVDNRQIV  131

Query  383  CAATEASIKIWDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGS  210
             A+ + +IK+W+   E K  + D                   A    + C   S N    
Sbjct  132  SASRDRTIKLWNTLGECKYTIQD-----------------ADAHTNWVSCVRFSPNTFQP  174

Query  209  TLFSGYTDGVIRVWGI  162
            T+ SG  D  ++VW +
Sbjct  175  TIVSGSWDRTVKVWNL  190


 Score = 50.4 bits (119),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 47/185 (25%), Positives = 79/185 (43%), Gaps = 27/185 (15%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVNTVAVSPDGS  513
            GH+ +V  V  S        +SGSWD  +++W+L+         GHT  V +VA S D  
Sbjct  71   GHSHFVQDVVLSSD--GQFALSGSWDGELRLWDLATGATTRRFVGHTKDVLSVAFSVDNR  128

Query  512  LCASGGKDGVILLWDLAEGKKLYSLDAGSI---IHALCFSPNRYW---LCAATEASIKIW  351
               S  +D  I LW+     K    DA +    +  + FSPN +    +  + + ++K+W
Sbjct  129  QIVSASRDRTIKLWNTLGECKYTIQDADAHTNWVSCVRFSPNTFQPTIVSGSWDRTVKVW  188

Query  350  DLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRV  171
            +L           + K  S ++  G          +  +++ + DGS   SG  DGV  +
Sbjct  189  NL----------TNCKLRSTLTGHGG---------YVNAVAVSPDGSLCASGGKDGVTLL  229

Query  170  WGIGR  156
            W +  
Sbjct  230  WDLAE  234



>ref|XP_010430893.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein A, partial [Camelina sativa]
Length=284

 Score =   319 bits (818),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 153/190 (81%), Positives = 170/190 (89%), Gaps = 2/190 (1%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDG--DGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKL  576
            TIKLWNTLGECKYTI +G  DGH +WVSCVRFSP+TLQPTIVS SWD+TVKVWNLSNCKL
Sbjct  61   TIKLWNTLGECKYTISEGGGDGHRDWVSCVRFSPNTLQPTIVSASWDKTVKVWNLSNCKL  120

Query  575  RSTLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPN  396
            RSTLAGHTGYV+TVAVSPDGSLCASGGKDGV+LLWDLAEGKKLYS +A S+IHALCFSPN
Sbjct  121  RSTLAGHTGYVSTVAVSPDGSLCASGGKDGVVLLWDLAEGKKLYSFEANSVIHALCFSPN  180

Query  395  RYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNAD  216
            RYWLCAATE  IKIWDLESK+IV DL+VDLK E+E +      A K K+I+CTSL+W+AD
Sbjct  181  RYWLCAATEQGIKIWDLESKTIVEDLKVDLKAEAEKADNSGPAATKRKVIYCTSLNWSAD  240

Query  215  GSTLFSGYTD  186
            GSTLFSGYT+
Sbjct  241  GSTLFSGYTE  250



>ref|XP_006837182.1| hypothetical protein AMTR_s00105p00058690 [Amborella trichopoda]
 gb|ERN00036.1| hypothetical protein AMTR_s00105p00058690 [Amborella trichopoda]
Length=314

 Score =   320 bits (821),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 153/199 (77%), Positives = 167/199 (84%), Gaps = 12/199 (6%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            TIKLWNTLGECKYTIQD D H  WVSCVRFSP+T QPTIVSGSWDRTVKVWNL+NCKLR 
Sbjct  128  TIKLWNTLGECKYTIQDQDSHTNWVSCVRFSPNTYQPTIVSGSWDRTVKVWNLTNCKLRC  187

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
            TL GH GYVN+VAVSPDGSLCASGGKDGV LLWDLAEGK+LYSL+AG IIHALCFSPNRY
Sbjct  188  TLTGHAGYVNSVAVSPDGSLCASGGKDGVTLLWDLAEGKRLYSLEAGGIIHALCFSPNRY  247

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGS  210
            WLCAATE S+KIWDLESKSIV DL+ D                KN++++CTSLSW+ DGS
Sbjct  248  WLCAATEESVKIWDLESKSIVQDLKTDAPTN------------KNQMLYCTSLSWSTDGS  295

Query  209  TLFSGYTDGVIRVWGIGRY  153
            TLF+GYTDG IRVW +GRY
Sbjct  296  TLFTGYTDGAIRVWVVGRY  314


 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 50/186 (27%), Positives = 83/186 (45%), Gaps = 27/186 (15%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAV  528
            GH++ V+ +  +P      IVS S D++V +W+L+  +      R  L GH+ +V  V +
Sbjct  13   GHSDMVTAIA-TPVDNSDVIVSSSRDKSVLLWHLTKEEGTYGVPRRRLTGHSHFVQDVVM  71

Query  527  SPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKI  354
            S DG    SG  DG + LWDL  G   + +     +++       NR  + A+ + +IK+
Sbjct  72   SSDGQFALSGSWDGELRLWDLNTGMTTRRFVGHTKNVLSVAFSIDNRQIVSASRDRTIKL  131

Query  353  WDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  180
            W+   E K  + D      Q+S               + C   S N    T+ SG  D  
Sbjct  132  WNTLGECKYTIQD------QDSH-----------TNWVSCVRFSPNTYQPTIVSGSWDRT  174

Query  179  IRVWGI  162
            ++VW +
Sbjct  175  VKVWNL  180



>ref|XP_010924141.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein A [Elaeis guineensis]
Length=323

 Score =   320 bits (821),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 154/199 (77%), Positives = 169/199 (85%), Gaps = 12/199 (6%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            TIKLWNTLGECKYTIQD D H  WVSCVRFSP+  QPTIVS SWDRTVKVWNL+NCKLRS
Sbjct  137  TIKLWNTLGECKYTIQDADAHTNWVSCVRFSPNAFQPTIVSASWDRTVKVWNLTNCKLRS  196

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
            TL GH+GYVN VAVSPDGSLCASGGKDGV LLWDLAEGK+LYSLDAG+IIH+LCFSPNRY
Sbjct  197  TLTGHSGYVNAVAVSPDGSLCASGGKDGVTLLWDLAEGKRLYSLDAGAIIHSLCFSPNRY  256

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGS  210
            WLCAAT+ S+KIWDLESKSIV     DLK E+  S        KN++++CTSLSW+ADGS
Sbjct  257  WLCAATQESVKIWDLESKSIV----QDLKPETPTS--------KNQMLYCTSLSWSADGS  304

Query  209  TLFSGYTDGVIRVWGIGRY  153
            TLF+GYTDG IRVW I RY
Sbjct  305  TLFTGYTDGTIRVWEISRY  323


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 52/195 (27%), Positives = 83/195 (43%), Gaps = 36/195 (18%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLS-NCKL-------------RSTLAGH  555
            GH++ V+ +  +P      IVS S D+++ VW+L+ +  L             R  L GH
Sbjct  13   GHSDMVTAIA-TPIDNSDMIVSSSRDKSILVWHLTKDAPLSAEGAAASSYGVPRRRLTGH  71

Query  554  TGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSI-IHALCFS-PNRYWLC  381
            + +V  V +S DG    SG  DG + LWDL  G         +  + ++ FS  NR  + 
Sbjct  72   SHFVEDVVLSSDGQFALSGSWDGELRLWDLNTGTTTRRFVGHTKDVLSVAFSIDNRQIVS  131

Query  380  AATEASIKIWDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGST  207
            A+ + +IK+W+   E K  + D                   A    + C   S NA   T
Sbjct  132  ASRDRTIKLWNTLGECKYTIQD-----------------ADAHTNWVSCVRFSPNAFQPT  174

Query  206  LFSGYTDGVIRVWGI  162
            + S   D  ++VW +
Sbjct  175  IVSASWDRTVKVWNL  189



>ref|XP_009405003.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Musa acuminata subsp. malaccensis]
Length=324

 Score =   320 bits (820),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 152/199 (76%), Positives = 171/199 (86%), Gaps = 13/199 (7%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            TIKLWNTLGECKYTIQD D H  WVSCVRFSP+  QPTIVSGSWDRT+KVWNL+NCKLRS
Sbjct  139  TIKLWNTLGECKYTIQDADAHTNWVSCVRFSPNAYQPTIVSGSWDRTIKVWNLTNCKLRS  198

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
            TLAGH+GYVNTVAVSPDGSLCASGGKDGV LLWDLAEGK+LYSLDAG+IIH+LCFSPNRY
Sbjct  199  TLAGHSGYVNTVAVSPDGSLCASGGKDGVTLLWDLAEGKRLYSLDAGAIIHSLCFSPNRY  258

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGS  210
            WLCAAT+ S+KIWDLESK+IV DL+ +             T  KN++++CTSL+W+ADGS
Sbjct  259  WLCAATQESVKIWDLESKTIVQDLKPE------------TTTTKNQMLYCTSLTWSADGS  306

Query  209  TLFSGYTDGVIRVWGIGRY  153
            TLF+GYTDG IRVW I RY
Sbjct  307  TLFTGYTDGTIRVWEI-RY  324


 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 53/197 (27%), Positives = 82/197 (42%), Gaps = 38/197 (19%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKL----------------RSTLA  561
            GH++ V+ +  +P      IVS S D++V VW+L+                    R  L 
Sbjct  13   GHSDMVTAIA-APVDNSDMIVSSSRDKSVLVWHLTKDAPAALADGSGAGSAYGVPRRRLT  71

Query  560  GHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGK--KLYSLDAGSIIHALCFSPNRYW  387
            GH+ +V  V +S DG    SG  DG + LWDL+ G   + +S     ++       NR  
Sbjct  72   GHSHFVEDVVLSSDGQFALSGSWDGDLRLWDLSTGATTRRFSGHTKDVLSVSFSVDNRQI  131

Query  386  LCAATEASIKIWDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADG  213
            + A+ + +IK+W+   E K  + D                   A    + C   S NA  
Sbjct  132  VSASRDRTIKLWNTLGECKYTIQD-----------------ADAHTNWVSCVRFSPNAYQ  174

Query  212  STLFSGYTDGVIRVWGI  162
             T+ SG  D  I+VW +
Sbjct  175  PTIVSGSWDRTIKVWNL  191


 Score = 50.1 bits (118),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 48/184 (26%), Positives = 79/184 (43%), Gaps = 27/184 (15%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVNTVAVSPDGS  513
            GH+ +V  V  S        +SGSWD  +++W+LS        +GHT  V +V+ S D  
Sbjct  72   GHSHFVEDVVLSSD--GQFALSGSWDGDLRLWDLSTGATTRRFSGHTKDVLSVSFSVDNR  129

Query  512  LCASGGKDGVILLWDLAEGKKLYSLDAGSI---IHALCFSPNRYW---LCAATEASIKIW  351
               S  +D  I LW+     K    DA +    +  + FSPN Y    +  + + +IK+W
Sbjct  130  QIVSASRDRTIKLWNTLGECKYTIQDADAHTNWVSCVRFSPNAYQPTIVSGSWDRTIKVW  189

Query  350  DLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRV  171
            +L           + K  S ++             +  +++ + DGS   SG  DGV  +
Sbjct  190  NL----------TNCKLRSTLAGHSG---------YVNTVAVSPDGSLCASGGKDGVTLL  230

Query  170  WGIG  159
            W + 
Sbjct  231  WDLA  234



>ref|XP_010495439.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein A [Camelina sativa]
Length=308

 Score =   318 bits (816),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 152/190 (80%), Positives = 170/190 (89%), Gaps = 2/190 (1%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDG--DGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKL  576
            TIKLWNTLGECKYTI +G  DGH +WVSCVRFSP+TLQPTIVS SWD+TVKVWNLSNCKL
Sbjct  85   TIKLWNTLGECKYTISEGGGDGHRDWVSCVRFSPNTLQPTIVSASWDKTVKVWNLSNCKL  144

Query  575  RSTLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPN  396
            RSTLAGHTGYV+TVAVSPDGSLCASGGKDGV+LLWDLAEGKKLYS +A S+IHALCFSPN
Sbjct  145  RSTLAGHTGYVSTVAVSPDGSLCASGGKDGVVLLWDLAEGKKLYSFEANSVIHALCFSPN  204

Query  395  RYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNAD  216
            RYWLCAATE  IKIWDLESK+IV DL+VDL+ E+E +      A K K+I+CTSL+W+AD
Sbjct  205  RYWLCAATEQGIKIWDLESKTIVEDLKVDLEAEAEKADHRGPAATKRKVIYCTSLNWSAD  264

Query  215  GSTLFSGYTD  186
            GSTLFSGYT+
Sbjct  265  GSTLFSGYTE  274



>emb|CAC09579.1| gbf1 protein [Fagus sylvatica]
Length=267

 Score =   317 bits (811),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 149/191 (78%), Positives = 171/191 (90%), Gaps = 1/191 (1%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            TIK WNTLGECK+TIQ+ D H +WVSCVRFSP+T QPTIVS SWD+T+KVW+L+NCK+++
Sbjct  75   TIKFWNTLGECKFTIQEQDAHTDWVSCVRFSPNTTQPTIVSASWDKTIKVWHLTNCKIKN  134

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
            TLAGH+GYVNTVAVSPDGSLCASGGKDGVILLWDLAEGK+LYSLDAG+IIHALCFSPNRY
Sbjct  135  TLAGHSGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKRLYSLDAGAIIHALCFSPNRY  194

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNN-TAAKNKIIFCTSLSWNADG  213
            WLCAATE SIKIWDLESKSIV DL+VDLK E+    +     + K K+I+CTSL+W+ADG
Sbjct  195  WLCAATEQSIKIWDLESKSIVEDLKVDLKTEAADKDDATTINSTKKKVIYCTSLNWSADG  254

Query  212  STLFSGYTDGV  180
            STLFSGYTDGV
Sbjct  255  STLFSGYTDGV  265



>ref|XP_009400497.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Musa acuminata subsp. malaccensis]
Length=324

 Score =   316 bits (809),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 151/199 (76%), Positives = 168/199 (84%), Gaps = 13/199 (7%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            TIKLWNTLGECKYTIQD D H  WVSCVRFSP+  QPTIVS SWDRT+KVWNL+NCKLR 
Sbjct  139  TIKLWNTLGECKYTIQDADAHTNWVSCVRFSPNAYQPTIVSASWDRTIKVWNLTNCKLRC  198

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
            TLAGH GYVNTVAVSPDGSLCASGGKDGV LLWDLAEGK+LYSLDAG+IIH+LCFSPNRY
Sbjct  199  TLAGHAGYVNTVAVSPDGSLCASGGKDGVTLLWDLAEGKRLYSLDAGAIIHSLCFSPNRY  258

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGS  210
            WLCAAT+ S+KIWDLESKSIV DL+ +             T  KN++++CTSL+W+ADGS
Sbjct  259  WLCAATQESVKIWDLESKSIVQDLKPE------------TTGTKNQMLYCTSLTWSADGS  306

Query  209  TLFSGYTDGVIRVWGIGRY  153
            TLF+GYTDG IRVW I RY
Sbjct  307  TLFTGYTDGTIRVWEI-RY  324


 Score = 53.5 bits (127),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 51/197 (26%), Positives = 80/197 (41%), Gaps = 38/197 (19%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKL----------------RSTLA  561
            GH + V+ +  +P      IVS S D++V VW+L+                    +  L 
Sbjct  13   GHTDMVTAIA-APIDNSDMIVSSSRDKSVLVWHLTKDAPSASGDGTATGSSYGVPKRRLT  71

Query  560  GHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYW  387
            GH+ +V  V +S DG    SG  DG + LWDL+ G   + +S     ++       NR  
Sbjct  72   GHSHFVQDVVLSSDGQFALSGSWDGDLRLWDLSTGVTTRRFSGHTKDVLSVAFSIDNRQI  131

Query  386  LCAATEASIKIWDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADG  213
            + A+ + +IK+W+   E K  + D                   A    + C   S NA  
Sbjct  132  VSASRDRTIKLWNTLGECKYTIQD-----------------ADAHTNWVSCVRFSPNAYQ  174

Query  212  STLFSGYTDGVIRVWGI  162
             T+ S   D  I+VW +
Sbjct  175  PTIVSASWDRTIKVWNL  191


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 51/184 (28%), Positives = 80/184 (43%), Gaps = 27/184 (15%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVNTVAVSPDGS  513
            GH+ +V  V  S        +SGSWD  +++W+LS        +GHT  V +VA S D  
Sbjct  72   GHSHFVQDVVLSSD--GQFALSGSWDGDLRLWDLSTGVTTRRFSGHTKDVLSVAFSIDNR  129

Query  512  LCASGGKDGVILLWDLAEGKKLYSLDAGSI---IHALCFSPNRYW---LCAATEASIKIW  351
               S  +D  I LW+     K    DA +    +  + FSPN Y    + A+ + +IK+W
Sbjct  130  QIVSASRDRTIKLWNTLGECKYTIQDADAHTNWVSCVRFSPNAYQPTIVSASWDRTIKVW  189

Query  350  DLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRV  171
            +L +      LR  L   +                +  +++ + DGS   SG  DGV  +
Sbjct  190  NLTN----CKLRCTLAGHAG---------------YVNTVAVSPDGSLCASGGKDGVTLL  230

Query  170  WGIG  159
            W + 
Sbjct  231  WDLA  234



>ref|XP_008803271.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein A [Phoenix dactylifera]
Length=323

 Score =   315 bits (807),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 152/199 (76%), Positives = 168/199 (84%), Gaps = 12/199 (6%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            TI+LWNTLGECKYTIQD D H  WVSCVRFSP+  QPTIVS SWDRTVKVWNL+NCKLR 
Sbjct  137  TIRLWNTLGECKYTIQDADAHTNWVSCVRFSPNAYQPTIVSASWDRTVKVWNLTNCKLRC  196

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
            TL GH GYVN VAVSPDGSLCASGGKDGV LLWDLAEGK+LYSLDAG+IIH+LCFSPNRY
Sbjct  197  TLTGHGGYVNAVAVSPDGSLCASGGKDGVTLLWDLAEGKRLYSLDAGAIIHSLCFSPNRY  256

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGS  210
            WLCAAT+ S+KIWDLESKSIV     DLK E+ +S        KN++++CTSLSW+ADGS
Sbjct  257  WLCAATQDSVKIWDLESKSIV----QDLKPETPIS--------KNQMLYCTSLSWSADGS  304

Query  209  TLFSGYTDGVIRVWGIGRY  153
            TLF+GYTDG IRVW I RY
Sbjct  305  TLFTGYTDGTIRVWEITRY  323


 Score = 53.5 bits (127),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 50/195 (26%), Positives = 81/195 (42%), Gaps = 36/195 (18%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLS-NCKL-------------RSTLAGH  555
            GH++ V+ +  +P      IVS S D+++ VWNL+ +  L             R  L GH
Sbjct  13   GHSDMVTAIA-APIDNSDMIVSSSRDKSILVWNLTKDAPLSAEGAAASSYGVPRRRLTGH  71

Query  554  TGYVNTVAVSPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLC  381
            + +V  V +S DG    SG  DG + LWDL  G   + +      ++       NR  + 
Sbjct  72   SHFVEDVVLSSDGQFALSGAWDGELRLWDLNTGITTRRFVGHTKDVLSVAFSIDNRQIVS  131

Query  380  AATEASIKIWDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGST  207
            A+ + +I++W+   E K  + D                   A    + C   S NA   T
Sbjct  132  ASRDRTIRLWNTLGECKYTIQD-----------------ADAHTNWVSCVRFSPNAYQPT  174

Query  206  LFSGYTDGVIRVWGI  162
            + S   D  ++VW +
Sbjct  175  IVSASWDRTVKVWNL  189


 Score = 49.7 bits (117),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 47/184 (26%), Positives = 79/184 (43%), Gaps = 27/184 (15%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVNTVAVSPDGS  513
            GH+ +V  V  S        +SG+WD  +++W+L+         GHT  V +VA S D  
Sbjct  70   GHSHFVEDVVLSSD--GQFALSGAWDGELRLWDLNTGITTRRFVGHTKDVLSVAFSIDNR  127

Query  512  LCASGGKDGVILLWDLAEGKKLYSLDAGSI---IHALCFSPNRYW---LCAATEASIKIW  351
               S  +D  I LW+     K    DA +    +  + FSPN Y    + A+ + ++K+W
Sbjct  128  QIVSASRDRTIRLWNTLGECKYTIQDADAHTNWVSCVRFSPNAYQPTIVSASWDRTVKVW  187

Query  350  DLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRV  171
            +L           + K    ++  G          +  +++ + DGS   SG  DGV  +
Sbjct  188  NL----------TNCKLRCTLTGHGG---------YVNAVAVSPDGSLCASGGKDGVTLL  228

Query  170  WGIG  159
            W + 
Sbjct  229  WDLA  232



>ref|XP_010923802.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein A [Elaeis guineensis]
Length=323

 Score =   315 bits (807),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 152/199 (76%), Positives = 168/199 (84%), Gaps = 12/199 (6%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            TIKLWNTLGECKYTIQD D H  WVSCVRFSP+  QPTIVSGSWDRTVKVWNL+NCKLR 
Sbjct  137  TIKLWNTLGECKYTIQDADAHTNWVSCVRFSPNAYQPTIVSGSWDRTVKVWNLTNCKLRC  196

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
            TL GH GYVN VAVSPDGSLCASGGKDG+ LLWDLAEGK+LYSLDAG+II+ALCFSPNRY
Sbjct  197  TLTGHGGYVNAVAVSPDGSLCASGGKDGITLLWDLAEGKRLYSLDAGAIIYALCFSPNRY  256

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGS  210
            WLCAAT+ S+KIWDLESKSIV     DLK E+  S        KN++++CTSLSW+ADGS
Sbjct  257  WLCAATQDSVKIWDLESKSIV----QDLKPETPTS--------KNQMLYCTSLSWSADGS  304

Query  209  TLFSGYTDGVIRVWGIGRY  153
            TLF+GYTDG IRVW + RY
Sbjct  305  TLFTGYTDGTIRVWEVSRY  323


 Score = 53.9 bits (128),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 52/195 (27%), Positives = 80/195 (41%), Gaps = 36/195 (18%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLS-NCKL-------------RSTLAGH  555
            GH + V+ +  +P      IVS S D++V VWNL+ +  L             R  L GH
Sbjct  13   GHTDVVTAIA-TPIDNSDMIVSSSRDKSVLVWNLTKDAPLSSEGAGASSYGVPRRRLTGH  71

Query  554  TGYVNTVAVSPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLC  381
            + +V  V +S DG    SG  D  + LWDL  G   + +      ++       NR  + 
Sbjct  72   SHFVEDVVLSSDGQFALSGSWDSELRLWDLNTGVTTRRFVGHTKDVLSVAFSVDNRQIVS  131

Query  380  AATEASIKIWDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGST  207
            A+ + +IK+W+   E K  + D                   A    + C   S NA   T
Sbjct  132  ASRDRTIKLWNTLGECKYTIQD-----------------ADAHTNWVSCVRFSPNAYQPT  174

Query  206  LFSGYTDGVIRVWGI  162
            + SG  D  ++VW +
Sbjct  175  IVSGSWDRTVKVWNL  189



>gb|AFV60006.1| heterotrimeric guanine nucleotide-binding protein subunit beta 
[Eschscholzia californica]
Length=313

 Score =   313 bits (802),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 149/198 (75%), Positives = 168/198 (85%), Gaps = 12/198 (6%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            +IKLWNTLGECKYTIQD D H  WVSCVRFSP+TLQPTIVSG WDRTVKVWNL+NCKLRS
Sbjct  128  SIKLWNTLGECKYTIQDADSHTNWVSCVRFSPNTLQPTIVSGFWDRTVKVWNLTNCKLRS  187

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
            TLAGH GYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSL AG IIHALCFSPNRY
Sbjct  188  TLAGHGGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLPAGHIIHALCFSPNRY  247

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGS  210
            WLCAAT+  I+IWDLESKS+V +L+ ++ Q             KNK+ +CTSL+W++DGS
Sbjct  248  WLCAATQGDIQIWDLESKSLVQELKPEVTQ------------GKNKMFYCTSLNWSSDGS  295

Query  209  TLFSGYTDGVIRVWGIGR  156
            TLF+G+TDG IRV+ + R
Sbjct  296  TLFTGFTDGTIRVYAVSR  313


 Score = 59.3 bits (142),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 51/186 (27%), Positives = 82/186 (44%), Gaps = 27/186 (15%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKL-----RSTLAGHTGYVNTVAV  528
            GH++ V+ +  +P      IVS S D+++ VW+L+         R  L GH+ +V  V +
Sbjct  13   GHDDMVTAIA-TPIDNSDMIVSSSRDKSILVWHLTKEDPTYGVPRRRLTGHSHFVQDVVL  71

Query  527  SPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSI-IHALCFS-PNRYWLCAATEASIKI  354
            S DG    SG  DG + LWDL  G         +  + ++ FS  NR  + A+ + SIK+
Sbjct  72   SSDGQFALSGAWDGELRLWDLNTGTTTRRFVGHTKDVLSVAFSIDNRQIVSASRDRSIKL  131

Query  353  WDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  180
            W+   E K  + D                   +    + C   S N    T+ SG+ D  
Sbjct  132  WNTLGECKYTIQD-----------------ADSHTNWVSCVRFSPNTLQPTIVSGFWDRT  174

Query  179  IRVWGI  162
            ++VW +
Sbjct  175  VKVWNL  180


 Score = 50.1 bits (118),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 51/203 (25%), Positives = 85/203 (42%), Gaps = 31/203 (15%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVNTVAVSPDGS  513
            GH+ +V  V  S        +SG+WD  +++W+L+         GHT  V +VA S D  
Sbjct  61   GHSHFVQDVVLSSD--GQFALSGAWDGELRLWDLNTGTTTRRFVGHTKDVLSVAFSIDNR  118

Query  512  LCASGGKDGVILLWDLAEGKKLYSLDAGSI---IHALCFSPNRYWLCAAT---EASIKIW  351
               S  +D  I LW+     K    DA S    +  + FSPN       +   + ++K+W
Sbjct  119  QIVSASRDRSIKLWNTLGECKYTIQDADSHTNWVSCVRFSPNTLQPTIVSGFWDRTVKVW  178

Query  350  DLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRV  171
            +L           + K  S ++  G          +  +++ + DGS   SG  DGVI +
Sbjct  179  NL----------TNCKLRSTLAGHGG---------YVNTVAVSPDGSLCASGGKDGVILL  219

Query  170  WGIGRY*MEEFRRSHMIIGHVCY  102
            W +     E  +   +  GH+ +
Sbjct  220  WDLA----EGKKLYSLPAGHIIH  238



>ref|XP_009380503.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein A [Musa acuminata subsp. malaccensis]
Length=323

 Score =   313 bits (803),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 151/199 (76%), Positives = 169/199 (85%), Gaps = 13/199 (7%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            TIKLWNTLGECKYTIQD D H  WVSCVRFSP+  QPTIVSGSWDRTVKVWNL+NCKLR 
Sbjct  138  TIKLWNTLGECKYTIQDADAHTNWVSCVRFSPNAYQPTIVSGSWDRTVKVWNLTNCKLRC  197

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
            TLAGH G VNTVAVSPDGSLCASGGKDGV LLWDLAEGK+LYSLDAG+IIH+LCFSPNRY
Sbjct  198  TLAGHAGSVNTVAVSPDGSLCASGGKDGVTLLWDLAEGKRLYSLDAGAIIHSLCFSPNRY  257

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGS  210
            WLCAAT+ S+KIWDLESKSIV DL+ ++            T  KN++++CTSL+W+A+GS
Sbjct  258  WLCAATQESVKIWDLESKSIVQDLKPEI------------TTTKNQMLYCTSLTWSANGS  305

Query  209  TLFSGYTDGVIRVWGIGRY  153
            TLF+GYTDG IRVW I RY
Sbjct  306  TLFTGYTDGTIRVWEI-RY  323


 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 53/198 (27%), Positives = 84/198 (42%), Gaps = 41/198 (21%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKL---------------RSTLAG  558
            GH + V+ +  +P      IVS S D++V VW+L+                   R  L G
Sbjct  13   GHTDMVTAIA-APIDNSDMIVSSSRDKSVLVWHLTKDAPAASADGSGVGSYGVPRRRLTG  71

Query  557  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEG---KKLYSLDAGSIIHALCFS-PNRY  390
            H+ +V  V +S DG    SG  DG + LWDL+ G   ++ +       + ++ FS  NR 
Sbjct  72   HSHFVQDVVLSSDGQFALSGSWDGDLRLWDLSTGVTTRRFFGHTKD--VLSVAFSIDNRQ  129

Query  389  WLCAATEASIKIWDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNAD  216
             + A+ + +IK+W+   E K  + D                   A    + C   S NA 
Sbjct  130  IVSASRDGTIKLWNTLGECKYTIQD-----------------ADAHTNWVSCVRFSPNAY  172

Query  215  GSTLFSGYTDGVIRVWGI  162
              T+ SG  D  ++VW +
Sbjct  173  QPTIVSGSWDRTVKVWNL  190


 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 54/184 (29%), Positives = 78/184 (42%), Gaps = 27/184 (15%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVNTVAVSPDGS  513
            GH+ +V  V  S        +SGSWD  +++W+LS         GHT  V +VA S D  
Sbjct  71   GHSHFVQDVVLSSD--GQFALSGSWDGDLRLWDLSTGVTTRRFFGHTKDVLSVAFSIDNR  128

Query  512  LCASGGKDGVILLWDLAEGKKLYSLDAGSI---IHALCFSPNRYW---LCAATEASIKIW  351
               S  +DG I LW+     K    DA +    +  + FSPN Y    +  + + ++K+W
Sbjct  129  QIVSASRDGTIKLWNTLGECKYTIQDADAHTNWVSCVRFSPNAYQPTIVSGSWDRTVKVW  188

Query  350  DLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRV  171
            +L +      LR  L       A   NT A +            DGS   SG  DGV  +
Sbjct  189  NLTN----CKLRCTLAGH----AGSVNTVAVSP-----------DGSLCASGGKDGVTLL  229

Query  170  WGIG  159
            W + 
Sbjct  230  WDLA  233



>ref|XP_004252271.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein isoform X2 [Solanum lycopersicum]
Length=301

 Score =   310 bits (793),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 146/173 (84%), Positives = 158/173 (91%), Gaps = 0/173 (0%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            +IKLWNTLGECKYTIQD D H++WVSCVRFSP+ LQPTIVSGSWDRTVK+WNLSNCKLR+
Sbjct  129  SIKLWNTLGECKYTIQDQDSHSDWVSCVRFSPNNLQPTIVSGSWDRTVKIWNLSNCKLRA  188

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
            TLAGHTGYVNT AVSPDGSLCASGGKDGVILLWDLAEGKKLYSLD+GSIIHALCFSPNRY
Sbjct  189  TLAGHTGYVNTAAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDSGSIIHALCFSPNRY  248

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSL  231
            WLCAATE+SIKIWDLESKSIVVDLRVDLKQE+EMS    +T+  +K  F  S 
Sbjct  249  WLCAATESSIKIWDLESKSIVVDLRVDLKQETEMSGNATSTSGNSKTKFLASF  301


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 51/186 (27%), Positives = 82/186 (44%), Gaps = 27/186 (15%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSN-----CKLRSTLAGHTGYVNTVAV  528
             H +WV+ +  +P      IV+ S D+++ VW+L+         R  L GH  +V  V +
Sbjct  14   AHTDWVTAIA-TPIDNSDMIVTSSRDKSIIVWSLTKEGSQYGVPRRRLTGHGHFVQDVVL  72

Query  527  SPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSI-IHALCFS-PNRYWLCAATEASIKI  354
            S DG    SG  DG + LWDL  G         +  + ++ FS  NR  + A+ + SIK+
Sbjct  73   SSDGMFALSGSWDGELRLWDLQAGTTARRFVGHTKDVLSVAFSVDNRQIVSASRDKSIKL  132

Query  353  WDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  180
            W+   E K  + D      Q+S            +  + C   S N    T+ SG  D  
Sbjct  133  WNTLGECKYTIQD------QDSH-----------SDWVSCVRFSPNNLQPTIVSGSWDRT  175

Query  179  IRVWGI  162
            +++W +
Sbjct  176  VKIWNL  181



>gb|ABK25010.1| unknown [Picea sitchensis]
 gb|ACN41136.1| unknown [Picea sitchensis]
Length=321

 Score =   308 bits (790),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 145/198 (73%), Positives = 167/198 (84%), Gaps = 11/198 (6%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            +IKLWNTLGECKYTIQD D H+ WVSCVRFSPST+ P IVSGSWDRTVKVWNL+NCKLR+
Sbjct  134  SIKLWNTLGECKYTIQDADAHSNWVSCVRFSPSTVNPMIVSGSWDRTVKVWNLANCKLRT  193

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
            TL GH+GY+NT  VSPDGSLCASGGKDGV +LWDLAEGK+LYSLD+G II++LCFSPNRY
Sbjct  194  TLTGHSGYINTCTVSPDGSLCASGGKDGVAMLWDLAEGKRLYSLDSGDIINSLCFSPNRY  253

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGS  210
            WLCAAT+  +KIWDLESKS+V +LR +            N   K ++ FCTSL+W+ADGS
Sbjct  254  WLCAATQQCVKIWDLESKSVVEELRPNF-----------NPTKKGQVPFCTSLAWSADGS  302

Query  209  TLFSGYTDGVIRVWGIGR  156
            TLFSGYTDGVIRVWG+GR
Sbjct  303  TLFSGYTDGVIRVWGVGR  320


 Score = 56.2 bits (134),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 46/193 (24%), Positives = 82/193 (42%), Gaps = 33/193 (17%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKL-----------RSTLAGHTGY  546
            GH+ WV+ +  +P      I+SGS D+++ VW+L+               +  L GH+ +
Sbjct  13   GHDNWVTSIA-TPIDNSDMIISGSRDKSILVWHLTKETTGGEEGGTYGVAKRRLTGHSHF  71

Query  545  VNTVAVSPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAAT  372
            ++ V +S DG    SG  D  + LWDL  G   + +   +  ++     + NR  + A+ 
Sbjct  72   IHDVVISSDGQFALSGSWDATLRLWDLNVGITTRRFVGHSKDVLSVAFSADNRQIVSASR  131

Query  371  EASIKIWDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFS  198
            + SIK+W+   E K  + D                   A +  + C   S +     + S
Sbjct  132  DRSIKLWNTLGECKYTIQD-----------------ADAHSNWVSCVRFSPSTVNPMIVS  174

Query  197  GYTDGVIRVWGIG  159
            G  D  ++VW + 
Sbjct  175  GSWDRTVKVWNLA  187



>gb|ACN41093.1| unknown [Picea sitchensis]
Length=321

 Score =   308 bits (790),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 145/198 (73%), Positives = 166/198 (84%), Gaps = 11/198 (6%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            +IKLWNTLGECKYTIQD D H  WVSCVRFSPST+ P IVSGSWDRTVKVWNL+NCKLR+
Sbjct  134  SIKLWNTLGECKYTIQDADAHTNWVSCVRFSPSTVNPMIVSGSWDRTVKVWNLANCKLRT  193

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
            TL GH+GY+NT  VSPDGSLCASGGKDGV +LWDLAEGK+LYSLD+G II++LCFSPNRY
Sbjct  194  TLTGHSGYINTCTVSPDGSLCASGGKDGVAMLWDLAEGKRLYSLDSGDIINSLCFSPNRY  253

