BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF008J02

Length=741
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP02196.1|  unnamed protein product                                322   9e-107   Coffea canephora [robusta coffee]
ref|XP_010087805.1|  Mitochondrial outer membrane protein porin o...    320   7e-106   Morus notabilis
ref|XP_008443436.1|  PREDICTED: mitochondrial outer membrane prot...    319   1e-105   Cucumis melo [Oriental melon]
ref|XP_010524325.1|  PREDICTED: mitochondrial outer membrane prot...    319   1e-105   Tarenaya hassleriana [spider flower]
ref|XP_009587690.1|  PREDICTED: mitochondrial outer membrane prot...    318   3e-105   Nicotiana tomentosiformis
ref|XP_010550070.1|  PREDICTED: mitochondrial outer membrane prot...    318   3e-105   Tarenaya hassleriana [spider flower]
ref|XP_004147460.1|  PREDICTED: mitochondrial outer membrane prot...    317   4e-105   
ref|XP_009798894.1|  PREDICTED: mitochondrial outer membrane prot...    316   1e-104   Nicotiana sylvestris
ref|XP_009596455.1|  PREDICTED: mitochondrial outer membrane prot...    316   2e-104   Nicotiana tomentosiformis
gb|ABC01904.1|  34 kDa outer mitochondrial membrane protein porin...    316   2e-104   Solanum tuberosum [potatoes]
ref|NP_001275154.1|  mitochondrial outer membrane protein porin o...    315   3e-104   Solanum tuberosum [potatoes]
ref|XP_004233349.1|  PREDICTED: mitochondrial outer membrane prot...    315   4e-104   Solanum lycopersicum
ref|XP_008230727.1|  PREDICTED: mitochondrial outer membrane prot...    315   5e-104   Prunus mume [ume]
ref|XP_009779190.1|  PREDICTED: mitochondrial outer membrane prot...    314   7e-104   Nicotiana sylvestris
ref|XP_006361834.1|  PREDICTED: uncharacterized LOC102577832            314   9e-104   Solanum tuberosum [potatoes]
ref|XP_011098570.1|  PREDICTED: mitochondrial outer membrane prot...    313   1e-103   Sesamum indicum [beniseed]
ref|XP_011085778.1|  PREDICTED: mitochondrial outer membrane prot...    313   1e-103   Sesamum indicum [beniseed]
dbj|BAF95070.1|  voltage-dependent anion channel                        313   2e-103   Nicotiana tabacum [American tobacco]
ref|XP_008379329.1|  PREDICTED: LOW QUALITY PROTEIN: mitochondria...    313   2e-103   Malus domestica [apple tree]
ref|XP_004234781.2|  PREDICTED: mitochondrial outer membrane prot...    313   2e-103   Solanum lycopersicum
gb|KHG03636.1|  Mitochondrial outer membrane porin of 34 kDa            312   5e-103   Gossypium arboreum [tree cotton]
ref|XP_008341536.1|  PREDICTED: outer plastidial membrane protein...    311   8e-103   Malus domestica [apple tree]
gb|AIL25718.1|  voltage-dependent anion channel                         311   9e-103   Nicotiana tabacum [American tobacco]
ref|XP_007215668.1|  hypothetical protein PRUPE_ppa008585mg             313   1e-102   
gb|KHG07130.1|  Mitochondrial outer membrane protein porin of 34 kDa    310   2e-102   Gossypium arboreum [tree cotton]
gb|KJB33661.1|  hypothetical protein B456_006G024700                    310   2e-102   Gossypium raimondii
ref|XP_007032450.1|  Voltage dependent anion channel 1                  310   3e-102   
ref|XP_003543710.1|  PREDICTED: outer plastidial membrane protein...    310   3e-102   Glycine max [soybeans]
gb|KHG10147.1|  Mitochondrial outer membrane porin of 34 kDa            310   4e-102   Gossypium arboreum [tree cotton]
gb|KHN13242.1|  Outer plastidial membrane protein porin                 310   5e-102   Glycine soja [wild soybean]
ref|XP_010066951.1|  PREDICTED: mitochondrial outer membrane prot...    309   7e-102   Eucalyptus grandis [rose gum]
gb|EYU34113.1|  hypothetical protein MIMGU_mgv1a011597mg                308   1e-101   Erythranthe guttata [common monkey flower]
ref|XP_002282471.1|  PREDICTED: mitochondrial outer membrane prot...    308   1e-101   Vitis vinifera
emb|CDP00287.1|  unnamed protein product                                308   2e-101   Coffea canephora [robusta coffee]
ref|XP_011085779.1|  PREDICTED: mitochondrial outer membrane prot...    308   2e-101   Sesamum indicum [beniseed]
gb|KHG07129.1|  Mitochondrial outer membrane protein porin of 34 kDa    310   2e-101   Gossypium arboreum [tree cotton]
ref|XP_002520135.1|  voltage-dependent anion-selective channel, p...    308   3e-101   Ricinus communis
gb|KHN11584.1|  Outer plastidial membrane protein porin                 307   4e-101   Glycine soja [wild soybean]
gb|KHN45480.1|  Mitochondrial outer membrane protein porin of 34 kDa    307   4e-101   Glycine soja [wild soybean]
ref|NP_001238377.1|  peroxisomal voltage-dependent anion-selectiv...    307   5e-101   Glycine max [soybeans]
ref|XP_003554316.1|  PREDICTED: mitochondrial outer membrane prot...    307   5e-101   Glycine max [soybeans]
ref|XP_003552508.1|  PREDICTED: outer plastidial membrane protein...    306   9e-101   Glycine max [soybeans]
ref|XP_011034213.1|  PREDICTED: mitochondrial outer membrane prot...    306   1e-100   Populus euphratica
ref|XP_002312708.1|  porin family protein                               306   2e-100   Populus trichocarpa [western balsam poplar]
gb|ACU20122.1|  unknown                                                 305   2e-100   Glycine max [soybeans]
gb|AAQ87020.1|  VDAC1.2                                                 305   3e-100   Lotus japonicus
gb|AAY82249.1|  mitochrondrial voltage-dependent anion-selective ...    305   5e-100   Phaseolus coccineus [scarlet runner bean]
gb|AAQ87019.1|  VDAC1.1                                                 304   6e-100   Lotus japonicus
gb|KJB11405.1|  hypothetical protein B456_001G256800                    302   7e-100   Gossypium raimondii
gb|KCW56275.1|  hypothetical protein EUGRSUZ_I02018                     303   8e-100   Eucalyptus grandis [rose gum]
gb|AAB38498.1|  porin                                                   304   1e-99    Mesembryanthemum crystallinum
emb|CDP00288.1|  unnamed protein product                                304   1e-99    Coffea canephora [robusta coffee]
ref|XP_006482536.1|  PREDICTED: mitochondrial outer membrane prot...    303   1e-99    Citrus sinensis [apfelsine]
gb|KJB50697.1|  hypothetical protein B456_008G182700                    301   2e-99    Gossypium raimondii
gb|AFK40985.1|  unknown                                                 303   3e-99    Lotus japonicus
gb|KJB11402.1|  hypothetical protein B456_001G256800                    303   3e-99    Gossypium raimondii
gb|KJB11404.1|  hypothetical protein B456_001G256800                    302   3e-99    Gossypium raimondii
ref|XP_008456460.1|  PREDICTED: mitochondrial outer membrane prot...    303   3e-99    Cucumis melo [Oriental melon]
ref|XP_006438620.1|  hypothetical protein CICLE_v10032366mg             302   4e-99    Citrus clementina [clementine]
ref|XP_010029375.1|  PREDICTED: mitochondrial outer membrane prot...    302   5e-99    Eucalyptus grandis [rose gum]
gb|ABB02635.1|  unknown                                                 298   5e-99    Solanum tuberosum [potatoes]
gb|ACU24178.1|  unknown                                                 302   6e-99    Glycine max [soybeans]
gb|AFK39621.1|  unknown                                                 302   6e-99    Lotus japonicus
gb|KJB50696.1|  hypothetical protein B456_008G182700                    301   7e-99    Gossypium raimondii
gb|KHG01383.1|  Mitochondrial outer membrane porin of 36 kDa            301   8e-99    Gossypium arboreum [tree cotton]
ref|XP_006431074.1|  hypothetical protein CICLE_v10012445mg             301   8e-99    Citrus clementina [clementine]
ref|XP_010033217.1|  PREDICTED: mitochondrial outer membrane prot...    301   9e-99    Eucalyptus grandis [rose gum]
ref|XP_006483230.1|  PREDICTED: mitochondrial outer membrane prot...    301   1e-98    Citrus sinensis [apfelsine]
ref|XP_010096343.1|  Mitochondrial outer membrane protein porin o...    301   1e-98    Morus notabilis
ref|XP_004146750.1|  PREDICTED: mitochondrial outer membrane prot...    301   1e-98    Cucumis sativus [cucumbers]
emb|CDY66736.1|  BnaCnng52100D                                          301   1e-98    Brassica napus [oilseed rape]
ref|XP_006378154.1|  porin family protein                               301   1e-98    Populus trichocarpa [western balsam poplar]
ref|XP_009125035.1|  PREDICTED: mitochondrial outer membrane prot...    300   2e-98    Brassica rapa
ref|XP_010683253.1|  PREDICTED: mitochondrial outer membrane prot...    300   3e-98    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009131920.1|  PREDICTED: mitochondrial outer membrane prot...    300   3e-98    Brassica rapa
emb|CDY28690.1|  BnaCnng05760D                                          300   5e-98    Brassica napus [oilseed rape]
ref|XP_007139603.1|  hypothetical protein PHAVU_008G043800g             299   6e-98    Phaseolus vulgaris [French bean]
gb|EPS57816.1|  hypothetical protein M569_17001                         299   6e-98    Genlisea aurea
gb|KJB30018.1|  hypothetical protein B456_005G139100                    299   8e-98    Gossypium raimondii
gb|KJB30017.1|  hypothetical protein B456_005G139100                    298   9e-98    Gossypium raimondii
ref|XP_011010796.1|  PREDICTED: mitochondrial outer membrane prot...    298   1e-97    Populus euphratica
gb|KHG13762.1|  Mitochondrial outer membrane porin of 36 kDa            298   1e-97    Gossypium arboreum [tree cotton]
ref|XP_008221678.1|  PREDICTED: mitochondrial outer membrane prot...    298   1e-97    Prunus mume [ume]
gb|KFK37589.1|  hypothetical protein AALP_AA3G002700                    298   1e-97    Arabis alpina [alpine rockcress]
ref|XP_009147408.1|  PREDICTED: mitochondrial outer membrane prot...    298   1e-97    Brassica rapa
gb|KGN47800.1|  hypothetical protein Csa_6G404150                       300   2e-97    Cucumis sativus [cucumbers]
ref|XP_010256458.1|  PREDICTED: mitochondrial outer membrane prot...    298   2e-97    Nelumbo nucifera [Indian lotus]
ref|XP_009797869.1|  PREDICTED: mitochondrial outer membrane prot...    298   2e-97    Nicotiana sylvestris
ref|XP_010242364.1|  PREDICTED: mitochondrial outer membrane prot...    298   3e-97    Nelumbo nucifera [Indian lotus]
ref|XP_009772199.1|  PREDICTED: mitochondrial outer membrane prot...    297   3e-97    Nicotiana sylvestris
gb|AAD38145.1|AF139498_1  porin                                         297   4e-97    Prunus armeniaca
ref|XP_002276636.1|  PREDICTED: mitochondrial outer membrane prot...    297   4e-97    Vitis vinifera
emb|CDY68122.1|  BnaA05g37480D                                          296   7e-97    Brassica napus [oilseed rape]
ref|XP_002884286.1|  hypothetical protein ARALYDRAFT_477400             296   1e-96    
ref|XP_008339931.1|  PREDICTED: mitochondrial outer membrane prot...    296   1e-96    
ref|XP_004228386.1|  PREDICTED: mitochondrial outer membrane prot...    296   2e-96    Solanum lycopersicum
ref|XP_006408480.1|  hypothetical protein EUTSA_v10021076mg             298   2e-96    
gb|AAA96275.1|  voltage-dependent anion channel protein                 295   2e-96    Spinacia oleracea
gb|AID59897.1|  voltage-dependent anion channel protein                 295   2e-96    Prunus persica
ref|NP_001275134.1|  mitochondrial outer membrane protein porin o...    295   3e-96    Solanum tuberosum [potatoes]
emb|CAA56601.1|  36kDa porin I                                          295   3e-96    Solanum tuberosum [potatoes]
gb|EYU34669.1|  hypothetical protein MIMGU_mgv1a011608mg                294   5e-96    Erythranthe guttata [common monkey flower]
ref|XP_007222361.1|  hypothetical protein PRUPE_ppa008111mg             296   8e-96    
ref|XP_010932447.1|  PREDICTED: mitochondrial outer membrane prot...    293   1e-95    Elaeis guineensis
ref|XP_009627246.1|  PREDICTED: mitochondrial outer membrane prot...    293   1e-95    Nicotiana tomentosiformis
ref|XP_008389525.1|  PREDICTED: mitochondrial outer membrane prot...    293   2e-95    Malus domestica [apple tree]
ref|XP_006298184.1|  hypothetical protein CARUB_v10014234mg             293   2e-95    
emb|CDY59668.1|  BnaCnng35410D                                          293   2e-95    Brassica napus [oilseed rape]
ref|XP_010925058.1|  PREDICTED: mitochondrial outer membrane prot...    293   2e-95    Elaeis guineensis
ref|XP_006298185.1|  hypothetical protein CARUB_v10014234mg             294   2e-95    
emb|CDX91952.1|  BnaC03g32540D                                          293   3e-95    
ref|XP_009599229.1|  PREDICTED: mitochondrial outer membrane prot...    292   5e-95    Nicotiana tomentosiformis
ref|XP_004302356.1|  PREDICTED: mitochondrial outer membrane prot...    291   6e-95    Fragaria vesca subsp. vesca