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGS  210
            WLCAAT+  +KIWDLESKS+V +LR +            N   K ++ FCTSL+W+ADGS
Sbjct  254  WLCAATQQCVKIWDLESKSVVEELRPNF-----------NPTKKGQVPFCTSLAWSADGS  302

Query  209  TLFSGYTDGVIRVWGIGR  156
            TLFSGYTDGVIRVWG+GR
Sbjct  303  TLFSGYTDGVIRVWGVGR  320


 Score = 56.2 bits (134),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 46/193 (24%), Positives = 81/193 (42%), Gaps = 33/193 (17%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKL-----------RSTLAGHTGY  546
            GH+ WV+ +  +P      I+SGS D+++ VW+L+               +  L GH+ +
Sbjct  13   GHDNWVTSIA-TPIDNSDMIISGSRDKSILVWHLTKETTGGEEGGTYGVAKRRLTGHSHF  71

Query  545  VNTVAVSPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAAT  372
            ++ V +S DG    SG  D  + LWDL  G   + +   +  ++     + NR  + A+ 
Sbjct  72   IHDVVISSDGQFALSGSWDATLRLWDLNVGITTRRFVGHSKDVLSVAFSADNRQIVSASR  131

Query  371  EASIKIWDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFS  198
            + SIK+W+   E K  + D                   A    + C   S +     + S
Sbjct  132  DRSIKLWNTLGECKYTIQD-----------------ADAHTNWVSCVRFSPSTVNPMIVS  174

Query  197  GYTDGVIRVWGIG  159
            G  D  ++VW + 
Sbjct  175  GSWDRTVKVWNLA  187



>ref|XP_008812615.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein A [Phoenix dactylifera]
Length=331

 Score =   308 bits (789),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 152/207 (73%), Positives = 169/207 (82%), Gaps = 20/207 (10%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEW--------VSCVRFSPSTLQPTIVSGSWDRTVKVWN  594
            TIKLWNTLGECKYTIQD DGH  W        VSCVRFSP+  QP IVSGSWDRTVKVWN
Sbjct  137  TIKLWNTLGECKYTIQDADGHTNWDADGHTNWVSCVRFSPNAFQPIIVSGSWDRTVKVWN  196

Query  593  LSNCKLRSTLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHA  414
            L+NCKLR TLAGH GYV+ VAVSPDGSLCASGGKDG+ LLWDLAEGK+LYSLDAG+IIHA
Sbjct  197  LTNCKLRCTLAGHGGYVSAVAVSPDGSLCASGGKDGITLLWDLAEGKRLYSLDAGAIIHA  256

Query  413  LCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTS  234
            LCFSPNRYWLCAAT+ S+KIWDLE+KSIV     DLK E+  S        KN++++CTS
Sbjct  257  LCFSPNRYWLCAATQDSVKIWDLENKSIV----QDLKPETPTS--------KNQMLYCTS  304

Query  233  LSWNADGSTLFSGYTDGVIRVWGIGRY  153
            LSW+ADGSTLF+GYTDG IRVW + RY
Sbjct  305  LSWSADGSTLFTGYTDGTIRVWEVSRY  331


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 51/195 (26%), Positives = 84/195 (43%), Gaps = 28/195 (14%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRST--------------LAGH  555
            GH++ V+ +  +P      IVS S D+++ VW+L+     ST              L GH
Sbjct  13   GHSDVVTGIA-TPIDNSDMIVSSSRDKSILVWHLTKDAPLSTDGAAASSYGVPRRRLTGH  71

Query  554  TGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGK--KLYSLDAGSIIHALCFSPNRYWLC  381
            + +V  V +S DG    SG  DG + LWDL  G   + +      ++       NR  + 
Sbjct  72   SHFVEDVVLSSDGQFALSGSWDGELRLWDLNTGATTRRFVGHTKDVLSVAFSVDNRQIVS  131

Query  380  AATEASIKIWDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGST  207
            A+ + +IK+W+   E K  +     D    +   A+G+        + C   S NA    
Sbjct  132  ASRDRTIKLWNTLGECKYTI----QDADGHTNWDADGH-----TNWVSCVRFSPNAFQPI  182

Query  206  LFSGYTDGVIRVWGI  162
            + SG  D  ++VW +
Sbjct  183  IVSGSWDRTVKVWNL  197



>gb|ABK26798.1| unknown [Picea sitchensis]
 gb|ACN40746.1| unknown [Picea sitchensis]
 gb|ACN40912.1| unknown [Picea sitchensis]
Length=316

 Score =   304 bits (779),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 150/199 (75%), Positives = 163/199 (82%), Gaps = 12/199 (6%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQ-DGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLR  573
            TIKLWNTLGECKYTIQ D +GH+ W+SCVRFSPS   PTIVS SWDRTVKVWNL+NCKLR
Sbjct  128  TIKLWNTLGECKYTIQPDAEGHSNWISCVRFSPSATNPTIVSCSWDRTVKVWNLTNCKLR  187

Query  572  STLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNR  393
            +TL GH GYVNT AVSPDGSLCASGGKDGV +LWDLAEGK+LYSLDAG II+ALCFSPNR
Sbjct  188  NTLVGHGGYVNTAAVSPDGSLCASGGKDGVTMLWDLAEGKRLYSLDAGDIIYALCFSPNR  247

Query  392  YWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADG  213
            YWLCAAT+  +KIWDLESKSIV DLR D                K +I +CTSLSW+ADG
Sbjct  248  YWLCAATQQCVKIWDLESKSIVADLRPDFIPNK-----------KAQIPYCTSLSWSADG  296

Query  212  STLFSGYTDGVIRVWGIGR  156
            STLFSGYTDG IRVWGIG 
Sbjct  297  STLFSGYTDGKIRVWGIGH  315


 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 51/207 (25%), Positives = 90/207 (43%), Gaps = 27/207 (13%)
 Frame = -3

Query  695  DGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVA  531
            +GH + V+ +  +P      IVS S D+++ +WNL+         R  L GH+ +V  V 
Sbjct  12   EGHTDAVTAIA-TPIDNSDMIVSSSRDKSILLWNLTKEPEKYGVPRRRLTGHSHFVQDVV  70

Query  530  VSPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIK  357
            +S DG    SG  D  + LWDL  G   + +      ++       NR  + A+ + +IK
Sbjct  71   ISSDGQFALSGSWDSELRLWDLNTGLTTRRFVGHTKDVLSVAFSIDNRQIVSASRDRTIK  130

Query  356  IWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVI  177
            +W+            + K   +  AEG+     +  I C   S +A   T+ S   D  +
Sbjct  131  LWNTLG---------ECKYTIQPDAEGH-----SNWISCVRFSPSATNPTIVSCSWDRTV  176

Query  176  RVWGIGRY*MEEFRRSHMIIGHVCYLS  96
            +VW      +   +  + ++GH  Y++
Sbjct  177  KVWN-----LTNCKLRNTLVGHGGYVN  198



>ref|NP_001136800.1| guanine nucleotide-binding protein beta subunit-like protein 
[Zea mays]
 gb|ACF82664.1| unknown [Zea mays]
 gb|ACG34796.1| guanine nucleotide-binding protein beta subunit-like protein 
[Zea mays]
 gb|AFW81011.1| guanine nucleotide-binding protein beta subunit-like protein 
[Zea mays]
Length=334

 Score =   301 bits (772),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 150/203 (74%), Positives = 167/203 (82%), Gaps = 16/203 (8%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDG----HNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNC  582
            TIKLWNTLGECKYTI    G    HN WVSCVRFSP+T QPTIVSGSWDRTVKVWNL+NC
Sbjct  140  TIKLWNTLGECKYTIGGDLGGGEGHNGWVSCVRFSPNTFQPTIVSGSWDRTVKVWNLTNC  199

Query  581  KLRSTLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFS  402
            KLR TL GH GYVN VAVSPDGSLCASGGKDGV LLWDLAEGK+LYSLDAGSIIH+LCFS
Sbjct  200  KLRCTLDGHGGYVNAVAVSPDGSLCASGGKDGVTLLWDLAEGKRLYSLDAGSIIHSLCFS  259

Query  401  PNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWN  222
            PNRYWLCAAT+ S+KIWDLESK +V DL+ D++             +KN+I++CTSLSW+
Sbjct  260  PNRYWLCAATQDSVKIWDLESKHVVQDLKPDIQ------------VSKNQILYCTSLSWS  307

Query  221  ADGSTLFSGYTDGVIRVWGIGRY  153
            ADGSTL++GYTDG IRVW I  Y
Sbjct  308  ADGSTLYTGYTDGSIRVWKISGY  330


 Score = 58.9 bits (141),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 52/194 (27%), Positives = 83/194 (43%), Gaps = 30/194 (15%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRST---------------LAG  558
            GHN  V+ +  +P    P IVS S D++V VW+L+N  + ST               L G
Sbjct  16   GHNGEVTAIA-TPIDNSPFIVSSSRDKSVLVWDLTN-PVHSTPESGVTADYGVPFRRLTG  73

Query  557  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWL  384
            H+ +V  V +S DG    SG  DG + LWDL+ G   + +      +I       NR  +
Sbjct  74   HSHFVQDVVLSSDGQFALSGSWDGELRLWDLSTGLTTRRFVGHEKDVISVAFSVDNRQIV  133

Query  383  CAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTL  204
             A+ + +IK+W+   +            +  +  +       N  + C   S N    T+
Sbjct  134  SASRDKTIKLWNTLGEC-----------KYTIGGDLGGGEGHNGWVSCVRFSPNTFQPTI  182

Query  203  FSGYTDGVIRVWGI  162
             SG  D  ++VW +
Sbjct  183  VSGSWDRTVKVWNL  196



>gb|ACL54313.1| unknown [Zea mays]
Length=334

 Score =   301 bits (772),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 150/203 (74%), Positives = 167/203 (82%), Gaps = 16/203 (8%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDG----HNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNC  582
            TIKLWNTLGECKYTI    G    HN WVSCVRFSP+T QPTIVSGSWDRTVKVWNL+NC
Sbjct  140  TIKLWNTLGECKYTIGGDLGGGEGHNGWVSCVRFSPNTFQPTIVSGSWDRTVKVWNLTNC  199

Query  581  KLRSTLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFS  402
            KLR TL GH GYVN VAVSPDGSLCASGGKDGV LLWDLAEGK+LYSLDAGSIIH+LCFS
Sbjct  200  KLRCTLDGHGGYVNAVAVSPDGSLCASGGKDGVTLLWDLAEGKRLYSLDAGSIIHSLCFS  259

Query  401  PNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWN  222
            PNRYWLCAAT+ S+KIWDLESK +V DL+ D++             +KN+I++CTSLSW+
Sbjct  260  PNRYWLCAATQDSVKIWDLESKHVVQDLKPDIQ------------ISKNQILYCTSLSWS  307

Query  221  ADGSTLFSGYTDGVIRVWGIGRY  153
            ADGSTL++GYTDG IRVW I  Y
Sbjct  308  ADGSTLYTGYTDGSIRVWKISGY  330


 Score = 56.6 bits (135),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 50/194 (26%), Positives = 83/194 (43%), Gaps = 30/194 (15%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRST---------------LAG  558
            GHN  V+ +  +P    P IVS S D+++ VW+L+N  + ST               L G
Sbjct  16   GHNGEVTTIA-TPIDNSPFIVSSSRDKSLLVWDLTN-PVHSTPESGATADYGVPFRRLTG  73

Query  557  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWL  384
            H+ +V  V +S DG    SG  DG + LWDL+ G   + +      ++       NR  +
Sbjct  74   HSHFVQDVVLSSDGQFALSGSWDGELRLWDLSTGLTTRRFVGHEKDVLSVAFSVDNRQIV  133

Query  383  CAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTL  204
             A+ + +IK+W+   +            +  +  +       N  + C   S N    T+
Sbjct  134  SASRDKTIKLWNTLGEC-----------KYTIGGDLGGGEGHNGWVSCVRFSPNTFQPTI  182

Query  203  FSGYTDGVIRVWGI  162
             SG  D  ++VW +
Sbjct  183  VSGSWDRTVKVWNL  196



>ref|NP_001146976.1| LOC100280585 [Zea mays]
 gb|ACG24854.1| guanine nucleotide-binding protein beta subunit-like protein 
[Zea mays]
 gb|AFW79043.1| guanine nucleotide-binding protein beta subunit-like protein 
[Zea mays]
Length=334

 Score =   301 bits (771),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 150/203 (74%), Positives = 167/203 (82%), Gaps = 16/203 (8%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDG----HNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNC  582
            TIKLWNTLGECKYTI    G    HN WVSCVRFSP+T QPTIVSGSWDRTVKVWNL+NC
Sbjct  140  TIKLWNTLGECKYTIGGDLGGGEGHNGWVSCVRFSPNTFQPTIVSGSWDRTVKVWNLTNC  199

Query  581  KLRSTLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFS  402
            KLR TL GH GYVN VAVSPDGSLCASGGKDGV LLWDLAEGK+LYSLDAGSIIH+LCFS
Sbjct  200  KLRCTLDGHGGYVNAVAVSPDGSLCASGGKDGVTLLWDLAEGKRLYSLDAGSIIHSLCFS  259

Query  401  PNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWN  222
            PNRYWLCAAT+ S+KIWDLESK +V DL+ D++             +KN+I++CTSLSW+
Sbjct  260  PNRYWLCAATQDSVKIWDLESKHVVQDLKPDIQ------------ISKNQILYCTSLSWS  307

Query  221  ADGSTLFSGYTDGVIRVWGIGRY  153
            ADGSTL++GYTDG IRVW I  Y
Sbjct  308  ADGSTLYTGYTDGSIRVWKISGY  330


 Score = 56.6 bits (135),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 50/194 (26%), Positives = 83/194 (43%), Gaps = 30/194 (15%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRST---------------LAG  558
            GHN  V+ +  +P    P IVS S D+++ VW+L+N  + ST               L G
Sbjct  16   GHNGEVTAIA-TPIDNSPFIVSSSRDKSLLVWDLTN-PVHSTPESGATADYGVPFRRLTG  73

Query  557  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWL  384
            H+ +V  V +S DG    SG  DG + LWDL+ G   + +      ++       NR  +
Sbjct  74   HSHFVQDVVLSSDGQFALSGSWDGELRLWDLSTGLTTRRFVGHEKDVLSVAFSVDNRQIV  133

Query  383  CAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTL  204
             A+ + +IK+W+   +            +  +  +       N  + C   S N    T+
Sbjct  134  SASRDKTIKLWNTLGEC-----------KYTIGGDLGGGEGHNGWVSCVRFSPNTFQPTI  182

Query  203  FSGYTDGVIRVWGI  162
             SG  D  ++VW +
Sbjct  183  VSGSWDRTVKVWNL  196



>ref|XP_002440202.1| hypothetical protein SORBIDRAFT_09g027690 [Sorghum bicolor]
 gb|EES18632.1| hypothetical protein SORBIDRAFT_09g027690 [Sorghum bicolor]
Length=334

 Score =   301 bits (770),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 149/203 (73%), Positives = 167/203 (82%), Gaps = 16/203 (8%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDG----HNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNC  582
            TIKLWNTLGECKYTI    G    HN WVSCVRFSP+T QPTIVSGSWDRTVKVWNL+NC
Sbjct  140  TIKLWNTLGECKYTIGGDLGGGEGHNGWVSCVRFSPNTFQPTIVSGSWDRTVKVWNLTNC  199

Query  581  KLRSTLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFS  402
            KLR TL GH GYVN VAVSPDGSLCASGGKDGV LLWDLAEGK+LYSLDAGSIIH+LCFS
Sbjct  200  KLRCTLDGHGGYVNAVAVSPDGSLCASGGKDGVTLLWDLAEGKRLYSLDAGSIIHSLCFS  259

Query  401  PNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWN  222
            PNRYWLCAAT+ S+KIWDLESK +V DL+ D++             +KN+I++C+SLSW+
Sbjct  260  PNRYWLCAATQDSVKIWDLESKHVVQDLKPDIQ------------ISKNQILYCSSLSWS  307

Query  221  ADGSTLFSGYTDGVIRVWGIGRY  153
            ADGSTL++GYTDG IRVW I  Y
Sbjct  308  ADGSTLYTGYTDGSIRVWKISAY  330


 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 53/194 (27%), Positives = 83/194 (43%), Gaps = 30/194 (15%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRST---------------LAG  558
             HN  V+ +  +P    P IVS S D++V +W+L N  + ST               L G
Sbjct  16   AHNGEVTAIA-TPIDNSPFIVSASRDKSVLLWDLEN-PVHSTPESGVTADYGVPKRRLTG  73

Query  557  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSL-DAGSIIHALCFS-PNRYWL  384
            H+ +V  V +S DG    SG  DG + LWDL+ G         G  I ++ FS  NR  +
Sbjct  74   HSHFVQDVVLSSDGMFALSGSWDGELRLWDLSTGATTRRFVGHGKDILSVAFSVDNRQII  133

Query  383  CAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTL  204
             A+ + +IK+W+   +            +  +  +       N  + C   S N    T+
Sbjct  134  SASRDKTIKLWNTLGEC-----------KYTIGGDLGGGEGHNGWVSCVRFSPNTFQPTI  182

Query  203  FSGYTDGVIRVWGI  162
             SG  D  ++VW +
Sbjct  183  VSGSWDRTVKVWNL  196



>ref|XP_001780288.1| predicted protein [Physcomitrella patens]
 gb|EDQ54847.1| predicted protein [Physcomitrella patens]
Length=316

 Score =   298 bits (763),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 143/198 (72%), Positives = 162/198 (82%), Gaps = 10/198 (5%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            TIKLWNTLGECKYTIQD DGH  WVSCVRFSP T  P IVSG WD+ VKVWNL+NCK+R+
Sbjct  128  TIKLWNTLGECKYTIQDVDGHTGWVSCVRFSPVTANPIIVSGGWDKVVKVWNLTNCKIRT  187

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
             L GHTGYVNTV VSPDGSLCASGGKDGV +LWDLAEGK+LYSLDAG IIH+LCFSPNRY
Sbjct  188  NLVGHTGYVNTVTVSPDGSLCASGGKDGVAMLWDLAEGKRLYSLDAGDIIHSLCFSPNRY  247

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGS  210
            WLCAAT++ IKIWDLESKS+V +LR +    S+          K ++ +C SL+W+ADGS
Sbjct  248  WLCAATQSCIKIWDLESKSVVDELRPEFTFVSK----------KAQVPYCVSLNWSADGS  297

Query  209  TLFSGYTDGVIRVWGIGR  156
            TLFSGYTDG IRVW +GR
Sbjct  298  TLFSGYTDGHIRVWAVGR  315


 Score = 53.1 bits (126),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 37/122 (30%), Positives = 59/122 (48%), Gaps = 8/122 (7%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAV  528
            GH+ WV+ +   P      I+S S D+++ VW L+  +      R  L GH  +V  V +
Sbjct  13   GHSNWVTAIA-CPLDNPDLILSSSRDKSIIVWTLTREEGNYGVARRRLTGHAHFVQDVVI  71

Query  527  SPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSI-IHALCFS-PNRYWLCAATEASIKI  354
            S DG    SG  DG + LWDL  G         +  + ++ FS  NR  +  + + +IK+
Sbjct  72   SSDGQFALSGSWDGTLRLWDLNTGTTTRRFIGHTKDVLSVAFSVDNRQIVSGSRDKTIKL  131

Query  353  WD  348
            W+
Sbjct  132  WN  133



>ref|XP_002945887.1| hypothetical protein VOLCADRAFT_78914 [Volvox carteri f. nagariensis]
 gb|EFJ52882.1| hypothetical protein VOLCADRAFT_78914 [Volvox carteri f. nagariensis]
Length=318

 Score =   298 bits (762),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 140/196 (71%), Positives = 164/196 (84%), Gaps = 10/196 (5%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            TIKLWNTLGECKYTI + +GH EWVSCVRFSP+T+ P IVSG WD+ VKVWNL+NCKL++
Sbjct  129  TIKLWNTLGECKYTIGEPEGHTEWVSCVRFSPTTVNPIIVSGGWDKMVKVWNLTNCKLKN  188

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
             L GHTGYVNTV VSPDGSLCASGGKDGV +LWDLAEGK+LYSLDAG +IH LCFSPNRY
Sbjct  189  NLVGHTGYVNTVTVSPDGSLCASGGKDGVAMLWDLAEGKRLYSLDAGDVIHCLCFSPNRY  248

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGS  210
            WLCAAT+++IKIWDLESKS+V DL+V          E N T+ K ++ +C SL+W+ADGS
Sbjct  249  WLCAATQSTIKIWDLESKSVVDDLKV----------EFNITSKKAQVPYCVSLAWSADGS  298

Query  209  TLFSGYTDGVIRVWGI  162
            TL+SGYTDG IRVW +
Sbjct  299  TLYSGYTDGQIRVWAV  314


 Score = 62.0 bits (149),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 36/122 (30%), Positives = 58/122 (48%), Gaps = 7/122 (6%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAV  528
            GH  WV+ +         T++S S D+TV VW L   +      +  L GH+ +V  V +
Sbjct  13   GHTNWVTAIATPLDPSSNTLLSASRDKTVLVWELERSESNYGYAKKALRGHSHFVQDVVI  72

Query  527  SPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKI  354
            S DG  C +G  DG + LWDL  G   + +      ++     + NR  +  A + +IK+
Sbjct  73   SSDGQFCLTGSWDGTLRLWDLNTGTTTRRFVGHTKDVLSVAFSADNRQIVSGARDKTIKL  132

Query  353  WD  348
            W+
Sbjct  133  WN  134


 Score = 49.7 bits (117),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 50/189 (26%), Positives = 76/189 (40%), Gaps = 35/189 (19%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVNTVAVSPDGS  513
            GH+ +V  V  S        ++GSWD T+++W+L+         GHT  V +VA S D  
Sbjct  62   GHSHFVQDVVISSD--GQFCLTGSWDGTLRLWDLNTGTTTRRFVGHTKDVLSVAFSADNR  119

Query  512  LCASGGKDGVILLWD-LAEGKKLYSLDAGSIIHALC--FSP---NRYWLCAATEASIKIW  351
               SG +D  I LW+ L E K       G      C  FSP   N   +    +  +K+W
Sbjct  120  QIVSGARDKTIKLWNTLGECKYTIGEPEGHTEWVSCVRFSPTTVNPIIVSGGWDKMVKVW  179

Query  350  DLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKII----FCTSLSWNADGSTLFSGYTDG  183
            +L                        N   KN ++    +  +++ + DGS   SG  DG
Sbjct  180  NL-----------------------TNCKLKNNLVGHTGYVNTVTVSPDGSLCASGGKDG  216

Query  182  VIRVWGIGR  156
            V  +W +  
Sbjct  217  VAMLWDLAE  225



>ref|XP_008811978.1| PREDICTED: LOW QUALITY PROTEIN: guanine nucleotide-binding protein 
subunit beta-like protein A [Phoenix dactylifera]
Length=316

 Score =   298 bits (762),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 148/199 (74%), Positives = 160/199 (80%), Gaps = 20/199 (10%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            TIKLWNTLGECKYTIQD D H  WVSCVRFSP+  QPTIVSGSWDRTVKVWNL+NCKLRS
Sbjct  138  TIKLWNTLGECKYTIQDADAHTNWVSCVRFSPNNFQPTIVSGSWDRTVKVWNLTNCKLRS  197

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
            TL GH GYVN VAVSPDGSLCASGGKDGV LLWDLAE K     D G   H+LCFSPNRY
Sbjct  198  TLTGHGGYVNAVAVSPDGSLCASGGKDGVTLLWDLAEEK-----DXG---HSLCFSPNRY  249

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGS  210
            WLCAAT+ S+KIWDLESKSIV DLR +               +KN+I++CTSLSW+ADGS
Sbjct  250  WLCAATQDSVKIWDLESKSIVQDLRPE------------TPTSKNQILYCTSLSWSADGS  297

Query  209  TLFSGYTDGVIRVWGIGRY  153
            TLF+GYTDGVIRVWGI RY
Sbjct  298  TLFTGYTDGVIRVWGISRY  316


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 53/196 (27%), Positives = 81/196 (41%), Gaps = 37/196 (19%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKL---------------RSTLAG  558
            GH+  V+ +  +P      IVS S D++V VW+L+                   R  L G
Sbjct  13   GHSGPVTAIA-APLDNSDMIVSSSRDKSVLVWHLTKDSPAAAAGEPGGAAYGIPRRRLTG  71

Query  557  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSI-IHALCFS-PNRYWL  384
            H+ +V  V +S DG    SG  DG + LWDLA G         +  + ++ FS  NR  +
Sbjct  72   HSHFVQDVVLSSDGQFALSGSWDGELRLWDLATGATTRRFVGHTKDVLSVAFSIDNRQIV  131

Query  383  CAATEASIKIWDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGS  210
             A+ + +IK+W+   E K  + D                   A    + C   S N    
Sbjct  132  SASRDRTIKLWNTLGECKYTIQD-----------------ADAHTNWVSCVRFSPNNFQP  174

Query  209  TLFSGYTDGVIRVWGI  162
            T+ SG  D  ++VW +
Sbjct  175  TIVSGSWDRTVKVWNL  190



>ref|XP_001779496.1| predicted protein [Physcomitrella patens]
 gb|EDQ55672.1| predicted protein [Physcomitrella patens]
Length=316

 Score =   296 bits (759),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 144/198 (73%), Positives = 161/198 (81%), Gaps = 10/198 (5%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            TIKLWNTLGECKYTIQD D H  WVSCVRFSP T  P IVSG WD+ VKVWNL+NCK+RS
Sbjct  128  TIKLWNTLGECKYTIQDVDAHTGWVSCVRFSPVTANPIIVSGGWDKVVKVWNLTNCKIRS  187

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
             L GHTGYVNTV VSPDGSLCASGGKDGV +LWDL+EGK+LYSLDAG IIH+LCFSPNRY
Sbjct  188  NLVGHTGYVNTVTVSPDGSLCASGGKDGVAMLWDLSEGKRLYSLDAGDIIHSLCFSPNRY  247

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGS  210
            WLCAAT++ IKIWDLESKSIV +LR +    S+          K +I +C SL+W+ADGS
Sbjct  248  WLCAATQSCIKIWDLESKSIVDELRPEFTFVSK----------KAQIPYCVSLNWSADGS  297

Query  209  TLFSGYTDGVIRVWGIGR  156
            TLFSGYTDG IRVW +GR
Sbjct  298  TLFSGYTDGHIRVWAVGR  315


 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 52/208 (25%), Positives = 86/208 (41%), Gaps = 32/208 (15%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAV  528
            GH+ WV+ +   P      I+S S D+++ VW L+  +      R  L GH  +V  V +
Sbjct  13   GHSNWVTAIA-CPLDNPDLILSSSRDKSIIVWTLTREEGNYGVARRRLTGHAHFVQDVVI  71

Query  527  SPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSI-IHALCFS-PNRYWLCAATEASIKI  354
            S DG    SG  DG + LWDL  G         +  + ++ FS  NR  +  + + +IK+
Sbjct  72   SSDGQFALSGSWDGTLRLWDLNTGTTTRRFIGHTKDVLSVAFSVDNRQIVSGSRDKTIKL  131

Query  353  WDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  180
            W+   E K  + D+                  A    + C   S       + SG  D V
Sbjct  132  WNTLGECKYTIQDVD-----------------AHTGWVSCVRFSPVTANPIIVSGGWDKV  174

Query  179  IRVWGIGRY*MEEFRRSHMIIGHVCYLS  96
            ++VW      +   +    ++GH  Y++
Sbjct  175  VKVWN-----LTNCKIRSNLVGHTGYVN  197



>ref|XP_001698065.1| receptor of activated protein kinase C 1 [Chlamydomonas reinhardtii]
 sp|P25387.1|GBLP_CHLRE RecName: Full=Guanine nucleotide-binding protein subunit beta-like 
protein [Chlamydomonas reinhardtii]
 emb|CAA37638.1| putative protein has homology to G protein beta subunit [Chlamydomonas 
reinhardtii]
 gb|EDO99650.1| receptor of activated protein kinase C 1 [Chlamydomonas reinhardtii]
Length=318

 Score =   296 bits (758),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 141/198 (71%), Positives = 161/198 (81%), Gaps = 10/198 (5%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            TIKLWNTLGECKYTI + +GH EWVSCVRFSP T  P IVSG WD+ VKVWNL+NCKL++
Sbjct  129  TIKLWNTLGECKYTIGEPEGHTEWVSCVRFSPMTTNPIIVSGGWDKMVKVWNLTNCKLKN  188

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
             L GH GYVNTV VSPDGSLCASGGKDG+ +LWDLAEGK+LYSLDAG +IH LCFSPNRY
Sbjct  189  NLVGHHGYVNTVTVSPDGSLCASGGKDGIAMLWDLAEGKRLYSLDAGDVIHCLCFSPNRY  248

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGS  210
            WLCAAT++SIKIWDLESKSIV DLR           E N T+ K ++ +C SL+W+ADGS
Sbjct  249  WLCAATQSSIKIWDLESKSIVDDLR----------PEFNITSKKAQVPYCVSLAWSADGS  298

Query  209  TLFSGYTDGVIRVWGIGR  156
            TL+SGYTDG IRVW +G 
Sbjct  299  TLYSGYTDGQIRVWAVGH  316


 Score = 59.7 bits (143),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 37/122 (30%), Positives = 59/122 (48%), Gaps = 7/122 (6%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAV  528
            GH  WV+ +         T++S S D++V VW L   +      R  L GH+ +V  V +
Sbjct  13   GHTNWVTAIATPLDPSSNTLLSASRDKSVLVWELERSESNYGYARKALRGHSHFVQDVVI  72

Query  527  SPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSI-IHALCFS-PNRYWLCAATEASIKI  354
            S DG  C +G  DG + LWDL  G         +  + ++ FS  NR  +  + + +IK+
Sbjct  73   SSDGQFCLTGSWDGTLRLWDLNTGTTTRRFVGHTKDVLSVAFSVDNRQIVSGSRDKTIKL  132

Query  353  WD  348
            W+
Sbjct  133  WN  134



>ref|XP_001754916.1| predicted protein [Physcomitrella patens]
 gb|EDQ80370.1| predicted protein [Physcomitrella patens]
Length=316

 Score =   296 bits (758),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 143/198 (72%), Positives = 160/198 (81%), Gaps = 10/198 (5%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            TIKLWNTLGECKYTIQD D H  WVSCVRFSP T  P IVSG WD+ VKVWNL+NCK+R+
Sbjct  128  TIKLWNTLGECKYTIQDVDAHTGWVSCVRFSPVTANPIIVSGGWDKVVKVWNLTNCKIRT  187

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
             L GHTGYVNTV VSPDGSLCASGGKDGV +LWDLAEGK+LYSLDAG IIH+LCFSPNRY
Sbjct  188  NLVGHTGYVNTVTVSPDGSLCASGGKDGVAMLWDLAEGKRLYSLDAGDIIHSLCFSPNRY  247

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGS  210
            WLCAAT+  IKIWDLESKS+V +LR +    S+          K +I +C SL+W+ADGS
Sbjct  248  WLCAATQTCIKIWDLESKSVVDELRPEFTFVSK----------KAQIPYCVSLNWSADGS  297

Query  209  TLFSGYTDGVIRVWGIGR  156
            TLFSGYTDG IRVW +GR
Sbjct  298  TLFSGYTDGHIRVWAVGR  315


 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 53/208 (25%), Positives = 86/208 (41%), Gaps = 32/208 (15%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAV  528
            GH  WV+ +   P      I+S S D+++ VW+LS  +      R  L GH  +V  V +
Sbjct  13   GHANWVTAIA-CPLDNPDLILSSSRDKSIIVWHLSREEGNYGVARRRLTGHAHFVQDVVI  71

Query  527  SPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSI-IHALCFS-PNRYWLCAATEASIKI  354
            S DG    SG  DG + LWDL  G         +  + ++ FS  NR  +  + + +IK+
Sbjct  72   SSDGQFALSGSWDGTLRLWDLNTGTTTRRFIGHTKDVLSVAFSVDNRQIVSGSRDKTIKL  131

Query  353  WDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  180
            W+   E K  + D+                  A    + C   S       + SG  D V
Sbjct  132  WNTLGECKYTIQDVD-----------------AHTGWVSCVRFSPVTANPIIVSGGWDKV  174

Query  179  IRVWGIGRY*MEEFRRSHMIIGHVCYLS  96
            ++VW      +   +    ++GH  Y++
Sbjct  175  VKVWN-----LTNCKIRTNLVGHTGYVN  197



>ref|XP_004969582.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein A-like [Setaria italica]
Length=334

 Score =   296 bits (759),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 145/203 (71%), Positives = 167/203 (82%), Gaps = 16/203 (8%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQD----GDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNC  582
            TIKLWNTLGECKYTI       +GH+ WVSCVRFSP+T+QPTIVSGSWDR+VKVWNL+NC
Sbjct  140  TIKLWNTLGECKYTIGGDHGASEGHSGWVSCVRFSPNTIQPTIVSGSWDRSVKVWNLTNC  199

Query  581  KLRSTLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFS  402
            KLRS L GH GYVN VAVSPDGSLCASGGKD V LLWDL EGK+LY+LDAGSIIH+LCFS
Sbjct  200  KLRSNLQGHGGYVNAVAVSPDGSLCASGGKDNVTLLWDLTEGKRLYALDAGSIIHSLCFS  259

Query  401  PNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWN  222
            PNRYWLCAAT+ SIKIWDLESK IV DLR ++            +A KN+I++CTSLSW+
Sbjct  260  PNRYWLCAATQDSIKIWDLESKHIVQDLRPEV------------SAGKNQILYCTSLSWS  307

Query  221  ADGSTLFSGYTDGVIRVWGIGRY  153
            ADGSTL++GYTDG IR++ I  +
Sbjct  308  ADGSTLYAGYTDGTIRIFKISGF  330


 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 51/196 (26%), Positives = 86/196 (44%), Gaps = 34/196 (17%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSN---------------CKLRSTLAG  558
            GHN+ V+ +  +P    P IVS S D+++ VW+L+N                  R  L G
Sbjct  16   GHNDVVTAIA-APIDNSPFIVSSSRDKSLLVWDLTNPVHVAGDGTTTADYGVPFRR-LTG  73

Query  557  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWL  384
            H+ +V  V +S DG    SG  DG + LWDL+ G   + +      ++       NR  +
Sbjct  74   HSHFVQDVVLSSDGQFALSGSWDGELRLWDLSTGLTTRRFVGHEKDVLSVAFSIDNRQIV  133

Query  383  CAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKI--IFCTSLSWNADGS  210
             A+ + +IK+W+                E + +  G++ A++     + C   S N    
Sbjct  134  SASRDKTIKLWNTLG-------------ECKYTIGGDHGASEGHSGWVSCVRFSPNTIQP  180

Query  209  TLFSGYTDGVIRVWGI  162
            T+ SG  D  ++VW +
Sbjct  181  TIVSGSWDRSVKVWNL  196



>gb|ACJ85349.1| unknown [Medicago truncatula]
Length=285

 Score =   294 bits (753),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 139/153 (91%), Positives = 149/153 (97%), Gaps = 0/153 (0%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            TIKLWNTLGECKYTIQDGD H++WVSCVRFSPSTLQPTIVS SWDRTVKVWNL+NCKLR+
Sbjct  128  TIKLWNTLGECKYTIQDGDAHSDWVSCVRFSPSTLQPTIVSASWDRTVKVWNLTNCKLRN  187

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
            TLAGH+GYVNTVAVSPDGSLCASGGKDGVILLWDLAEGK+LYSLDAGSIIHALCFSPNRY
Sbjct  188  TLAGHSGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKRLYSLDAGSIIHALCFSPNRY  247

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESE  291
            WLCAATE+SIKIWDLESKSIV DL+VDLK E++
Sbjct  248  WLCAATESSIKIWDLESKSIVEDLKVDLKTEAD  280



>ref|XP_006644561.1| PREDICTED: LOW QUALITY PROTEIN: guanine nucleotide-binding protein 
subunit beta-like protein A-like [Oryza brachyantha]
Length=334

 Score =   295 bits (754),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 145/203 (71%), Positives = 165/203 (81%), Gaps = 16/203 (8%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDG----HNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNC  582
            TIKLWNTLGECKYTI    G    HN WVSCVRFSP+T QPTIVSGSWDRTVKVWNL+NC
Sbjct  140  TIKLWNTLGECKYTIGGDLGGGEGHNGWVSCVRFSPNTFQPTIVSGSWDRTVKVWNLTNC  199

Query  581  KLRSTLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFS  402
            KLR  L GH GYVN VAVSPDGSLCASGGKDGV LLWDLAEGK+LYSLDAGSIIH+LCFS
Sbjct  200  KLRCNLEGHGGYVNAVAVSPDGSLCASGGKDGVTLLWDLAEGKRLYSLDAGSIIHSLCFS  259

Query  401  PNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWN  222
            PNRYWLCAAT+ SIKIWDLESK IV DL+ ++              +KN++++CTSL+W+
Sbjct  260  PNRYWLCAATQDSIKIWDLESKHIVQDLKPEIP------------VSKNQMLYCTSLNWS  307

Query  221  ADGSTLFSGYTDGVIRVWGIGRY  153
            ADGSTL++GYTDG IR++ I  +
Sbjct  308  ADGSTLYAGYTDGTIRIYKISGF  330


 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 50/196 (26%), Positives = 85/196 (43%), Gaps = 34/196 (17%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSN---------------CKLRSTLAG  558
            GHN+ V+ +  +P    P IVS S D+++ VW+L+N                  R  L G
Sbjct  16   GHNDVVTAIA-TPIDNSPFIVSSSRDKSLLVWDLTNPVPVVGETASATEYGVPFRR-LTG  73

Query  557  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEG---KKLYSLDAGSIIHALCFS-PNRY  390
            H+ +V  V +S +     SG  DG + LWDL+ G   ++    D    + ++ FS  NR 
Sbjct  74   HSHFVQDVVLSSNDQFTLSGSXDGELRLWDLSTGATTRRFVGHDKD--VLSVAFSVDNRQ  131

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGS  210
             + A+ + +IK+W+   +            +  +  +       N  + C   S N    
Sbjct  132  IVSASRDRTIKLWNTLGEC-----------KYTIGGDLGGGEGHNGWVSCVRFSPNTFQP  180

Query  209  TLFSGYTDGVIRVWGI  162
            T+ SG  D  ++VW +
Sbjct  181  TIVSGSWDRTVKVWNL  196



>ref|XP_004961307.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein A-like [Setaria italica]
Length=334

 Score =   294 bits (752),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 146/203 (72%), Positives = 164/203 (81%), Gaps = 16/203 (8%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDG----HNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNC  582
            TIKLWNTLGECKYTI    G    HN WVSCVRFSP+T  PTIVSGSWDRTVKVWNL+NC
Sbjct  140  TIKLWNTLGECKYTIGGDLGGGEGHNGWVSCVRFSPNTFAPTIVSGSWDRTVKVWNLTNC  199

Query  581  KLRSTLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFS  402
            KLR TL GH GYVN VAVSPDGSLCASGGKDG  LLWDL EGK+LYSLDAGSIIH+LCFS
Sbjct  200  KLRCTLDGHGGYVNAVAVSPDGSLCASGGKDGYTLLWDLTEGKRLYSLDAGSIIHSLCFS  259

Query  401  PNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWN  222
            PNRYWLCAAT+ S+KIWDLESK +V DL+ D++             +KN+I++CTSLSW+
Sbjct  260  PNRYWLCAATQDSVKIWDLESKHVVQDLKPDIQ------------ISKNQILYCTSLSWS  307

Query  221  ADGSTLFSGYTDGVIRVWGIGRY  153
            ADGSTL++GYTDG IRVW I  +
Sbjct  308  ADGSTLYTGYTDGSIRVWKISGF  330


 Score = 59.7 bits (143),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 52/194 (27%), Positives = 83/194 (43%), Gaps = 30/194 (15%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRST---------------LAG  558
            GHN  V+ +  +P    P IVS S D++V VW+L+N  + ST               L G
Sbjct  16   GHNGEVTAIA-TPIDNSPFIVSSSRDKSVLVWDLTN-PVHSTPDSGAAADYGVPFRRLTG  73

Query  557  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWL  384
            H+ +V  V +S DG    SG  DG + LWDL+ G   + +      +I       NR  +
Sbjct  74   HSHFVQDVVLSSDGQFALSGSWDGELRLWDLSTGLTTRRFVGHEKDVISVAFSVDNRQIV  133

Query  383  CAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTL  204
             A+ + +IK+W+   +            +  +  +       N  + C   S N    T+
Sbjct  134  SASRDKTIKLWNTLGEC-----------KYTIGGDLGGGEGHNGWVSCVRFSPNTFAPTI  182

Query  203  FSGYTDGVIRVWGI  162
             SG  D  ++VW +
Sbjct  183  VSGSWDRTVKVWNL  196



>ref|NP_001043910.1| Os01g0686800 [Oryza sativa Japonica Group]
 sp|P49027.1|GBLPA_ORYSJ RecName: Full=Guanine nucleotide-binding protein subunit beta-like 
protein A; Short=GPB-LR; AltName: Full=RWD; AltName: Full=Receptor 
for activated C kinase 1A [Oryza sativa Japonica 
Group]
 dbj|BAA07404.1| q group of receptor for activated C-kinase [Oryza sativa Japonica 
Group]
 dbj|BAF05824.1| Os01g0686800 [Oryza sativa Japonica Group]
 gb|EAY75412.1| hypothetical protein OsI_03315 [Oryza sativa Indica Group]
 gb|EAZ13132.1| hypothetical protein OsJ_03054 [Oryza sativa Japonica Group]
 dbj|BAG93799.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG87442.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH00562.1| unnamed protein product [Oryza sativa Japonica Group]
Length=334

 Score =   294 bits (752),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 145/203 (71%), Positives = 165/203 (81%), Gaps = 16/203 (8%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDG----HNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNC  582
            TIKLWNTLGECKYTI    G    HN WVSCVRFSP+T QPTIVSGSWDRTVKVWNL+NC
Sbjct  140  TIKLWNTLGECKYTIGGDLGGGEGHNGWVSCVRFSPNTFQPTIVSGSWDRTVKVWNLTNC  199

Query  581  KLRSTLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFS  402
            KLR  L GH GYVN VAVSPDGSLCASGGKDGV LLWDLAEGK+LYSLDAGSIIH+LCFS
Sbjct  200  KLRCNLEGHGGYVNAVAVSPDGSLCASGGKDGVTLLWDLAEGKRLYSLDAGSIIHSLCFS  259

Query  401  PNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWN  222
            PNRYWLCAAT+ SIKIWDLESK IV DL+ ++              +KN++++CTSL+W+
Sbjct  260  PNRYWLCAATQDSIKIWDLESKHIVQDLKPEIP------------VSKNQMLYCTSLNWS  307

Query  221  ADGSTLFSGYTDGVIRVWGIGRY  153
            ADGSTL++GYTDG IR++ I  +
Sbjct  308  ADGSTLYAGYTDGTIRIYKISGF  330


 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 52/196 (27%), Positives = 86/196 (44%), Gaps = 34/196 (17%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSN---------------CKLRSTLAG  558
            GHN+ V+ +  +P    P IVS S D+++ VW+L+N                  R  L G
Sbjct  16   GHNDVVTAIA-TPIDNSPFIVSSSRDKSLLVWDLTNPVQNVGEGAGASEYGVPFRR-LTG  73

Query  557  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEG---KKLYSLDAGSIIHALCFS-PNRY  390
            H+ +V  V +S DG    SG  DG + LWDL+ G   ++    D    + ++ FS  NR 
Sbjct  74   HSHFVQDVVLSSDGQFALSGSWDGELRLWDLSTGVTTRRFVGHDKD--VLSVAFSVDNRQ  131

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGS  210
             + A+ + +IK+W+   +            +  +  +       N  + C   S N    
Sbjct  132  IVSASRDRTIKLWNTLGEC-----------KYTIGGDLGGGEGHNGWVSCVRFSPNTFQP  180

Query  209  TLFSGYTDGVIRVWGI  162
            T+ SG  D  ++VW +
Sbjct  181  TIVSGSWDRTVKVWNL  196



>ref|XP_005847990.1| hypothetical protein CHLNCDRAFT_31033 [Chlorella variabilis]
 gb|EFN55888.1| hypothetical protein CHLNCDRAFT_31033 [Chlorella variabilis]
Length=319

 Score =   293 bits (750),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 139/198 (70%), Positives = 161/198 (81%), Gaps = 10/198 (5%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            TIKLWNTLGECKYTI + DGH EWVSCVRFSP T  P IVS  WD+ VKVWNL+NCKLR+
Sbjct  130  TIKLWNTLGECKYTIGEPDGHTEWVSCVRFSPVTQNPIIVSAGWDKAVKVWNLTNCKLRN  189

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
             L GH GYVNTV VSPDGSLCASGGKDGV +LWDL+EGK+LYSLDA  IIH+LCFSPNRY
Sbjct  190  NLVGHQGYVNTVTVSPDGSLCASGGKDGVAMLWDLSEGKRLYSLDATDIIHSLCFSPNRY  249

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGS  210
            WLCAAT+ SIKIWDLESKS+V +LR +L + S+          K ++ +C  L+W+ADGS
Sbjct  250  WLCAATQGSIKIWDLESKSLVDELRPELPERSK----------KAQVPYCVCLAWSADGS  299

Query  209  TLFSGYTDGVIRVWGIGR  156
            TL+SGYTDG+IRVW +GR
Sbjct  300  TLYSGYTDGLIRVWQVGR  317


 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 39/123 (32%), Positives = 60/123 (49%), Gaps = 8/123 (7%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK------LRSTLAGHTGYVNTVA  531
            GH  WV+ +         T++S S D+TV VW L N +       +  L GH+ YV  V 
Sbjct  13   GHRGWVTAIAAPLDPTSETLLSSSRDKTVLVWQLGNAEDGSLGYPKRALRGHSHYVQDVV  72

Query  530  VSPDGSLCASGGKDGVILLWDLAEGKKLYS-LDAGSIIHALCFSP-NRYWLCAATEASIK  357
            +S DG  C +G  DG + LWD+  G      L     + ++ FS  NR  +  + + +IK
Sbjct  73   ISSDGQFCLTGSWDGTLRLWDINTGATTRRFLGHTKDVLSVAFSADNRQIVSGSRDKTIK  132

Query  356  IWD  348
            +W+
Sbjct  133  LWN  135


 Score = 50.1 bits (118),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 51/198 (26%), Positives = 81/198 (41%), Gaps = 35/198 (18%)
 Frame = -3

Query  725  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  546
            G   Y  +   GH+ +V  V  S        ++GSWD T+++W+++         GHT  
Sbjct  52   GSLGYPKRALRGHSHYVQDVVISSD--GQFCLTGSWDGTLRLWDINTGATTRRFLGHTKD  109

Query  545  VNTVAVSPDGSLCASGGKDGVILLWD-LAEGKKLYSLDAGSIIHALC--FSP---NRYWL  384
            V +VA S D     SG +D  I LW+ L E K       G      C  FSP   N   +
Sbjct  110  VLSVAFSADNRQIVSGSRDKTIKLWNTLGECKYTIGEPDGHTEWVSCVRFSPVTQNPIIV  169

Query  383  CAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKII----FCTSLSWNAD  216
             A  + ++K+W+L                        N   +N ++    +  +++ + D
Sbjct  170  SAGWDKAVKVWNL-----------------------TNCKLRNNLVGHQGYVNTVTVSPD  206

Query  215  GSTLFSGYTDGVIRVWGI  162
            GS   SG  DGV  +W +
Sbjct  207  GSLCASGGKDGVAMLWDL  224



>emb|CEG00110.1| G-protein beta WD-40 repeat [Ostreococcus tauri]
Length=319

 Score =   292 bits (748),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 138/197 (70%), Positives = 158/197 (80%), Gaps = 10/197 (5%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            TIKLWNTLGECKYTIQD D H+EWVSCVRFSP T  P IVSG WD+ VKVWNL+NCK+R+
Sbjct  128  TIKLWNTLGECKYTIQDADAHSEWVSCVRFSPVTTNPIIVSGGWDKLVKVWNLTNCKIRT  187

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
             L GHTGY+NTV VSPDGSLCASGGKDGV +LWDL EGK+LYSLDAG II+ LCFSPNRY
Sbjct  188  NLVGHTGYINTVTVSPDGSLCASGGKDGVAMLWDLGEGKRLYSLDAGDIIYGLCFSPNRY  247

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGS  210
            WLCAATE+ +KIWDLESKSIV +LR +                K++  +CTSL W+ADGS
Sbjct  248  WLCAATESCVKIWDLESKSIVDELRPEFPP----------VGKKSQQPYCTSLQWSADGS  297

Query  209  TLFSGYTDGVIRVWGIG  159
            TL++GYTD VIRVW +G
Sbjct  298  TLYTGYTDNVIRVWSVG  314


 Score = 59.3 bits (142),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 51/208 (25%), Positives = 88/208 (42%), Gaps = 32/208 (15%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAV  528
            GH  WV+ +  +P      ++S S D+TV +WNL+  +      R +L GH+ YV  V +
Sbjct  13   GHENWVTSIA-TPLDNSDILLSSSRDKTVILWNLTREEENYGYPRRSLHGHSHYVQEVVI  71

Query  527  SPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKI  354
            S DG    SG  DG + LWDL  G   + +      ++       NR  +  + + +IK+
Sbjct  72   SSDGQFALSGSWDGTLRLWDLNTGTTTRRFVGHTKDVLSVAFSVDNRQIVSGSRDKTIKL  131

Query  353  WDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  180
            W+   E K  + D                   A ++ + C   S       + SG  D +
Sbjct  132  WNTLGECKYTIQD-----------------ADAHSEWVSCVRFSPVTTNPIIVSGGWDKL  174

Query  179  IRVWGIGRY*MEEFRRSHMIIGHVCYLS  96
            ++VW      +   +    ++GH  Y++
Sbjct  175  VKVWN-----LTNCKIRTNLVGHTGYIN  197


 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 59/207 (29%), Positives = 91/207 (44%), Gaps = 30/207 (14%)
 Frame = -3

Query  749  TIKLWNTLGECK---YTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK  579
            T+ LWN   E +   Y  +   GH+ +V  V  S        +SGSWD T+++W+L+   
Sbjct  39   TVILWNLTREEENYGYPRRSLHGHSHYVQEVVISSD--GQFALSGSWDGTLRLWDLNTGT  96

Query  578  LRSTLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWD-LAEGK-KLYSLDAGSI-IHALC  408
                  GHT  V +VA S D     SG +D  I LW+ L E K  +   DA S  +  + 
Sbjct  97   TTRRFVGHTKDVLSVAFSVDNRQIVSGSRDKTIKLWNTLGECKYTIQDADAHSEWVSCVR  156

Query  407  FSP---NRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCT  237
            FSP   N   +    +  +K+W+L +  I  +L         +   G          +  
Sbjct  157  FSPVTTNPIIVSGGWDKLVKVWNLTNCKIRTNL---------VGHTG----------YIN  197

Query  236  SLSWNADGSTLFSGYTDGVIRVWGIGR  156
            +++ + DGS   SG  DGV  +W +G 
Sbjct  198  TVTVSPDGSLCASGGKDGVAMLWDLGE  224



>gb|EMS52917.1| Guanine nucleotide-binding protein subunit beta-like protein 
B [Triticum urartu]
Length=359

 Score =   293 bits (751),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 144/200 (72%), Positives = 165/200 (83%), Gaps = 16/200 (8%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDG----HNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNC  582
            TIKLWNTLGECKYTI    G    H  WVSCVRFSP+  QPTIVSGSWD+TVKVWNL+NC
Sbjct  164  TIKLWNTLGECKYTIGGDMGGGEGHTGWVSCVRFSPNIQQPTIVSGSWDKTVKVWNLTNC  223

Query  581  KLRSTLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFS  402
            KLRSTLAGH GYVN VAVSPDGSLCASGGKDGV LLWDL+EGK+LY L+AGSIIHALCFS
Sbjct  224  KLRSTLAGHGGYVNAVAVSPDGSLCASGGKDGVTLLWDLSEGKRLYQLEAGSIIHALCFS  283

Query  401  PNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWN  222
            PNRYWLCAATE S+KIWDLESK +V DL+ +++             +KN++++CTSLSW+
Sbjct  284  PNRYWLCAATEESVKIWDLESKHVVQDLKPEVQ------------VSKNQMLYCTSLSWS  331

Query  221  ADGSTLFSGYTDGVIRVWGI  162
            ADGSTL++GYTDG IRV+ I
Sbjct  332  ADGSTLYTGYTDGTIRVFKI  351



>dbj|BAJ90663.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK06408.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ91024.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=335

 Score =   292 bits (748),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 144/200 (72%), Positives = 165/200 (83%), Gaps = 16/200 (8%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDG----HNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNC  582
            TIKLWNTLGECKYTI    G    H  WVSCVRFSP+  QPTIVSGSWD+TVKVWNL+NC
Sbjct  140  TIKLWNTLGECKYTIGGDMGGGEGHTGWVSCVRFSPNIQQPTIVSGSWDKTVKVWNLANC  199

Query  581  KLRSTLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFS  402
            KLRSTLAGH GYVN VAVSPDGSLCASGGKDGV LLWDL+EGK+LY L+AGSIIH+LCFS
Sbjct  200  KLRSTLAGHGGYVNAVAVSPDGSLCASGGKDGVTLLWDLSEGKRLYQLEAGSIIHSLCFS  259

Query  401  PNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWN  222
            PNRYWLCAATE SIKIWDLESK +V DL+ +++             +KN++++CTSLSW+
Sbjct  260  PNRYWLCAATEESIKIWDLESKHVVQDLKPEVQ------------VSKNQMLYCTSLSWS  307

Query  221  ADGSTLFSGYTDGVIRVWGI  162
            ADGSTL++GYTDG IRV+ I
Sbjct  308  ADGSTLYTGYTDGTIRVFKI  327


 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 50/194 (26%), Positives = 81/194 (42%), Gaps = 30/194 (15%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSN---------------CKLRSTLAG  558
            GHN+ V+ +  +P    P IVSGS D+++ VW+L+N                  R  L G
Sbjct  16   GHNDVVTAIA-APIDNSPYIVSGSRDKSLLVWDLTNPVASLGDGTVGTDYAVPFRR-LTG  73

Query  557  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWL  384
            H  +V  V +S DG    SG  DG + LWDL+ G   + +      +I       NR  +
Sbjct  74   HGHFVQDVVISSDGQFALSGSWDGELRLWDLSTGLTTRRFVGHTKDVISVAFSVDNRQIV  133

Query  383  CAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTL  204
             A+ + +IK+W+   +            +  +  +          + C   S N    T+
Sbjct  134  SASRDNTIKLWNTLGEC-----------KYTIGGDMGGGEGHTGWVSCVRFSPNIQQPTI  182

Query  203  FSGYTDGVIRVWGI  162
             SG  D  ++VW +
Sbjct  183  VSGSWDKTVKVWNL  196



>ref|XP_003567944.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein A [Brachypodium distachyon]
Length=333

 Score =   292 bits (747),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 143/200 (72%), Positives = 164/200 (82%), Gaps = 16/200 (8%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDG----HNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNC  582
            TIKLWNTLGECKYTI    G    H  WVSCVRFSP+T QPTIVSGSWD+TVKVWNL+NC
Sbjct  138  TIKLWNTLGECKYTIGGDLGGGEGHTGWVSCVRFSPNTFQPTIVSGSWDKTVKVWNLTNC  197

Query  581  KLRSTLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFS  402
            KLR+TLAGH GYVN VAVSPDGSLCASGGKDGV LLWDLAEGK+LY L+AGSIIH+LCFS
Sbjct  198  KLRNTLAGHGGYVNAVAVSPDGSLCASGGKDGVTLLWDLAEGKRLYQLEAGSIIHSLCFS  257

Query  401  PNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWN  222
            PNRYWLCAATE S+KIWDLESK +V DL+ + +             +KN++++CTSL W+
Sbjct  258  PNRYWLCAATEDSVKIWDLESKHVVQDLKPEFQ------------VSKNQMLYCTSLCWS  305

Query  221  ADGSTLFSGYTDGVIRVWGI  162
            ADGSTL++GYTDG IRV+ I
Sbjct  306  ADGSTLYTGYTDGTIRVFKI  325


 Score = 53.1 bits (126),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 48/193 (25%), Positives = 78/193 (40%), Gaps = 28/193 (15%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRST--------------LAGH  555
            GHN+ V+ +  +P      IVS S D++V VW+L+N                    L GH
Sbjct  14   GHNDVVTAIA-APIDNTAFIVSSSRDKSVLVWDLTNPAPSPADGTVATDYGVPFRRLTGH  72

Query  554  TGYVNTVAVSPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLC  381
              +V  V +S DG    SG  DG + LWDL+ G   + +      +I       NR  + 
Sbjct  73   GHFVQDVVISSDGQFALSGSWDGELRLWDLSTGLTTRRFVGHTKDVISVAFSVDNRQIVS  132

Query  380  AATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLF  201
            A+ + +IK+W+   +            +  +  +          + C   S N    T+ 
Sbjct  133  ASRDNTIKLWNTLGEC-----------KYTIGGDLGGGEGHTGWVSCVRFSPNTFQPTIV  181

Query  200  SGYTDGVIRVWGI  162
            SG  D  ++VW +
Sbjct  182  SGSWDKTVKVWNL  194



>ref|XP_001421096.1| Receptor of activated protein kinase C 1A, component of 40S small 
ribosomal subunit [Ostreococcus lucimarinus CCE9901]
 ref|XP_001422858.1| Receptor of activated protein kinase C 1B, component of 40S small 
ribosomal subunit [Ostreococcus lucimarinus CCE9901]
 gb|ABO99389.1| Receptor of activated protein kinase C 1A, component of 40S small 
ribosomal subunit [Ostreococcus lucimarinus CCE9901]
 gb|ABP01217.1| Receptor of activated protein kinase C 1B, component of 40S small 
ribosomal subunit [Ostreococcus lucimarinus CCE9901]
Length=321

 Score =   290 bits (742),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 137/197 (70%), Positives = 157/197 (80%), Gaps = 10/197 (5%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            TIKLWNTLGECKYTIQD D H+EWVSCVRFSP T  P IVSG WD+ VKVWNL+NCK+R+
Sbjct  128  TIKLWNTLGECKYTIQDADAHSEWVSCVRFSPVTSNPIIVSGGWDKLVKVWNLTNCKIRT  187

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
             L GHTGY+N V VSPDGSLCASGGKDGV +LWDL EGK+LYSLDAG II+ LCFSPNRY
Sbjct  188  NLVGHTGYINAVTVSPDGSLCASGGKDGVAMLWDLGEGKRLYSLDAGDIIYGLCFSPNRY  247

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGS  210
            WLCAATE+ +KIWDLESKSIV +LR +                K++  +CTSL W+ADGS
Sbjct  248  WLCAATESCVKIWDLESKSIVDELRPEFPP----------VGKKSQQPYCTSLQWSADGS  297

Query  209  TLFSGYTDGVIRVWGIG  159
            TL++GYTD VIRVW +G
Sbjct  298  TLYTGYTDNVIRVWSVG  314


 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 50/208 (24%), Positives = 88/208 (42%), Gaps = 32/208 (15%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAV  528
            GH  WV+ +  +P      ++S S D+TV +WNL+  +      R +L GH+ +V  V +
Sbjct  13   GHENWVTSIA-TPLDNSDILLSSSRDKTVILWNLTREEENYGYPRRSLHGHSHFVQDVVI  71

Query  527  SPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKI  354
            S DG    SG  DG + LWDL  G   + +      ++       NR  +  + + +IK+
Sbjct  72   SSDGQFALSGSWDGTLRLWDLNTGTTTRRFVGHTKDVLSVAFSVDNRQIVSGSRDKTIKL  131

Query  353  WDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  180
            W+   E K  + D                   A ++ + C   S       + SG  D +
Sbjct  132  WNTLGECKYTIQD-----------------ADAHSEWVSCVRFSPVTSNPIIVSGGWDKL  174

Query  179  IRVWGIGRY*MEEFRRSHMIIGHVCYLS  96
            ++VW      +   +    ++GH  Y++
Sbjct  175  VKVWN-----LTNCKIRTNLVGHTGYIN  197


 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 59/207 (29%), Positives = 91/207 (44%), Gaps = 30/207 (14%)
 Frame = -3

Query  749  TIKLWNTLGECK---YTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK  579
            T+ LWN   E +   Y  +   GH+ +V  V  S        +SGSWD T+++W+L+   
Sbjct  39   TVILWNLTREEENYGYPRRSLHGHSHFVQDVVISSD--GQFALSGSWDGTLRLWDLNTGT  96

Query  578  LRSTLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWD-LAEGK-KLYSLDAGSI-IHALC  408
                  GHT  V +VA S D     SG +D  I LW+ L E K  +   DA S  +  + 
Sbjct  97   TTRRFVGHTKDVLSVAFSVDNRQIVSGSRDKTIKLWNTLGECKYTIQDADAHSEWVSCVR  156

Query  407  FSP---NRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCT  237
            FSP   N   +    +  +K+W+L +  I  +L         +   G          +  
Sbjct  157  FSPVTSNPIIVSGGWDKLVKVWNLTNCKIRTNL---------VGHTG----------YIN  197

Query  236  SLSWNADGSTLFSGYTDGVIRVWGIGR  156
            +++ + DGS   SG  DGV  +W +G 
Sbjct  198  AVTVSPDGSLCASGGKDGVAMLWDLGE  224



>ref|XP_003082627.1| GTP-binding regulatory protein beta chain homolog-Ch (ISS) [Ostreococcus 
tauri]
Length=483

 Score =   295 bits (755),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 138/197 (70%), Positives = 158/197 (80%), Gaps = 10/197 (5%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            TIKLWNTLGECKYTIQD D H+EWVSCVRFSP T  P IVSG WD+ VKVWNL+NCK+R+
Sbjct  292  TIKLWNTLGECKYTIQDADAHSEWVSCVRFSPVTTNPIIVSGGWDKLVKVWNLTNCKIRT  351

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
             L GHTGY+NTV VSPDGSLCASGGKDGV +LWDL EGK+LYSLDAG II+ LCFSPNRY
Sbjct  352  NLVGHTGYINTVTVSPDGSLCASGGKDGVAMLWDLGEGKRLYSLDAGDIIYGLCFSPNRY  411

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGS  210
            WLCAATE+ +KIWDLESKSIV +LR +                K++  +CTSL W+ADGS
Sbjct  412  WLCAATESCVKIWDLESKSIVDELRPEFPP----------VGKKSQQPYCTSLQWSADGS  461

Query  209  TLFSGYTDGVIRVWGIG  159
            TL++GYTD VIRVW +G
Sbjct  462  TLYTGYTDNVIRVWSVG  478


 Score = 53.9 bits (128),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 59/206 (29%), Positives = 91/206 (44%), Gaps = 30/206 (15%)
 Frame = -3

Query  749  TIKLWNTLGECK---YTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK  579
            T+ LWN   E +   Y  +   GH+ +V  V  S        +SGSWD T+++W+L+   
Sbjct  203  TVILWNLTREEENYGYPRRSLHGHSHYVQEVVISSDGQ--FALSGSWDGTLRLWDLNTGT  260

Query  578  LRSTLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWD-LAEGK-KLYSLDAGSI-IHALC  408
                  GHT  V +VA S D     SG +D  I LW+ L E K  +   DA S  +  + 
Sbjct  261  TTRRFVGHTKDVLSVAFSVDNRQIVSGSRDKTIKLWNTLGECKYTIQDADAHSEWVSCVR  320

Query  407  FSP---NRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCT  237
            FSP   N   +    +  +K+W+L +  I  +L         +   G          +  
Sbjct  321  FSPVTTNPIIVSGGWDKLVKVWNLTNCKIRTNL---------VGHTG----------YIN  361

Query  236  SLSWNADGSTLFSGYTDGVIRVWGIG  159
            +++ + DGS   SG  DGV  +W +G
Sbjct  362  TVTVSPDGSLCASGGKDGVAMLWDLG  387


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 45/167 (27%), Positives = 74/167 (44%), Gaps = 26/167 (16%)
 Frame = -3

Query  635  IVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAVSPDGSLCASGGKDGVILLW  471
            ++S S D+TV +WNL+  +      R +L GH+ YV  V +S DG    SG  DG + LW
Sbjct  195  LLSSSRDKTVILWNLTREEENYGYPRRSLHGHSHYVQEVVISSDGQFALSGSWDGTLRLW  254

Query  470  DLAEGKKLYSLDAGSI-IHALCFS-PNRYWLCAATEASIKIWDL--ESKSIVVDLRVDLK  303
            DL  G         +  + ++ FS  NR  +  + + +IK+W+   E K  + D      
Sbjct  255  DLNTGTTTRRFVGHTKDVLSVAFSVDNRQIVSGSRDKTIKLWNTLGECKYTIQD------  308

Query  302  QESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGI  162
                         A ++ + C   S       + SG  D +++VW +
Sbjct  309  -----------ADAHSEWVSCVRFSPVTTNPIIVSGGWDKLVKVWNL  344



>ref|NP_001056254.1| Os05g0552300 [Oryza sativa Japonica Group]
 sp|Q6L4F8.1|GBLPB_ORYSJ RecName: Full=Guanine nucleotide-binding protein subunit beta-like 
protein B; Short=GPB-LR; AltName: Full=Receptor for activated 
C kinase 1B [Oryza sativa Japonica Group]
 gb|AAT39277.1| putative guanine nucleotide-binding protein beta subunit [Oryza 
sativa Japonica Group]
 gb|AAT85192.1| putative guanine nucleotide binding protein beta subunit [Oryza 
sativa Japonica Group]
 dbj|BAF18168.1| Os05g0552300 [Oryza sativa Japonica Group]
 dbj|BAG88240.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG89443.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH00554.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE64615.1| hypothetical protein OsJ_19467 [Oryza sativa Japonica Group]
Length=336

 Score =   290 bits (742),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 142/206 (69%), Positives = 164/206 (80%), Gaps = 19/206 (9%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQD----GDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNC  582
            TIKLWNTLGECKYTI      G+GH  WVSCVRFSP+ + PTIVSGSWDR+VKVWNL+NC
Sbjct  141  TIKLWNTLGECKYTIGGDHGAGEGHTGWVSCVRFSPNPMAPTIVSGSWDRSVKVWNLTNC  200

Query  581  KLRSTLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFS  402
            KLR+ L GH GYVN VAVSPDGSLCASGGKDG  LLWDL EGK LY LDAG+IIH+LCFS
Sbjct  201  KLRTKLEGHNGYVNAVAVSPDGSLCASGGKDGTTLLWDLTEGKMLYKLDAGAIIHSLCFS  260

Query  401  PNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWN  222
            PNRYWLCAATE S+KIWDLESK ++ DL+ +++            A K+++++CTSLSW+
Sbjct  261  PNRYWLCAATEDSVKIWDLESKLVMQDLKPEVQ------------AFKSQMLYCTSLSWS  308

Query  221  ADGSTLFSGYTDGVIRVW---GIGRY  153
            ADGSTLF+GYTDG IRVW   G G Y
Sbjct  309  ADGSTLFAGYTDGTIRVWKVSGFGGY  334


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 53/197 (27%), Positives = 87/197 (44%), Gaps = 34/197 (17%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLR----------------STLA  561
            GHN+ V+ +  +P    P IVS S D+++ VW+++N                      L 
Sbjct  15   GHNDMVTAIA-APIDNSPFIVSSSRDKSLLVWDITNPSTAVATDPEAAPPEYGVSYRRLT  73

Query  560  GHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSI-IHALCFS-PNRYW  387
            GH+ +V  V +S DG    SG  DG + LWDLA G+        +  + ++ FS  NR  
Sbjct  74   GHSHFVQDVVLSSDGQFALSGSWDGELRLWDLATGRTTRRFVGHTKDVLSVAFSVDNRQI  133

Query  386  LCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKI--IFCTSLSWNADG  213
            + AA + +IK+W+                E + +  G++ A +     + C   S N   
Sbjct  134  VSAARDNTIKLWNTLG-------------ECKYTIGGDHGAGEGHTGWVSCVRFSPNPMA  180

Query  212  STLFSGYTDGVIRVWGI  162
             T+ SG  D  ++VW +
Sbjct  181  PTIVSGSWDRSVKVWNL  197


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 56/207 (27%), Positives = 89/207 (43%), Gaps = 31/207 (15%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVNTVAVSPDGS  513
            GH+ +V  V  S        +SGSWD  +++W+L+  +      GHT  V +VA S D  
Sbjct  74   GHSHFVQDVVLSSD--GQFALSGSWDGELRLWDLATGRTTRRFVGHTKDVLSVAFSVDNR  131

Query  512  LCASGGKDGVILLWD-LAEGKKLYSLDAGSI------IHALCFSPNRYW---LCAATEAS  363
               S  +D  I LW+ L E K     D G+       +  + FSPN      +  + + S
Sbjct  132  QIVSAARDNTIKLWNTLGECKYTIGGDHGAGEGHTGWVSCVRFSPNPMAPTIVSGSWDRS  191

Query  362  IKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDG  183
            +K+W+L +      LR  L        EG+N        +  +++ + DGS   SG  DG
Sbjct  192  VKVWNLTN----CKLRTKL--------EGHNG-------YVNAVAVSPDGSLCASGGKDG  232

Query  182  VIRVWGIGRY*MEEFRRSHMIIGHVCY  102
               +W +    M     +  II  +C+
Sbjct  233  TTLLWDLTEGKMLYKLDAGAIIHSLCF  259



>gb|AEF79971.1| receptor of activated protein kinase C 1 [Dunaliella salina]
Length=318

 Score =   289 bits (739),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 138/196 (70%), Positives = 161/196 (82%), Gaps = 9/196 (5%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            TI+LWNTLGECKY+I + +GH+EWVSCVRFSP T  P IVSG WD+ VKVWNL+NCKL++
Sbjct  129  TIRLWNTLGECKYSIGEPEGHSEWVSCVRFSPMTANPIIVSGGWDKYVKVWNLTNCKLKN  188

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
             L GH GYVNTV VSPDGSLCASGGKDGV +LWDLAEGK+LYSLDAG IIHALCFSPNRY
Sbjct  189  NLIGHMGYVNTVTVSPDGSLCASGGKDGVGMLWDLAEGKRLYSLDAGDIIHALCFSPNRY  248

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGS  210
            WLCAAT +SIKIWDLESKS+V DLR +  +E +  A          + +C SL+W+ADGS
Sbjct  249  WLCAATSSSIKIWDLESKSVVDDLRPEWNKEFKKKAT---------VPYCVSLAWSADGS  299

Query  209  TLFSGYTDGVIRVWGI  162
            TL+SGYTDG+IRVW +
Sbjct  300  TLYSGYTDGMIRVWNV  315


 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 48/206 (23%), Positives = 88/206 (43%), Gaps = 27/206 (13%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNL-----SNCKLRSTLAGHTGYVNTVAV  528
            GH+ WV+ +          ++S S D++V VW L     S    + +L GH+ +V  V +
Sbjct  13   GHSGWVTALAAPLDPSSNVLLSASRDKSVIVWELERGGDSYGYPKKSLRGHSHFVQDVVI  72