gb|KDP21225.1|  hypothetical protein JCGZ_21696                         291   7e-95    Jatropha curcas
emb|CDX74294.1|  BnaA03g27530D                                          291   7e-95    
gb|AAS48868.1|  voltage-dependent anion-selective channel               291   7e-95    Brassica rapa subsp. pekinensis [bai cai]
gb|AAW22621.1|  outer mitochondrial membrane protein porin 1            291   7e-95    Brassica napus [oilseed rape]
ref|XP_009360395.1|  PREDICTED: mitochondrial outer membrane prot...    291   8e-95    Pyrus x bretschneideri [bai li]
ref|XP_009134621.1|  PREDICTED: mitochondrial outer membrane prot...    291   8e-95    Brassica rapa
gb|KJB11403.1|  hypothetical protein B456_001G256800                    291   9e-95    Gossypium raimondii
ref|NP_186777.1|  voltage dependent anion channel 1                     291   1e-94    Arabidopsis thaliana [mouse-ear cress]
ref|NP_001288856.1|  mitochondrial outer membrane protein porin 3...    291   1e-94    Brassica rapa
ref|XP_006400027.1|  hypothetical protein EUTSA_v10014354mg             290   2e-94    Eutrema salsugineum [saltwater cress]
ref|XP_011071026.1|  PREDICTED: mitochondrial outer membrane prot...    290   2e-94    Sesamum indicum [beniseed]
gb|AAM65525.1|  putative porin                                          290   2e-94    Arabidopsis thaliana [mouse-ear cress]
gb|KDP45473.1|  hypothetical protein JCGZ_09722                         290   2e-94    Jatropha curcas
ref|XP_007046221.1|  Voltage dependent anion channel 1 isoform 1        290   3e-94    Theobroma cacao [chocolate]
gb|KHG20441.1|  Mitochondrial outer membrane porin of 36 kDa            290   4e-94    Gossypium arboreum [tree cotton]
ref|XP_008775594.1|  PREDICTED: mitochondrial outer membrane prot...    289   8e-94    Phoenix dactylifera
emb|CDY63765.1|  BnaCnng42590D                                          288   9e-94    Brassica napus [oilseed rape]
ref|XP_002324035.1|  hypothetical protein POPTR_0017s11430g             288   9e-94    Populus trichocarpa [western balsam poplar]
ref|XP_009410756.1|  PREDICTED: mitochondrial outer membrane prot...    287   3e-93    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011005064.1|  PREDICTED: mitochondrial outer membrane prot...    287   4e-93    Populus euphratica
emb|CDX85566.1|  BnaA02g02470D                                          286   5e-93    
ref|XP_011086392.1|  PREDICTED: mitochondrial outer membrane prot...    286   6e-93    Sesamum indicum [beniseed]
ref|XP_004297335.1|  PREDICTED: mitochondrial outer membrane prot...    286   7e-93    Fragaria vesca subsp. vesca
ref|XP_010925360.1|  PREDICTED: mitochondrial outer membrane prot...    286   8e-93    Elaeis guineensis
ref|XP_008808420.1|  PREDICTED: mitochondrial outer membrane prot...    286   8e-93    Phoenix dactylifera
ref|XP_010485517.1|  PREDICTED: mitochondrial outer membrane prot...    286   1e-92    Camelina sativa [gold-of-pleasure]
gb|KJB60739.1|  hypothetical protein B456_009G323300                    285   2e-92    Gossypium raimondii
ref|NP_001288964.1|  mitochondrial outer membrane protein porin 3       285   3e-92    Brassica rapa
ref|XP_010670319.1|  PREDICTED: mitochondrial outer membrane prot...    285   4e-92    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010463547.1|  PREDICTED: mitochondrial outer membrane prot...    284   4e-92    Camelina sativa [gold-of-pleasure]
ref|XP_010512938.1|  PREDICTED: mitochondrial outer membrane prot...    283   1e-91    Camelina sativa [gold-of-pleasure]
gb|AAQ87021.1|  VDAC1.3                                                 283   2e-91    Lotus japonicus
ref|XP_009408682.1|  PREDICTED: mitochondrial outer membrane prot...    282   3e-91    Musa acuminata subsp. malaccensis [pisang utan]
gb|EYU22439.1|  hypothetical protein MIMGU_mgv1a011543mg                282   3e-91    Erythranthe guttata [common monkey flower]
ref|XP_010453637.1|  PREDICTED: mitochondrial outer membrane prot...    282   4e-91    Camelina sativa [gold-of-pleasure]
ref|XP_004489372.1|  PREDICTED: outer plastidial membrane protein...    282   4e-91    Cicer arietinum [garbanzo]
ref|XP_008786741.1|  PREDICTED: mitochondrial outer membrane prot...    281   6e-91    Phoenix dactylifera
ref|XP_010492333.1|  PREDICTED: mitochondrial outer membrane prot...    280   2e-90    Camelina sativa [gold-of-pleasure]
ref|XP_006286537.1|  hypothetical protein CARUB_v10001678mg             280   3e-90    Capsella rubella
ref|XP_010420161.1|  PREDICTED: mitochondrial outer membrane prot...    279   4e-90    Camelina sativa [gold-of-pleasure]
ref|NP_001241054.1|  uncharacterized protein LOC100805016               279   7e-90    Glycine max [soybeans]
gb|EYU28705.1|  hypothetical protein MIMGU_mgv1a011554mg                278   8e-90    Erythranthe guttata [common monkey flower]
sp|P42054.2|VDAC_PEA  RecName: Full=Outer plastidial membrane pro...    278   1e-89    Pisum sativum [garden pea]
ref|XP_006842115.1|  hypothetical protein AMTR_s00078p00100600          278   1e-89    Amborella trichopoda
ref|XP_007153842.1|  hypothetical protein PHAVU_003G069300g             278   2e-89    Phaseolus vulgaris [French bean]
ref|XP_003532049.1|  PREDICTED: mitochondrial outer membrane prot...    277   3e-89    Glycine max [soybeans]
gb|KFK25745.1|  hypothetical protein AALP_AA8G154100                    277   4e-89    Arabis alpina [alpine rockcress]
ref|XP_002517470.1|  voltage-dependent anion-selective channel, p...    275   1e-88    Ricinus communis
ref|XP_004489166.1|  PREDICTED: outer plastidial membrane protein...    274   4e-88    Cicer arietinum [garbanzo]
ref|XP_004956656.1|  PREDICTED: mitochondrial outer membrane prot...    274   6e-88    Setaria italica
ref|XP_009393634.1|  PREDICTED: mitochondrial outer membrane prot...    273   8e-88    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002873707.1|  voltage-dependent anion-selective channel pr...    273   1e-87    Arabidopsis lyrata subsp. lyrata
ref|XP_003578022.1|  PREDICTED: mitochondrial outer membrane porin      271   5e-87    Brachypodium distachyon [annual false brome]
ref|XP_009403419.1|  PREDICTED: mitochondrial outer membrane prot...    271   6e-87    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002460110.1|  hypothetical protein SORBIDRAFT_02g022910          271   8e-87    Sorghum bicolor [broomcorn]
ref|XP_009408829.1|  PREDICTED: mitochondrial outer membrane prot...    271   8e-87    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006660565.1|  PREDICTED: mitochondrial outer membrane prot...    271   9e-87    Oryza brachyantha
ref|NP_001105619.1|  voltage-dependent anion channel protein1a          269   5e-86    Zea mays [maize]
gb|ACF85328.1|  unknown                                                 268   1e-85    Zea mays [maize]
tpg|DAA61162.1|  TPA: voltage-dependent anion-selective channel p...    266   1e-84    
ref|NP_001062983.1|  Os09g0361400                                       265   1e-84    
gb|EAZ44453.1|  hypothetical protein OsJ_29066                          265   2e-84    Oryza sativa Japonica Group [Japonica rice]
ref|NP_001104948.1|  voltage-dependent anion channel protein1b          264   3e-84    
gb|AFK34190.1|  unknown                                                 264   3e-84    Medicago truncatula
ref|XP_004514771.1|  PREDICTED: mitochondrial outer membrane prot...    264   4e-84    Cicer arietinum [garbanzo]
sp|P46274.1|VDAC1_WHEAT  RecName: Full=Mitochondrial outer membra...    264   5e-84    Triticum aestivum [Canadian hard winter wheat]
gb|ABK24200.1|  unknown                                                 263   7e-84    Picea sitchensis
gb|EPS68383.1|  hypothetical protein M569_06388                         263   9e-84    Genlisea aurea
gb|EAZ08792.1|  hypothetical protein OsI_31052                          263   1e-83    Oryza sativa Indica Group [Indian rice]
gb|AAM62480.1|  voltage-dependent anion-selective channel protein...    261   3e-83    Arabidopsis thaliana [mouse-ear cress]
ref|NP_197013.1|  voltage dependent anion channel 3                     261   4e-83    Arabidopsis thaliana [mouse-ear cress]
gb|KJB31318.1|  hypothetical protein B456_005G186100                    260   4e-83    Gossypium raimondii
gb|KJB30164.1|  hypothetical protein B456_005G132100                    263   5e-83    Gossypium raimondii
pir||B55017  porin, plastid - garden pea                                256   3e-81 
emb|CAA57647.1|  Voltage dependent anion channel (VDAC)                 256   7e-81    Triticum aestivum [Canadian hard winter wheat]
dbj|BAJ99317.1|  predicted protein                                      254   4e-80    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001043433.1|  Os01g0588200                                       253   5e-80    
ref|NP_001104949.1|  voltage-dependent anion channel protein2           253   6e-80    Zea mays [maize]
ref|XP_004961383.1|  PREDICTED: mitochondrial outer membrane prot...    253   7e-80    Setaria italica
ref|XP_002440144.1|  hypothetical protein SORBIDRAFT_09g026790          251   3e-79    Sorghum bicolor [broomcorn]
ref|XP_006646048.1|  PREDICTED: mitochondrial outer membrane prot...    251   3e-79    Oryza brachyantha
gb|ACJ85279.1|  unknown                                                 251   6e-79    Medicago truncatula
ref|XP_010231957.1|  PREDICTED: mitochondrial outer membrane prot...    251   6e-79    Brachypodium distachyon [annual false brome]
ref|XP_004969745.1|  PREDICTED: mitochondrial outer membrane prot...    250   9e-79    Setaria italica
gb|KHG11726.1|  Mitochondrial outer membrane porin of 34 kDa            246   5e-78    Gossypium arboreum [tree cotton]
ref|XP_003621109.1|  Outer plastidial membrane protein porin            248   6e-78    Medicago truncatula
gb|ACJ85253.1|  unknown                                                 248   6e-78    Medicago truncatula
ref|XP_003568015.1|  PREDICTED: mitochondrial outer membrane prot...    246   3e-77    Brachypodium distachyon [annual false brome]
ref|NP_001056162.1|  Os05g0536200                                       246   3e-77    
ref|XP_004969385.1|  PREDICTED: mitochondrial outer membrane prot...    246   4e-77    Setaria italica
gb|AFW82970.1|  outer membrane protein porin                            243   4e-77    
gb|AFK38338.1|  unknown                                                 246   6e-77    Medicago truncatula
gb|EMT20213.1|  Mitochondrial outer membrane porin                      260   1e-76    
gb|AFW82971.1|  hypothetical protein ZEAMMB73_507543                    243   2e-76    
emb|CDM83072.1|  unnamed protein product                                244   2e-76    Triticum aestivum [Canadian hard winter wheat]
gb|EMS62963.1|  Mitochondrial outer membrane protein porin              259   3e-76    Triticum urartu
gb|EEC71387.1|  hypothetical protein OsI_03508                          244   3e-76    Oryza sativa Indica Group [Indian rice]
sp|Q0JJV1.3|VDAC4_ORYSJ  RecName: Full=Mitochondrial outer membra...    245   4e-76    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006655528.1|  PREDICTED: mitochondrial outer membrane prot...    243   5e-76    Oryza brachyantha
ref|NP_001044063.2|  Os01g0715500                                       244   6e-76    
gb|ADE76112.1|  unknown                                                 239   6e-76    Picea sitchensis
emb|CAA57646.1|  Voltage dependent anion channel (VDAC)                 242   2e-75    Triticum aestivum [Canadian hard winter wheat]
gb|EMS47295.1|  Outer plastidial membrane protein porin                 242   2e-75    Triticum urartu
ref|XP_002458065.1|  hypothetical protein SORBIDRAFT_03g026350          241   2e-75    Sorghum bicolor [broomcorn]
gb|ACG25664.1|  outer plastidial membrane protein porin                 241   4e-75    Zea mays [maize]
gb|KJB29688.1|  hypothetical protein B456_005G114000                    238   6e-75    Gossypium raimondii
ref|NP_001141587.1|  outer plastidial membrane protein porin            240   8e-75    Zea mays [maize]
dbj|BAJ99489.1|  predicted protein                                      238   4e-74    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMS51310.1|  Mitochondrial outer membrane porin                      247   5e-74    Triticum urartu
ref|NP_001278544.1|  outer plastidial membrane protein porin            238   7e-74    Zea mays [maize]
sp|P42057.1|VDAC_MAIZE  RecName: Full=Outer plastidial membrane p...    237   1e-73    Zea mays [maize]
gb|KEH19833.1|  porin/voltage-dependent anion-selective channel p...    237   2e-73    Medicago truncatula