Query  527  SPDGSLCASGGKDGVILLWDLAEGK--KLYSLDAGSIIHALCFSPNRYWLCAATEASIKI  354
            S DG  C SG  DG + LWDL  G   + +      ++       NR  +  + + +I++
Sbjct  73   SSDGQFCLSGSWDGTLRLWDLNTGATTRRFVGHTKDVLSVAFSVDNRQIVSGSRDKTIRL  132

Query  353  WDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIR  174
            W+   +           + S    EG+     ++ + C   S       + SG  D  ++
Sbjct  133  WNTLGEC----------KYSIGEPEGH-----SEWVSCVRFSPMTANPIIVSGGWDKYVK  177

Query  173  VWGIGRY*MEEFRRSHMIIGHVCYLS  96
            VW      +   +  + +IGH+ Y++
Sbjct  178  VWN-----LTNCKLKNNLIGHMGYVN  198



>ref|XP_002456166.1| hypothetical protein SORBIDRAFT_03g031520 [Sorghum bicolor]
 gb|EES01286.1| hypothetical protein SORBIDRAFT_03g031520 [Sorghum bicolor]
Length=332

 Score =   289 bits (739),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 140/203 (69%), Positives = 164/203 (81%), Gaps = 16/203 (8%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQD----GDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNC  582
            TIKLWNTLGECKYTI       +GHN WVSCVRFSP+T QPTIVSGSWDR+VKVWNL+NC
Sbjct  140  TIKLWNTLGECKYTIGGDLGGAEGHNGWVSCVRFSPNTYQPTIVSGSWDRSVKVWNLTNC  199

Query  581  KLRSTLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFS  402
            KLR TL GH GYVN VAVSPDGSLCASGGKD V LLWDL EGK+LY+LDAG IIH+LCFS
Sbjct  200  KLRCTLQGHGGYVNAVAVSPDGSLCASGGKDHVTLLWDLTEGKRLYALDAGDIIHSLCFS  259

Query  401  PNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWN  222
            PNRYWLCAAT+ SIKIWDLESK +V DL+ ++            ++ K+++++CT LSW+
Sbjct  260  PNRYWLCAATQESIKIWDLESKHVVQDLKPEV------------SSTKDQMLYCTCLSWS  307

Query  221  ADGSTLFSGYTDGVIRVWGIGRY  153
            ADGSTL++GYTDG IR++ I  Y
Sbjct  308  ADGSTLYAGYTDGSIRIYKISAY  330


 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 54/197 (27%), Positives = 85/197 (43%), Gaps = 36/197 (18%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSN---------------CKLRSTLAG  558
            GHN  V+ +  +P      IVS S D+++ VW+L N                 LR  L G
Sbjct  16   GHNGVVTAIA-TPIDNSDLIVSSSRDKSLLVWDLRNPVQAAGDGTTTADYGVPLRR-LTG  73

Query  557  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKL--YSLDAGSIIHALCFSPNRYWL  384
            H+ +V  V +S DG    SG  DG + LW+L  G+    +      ++     + NR  +
Sbjct  74   HSHFVQDVVLSSDGQFALSGSWDGDLRLWNLTTGETTCRFVGHEKDVLSVAFSADNRQIV  133

Query  383  CAATEASIKIWDLESK---SIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADG  213
             A+ + +IK+W+   +   +I  DL           AEG+     N  + C   S N   
Sbjct  134  SASRDRTIKLWNTLGECKYTIGGDLG---------GAEGH-----NGWVSCVRFSPNTYQ  179

Query  212  STLFSGYTDGVIRVWGI  162
             T+ SG  D  ++VW +
Sbjct  180  PTIVSGSWDRSVKVWNL  196



>ref|XP_006654750.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein B-like [Oryza brachyantha]
Length=336

 Score =   289 bits (739),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 143/206 (69%), Positives = 165/206 (80%), Gaps = 19/206 (9%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQD----GDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNC  582
            TIKLWNTLGECKYTI      GDGH+ WVSCVRFSP+ L PTIVSGSWDR+VKVWNL+NC
Sbjct  141  TIKLWNTLGECKYTIGGDLGAGDGHSGWVSCVRFSPNPLMPTIVSGSWDRSVKVWNLTNC  200

Query  581  KLRSTLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFS  402
            KLR+ L GH GYVN VAVSPDGSLCASGGKDGV LLWDL EGK LY L+AG+IIH+LCFS
Sbjct  201  KLRTKLEGHGGYVNAVAVSPDGSLCASGGKDGVTLLWDLTEGKMLYKLEAGAIIHSLCFS  260

Query  401  PNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWN  222
            PNRYWLCAATE S+KIWDLESK ++ DL+ +++            A K++++ CTSLSW+
Sbjct  261  PNRYWLCAATEDSVKIWDLESKLVMQDLKPEVQ------------AFKSQMLHCTSLSWS  308

Query  221  ADGSTLFSGYTDGVIRVW---GIGRY  153
            ADGSTL++GYTDG IRVW   G G Y
Sbjct  309  ADGSTLYTGYTDGTIRVWKVSGFGGY  334


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 51/198 (26%), Positives = 84/198 (42%), Gaps = 36/198 (18%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSN-----------------CKLRSTL  564
            GHN+ V+ +  +P    P +VS S D+++ VW++SN                    R  L
Sbjct  15   GHNDVVTAIA-APIDNSPFVVSSSRDKSLMVWDISNPAPAVATDPDSAPPEYGVPFRR-L  72

Query  563  AGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGK--KLYSLDAGSIIHALCFSPNRY  390
             GH+ +V  V +S DG    SG  DG + LWDL+ G   + +   A  ++       NR 
Sbjct  73   TGHSHFVQDVVLSSDGQFALSGSWDGELRLWDLSTGATTRRFVGHAKDVLSVAFSVDNRQ  132

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKI--IFCTSLSWNAD  216
             + A+ + +IK+W+                E + +  G+  A       + C   S N  
Sbjct  133  IVSASRDNTIKLWNTLG-------------ECKYTIGGDLGAGDGHSGWVSCVRFSPNPL  179

Query  215  GSTLFSGYTDGVIRVWGI  162
              T+ SG  D  ++VW +
Sbjct  180  MPTIVSGSWDRSVKVWNL  197


 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 53/207 (26%), Positives = 86/207 (42%), Gaps = 31/207 (15%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVNTVAVSPDGS  513
            GH+ +V  V  S        +SGSWD  +++W+LS         GH   V +VA S D  
Sbjct  74   GHSHFVQDVVLSSD--GQFALSGSWDGELRLWDLSTGATTRRFVGHAKDVLSVAFSVDNR  131

Query  512  LCASGGKDGVILLWD-LAEGKKLYSLDAGSI------IHALCFSPNRYW---LCAATEAS  363
               S  +D  I LW+ L E K     D G+       +  + FSPN      +  + + S
Sbjct  132  QIVSASRDNTIKLWNTLGECKYTIGGDLGAGDGHSGWVSCVRFSPNPLMPTIVSGSWDRS  191

Query  362  IKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDG  183
            +K+W+L           + K  +++   G          +  +++ + DGS   SG  DG
Sbjct  192  VKVWNL----------TNCKLRTKLEGHGG---------YVNAVAVSPDGSLCASGGKDG  232

Query  182  VIRVWGIGRY*MEEFRRSHMIIGHVCY  102
            V  +W +    M     +  II  +C+
Sbjct  233  VTLLWDLTEGKMLYKLEAGAIIHSLCF  259



>gb|AEO44580.1| receptor for activated C kinase 1 [Dunaliella salina]
Length=318

 Score =   287 bits (735),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 137/196 (70%), Positives = 161/196 (82%), Gaps = 9/196 (5%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            TI+LWNTLGECKY+I + +GH+EWVSCVRFSP T  P IVSG WD+ VKVWNL+NCKL++
Sbjct  129  TIRLWNTLGECKYSIGEPEGHSEWVSCVRFSPMTANPIIVSGGWDKYVKVWNLTNCKLKN  188

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
             L GH+GYVNTV VSPDGSLCASGGKD V +LWDLAEGK+LYSLDAG IIHALCFSPNRY
Sbjct  189  NLIGHSGYVNTVTVSPDGSLCASGGKDNVGMLWDLAEGKRLYSLDAGDIIHALCFSPNRY  248

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGS  210
            WLCAAT +SIKIWDLESKS+V DLR +  +E +  A          + +C SL+W+ADGS
Sbjct  249  WLCAATSSSIKIWDLESKSVVDDLRPEWNKEFKKKA---------TVPYCVSLAWSADGS  299

Query  209  TLFSGYTDGVIRVWGI  162
            TL+SGYTDG+IRVW +
Sbjct  300  TLYSGYTDGMIRVWNV  315


 Score = 56.2 bits (134),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 35/122 (29%), Positives = 58/122 (48%), Gaps = 7/122 (6%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNL-----SNCKLRSTLAGHTGYVNTVAV  528
            GH+ WV+ +          ++S S D+TV VW L     S    + +L GH+ +V  V +
Sbjct  13   GHSGWVTALAAPLDPASNVLLSASRDKTVIVWELERGGDSYGYPKKSLHGHSHFVQDVVI  72

Query  527  SPDGSLCASGGKDGVILLWDLAEGK--KLYSLDAGSIIHALCFSPNRYWLCAATEASIKI  354
            S DG  C SG  DG + LWDL  G   + +      ++       NR  +  + + +I++
Sbjct  73   SSDGQFCLSGSWDGTLRLWDLNTGATTRRFVGHTKDVLSVAFSVDNRQIVSGSRDKTIRL  132

Query  353  WD  348
            W+
Sbjct  133  WN  134



>gb|EMT00770.1| hypothetical protein F775_19376 [Aegilops tauschii]
Length=599

 Score =   296 bits (757),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 144/200 (72%), Positives = 165/200 (83%), Gaps = 16/200 (8%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDG----HNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNC  582
            TIKLWNTLGECKYTI    G    H  WVSCVRFSP+  QPTIVSGSWD+TVKVWNL+NC
Sbjct  71   TIKLWNTLGECKYTIGGDMGGGEGHTGWVSCVRFSPNIQQPTIVSGSWDKTVKVWNLTNC  130

Query  581  KLRSTLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFS  402
            KLRSTLAGH GYVN VAVSPDGSLCASGGKDGV LLWDL+EGK+LY L+AGSIIHALCFS
Sbjct  131  KLRSTLAGHGGYVNAVAVSPDGSLCASGGKDGVTLLWDLSEGKRLYQLEAGSIIHALCFS  190

Query  401  PNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWN  222
            PNRYWLCAATE S+KIWDLESK +V DL+ +++             +KN++++CTSLSW+
Sbjct  191  PNRYWLCAATEESVKIWDLESKHVVQDLKPEVQ------------VSKNQMLYCTSLSWS  238

Query  221  ADGSTLFSGYTDGVIRVWGI  162
            ADGSTL++GYTDG IRV+ I
Sbjct  239  ADGSTLYTGYTDGTIRVFKI  258



>ref|XP_002502835.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO64093.1| predicted protein [Micromonas sp. RCC299]
Length=324

 Score =   287 bits (734),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 138/198 (70%), Positives = 157/198 (79%), Gaps = 10/198 (5%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            TIKLWNTLGECKYTIQ+ +GH EWVSCVRFSP T  P IVSG WD+ VKVWNL+NCKLR+
Sbjct  129  TIKLWNTLGECKYTIQEQEGHTEWVSCVRFSPVTSNPIIVSGGWDKLVKVWNLTNCKLRT  188

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
             L GHTGY+NTV VSPDGSLCASGGKDGV +LWDLAEGK+LYSLDAG II+ALCFSPNRY
Sbjct  189  NLVGHTGYINTVTVSPDGSLCASGGKDGVAMLWDLAEGKRLYSLDAGDIIYALCFSPNRY  248

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGS  210
            WLCAAT++ +KIWDLESKSIV           E+  E      K+   FCTSL W++DG+
Sbjct  249  WLCAATQSCVKIWDLESKSIV----------DELHPEFPPVGKKSIPPFCTSLQWSSDGA  298

Query  209  TLFSGYTDGVIRVWGIGR  156
            TLF+GYTD  IRVW + R
Sbjct  299  TLFTGYTDCQIRVWTVSR  316


 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 52/208 (25%), Positives = 86/208 (41%), Gaps = 31/208 (15%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAV  528
            GH  WV+ +          ++S S D+TV +W L+  +      +  L GH+ +V  V +
Sbjct  13   GHEGWVTSLATPLDNNSDMLLSSSRDKTVILWTLTREEGNYGYAQKALRGHSHFVQDVVI  72

Query  527  SPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSI-IHALCFS-PNRYWLCAATEASIKI  354
            S DG    SG  DG + LWDL  G         S  + ++ FS  NR  +  + + +IK+
Sbjct  73   SSDGQFALSGSWDGTLRLWDLNTGSTTRRFVGHSKDVLSVAFSVDNRQIVSGSRDKTIKL  132

Query  353  WDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  180
            W+   E K  +        QE E   E          + C   S       + SG  D +
Sbjct  133  WNTLGECKYTI--------QEQEGHTE---------WVSCVRFSPVTSNPIIVSGGWDKL  175

Query  179  IRVWGIGRY*MEEFRRSHMIIGHVCYLS  96
            ++VW      +   +    ++GH  Y++
Sbjct  176  VKVWN-----LTNCKLRTNLVGHTGYIN  198



>ref|XP_003060952.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH54602.1| predicted protein [Micromonas pusilla CCMP1545]
Length=325

 Score =   286 bits (733),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 138/198 (70%), Positives = 158/198 (80%), Gaps = 10/198 (5%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            TIKLWNTLGECKYTIQ+ +GH EWVSCVRFSP T  P IVSG WD+ VKVWNL+NCKLR+
Sbjct  128  TIKLWNTLGECKYTIQEQEGHTEWVSCVRFSPVTSNPIIVSGGWDKLVKVWNLTNCKLRT  187

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
             L GHTGY+NTV VSPDGSLCASGGKDGV +LWDLAEGK+LY+LDAG II+ALCFSPNRY
Sbjct  188  NLVGHTGYINTVTVSPDGSLCASGGKDGVAMLWDLAEGKRLYTLDAGDIIYALCFSPNRY  247

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGS  210
            WLCAAT++ +KIWDLESKSIV           E+  E      K+   FCTSL+W+ADG 
Sbjct  248  WLCAATQSCVKIWDLESKSIV----------DELHPEFPPVGKKSIPPFCTSLNWSADGG  297

Query  209  TLFSGYTDGVIRVWGIGR  156
            TLF+GYTD +IRVW + R
Sbjct  298  TLFTGYTDCLIRVWTVNR  315



>ref|XP_010480509.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein A, partial [Camelina sativa]
Length=232

 Score =   282 bits (722),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 136/169 (80%), Positives = 149/169 (88%), Gaps = 2/169 (1%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDG--DGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKL  576
            TIKLWNTLGECKYTI +G  DGH +WVSCVRFSP+TLQPTIVS SWD+TVKVWNLSNCKL
Sbjct  61   TIKLWNTLGECKYTISEGGGDGHRDWVSCVRFSPNTLQPTIVSASWDKTVKVWNLSNCKL  120

Query  575  RSTLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPN  396
            RSTLAGHTGYV+TVAVSPDGSLCASGGKDGV+LLWDLAEGKKLYS +A S+IHALCFSPN
Sbjct  121  RSTLAGHTGYVSTVAVSPDGSLCASGGKDGVVLLWDLAEGKKLYSFEANSVIHALCFSPN  180

Query  395  RYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKI  249
            RYWLCAATE  IKIWDLESK+IV DL+VDLK E+E +      A K K+
Sbjct  181  RYWLCAATEQGIKIWDLESKTIVEDLKVDLKAEAEKADNSGPAATKRKV  229



>ref|XP_002967499.1| hypothetical protein SELMODRAFT_144795 [Selaginella moellendorffii]
 gb|EFJ32098.1| hypothetical protein SELMODRAFT_144795 [Selaginella moellendorffii]
Length=315

 Score =   282 bits (722),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 133/198 (67%), Positives = 157/198 (79%), Gaps = 13/198 (7%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            +IKLWNTLGECKYTIQD D H  WVSCVRFSP T  P IVSG WD+ VKVWNL+NCKLR+
Sbjct  131  SIKLWNTLGECKYTIQDQDSHTGWVSCVRFSPVTTNPIIVSGGWDKMVKVWNLTNCKLRT  190

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
             LAGH+GYVN+V VSPDGSLCASGGKDGV +LWDLAEGK+LYSLDAG IIH+LCFSPNRY
Sbjct  191  NLAGHSGYVNSVTVSPDGSLCASGGKDGVAMLWDLAEGKRLYSLDAGDIIHSLCFSPNRY  250

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGS  210
            WLCAAT+  +KIWDLESK+IV +++ +               +K +  +CT+L+W+ DGS
Sbjct  251  WLCAATQQCVKIWDLESKNIVEEIKPE-------------QVSKKEPTYCTTLNWSMDGS  297

Query  209  TLFSGYTDGVIRVWGIGR  156
             LF+GYTDGVIRV  +G 
Sbjct  298  KLFAGYTDGVIRVHSVGH  315


 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 58/210 (28%), Positives = 88/210 (42%), Gaps = 33/210 (16%)
 Frame = -3

Query  749  TIKLWNT----LGECKYTIQDGD--GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLS  588
            ++ LWNT    L E  + +      GH  +V  V  S  +     +SGSWD T+++W+L+
Sbjct  39   SVLLWNTQHKDLTEQDFGLPQRRLTGHAHFVQDVVISSDS--QFALSGSWDGTLRLWDLA  96

Query  587  NCKLRSTLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSI---IH  417
            N        GHT  V +VA S D     SG +D  I LW+     K    D  S    + 
Sbjct  97   NGNTTRRFVGHTKDVLSVAFSADNRQIVSGSRDKSIKLWNTLGECKYTIQDQDSHTGWVS  156

Query  416  ALCFSP---NRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKII  246
             + FSP   N   +    +  +K+W+L +      LR +L   S                
Sbjct  157  CVRFSPVTTNPIIVSGGWDKMVKVWNLTN----CKLRTNLAGHSG---------------  197

Query  245  FCTSLSWNADGSTLFSGYTDGVIRVWGIGR  156
            +  S++ + DGS   SG  DGV  +W +  
Sbjct  198  YVNSVTVSPDGSLCASGGKDGVAMLWDLAE  227



>ref|XP_005652002.1| WD40 repeat-like protein [Coccomyxa subellipsoidea C-169]
 gb|EIE27458.1| WD40 repeat-like protein [Coccomyxa subellipsoidea C-169]
Length=317

 Score =   281 bits (720),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 133/196 (68%), Positives = 156/196 (80%), Gaps = 10/196 (5%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            TIKLWNT+GECKYTI + DGH EWVSCVRFSP T  P IVS  WD+ VKVWNL+NCKLR+
Sbjct  129  TIKLWNTIGECKYTIAEPDGHTEWVSCVRFSPVTNNPIIVSAGWDKLVKVWNLTNCKLRA  188

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
             L GH+GY+NTV VSPDGSLCASGGKDGV +LWDLAEGK+LY+L+AG IIHALCFSPNRY
Sbjct  189  NLQGHSGYINTVTVSPDGSLCASGGKDGVAMLWDLAEGKRLYNLEAGEIIHALCFSPNRY  248

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGS  210
            WLCAAT   IKIWDLESKSIV +L+ D  +             K ++ +C SL+W+ADG+
Sbjct  249  WLCAATTNCIKIWDLESKSIVDELKPDFGE----------LGKKAQVPYCVSLAWSADGA  298

Query  209  TLFSGYTDGVIRVWGI  162
            TL+SGYT+G I VWG+
Sbjct  299  TLYSGYTNGKIEVWGV  314


 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 40/134 (30%), Positives = 66/134 (49%), Gaps = 7/134 (5%)
 Frame = -3

Query  728  LGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTL  564
            + E  Y     +GH  WV+ +         TI+S S D+T+ VW L+  +      + +L
Sbjct  1    MAETLYHRGSLEGHAGWVTSIATPLDPNSDTILSSSRDKTILVWTLTREEGNYGFAKRSL  60

Query  563  AGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYS-LDAGSIIHALCFS-PNRY  390
             GH+ +V  V +S DG    SG  DG + LWDL+ G+     L     + ++ FS  NR 
Sbjct  61   KGHSHFVEDVVISSDGQFALSGSWDGTLRLWDLSTGQTTRRFLGHSKDVLSVAFSMDNRQ  120

Query  389  WLCAATEASIKIWD  348
             +  + + +IK+W+
Sbjct  121  IVSGSRDKTIKLWN  134


 Score = 52.8 bits (125),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 52/185 (28%), Positives = 81/185 (44%), Gaps = 27/185 (15%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVNTVAVSPDGS  513
            GH+ +V  V  S        +SGSWD T+++W+LS  +      GH+  V +VA S D  
Sbjct  62   GHSHFVEDVVISSD--GQFALSGSWDGTLRLWDLSTGQTTRRFLGHSKDVLSVAFSMDNR  119

Query  512  LCASGGKDGVILLWD-LAEGKKLYSLDAGSIIHALC--FSP---NRYWLCAATEASIKIW  351
               SG +D  I LW+ + E K   +   G      C  FSP   N   + A  +  +K+W
Sbjct  120  QIVSGSRDKTIKLWNTIGECKYTIAEPDGHTEWVSCVRFSPVTNNPIIVSAGWDKLVKVW  179

Query  350  DLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRV  171
            +L +      LR +L+  S                +  +++ + DGS   SG  DGV  +
Sbjct  180  NLTN----CKLRANLQGHSG---------------YINTVTVSPDGSLCASGGKDGVAML  220

Query  170  WGIGR  156
            W +  
Sbjct  221  WDLAE  225



>ref|XP_003569582.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein A [Brachypodium distachyon]
Length=331

 Score =   280 bits (716),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 140/203 (69%), Positives = 164/203 (81%), Gaps = 16/203 (8%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNE----WVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNC  582
            TIKLWNTLGECKYTI    G  E    WVSCVRFSP+T  PTIVSGSWDR+VKVWNL+NC
Sbjct  137  TIKLWNTLGECKYTIGGDHGGGEGHTGWVSCVRFSPNTFVPTIVSGSWDRSVKVWNLTNC  196

Query  581  KLRSTLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFS  402
            K+RSTL GH GYV+ VAVSPDGSLCASGGKDGV LLWDLAEGK+LYSLDAG+II++LCFS
Sbjct  197  KIRSTLDGHGGYVSAVAVSPDGSLCASGGKDGVTLLWDLAEGKRLYSLDAGAIINSLCFS  256

Query  401  PNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWN  222
            PNRYWLCAAT+ SIKIWDLESK +V DLR ++              +KN++++CT LSW+
Sbjct  257  PNRYWLCAATQDSIKIWDLESKHVVQDLRPEVP------------VSKNQMLYCTCLSWS  304

Query  221  ADGSTLFSGYTDGVIRVWGIGRY  153
            ADGSTL++GYTDG IR++ I  +
Sbjct  305  ADGSTLYAGYTDGTIRIYKISGF  327


 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 39/130 (30%), Positives = 65/130 (50%), Gaps = 17/130 (13%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRST-------------LAGHT  552
            GHN+ V+ +  +P    P IVS S D+++ VW+L+N  +++T             L GH 
Sbjct  15   GHNDVVTAIA-TPIDNSPFIVSSSRDKSLLVWDLTN-PIQATQDSSSEYGIPFRRLTGHG  72

Query  551  GYVNTVAVSPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCA  378
             +V  V +S DG    SG  DG + LWDL+ G   + +      ++       NR  + A
Sbjct  73   HFVQDVVLSSDGQFALSGSWDGELRLWDLSTGVTTRRFVGHEKDVLSVAFSVDNRQIVSA  132

Query  377  ATEASIKIWD  348
            + + +IK+W+
Sbjct  133  SRDRTIKLWN  142



>ref|XP_002960209.1| hypothetical protein SELMODRAFT_266532 [Selaginella moellendorffii]
 gb|EFJ37748.1| hypothetical protein SELMODRAFT_266532 [Selaginella moellendorffii]
Length=310

 Score =   279 bits (713),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 132/198 (67%), Positives = 155/198 (78%), Gaps = 18/198 (9%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            +IKLWNTLGECKYTIQD D H  WVSCVRFSP T  P IVSG WD+ VKVWNL+NCKLR+
Sbjct  131  SIKLWNTLGECKYTIQDQDSHTGWVSCVRFSPVTTNPIIVSGGWDKMVKVWNLTNCKLRT  190

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
             LAGH+GYVN+V VSPDGSLCASGGKDGV +LWDLAEGK+LYSLDAG IIH+LCFSPNRY
Sbjct  191  NLAGHSGYVNSVTVSPDGSLCASGGKDGVAMLWDLAEGKRLYSLDAGDIIHSLCFSPNRY  250

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGS  210
            WLCAAT+  +KIWDLESK+IV +++ +                  +  +CT+L+W+ DGS
Sbjct  251  WLCAATQQCVKIWDLESKNIVEEIKPE------------------QPTYCTTLNWSMDGS  292

Query  209  TLFSGYTDGVIRVWGIGR  156
             LF+GYTDGVIRV  +G 
Sbjct  293  KLFAGYTDGVIRVHSVGH  310


 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 58/210 (28%), Positives = 88/210 (42%), Gaps = 33/210 (16%)
 Frame = -3

Query  749  TIKLWNT----LGECKYTIQDGD--GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLS  588
            ++ LWNT    L E  + +      GH  +V  V  S  +     +SGSWD T+++W+L+
Sbjct  39   SVLLWNTQHKDLTEQDFGLPQRRLTGHAHFVQDVVISSDS--QFALSGSWDGTLRLWDLA  96

Query  587  NCKLRSTLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSI---IH  417
            N        GHT  V +VA S D     SG +D  I LW+     K    D  S    + 
Sbjct  97   NGNTTRRFVGHTKDVLSVAFSADNRQIVSGSRDKSIKLWNTLGECKYTIQDQDSHTGWVS  156

Query  416  ALCFSP---NRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKII  246
             + FSP   N   +    +  +K+W+L +      LR +L   S                
Sbjct  157  CVRFSPVTTNPIIVSGGWDKMVKVWNLTN----CKLRTNLAGHSG---------------  197

Query  245  FCTSLSWNADGSTLFSGYTDGVIRVWGIGR  156
            +  S++ + DGS   SG  DGV  +W +  
Sbjct  198  YVNSVTVSPDGSLCASGGKDGVAMLWDLAE  227



>gb|KIY98327.1| Guanine nucleotide-binding protein subunit beta-like protein 
[Monoraphidium neglectum]
Length=319

 Score =   279 bits (713),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 134/194 (69%), Positives = 155/194 (80%), Gaps = 9/194 (5%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            TIKLWNTLGECKYTI + +GH+EWVSCVRFSP T  P IVSG WD+ VKV+NLSNCKL+ 
Sbjct  129  TIKLWNTLGECKYTIAEPEGHSEWVSCVRFSPMTNNPIIVSGGWDKLVKVFNLSNCKLKC  188

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
             L GH GY+NTV VSPDGSLCASGGKDGV +LWDLAEGK+LYSLDAG IIH+L FSPNRY
Sbjct  189  NLVGHAGYINTVTVSPDGSLCASGGKDGVAMLWDLAEGKRLYSLDAGDIIHSLVFSPNRY  248

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGS  210
            WLCAAT+ SIKIWDLESKS+V DLR +  +             K  I +C SL+W+ADGS
Sbjct  249  WLCAATQTSIKIWDLESKSVVDDLRPEFSK---------TFGKKATIPYCVSLAWSADGS  299

Query  209  TLFSGYTDGVIRVW  168
            TL++GY+DG IRV+
Sbjct  300  TLYAGYSDGDIRVF  313


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 36/122 (30%), Positives = 55/122 (45%), Gaps = 7/122 (6%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKL-----RSTLAGHTGYVNTVAV  528
            GH  WV+ +          I+S S D+TV VW L   +         L GH+ +V  V +
Sbjct  13   GHRGWVTAIATPLDPNADVILSASRDKTVIVWKLDRSETNYGVAHKALKGHSHFVQDVVI  72

Query  527  SPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKI  354
            S DG    SG  DG + LWDL +G   + +      ++       NR  +  A + +IK+
Sbjct  73   SSDGQFALSGSWDGTLRLWDLQQGTTTRRFVGHTKDVLSVAFSVDNRQIVSGARDKTIKL  132

Query  353  WD  348
            W+
Sbjct  133  WN  134



>ref|XP_005711409.1| receptor for activated protein kinase C [Chondrus crispus]
 emb|CDF41115.1| receptor for activated protein kinase C [Chondrus crispus]
Length=320

 Score =   277 bits (709),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 136/197 (69%), Positives = 154/197 (78%), Gaps = 10/197 (5%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            TIKLWNTLGECKYTIQ+ +GH EWVSCVRFSPST  P IVS  WD+ VKVWNL+NCKLR+
Sbjct  131  TIKLWNTLGECKYTIQE-EGHTEWVSCVRFSPSTQNPLIVSCGWDKLVKVWNLTNCKLRT  189

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
             L  H+GY+N V VSPDGSLCASGGKDGV +LWDL EGK LYSL+A  IIHALCFSPNRY
Sbjct  190  NLHNHSGYLNAVTVSPDGSLCASGGKDGVAMLWDLQEGKHLYSLEANDIIHALCFSPNRY  249

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGS  210
            WLCAAT + IKIWDLESK++V +LR D         +  +   K     C SL+W+ADGS
Sbjct  250  WLCAATNSCIKIWDLESKTVVDELRDD---------QAESIGKKAAQPACISLTWSADGS  300

Query  209  TLFSGYTDGVIRVWGIG  159
            TLFSGYTD VIRVWG+G
Sbjct  301  TLFSGYTDNVIRVWGVG  317


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 53/194 (27%), Positives = 79/194 (41%), Gaps = 26/194 (13%)
 Frame = -3

Query  728  LGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTG  549
            LG   Y  +   GH  +VS V  S        +S SWD T+++W+LS         GH+ 
Sbjct  52   LGSYGYPKRALRGHGHFVSDVVLSSD--GQFALSSSWDHTLRLWDLSTGVTTRRFVGHSK  109

Query  548  YVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALC--FSP---NRYWL  384
             V +VA S D     SG +D  I LW+     K    + G      C  FSP   N   +
Sbjct  110  DVLSVAFSADNRQIVSGSRDRTIKLWNTLGECKYTIQEEGHTEWVSCVRFSPSTQNPLIV  169

Query  383  CAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTL  204
                +  +K+W+L +      LR +L   S                +  +++ + DGS  
Sbjct  170  SCGWDKLVKVWNLTN----CKLRTNLHNHSG---------------YLNAVTVSPDGSLC  210

Query  203  FSGYTDGVIRVWGI  162
             SG  DGV  +W +
Sbjct  211  ASGGKDGVAMLWDL  224



>dbj|BAJ98167.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=332

 Score =   277 bits (709),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 139/203 (68%), Positives = 160/203 (79%), Gaps = 16/203 (8%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDG----HNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNC  582
            TIKLWNTLGECKYTI    G    H  WVSCVRFSP+   PTIVSGSWDR+VKVWNL+NC
Sbjct  138  TIKLWNTLGECKYTIGGDLGGGEGHTGWVSCVRFSPNNFAPTIVSGSWDRSVKVWNLTNC  197

Query  581  KLRSTLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFS  402
            KLR TL GH GYV+ VAVSPDGSLCASGGKDGV LLWDL EGK+LYSLDAGSII++LCFS
Sbjct  198  KLRCTLDGHGGYVSAVAVSPDGSLCASGGKDGVTLLWDLTEGKRLYSLDAGSIINSLCFS  257

Query  401  PNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWN  222
            PNRYWLCAAT+ SIKIWDLESK IV DLR ++   S+            ++++CT LSW+
Sbjct  258  PNRYWLCAATQDSIKIWDLESKHIVQDLRPEVPVSSK------------QMLYCTCLSWS  305

Query  221  ADGSTLFSGYTDGVIRVWGIGRY  153
            ADGSTL++GYTDG IR++ I  +
Sbjct  306  ADGSTLYAGYTDGTIRIYKISGF  328


 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 48/192 (25%), Positives = 83/192 (43%), Gaps = 28/192 (15%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRST-------------LAGHT  552
            GHN+ V+ +  +P    P IVS S D+++ VW+L+N  +++T             L GH 
Sbjct  16   GHNDVVTAIA-TPIDNSPFIVSSSRDKSLLVWDLTN-PIQATQDTSSEYGVPFRRLTGHG  73

Query  551  GYVNTVAVSPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCA  378
             +V  V +S DG    SG  DG + LWDL+ G   + +      ++       NR  + A
Sbjct  74   HFVQDVVLSSDGQFALSGSWDGELRLWDLSTGVTTRRFVGHEKDVLSVAFSIDNRQIVSA  133

Query  377  ATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFS  198
            + + +IK+W+   +            +  +  +          + C   S N    T+ S
Sbjct  134  SRDRTIKLWNTLGEC-----------KYTIGGDLGGGEGHTGWVSCVRFSPNNFAPTIVS  182

Query  197  GYTDGVIRVWGI  162
            G  D  ++VW +
Sbjct  183  GSWDRSVKVWNL  194



>emb|CDM83867.1| unnamed protein product [Triticum aestivum]
Length=332

 Score =   276 bits (707),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 138/203 (68%), Positives = 159/203 (78%), Gaps = 16/203 (8%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDG----HNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNC  582
            TIKLWNTLGECKYTI    G    H  WVSCVRFSP+   PTIVSGSWDR+VKVWNL+NC
Sbjct  138  TIKLWNTLGECKYTIGGDLGGGEGHTGWVSCVRFSPNNFAPTIVSGSWDRSVKVWNLTNC  197

Query  581  KLRSTLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFS  402
            KLR TL GH GYV+ VAVSPDGSLCASGGKDGV LLWDL EGK+LYSLDAGSII++LCFS
Sbjct  198  KLRCTLDGHGGYVSAVAVSPDGSLCASGGKDGVTLLWDLTEGKRLYSLDAGSIINSLCFS  257

Query  401  PNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWN  222
            PNRYWLCAAT+ SIKIWDLESK IV DLR ++              +  ++++CT LSW+
Sbjct  258  PNRYWLCAATQDSIKIWDLESKHIVQDLRPEVP------------VSTKQMLYCTCLSWS  305

Query  221  ADGSTLFSGYTDGVIRVWGIGRY  153
            ADGSTL++GYTDG IR++ I  +
Sbjct  306  ADGSTLYAGYTDGTIRIYKISGF  328


 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 48/192 (25%), Positives = 83/192 (43%), Gaps = 28/192 (15%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRST-------------LAGHT  552
            GHN+ V+ +  +P    P IVS S D+++ VW+L+N  +++T             L GH 
Sbjct  16   GHNDVVTAIA-TPIDNSPFIVSSSRDKSLLVWDLTN-PIQATQDSSSEYGVPFRRLTGHG  73

Query  551  GYVNTVAVSPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCA  378
             +V  V +S DG    SG  DG + LWDL+ G   + +      ++       NR  + A
Sbjct  74   HFVQDVVLSSDGQFALSGSWDGELRLWDLSTGVTTRRFVGHEKDVLSVAFSIDNRQIVSA  133