gb|ACG45954.1|  outer plastidial membrane protein porin                 237   2e-73    Zea mays [maize]
gb|AFW83107.1|  outer plastidial membrane protein porin                 237   2e-73    
ref|NP_001152335.1|  outer mitochondrial membrane protein porin         237   4e-73    Zea mays [maize]
emb|CDY70638.1|  BnaCnng69120D                                          235   4e-73    Brassica napus [oilseed rape]
gb|EMT02908.1|  Mitochondrial outer membrane porin                      245   1e-72    
ref|XP_003569678.1|  PREDICTED: mitochondrial outer membrane prot...    235   5e-72    Brachypodium distachyon [annual false brome]
gb|ABK23226.1|  unknown                                                 232   1e-71    Picea sitchensis
ref|XP_002458403.1|  hypothetical protein SORBIDRAFT_03g032840          231   5e-71    Sorghum bicolor [broomcorn]
dbj|BAD87377.1|  putative 36kDA porin II                                234   6e-71    Oryza sativa Japonica Group [Japonica rice]
emb|CBI32017.3|  unnamed protein product                                228   1e-70    Vitis vinifera
emb|CAJ42303.1|  VDAC-like porin                                        225   2e-69    Plantago major [cart-track plant]
gb|ADE77918.1|  unknown                                                 223   3e-68    Picea sitchensis
ref|XP_001781995.1|  predicted protein                                  222   7e-68    
ref|XP_010918628.1|  PREDICTED: mitochondrial outer membrane prot...    218   2e-66    
ref|XP_010918626.1|  PREDICTED: mitochondrial outer membrane prot...    218   2e-66    Elaeis guineensis
ref|XP_001779057.1|  predicted protein                                  218   4e-66    
ref|XP_002973372.1|  hypothetical protein SELMODRAFT_271012             217   7e-66    Selaginella moellendorffii
ref|XP_002976531.1|  hypothetical protein SELMODRAFT_267998             217   1e-65    Selaginella moellendorffii
ref|XP_008787191.1|  PREDICTED: mitochondrial outer membrane prot...    216   2e-65    Phoenix dactylifera
ref|XP_008777257.1|  PREDICTED: mitochondrial outer membrane prot...    215   4e-65    
ref|XP_008453611.1|  PREDICTED: mitochondrial outer membrane prot...    215   4e-65    Cucumis melo [Oriental melon]
ref|XP_008777255.1|  PREDICTED: mitochondrial outer membrane prot...    215   7e-65    Phoenix dactylifera
gb|EYU34672.1|  hypothetical protein MIMGU_mgv1a021682mg                209   1e-64    Erythranthe guttata [common monkey flower]
ref|XP_004172904.1|  PREDICTED: mitochondrial outer membrane prot...    213   2e-64    
ref|XP_004146313.1|  PREDICTED: mitochondrial outer membrane prot...    213   2e-64    Cucumis sativus [cucumbers]
ref|XP_006841082.1|  hypothetical protein AMTR_s00086p00035910          212   8e-64    Amborella trichopoda
ref|NP_001241153.1|  uncharacterized protein LOC100818855               211   2e-63    Glycine max [soybeans]
gb|KHN36298.1|  Mitochondrial outer membrane protein porin 2            211   2e-63    Glycine soja [wild soybean]
ref|XP_004511842.1|  PREDICTED: mitochondrial outer membrane prot...    210   3e-63    Cicer arietinum [garbanzo]
ref|XP_009413143.1|  PREDICTED: mitochondrial outer membrane prot...    210   4e-63    Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001149108.1|  outer mitochondrial membrane protein porin         210   5e-63    Zea mays [maize]
ref|XP_009386273.1|  PREDICTED: mitochondrial outer membrane prot...    210   6e-63    Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001239899.1|  uncharacterized protein LOC100790578               209   1e-62    Glycine max [soybeans]
ref|XP_008805677.1|  PREDICTED: mitochondrial outer membrane prot...    209   1e-62    Phoenix dactylifera
ref|XP_010942794.1|  PREDICTED: mitochondrial outer membrane prot...    208   2e-62    
ref|XP_008805725.1|  PREDICTED: mitochondrial outer membrane prot...    206   1e-61    Phoenix dactylifera
ref|XP_007047520.1|  Voltage dependent anion channel 2                  206   1e-61    
ref|XP_010550772.1|  PREDICTED: mitochondrial outer membrane prot...    205   1e-61    Tarenaya hassleriana [spider flower]
ref|XP_010938962.1|  PREDICTED: mitochondrial outer membrane prot...    206   2e-61    Elaeis guineensis
ref|XP_002964960.1|  hypothetical protein SELMODRAFT_143103             206   2e-61    Selaginella moellendorffii
ref|XP_002279650.2|  PREDICTED: mitochondrial outer membrane prot...    206   2e-61    Vitis vinifera
gb|KHG00012.1|  Mitochondrial outer membrane porin 2 -like protein      205   3e-61    Gossypium arboreum [tree cotton]
ref|XP_007156717.1|  hypothetical protein PHAVU_002G011300g             205   4e-61    Phaseolus vulgaris [French bean]
ref|XP_010550330.1|  PREDICTED: mitochondrial outer membrane prot...    205   4e-61    Tarenaya hassleriana [spider flower]
ref|XP_004288248.1|  PREDICTED: mitochondrial outer membrane prot...    205   5e-61    Fragaria vesca subsp. vesca
ref|XP_010652706.1|  PREDICTED: mitochondrial outer membrane prot...    204   9e-61    Vitis vinifera
ref|XP_009411051.1|  PREDICTED: mitochondrial outer membrane prot...    204   1e-60    Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY11866.1|  BnaC03g12920D                                          203   1e-60    Brassica napus [oilseed rape]
emb|CDX88625.1|  BnaA03g10240D                                          203   2e-60    
ref|XP_009132124.1|  PREDICTED: mitochondrial outer membrane prot...    203   2e-60    Brassica rapa
ref|XP_006826372.1|  hypothetical protein AMTR_s00004p00132460          198   4e-60    
ref|XP_010259833.1|  PREDICTED: mitochondrial outer membrane prot...    202   5e-60    Nelumbo nucifera [Indian lotus]
ref|XP_006644617.1|  PREDICTED: mitochondrial outer membrane prot...    203   6e-60    Oryza brachyantha
emb|CDP02971.1|  unnamed protein product                                203   7e-60    Coffea canephora [robusta coffee]
gb|KJB48714.1|  hypothetical protein B456_008G082900                    202   7e-60    
gb|KJB58633.1|  hypothetical protein B456_009G219700                    201   8e-60    
ref|XP_010259832.1|  PREDICTED: mitochondrial outer membrane prot...    202   9e-60    
ref|XP_009354614.1|  PREDICTED: mitochondrial outer membrane prot...    201   1e-59    
gb|KHG05706.1|  Mitochondrial outer membrane porin 4 -like protein      201   2e-59    
gb|KDP32072.1|  hypothetical protein JCGZ_12533                         200   3e-59    
ref|XP_007222510.1|  hypothetical protein PRUPE_ppa009817mg             200   3e-59    
ref|XP_008223703.1|  PREDICTED: mitochondrial outer membrane prot...    200   3e-59    
ref|XP_008338437.1|  PREDICTED: mitochondrial outer membrane prot...    200   3e-59    
ref|XP_003611587.1|  Mitochondrial outer membrane protein porin         200   3e-59    
ref|XP_007205702.1|  hypothetical protein PRUPE_ppa009821mg             200   4e-59    
ref|XP_008354718.1|  PREDICTED: mitochondrial outer membrane prot...    199   4e-59    
gb|KJB23473.1|  hypothetical protein B456_004G100400                    199   7e-59    
ref|XP_009338032.1|  PREDICTED: mitochondrial outer membrane prot...    199   8e-59    
ref|XP_010247341.1|  PREDICTED: mitochondrial outer membrane prot...    198   1e-58    
ref|XP_010272561.1|  PREDICTED: mitochondrial outer membrane prot...    198   1e-58    
ref|XP_007018499.1|  Voltage dependent anion channel 2                  198   1e-58    
ref|XP_008238010.1|  PREDICTED: mitochondrial outer membrane prot...    198   2e-58    
ref|XP_008351971.1|  PREDICTED: mitochondrial outer membrane prot...    197   3e-58    
ref|XP_009400023.1|  PREDICTED: mitochondrial outer membrane prot...    197   3e-58    
ref|XP_010943375.1|  PREDICTED: mitochondrial outer membrane prot...    197   3e-58    
ref|XP_009112213.1|  PREDICTED: mitochondrial outer membrane prot...    197   5e-58    
ref|XP_006381815.1|  VDAC3.1 family protein                             197   5e-58    
ref|XP_008363546.1|  PREDICTED: mitochondrial outer membrane prot...    197   5e-58    
ref|XP_010943374.1|  PREDICTED: mitochondrial outer membrane prot...    197   6e-58    
emb|CDY18662.1|  BnaA09g07330D                                          197   7e-58    
emb|CDX81312.1|  BnaC09g07230D                                          196   8e-58    
ref|XP_002866208.1|  hypothetical protein ARALYDRAFT_495848             196   9e-58    
emb|CDY36497.1|  BnaC03g48560D                                          196   1e-57    
ref|XP_009614284.1|  PREDICTED: mitochondrial outer membrane prot...    196   1e-57    
gb|KFK28435.1|  hypothetical protein AALP_AA8G514300                    196   1e-57    
ref|XP_010539443.1|  PREDICTED: mitochondrial outer membrane prot...    196   1e-57    
ref|XP_006280944.1|  hypothetical protein CARUB_v10026945mg             196   1e-57    
ref|XP_006426127.1|  hypothetical protein CICLE_v10026251mg             195   2e-57    
ref|XP_010536913.1|  PREDICTED: mitochondrial outer membrane prot...    195   2e-57    
ref|XP_002325061.1|  VDAC3.1 family protein                             195   2e-57    
ref|XP_008457836.1|  PREDICTED: mitochondrial outer membrane prot...    195   2e-57    
ref|XP_009150694.1|  PREDICTED: mitochondrial outer membrane prot...    195   3e-57    
emb|CDY08723.1|  BnaA06g25010D                                          195   3e-57    
ref|XP_004148030.1|  PREDICTED: mitochondrial outer membrane prot...    195   3e-57    
gb|EMT32910.1|  Mitochondrial outer membrane protein porin              195   3e-57    
ref|XP_011043983.1|  PREDICTED: mitochondrial outer membrane prot...    195   3e-57    
ref|XP_011011237.1|  PREDICTED: mitochondrial outer membrane prot...    195   4e-57    
ref|XP_002984740.1|  hypothetical protein SELMODRAFT_156847             194   4e-57    
ref|XP_006845625.1|  hypothetical protein AMTR_s00019p00217910          194   4e-57    
ref|XP_009798280.1|  PREDICTED: mitochondrial outer membrane prot...    194   4e-57    
ref|XP_011007586.1|  PREDICTED: mitochondrial outer membrane prot...    194   5e-57    
ref|XP_008220333.1|  PREDICTED: mitochondrial outer membrane prot...    194   5e-57    
ref|XP_006380609.1|  VDAC2.1 family protein                             194   5e-57    
ref|XP_010101100.1|  Mitochondrial outer membrane protein porin 4       196   6e-57    
ref|XP_004296415.1|  PREDICTED: mitochondrial outer membrane prot...    194   7e-57    
ref|XP_007014286.1|  Voltage dependent anion channel 4                  196   8e-57    
ref|XP_006383551.1|  hypothetical protein POPTR_0005s19050g             192   1e-56    
gb|KDP41624.1|  hypothetical protein JCGZ_16031                         193   1e-56    
ref|XP_006453392.1|  hypothetical protein CICLE_v10009163mg             193   1e-56    
ref|XP_011008399.1|  PREDICTED: mitochondrial outer membrane prot...    193   2e-56    
ref|XP_010483270.1|  PREDICTED: mitochondrial outer membrane prot...    193   2e-56    
ref|XP_006366956.1|  PREDICTED: mitochondrial outer membrane prot...    193   2e-56    
gb|AAQ87022.1|  VDAC2.1                                                 193   2e-56    
ref|XP_006649583.1|  PREDICTED: mitochondrial outer membrane prot...    192   3e-56    
ref|XP_007227465.1|  hypothetical protein PRUPE_ppa009796mg             192   3e-56    
ref|XP_002525270.1|  voltage-dependent anion-selective channel, p...    192   3e-56    
ref|XP_002468550.1|  hypothetical protein SORBIDRAFT_01g047800          192   4e-56    
ref|XP_010463972.1|  PREDICTED: mitochondrial outer membrane prot...    192   4e-56    
ref|XP_006280940.1|  hypothetical protein CARUB_v10026938mg             192   5e-56    
gb|KHG14881.1|  Mitochondrial outer membrane porin 2 -like protein      192   5e-56    
ref|XP_006649363.1|  PREDICTED: mitochondrial outer membrane prot...    192   5e-56    
ref|XP_010452150.1|  PREDICTED: mitochondrial outer membrane prot...    192   6e-56    
gb|ACG30926.1|  outer mitochondrial membrane protein porin              192   6e-56    
gb|AFK33448.1|  unknown                                                 191   8e-56    
gb|EMT12164.1|  Mitochondrial outer membrane protein porin of 34 kDa    191   9e-56    
ref|XP_004290968.1|  PREDICTED: mitochondrial outer membrane prot...    191   1e-55    
gb|AAW22622.1|  porin-like protein                                      191   1e-55    
ref|XP_010484488.1|  PREDICTED: mitochondrial outer membrane prot...    191   1e-55    
ref|XP_002306507.2|  hypothetical protein POPTR_0005s19050g             192   1e-55    
gb|EMS46046.1|  Mitochondrial outer membrane protein porin of 34 kDa    190   1e-55    
ref|XP_010551652.1|  PREDICTED: mitochondrial outer membrane prot...    187   1e-55    