Query  377  ATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFS  198
            + + +IK+W+   +            +  +  +          + C   S N    T+ S
Sbjct  134  SRDRTIKLWNTLGEC-----------KYTIGGDLGGGEGHTGWVSCVRFSPNNFAPTIVS  182

Query  197  GYTDGVIRVWGI  162
            G  D  ++VW +
Sbjct  183  GSWDRSVKVWNL  194



>gb|KDD72035.1| hypothetical protein H632_c3969p0, partial [Helicosporidium sp. 
ATCC 50920]
Length=262

 Score =   273 bits (698),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 127/198 (64%), Positives = 157/198 (79%), Gaps = 10/198 (5%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            TIKLWNTL ECKYT+ +  GH  WVSCVR SP    P +VS SWD+TVK+W+L++CKLR+
Sbjct  74   TIKLWNTLAECKYTMAEPSGHTGWVSCVRLSPVGATPVVVSASWDKTVKIWDLASCKLRA  133

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
            TL+GH GYVN V +SPDGSLCASGGKDG  +LWDLAEGK+LY+L+AG +IH+L FSPNRY
Sbjct  134  TLSGHEGYVNAVTISPDGSLCASGGKDGSAMLWDLAEGKQLYTLEAGDVIHSLVFSPNRY  193

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGS  210
            WLCAAT++ IKIWDLE KS+V DLR +L + S          AK ++ +  SL+W+ADGS
Sbjct  194  WLCAATQSGIKIWDLEFKSVVDDLRPELPERS----------AKAQVPYPISLTWSADGS  243

Query  209  TLFSGYTDGVIRVWGIGR  156
            TL++GYTDGVIRVW +GR
Sbjct  244  TLYAGYTDGVIRVWQVGR  261



>ref|XP_007508318.1| predicted protein [Bathycoccus prasinos]
 emb|CCO20422.1| predicted protein [Bathycoccus prasinos]
Length=318

 Score =   275 bits (702),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 130/198 (66%), Positives = 154/198 (78%), Gaps = 10/198 (5%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            TIKLWNTLGECKYTIQ+ +GH EWVSCVRFSP+   P IVS  WD+ VKVWNL+NCKLR+
Sbjct  127  TIKLWNTLGECKYTIQEHEGHTEWVSCVRFSPAPSNPIIVSCGWDKLVKVWNLNNCKLRT  186

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
             L GHTGY+NTV VSPDGSLCASGGKDGV +LWDLAEGK+LYSLDAG II+++CFSPNRY
Sbjct  187  NLVGHTGYINTVTVSPDGSLCASGGKDGVAMLWDLAEGKRLYSLDAGDIIYSMCFSPNRY  246

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGS  210
            WLCAAT++ +KIWDLESKSIV           E+  E      K+    CTSL W+ADG 
Sbjct  247  WLCAATQSCVKIWDLESKSIV----------DELHPEFPPVGKKSMPPHCTSLQWSADGQ  296

Query  209  TLFSGYTDGVIRVWGIGR  156
            TL++GY+D  +RV+ + R
Sbjct  297  TLYTGYSDNKVRVYVVSR  314


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 36/123 (29%), Positives = 61/123 (50%), Gaps = 8/123 (7%)
 Frame = -3

Query  695  DGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVA  531
            +GH  WV+ +  +P      +++ S D++V +W L+  +      R  L GH+ +V  V 
Sbjct  11   EGHEGWVTSIA-TPLDNSDILLTSSRDKSVILWTLTREEGNYGYPRRRLHGHSHFVQDVV  69

Query  530  VSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSI-IHALCFS-PNRYWLCAATEASIK  357
            +S DG    SG  DG + LWDL  G         S  + ++ FS  NR  +  + + +IK
Sbjct  70   ISSDGQFALSGSWDGTLRLWDLNSGTTTRRFVGHSKDVLSVAFSVDNRQIVSGSRDKTIK  129

Query  356  IWD  348
            +W+
Sbjct  130  LWN  132



>ref|XP_010926201.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein A [Elaeis guineensis]
Length=299

 Score =   269 bits (687),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 127/169 (75%), Positives = 142/169 (84%), Gaps = 12/169 (7%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            TIKLWNTLGECKYTIQD D H  WVSCVRFSP+T QPTIVSGSWDRTVKVWNL++CKLRS
Sbjct  142  TIKLWNTLGECKYTIQDADAHTNWVSCVRFSPNTSQPTIVSGSWDRTVKVWNLTSCKLRS  201

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
            TL GH GYVN VAVSPDGSLCASGGKDGV LLWDLAEG++LYSLDAG+IIH LCFSP+RY
Sbjct  202  TLTGHGGYVNAVAVSPDGSLCASGGKDGVALLWDLAEGRRLYSLDAGAIIHGLCFSPSRY  261

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIF  243
            WLCAAT+ S+KIWDLESKSIV DLR ++              +KN+++F
Sbjct  262  WLCAATQDSVKIWDLESKSIVQDLRPEMP------------TSKNQVLF  298


 Score = 56.2 bits (134),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 51/200 (26%), Positives = 82/200 (41%), Gaps = 41/200 (21%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKL-------------------RS  570
            GH++ V+ +  +P      IVS S D++V VW+L+                       R 
Sbjct  13   GHSDVVTAIA-TPLDNSDMIVSSSRDKSVLVWHLTKASPVAVAGDSSATSAVPSYGVPRR  71

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPN  396
             L GH+ +V  V +S DG    SG  DG + LWDLA G   + +   +  ++  +    N
Sbjct  72   RLTGHSHFVEDVVLSSDGQFALSGSWDGELRLWDLATGTTTRRFVGHSKDVLSVVLSVDN  131

Query  395  RYWLCAATEASIKIWDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWN  222
            R  + A+ + +IK+W+   E K  + D                   A    + C   S N
Sbjct  132  RQIVSASRDRTIKLWNTLGECKYTIQD-----------------ADAHTNWVSCVRFSPN  174

Query  221  ADGSTLFSGYTDGVIRVWGI  162
                T+ SG  D  ++VW +
Sbjct  175  TSQPTIVSGSWDRTVKVWNL  194



>ref|XP_002903189.1| guanine nucleotide-binding protein subunit beta-2-like protein 
[Phytophthora infestans T30-4]
 ref|XP_008893306.1| guanine nucleotide-binding protein subunit beta-like protein 
[Phytophthora parasitica INRA-310]
 gb|EEY55613.1| guanine nucleotide-binding protein subunit beta-2-like protein 
[Phytophthora infestans T30-4]
 gb|ETK85071.1| guanine nucleotide-binding protein subunit beta-like protein 
[Phytophthora parasitica]
 gb|ETL38496.1| guanine nucleotide-binding protein subunit beta-like protein 
[Phytophthora parasitica]
 gb|ETL91623.1| guanine nucleotide-binding protein subunit beta-like protein 
[Phytophthora parasitica]
 gb|ETN21521.1| guanine nucleotide-binding protein subunit beta-like protein 
[Phytophthora parasitica INRA-310]
 gb|ETO73708.1| guanine nucleotide-binding protein subunit beta-like protein 
[Phytophthora parasitica P1976]
 gb|ETP14913.1| guanine nucleotide-binding protein subunit beta-like protein 
[Phytophthora parasitica CJ01A1]
Length=317

 Score =   269 bits (687),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 130/197 (66%), Positives = 153/197 (78%), Gaps = 10/197 (5%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            T+KLWNTLGECKYTI + DGH EWVSCVRFSPST  P IVS  WD+ VK+WNLSNCKLR+
Sbjct  130  TVKLWNTLGECKYTITE-DGHTEWVSCVRFSPSTANPLIVSCGWDKVVKIWNLSNCKLRT  188

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
             L GH GY+NTV VSPDGS+CASGGKDG   LWDL EGK+LYSL AG +IHAL FSPNRY
Sbjct  189  NLFGHEGYLNTVTVSPDGSICASGGKDGTANLWDLNEGKRLYSLVAGDVIHALIFSPNRY  248

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGS  210
            WLCAAT + IKIWDLESK +V DL+ ++++     A+  +         C SL+W+ADGS
Sbjct  249  WLCAATTSGIKIWDLESKIVVHDLQPEIEEPKGKYAQPPH---------CISLAWSADGS  299

Query  209  TLFSGYTDGVIRVWGIG  159
             LFSGYTDG++RVW +G
Sbjct  300  VLFSGYTDGIVRVWAVG  316


 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 38/133 (29%), Positives = 63/133 (47%), Gaps = 15/133 (11%)
 Frame = -3

Query  713  YTIQDGDGHN----EWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLA  561
            Y   + DGHN      ++  R +P+ L    ++ S D+++ VW LSN        R  L 
Sbjct  7    YPRAELDGHNGKAVTAIATTRENPNLL----LTASRDKSLLVWQLSNDGEEYGFARRRLQ  62

Query  560  GHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYW  387
            GH+ YV  V +S DG    SG  DG + LWDL  G   + +      ++     + NR  
Sbjct  63   GHSHYVEDVVISSDGQFALSGSWDGTLRLWDLNTGITTRRFVGHTKDVLSVAFSADNRQI  122

Query  386  LCAATEASIKIWD  348
            +  + + ++K+W+
Sbjct  123  VSGSRDKTVKLWN  135


 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 58/219 (26%), Positives = 93/219 (42%), Gaps = 30/219 (14%)
 Frame = -3

Query  743  KLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTL  564
            +L N   E  +  +   GH+ +V  V  S        +SGSWD T+++W+L+        
Sbjct  46   QLSNDGEEYGFARRRLQGHSHYVEDVVISSD--GQFALSGSWDGTLRLWDLNTGITTRRF  103

Query  563  AGHTGYVNTVAVSPDGSLCASGGKDGVILLWD-LAEGKKLYSLDAGSI-IHALCFSP---  399
             GHT  V +VA S D     SG +D  + LW+ L E K   + D  +  +  + FSP   
Sbjct  104  VGHTKDVLSVAFSADNRQIVSGSRDKTVKLWNTLGECKYTITEDGHTEWVSCVRFSPSTA  163

Query  398  NRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNA  219
            N   +    +  +KIW+L +      LR +L        EG          +  +++ + 
Sbjct  164  NPLIVSCGWDKVVKIWNLSN----CKLRTNL-----FGHEG----------YLNTVTVSP  204

Query  218  DGSTLFSGYTDGVIRVWGIGRY*MEEFRRSHMIIGHVCY  102
            DGS   SG  DG   +W +     E  R   ++ G V +
Sbjct  205  DGSICASGGKDGTANLWDLN----EGKRLYSLVAGDVIH  239



>ref|XP_009836542.1| guanine nucleotide-binding protein subunit beta-like protein 
[Aphanomyces astaci]
 gb|ETV74029.1| guanine nucleotide-binding protein subunit beta-like protein 
[Aphanomyces astaci]
Length=318

 Score =   268 bits (686),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 131/197 (66%), Positives = 154/197 (78%), Gaps = 11/197 (6%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            +IKLWNTLGECKYTI + +GH EWVSCVRFSPS+  P IVS  WDR VKVWNL+NCKLR+
Sbjct  131  SIKLWNTLGECKYTITE-EGHTEWVSCVRFSPSSANPLIVSAGWDRLVKVWNLTNCKLRT  189

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
             L GHTGY+NTV VSPDGSLCASGGKDGV +LWDL EGK+LYSL+A  IIHAL FSPNRY
Sbjct  190  NLCGHTGYLNTVTVSPDGSLCASGGKDGVAMLWDLNEGKRLYSLEANDIIHALVFSPNRY  249

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGS  210
            WL AAT ++IKIWDLESK +VVD         E+  E  N   K++     SL+W+ADG 
Sbjct  250  WLVAATSSAIKIWDLESK-VVVD---------ELVPEFENVGKKSQPPHAVSLAWSADGQ  299

Query  209  TLFSGYTDGVIRVWGIG  159
            TLF+GYTDG++RV+ +G
Sbjct  300  TLFAGYTDGIVRVYAVG  316


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 38/127 (30%), Positives = 62/127 (49%), Gaps = 13/127 (10%)
 Frame = -3

Query  698  GDGHNEWVSCVRFSPSTLQPT-IVSGSWDRTVKVWNLSNCK-------LRSTLAGHTGYV  543
            G G N WV+ +  + S   P  +V+ S D++V VW L++          R  L GH+ +V
Sbjct  13   GHGKN-WVTAI--ATSRENPNLVVTSSRDKSVLVWQLTHDADPDNYGYARRRLTGHSHFV  69

Query  542  NTVAVSPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATE  369
              V +S DG    SG  DG + LWDL  G   + +   +  ++     + NR  +  + +
Sbjct  70   EDVVISSDGQFALSGSWDGTLRLWDLNTGITTRRFVGHSKDVLSVAFSADNRQIVSGSRD  129

Query  368  ASIKIWD  348
             SIK+W+
Sbjct  130  RSIKLWN  136



>gb|ETM44908.1| guanine nucleotide-binding protein subunit beta-like protein, 
partial [Phytophthora parasitica]
Length=334

 Score =   269 bits (687),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 130/197 (66%), Positives = 153/197 (78%), Gaps = 10/197 (5%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            T+KLWNTLGECKYTI + DGH EWVSCVRFSPST  P IVS  WD+ VK+WNLSNCKLR+
Sbjct  147  TVKLWNTLGECKYTITE-DGHTEWVSCVRFSPSTANPLIVSCGWDKVVKIWNLSNCKLRT  205

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
             L GH GY+NTV VSPDGS+CASGGKDG   LWDL EGK+LYSL AG +IHAL FSPNRY
Sbjct  206  NLFGHEGYLNTVTVSPDGSICASGGKDGTANLWDLNEGKRLYSLVAGDVIHALIFSPNRY  265

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGS  210
            WLCAAT + IKIWDLESK +V DL+ ++++     A+  +         C SL+W+ADGS
Sbjct  266  WLCAATTSGIKIWDLESKIVVHDLQPEIEEPKGKYAQPPH---------CISLAWSADGS  316

Query  209  TLFSGYTDGVIRVWGIG  159
             LFSGYTDG++RVW +G
Sbjct  317  VLFSGYTDGIVRVWAVG  333


 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 38/133 (29%), Positives = 63/133 (47%), Gaps = 15/133 (11%)
 Frame = -3

Query  713  YTIQDGDGHN----EWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLA  561
            Y   + DGHN      ++  R +P+ L    ++ S D+++ VW LSN        R  L 
Sbjct  24   YPRAELDGHNGKAVTAIATTRENPNLL----LTASRDKSLLVWQLSNDGEEYGFARRRLQ  79

Query  560  GHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYW  387
            GH+ YV  V +S DG    SG  DG + LWDL  G   + +      ++     + NR  
Sbjct  80   GHSHYVEDVVISSDGQFALSGSWDGTLRLWDLNTGITTRRFVGHTKDVLSVAFSADNRQI  139

Query  386  LCAATEASIKIWD  348
            +  + + ++K+W+
Sbjct  140  VSGSRDKTVKLWN  152


 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 58/219 (26%), Positives = 93/219 (42%), Gaps = 30/219 (14%)
 Frame = -3

Query  743  KLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTL  564
            +L N   E  +  +   GH+ +V  V  S        +SGSWD T+++W+L+        
Sbjct  63   QLSNDGEEYGFARRRLQGHSHYVEDVVISSD--GQFALSGSWDGTLRLWDLNTGITTRRF  120

Query  563  AGHTGYVNTVAVSPDGSLCASGGKDGVILLWD-LAEGKKLYSLDAGSI-IHALCFSP---  399
             GHT  V +VA S D     SG +D  + LW+ L E K   + D  +  +  + FSP   
Sbjct  121  VGHTKDVLSVAFSADNRQIVSGSRDKTVKLWNTLGECKYTITEDGHTEWVSCVRFSPSTA  180

Query  398  NRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNA  219
            N   +    +  +KIW+L +      LR +L        EG          +  +++ + 
Sbjct  181  NPLIVSCGWDKVVKIWNLSN----CKLRTNL-----FGHEG----------YLNTVTVSP  221

Query  218  DGSTLFSGYTDGVIRVWGIGRY*MEEFRRSHMIIGHVCY  102
            DGS   SG  DG   +W +     E  R   ++ G V +
Sbjct  222  DGSICASGGKDGTANLWDLN----EGKRLYSLVAGDVIH  256



>ref|XP_009531042.1| hypothetical protein PHYSODRAFT_355000 [Phytophthora sojae]
 gb|EGZ13613.1| hypothetical protein PHYSODRAFT_355000 [Phytophthora sojae]
Length=317

 Score =   268 bits (684),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 129/197 (65%), Positives = 153/197 (78%), Gaps = 10/197 (5%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            T+KLWNTLGECKYTI + DGH EWVSCVRFSPST  P IVS  WD+ VK+WNLSNCKLR+
Sbjct  130  TVKLWNTLGECKYTITE-DGHTEWVSCVRFSPSTANPLIVSCGWDKVVKIWNLSNCKLRT  188

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
             L GH GY+NTV VSPDGS+CASGGKDG   LWDL EGK+LYSL AG +IHAL FSPNRY
Sbjct  189  NLFGHEGYLNTVTVSPDGSICASGGKDGTANLWDLNEGKRLYSLVAGDVIHALVFSPNRY  248

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGS  210
            WLCAAT + IKIWDLESK +V DL+ ++++     A+  +         C SL+W+ADG+
Sbjct  249  WLCAATTSGIKIWDLESKIVVHDLQPEVEEPKGKYAQPPH---------CISLAWSADGT  299

Query  209  TLFSGYTDGVIRVWGIG  159
             LFSGYTDG++RVW +G
Sbjct  300  VLFSGYTDGIVRVWAVG  316


 Score = 53.5 bits (127),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 38/133 (29%), Positives = 63/133 (47%), Gaps = 15/133 (11%)
 Frame = -3

Query  713  YTIQDGDGHN----EWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLA  561
            Y   + DGHN      ++  R +P+ L    ++ S D+++ VW LSN        R  L 
Sbjct  7    YPRAELDGHNGKAVTALATTRENPNLL----LTASRDKSLLVWQLSNDGEEYGFARRRLQ  62

Query  560  GHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYW  387
            GH+ YV  V +S DG    SG  DG + LWDL  G   + +      ++     + NR  
Sbjct  63   GHSHYVEDVVISSDGQFALSGSWDGTLRLWDLNTGITTRRFVGHTKDVLSVAFSADNRQI  122

Query  386  LCAATEASIKIWD  348
            +  + + ++K+W+
Sbjct  123  VSGSRDKTVKLWN  135


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 58/219 (26%), Positives = 93/219 (42%), Gaps = 30/219 (14%)
 Frame = -3

Query  743  KLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTL  564
            +L N   E  +  +   GH+ +V  V  S        +SGSWD T+++W+L+        
Sbjct  46   QLSNDGEEYGFARRRLQGHSHYVEDVVISSD--GQFALSGSWDGTLRLWDLNTGITTRRF  103

Query  563  AGHTGYVNTVAVSPDGSLCASGGKDGVILLWD-LAEGKKLYSLDAGSI-IHALCFSP---  399
             GHT  V +VA S D     SG +D  + LW+ L E K   + D  +  +  + FSP   
Sbjct  104  VGHTKDVLSVAFSADNRQIVSGSRDKTVKLWNTLGECKYTITEDGHTEWVSCVRFSPSTA  163

Query  398  NRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNA  219
            N   +    +  +KIW+L +      LR +L        EG          +  +++ + 
Sbjct  164  NPLIVSCGWDKVVKIWNLSN----CKLRTNL-----FGHEG----------YLNTVTVSP  204

Query  218  DGSTLFSGYTDGVIRVWGIGRY*MEEFRRSHMIIGHVCY  102
            DGS   SG  DG   +W +     E  R   ++ G V +
Sbjct  205  DGSICASGGKDGTANLWDLN----EGKRLYSLVAGDVIH  239



>ref|XP_011397272.1| Guanine nucleotide-binding protein subunit beta-like protein 
[Auxenochlorella protothecoides]
 gb|KFM24384.1| Guanine nucleotide-binding protein subunit beta-like protein 
[Auxenochlorella protothecoides]
Length=317

 Score =   266 bits (681),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 130/198 (66%), Positives = 154/198 (78%), Gaps = 11/198 (6%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            +IKLWNTL ECK+T+ +  GH EWVSCVR SP +  P IVS SWD+TVKVWNL +CKLR 
Sbjct  130  SIKLWNTLAECKFTVAEPAGHTEWVSCVRLSPVSKPPLIVSASWDKTVKVWNLQDCKLRD  189

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
            TL+GH GY+N+V VSPDGSLCASGGKDGV +LWDL+ GK LYSLDAG++I+AL FSPNRY
Sbjct  190  TLSGHRGYINSVTVSPDGSLCASGGKDGVAMLWDLSVGKHLYSLDAGNVINALVFSPNRY  249

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGS  210
            WLCAAT+  IKIWDLE KS+V DL   L        EG   A + K +   SL+W+ADG+
Sbjct  250  WLCAATDRGIKIWDLEYKSVVDDLDAPL--------EGVEAAKQPKPV---SLAWSADGA  298

Query  209  TLFSGYTDGVIRVWGIGR  156
            TL+SGYTDGVIRVW +GR
Sbjct  299  TLYSGYTDGVIRVWAVGR  316


 Score = 56.2 bits (134),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 50/209 (24%), Positives = 86/209 (41%), Gaps = 32/209 (15%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK------LRSTLAGHTGYVNTVA  531
            GH  WV+ +          +V+ S D++V VW L+  +       R +L GH+ YV  V 
Sbjct  13   GHRGWVTAIAPPLDPNSDLLVTSSRDKSVIVWTLTRGEKEDYGFARRSLRGHSHYVQDVV  72

Query  530  VSPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIK  357
            +S D     SG  DG + LWDL +G   + +      ++     + NR  L  + + SIK
Sbjct  73   LSSDAQYALSGSWDGTMRLWDLNKGTTTRRFLGHTKDVLSVAISADNRQILSGSRDKSIK  132

Query  356  IWDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDG  183
            +W+   E K  V +                  A   + + C  LS  +    + S   D 
Sbjct  133  LWNTLAECKFTVAE-----------------PAGHTEWVSCVRLSPVSKPPLIVSASWDK  175

Query  182  VIRVWGIGRY*MEEFRRSHMIIGHVCYLS  96
             ++VW      +++ +    + GH  Y++
Sbjct  176  TVKVWN-----LQDCKLRDTLSGHRGYIN  199


 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 52/183 (28%), Positives = 81/183 (44%), Gaps = 27/183 (15%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVNTVAVSPDGS  513
            GH+ +V  V  S        +SGSWD T+++W+L+         GHT  V +VA+S D  
Sbjct  63   GHSHYVQDVVLSSDAQY--ALSGSWDGTMRLWDLNKGTTTRRFLGHTKDVLSVAISADNR  120

Query  512  LCASGGKDGVILLWD-LAEGKKLYSLDAG-----SIIHALCFSPNRYWLCAATEASIKIW  351
               SG +D  I LW+ LAE K   +  AG     S +     S     + A+ + ++K+W
Sbjct  121  QILSGSRDKSIKLWNTLAECKFTVAEPAGHTEWVSCVRLSPVSKPPLIVSASWDKTVKVW  180

Query  350  DLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRV  171
            +L+          D K    +S             +  S++ + DGS   SG  DGV  +
Sbjct  181  NLQ----------DCKLRDTLSGHRG---------YINSVTVSPDGSLCASGGKDGVAML  221

Query  170  WGI  162
            W +
Sbjct  222  WDL  224



>gb|KDO19117.1| guanine nucleotide-binding protein subunit beta-2-like 1 [Saprolegnia 
parasitica CBS 223.65]
Length=326

 Score =   267 bits (682),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 131/197 (66%), Positives = 154/197 (78%), Gaps = 11/197 (6%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            +IKLWNTLGECKYTI + +GH EWVSCVRFSPS+  P IVS  WDR VKVWNL+NCKLR+
Sbjct  139  SIKLWNTLGECKYTITE-EGHTEWVSCVRFSPSSANPLIVSCGWDRLVKVWNLTNCKLRT  197

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
             L GHTGY+NTV VSPDGSLCASGGKDGV +LWDL EGK+LY+L+AG IIHAL FSPNRY
Sbjct  198  NLCGHTGYLNTVTVSPDGSLCASGGKDGVAMLWDLNEGKRLYTLEAGDIIHALVFSPNRY  257

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGS  210
            WLCAAT + IKIWDLESK +VVD         E+  E      K+    C SL W+ADG+
Sbjct  258  WLCAATSSGIKIWDLESK-VVVD---------EIVPEFEAVGKKSLPPHCVSLCWSADGA  307

Query  209  TLFSGYTDGVIRVWGIG  159
            +LF+GYTDG++RV+ +G
Sbjct  308  SLFAGYTDGIVRVYAVG  324


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 38/129 (29%), Positives = 62/129 (48%), Gaps = 18/129 (14%)
 Frame = -3

Query  692  GHNE-WVSCV---RFSPSTLQPTIVSGSWDRTVKVWNLSNCK--------LRSTLAGHTG  549
            GH + WV+ +   R +PS     IV+ S D+++ VW L+            R  L GH+ 
Sbjct  20   GHGKAWVTAIATSRENPSM----IVTASRDKSILVWQLTGDSSDLENYGFARRRLQGHSH  75

Query  548  YVNTVAVSPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAA  375
            +V  V +S DG    SG  DG + LWDL  G   + +   +  ++     + NR  +  +
Sbjct  76   FVEDVVISSDGQFALSGSWDGTLRLWDLNTGITTRRFVGHSKDVLSVAFSADNRQIVSGS  135

Query  374  TEASIKIWD  348
             + SIK+W+
Sbjct  136  RDRSIKLWN  144



>ref|XP_008608530.1| guanine nucleotide-binding protein subunit beta-2-like 1 [Saprolegnia 
diclina VS20]
 gb|EQC38203.1| guanine nucleotide-binding protein subunit beta-2-like 1 [Saprolegnia 
diclina VS20]
Length=319

 Score =   266 bits (681),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 131/197 (66%), Positives = 154/197 (78%), Gaps = 11/197 (6%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            +IKLWNTLGECKYTI + +GH EWVSCVRFSPS+  P IVS  WDR VKVWNL+NCKLR+
Sbjct  132  SIKLWNTLGECKYTITE-EGHTEWVSCVRFSPSSANPLIVSCGWDRLVKVWNLTNCKLRT  190

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
             L GHTGY+NTV VSPDGSLCASGGKDGV +LWDL EGK+LY+L+AG IIHAL FSPNRY
Sbjct  191  NLCGHTGYLNTVTVSPDGSLCASGGKDGVAMLWDLNEGKRLYTLEAGDIIHALVFSPNRY  250

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGS  210
            WLCAAT + IKIWDLESK +VVD         E+  E      K+    C SL W+ADG+
Sbjct  251  WLCAATSSGIKIWDLESK-VVVD---------EIVPEFEAVGKKSLPPHCVSLCWSADGA  300

Query  209  TLFSGYTDGVIRVWGIG  159
            +LF+GYTDG++RV+ +G
Sbjct  301  SLFAGYTDGIVRVYAVG  317


 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 38/129 (29%), Positives = 62/129 (48%), Gaps = 18/129 (14%)
 Frame = -3

Query  692  GHNE-WVSCV---RFSPSTLQPTIVSGSWDRTVKVWNLSNCK--------LRSTLAGHTG  549
            GH + WV+ +   R +PS     IV+ S D+++ VW L+            R  L GH+ 
Sbjct  13   GHGKAWVTAIATSRENPSM----IVTASRDKSILVWQLTGDSSDLENYGFARRRLQGHSH  68

Query  548  YVNTVAVSPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAA  375
            +V  V +S DG    SG  DG + LWDL  G   + +   +  ++     + NR  +  +
Sbjct  69   FVEDVVISSDGQFALSGSWDGTLRLWDLNTGITTRRFVGHSKDVLSVAFSADNRQIVSGS  128

Query  374  TEASIKIWD  348
             + SIK+W+
Sbjct  129  RDRSIKLWN  137



>ref|XP_004343796.1| guanine nucleotide-binding protein [Capsaspora owczarzaki ATCC 
30864]
 gb|KJE96804.1| guanine nucleotide-binding protein [Capsaspora owczarzaki ATCC 
30864]
Length=316

 Score =   265 bits (677),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 131/199 (66%), Positives = 155/199 (78%), Gaps = 11/199 (6%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            +I+LWNTLGECK+ IQ+ DGH+EWVS VRFSP+T  P IVS  WDR VKVWNL+NCKLR+
Sbjct  128  SIRLWNTLGECKFVIQE-DGHSEWVSSVRFSPNTSNPNIVSVGWDRVVKVWNLNNCKLRT  186

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
               GHTGYVNTV VSPDGSLCASGGKDGV +LWDL EGK LY+L+AG  I+AL FSPNRY
Sbjct  187  NHYGHTGYVNTVTVSPDGSLCASGGKDGVAMLWDLNEGKHLYTLEAGDEINALVFSPNRY  246

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGS  210
            WLCAA+ ASIKIWDLESK++V DLR           E  +   K+++  C SL+W+ADG 
Sbjct  247  WLCAASGASIKIWDLESKNLVDDLR----------PEFLSVGKKSQLPQCISLAWSADGQ  296

Query  209  TLFSGYTDGVIRVWGIGRY  153
            TLF+GYTD VIRVW + R+
Sbjct  297  TLFAGYTDNVIRVWQVTRH  315


 Score = 55.8 bits (133),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 56/204 (27%), Positives = 89/204 (44%), Gaps = 29/204 (14%)
 Frame = -3

Query  749  TIKLWN-TLGECKYTIQDG--DGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK  579
            ++ +WN T  E  Y +      GHN +VS V  S        +SGSWD T+++W+L++  
Sbjct  39   SLIIWNLTRDETNYGVPKRRLQGHNHFVSDVVISSDG--QFALSGSWDHTLRLWDLNSGV  96

Query  578  LRSTLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWD-LAEGKKLYSLDAGSI-IHALCF  405
                  GHT  V +VA S D     SG +D  I LW+ L E K +   D  S  + ++ F
Sbjct  97   TTRRFVGHTSDVLSVAFSADNRQIVSGSRDKSIRLWNTLGECKFVIQEDGHSEWVSSVRF  156

Query  404  SPNRY---WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTS  234
            SPN      +    +  +K+W+L +  +                    T       +  +
Sbjct  157  SPNTSNPNIVSVGWDRVVKVWNLNNCKL-------------------RTNHYGHTGYVNT  197

Query  233  LSWNADGSTLFSGYTDGVIRVWGI  162
            ++ + DGS   SG  DGV  +W +
Sbjct  198  VTVSPDGSLCASGGKDGVAMLWDL  221



>emb|CCI48432.1| unnamed protein product [Albugo candida]
Length=318

 Score =   265 bits (678),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 128/197 (65%), Positives = 153/197 (78%), Gaps = 10/197 (5%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            TIKLWNTLGECKYTI + +GH+EWVSCVRFSPS+  P IVS  WD+ VK+WNL+NCKL +
Sbjct  131  TIKLWNTLGECKYTITE-NGHSEWVSCVRFSPSSSNPLIVSCGWDKAVKIWNLTNCKLHT  189

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
             L GHTGY+N+V VSPDGS+CASGGKDG   LWDL EGK+LYSL AG +IHAL FSPNRY
Sbjct  190  NLLGHTGYLNSVTVSPDGSICASGGKDGTANLWDLNEGKRLYSLVAGDVIHALVFSPNRY  249

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGS  210
            WLCAAT + IKIWDLESK++V +L  DL+      A         ++  C SL+W+ADGS
Sbjct  250  WLCAATSSGIKIWDLESKAVVHELNPDLEPPKGKYA---------RVPHCVSLAWSADGS  300

Query  209  TLFSGYTDGVIRVWGIG  159
             LFSGYTDG++RVW +G
Sbjct  301  ILFSGYTDGIVRVWAVG  317


 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 40/133 (30%), Positives = 64/133 (48%), Gaps = 15/133 (11%)
 Frame = -3

Query  713  YTIQDGDGHN----EWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLS----NCKL-RSTLA  561
            Y   + DGHN      ++  R +P+ L    ++ S D++V VW L+    NC   R  L 
Sbjct  8    YLRGELDGHNGKCVSSIATSRENPNML----LTASHDKSVLVWQLTSDGENCGFPRRRLL  63

Query  560  GHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGK--KLYSLDAGSIIHALCFSPNRYW  387
            GH  YV  V +S DG    SG  D  + LWDL  G   + +   +  ++     + NR  
Sbjct  64   GHAHYVQDVVISSDGQFALSGSWDSTLRLWDLNTGNTTRRFVGHSKDVLSVAFSADNRQI  123

Query  386  LCAATEASIKIWD  348
            + A+ + +IK+W+
Sbjct  124  VSASRDKTIKLWN  136



>emb|CCA26420.1| guanine nucleotidebinding protein subunit beta2like protein putative 
[Albugo laibachii Nc14]
Length=318

 Score =   265 bits (678),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 128/197 (65%), Positives = 153/197 (78%), Gaps = 10/197 (5%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            TIKLWNTLGECKYTI + +GH+EWVSCVRFSPS+  P IVS  WD+ VK+WNL+NCKL +
Sbjct  131  TIKLWNTLGECKYTITE-NGHSEWVSCVRFSPSSSNPLIVSCGWDKAVKIWNLTNCKLHT  189

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
             L GHTGY+N+V VSPDGS+CASGGKDG   LWDL EGK+LYSL AG +IHAL FSPNRY
Sbjct  190  NLLGHTGYLNSVTVSPDGSICASGGKDGTANLWDLNEGKRLYSLVAGDVIHALVFSPNRY  249

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGS  210
            WLCAAT + IKIWDLESK++V +L  DL+      A         ++  C SL+W+ADGS
Sbjct  250  WLCAATSSGIKIWDLESKAVVHELNPDLEPPKGKYA---------RVPHCVSLAWSADGS  300

Query  209  TLFSGYTDGVIRVWGIG  159
             LFSGYTDG++RVW +G
Sbjct  301  ILFSGYTDGIVRVWAVG  317


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 40/131 (31%), Positives = 62/131 (47%), Gaps = 11/131 (8%)
 Frame = -3

Query  713  YTIQDGDGHNEWVSCVR-FSPSTLQPTIV-SGSWDRTVKVWNLSN----CKL-RSTLAGH  555
            Y   + DGHN    CV   + S   P ++ + S D++V VW L++    C   R  L GH
Sbjct  8    YLRGELDGHNG--KCVSSIATSRENPNLLLTASHDKSVLVWQLTSDGESCGFPRRRLLGH  65

Query  554  TGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGK--KLYSLDAGSIIHALCFSPNRYWLC  381
              YV  V +S DG    SG  D  + LWDL  G   + +      ++     + NR  + 
Sbjct  66   AHYVQDVVISSDGQFALSGSWDSTLRLWDLNTGNTTRRFVGHTKDVLSVAFSADNRQIVS  125

Query  380  AATEASIKIWD  348
            A+ + +IK+W+
Sbjct  126  ASRDKTIKLWN  136



>ref|XP_009037831.1| hypothetical protein AURANDRAFT_37768 [Aureococcus anophagefferens]
 gb|EGB07194.1| hypothetical protein AURANDRAFT_37768 [Aureococcus anophagefferens]
Length=319

 Score =   264 bits (675),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 128/197 (65%), Positives = 149/197 (76%), Gaps = 11/197 (6%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            T+KLWNTLGECKYTI D +GH EWVSCVRFSPS   P IVS  WD+ VKVW+L+NCKLR+
Sbjct  133  TVKLWNTLGECKYTISD-EGHTEWVSCVRFSPSVQAPVIVSCGWDKLVKVWSLTNCKLRT  191

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
             L GH GY+NTV VSPDGSLCASGGKDG  +LWDL EGK+LYSLDAG +IH+L FSPNRY
Sbjct  192  NLYGHNGYLNTVTVSPDGSLCASGGKDGTAMLWDLNEGKRLYSLDAGDVIHSLVFSPNRY  251

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGS  210
            WLCAAT   +KIWDLESK +V +L+       E  A G N        +CT + W+ADG+
Sbjct  252  WLCAATTLGVKIWDLESKVVVDELK------PEFPAMGKNATPP----YCTCICWSADGA  301

Query  209  TLFSGYTDGVIRVWGIG  159
             LFSGYTDG+IR W +G
Sbjct  302  VLFSGYTDGLIRAWHVG  318


 Score = 53.9 bits (128),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 36/127 (28%), Positives = 63/127 (50%), Gaps = 13/127 (10%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNC----------KLRSTLAGHTGYV  543
            GH++WV+ +  + S     I+S S D+TV +W L+              R  L GH+ +V
Sbjct  13   GHSDWVTSIA-TTSEDPSMILSSSRDKTVLLWALTAGGGSAEGEAYGYPRRALKGHSHFV  71

Query  542  NTVAVSPDGSLCASGGKDGVILLWDLAEGK--KLYSLDAGSIIHALCFSPNRYWLCAATE  369
            + V +S DG    SG  DG + LW+LA GK  + +      ++     + NR  +  + +
Sbjct  72   SDVVISSDGQFALSGSWDGTLRLWELATGKTTRRFVGHTKDVLSVAFSTDNRQIVSGSRD  131

Query  368  ASIKIWD  348
             ++K+W+
Sbjct  132  KTVKLWN  138



>gb|ETI45096.1| guanine nucleotide-binding protein subunit beta-like protein 
[Phytophthora parasitica P1569]
Length=431

 Score =   267 bits (683),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 129/195 (66%), Positives = 151/195 (77%), Gaps = 10/195 (5%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            T+KLWNTLGECKYTI + DGH EWVSCVRFSPST  P IVS  WD+ VK+WNLSNCKLR+
Sbjct  130  TVKLWNTLGECKYTITE-DGHTEWVSCVRFSPSTANPLIVSCGWDKVVKIWNLSNCKLRT  188

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
             L GH GY+NTV VSPDGS+CASGGKDG   LWDL EGK+LYSL AG +IHAL FSPNRY
Sbjct  189  NLFGHEGYLNTVTVSPDGSICASGGKDGTANLWDLNEGKRLYSLVAGDVIHALIFSPNRY  248

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGS  210
            WLCAAT + IKIWDLESK +V DL+ ++++     A+  +         C SL+W+ADGS
Sbjct  249  WLCAATTSGIKIWDLESKIVVHDLQPEIEEPKGKYAQPPH---------CISLAWSADGS  299

Query  209  TLFSGYTDGVIRVWG  165
             LFSGYTDG++RVW 
Sbjct  300  VLFSGYTDGIVRVWA  314


 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 38/133 (29%), Positives = 63/133 (47%), Gaps = 15/133 (11%)
 Frame = -3

Query  713  YTIQDGDGHN----EWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLA  561
            Y   + DGHN      ++  R +P+ L    ++ S D+++ VW LSN        R  L 
Sbjct  7    YPRAELDGHNGKAVTAIATTRENPNLL----LTASRDKSLLVWQLSNDGEEYGFARRRLQ  62

Query  560  GHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYW  387
            GH+ YV  V +S DG    SG  DG + LWDL  G   + +      ++     + NR  
Sbjct  63   GHSHYVEDVVISSDGQFALSGSWDGTLRLWDLNTGITTRRFVGHTKDVLSVAFSADNRQI  122

Query  386  LCAATEASIKIWD  348
            +  + + ++K+W+
Sbjct  123  VSGSRDKTVKLWN  135


 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 54/199 (27%), Positives = 86/199 (43%), Gaps = 26/199 (13%)
 Frame = -3

Query  743  KLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTL  564
            +L N   E  +  +   GH+ +V  V  S        +SGSWD T+++W+L+        
Sbjct  46   QLSNDGEEYGFARRRLQGHSHYVEDVVISSD--GQFALSGSWDGTLRLWDLNTGITTRRF  103

Query  563  AGHTGYVNTVAVSPDGSLCASGGKDGVILLWD-LAEGKKLYSLDAGSI-IHALCFSP---  399
             GHT  V +VA S D     SG +D  + LW+ L E K   + D  +  +  + FSP   
Sbjct  104  VGHTKDVLSVAFSADNRQIVSGSRDKTVKLWNTLGECKYTITEDGHTEWVSCVRFSPSTA  163

Query  398  NRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNA  219
            N   +    +  +KIW+L +      LR +L        EG          +  +++ + 
Sbjct  164  NPLIVSCGWDKVVKIWNLSN----CKLRTNL-----FGHEG----------YLNTVTVSP  204

Query  218  DGSTLFSGYTDGVIRVWGI  162
            DGS   SG  DG   +W +
Sbjct  205  DGSICASGGKDGTANLWDL  223



>gb|ACQ83470.1| receptor of activated protein kinase C [Platynereis dumerilii]
Length=318

 Score =   263 bits (673),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 128/196 (65%), Positives = 150/196 (77%), Gaps = 10/196 (5%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            +IKLWNTLG CKYTIQ  DGH++WVSCVRFSP+T  P IVS  WD+TVKVWNL+NCKL++
Sbjct  128  SIKLWNTLGVCKYTIQQEDGHSDWVSCVRFSPNTQNPIIVSCGWDKTVKVWNLTNCKLKT  187

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
               GHTGY+N V VSPDGSLCASGGKDG  +LWDL EGK LY+LD G II++LCFSPNRY
Sbjct  188  NHIGHTGYLNVVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGGDIINSLCFSPNRY  247

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGS  210
            WLCAAT  SIKIWDLE K +V +LR           E  +T+ K +   C SL+W+ADG 
Sbjct  248  WLCAATGPSIKIWDLEGKVVVDELR----------PEVISTSPKAQPPQCISLAWSADGQ  297

Query  209  TLFSGYTDGVIRVWGI  162
            TLF+GYTD VIRVW +
Sbjct  298  TLFAGYTDNVIRVWQV  313


 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 50/206 (24%), Positives = 88/206 (43%), Gaps = 28/206 (14%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKL-----RSTLAGHTGYVNTVAV  528
            GH  WV+ +  +P      I+S S D+++ +W L+  +      +  L GH  +V+ V +
Sbjct  13   GHGNWVTQIATTPQ-YPDMILSASRDKSLIMWKLTRDETNYGIPQKALRGHGHFVSDVVM  71

Query  527  SPDGSLCASGGKDGVILLWDLAEGKKLYSL--DAGSIIHALCFSPNRYWLCAATEASIKI  354
            S DG    SG  DG + LWDL+ G    +       ++     + NR  +  + + SIK+
Sbjct  72   SSDGQFALSGSWDGTLRLWDLSAGTTTRNFVGHTKDVLSVAFSADNRQIVSGSRDKSIKL  131

Query  353  WDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIR  174
            W+      +   +  ++QE   S            + C   S N     + S   D  ++
Sbjct  132  WN-----TLGVCKYTIQQEDGHS----------DWVSCVRFSPNTQNPIIVSCGWDKTVK  176

Query  173  VWGIGRY*MEEFRRSHMIIGHVCYLS  96
            VW +      + + +H  IGH  YL+
Sbjct  177  VWNLTNC---KLKTNH--IGHTGYLN  197



>ref|XP_002286095.1| guanine nucleotide binding protein beta subunit-like protein 
[Thalassiosira pseudonana CCMP1335]
 gb|EED95736.1| guanine nucleotide binding protein beta subunit-like protein 
[Thalassiosira pseudonana CCMP1335]
Length=326

 Score =   263 bits (673),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 133/195 (68%), Positives = 152/195 (78%), Gaps = 6/195 (3%)
 Frame = -3

Query  749  TIKLWNTLGECKYTI-QDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLR  573
            +IKLWNTLGECKYTI  D  GH+EWVSCVRFSPS   P IVS  WDR VKVW L+NCKLR
Sbjct  132  SIKLWNTLGECKYTIGTDAQGHSEWVSCVRFSPSQSVPLIVSCGWDRLVKVWALTNCKLR  191

Query  572  STLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNR  393
            + L GHTGY+NTV VSPDGSLCASGGKDG  +LWDL EGK+LYSLDAG IIH+L FSPNR
Sbjct  192  NDLIGHTGYLNTVCVSPDGSLCASGGKDGTAMLWDLNEGKRLYSLDAGEIIHSLVFSPNR  251

Query  392  YWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADG  213
            YWLCAAT+  IKIWDLESK +V  LR    +E ++  E     A+     CTSL+W+ADG
Sbjct  252  YWLCAATDECIKIWDLESKVVVDTLR---PEEFDLGNEEGTGHARAP--HCTSLAWSADG  306

Query  212  STLFSGYTDGVIRVW  168
            STLF+GY+D VIRV+
Sbjct  307  STLFAGYSDKVIRVY  321


 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 51/213 (24%), Positives = 94/213 (44%), Gaps = 37/213 (17%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPT-IVSGSWDRTVKVWNLSNCKL---------RSTLAGHTGYV  543
            GH +WV+ +  + ++  P  I+S S D++V VW L++            +  L GH+ +V
Sbjct  13   GHRDWVTSI--ATTSEDPNLILSASRDKSVMVWRLTHSNTGEDDSYGYAQRALRGHSHFV  70

Query  542  NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSI-IHALCFS-PNRYWLCAATE  369
            + V +S DG    SG  DG + LW++  G+        S  + ++ FS  NR  +  + +
Sbjct  71   SDVVISSDGQFALSGSWDGTLRLWEINSGRTTRRFVGHSKDVLSVAFSVDNRQIVSGSRD  130

Query  368  ASIKIWDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSG  195
             SIK+W+   E K  +                G +    ++ + C   S +     + S 
Sbjct  131  KSIKLWNTLGECKYTI----------------GTDAQGHSEWVSCVRFSPSQSVPLIVSC  174

Query  194  YTDGVIRVWGIGRY*MEEFRRSHMIIGHVCYLS  96
              D +++VW      +   +  + +IGH  YL+
Sbjct  175  GWDRLVKVWA-----LTNCKLRNDLIGHTGYLN  202



>emb|CEG76293.1| Putative Guanine nucleotide-binding protein subunit beta-2-like 
1 [Rhizopus microsporus]
Length=278

 Score =   261 bits (668),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 125/198 (63%), Positives = 149/198 (75%), Gaps = 10/198 (5%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            +IKLWNTLGECKY I + DGH EWVSCVRFSP+   P IVSG WD+ VKVW+L+  KLR+
Sbjct  89   SIKLWNTLGECKYNITE-DGHTEWVSCVRFSPNPATPLIVSGGWDKLVKVWDLTKLKLRT  147

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
               GH GYVNTV +SPDGSLCAS GKDGV++LWDL + K LYSLDAGS++HAL FSPNRY
Sbjct  148  NFIGHNGYVNTVTISPDGSLCASAGKDGVVMLWDLNDAKHLYSLDAGSVVHALTFSPNRY  207

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGS  210
            WLCAAT   IKIWDLE+KSIV +LR +  Q  +          KN    C S++W+ADG+
Sbjct  208  WLCAATANGIKIWDLETKSIVDELRPEFAQLGKR---------KNPDPECLSVAWSADGA  258

Query  209  TLFSGYTDGVIRVWGIGR  156
            TLFSGY+D +IRVW + R
Sbjct  259  TLFSGYSDNIIRVWQVTR  276



>ref|XP_005795376.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1-like [Xiphophorus maculatus]
Length=317

 Score =   263 bits (671),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 131/196 (67%), Positives = 152/196 (78%), Gaps = 11/196 (6%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            TIKLWNTLG CKYTIQD +GH EWVSCVRFSP++  P IVS  WD+ VKVWNL+NCKL++
Sbjct  128  TIKLWNTLGVCKYTIQD-EGHTEWVSCVRFSPNSSNPIIVSCGWDKMVKVWNLANCKLKT  186

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
               GHTGY+NTV VSPDGSLCASGGKDG  +LWDL EGK LY+LD+G II+ALCFSPNRY
Sbjct  187  NHIGHTGYLNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDSGDIINALCFSPNRY  246

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGS  210
            WLCAAT  SIKIWDLE K IV +LR           E  +T +K +   CTSL+W+ADG 
Sbjct  247  WLCAATGPSIKIWDLEGKIIVDELR----------QEVISTNSKAEPPQCTSLAWSADGQ  296

Query  209  TLFSGYTDGVIRVWGI  162
            TLF+GYTD +IRVW +
Sbjct  297  TLFAGYTDNLIRVWQV  312



>ref|XP_004696065.1| PREDICTED: LOW QUALITY PROTEIN: guanine nucleotide binding protein 
(G protein), beta polypeptide 2-like 1 [Condylura cristata]
Length=271

 Score =   261 bits (666),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 130/196 (66%), Positives = 155/196 (79%), Gaps = 11/196 (6%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            TIKLWNTLG CKYT+QD + H+EWVSCVRFSP++  P IVS  WD+ VKVWNL+NCKL++
Sbjct  82   TIKLWNTLGVCKYTVQD-ESHSEWVSCVRFSPNSSNPIIVSCGWDKLVKVWNLANCKLKT  140

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
               GHTGY+NTV VSPDGSLCASGGKDG  +LWDL EGK LY+LD G II+ALCFSPNRY
Sbjct  141  NHIGHTGYLNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRY  200

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGS  210
            WLCAAT  SIKIWDLE K I+VD   +LKQE        +T++K +   CTSL+W+ADG 
Sbjct  201  WLCAATGPSIKIWDLEGK-IIVD---ELKQEVI------STSSKAEPPQCTSLAWSADGQ  250

Query  209  TLFSGYTDGVIRVWGI  162
            TLF+GYTD ++RVW +
Sbjct  251  TLFAGYTDNLVRVWQV  266



>ref|XP_004073369.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1 [Oryzias latipes]
Length=317

 Score =   262 bits (669),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 130/196 (66%), Positives = 152/196 (78%), Gaps = 11/196 (6%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            TIKLWNTLG CKYTIQD +GH EWVSCVRFSP++  P IVS  WD+ VKVWNL+NCKL++
Sbjct  128  TIKLWNTLGVCKYTIQD-EGHTEWVSCVRFSPNSSNPIIVSCGWDKMVKVWNLANCKLKT  186

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
               GHTGY+NTV VSPDGSLCASGGKDG  +LWDL EGK LY+LD+G +I+ALCFSPNRY
Sbjct  187  NHIGHTGYLNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDSGDVINALCFSPNRY  246

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGS  210
            WLCAAT  SIKIWDLE K IV +LR           E  +T +K +   CTSL+W+ADG 
Sbjct  247  WLCAATGPSIKIWDLEGKIIVDELR----------QEVISTNSKAEPPQCTSLAWSADGQ  296

Query  209  TLFSGYTDGVIRVWGI  162
            TLF+GYTD +IRVW +
Sbjct  297  TLFAGYTDNLIRVWQV  312



>ref|XP_004540947.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1-like [Maylandia zebra]
 ref|XP_005719882.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1-like [Pundamilia nyererei]
 ref|XP_005921230.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1-like [Haplochromis burtoni]
 ref|XP_006781554.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1-like [Neolamprologus brichardi]
 gb|AAQ91574.1| receptor for activated protein kinase C [Oreochromis mossambicus]
Length=317

 Score =   262 bits (669),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 130/196 (66%), Positives = 152/196 (78%), Gaps = 11/196 (6%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            TIKLWNTLG CKYTIQD +GH EWVSCVRFSP++  P IVS  WD+ VKVWNL+NCKL++
Sbjct  128  TIKLWNTLGVCKYTIQD-EGHTEWVSCVRFSPNSSNPIIVSCGWDKMVKVWNLANCKLKT  186

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
               GHTGY+NTV VSPDGSLCASGGKDG  +LWDL EGK LY+LD+G +I+ALCFSPNRY
Sbjct  187  NHIGHTGYLNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDSGDVINALCFSPNRY  246

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGS  210
            WLCAAT  SIKIWDLE K IV +LR           E  +T +K +   CTSL+W+ADG 
Sbjct  247  WLCAATGPSIKIWDLEGKIIVDELR----------QEVISTNSKAEPPQCTSLAWSADGQ  296

Query  209  TLFSGYTDGVIRVWGI  162
            TLF+GYTD +IRVW +
Sbjct  297  TLFAGYTDNLIRVWQV  312



>ref|NP_001266445.1| guanine nucleotide-binding protein subunit beta-2-like 1 [Oreochromis 
niloticus]
 sp|O42249.1|GBLP_ORENI RecName: Full=Guanine nucleotide-binding protein subunit beta-2-like 
1; AltName: Full=Receptor of activated protein kinase 
C; Short=RACK [Oreochromis niloticus]
 gb|AAB81618.1| receptor for activated protein kinase C [Oreochromis niloticus]
Length=317

 Score =   262 bits (669),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 130/196 (66%), Positives = 152/196 (78%), Gaps = 11/196 (6%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            TIKLWNTLG CKYTIQD +GH EWVSCVRFSP++  P IVS  WD+ VKVWNL+NCKL++
Sbjct  128  TIKLWNTLGVCKYTIQD-EGHTEWVSCVRFSPNSSNPIIVSCGWDKMVKVWNLANCKLKT  186

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
               GHTGY+NTV VSPDGSLCASGGKDG  +LWDL EGK LY+LD+G +I+ALCFSPNRY
Sbjct  187  NHIGHTGYLNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDSGDVINALCFSPNRY  246

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGS  210
            WLCAAT  SIKIWDLE K IV +LR           E  +T +K +   CTSL+W+ADG 
Sbjct  247  WLCAATGPSIKIWDLEGKIIVDELR----------QEVISTNSKAEPPQCTSLAWSADGQ  296

Query  209  TLFSGYTDGVIRVWGI  162
            TLF+GYTD +IRVW +
Sbjct  297  TLFAGYTDNLIRVWQV  312



>gb|EJT47727.1| G protein beta subunit-like protein Rkp1 [Trichosporon asahii 
var. asahii CBS 2479]
 gb|EKD01510.1| G protein beta subunit-like protein Rkp1 [Trichosporon asahii 
var. asahii CBS 8904]
Length=314

 Score =   261 bits (668),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 126/196 (64%), Positives = 152/196 (78%), Gaps = 11/196 (6%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            TIKLWNTLGECK+ I D DGH+EWVSCVRFSP+ + P IVS  WD+ VKVW LS CKL++
Sbjct  128  TIKLWNTLGECKFNIVD-DGHSEWVSCVRFSPNPVIPVIVSAGWDKVVKVWELSKCKLKT  186

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
               GHTGY+NT+AVSPDGSL ASGGKDG+++LWDL EGK LYSL+AG I+++L FSPNRY
Sbjct  187  NHYGHTGYINTLAVSPDGSLAASGGKDGIVMLWDLNEGKHLYSLEAGDIVNSLVFSPNRY  246

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGS  210
            WLCAAT +SIKI+DLESKSIV DL+ D  + SE + +            C SL+W+ADG 
Sbjct  247  WLCAATASSIKIFDLESKSIVDDLKPDFNELSEKARKPE----------CASLAWSADGQ  296

Query  209  TLFSGYTDGVIRVWGI  162
            TLF GYTD +IRVW +
Sbjct  297  TLFGGYTDNLIRVWAV  312


 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 51/182 (28%), Positives = 78/182 (43%), Gaps = 26/182 (14%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVNTVAVSPDGS  513
            GHN +VS V  S        +S SWD+T+++W+L+         GHTG V +V+ S D  
Sbjct  61   GHNHFVSDVVISSD--GQFALSSSWDKTLRLWDLNTGLTTRKFVGHTGDVLSVSFSADNR  118

Query  512  LCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALC--FSPN---RYWLCAATEASIKIWD  348
               S  +D  I LW+     K   +D G      C  FSPN      + A  +  +K+W+
Sbjct  119  QIVSASRDRTIKLWNTLGECKFNIVDDGHSEWVSCVRFSPNPVIPVIVSAGWDKVVKVWE  178

Query  347  LESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVW  168
            L         +  LK           T       +  +L+ + DGS   SG  DG++ +W
Sbjct  179  LS--------KCKLK-----------TNHYGHTGYINTLAVSPDGSLAASGGKDGIVMLW  219

Query  167  GI  162
             +
Sbjct  220  DL  221


 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 52/210 (25%), Positives = 90/210 (43%), Gaps = 33/210 (16%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAV  528
            GH  WV+ +  S S     I++ S D+T+ VW L+  +      +  L GH  +V+ V +
Sbjct  13   GHAGWVTAIATS-SENPDMILTASRDKTIIVWQLTRDESSFGFPKKILHGHNHFVSDVVI  71

Query  527  SPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKI  354
            S DG    S   D  + LWDL  G   + +    G ++     + NR  + A+ + +IK+
Sbjct  72   SSDGQFALSSSWDKTLRLWDLNTGLTTRKFVGHTGDVLSVSFSADNRQIVSASRDRTIKL  131

Query  353  WDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  180
            W+   E K  +VD                     ++ + C   S N     + S   D V
Sbjct  132  WNTLGECKFNIVD------------------DGHSEWVSCVRFSPNPVIPVIVSAGWDKV  173

Query  179  IRVWGIGRY*MEEFRRSHMIIGHVCYLSHL  90
            ++VW + +    + + +H   GH  Y++ L
Sbjct  174  VKVWELSKC---KLKTNHY--GHTGYINTL  198



>ref|XP_007527211.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1 isoform X2 [Erinaceus europaeus]
Length=271

 Score =   260 bits (664),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 130/196 (66%), Positives = 155/196 (79%), Gaps = 11/196 (6%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            TIKLWNTLG CKYT+QD + H+EWVSCVRFSP++  P IVS  WD+ VKVWNL+NCKL++
Sbjct  82   TIKLWNTLGVCKYTVQD-ESHSEWVSCVRFSPNSSNPIIVSCGWDKLVKVWNLANCKLKT  140

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
               GHTGY+NTV VSPDGSLCASGGKDG  +LWDL EGK LY+LD G II+ALCFSPNRY
Sbjct  141  NHIGHTGYLNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRY  200

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGS  210
            WLCAAT  SIKIWDLE K I+VD   +LKQE        +T++K +   CTSL+W+ADG 
Sbjct  201  WLCAATGPSIKIWDLEGK-IIVD---ELKQEVI------STSSKAEPPQCTSLAWSADGQ  250

Query  209  TLFSGYTDGVIRVWGI  162
            TLF+GYTD ++RVW +
Sbjct  251  TLFAGYTDNLVRVWQV  266



>gb|KFM07186.1| Guanine nucleotide-binding protein subunit beta-2-like 1, partial 
[Aptenodytes forsteri]
 gb|KFW05064.1| Guanine nucleotide-binding protein subunit beta-2-like 1, partial 
[Fulmarus glacialis]
Length=224

 Score =   258 bits (659),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 128/196 (65%), Positives = 153/196 (78%), Gaps = 11/196 (6%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            TIKLWNTLG CKYT+QD + H+EWVSCVRFSP++  P IVS  WD+ VKVWNL+NCKL++
Sbjct  35   TIKLWNTLGVCKYTVQD-ESHSEWVSCVRFSPNSSNPIIVSCGWDKLVKVWNLANCKLKT  93

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
               GHTGY+NTV VSPDGSLCASGGKDG  +LWDL EGK LY+LD G II+ALCFSPNRY
Sbjct  94   NHIGHTGYLNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRY  153

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGS  210
            WLCAAT  SIKIWDLE K I+VD         E+  E  +T++K +   CTSL+W+ADG 
Sbjct  154  WLCAATGPSIKIWDLEGK-IIVD---------ELKQEVISTSSKAEPPQCTSLAWSADGQ  203

Query  209  TLFSGYTDGVIRVWGI  162
            TLF+GYTD ++RVW +
Sbjct  204  TLFAGYTDNLVRVWQV  219



>gb|EAW53697.1| guanine nucleotide binding protein (G protein), beta polypeptide 
2-like 1, isoform CRA_f [Homo sapiens]
Length=228

 Score =   258 bits (659),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 130/196 (66%), Positives = 155/196 (79%), Gaps = 11/196 (6%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            TIKLWNTLG CKYT+QD + H+EWVSCVRFSP++  P IVS  WD+ VKVWNL+NCKL++
Sbjct  39   TIKLWNTLGVCKYTVQD-ESHSEWVSCVRFSPNSSNPIIVSCGWDKLVKVWNLANCKLKT  97

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
               GHTGY+NTV VSPDGSLCASGGKDG  +LWDL EGK LY+LD G II+ALCFSPNRY
Sbjct  98   NHIGHTGYLNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRY  157

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGS  210
            WLCAAT  SIKIWDLE K I+VD   +LKQE        +T++K +   CTSL+W+ADG 
Sbjct  158  WLCAATGPSIKIWDLEGK-IIVD---ELKQEVI------STSSKAEPPQCTSLAWSADGQ  207

Query  209  TLFSGYTDGVIRVWGI  162
            TLF+GYTD ++RVW +
Sbjct  208  TLFAGYTDNLVRVWQV  223



>ref|XP_006746631.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1 isoform X2 [Leptonychotes weddellii]
Length=271

 Score =   259 bits (663),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 130/196 (66%), Positives = 155/196 (79%), Gaps = 11/196 (6%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            TIKLWNTLG CKYT+QD + H+EWVSCVRFSP++  P IVS  WD+ VKVWNL+NCKL++
Sbjct  82   TIKLWNTLGVCKYTVQD-ESHSEWVSCVRFSPNSSNPIIVSCGWDKLVKVWNLANCKLKT  140

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
               GHTGY+NTV VSPDGSLCASGGKDG  +LWDL EGK LY+LD G II+ALCFSPNRY
Sbjct  141  NHIGHTGYLNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRY  200

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGS  210
            WLCAAT  SIKIWDLE K I+VD   +LKQE        +T++K +   CTSL+W+ADG 
Sbjct  201  WLCAATGPSIKIWDLEGK-IIVD---ELKQEVI------STSSKAEPPQCTSLAWSADGQ  250

Query  209  TLFSGYTDGVIRVWGI  162
            TLF+GYTD ++RVW +
Sbjct  251  TLFAGYTDNLVRVWQV  266



>ref|XP_005977784.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1-like isoform X2 [Pantholops hodgsonii]
Length=271

 Score =   259 bits (663),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 130/196 (66%), Positives = 155/196 (79%), Gaps = 11/196 (6%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            TIKLWNTLG CKYT+QD + H+EWVSCVRFSP++  P IVS  WD+ VKVWNL+NCKL++
Sbjct  82   TIKLWNTLGVCKYTVQD-ESHSEWVSCVRFSPNSSNPIIVSCGWDKLVKVWNLANCKLKT  140

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
               GHTGY+NTV VSPDGSLCASGGKDG  +LWDL EGK LY+LD G II+ALCFSPNRY
Sbjct  141  NHIGHTGYLNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRY  200

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGS  210
            WLCAAT  SIKIWDLE K I+VD   +LKQE        +T++K +   CTSL+W+ADG 
Sbjct  201  WLCAATGPSIKIWDLEGK-IIVD---ELKQEVI------STSSKAEPPQCTSLAWSADGQ  250

Query  209  TLFSGYTDGVIRVWGI  162
            TLF+GYTD ++RVW +
Sbjct  251  TLFAGYTDNLVRVWQV  266



>gb|EWM27643.1| guanine nucleotide binding protein [Nannochloropsis gaditana]
Length=314

 Score =   261 bits (667),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 128/196 (65%), Positives = 150/196 (77%), Gaps = 9/196 (5%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            TIKLWNTLGECK+TI +G GH+EWVSCVRFSPS   P IVS  WD+ VKVWNL++CKL+ 
Sbjct  127  TIKLWNTLGECKFTITEG-GHSEWVSCVRFSPSPTAPVIVSCGWDKRVKVWNLADCKLKQ  185

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
             L GHTGY+N V VSPDGSLCASGGKDG  +LWDL EGK+LYSLDAG IIH+L FSPNRY
Sbjct  186  NLIGHTGYLNVVTVSPDGSLCASGGKDGTAMLWDLNEGKRLYSLDAGDIIHSLVFSPNRY  245

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGS  210
            WLCAAT   IKIWDLESK +V  L      + +   +G ++ +     +CTSL+W+ADG 
Sbjct  246  WLCAATSQGIKIWDLESKDMVDHL------QPKWPVQGKHSLSPQP--YCTSLAWSADGQ  297

Query  209  TLFSGYTDGVIRVWGI  162
            TLFSGYTDG IR W +
Sbjct  298  TLFSGYTDGKIRCWSV  313


 Score = 53.1 bits (126),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 53/206 (26%), Positives = 91/206 (44%), Gaps = 30/206 (15%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIV-SGSWDRTVKVWNLSNCK----LRSTLAGHTGYVNTVAV  528
            GH  WV+ +  +     P +V S S D+TV VWNL+  +     +  L GH  +V+ V +
Sbjct  13   GHAGWVTSI--ATHADNPNLVLSSSRDKTVMVWNLTGGEDYGYPQRALRGHGHFVSDVII  70

Query  527  SPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSI-IHALCFS-PNRYWLCAATEASIKI  354
            S DG    SG  DG + LW++  GK   +    S  + ++ FS  NR  +  + + +IK+
Sbjct  71   SSDGQFALSGSWDGTLRLWEIKTGKSTRTFVGHSKDVLSVSFSHDNRQIVSGSRDKTIKL  130

Query  353  WDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIR  174
            W+             L +      EG ++    + + C   S +     + S   D  ++
Sbjct  131  WNT------------LGECKFTITEGGHS----EWVSCVRFSPSPTAPVIVSCGWDKRVK  174

Query  173  VWGIGRY*MEEFRRSHMIIGHVCYLS  96
            VW +      + +    +IGH  YL+
Sbjct  175  VWNLA-----DCKLKQNLIGHTGYLN  195



>ref|XP_009277073.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1 [Aptenodytes forsteri]
Length=240

 Score =   258 bits (660),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 130/196 (66%), Positives = 155/196 (79%), Gaps = 11/196 (6%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            TIKLWNTLG CKYT+QD + H+EWVSCVRFSP++  P IVS  WD+ VKVWNL+NCKL++
Sbjct  51   TIKLWNTLGVCKYTVQD-ESHSEWVSCVRFSPNSSNPIIVSCGWDKLVKVWNLANCKLKT  109

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
               GHTGY+NTV VSPDGSLCASGGKDG  +LWDL EGK LY+LD G II+ALCFSPNRY
Sbjct  110  NHIGHTGYLNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRY  169

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGS  210
            WLCAAT  SIKIWDLE K I+VD   +LKQE        +T++K +   CTSL+W+ADG 
Sbjct  170  WLCAATGPSIKIWDLEGK-IIVD---ELKQEVI------STSSKAEPPQCTSLAWSADGQ  219

Query  209  TLFSGYTDGVIRVWGI  162
            TLF+GYTD ++RVW +
Sbjct  220  TLFAGYTDNLVRVWQV  235



>gb|ETP42980.1| guanine nucleotide-binding protein subunit beta-like protein 
[Phytophthora parasitica P10297]
Length=429

 Score =   265 bits (677),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 128/193 (66%), Positives = 150/193 (78%), Gaps = 10/193 (5%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            T+KLWNTLGECKYTI + DGH EWVSCVRFSPST  P IVS  WD+ VK+WNLSNCKLR+
Sbjct  130  TVKLWNTLGECKYTITE-DGHTEWVSCVRFSPSTANPLIVSCGWDKVVKIWNLSNCKLRT  188

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
             L GH GY+NTV VSPDGS+CASGGKDG   LWDL EGK+LYSL AG +IHAL FSPNRY
Sbjct  189  NLFGHEGYLNTVTVSPDGSICASGGKDGTANLWDLNEGKRLYSLVAGDVIHALIFSPNRY  248

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGS  210
            WLCAAT + IKIWDLESK +V DL+ ++++     A+  +         C SL+W+ADGS
Sbjct  249  WLCAATTSGIKIWDLESKIVVHDLQPEIEEPKGKYAQPPH---------CISLAWSADGS  299

Query  209  TLFSGYTDGVIRV  171
             LFSGYTDG++RV
Sbjct  300  VLFSGYTDGIVRV  312


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 38/133 (29%), Positives = 63/133 (47%), Gaps = 15/133 (11%)
 Frame = -3

Query  713  YTIQDGDGHN----EWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLA  561
            Y   + DGHN      ++  R +P+ L    ++ S D+++ VW LSN        R  L 
Sbjct  7    YPRAELDGHNGKAVTAIATTRENPNLL----LTASRDKSLLVWQLSNDGEEYGFARRRLQ  62

Query  560  GHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYW  387
            GH+ YV  V +S DG    SG  DG + LWDL  G   + +      ++     + NR  
Sbjct  63   GHSHYVEDVVISSDGQFALSGSWDGTLRLWDLNTGITTRRFVGHTKDVLSVAFSADNRQI  122

Query  386  LCAATEASIKIWD  348
            +  + + ++K+W+
Sbjct  123  VSGSRDKTVKLWN  135


 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 54/199 (27%), Positives = 86/199 (43%), Gaps = 26/199 (13%)
 Frame = -3

Query  743  KLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTL  564
            +L N   E  +  +   GH+ +V  V  S        +SGSWD T+++W+L+        
Sbjct  46   QLSNDGEEYGFARRRLQGHSHYVEDVVISSDG--QFALSGSWDGTLRLWDLNTGITTRRF  103

Query  563  AGHTGYVNTVAVSPDGSLCASGGKDGVILLWD-LAEGKKLYSLDAGSI-IHALCFSP---  399
             GHT  V +VA S D     SG +D  + LW+ L E K   + D  +  +  + FSP   
Sbjct  104  VGHTKDVLSVAFSADNRQIVSGSRDKTVKLWNTLGECKYTITEDGHTEWVSCVRFSPSTA  163

Query  398  NRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNA  219
            N   +    +  +KIW+L +      LR +L        EG          +  +++ + 
Sbjct  164  NPLIVSCGWDKVVKIWNLSN----CKLRTNL-----FGHEG----------YLNTVTVSP  204

Query  218  DGSTLFSGYTDGVIRVWGI  162
            DGS   SG  DG   +W +
Sbjct  205  DGSICASGGKDGTANLWDL  223



>ref|XP_005891160.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1 isoform X2 [Bos mutus]
Length=271

 Score =   259 bits (663),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 130/196 (66%), Positives = 155/196 (79%), Gaps = 11/196 (6%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            TIKLWNTLG CKYT+QD + H+EWVSCVRFSP++  P IVS  WD+ VKVWNL+NCKL++
Sbjct  82   TIKLWNTLGVCKYTVQD-ESHSEWVSCVRFSPNSSNPIIVSCGWDKLVKVWNLANCKLKT  140

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
               GHTGY+NTV VSPDGSLCASGGKDG  +LWDL EGK LY+LD G II+ALCFSPNRY
Sbjct  141  NHIGHTGYLNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRY  200

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGS  210
            WLCAAT  SIKIWDLE K I+VD   +LKQE        +T++K +   CTSL+W+ADG 
Sbjct  201  WLCAATGPSIKIWDLEGK-IIVD---ELKQEVI------STSSKAEPPQCTSLAWSADGQ  250