gb|ABF94514.1|  Eukaryotic porin family protein, expressed              190   1e-55    
gb|KJB43907.1|  hypothetical protein B456_007G223000                    191   1e-55    
ref|XP_003558860.1|  PREDICTED: mitochondrial outer membrane prot...    191   1e-55    
ref|NP_200557.1|  voltage dependent anion channel 4                     191   2e-55    
ref|XP_006401200.1|  hypothetical protein EUTSA_v10014362mg             191   2e-55    
ref|XP_010443435.1|  PREDICTED: mitochondrial outer membrane prot...    191   2e-55    
ref|NP_001049301.1|  Os03g0202200                                       191   2e-55    
ref|XP_003558558.1|  PREDICTED: mitochondrial outer membrane prot...    190   2e-55    
ref|XP_010444638.1|  PREDICTED: mitochondrial outer membrane prot...    190   2e-55    
ref|XP_010102769.1|  Mitochondrial outer membrane protein porin 2       190   2e-55    
ref|NP_001149101.1|  outer mitochondrial membrane protein porin         190   2e-55    
ref|XP_010046987.1|  PREDICTED: mitochondrial outer membrane prot...    190   2e-55    
gb|ABE77194.1|  putative voltage-dependent ion channel                  191   3e-55    
ref|XP_002866701.1|  hypothetical protein ARALYDRAFT_496845             190   3e-55    
gb|KCW78721.1|  hypothetical protein EUGRSUZ_C00165                     191   3e-55    
ref|NP_201551.1|  voltage dependent anion channel 2                     189   4e-55    
ref|XP_011079306.1|  PREDICTED: mitochondrial outer membrane prot...    189   4e-55    
gb|KCW78720.1|  hypothetical protein EUGRSUZ_C00165                     191   4e-55    
ref|XP_002272180.1|  PREDICTED: mitochondrial outer membrane prot...    189   5e-55    
ref|NP_001048902.1|  Os03g0137500                                       189   6e-55    
ref|NP_001190641.1|  voltage dependent anion channel 2                  189   7e-55    
tpg|DAA43267.1|  TPA: hypothetical protein ZEAMMB73_938356              188   1e-54    
tpg|DAA43264.1|  TPA: outer membrane protein porin                      188   2e-54    
ref|XP_003634315.2|  PREDICTED: mitochondrial outer membrane prot...    187   2e-54    
dbj|BAJ91367.1|  predicted protein                                      187   2e-54    
ref|NP_001147762.1|  outer mitochondrial membrane protein porin         187   2e-54    
gb|ABB16970.1|  POM30-like protein                                      187   2e-54    
ref|XP_004231921.1|  PREDICTED: mitochondrial outer membrane prot...    189   2e-54    
emb|CAA63968.1|  pom30                                                  187   3e-54    
emb|CAN64922.1|  hypothetical protein VITISV_017201                     187   3e-54    
gb|EEC74475.1|  hypothetical protein OsI_09925                          187   3e-54    
ref|XP_004985298.1|  PREDICTED: mitochondrial outer membrane prot...    187   3e-54    
ref|XP_003634314.2|  PREDICTED: mitochondrial outer membrane prot...    186   4e-54    
ref|XP_010323316.1|  PREDICTED: mitochondrial outer membrane prot...    186   5e-54    
ref|XP_010688492.1|  PREDICTED: mitochondrial outer membrane prot...    186   1e-53    
gb|AAP46186.1|  PgPOR29                                                 186   1e-53    
gb|KJB34748.1|  hypothetical protein B456_006G081500                    184   1e-53    
ref|XP_002510098.1|  voltage-dependent anion-selective channel, p...    185   2e-53    
emb|CDP02599.1|  unnamed protein product                                185   2e-53    
ref|XP_010547555.1|  PREDICTED: mitochondrial outer membrane prot...    185   2e-53    
ref|XP_002877711.1|  hypothetical protein ARALYDRAFT_323570             184   3e-53    
ref|XP_006393957.1|  hypothetical protein EUTSA_v10004631mg             185   5e-53    
ref|NP_001288497.1|  mitochondrial outer membrane protein porin 5       184   5e-53    
ref|XP_009360705.1|  PREDICTED: mitochondrial outer membrane prot...    184   6e-53    
gb|AAQ87023.1|  VDAC3.1                                                 183   9e-53    
gb|EYU20913.1|  hypothetical protein MIMGU_mgv1a011651mg                183   1e-52    
ref|XP_009136524.1|  PREDICTED: mitochondrial outer membrane prot...    183   1e-52    
emb|CDY02103.1|  BnaA03g40640D                                          183   1e-52    
ref|XP_010679633.1|  PREDICTED: mitochondrial outer membrane prot...    182   2e-52    
ref|XP_006350613.1|  PREDICTED: mitochondrial outer membrane prot...    182   2e-52    
ref|XP_004234649.1|  PREDICTED: mitochondrial outer membrane prot...    182   2e-52    
ref|XP_009615970.1|  PREDICTED: mitochondrial outer membrane prot...    181   5e-52    
ref|XP_002320689.2|  hypothetical protein POPTR_0014s01660g             181   5e-52    
dbj|BAL41368.1|  porin                                                  179   6e-52    
gb|EEE58291.1|  hypothetical protein OsJ_09329                          191   6e-52    
ref|XP_010061677.1|  PREDICTED: mitochondrial outer membrane prot...    181   6e-52    
ref|XP_010061676.1|  PREDICTED: mitochondrial outer membrane prot...    181   7e-52    
ref|XP_009801997.1|  PREDICTED: mitochondrial outer membrane prot...    181   8e-52    
ref|XP_010999872.1|  PREDICTED: mitochondrial outer membrane prot...    181   1e-51    
ref|XP_002465683.1|  hypothetical protein SORBIDRAFT_01g043700          181   1e-51    
gb|KDO82796.1|  hypothetical protein CISIN_1g0238542mg                  175   1e-51    
ref|XP_010545418.1|  PREDICTED: mitochondrial outer membrane prot...    180   1e-51    
gb|ACU19720.1|  unknown                                                 179   1e-51    
ref|XP_009770519.1|  PREDICTED: mitochondrial outer membrane prot...    180   2e-51    
ref|XP_009604076.1|  PREDICTED: mitochondrial outer membrane prot...    179   3e-51    
ref|XP_004985785.1|  PREDICTED: mitochondrial outer membrane prot...    182   4e-51    
ref|XP_006600196.1|  PREDICTED: uncharacterized protein LOC100797...    179   4e-51    
ref|XP_010028100.1|  PREDICTED: mitochondrial outer membrane prot...    179   6e-51    
gb|KHN17590.1|  Mitochondrial outer membrane protein porin 6            179   7e-51    
ref|NP_001147486.1|  outer mitochondrial membrane protein porin         178   1e-50    
ref|XP_006662285.1|  PREDICTED: mitochondrial outer membrane prot...    178   1e-50    
ref|XP_007154773.1|  hypothetical protein PHAVU_003G146600g             177   1e-50    
tpg|DAA43927.1|  TPA: outer membrane protein porin                      176   7e-50    
ref|NP_001242630.1|  uncharacterized protein LOC100797369               176   8e-50    
ref|XP_003610136.1|  Mitochondrial outer membrane protein porin         176   8e-50    
gb|KEH40016.1|  porin/voltage-dependent anion-selective channel p...    176   9e-50    
gb|KFK34258.1|  hypothetical protein AALP_AA5G121500                    175   1e-49    
ref|NP_001242891.1|  uncharacterized protein LOC100790270               175   2e-49    
ref|XP_006593432.1|  PREDICTED: uncharacterized protein LOC100790...    175   2e-49    
ref|XP_004498999.1|  PREDICTED: mitochondrial outer membrane prot...    174   3e-49    
ref|XP_007160908.1|  hypothetical protein PHAVU_001G027200g             174   3e-49    
ref|XP_004507845.1|  PREDICTED: mitochondrial outer membrane prot...    174   4e-49    
ref|XP_004507844.1|  PREDICTED: mitochondrial outer membrane prot...    174   4e-49    
ref|XP_011099371.1|  PREDICTED: mitochondrial outer membrane prot...    174   5e-49    
ref|XP_010426523.1|  PREDICTED: mitochondrial outer membrane prot...    172   7e-49    
ref|XP_003557011.2|  PREDICTED: mitochondrial outer membrane prot...    173   1e-48    
gb|EMS67817.1|  Mitochondrial outer membrane protein porin              169   2e-48    
gb|ACU23163.1|  unknown                                                 172   2e-48    
gb|ACJ85119.1|  unknown                                                 172   3e-48    
ref|XP_003589068.1|  Mitochondrial outer membrane protein porin         171   9e-48    
ref|XP_004508774.1|  PREDICTED: mitochondrial outer membrane prot...    169   1e-47    
ref|XP_011073688.1|  PREDICTED: mitochondrial outer membrane prot...    170   1e-47    
emb|CDP01200.1|  unnamed protein product                                169   4e-47    
ref|XP_006404089.1|  hypothetical protein EUTSA_v10010622mg             168   6e-47    
ref|XP_010029026.1|  PREDICTED: mitochondrial outer membrane prot...    166   7e-47    
gb|EPS73591.1|  pom30 protein                                           168   9e-47    
ref|XP_010029017.1|  PREDICTED: mitochondrial outer membrane prot...    165   4e-46    
ref|XP_002318608.2|  hypothetical protein POPTR_0012s07210g             165   5e-46    
ref|XP_007037222.1|  Porin/voltage-dependent anion-selective chan...    163   3e-45    
ref|XP_004164031.1|  PREDICTED: mitochondrial outer membrane prot...    163   5e-45    
ref|XP_004141289.1|  PREDICTED: mitochondrial outer membrane prot...    163   5e-45    
tpg|DAA43266.1|  TPA: hypothetical protein ZEAMMB73_938356              162   8e-45    
gb|KHN48663.1|  Mitochondrial outer membrane protein porin 1            160   8e-45    
gb|EYU29628.1|  hypothetical protein MIMGU_mgv1a011618mg                162   8e-45    
gb|AFK40114.1|  unknown                                                 162   1e-44    
ref|XP_011044010.1|  PREDICTED: mitochondrial outer membrane prot...    161   2e-44    
gb|AHH02397.1|  putative 34 kDa outer mitochondrial membrane prot...    156   2e-44    
ref|XP_003524958.1|  PREDICTED: mitochondrial outer membrane prot...    160   3e-44    
gb|KJB42460.1|  hypothetical protein B456_007G244300                    156   4e-44    
ref|XP_008452645.1|  PREDICTED: mitochondrial outer membrane prot...    159   2e-43    
ref|XP_007155337.1|  hypothetical protein PHAVU_003G192600g             158   2e-43    
gb|KHN07668.1|  Mitochondrial outer membrane protein porin 2            160   2e-43    
ref|XP_006607009.1|  PREDICTED: mitochondrial outer membrane prot...    160   3e-43    
gb|EPS70241.1|  hypothetical protein M569_04517                         158   4e-43    
gb|KJB60742.1|  hypothetical protein B456_009G323300                    156   5e-43    
ref|XP_007211055.1|  hypothetical protein PRUPE_ppa018776mg             156   1e-42    
gb|ABI73982.1|  voltage-dependent anion-selective channel protein       150   3e-42    
ref|XP_010086579.1|  Mitochondrial outer membrane protein porin o...    155   4e-42    
ref|XP_007046222.1|  Mitochondrial outer membrane protein porin 1...    153   8e-42    
ref|XP_011465744.1|  PREDICTED: mitochondrial outer membrane prot...    150   2e-41    
gb|KHG03239.1|  Mitochondrial outer membrane porin of 36 kDa            151   4e-41    
ref|XP_003549662.1|  PREDICTED: mitochondrial outer membrane prot...    152   4e-41    
gb|KJB50870.1|  hypothetical protein B456_008G190600                    151   7e-41    
ref|XP_011463658.1|  PREDICTED: mitochondrial outer membrane prot...    147   1e-40    
ref|XP_006291699.1|  hypothetical protein CARUB_v10017863mg             151   1e-40    
ref|XP_008239838.1|  PREDICTED: mitochondrial outer membrane prot...    150   3e-40    
emb|CDY25906.1|  BnaC09g32780D                                          152   3e-40    
gb|AFK37646.1|  unknown                                                 148   3e-40    
ref|XP_009614188.1|  PREDICTED: mitochondrial outer membrane prot...    149   4e-40    
gb|KHN18528.1|  Mitochondrial outer membrane protein porin 1            152   4e-40    
dbj|BAG09387.1|  peroxisomal voltage-dependent anion-selective ch...    147   4e-40    
ref|XP_009801980.1|  PREDICTED: mitochondrial outer membrane prot...    149   8e-40    
gb|KDP31208.1|  hypothetical protein JCGZ_11584                         149   9e-40    
ref|XP_010691575.1|  PREDICTED: mitochondrial outer membrane prot...    147   7e-39    
ref|XP_006367075.1|  PREDICTED: mitochondrial outer membrane prot...    146   7e-39    
emb|CAN67632.1|  hypothetical protein VITISV_019646                     142   4e-38    
ref|XP_003609006.1|  Mitochondrial outer membrane protein porin         143   8e-38    
ref|XP_008359117.1|  PREDICTED: mitochondrial outer membrane prot...    143   1e-37    
ref|XP_002511521.1|  voltage-dependent anion-selective channel, p...    142   3e-37    
gb|ABR25498.1|  voltage dependent anion channel                         137   3e-37    
ref|XP_010551869.1|  PREDICTED: mitochondrial outer membrane prot...    138   3e-37    
gb|ACJ84955.1|  unknown                                                 141   4e-37    
ref|XP_006439652.1|  hypothetical protein CICLE_v10021785mg             142   5e-37    
ref|XP_010551867.1|  PREDICTED: mitochondrial outer membrane prot...    139   1e-36    