Query  209  TLFSGYTDGVIRVWGI  162
            TLF+GYTD ++RVW +
Sbjct  251  TLFAGYTDNLVRVWQV  266



>gb|EDL33790.1| guanine nucleotide binding protein (G protein), beta polypeptide 
2 like 1, isoform CRA_a [Mus musculus]
 gb|EDM04194.1| rCG34190, isoform CRA_b [Rattus norvegicus]
Length=228

 Score =   258 bits (659),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 128/196 (65%), Positives = 153/196 (78%), Gaps = 11/196 (6%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            TIKLWNTLG CKYT+QD + H+EWVSCVRFSP++  P IVS  WD+ VKVWNL+NCKL++
Sbjct  39   TIKLWNTLGVCKYTVQD-ESHSEWVSCVRFSPNSSNPIIVSCGWDKLVKVWNLANCKLKT  97

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
               GHTGY+NTV VSPDGSLCASGGKDG  +LWDL EGK LY+LD G II+ALCFSPNRY
Sbjct  98   NHIGHTGYLNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRY  157

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGS  210
            WLCAAT  SIKIWDLE K I+VD         E+  E  +T++K +   CTSL+W+ADG 
Sbjct  158  WLCAATGPSIKIWDLEGK-IIVD---------ELKQEVISTSSKAEPPQCTSLAWSADGQ  207

Query  209  TLFSGYTDGVIRVWGI  162
            TLF+GYTD ++RVW +
Sbjct  208  TLFAGYTDNLVRVWQV  223



>gb|ERE68979.1| guanine nucleotide-binding protein subunit beta-2-like 1-like 
protein [Cricetulus griseus]
Length=235

 Score =   258 bits (660),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 128/196 (65%), Positives = 153/196 (78%), Gaps = 11/196 (6%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            TIKLWNTLG CKYT+QD + H+EWVSCVRFSP++  P IVS  WD+ VKVWNL+NCKL++
Sbjct  46   TIKLWNTLGVCKYTVQD-ESHSEWVSCVRFSPNSSNPIIVSCGWDKLVKVWNLANCKLKT  104

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
               GHTGY+NTV VSPDGSLCASGGKDG  +LWDL EGK LY+LD G II+ALCFSPNRY
Sbjct  105  NHIGHTGYLNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRY  164

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGS  210
            WLCAAT  SIKIWDLE K I+VD         E+  E  +T++K +   CTSL+W+ADG 
Sbjct  165  WLCAATGPSIKIWDLEGK-IIVD---------ELKQEVISTSSKAEPPQCTSLAWSADGQ  214

Query  209  TLFSGYTDGVIRVWGI  162
            TLF+GYTD ++RVW +
Sbjct  215  TLFAGYTDNLVRVWQV  230



>gb|AAR24619.1| proliferation-inducing gene 21 [Homo sapiens]
Length=271

 Score =   259 bits (663),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 130/196 (66%), Positives = 155/196 (79%), Gaps = 11/196 (6%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            TIKLWNTLG CKYT+QD + H+EWVSCVRFSP++  P IVS  WD+ VKVWNL+NCKL++
Sbjct  82   TIKLWNTLGVCKYTVQD-ESHSEWVSCVRFSPNSSNPIIVSCGWDKLVKVWNLANCKLKT  140

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
               GHTGY+NTV VSPDGSLCASGGKDG  +LWDL EGK LY+LD G II+ALCFSPNRY
Sbjct  141  NHIGHTGYLNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRY  200

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGS  210
            WLCAAT  SIKIWDLE K I+VD   +LKQE        +T++K +   CTSL+W+ADG 
Sbjct  201  WLCAATGPSIKIWDLEGK-IIVD---ELKQEVI------STSSKAEPPQCTSLAWSADGQ  250

Query  209  TLFSGYTDGVIRVWGI  162
            TLF+GYTD ++RVW +
Sbjct  251  TLFAGYTDNLVRVWQV  266



>gb|EPQ05298.1| Guanine nucleotide-binding protein subunit beta-2-like 1 [Myotis 
brandtii]
Length=256

 Score =   259 bits (661),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 128/196 (65%), Positives = 153/196 (78%), Gaps = 11/196 (6%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            TIKLWNTLG CKYT+QD + H+EWVSCVRFSP++  P IVS  WD+ VKVWNL+NCKL++
Sbjct  67   TIKLWNTLGVCKYTVQD-ESHSEWVSCVRFSPNSSNPIIVSCGWDKLVKVWNLANCKLKT  125

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
               GHTGY+NTV VSPDGSLCASGGKDG  +LWDL EGK LY+LD G II+ALCFSPNRY
Sbjct  126  NHIGHTGYLNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRY  185

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGS  210
            WLCAAT  SIKIWDLE K I+VD         E+  E  +T++K +   CTSL+W+ADG 
Sbjct  186  WLCAATGPSIKIWDLEGK-IIVD---------ELKQEVISTSSKAEPPQCTSLAWSADGQ  235

Query  209  TLFSGYTDGVIRVWGI  162
            TLF+GYTD ++RVW +
Sbjct  236  TLFAGYTDNLVRVWQV  251



>ref|XP_004657524.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1 isoform X2 [Jaculus jaculus]
Length=267

 Score =   259 bits (662),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 130/196 (66%), Positives = 155/196 (79%), Gaps = 11/196 (6%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            TIKLWNTLG CKYT+QD + H+EWVSCVRFSP++  P IVS  WD+ VKVWNL+NCKL++
Sbjct  78   TIKLWNTLGVCKYTVQD-ESHSEWVSCVRFSPNSSNPIIVSCGWDKLVKVWNLANCKLKT  136

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
               GHTGY+NTV VSPDGSLCASGGKDG  +LWDL EGK LY+LD G II+ALCFSPNRY
Sbjct  137  NHIGHTGYLNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRY  196

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGS  210
            WLCAAT  SIKIWDLE K I+VD   +LKQE        +T++K +   CTSL+W+ADG 
Sbjct  197  WLCAATGPSIKIWDLEGK-IIVD---ELKQEVI------STSSKAEPPQCTSLAWSADGQ  246

Query  209  TLFSGYTDGVIRVWGI  162
            TLF+GYTD ++RVW +
Sbjct  247  TLFAGYTDNLVRVWQV  262



>gb|ABY75292.1| putative guanine nucleotide binding protein beta polypeptide 
2-like 1 protein [Ovis aries]
Length=227

 Score =   258 bits (659),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 128/196 (65%), Positives = 153/196 (78%), Gaps = 11/196 (6%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            TIKLWNTLG CKYT+QD + H+EWVSCVRFSP++  P IVS  WD+ VKVWNL+NCKL++
Sbjct  38   TIKLWNTLGVCKYTVQD-ESHSEWVSCVRFSPNSSNPIIVSCGWDKLVKVWNLANCKLKT  96

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
               GHTGY+NTV VSPDGSLCASGGKDG  +LWDL EGK LY+LD G II+ALCFSPNRY
Sbjct  97   NHIGHTGYLNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRY  156

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGS  210
            WLCAAT  SIKIWDLE K I+VD         E+  E  +T++K +   CTSL+W+ADG 
Sbjct  157  WLCAATGPSIKIWDLEGK-IIVD---------ELKQEVISTSSKAEPPQCTSLAWSADGQ  206

Query  209  TLFSGYTDGVIRVWGI  162
            TLF+GYTD ++RVW +
Sbjct  207  TLFAGYTDNLVRVWQV  222



>ref|XP_009576203.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1, partial [Fulmarus glacialis]
Length=223

 Score =   258 bits (658),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 128/196 (65%), Positives = 153/196 (78%), Gaps = 11/196 (6%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            TIKLWNTLG CKYT+QD + H+EWVSCVRFSP++  P IVS  WD+ VKVWNL+NCKL++
Sbjct  34   TIKLWNTLGVCKYTVQD-ESHSEWVSCVRFSPNSSNPIIVSCGWDKLVKVWNLANCKLKT  92

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
               GHTGY+NTV VSPDGSLCASGGKDG  +LWDL EGK LY+LD G II+ALCFSPNRY
Sbjct  93   NHIGHTGYLNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRY  152

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGS  210
            WLCAAT  SIKIWDLE K I+VD         E+  E  +T++K +   CTSL+W+ADG 
Sbjct  153  WLCAATGPSIKIWDLEGK-IIVD---------ELKQEVISTSSKAEPPQCTSLAWSADGQ  202

Query  209  TLFSGYTDGVIRVWGI  162
            TLF+GYTD ++RVW +
Sbjct  203  TLFAGYTDNLVRVWQV  218



>gb|ELK03178.1| Guanine nucleotide-binding protein subunit beta-2-like 1 [Pteropus 
alecto]
Length=251

 Score =   259 bits (661),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 130/196 (66%), Positives = 155/196 (79%), Gaps = 11/196 (6%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            TIKLWNTLG CKYT+QD + H+EWVSCVRFSP++  P IVS  WD+ VKVWNL+NCKL++
Sbjct  62   TIKLWNTLGVCKYTVQD-ESHSEWVSCVRFSPNSSNPIIVSCGWDKLVKVWNLANCKLKT  120

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
               GHTGY+NTV VSPDGSLCASGGKDG  +LWDL EGK LY+LD G II+ALCFSPNRY
Sbjct  121  NHIGHTGYLNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRY  180

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGS  210
            WLCAAT  SIKIWDLE K I+VD   +LKQE        +T++K +   CTSL+W+ADG 
Sbjct  181  WLCAATGPSIKIWDLEGK-IIVD---ELKQEVI------STSSKAEPPQCTSLAWSADGQ  230

Query  209  TLFSGYTDGVIRVWGI  162
            TLF+GYTD ++RVW +
Sbjct  231  TLFAGYTDNLVRVWQV  246



>gb|EIE78732.1| guanine nucleotide-binding protein subunit beta-2-like 1 [Rhizopus 
delemar RA 99-880]
Length=311

 Score =   261 bits (666),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 125/198 (63%), Positives = 150/198 (76%), Gaps = 10/198 (5%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            +IKLWNTLGECKY I + DGH+EWVSCVRFSP+   P IVSG WD+ VKVW+L+  KLR+
Sbjct  122  SIKLWNTLGECKYNITE-DGHSEWVSCVRFSPNPANPLIVSGGWDKLVKVWDLTKLKLRT  180

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
               GH GYVNTV +SPDGSLCAS GKDGV++LWDL + K LYSLDAGS++HAL FSPNRY
Sbjct  181  NFIGHNGYVNTVTISPDGSLCASAGKDGVVMLWDLNDAKHLYSLDAGSVVHALTFSPNRY  240

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGS  210
            WLCAAT   IKIWDLE+KSIV +LR +  Q  +          KN    C S++W+ADG+
Sbjct  241  WLCAATANGIKIWDLETKSIVDELRPEFAQLGKR---------KNPDPECLSVAWSADGA  291

Query  209  TLFSGYTDGVIRVWGIGR  156
            TLFSGY+D +IRVW + R
Sbjct  292  TLFSGYSDNIIRVWQVTR  309


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 46/162 (28%), Positives = 74/162 (46%), Gaps = 24/162 (15%)
 Frame = -3

Query  632  VSGSWDRTVKVWNLSNCKLRSTLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWD-LAEG  456
            +S SWD T+++W+L+N        GHT  V +V+ S D     SG +D  I LW+ L E 
Sbjct  73   LSASWDHTLRLWDLNNGTTTCRFVGHTNDVLSVSFSADNRQIVSGSRDKSIKLWNTLGEC  132

Query  455  KKLYSLDAGSI-IHALCFSP---NRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEM  288
            K   + D  S  +  + FSP   N   +    +  +K+WDL      + LR +       
Sbjct  133  KYNITEDGHSEWVSCVRFSPNPANPLIVSGGWDKLVKVWDLTK----LKLRTNFI-----  183

Query  287  SAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGI  162
               G+N        +  +++ + DGS   S   DGV+ +W +
Sbjct  184  ---GHNG-------YVNTVTISPDGSLCASAGKDGVVMLWDL  215



>ref|XP_005703361.1| hypothetical protein Gasu_55280 [Galdieria sulphuraria]
 gb|EME26841.1| hypothetical protein Gasu_55280 [Galdieria sulphuraria]
Length=315

 Score =   261 bits (666),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 130/196 (66%), Positives = 154/196 (79%), Gaps = 12/196 (6%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            TIKLWNT+GECKYT+ + DGH++WVSCVRFSPST  P IVS  WD+ VKVWNLSNCK+RS
Sbjct  128  TIKLWNTIGECKYTLTE-DGHSDWVSCVRFSPSTATPLIVSCGWDKMVKVWNLSNCKIRS  186

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
             LA HTGY+NTV+VSPDGSLCASGGKDGV +LW+L EGK LYSL+A  II+ALCFSP RY
Sbjct  187  NLASHTGYLNTVSVSPDGSLCASGGKDGVAMLWELQEGKHLYSLNANDIINALCFSPVRY  246

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGS  210
            WLCAAT  +IKIWDLE K+IV +L      E E+S        K ++  CT L+W+ADGS
Sbjct  247  WLCAATNTAIKIWDLEKKNIVAELLY----EEEVS-------KKAQVPACTCLAWSADGS  295

Query  209  TLFSGYTDGVIRVWGI  162
            TL++GYTD  IRVW +
Sbjct  296  TLYAGYTDNSIRVWTV  311


 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 34/122 (28%), Positives = 60/122 (49%), Gaps = 8/122 (7%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAV  528
            GH  WV+ +  +P      IVS S DR + +W ++  +      R +L GH+ +++ + +
Sbjct  13   GHGNWVTSI-CTPLDNSDFIVSCSRDRKIMIWQITREEGAFGVPRKSLTGHSHFISDIVL  71

Query  527  SPDGSLCASGGKDGVILLWDLAEGKKLYSL-DAGSIIHALCFSP-NRYWLCAATEASIKI  354
            S DG    S   D  + LWDL +G       D    + ++ FS  NR  +  + + +IK+
Sbjct  72   SSDGQFALSSSWDHTLRLWDLTQGVSTRRFVDHTKDVLSVAFSADNRQIVSGSRDRTIKL  131

Query  353  WD  348
            W+
Sbjct  132  WN  133



>ref|XP_007548404.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1 [Poecilia formosa]
 ref|XP_008418331.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1 [Poecilia reticulata]
Length=317

 Score =   261 bits (666),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 130/196 (66%), Positives = 151/196 (77%), Gaps = 11/196 (6%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            TIKLWNTLG CKYTIQD +GH EWVSCVRFSP++  P IVS  WD+ VKVWNL+NCKL++
Sbjct  128  TIKLWNTLGVCKYTIQD-EGHTEWVSCVRFSPNSSNPIIVSCGWDKMVKVWNLANCKLKT  186

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
               GHTGY+NTV VSPDGSLCASGGKDG  +LWDL EGK LY+LD+G  I+ALCFSPNRY
Sbjct  187  NHIGHTGYLNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDSGDTINALCFSPNRY  246

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGS  210
            WLCAAT  SIKIWDLE K IV +LR           E  +T +K +   CTSL+W+ADG 
Sbjct  247  WLCAATGPSIKIWDLEGKIIVDELR----------QEVISTNSKAEPPQCTSLAWSADGQ  296

Query  209  TLFSGYTDGVIRVWGI  162
            TLF+GYTD +IRVW +
Sbjct  297  TLFAGYTDNLIRVWQV  312



>ref|NP_571519.1| guanine nucleotide-binding protein subunit beta-2-like 1 [Danio 
rerio]
 sp|O42248.1|GBLP_DANRE RecName: Full=Guanine nucleotide-binding protein subunit beta-2-like 
1; AltName: Full=Receptor of activated protein kinase 
C; Short=RACK [Danio rerio]
 gb|AAB81617.1| receptor for activated protein kinase C [Danio rerio]
 gb|AAH49459.1| Guanine nucleotide binding protein (G protein), beta polypeptide 
2-like 1 [Danio rerio]
 gb|AAQ98014.1| guanine nucleotide binding protein beta polypeptide 2-like 1 
[Danio rerio]
Length=317

 Score =   261 bits (666),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 130/196 (66%), Positives = 149/196 (76%), Gaps = 11/196 (6%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            TIKLWNTLG CKYTIQD D H EWVSCVRFSP++  P IVS  WD+ VKVWNL+NCKL++
Sbjct  128  TIKLWNTLGVCKYTIQD-DSHTEWVSCVRFSPNSSNPIIVSCGWDKMVKVWNLANCKLKT  186

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
               GHTGY+NTV VSPDGSLCASGGKDG  +LWDL EGK LY+LD G  I+ALCFSPNRY
Sbjct  187  NHIGHTGYLNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGGDTINALCFSPNRY  246

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGS  210
            WLCAAT  SIKIWDLE K IV +LR D+            T +K +   CTSL+W+ADG 
Sbjct  247  WLCAATGPSIKIWDLEGKIIVDELRQDII----------TTNSKAEPPQCTSLAWSADGQ  296

Query  209  TLFSGYTDGVIRVWGI  162
            TLF+GYTD +IRVW +
Sbjct  297  TLFAGYTDNLIRVWQV  312



>ref|XP_008063710.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1, partial [Tarsius syrichta]
Length=262

 Score =   259 bits (661),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 128/196 (65%), Positives = 153/196 (78%), Gaps = 11/196 (6%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            TIKLWNTLG CKYT+QD + H+EWVSCVRFSP++  P IVS  WD+ VKVWNL+NCKL++
Sbjct  73   TIKLWNTLGVCKYTVQD-ESHSEWVSCVRFSPNSSNPIIVSCGWDKLVKVWNLANCKLKT  131

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
               GHTGY+NTV VSPDGSLCASGGKDG  +LWDL EGK LY+LD G II+ALCFSPNRY
Sbjct  132  NHIGHTGYLNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRY  191

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGS  210
            WLCAAT  SIKIWDLE K I+VD         E+  E  +T++K +   CTSL+W+ADG 
Sbjct  192  WLCAATGPSIKIWDLEGK-IIVD---------ELKQEVISTSSKAEPPQCTSLAWSADGQ  241

Query  209  TLFSGYTDGVIRVWGI  162
            TLF+GYTD ++RVW +
Sbjct  242  TLFAGYTDNLVRVWQV  257



>ref|XP_005989393.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1-like [Latimeria chalumnae]
Length=317

 Score =   260 bits (665),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 130/196 (66%), Positives = 150/196 (77%), Gaps = 11/196 (6%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            TIKLWNTLG CKYTIQD +GH EW SCVRFSP++  P IVS  WDR VKVWNL+NCKL++
Sbjct  128  TIKLWNTLGVCKYTIQD-EGHTEWASCVRFSPNSNNPIIVSCGWDRLVKVWNLANCKLKT  186

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
               GH GY+NTV VSPDGSLCASGGKDG  +LWDL EGK LY+LD G II+ALCFSPNRY
Sbjct  187  NHIGHVGYLNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRY  246

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGS  210
            WLCAAT  SIKIWDLE K IV +LR           E  +T++K +   CTSL+W+ADG 
Sbjct  247  WLCAATGPSIKIWDLEGKIIVDELR----------QEVISTSSKAEPPQCTSLAWSADGQ  296

Query  209  TLFSGYTDGVIRVWGI  162
            TLF+GYTD +IRVW +
Sbjct  297  TLFAGYTDNLIRVWQV  312


 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 50/206 (24%), Positives = 91/206 (44%), Gaps = 29/206 (14%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKL-----RSTLAGHTGYVNTVAV  528
            GHN WV+ +  +P      I+S S D+++ +W L+  +      +  L GH  +V+ V +
Sbjct  13   GHNGWVTQIATTPQ-FPDMILSASRDKSIIMWKLTRDETNYGIPQRALRGHAHFVSDVVI  71

Query  527  SPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKI  354
            S DG    SG  D  + LWDL  G   + +   +  ++     + NR  +  + + +IK+
Sbjct  72   SSDGQFALSGSWDSNLRLWDLTLGITTRQFVGHSKDVLSVAFSADNRQIVSGSRDKTIKL  131

Query  353  WDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIR  174
            W+                +  +  EG+   A      C   S N++   + S   D +++
Sbjct  132  WNTLGVC-----------KYTIQDEGHTEWAS-----CVRFSPNSNNPIIVSCGWDRLVK  175

Query  173  VWGIGRY*MEEFRRSHMIIGHVCYLS  96
            VW +      + + +H  IGHV YL+
Sbjct  176  VWNLANC---KLKTNH--IGHVGYLN  196



>dbj|BAE39095.1| unnamed protein product [Mus musculus]
Length=232

 Score =   258 bits (658),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 128/196 (65%), Positives = 153/196 (78%), Gaps = 11/196 (6%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            TIKLWNTLG CKYT+QD + H+EWVSCVRFSP++  P IVS  WD+ VKVWNL+NCKL++
Sbjct  43   TIKLWNTLGVCKYTVQD-ESHSEWVSCVRFSPNSSNPIIVSCGWDKLVKVWNLANCKLKT  101

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
               GHTGY+NTV VSPDGSLCASGGKDG  +LWDL EGK LY+LD G II+ALCFSPNRY
Sbjct  102  NHIGHTGYLNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRY  161

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGS  210
            WLCAAT  SIKIWDLE K I+VD         E+  E  +T++K +   CTSL+W+ADG 
Sbjct  162  WLCAATGPSIKIWDLEGK-IIVD---------ELKQEVISTSSKAEPPQCTSLAWSADGQ  211

Query  209  TLFSGYTDGVIRVWGI  162
            TLF+GYTD ++RVW +
Sbjct  212  TLFAGYTDNLVRVWQV  227



>dbj|BAG53102.1| unnamed protein product [Homo sapiens]
Length=275

 Score =   259 bits (662),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 128/196 (65%), Positives = 153/196 (78%), Gaps = 11/196 (6%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            TIKLWNTLG CKYT+QD + H+EWVSCVRFSP++  P IVS  WD+ VKVWNL+NCKL++
Sbjct  86   TIKLWNTLGVCKYTVQD-ESHSEWVSCVRFSPNSSNPIIVSCGWDKLVKVWNLANCKLKT  144

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
               GHTGY+NTV VSPDGSLCASGGKDG  +LWDL EGK LY+LD G II+ALCFSPNRY
Sbjct  145  NHIGHTGYLNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRY  204

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGS  210
            WLCAAT  SIKIWDLE K I+VD         E+  E  +T++K +   CTSL+W+ADG 
Sbjct  205  WLCAATGPSIKIWDLEGK-IIVD---------ELKQEVISTSSKAEPPQCTSLAWSADGQ  254

Query  209  TLFSGYTDGVIRVWGI  162
            TLF+GYTD ++RVW +
Sbjct  255  TLFAGYTDNLVRVWQV  270



>ref|XP_002804718.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1-like [Macaca mulatta]
Length=279

 Score =   259 bits (662),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 128/196 (65%), Positives = 153/196 (78%), Gaps = 11/196 (6%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            TIKLWNTLG CKYT+QD + H+EWVSCVRFSP++  P IVS  WD+ VKVWNL+NCKL++
Sbjct  90   TIKLWNTLGVCKYTVQD-ESHSEWVSCVRFSPNSSNPIIVSCGWDKLVKVWNLANCKLKT  148

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
               GHTGY+NTV VSPDGSLCASGGKDG  +LWDL EGK LY+LD G II+ALCFSPNRY
Sbjct  149  NHIGHTGYLNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRY  208

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGS  210
            WLCAAT  SIKIWDLE K I+VD         E+  E  +T++K +   CTSL+W+ADG 
Sbjct  209  WLCAATGPSIKIWDLEGK-IIVD---------ELKQEVISTSSKAEPPQCTSLAWSADGQ  258

Query  209  TLFSGYTDGVIRVWGI  162
            TLF+GYTD ++RVW +
Sbjct  259  TLFAGYTDNLVRVWQV  274



>ref|XP_002181732.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gb|EEC46946.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
Length=316

 Score =   260 bits (665),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 132/197 (67%), Positives = 151/197 (77%), Gaps = 14/197 (7%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQ-DGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLR  573
            +I+LWNTLGECKYTI  D +GH+EWVSCVRFSPS   P IVS  WDR VKVWNL+NCKLR
Sbjct  133  SIRLWNTLGECKYTISGDSEGHSEWVSCVRFSPSQSVPLIVSAGWDRLVKVWNLTNCKLR  192

Query  572  STLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNR  393
            + L GHTGY+NTV VSPDGSL ASGGKD   +LWDL EGK+LYSLDAG II+ L FSPNR
Sbjct  193  NDLVGHTGYLNTVCVSPDGSLAASGGKDSTAMLWDLNEGKRLYSLDAGEIINGLVFSPNR  252

Query  392  YWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADG  213
            YWLCAAT+ SIKIWDLESK +V  LR    +ESE            KI  CT L+W+ADG
Sbjct  253  YWLCAATDDSIKIWDLESKIVVDTLR---PEESE----------SGKIPSCTCLAWSADG  299

Query  212  STLFSGYTDGVIRVWGI  162
            STLF+G+TD VIRV+ +
Sbjct  300  STLFAGFTDNVIRVYAV  316


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 46/210 (22%), Positives = 94/210 (45%), Gaps = 31/210 (15%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK---------LRSTLAGHTGYVN  540
            GH +W++ +  +P      ++S S D++V  W+L++            R  L GH+ +V+
Sbjct  14   GHGDWITSLATTPEDPN-LLLSSSRDKSVIAWHLTHSSSGEDDSYGYARRALRGHSHFVS  72

Query  539  TVAVSPDGSLCASGGKDGVILLWDLAEGK--KLYSLDAGSIIHALCFSPNRYWLCAATEA  366
             V +S DG+   S   D  + LWD+A GK  + +      ++     + NR  +  + +A
Sbjct  73   DVVISSDGAFALSASWDSELRLWDIATGKTTRRFVGHEKDVLSVAFSADNRQIVSGSRDA  132

Query  365  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTD  186
            SI++W+      + + +  +  +SE  +E          + C   S +     + S   D
Sbjct  133  SIRLWN-----TLGECKYTISGDSEGHSE---------WVSCVRFSPSQSVPLIVSAGWD  178

Query  185  GVIRVWGIGRY*MEEFRRSHMIIGHVCYLS  96
             +++VW      +   +  + ++GH  YL+
Sbjct  179  RLVKVWN-----LTNCKLRNDLVGHTGYLN  203



>emb|CEG67117.1| Putative Guanine nucleotide-binding protein subunit beta-2-like 
1 [Rhizopus microsporus]
 emb|CEI95133.1| Putative Guanine nucleotide-binding protein subunit beta-2-like 
1 [Rhizopus microsporus]
 emb|CEI93908.1| Putative Guanine nucleotide-binding protein subunit beta-2-like 
1 [Rhizopus microsporus]
Length=316

 Score =   260 bits (665),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 125/198 (63%), Positives = 149/198 (75%), Gaps = 10/198 (5%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            +IKLWNTLGECKY I + DGH EWVSCVRFSP+   P IVSG WD+ VKVW+L+  KLR+
Sbjct  127  SIKLWNTLGECKYNITE-DGHTEWVSCVRFSPNPATPLIVSGGWDKLVKVWDLTKLKLRT  185

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
               GH GYVNTV +SPDGSLCAS GKDGV++LWDL + K LYSLDAGS++HAL FSPNRY
Sbjct  186  NFIGHNGYVNTVTISPDGSLCASAGKDGVVMLWDLNDAKHLYSLDAGSVVHALTFSPNRY  245

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGS  210
            WLCAAT   IKIWDLE+KSIV +LR +  Q  +          KN    C S++W+ADG+
Sbjct  246  WLCAATANGIKIWDLETKSIVDELRPEFAQLGKR---------KNPDPECLSVAWSADGA  296

Query  209  TLFSGYTDGVIRVWGIGR  156
            TLFSGY+D +IRVW + R
Sbjct  297  TLFSGYSDNIIRVWQVTR  314


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 48/207 (23%), Positives = 92/207 (44%), Gaps = 29/207 (14%)
 Frame = -3

Query  695  DGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKL-----RSTLAGHTGYVNTVA  531
            +GH  WV+ +  + S     ++S S D+T+ VWNL+  ++     R +L GH+ +V  +A
Sbjct  11   EGHGNWVTAIA-TTSEAPDMVLSASRDKTIIVWNLTRDEVNYGVPRKSLVGHSHFVEDIA  69

Query  530  VSPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIK  357
            +S DG    S   D  + LWDL  G   + +      ++     + NR  +  + + SIK
Sbjct  70   ISSDGQFALSASWDHTLRLWDLNNGTTTRRFVGHTNDVLSVSFSADNRQIVSGSRDKSIK  129

Query  356  IWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVI  177
            +W+   +            +  ++ +G+      + + C   S N     + SG  D ++
Sbjct  130  LWNTLGEC-----------KYNITEDGH-----TEWVSCVRFSPNPATPLIVSGGWDKLV  173

Query  176  RVWGIGRY*MEEFRRSHMIIGHVCYLS  96
            +VW      + + +     IGH  Y++
Sbjct  174  KVWD-----LTKLKLRTNFIGHNGYVN  195


 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 56/204 (27%), Positives = 90/204 (44%), Gaps = 29/204 (14%)
 Frame = -3

Query  749  TIKLWN-TLGECKYTIQDGD--GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK  579
            TI +WN T  E  Y +      GH+ +V  +  S        +S SWD T+++W+L+N  
Sbjct  38   TIIVWNLTRDEVNYGVPRKSLVGHSHFVEDIAISSD--GQFALSASWDHTLRLWDLNNGT  95

Query  578  LRSTLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWD-LAEGKKLYSLDAGSI-IHALCF  405
                  GHT  V +V+ S D     SG +D  I LW+ L E K   + D  +  +  + F
Sbjct  96   TTRRFVGHTNDVLSVSFSADNRQIVSGSRDKSIKLWNTLGECKYNITEDGHTEWVSCVRF  155

Query  404  SPN---RYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTS  234
            SPN      +    +  +K+WDL      + LR +          G+N        +  +
Sbjct  156  SPNPATPLIVSGGWDKLVKVWDLTK----LKLRTNFI--------GHNG-------YVNT  196

Query  233  LSWNADGSTLFSGYTDGVIRVWGI  162
            ++ + DGS   S   DGV+ +W +
Sbjct  197  VTISPDGSLCASAGKDGVVMLWDL  220



>gb|AAX94566.1| Gpa1 interacting G protein subunit [Cryptococcus neoformans var. 
grubii]
Length=227

 Score =   257 bits (657),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 125/196 (64%), Positives = 153/196 (78%), Gaps = 11/196 (6%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            +IKLWNTLGECK+ I + DGH EWVSCVRFSP+   P I+S  WD+TVKVW LSNCKL++
Sbjct  41   SIKLWNTLGECKFDIVE-DGHTEWVSCVRFSPNPALPVIISAGWDKTVKVWELSNCKLKT  99

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
            T  GHTGY+NT+AVSPDGSL ASGGKDG+ +LWDL EGK LYSLDAG +I+AL FSPNRY
Sbjct  100  THHGHTGYLNTLAVSPDGSLAASGGKDGITMLWDLNEGKHLYSLDAGDVINALVFSPNRY  159

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGS  210
            WLCAAT +SIKI+DLESKS+V DL+ D    S+          K +   CTSL+W+ADG 
Sbjct  160  WLCAATASSIKIFDLESKSLVDDLQPDFDGLSD----------KARKPECTSLAWSADGQ  209

Query  209  TLFSGYTDGVIRVWGI  162
            TLF+G++D ++RVW +
Sbjct  210  TLFAGFSDNLVRVWAV  225



>ref|XP_007244608.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1-like [Astyanax mexicanus]
Length=317

 Score =   260 bits (665),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 129/196 (66%), Positives = 152/196 (78%), Gaps = 11/196 (6%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            TIKLWNTLG CKYTIQD +GH+EWVSCVRFSP++  P IVS  WD+ VKVWNL+NCKL++
Sbjct  128  TIKLWNTLGVCKYTIQD-EGHSEWVSCVRFSPNSSNPIIVSCGWDKMVKVWNLANCKLKT  186

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
               GHTG++NTV VSPDGSLCASGGKDG  +LWDL EGK LY+LD G  I+ALCFSPNRY
Sbjct  187  NHIGHTGFLNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGGDTINALCFSPNRY  246

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGS  210
            WLCAAT  SIKIWDLE K IV +LR           E  +T++K +   CTSL+W+ADG 
Sbjct  247  WLCAATGPSIKIWDLEGKIIVDELR----------QEVISTSSKAEPPQCTSLAWSADGQ  296

Query  209  TLFSGYTDGVIRVWGI  162
            TLF+GYTD +IRVW +
Sbjct  297  TLFAGYTDNLIRVWQV  312


 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 49/206 (24%), Positives = 90/206 (44%), Gaps = 29/206 (14%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKL-----RSTLAGHTGYVNTVAV  528
            GH+ WV+ +  +P      I+S S D+T+ +W L+  +      +  L GH+ +V+ V +
Sbjct  13   GHSGWVTQIATTPQ-FPDMILSASRDKTIVMWKLTRDETNYGVPQRALRGHSHFVSDVVI  71

Query  527  SPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKI  354
            S DG    SG  DG + LWDL  G   + +      ++     + NR  +  + + +IK+
Sbjct  72   SSDGQFALSGSWDGTLRLWDLTTGTTTRRFVGHTKDVLSVAFSADNRQIVSGSRDKTIKL  131

Query  353  WDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIR  174
            W+      V    +  +  SE              + C   S N+    + S   D +++
Sbjct  132  WNTLG---VCKYTIQDEGHSEW-------------VSCVRFSPNSSNPIIVSCGWDKMVK  175

Query  173  VWGIGRY*MEEFRRSHMIIGHVCYLS  96
            VW +      + + +H  IGH  +L+
Sbjct  176  VWNLANC---KLKTNH--IGHTGFLN  196



>gb|ADO27998.1| guanine nucleotide-binding protein subunit beta-2-like 1 [Ictalurus 
furcatus]
Length=317

 Score =   260 bits (664),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 129/196 (66%), Positives = 152/196 (78%), Gaps = 11/196 (6%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            TIKLWNTLG CKYTIQD +GH+EWVSCVRFSP++  P IVS  WD+ VKVWNL+NCKL++
Sbjct  128  TIKLWNTLGVCKYTIQD-EGHSEWVSCVRFSPNSSNPIIVSCGWDKLVKVWNLTNCKLKT  186

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
               GHTG++NTV VSPDGSLCASGGKDG  +LWDL EGK LY+LD G  I+ALCFSPNRY
Sbjct  187  NHIGHTGFLNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGGDTINALCFSPNRY  246

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGS  210
            WLCAAT  SIKIWDLE K IV +LR           E  +T++K +   CTSL+W+ADG 
Sbjct  247  WLCAATGPSIKIWDLEGKIIVDELR----------QEVISTSSKAEPPQCTSLAWSADGQ  296

Query  209  TLFSGYTDGVIRVWGI  162
            TLF+GYTD +IRVW +
Sbjct  297  TLFAGYTDNLIRVWQV  312


 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 33/122 (27%), Positives = 61/122 (50%), Gaps = 8/122 (7%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKL-----RSTLAGHTGYVNTVAV  528
            GH+ WV+ +  +P      I+S S D+++ +W L+  +      +  L GH+ +V+ V +
Sbjct  13   GHSGWVTQIATTPQ-FPDMILSASRDKSIIMWKLTRDETNYGVPQRALRGHSHFVSDVVI  71

Query  527  SPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKI  354
            S DG    SG  DG + LWDL  G   + +      ++     + NR  +  + + +IK+
Sbjct  72   SSDGQFALSGSWDGTLRLWDLTTGTTTRRFVGHTKDVLSVASSADNRQIVSGSRDKTIKL  131