>emb|CDP02196.1| unnamed protein product [Coffea canephora]
Length=276

 Score =   322 bits (824),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 153/182 (84%), Positives = 172/182 (95%), Gaps = 0/182 (0%)
 Frame = -2

Query  725  SFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGA  546
            SFRVPDQRSGK+ELQYLHD+AGISTSVGLTANPI+NFSGVVGTNALALGTDVSFDTK+G 
Sbjct  95   SFRVPDQRSGKLELQYLHDYAGISTSVGLTANPIINFSGVVGTNALALGTDVSFDTKTGT  154

Query  545  FTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTIT  366
             TK NAGLSFTNSDLIASLTLNDKGD+LSASYYH V+PL++TAVGAEV HSFS+N NTIT
Sbjct  155  LTKCNAGLSFTNSDLIASLTLNDKGDALSASYYHTVSPLTSTAVGAEVTHSFSTNENTIT  214

Query  365  VGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALAL  186
            +GTQH LDPLTT+KARVNN+G+A+ALIQHEWRPKSL T++GEVD K++D+SAKFGLAL L
Sbjct  215  LGTQHALDPLTTLKARVNNYGKASALIQHEWRPKSLFTITGEVDTKSIDQSAKFGLALVL  274

Query  185  KP  180
            KP
Sbjct  275  KP  276



>ref|XP_010087805.1| Mitochondrial outer membrane protein porin of 34 kDa [Morus notabilis]
 gb|EXB30112.1| Mitochondrial outer membrane protein porin of 34 kDa [Morus notabilis]
Length=276

 Score =   320 bits (819),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 154/182 (85%), Positives = 169/182 (93%), Gaps = 0/182 (0%)
 Frame = -2

Query  725  SFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGA  546
            SFR+PDQRSGKVELQYLHD+AGI+TSVGLTANP+VNFSGV GTN +ALGTDVSFD+K+G 
Sbjct  95   SFRLPDQRSGKVELQYLHDYAGITTSVGLTANPVVNFSGVFGTNVVALGTDVSFDSKTGQ  154

Query  545  FTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTIT  366
            FTK NAGLSF+N+DLIASLTLNDKGD+LSASYYH VN L+NTAVGAEV HSFS+N NTIT
Sbjct  155  FTKLNAGLSFSNADLIASLTLNDKGDTLSASYYHTVNLLTNTAVGAEVTHSFSTNENTIT  214

Query  365  VGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALAL  186
            VGTQH LDPLTTVKARVNNFG+ANALIQHEWRPKS  TLSGEVD KA++KSAK GLALAL
Sbjct  215  VGTQHALDPLTTVKARVNNFGKANALIQHEWRPKSFFTLSGEVDTKAIEKSAKVGLALAL  274

Query  185  KP  180
            KP
Sbjct  275  KP  276



>ref|XP_008443436.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa 
[Cucumis melo]
Length=276

 Score =   319 bits (818),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 154/182 (85%), Positives = 170/182 (93%), Gaps = 0/182 (0%)
 Frame = -2

Query  725  SFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGA  546
            SF+VPDQRSGKVELQYLHD+AGISTS+GLTANPIVNFSGVVG+N LALGTD+SFDTK+G 
Sbjct  95   SFKVPDQRSGKVELQYLHDYAGISTSIGLTANPIVNFSGVVGSNLLALGTDLSFDTKTGN  154

Query  545  FTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTIT  366
            FTK NAGLSF N+DLIASLTLNDKGD+LSASYYH VNPL++TAVGAEV HSFSSN NTIT
Sbjct  155  FTKVNAGLSFANADLIASLTLNDKGDTLSASYYHTVNPLTSTAVGAEVAHSFSSNENTIT  214

Query  365  VGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALAL  186
            VGTQH LDPLT+VKARVNNFG+A+ALIQHEWRPKS  T+SGEVD KA++KSAK GLALAL
Sbjct  215  VGTQHALDPLTSVKARVNNFGKASALIQHEWRPKSFFTVSGEVDTKAIEKSAKVGLALAL  274

Query  185  KP  180
            KP
Sbjct  275  KP  276



>ref|XP_010524325.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa-like 
[Tarenaya hassleriana]
Length=276

 Score =   319 bits (817),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 155/187 (83%), Positives = 171/187 (91%), Gaps = 0/187 (0%)
 Frame = -2

Query  740  LENHSSFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFD  561
            L++  SF+VPDQRSGKVELQYLHD+AGISTS+GLTANPIVNFSGVVGTN LALGTDVSFD
Sbjct  90   LKSIFSFKVPDQRSGKVELQYLHDYAGISTSIGLTANPIVNFSGVVGTNVLALGTDVSFD  149

Query  560  TKSGAFTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSN  381
            TK+G FTK NAGLSFT  DLIASLTLNDKGD+++ASYYH VNPLSNTAVGAEV+HSFS+N
Sbjct  150  TKTGNFTKCNAGLSFTKDDLIASLTLNDKGDTVNASYYHIVNPLSNTAVGAEVSHSFSTN  209

Query  380  VNTITVGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFG  201
             NTITVGTQH LDPLT VKARVNN G+A+ALIQHEWRPKS  T+SGEVD KA++KSAK G
Sbjct  210  ENTITVGTQHALDPLTAVKARVNNAGKASALIQHEWRPKSFFTISGEVDTKAIEKSAKIG  269

Query  200  LALALKP  180
            LALALKP
Sbjct  270  LALALKP  276



>ref|XP_009587690.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa 
[Nicotiana tomentosiformis]
 dbj|BAF95072.1| voltage-dependent anion channel [Nicotiana tabacum]
Length=276

 Score =   318 bits (815),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 151/182 (83%), Positives = 171/182 (94%), Gaps = 0/182 (0%)
 Frame = -2

Query  725  SFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGA  546
            SFRVPDQRSGK+E+QYLH++AGISTSVGLTANPIVNFSGVVGTN LALGTDVSFD+K+G 
Sbjct  95   SFRVPDQRSGKLEVQYLHEYAGISTSVGLTANPIVNFSGVVGTNILALGTDVSFDSKTGD  154

Query  545  FTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTIT  366
            FTK NAGLSFTN+DL+ASL LNDKGD+LSASYYH V+P ++TAVGAEVNH FS+N NTIT
Sbjct  155  FTKCNAGLSFTNADLVASLNLNDKGDNLSASYYHSVSPFTSTAVGAEVNHCFSTNENTIT  214

Query  365  VGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALAL  186
            VGTQH+LDPLT+VKARVNNFG+A+AL+QHEWRPKSL T+SGEVD K+VDK AKFGLALAL
Sbjct  215  VGTQHRLDPLTSVKARVNNFGKASALLQHEWRPKSLFTISGEVDTKSVDKGAKFGLALAL  274

Query  185  KP  180
            KP
Sbjct  275  KP  276



>ref|XP_010550070.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa-like 
[Tarenaya hassleriana]
Length=276

 Score =   318 bits (814),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 154/187 (82%), Positives = 171/187 (91%), Gaps = 0/187 (0%)
 Frame = -2

Query  740  LENHSSFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFD  561
            L++  SF+VPDQRSGKVELQYLHD+AGISTS+GLTANP+VNFSGVVG+N LALGTDVSFD
Sbjct  90   LKSIFSFKVPDQRSGKVELQYLHDYAGISTSIGLTANPVVNFSGVVGSNVLALGTDVSFD  149

Query  560  TKSGAFTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSN  381
            TK+G FTK NAGLSFT  DLIASLTLNDKGD+L+ SYYH VNPLSNTAVGAEV+HSFS+N
Sbjct  150  TKTGNFTKCNAGLSFTKDDLIASLTLNDKGDTLNGSYYHIVNPLSNTAVGAEVSHSFSTN  209

Query  380  VNTITVGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFG  201
             NTITVGTQH LDPLTTVKARVNN G+A+ALIQHEWRPKS  T+SGEVD KA++KSAK G
Sbjct  210  ENTITVGTQHALDPLTTVKARVNNTGKASALIQHEWRPKSFFTISGEVDTKAIEKSAKVG  269

Query  200  LALALKP  180
            LALALKP
Sbjct  270  LALALKP  276



>ref|XP_004147460.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa-like 
[Cucumis sativus]
 ref|XP_004168625.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa-like 
[Cucumis sativus]
 gb|KGN59595.1| Porin [Cucumis sativus]
Length=276

 Score =   317 bits (813),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 153/182 (84%), Positives = 169/182 (93%), Gaps = 0/182 (0%)
 Frame = -2

Query  725  SFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGA  546
            SF+VPDQRSGKVELQYLHD+AGISTS+GLTANPIVNFSGVVG+N LALGTD+SFDTK+G 
Sbjct  95   SFKVPDQRSGKVELQYLHDYAGISTSIGLTANPIVNFSGVVGSNLLALGTDLSFDTKTGN  154

Query  545  FTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTIT  366
            FTK N GLSF N+DLIASLTLNDKGD+LSASYYH VNPL++TAVGAEV HSFSSN NTIT
Sbjct  155  FTKVNTGLSFANADLIASLTLNDKGDTLSASYYHTVNPLTSTAVGAEVAHSFSSNENTIT  214

Query  365  VGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALAL  186
            VGTQH LDPLT+VKARVNNFG+A+ALIQHEWRPKS  T+SGEVD KA++KSAK GLALAL
Sbjct  215  VGTQHALDPLTSVKARVNNFGKASALIQHEWRPKSFFTVSGEVDTKAIEKSAKVGLALAL  274

Query  185  KP  180
            KP
Sbjct  275  KP  276



>ref|XP_009798894.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa 
[Nicotiana sylvestris]
Length=276

 Score =   316 bits (810),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 151/182 (83%), Positives = 169/182 (93%), Gaps = 0/182 (0%)
 Frame = -2

Query  725  SFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGA  546
            SFRVPDQRSGK+E+QYLHD+AGISTSVGLTANPIVNFSGVVGTN LALGTDVSFDTK+G 
Sbjct  95   SFRVPDQRSGKLEVQYLHDYAGISTSVGLTANPIVNFSGVVGTNILALGTDVSFDTKTGD  154

Query  545  FTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTIT  366
            FTK NAGLSFTN+DL+ASL LNDKGD+LSASYYH V+P ++T VGAEV H FS+N NTIT
Sbjct  155  FTKCNAGLSFTNADLVASLNLNDKGDNLSASYYHTVSPFTSTVVGAEVTHCFSTNENTIT  214

Query  365  VGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALAL  186
            VGTQH+LDPLT+VKARVNNFG+A+AL+QHEWRPKSL T+SGEVD K+VDK AKFGLALAL
Sbjct  215  VGTQHRLDPLTSVKARVNNFGKASALLQHEWRPKSLFTISGEVDTKSVDKGAKFGLALAL  274

Query  185  KP  180
            KP
Sbjct  275  KP  276



>ref|XP_009596455.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa-like 
[Nicotiana tomentosiformis]
Length=276

 Score =   316 bits (809),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 154/182 (85%), Positives = 167/182 (92%), Gaps = 0/182 (0%)
 Frame = -2

Query  725  SFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGA  546
            SFR+PD  S K+E+QYLHD+AGISTS+GLTANPIVNFSGVVGTN L+LGTDVSFDTK GA
Sbjct  95   SFRIPDHSSAKLEVQYLHDYAGISTSLGLTANPIVNFSGVVGTNLLSLGTDVSFDTKVGA  154

Query  545  FTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTIT  366
             TK NAGLSFTN+DLIASL LNDKGDSLSASYYH V+PL+ TAVGAEV HSFS+N NTI+
Sbjct  155  ITKCNAGLSFTNTDLIASLNLNDKGDSLSASYYHIVSPLTMTAVGAEVTHSFSTNENTIS  214

Query  365  VGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALAL  186
            VGTQHQLDPLTTVKARVNN G+ANALIQHEWRPKSL T+SGEVD KAVDKSAKFGLALAL
Sbjct  215  VGTQHQLDPLTTVKARVNNLGKANALIQHEWRPKSLFTISGEVDTKAVDKSAKFGLALAL  274

Query  185  KP  180
            KP
Sbjct  275  KP  276



>gb|ABC01904.1| 34 kDa outer mitochondrial membrane protein porin-like protein 
[Solanum tuberosum]
Length=276

 Score =   316 bits (809),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 154/182 (85%), Positives = 165/182 (91%), Gaps = 0/182 (0%)
 Frame = -2

Query  725  SFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGA  546
            S R+PDQ S K+ELQYLHD+AGI TSVGLTANPIVNFSGV+GTN LALGTDVSFDTK+GA
Sbjct  95   SCRIPDQSSAKMELQYLHDYAGICTSVGLTANPIVNFSGVLGTNVLALGTDVSFDTKAGA  154

Query  545  FTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTIT  366
             TK NAGLSFTN+DLI SL LN+KGDSLSASYYH V PL++TAVGAEV HSFS+N NTIT
Sbjct  155  ITKCNAGLSFTNADLITSLNLNNKGDSLSASYYHIVTPLTSTAVGAEVTHSFSTNENTIT  214

Query  365  VGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALAL  186
            VGTQHQLDPLTTVKARVNNFG A ALIQHEWRPKSL T+SGEVD KAVDKSAKFGLALAL
Sbjct  215  VGTQHQLDPLTTVKARVNNFGTATALIQHEWRPKSLFTISGEVDTKAVDKSAKFGLALAL  274

Query  185  KP  180
            KP
Sbjct  275  KP  276



>ref|NP_001275154.1| mitochondrial outer membrane protein porin of 34 kDa [Solanum 
tuberosum]
 sp|P42055.2|VDAC1_SOLTU RecName: Full=Mitochondrial outer membrane protein porin of 34 
kDa; AltName: Full=POM 34; AltName: Full=Voltage-dependent 
anion-selective channel protein; Short=VDAC [Solanum tuberosum]
 emb|CAA56599.1| 34 kDA porin [Solanum tuberosum]
Length=276

 Score =   315 bits (808),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 149/182 (82%), Positives = 171/182 (94%), Gaps = 0/182 (0%)
 Frame = -2

Query  725  SFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGA  546
            SFRVPDQRSGK+E+QYLHD+AGI TSVGLTANPIVNFSGVVGTN +ALGTDVSFDTK+G 
Sbjct  95   SFRVPDQRSGKLEVQYLHDYAGICTSVGLTANPIVNFSGVVGTNIIALGTDVSFDTKTGD  154

Query  545  FTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTIT  366
            FTK NAGLSFTN+DL+ASL LN+KGD+L+ASYYH V+PL++TAVGAEVNHSFS+N N IT
Sbjct  155  FTKCNAGLSFTNADLVASLNLNNKGDNLTASYYHTVSPLTSTAVGAEVNHSFSTNENIIT  214

Query  365  VGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALAL  186
            VGTQH+LDPLT+VKAR+NNFG+A+AL+QHEWRPKSL T+SGEVD K+VDK AKFGLALAL
Sbjct  215  VGTQHRLDPLTSVKARINNFGKASALLQHEWRPKSLFTVSGEVDTKSVDKGAKFGLALAL  274

Query  185  KP  180
            KP
Sbjct  275  KP  276



>ref|XP_004233349.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa 
[Solanum lycopersicum]
Length=276

 Score =   315 bits (807),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 149/182 (82%), Positives = 171/182 (94%), Gaps = 0/182 (0%)
 Frame = -2

Query  725  SFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGA  546
            SFRVPDQRSGK+E+QYLHD+AGI TSVGLTANPIVNFSGVVGTN +ALGTDVSFDTK+G 
Sbjct  95   SFRVPDQRSGKLEVQYLHDYAGICTSVGLTANPIVNFSGVVGTNIVALGTDVSFDTKTGD  154

Query  545  FTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTIT  366
            FTK NAGLSFTN+DL+ASL LN+KGD+L+ASYYH V+PL++TAVGAEVNHSFS+N N IT
Sbjct  155  FTKCNAGLSFTNADLVASLNLNNKGDNLTASYYHTVSPLTSTAVGAEVNHSFSTNENIIT  214

Query  365  VGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALAL  186
            VGTQH+LDPLT+VKAR+NNFG+A+AL+QHEWRPKSL T+SGEVD K+VDK AKFGLALAL
Sbjct  215  VGTQHRLDPLTSVKARINNFGKASALLQHEWRPKSLFTVSGEVDTKSVDKGAKFGLALAL  274

Query  185  KP  180
            KP
Sbjct  275  KP  276



>ref|XP_008230727.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa-like 
[Prunus mume]
Length=275

 Score =   315 bits (806),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 148/182 (81%), Positives = 169/182 (93%), Gaps = 0/182 (0%)
 Frame = -2

Query  725  SFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGA  546
            SF+VPDQRSGKVELQYLHD+AGISTSVGLTANPIVNFSGV+GTN LALGTD+SFDTK+G 
Sbjct  94   SFKVPDQRSGKVELQYLHDYAGISTSVGLTANPIVNFSGVIGTNQLALGTDLSFDTKTGN  153

Query  545  FTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTIT  366
             TK NAG+SF+N+DLIA+LTLNDKGD LSASYYH+VNPL+NTAVGAEV H F +N NTIT
Sbjct  154  LTKCNAGVSFSNADLIAALTLNDKGDILSASYYHNVNPLANTAVGAEVTHRFPTNENTIT  213

Query  365  VGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALAL  186
            +GTQH LDPLTT+KARVNNFG+A+ALIQHEWRPKS +T+SGEVD KA++K+AK GLALAL
Sbjct  214  LGTQHALDPLTTLKARVNNFGKASALIQHEWRPKSFVTISGEVDTKAIEKTAKIGLALAL  273

Query  185  KP  180
            KP
Sbjct  274  KP  275



>ref|XP_009779190.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa-like 
[Nicotiana sylvestris]
Length=276

 Score =   314 bits (805),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 152/182 (84%), Positives = 166/182 (91%), Gaps = 0/182 (0%)
 Frame = -2