Query  353  WD  348
            W+
Sbjct  132  WN  133



>gb|AAI50408.1| Guanine nucleotide binding protein (G protein), beta polypeptide 
2-like 1 [Danio rerio]
Length=317

 Score =   259 bits (663),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 129/196 (66%), Positives = 149/196 (76%), Gaps = 11/196 (6%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            TIKLWNTLG CKYTIQD D H EWVSCVRFSP++  P IVS  WD+ VKVWNL+NCKL++
Sbjct  128  TIKLWNTLGVCKYTIQD-DSHTEWVSCVRFSPNSSNPIIVSCGWDKMVKVWNLANCKLKT  186

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
               GHTGY+NTV VSPDGSLCASGGKDG  +LWDL EGK LY+LD G  I+ALCFSPNRY
Sbjct  187  NHIGHTGYLNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGGDTINALCFSPNRY  246

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGS  210
            WLCAAT  SI+IWDLE K IV +LR D+            T +K +   CTSL+W+ADG 
Sbjct  247  WLCAATGPSIRIWDLEGKIIVDELRQDII----------TTNSKAEPPQCTSLAWSADGQ  296

Query  209  TLFSGYTDGVIRVWGI  162
            TLF+GYTD +IRVW +
Sbjct  297  TLFAGYTDNLIRVWQV  312



>ref|XP_006147504.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1, partial [Tupaia chinensis]
Length=262

 Score =   258 bits (658),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 128/196 (65%), Positives = 153/196 (78%), Gaps = 11/196 (6%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            TIKLWNTLG CKYT+QD + H+EWVSCVRFSP++  P IVS  WD+ VKVWNL+NCKL++
Sbjct  73   TIKLWNTLGVCKYTVQD-ESHSEWVSCVRFSPNSSNPIIVSCGWDKLVKVWNLANCKLKT  131

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
               GHTGY+NTV VSPDGSLCASGGKDG  +LWDL EGK LY+LD G II+ALCFSPNRY
Sbjct  132  NHIGHTGYLNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRY  191

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGS  210
            WLCAAT  SIKIWDLE K I+VD         E+  E  +T++K +   CTSL+W+ADG 
Sbjct  192  WLCAATGPSIKIWDLEGK-IIVD---------ELKQEVISTSSKAEPPQCTSLAWSADGQ  241

Query  209  TLFSGYTDGVIRVWGI  162
            TLF+GYTD ++RVW +
Sbjct  242  TLFAGYTDNLVRVWQV  257



>gb|KFP96911.1| Guanine nucleotide-binding protein subunit beta-2-like 1, partial 
[Haliaeetus albicilla]
Length=287

 Score =   258 bits (660),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 128/196 (65%), Positives = 153/196 (78%), Gaps = 11/196 (6%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            TIKLWNTLG CKYT+QD + H+EWVSCVRFSP++  P IVS  WD+ VKVWNL+NCKL++
Sbjct  98   TIKLWNTLGVCKYTVQD-ESHSEWVSCVRFSPNSSNPIIVSCGWDKLVKVWNLANCKLKT  156

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
               GHTGY+NTV VSPDGSLCASGGKDG  +LWDL EGK LY+LD G II+ALCFSPNRY
Sbjct  157  NHIGHTGYLNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRY  216

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGS  210
            WLCAAT  SIKIWDLE K I+VD         E+  E  +T++K +   CTSL+W+ADG 
Sbjct  217  WLCAATGPSIKIWDLEGK-IIVD---------ELKQEVISTSSKAEPPQCTSLAWSADGQ  266

Query  209  TLFSGYTDGVIRVWGI  162
            TLF+GYTD ++RVW +
Sbjct  267  TLFAGYTDNLVRVWQV  282



>ref|NP_001187435.1| guanine nucleotide-binding protein subunit beta-2-like 1 [Ictalurus 
punctatus]
 gb|ADO28638.1| guanine nucleotide-binding protein subunit beta-2-like 1 [Ictalurus 
punctatus]
Length=317

 Score =   259 bits (663),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 129/196 (66%), Positives = 152/196 (78%), Gaps = 11/196 (6%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            TIKLWNTLG CKYTIQD +GH+EWVSCVRFSP++  P IVS  WD+ VKVWNL+NCKL++
Sbjct  128  TIKLWNTLGVCKYTIQD-EGHSEWVSCVRFSPNSSNPIIVSCGWDKLVKVWNLANCKLKT  186

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
               GHTG++NTV VSPDGSLCASGGKDG  +LWDL EGK LY+LD G  I+ALCFSPNRY
Sbjct  187  NHIGHTGFLNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGGDTINALCFSPNRY  246

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGS  210
            WLCAAT  SIKIWDLE K IV +LR           E  +T++K +   CTSL+W+ADG 
Sbjct  247  WLCAATGPSIKIWDLEGKIIVDELR----------QEVISTSSKAEPPQCTSLAWSADGQ  296

Query  209  TLFSGYTDGVIRVWGI  162
            TLF+GYTD +IRVW +
Sbjct  297  TLFAGYTDNLIRVWQV  312


 Score = 55.8 bits (133),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 48/206 (23%), Positives = 90/206 (44%), Gaps = 29/206 (14%)
 Frame = -3

Query  692  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKL-----RSTLAGHTGYVNTVAV  528
            GH+ WV+ +  +P      I+S S D+++ +W L+  +      +  L GH+ +V+ V +
Sbjct  13   GHSGWVTQIATTPQ-FPDMILSASRDKSIIMWKLTRDETNYGVPQRALRGHSHFVSDVVI  71

Query  527  SPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKI  354
            S DG    SG  DG + LWDL  G   + +      ++     + NR  +  + + +IK+
Sbjct  72   SSDGQFALSGSWDGTLRLWDLTTGTTTRRFVGHTKDVLSVAFSADNRQIVSGSRDKTIKL  131

Query  353  WDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIR  174
            W+      V    +  +  SE              + C   S N+    + S   D +++
Sbjct  132  WNTLG---VCKYTIQDEGHSEW-------------VSCVRFSPNSSNPIIVSCGWDKLVK  175

Query  173  VWGIGRY*MEEFRRSHMIIGHVCYLS  96
            VW +      + + +H  IGH  +L+
Sbjct  176  VWNLANC---KLKTNH--IGHTGFLN  196



>ref|XP_009080129.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1, partial [Acanthisitta chloris]
Length=236

 Score =   256 bits (655),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 128/196 (65%), Positives = 153/196 (78%), Gaps = 11/196 (6%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            TIKLWNTLG CKYT+QD + H+EWVSCVRFSP++  P IVS  WD+ VKVWNL+NCKL++
Sbjct  47   TIKLWNTLGVCKYTVQD-ESHSEWVSCVRFSPNSSNPIIVSCGWDKLVKVWNLANCKLKT  105

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
               GHTGY+NTV VSPDGSLCASGGKDG  +LWDL EGK LY+LD G II+ALCFSPNRY
Sbjct  106  NHIGHTGYLNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRY  165

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGS  210
            WLCAAT  SIKIWDLE K I+VD         E+  E  +T++K +   CTSL+W+ADG 
Sbjct  166  WLCAATGPSIKIWDLEGK-IIVD---------ELKQEVISTSSKAEPPQCTSLAWSADGQ  215

Query  209  TLFSGYTDGVIRVWGI  162
            TLF+GYTD ++RVW +
Sbjct  216  TLFAGYTDNLVRVWQV  231



>gb|KFQ89059.1| Guanine nucleotide-binding protein subunit beta-2-like 1, partial 
[Phoenicopterus ruber ruber]
Length=290

 Score =   258 bits (660),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 128/196 (65%), Positives = 153/196 (78%), Gaps = 11/196 (6%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            TIKLWNTLG CKYT+QD + H+EWVSCVRFSP++  P IVS  WD+ VKVWNL+NCKL++
Sbjct  101  TIKLWNTLGVCKYTVQD-ESHSEWVSCVRFSPNSSNPIIVSCGWDKLVKVWNLANCKLKT  159

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
               GHTGY+NTV VSPDGSLCASGGKDG  +LWDL EGK LY+LD G II+ALCFSPNRY
Sbjct  160  NHIGHTGYLNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRY  219

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGS  210
            WLCAAT  SIKIWDLE K I+VD         E+  E  +T++K +   CTSL+W+ADG 
Sbjct  220  WLCAATGPSIKIWDLEGK-IIVD---------ELKQEVISTSSKAEPPQCTSLAWSADGQ  269

Query  209  TLFSGYTDGVIRVWGI  162
            TLF+GYTD ++RVW +
Sbjct  270  TLFAGYTDNLVRVWQV  285



>ref|XP_009922131.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1, partial [Haliaeetus albicilla]
Length=291

 Score =   258 bits (660),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 128/196 (65%), Positives = 153/196 (78%), Gaps = 11/196 (6%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            TIKLWNTLG CKYT+QD + H+EWVSCVRFSP++  P IVS  WD+ VKVWNL+NCKL++
Sbjct  102  TIKLWNTLGVCKYTVQD-ESHSEWVSCVRFSPNSSNPIIVSCGWDKLVKVWNLANCKLKT  160

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
               GHTGY+NTV VSPDGSLCASGGKDG  +LWDL EGK LY+LD G II+ALCFSPNRY
Sbjct  161  NHIGHTGYLNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRY  220

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGS  210
            WLCAAT  SIKIWDLE K I+VD         E+  E  +T++K +   CTSL+W+ADG 
Sbjct  221  WLCAATGPSIKIWDLEGK-IIVD---------ELKQEVISTSSKAEPPQCTSLAWSADGQ  270

Query  209  TLFSGYTDGVIRVWGI  162
            TLF+GYTD ++RVW +
Sbjct  271  TLFAGYTDNLVRVWQV  286



>gb|EDL33792.1| guanine nucleotide binding protein (G protein), beta polypeptide 
2 like 1, isoform CRA_c [Mus musculus]
Length=264

 Score =   258 bits (658),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 128/196 (65%), Positives = 153/196 (78%), Gaps = 11/196 (6%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            TIKLWNTLG CKYT+QD + H+EWVSCVRFSP++  P IVS  WD+ VKVWNL+NCKL++
Sbjct  75   TIKLWNTLGVCKYTVQD-ESHSEWVSCVRFSPNSSNPIIVSCGWDKLVKVWNLANCKLKT  133

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
               GHTGY+NTV VSPDGSLCASGGKDG  +LWDL EGK LY+LD G II+ALCFSPNRY
Sbjct  134  NHIGHTGYLNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRY  193

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGS  210
            WLCAAT  SIKIWDLE K I+VD         E+  E  +T++K +   CTSL+W+ADG 
Sbjct  194  WLCAATGPSIKIWDLEGK-IIVD---------ELKQEVISTSSKAEPPQCTSLAWSADGQ  243

Query  209  TLFSGYTDGVIRVWGI  162
            TLF+GYTD ++RVW +
Sbjct  244  TLFAGYTDNLVRVWQV  259



>gb|KFP61115.1| Guanine nucleotide-binding protein subunit beta-2-like 1, partial 
[Cariama cristata]
Length=300

 Score =   259 bits (661),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 128/196 (65%), Positives = 153/196 (78%), Gaps = 11/196 (6%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            TIKLWNTLG CKYT+QD + H+EWVSCVRFSP++  P IVS  WD+ VKVWNL+NCKL++
Sbjct  111  TIKLWNTLGVCKYTVQD-ESHSEWVSCVRFSPNSSNPIIVSCGWDKLVKVWNLANCKLKT  169

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
               GHTGY+NTV VSPDGSLCASGGKDG  +LWDL EGK LY+LD G II+ALCFSPNRY
Sbjct  170  NHIGHTGYLNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRY  229

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGS  210
            WLCAAT  SIKIWDLE K I+VD         E+  E  +T++K +   CTSL+W+ADG 
Sbjct  230  WLCAATGPSIKIWDLEGK-IIVD---------ELKQEVISTSSKAEPPQCTSLAWSADGQ  279

Query  209  TLFSGYTDGVIRVWGI  162
            TLF+GYTD ++RVW +
Sbjct  280  TLFAGYTDNLVRVWQV  295



>ref|XP_007070338.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1, partial [Chelonia mydas]
Length=282

 Score =   258 bits (659),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 128/196 (65%), Positives = 153/196 (78%), Gaps = 11/196 (6%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            TIKLWNTLG CKYT+QD + H+EWVSCVRFSP++  P IVS  WD+ VKVWNL+NCKL++
Sbjct  93   TIKLWNTLGVCKYTVQD-ESHSEWVSCVRFSPNSSNPIIVSCGWDKLVKVWNLANCKLKT  151

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
               GHTGY+NTV VSPDGSLCASGGKDG  +LWDL EGK LY+LD G II+ALCFSPNRY
Sbjct  152  NHIGHTGYLNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRY  211

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGS  210
            WLCAAT  SIKIWDLE K I+VD         E+  E  +T++K +   CTSL+W+ADG 
Sbjct  212  WLCAATGPSIKIWDLEGK-IIVD---------ELKQEVISTSSKAEPPQCTSLAWSADGQ  261

Query  209  TLFSGYTDGVIRVWGI  162
            TLF+GYTD ++RVW +
Sbjct  262  TLFAGYTDNLVRVWQV  277



>dbj|BAB28114.1| unnamed protein product [Mus musculus]
Length=280

 Score =   258 bits (659),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 128/196 (65%), Positives = 153/196 (78%), Gaps = 11/196 (6%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            TIKLWNTLG CKYT+QD + H+EWVSCVRFSP++  P IVS  WD+ VKVWNL+NCKL++
Sbjct  91   TIKLWNTLGVCKYTVQD-ESHSEWVSCVRFSPNSSNPIIVSCGWDKLVKVWNLANCKLKT  149

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
               GHTGY+NTV VSPDGSLCASGGKDG  +LWDL EGK LY+LD G II+ALCFSPNRY
Sbjct  150  NHIGHTGYLNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRY  209

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGS  210
            WLCAAT  SIKIWDLE K I+VD         E+  E  +T++K +   CTSL+W+ADG 
Sbjct  210  WLCAATGPSIKIWDLEGK-IIVD---------ELKQEVISTSSKAEPPQCTSLAWSADGQ  259

Query  209  TLFSGYTDGVIRVWGI  162
            TLF+GYTD ++RVW +
Sbjct  260  TLFAGYTDNLVRVWQV  275



>gb|KFP58388.1| Guanine nucleotide-binding protein subunit beta-2-like 1, partial 
[Cathartes aura]
Length=287

 Score =   258 bits (659),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 128/196 (65%), Positives = 153/196 (78%), Gaps = 11/196 (6%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            TIKLWNTLG CKYT+QD + H+EWVSCVRFSP++  P IVS  WD+ VKVWNL+NCKL++
Sbjct  98   TIKLWNTLGVCKYTVQD-ESHSEWVSCVRFSPNSSNPIIVSCGWDKLVKVWNLANCKLKT  156

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
               GHTGY+NTV VSPDGSLCASGGKDG  +LWDL EGK LY+LD G II+ALCFSPNRY
Sbjct  157  NHIGHTGYLNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRY  216

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGS  210
            WLCAAT  SIKIWDLE K I+VD         E+  E  +T++K +   CTSL+W+ADG 
Sbjct  217  WLCAATGPSIKIWDLEGK-IIVD---------ELKQEVISTSSKAEPPQCTSLAWSADGQ  266

Query  209  TLFSGYTDGVIRVWGI  162
            TLF+GYTD ++RVW +
Sbjct  267  TLFAGYTDNLVRVWQV  282



>ref|XP_009701898.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1, partial [Cariama cristata]
Length=301

 Score =   259 bits (661),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 128/196 (65%), Positives = 153/196 (78%), Gaps = 11/196 (6%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            TIKLWNTLG CKYT+QD + H+EWVSCVRFSP++  P IVS  WD+ VKVWNL+NCKL++
Sbjct  112  TIKLWNTLGVCKYTVQD-ESHSEWVSCVRFSPNSSNPIIVSCGWDKLVKVWNLANCKLKT  170

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
               GHTGY+NTV VSPDGSLCASGGKDG  +LWDL EGK LY+LD G II+ALCFSPNRY
Sbjct  171  NHIGHTGYLNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRY  230

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGS  210
            WLCAAT  SIKIWDLE K I+VD         E+  E  +T++K +   CTSL+W+ADG 
Sbjct  231  WLCAATGPSIKIWDLEGK-IIVD---------ELKQEVISTSSKAEPPQCTSLAWSADGQ  280

Query  209  TLFSGYTDGVIRVWGI  162
            TLF+GYTD ++RVW +
Sbjct  281  TLFAGYTDNLVRVWQV  296



>dbj|BAE40068.1| unnamed protein product [Mus musculus]
 dbj|BAE40156.1| unnamed protein product [Mus musculus]
Length=317

 Score =   259 bits (662),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 128/196 (65%), Positives = 153/196 (78%), Gaps = 11/196 (6%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            TIKLWNTLG CKYT+QD + H+EWVSCVRFSP++  P IVS  WD+ VKVWNL+NCKL++
Sbjct  128  TIKLWNTLGVCKYTVQD-ESHSEWVSCVRFSPNSSNPIIVSCGWDKLVKVWNLANCKLKT  186

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
               GHTGY+NTV VSPDGSLCASGGKDG  +LWDL EGK LY+LD G II+ALCFSPNRY
Sbjct  187  NHIGHTGYLNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRY  246

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGS  210
            WLCAAT  SIKIWDLE K I+VD         E+  E  +T++K +   CTSL+W+ADG 
Sbjct  247  WLCAATGPSIKIWDLEGK-IIVD---------ELKQEVISTSSKAEPPQCTSLAWSADGQ  296

Query  209  TLFSGYTDGVIRVWGI  162
            TLF+GYTD ++RVW +
Sbjct  297  TLFAGYTDNLVRVWQV  312



>ref|XP_009462428.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1 [Nipponia nippon]
Length=307

 Score =   259 bits (661),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 128/196 (65%), Positives = 153/196 (78%), Gaps = 11/196 (6%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            TIKLWNTLG CKYT+QD + H+EWVSCVRFSP++  P IVS  WD+ VKVWNL+NCKL++
Sbjct  118  TIKLWNTLGVCKYTVQD-ESHSEWVSCVRFSPNSSNPIIVSCGWDKLVKVWNLANCKLKT  176

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
               GHTGY+NTV VSPDGSLCASGGKDG  +LWDL EGK LY+LD G II+ALCFSPNRY
Sbjct  177  NHIGHTGYLNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRY  236

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGS  210
            WLCAAT  SIKIWDLE K I+VD         E+  E  +T++K +   CTSL+W+ADG 
Sbjct  237  WLCAATGPSIKIWDLEGK-IIVD---------ELKQEVISTSSKAEPPQCTSLAWSADGQ  286

Query  209  TLFSGYTDGVIRVWGI  162
            TLF+GYTD ++RVW +
Sbjct  287  TLFAGYTDNLVRVWQV  302



>gb|KFQ99079.1| Guanine nucleotide-binding protein subunit beta-2-like 1, partial 
[Opisthocomus hoazin]
Length=281

 Score =   258 bits (658),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 128/196 (65%), Positives = 153/196 (78%), Gaps = 11/196 (6%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            TIKLWNTLG CKYT+QD + H+EWVSCVRFSP++  P IVS  WD+ VKVWNL+NCKL++
Sbjct  92   TIKLWNTLGVCKYTVQD-ESHSEWVSCVRFSPNSSNPIIVSCGWDKLVKVWNLANCKLKT  150

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
               GHTGY+NTV VSPDGSLCASGGKDG  +LWDL EGK LY+LD G II+ALCFSPNRY
Sbjct  151  NHIGHTGYLNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRY  210

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGS  210
            WLCAAT  SIKIWDLE K I+VD         E+  E  +T++K +   CTSL+W+ADG 
Sbjct  211  WLCAATGPSIKIWDLEGK-IIVD---------ELKQEVISTSSKAEPPQCTSLAWSADGQ  260

Query  209  TLFSGYTDGVIRVWGI  162
            TLF+GYTD ++RVW +
Sbjct  261  TLFAGYTDNLVRVWQV  276



>gb|AEW43729.1| activated protein kinase C receptor, partial [Epinephelus coioides]
Length=302

 Score =   258 bits (660),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 128/196 (65%), Positives = 152/196 (78%), Gaps = 11/196 (6%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            TIKLWNTLG CKYTIQD +GH+EWVSCVRFSP++  P IVS  WD+ VKVWNL+NCKL++
Sbjct  113  TIKLWNTLGVCKYTIQD-EGHSEWVSCVRFSPNSQNPIIVSCGWDKMVKVWNLTNCKLKT  171

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
               GHTG++NTV VSPDGSLCASGG+DG  +LWDL EGK LY+LD+G  I+ALCFSPNRY
Sbjct  172  NHIGHTGFLNTVTVSPDGSLCASGGRDGQAMLWDLNEGKHLYTLDSGDTINALCFSPNRY  231

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGS  210
            WLCAAT  SIKIWDLE K IV +LR           E  +T +K +   CTSL+W+ADG 
Sbjct  232  WLCAATGPSIKIWDLEGKVIVDELR----------QEVISTNSKAEPPQCTSLAWSADGQ  281

Query  209  TLFSGYTDGVIRVWGI  162
            TLF+GYTD +IRVW +
Sbjct  282  TLFAGYTDNLIRVWQV  297



>gb|EPB90862.1| guanine nucleotide-binding protein subunit beta-2-like 1 [Mucor 
circinelloides f. circinelloides 1006PhL]
Length=311

 Score =   259 bits (661),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 126/198 (64%), Positives = 149/198 (75%), Gaps = 10/198 (5%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            +IKLWNTLGECKY I + DGH+EWVSCVRFSP+   P IVSG WD+ VKVW+L+  KLR+
Sbjct  122  SIKLWNTLGECKYNITE-DGHSEWVSCVRFSPNPANPLIVSGGWDKLVKVWDLTKMKLRT  180

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
               GH GYVNTV +SPDGSLCAS GKDGV++LWDL + K LYSL+AGS++HAL FSPNRY
Sbjct  181  NFIGHNGYVNTVTISPDGSLCASAGKDGVVMLWDLNDAKHLYSLEAGSLVHALTFSPNRY  240

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGS  210
            WLCAAT   IKIWDLESKSIV +LR +  Q  +          KN    C S+ W+ADG+
Sbjct  241  WLCAATANGIKIWDLESKSIVDELRPEFAQLGKR---------KNPDPDCLSVCWSADGA  291

Query  209  TLFSGYTDGVIRVWGIGR  156
            TLFSGY+D VIRVW + R
Sbjct  292  TLFSGYSDNVIRVWQVTR  309


 Score = 53.1 bits (126),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 43/187 (23%), Positives = 83/187 (44%), Gaps = 28/187 (15%)
 Frame = -3

Query  635  IVSGSWDRTVKVWNLSNCKL-----RSTLAGHTGYVNTVAVSPDGSLCASGGKDGVILLW  471
            ++S S D+T+ VWNL   ++     R +L GH+ +V  +A+S DG    S   D  + LW
Sbjct  25   VLSASRDKTIIVWNLIRDEMNYGVPRKSLVGHSHFVEDLAISSDGQFALSASWDQTLRLW  84

Query  470  DLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQE  297
            DL  G   + +      ++     + NR  +  + + SIK+W+   +            +
Sbjct  85   DLNSGTTTRRFVGHTNDVLSVSFSADNRQIVSGSRDKSIKLWNTLGEC-----------K  133

Query  296  SEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY*MEEFRRSHMII  117
              ++ +G+     ++ + C   S N     + SG  D +++VW + +      +     I
Sbjct  134  YNITEDGH-----SEWVSCVRFSPNPANPLIVSGGWDKLVKVWDLTK-----MKLRTNFI  183

Query  116  GHVCYLS  96
            GH  Y++
Sbjct  184  GHNGYVN  190


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 54/204 (26%), Positives = 90/204 (44%), Gaps = 29/204 (14%)
 Frame = -3

Query  749  TIKLWNTL-GECKYTIQDGD--GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK  579
            TI +WN +  E  Y +      GH+ +V  +  S        +S SWD+T+++W+L++  
Sbjct  33   TIIVWNLIRDEMNYGVPRKSLVGHSHFVEDLAISSD--GQFALSASWDQTLRLWDLNSGT  90

Query  578  LRSTLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWD-LAEGKKLYSLDAGSI-IHALCF  405
                  GHT  V +V+ S D     SG +D  I LW+ L E K   + D  S  +  + F
Sbjct  91   TTRRFVGHTNDVLSVSFSADNRQIVSGSRDKSIKLWNTLGECKYNITEDGHSEWVSCVRF  150

Query  404  SP---NRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTS  234
            SP   N   +    +  +K+WDL             K +   +  G+N        +  +
Sbjct  151  SPNPANPLIVSGGWDKLVKVWDLT------------KMKLRTNFIGHNG-------YVNT  191

Query  233  LSWNADGSTLFSGYTDGVIRVWGI  162
            ++ + DGS   S   DGV+ +W +
Sbjct  192  VTISPDGSLCASAGKDGVVMLWDL  215



>ref|XP_009448630.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1 isoform X3 [Pan troglodytes]
 gb|EAW53695.1| guanine nucleotide binding protein (G protein), beta polypeptide 
2-like 1, isoform CRA_d [Homo sapiens]
 gb|EOB02165.1| Guanine nucleotide-binding protein subunit beta-2-like 1 [Anas 
platyrhynchos]
Length=276

 Score =   258 bits (658),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 128/196 (65%), Positives = 153/196 (78%), Gaps = 11/196 (6%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            TIKLWNTLG CKYT+QD + H+EWVSCVRFSP++  P IVS  WD+ VKVWNL+NCKL++
Sbjct  87   TIKLWNTLGVCKYTVQD-ESHSEWVSCVRFSPNSSNPIIVSCGWDKLVKVWNLANCKLKT  145

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
               GHTGY+NTV VSPDGSLCASGGKDG  +LWDL EGK LY+LD G II+ALCFSPNRY
Sbjct  146  NHIGHTGYLNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRY  205

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGS  210
            WLCAAT  SIKIWDLE K I+VD         E+  E  +T++K +   CTSL+W+ADG 
Sbjct  206  WLCAATGPSIKIWDLEGK-IIVD---------ELKQEVISTSSKAEPPQCTSLAWSADGQ  255

Query  209  TLFSGYTDGVIRVWGI  162
            TLF+GYTD ++RVW +
Sbjct  256  TLFAGYTDNLVRVWQV  271



>ref|XP_006037851.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1 [Alligator sinensis]
Length=306

 Score =   259 bits (661),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 130/196 (66%), Positives = 155/196 (79%), Gaps = 11/196 (6%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            TIKLWNTLG CKYT+QD + H+EWVSCVRFSP++  P IVS  WD+ VKVWNL+NCKL++
Sbjct  117  TIKLWNTLGVCKYTVQD-ESHSEWVSCVRFSPNSSNPIIVSCGWDKLVKVWNLANCKLKT  175

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
               GHTGY+NTV VSPDGSLCASGGKDG  +LWDL EGK LY+LD G II+ALCFSPNRY
Sbjct  176  NHIGHTGYLNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRY  235

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGS  210
            WLCAAT  SIKIWDLE K I+VD   +LKQE        +T++K +   CTSL+W+ADG 
Sbjct  236  WLCAATGPSIKIWDLEGK-IIVD---ELKQEVI------STSSKAEPPQCTSLAWSADGQ  285

Query  209  TLFSGYTDGVIRVWGI  162
            TLF+GYTD ++RVW +
Sbjct  286  TLFAGYTDNLVRVWQV  301



>ref|XP_005658294.1| PREDICTED: guanine nucleotide binding protein (G protein), beta 
polypeptide 2-like 1 isoform X1 [Sus scrofa]
Length=308

 Score =   259 bits (661),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 128/196 (65%), Positives = 153/196 (78%), Gaps = 11/196 (6%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            TIKLWNTLG CKYT+QD + H+EWVSCVRFSP++  P IVS  WD+ VKVWNL+NCKL++
Sbjct  119  TIKLWNTLGVCKYTVQD-ESHSEWVSCVRFSPNSSNPIIVSCGWDKLVKVWNLANCKLKT  177

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
               GHTGY+NTV VSPDGSLCASGGKDG  +LWDL EGK LY+LD G II+ALCFSPNRY
Sbjct  178  NHIGHTGYLNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRY  237

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGS  210
            WLCAAT  SIKIWDLE K I+VD         E+  E  +T++K +   CTSL+W+ADG 
Sbjct  238  WLCAATGPSIKIWDLEGK-IIVD---------ELKQEVISTSSKAEPPQCTSLAWSADGQ  287

Query  209  TLFSGYTDGVIRVWGI  162
            TLF+GYTD ++RVW +
Sbjct  288  TLFAGYTDNLVRVWQV  303



>ref|XP_010296751.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1, partial [Balearica regulorum gibbericeps]
Length=286

 Score =   258 bits (659),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 128/196 (65%), Positives = 153/196 (78%), Gaps = 11/196 (6%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            TIKLWNTLG CKYT+QD + H+EWVSCVRFSP++  P IVS  WD+ VKVWNL+NCKL++
Sbjct  97   TIKLWNTLGVCKYTVQD-ESHSEWVSCVRFSPNSSNPIIVSCGWDKLVKVWNLANCKLKT  155

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
               GHTGY+NTV VSPDGSLCASGGKDG  +LWDL EGK LY+LD G II+ALCFSPNRY
Sbjct  156  NHIGHTGYLNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRY  215

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGS  210
            WLCAAT  SIKIWDLE K I+VD         E+  E  +T++K +   CTSL+W+ADG 
Sbjct  216  WLCAATGPSIKIWDLEGK-IIVD---------ELKQEVISTSSKAEPPQCTSLAWSADGQ  265

Query  209  TLFSGYTDGVIRVWGI  162
            TLF+GYTD ++RVW +
Sbjct  266  TLFAGYTDNLVRVWQV  281



>ref|XP_009489930.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1, partial [Pelecanus crispus]
Length=289

 Score =   258 bits (659),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 128/196 (65%), Positives = 153/196 (78%), Gaps = 11/196 (6%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            TIKLWNTLG CKYT+QD + H+EWVSCVRFSP++  P IVS  WD+ VKVWNL+NCKL++
Sbjct  100  TIKLWNTLGVCKYTVQD-ESHSEWVSCVRFSPNSSNPIIVSCGWDKLVKVWNLANCKLKT  158

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
               GHTGY+NTV VSPDGSLCASGGKDG  +LWDL EGK LY+LD G II+ALCFSPNRY
Sbjct  159  NHIGHTGYLNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRY  218

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGS  210
            WLCAAT  SIKIWDLE K I+VD         E+  E  +T++K +   CTSL+W+ADG 
Sbjct  219  WLCAATGPSIKIWDLEGK-IIVD---------ELKQEVISTSSKAEPPQCTSLAWSADGQ  268

Query  209  TLFSGYTDGVIRVWGI  162
            TLF+GYTD ++RVW +
Sbjct  269  TLFAGYTDNLVRVWQV  284



>ref|XP_004387229.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1 [Trichechus manatus latirostris]
Length=317

 Score =   259 bits (661),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 128/196 (65%), Positives = 153/196 (78%), Gaps = 11/196 (6%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            TIKLWNTLG CKYT+QD + H+EWVSCVRFSP++  P IVS  WD+ VKVWNL+NCKL++
Sbjct  128  TIKLWNTLGVCKYTVQD-ESHSEWVSCVRFSPNSSNPIIVSCGWDKLVKVWNLANCKLKT  186

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
               GHTGY+NTV VSPDGSLCASGGKDG  +LWDL EGK LY+LD G II+ALCFSPNRY
Sbjct  187  NHIGHTGYLNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRY  246

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGS  210
            WLCAAT  SIKIWDLE K I+VD         E+  E  +T++K +   CTSL+W+ADG 
Sbjct  247  WLCAATGPSIKIWDLEGK-IIVD---------ELKQEVISTSSKAEPPQCTSLAWSADGQ  296

Query  209  TLFSGYTDGVIRVWGI  162
            TLF+GYTD ++RVW +
Sbjct  297  TLFAGYTDNLVRVWQV  312



>gb|KFQ96249.1| Guanine nucleotide-binding protein subunit beta-2-like 1, partial 
[Nipponia nippon]
Length=291

 Score =   258 bits (659),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 128/196 (65%), Positives = 153/196 (78%), Gaps = 11/196 (6%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            TIKLWNTLG CKYT+QD + H+EWVSCVRFSP++  P IVS  WD+ VKVWNL+NCKL++
Sbjct  102  TIKLWNTLGVCKYTVQD-ESHSEWVSCVRFSPNSSNPIIVSCGWDKLVKVWNLANCKLKT  160

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
               GHTGY+NTV VSPDGSLCASGGKDG  +LWDL EGK LY+LD G II+ALCFSPNRY
Sbjct  161  NHIGHTGYLNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRY  220

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGS  210
            WLCAAT  SIKIWDLE K I+VD         E+  E  +T++K +   CTSL+W+ADG 
Sbjct  221  WLCAATGPSIKIWDLEGK-IIVD---------ELKQEVISTSSKAEPPQCTSLAWSADGQ  270

Query  209  TLFSGYTDGVIRVWGI  162
            TLF+GYTD ++RVW +
Sbjct  271  TLFAGYTDNLVRVWQV  286



>dbj|BAE40059.1| unnamed protein product [Mus musculus]
Length=317

 Score =   259 bits (661),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 128/196 (65%), Positives = 153/196 (78%), Gaps = 11/196 (6%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            TIKLWNTLG CKYT+QD + H+EWVSCVRFSP++  P IVS  WD+ VKVWNL+NCKL++
Sbjct  128  TIKLWNTLGVCKYTVQD-ESHSEWVSCVRFSPNSSNPIIVSCGWDKLVKVWNLANCKLKT  186

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
               GHTGY+NTV VSPDGSLCASGGKDG  +LWDL EGK LY+LD G II+ALCFSPNRY
Sbjct  187  NHIGHTGYLNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRY  246

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGS  210
            WLCAAT  SIKIWDLE K I+VD         E+  E  +T++K +   CTSL+W+ADG 
Sbjct  247  WLCAATGPSIKIWDLEGK-IIVD---------ELKQEVISTSSKAEPPQCTSLAWSADGQ  296

Query  209  TLFSGYTDGVIRVWGI  162
            TLF+GYTD ++RVW +
Sbjct  297  TLFAGYTDNLVRVWQV  312



>gb|AAI02287.2| GNB2L1 protein [Bos taurus]
Length=317

 Score =   259 bits (661),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 128/196 (65%), Positives = 153/196 (78%), Gaps = 11/196 (6%)
 Frame = -3

Query  749  TIKLWNTLGECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  570
            TIKLWNTLG CKYT+QD + H+EWVSCVRFSP++  P IVS  WD+ VKVWNL+NCKL++
Sbjct  128  TIKLWNTLGVCKYTVQD-ESHSEWVSCVRFSPNSSNPIIVSCGWDKLVKVWNLANCKLKT  186

Query  569  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  390
               GHTGY+NTV VSPDGSLCASGGKDG  +LWDL EGK LY+LD G II+ALCFSPNRY
Sbjct  187  NHIGHTGYLNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRY  246

Query  389  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGS  210
            WLCAAT  SIKIWDLE K I+VD         E+  E  +T++K +   CTSL+W+ADG 
Sbjct  247  WLCAATGPSIKIWDLEGK-IIVD---------ELKQEVISTSSKAEPPQCTSLAWSADGQ  296

Query  209  TLFSGYTDGVIRVWGI  162
            TLF+GYTD ++RVW +
Sbjct  297  TLFAGYTDNLVRVWQV  312



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1387667965840