Query  725  SFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGA  546
            SFR+PDQ S K+E+QYLHD+AGISTS+GLTANPIVNFSGVVGTN L+LGTD+SFDTK GA
Sbjct  95   SFRIPDQSSAKLEVQYLHDYAGISTSLGLTANPIVNFSGVVGTNLLSLGTDLSFDTKVGA  154

Query  545  FTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTIT  366
             TK NAGLSFTN+DLIASL LNDKGD+LSASYYH V+PL+ TAV AEV HSF +N NTIT
Sbjct  155  ITKCNAGLSFTNTDLIASLNLNDKGDALSASYYHIVSPLTMTAVSAEVTHSFCTNENTIT  214

Query  365  VGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALAL  186
            VGTQHQLDPLTTVKARVNN G+ANALIQHEWRPKSL T+SGEVD KAVDKSAKFGLALAL
Sbjct  215  VGTQHQLDPLTTVKARVNNLGKANALIQHEWRPKSLFTISGEVDTKAVDKSAKFGLALAL  274

Query  185  KP  180
            KP
Sbjct  275  KP  276



>ref|XP_006361834.1| PREDICTED: uncharacterized LOC102577832 [Solanum tuberosum]
Length=276

 Score =   314 bits (805),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 153/182 (84%), Positives = 165/182 (91%), Gaps = 0/182 (0%)
 Frame = -2

Query  725  SFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGA  546
            S R+PDQ S K+ELQYLHD+AGI TSVGLTANPIVNFSGV+GTN LALGTDVSFDTK+GA
Sbjct  95   SCRIPDQSSAKMELQYLHDYAGICTSVGLTANPIVNFSGVLGTNVLALGTDVSFDTKAGA  154

Query  545  FTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTIT  366
             TK NAGLSFTN+DLI SL LN+KGDSLSASYYH V PL++TAVGAEV HSFS++ NTIT
Sbjct  155  ITKCNAGLSFTNADLITSLNLNNKGDSLSASYYHIVTPLTSTAVGAEVTHSFSTSENTIT  214

Query  365  VGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALAL  186
            VGTQHQLDPLTTVKARVNNFG A ALIQHEWRPKSL T+SGEVD KAVDKSAKFGLALAL
Sbjct  215  VGTQHQLDPLTTVKARVNNFGTATALIQHEWRPKSLFTISGEVDTKAVDKSAKFGLALAL  274

Query  185  KP  180
            KP
Sbjct  275  KP  276



>ref|XP_011098570.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa-like 
[Sesamum indicum]
Length=276

 Score =   313 bits (803),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 151/182 (83%), Positives = 168/182 (92%), Gaps = 0/182 (0%)
 Frame = -2

Query  725  SFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGA  546
            SFRVPDQRSGK+ELQYLHD+AGIS+SVGLTANPIVNFS V+G+N LA+G+DVSFD+K GA
Sbjct  95   SFRVPDQRSGKLELQYLHDYAGISSSVGLTANPIVNFSAVLGSNKLAVGSDVSFDSKEGA  154

Query  545  FTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTIT  366
             TK N G SFTNSDLIA+LTLNDKGD+LSASYYH VNPL+NTAVGAEV HSFSSN NTIT
Sbjct  155  ITKCNFGASFTNSDLIAALTLNDKGDTLSASYYHTVNPLTNTAVGAEVTHSFSSNENTIT  214

Query  365  VGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALAL  186
            VGTQH LDPLT VKARVNNFG+A+ALIQHEWRPKSLIT+S EVD K++DKSAKFG+ALAL
Sbjct  215  VGTQHSLDPLTMVKARVNNFGKASALIQHEWRPKSLITVSTEVDTKSIDKSAKFGVALAL  274

Query  185  KP  180
            KP
Sbjct  275  KP  276



>ref|XP_011085778.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa-like 
[Sesamum indicum]
Length=276

 Score =   313 bits (803),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 151/182 (83%), Positives = 168/182 (92%), Gaps = 0/182 (0%)
 Frame = -2

Query  725  SFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGA  546
            SFRVPDQRSGK+ELQYLHD+AGIS++VGLTANPIVNFSGVVG N +ALG+DVSFDTK GA
Sbjct  95   SFRVPDQRSGKLELQYLHDYAGISSNVGLTANPIVNFSGVVGNNKVALGSDVSFDTKEGA  154

Query  545  FTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTIT  366
            F K N G SFTN+DLIA+LTLNDKGD+LSASYYH V+PL+NTAVGAEV HSFS+N NTIT
Sbjct  155  FVKCNFGASFTNADLIAALTLNDKGDTLSASYYHIVSPLTNTAVGAEVTHSFSTNENTIT  214

Query  365  VGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALAL  186
            VGTQH LDPLT+VKARVNNFG+ANALIQHEWRPKSLIT+S EVD K++DKSAKFG ALAL
Sbjct  215  VGTQHALDPLTSVKARVNNFGKANALIQHEWRPKSLITVSTEVDTKSIDKSAKFGFALAL  274

Query  185  KP  180
            KP
Sbjct  275  KP  276



>dbj|BAF95070.1| voltage-dependent anion channel [Nicotiana tabacum]
Length=276

 Score =   313 bits (802),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 151/182 (83%), Positives = 166/182 (91%), Gaps = 0/182 (0%)
 Frame = -2

Query  725  SFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGA  546
            SFR+PDQ S K+E+QYLHD+AGISTS+GLTANPIVNFSGVVGTN L+LGTD+SFDTK GA
Sbjct  95   SFRIPDQSSAKLEVQYLHDYAGISTSLGLTANPIVNFSGVVGTNLLSLGTDLSFDTKVGA  154

Query  545  FTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTIT  366
             TK NAGLSFTN+DLIASL LNDKGD+LSASYYH V+PL+ TAV AEV HSF +N NTI+
Sbjct  155  ITKCNAGLSFTNTDLIASLNLNDKGDALSASYYHIVSPLTMTAVSAEVTHSFCTNENTIS  214

Query  365  VGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALAL  186
            VGTQHQLDPLTTVKARVNN G+ANALIQHEWRPKSL T+SGEVD KAVDKSAKFGLALAL
Sbjct  215  VGTQHQLDPLTTVKARVNNLGKANALIQHEWRPKSLFTISGEVDTKAVDKSAKFGLALAL  274

Query  185  KP  180
            KP
Sbjct  275  KP  276



>ref|XP_008379329.1| PREDICTED: LOW QUALITY PROTEIN: mitochondrial outer membrane 
protein porin of 34 kDa-like [Malus domestica]
 ref|XP_009342873.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa 
[Pyrus x bretschneideri]
Length=275

 Score =   313 bits (802),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 148/182 (81%), Positives = 168/182 (92%), Gaps = 0/182 (0%)
 Frame = -2

Query  725  SFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGA  546
            SF+VPDQRSGKVELQYLHD+AGIS+SVGLTANPIVNFSGV+GTN LALGTD+SFDTK+G 
Sbjct  94   SFKVPDQRSGKVELQYLHDYAGISSSVGLTANPIVNFSGVIGTNQLALGTDLSFDTKTGN  153

Query  545  FTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTIT  366
             TK NAGLSF+N+DL+A+LTLNDKGD LSASYYH VNPLSNTAVGAEV H F +N NTIT
Sbjct  154  LTKCNAGLSFSNADLVAALTLNDKGDILSASYYHSVNPLSNTAVGAEVTHRFPTNENTIT  213

Query  365  VGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALAL  186
            +GTQH LDPLT++KARVNNFG+A+ALIQHEWRPKS +T+SGEVD KA++KSAK GLALAL
Sbjct  214  LGTQHALDPLTSIKARVNNFGKASALIQHEWRPKSFLTVSGEVDTKAIEKSAKIGLALAL  273

Query  185  KP  180
            KP
Sbjct  274  KP  275



>ref|XP_004234781.2| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa 
[Solanum lycopersicum]
Length=276

 Score =   313 bits (802),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 152/182 (84%), Positives = 165/182 (91%), Gaps = 0/182 (0%)
 Frame = -2

Query  725  SFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGA  546
            S R+PDQ S K+ELQYLHD+AGI TSVGLTANPIVNFSGV+GTN LALGTDVSFDTK+GA
Sbjct  95   SCRIPDQSSAKMELQYLHDYAGICTSVGLTANPIVNFSGVLGTNVLALGTDVSFDTKAGA  154

Query  545  FTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTIT  366
             TK NAGL FTN+DLI SL LN+KGDSLSASYYH V+PL++TAVGAEV HSFS++ NTIT
Sbjct  155  ITKCNAGLRFTNADLITSLNLNNKGDSLSASYYHIVSPLTSTAVGAEVTHSFSTSENTIT  214

Query  365  VGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALAL  186
            VGTQHQLDPLTTVKARVNNFG A ALIQHEWRPKSL T+SGEVD KAVDKSAKFGLALAL
Sbjct  215  VGTQHQLDPLTTVKARVNNFGMATALIQHEWRPKSLFTISGEVDTKAVDKSAKFGLALAL  274

Query  185  KP  180
            KP
Sbjct  275  KP  276



>gb|KHG03636.1| Mitochondrial outer membrane porin of 34 kDa [Gossypium arboreum]
Length=276

 Score =   312 bits (800),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 148/182 (81%), Positives = 168/182 (92%), Gaps = 0/182 (0%)
 Frame = -2

Query  725  SFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGA  546
            SFR PDQRSGKVELQYLH++AGIS+S+GLTANPIVN SGV+GTN LALGTD+SFDTK+G 
Sbjct  95   SFRAPDQRSGKVELQYLHEYAGISSSIGLTANPIVNLSGVIGTNVLALGTDLSFDTKTGN  154

Query  545  FTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTIT  366
            FTK NAGLSF+N DLIASLTLN+KGDSL+ASYYH VNP++NTAVGAEV HSFS+N NTIT
Sbjct  155  FTKCNAGLSFSNVDLIASLTLNEKGDSLNASYYHIVNPMTNTAVGAEVTHSFSTNENTIT  214

Query  365  VGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALAL  186
            +GTQH LDPLT VKARVNN G+A+ALIQHEWRP+SLIT+SGEVD K++DKSAK GLALAL
Sbjct  215  IGTQHALDPLTMVKARVNNAGKASALIQHEWRPRSLITISGEVDTKSIDKSAKVGLALAL  274

Query  185  KP  180
            KP
Sbjct  275  KP  276



>ref|XP_008341536.1| PREDICTED: outer plastidial membrane protein porin-like [Malus 
domestica]
Length=275

 Score =   311 bits (798),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 146/182 (80%), Positives = 166/182 (91%), Gaps = 0/182 (0%)
 Frame = -2

Query  725  SFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGA  546
             F+VPDQRSGKVELQYLHD+AGIS+SVGLTANPIVNFSGV+GTN LALG D+SFDTK+G 
Sbjct  94   CFKVPDQRSGKVELQYLHDYAGISSSVGLTANPIVNFSGVIGTNQLALGADLSFDTKTGI  153

Query  545  FTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTIT  366
             TK NAGLSF+N+DLIA+LTLNDKGD LSASYYH VNPLSNTAVGAEV H F +N NTIT
Sbjct  154  LTKCNAGLSFSNADLIAALTLNDKGDILSASYYHSVNPLSNTAVGAEVTHRFPTNENTIT  213

Query  365  VGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALAL  186
            +GTQH LDP+TT+KARVNNFG+A+AL+QHEWRPKS +T+SGEVD KA++KSAK GLALAL
Sbjct  214  LGTQHALDPMTTIKARVNNFGKASALVQHEWRPKSFLTVSGEVDTKAIEKSAKIGLALAL  273

Query  185  KP  180
            KP
Sbjct  274  KP  275



>gb|AIL25718.1| voltage-dependent anion channel [Nicotiana tabacum]
Length=276

 Score =   311 bits (798),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 150/182 (82%), Positives = 166/182 (91%), Gaps = 0/182 (0%)
 Frame = -2

Query  725  SFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGA  546
            SFR+PDQ S ++E+QYLHD+AGISTS+GLTANPIVNFSGVVGTN L+LGTD+SFDTK GA
Sbjct  95   SFRIPDQSSAELEVQYLHDYAGISTSLGLTANPIVNFSGVVGTNLLSLGTDLSFDTKVGA  154

Query  545  FTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTIT  366
             TK NAGLSFTN+DLIASL LNDKGD+LSASYYH V+PL+ TAV AEV HSF +N NTI+
Sbjct  155  ITKCNAGLSFTNTDLIASLNLNDKGDALSASYYHIVSPLTMTAVSAEVTHSFCTNENTIS  214

Query  365  VGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALAL  186
            VGTQHQLDPLTTVKARVNN G+ANALIQHEWRPKSL T+SGEVD KAVDKSAKFGLALAL
Sbjct  215  VGTQHQLDPLTTVKARVNNLGKANALIQHEWRPKSLFTISGEVDTKAVDKSAKFGLALAL  274

Query  185  KP  180
            KP
Sbjct  275  KP  276



>ref|XP_007215668.1| hypothetical protein PRUPE_ppa008585mg [Prunus persica]
 gb|EMJ16867.1| hypothetical protein PRUPE_ppa008585mg [Prunus persica]
Length=326

 Score =   313 bits (802),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 147/182 (81%), Positives = 169/182 (93%), Gaps = 0/182 (0%)
 Frame = -2

Query  725  SFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGA  546
            SF+VPDQRSGKVELQYLHD+AGISTS+GLTANPIVNFSGV+GTN LALGTD+SFDTK+G 
Sbjct  145  SFKVPDQRSGKVELQYLHDYAGISTSIGLTANPIVNFSGVIGTNQLALGTDLSFDTKTGN  204

Query  545  FTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTIT  366
             TK NAG+SF+N+DLIA+LTLNDKGD LSASYYH+VNPL+NTAVGAEV H F +N NTIT
Sbjct  205  LTKCNAGVSFSNADLIAALTLNDKGDILSASYYHNVNPLANTAVGAEVTHRFPTNENTIT  264

Query  365  VGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALAL  186
            +GTQH LDPLTT+KARVNNFG+A+ALIQHEWRPKS +T+SGEVD KA++K+AK GLALAL
Sbjct  265  LGTQHALDPLTTLKARVNNFGKASALIQHEWRPKSFVTISGEVDTKAIEKTAKIGLALAL  324

Query  185  KP  180
            KP
Sbjct  325  KP  326



>gb|KHG07130.1| Mitochondrial outer membrane protein porin of 34 kDa [Gossypium 
arboreum]
Length=258

 Score =   310 bits (794),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 146/181 (81%), Positives = 167/181 (92%), Gaps = 0/181 (0%)
 Frame = -2

Query  722  FRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAF  543
            FRVPDQRSGK+ELQYLH++AGIS+S+GLTANPIVNFSGV+GTN LALGTD+SFDTK+G F
Sbjct  78   FRVPDQRSGKIELQYLHEYAGISSSIGLTANPIVNFSGVLGTNVLALGTDISFDTKTGNF  137

Query  542  TKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITV  363
            TK NAG SFTN+DLIASL LN+KGDS++ASYYH VNP +NTAVGAEV HSFS+NVNTITV
Sbjct  138  TKCNAGFSFTNADLIASLALNEKGDSVNASYYHIVNPSTNTAVGAEVTHSFSTNVNTITV  197

Query  362  GTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALK  183
            GTQH LDPLTT+KARVNN G+A+ALIQHEWRPKSL ++SGEVD K++DKS K GLALALK
Sbjct  198  GTQHALDPLTTIKARVNNAGKASALIQHEWRPKSLFSISGEVDTKSIDKSPKVGLALALK  257

Query  182  P  180
            P
Sbjct  258  P  258



>gb|KJB33661.1| hypothetical protein B456_006G024700 [Gossypium raimondii]
Length=276

 Score =   310 bits (795),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 148/182 (81%), Positives = 167/182 (92%), Gaps = 0/182 (0%)
 Frame = -2

Query  725  SFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGA  546
            SFRVPDQRSGKVELQYLH++AGIS+S+GLTANPIVN SGV+GTN LALGTD+SFDTK+G 
Sbjct  95   SFRVPDQRSGKVELQYLHEYAGISSSIGLTANPIVNLSGVIGTNVLALGTDLSFDTKTGN  154

Query  545  FTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTIT  366
            FTK NAGLSF+N DLIASLTLN+KGDSL+ASYYH VNP++NTAVGAEV HSFS+N NTIT
Sbjct  155  FTKCNAGLSFSNVDLIASLTLNEKGDSLNASYYHIVNPMTNTAVGAEVTHSFSTNENTIT  214

Query  365  VGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALAL  186
            +GTQH LDPLT VKARVNN G A+ALIQHEWRP+SL T+SGEVD K++DKSAK GLALAL
Sbjct  215  IGTQHALDPLTMVKARVNNAGNASALIQHEWRPRSLFTISGEVDTKSIDKSAKVGLALAL  274

Query  185  KP  180
            KP
Sbjct  275  KP  276



>ref|XP_007032450.1| Voltage dependent anion channel 1 [Theobroma cacao]
 gb|EOY03376.1| Voltage dependent anion channel 1 [Theobroma cacao]
Length=276

 Score =   310 bits (795),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 149/182 (82%), Positives = 166/182 (91%), Gaps = 0/182 (0%)
 Frame = -2

Query  725  SFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGA  546
            SFRVPDQRSGKVELQYLHD+AGIS+S+GLTANPIVNFSGV GTN LALGTD+SFDTK+G 
Sbjct  95   SFRVPDQRSGKVELQYLHDYAGISSSIGLTANPIVNFSGVFGTNVLALGTDLSFDTKTGN  154

Query  545  FTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTIT  366
            FTK NAGLSF+N DLIAS+ LN+KGDSL+ASYYH VNPL+NTAVGAEV H FS+N NTIT
Sbjct  155  FTKCNAGLSFSNVDLIASVALNEKGDSLNASYYHIVNPLTNTAVGAEVTHCFSTNENTIT  214

Query  365  VGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALAL  186
            VGTQH LDPLT VKARVNN G+A+ALIQHEWRP+SL T+SGEVD K++DKSAK GLALAL
Sbjct  215  VGTQHALDPLTMVKARVNNAGKASALIQHEWRPRSLFTISGEVDTKSIDKSAKVGLALAL  274

Query  185  KP  180
            KP
Sbjct  275  KP  276



>ref|XP_003543710.1| PREDICTED: outer plastidial membrane protein porin-like [Glycine 
max]
Length=276

 Score =   310 bits (794),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 148/182 (81%), Positives = 165/182 (91%), Gaps = 0/182 (0%)
 Frame = -2

Query  725  SFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGA  546
            SFRVPDQRSGKVE+QYLHD+AGISTSVGLTANPIVNFSGVVGTN LALGTDVSFDTK G 
Sbjct  95   SFRVPDQRSGKVEVQYLHDYAGISTSVGLTANPIVNFSGVVGTNVLALGTDVSFDTKIGE  154

Query  545  FTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTIT  366
             TK+NAGL+FT  DL+ASLT+NDKGD+L+ASYYH VN L+NTAVGAEV H FS+N NT+T
Sbjct  155  LTKFNAGLNFTKDDLVASLTVNDKGDALNASYYHAVNRLTNTAVGAEVTHRFSTNENTLT  214

Query  365  VGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALAL  186
            +GTQH LDPLTT+KARVNNFG+ANALIQHEWRPKS  T+SGEVD KA++KSAK GL LAL
Sbjct  215  LGTQHALDPLTTMKARVNNFGKANALIQHEWRPKSFFTISGEVDTKAIEKSAKVGLGLAL  274

Query  185  KP  180
            KP
Sbjct  275  KP  276



>gb|KHG10147.1| Mitochondrial outer membrane porin of 34 kDa [Gossypium arboreum]
Length=271

 Score =   310 bits (794),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 146/181 (81%), Positives = 167/181 (92%), Gaps = 0/181 (0%)
 Frame = -2

Query  722  FRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAF  543
            FRVPDQRSGK+ELQYLH++AGIS+S+GLTANPIVNFSGV+GTN LALGTD+SFDTK+G F
Sbjct  91   FRVPDQRSGKIELQYLHEYAGISSSIGLTANPIVNFSGVLGTNVLALGTDISFDTKTGNF  150

Query  542  TKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITV  363
            TK NAG SFTN+DLIASL LN+KGDS++ASYYH VNP +NTAVGAEV HSFS+NVNTITV
Sbjct  151  TKCNAGFSFTNADLIASLALNEKGDSVNASYYHIVNPSTNTAVGAEVTHSFSTNVNTITV  210

Query  362  GTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALK  183
            GTQH LDPLTT+KARVNN G+A+ALIQHEWRPKSL ++SGEVD K++DKS K GLALALK
Sbjct  211  GTQHALDPLTTIKARVNNAGKASALIQHEWRPKSLFSISGEVDTKSIDKSPKVGLALALK  270

Query  182  P  180
            P
Sbjct  271  P  271



>gb|KHN13242.1| Outer plastidial membrane protein porin [Glycine soja]
Length=276

 Score =   310 bits (793),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 147/182 (81%), Positives = 165/182 (91%), Gaps = 0/182 (0%)
 Frame = -2

Query  725  SFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGA  546
            SFRVPDQRSGKVE+QYLHD+AGISTSVGLTANPIVNFSG+VGTN LALGTDVSFDTK G 
Sbjct  95   SFRVPDQRSGKVEVQYLHDYAGISTSVGLTANPIVNFSGIVGTNVLALGTDVSFDTKIGE  154

Query  545  FTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTIT  366
             TK+NAGL+FT  DL+ASLT+NDKGD+L+ASYYH VN L+NTAVGAEV H FS+N NT+T
Sbjct  155  LTKFNAGLNFTKDDLVASLTVNDKGDALNASYYHAVNRLTNTAVGAEVTHRFSTNENTLT  214

Query  365  VGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALAL  186
            +GTQH LDPLTT+KARVNNFG+ANALIQHEWRPKS  T+SGEVD KA++KSAK GL LAL
Sbjct  215  LGTQHALDPLTTMKARVNNFGKANALIQHEWRPKSFFTISGEVDTKAIEKSAKVGLGLAL  274

Query  185  KP  180
            KP
Sbjct  275  KP  276



>ref|XP_010066951.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa 
[Eucalyptus grandis]
 gb|KCW65006.1| hypothetical protein EUGRSUZ_G02544 [Eucalyptus grandis]
Length=276

 Score =   309 bits (792),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 149/182 (82%), Positives = 167/182 (92%), Gaps = 0/182 (0%)
 Frame = -2

Query  725  SFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGA  546
            SF VPDQRSGKVELQY H++AGISTS+GLTANPIVNFSGVVG N LALGTD+SFDT SG 
Sbjct  95   SFIVPDQRSGKVELQYQHEYAGISTSIGLTANPIVNFSGVVGNNLLALGTDLSFDTASGN  154

Query  545  FTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTIT  366
            FTK NAGLSFTNSDLIASLTLNDKGD+LSASYYH V+PL++TAVGAE++HSFSSN N +T
Sbjct  155  FTKCNAGLSFTNSDLIASLTLNDKGDTLSASYYHTVSPLTSTAVGAELSHSFSSNENMLT  214

Query  365  VGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALAL  186
            +GTQH LDPLT VKARVNN+GRA+ALIQHEWRPKSL T+SGEVD +A++KSAK GLALAL
Sbjct  215  IGTQHALDPLTNVKARVNNYGRASALIQHEWRPKSLFTISGEVDTRAIEKSAKIGLALAL  274

Query  185  KP  180
            KP
Sbjct  275  KP  276



>gb|EYU34113.1| hypothetical protein MIMGU_mgv1a011597mg [Erythranthe guttata]
Length=276

 Score =   308 bits (790),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 149/182 (82%), Positives = 166/182 (91%), Gaps = 0/182 (0%)
 Frame = -2

Query  725  SFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGA  546
            SF+VPDQRSGK+ELQYLHD+AGIS+SVGLTANPIVNFSGVVG N  ++G+DVS+DTK GA
Sbjct  95   SFKVPDQRSGKLELQYLHDYAGISSSVGLTANPIVNFSGVVGNNLFSVGSDVSYDTKEGA  154

Query  545  FTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTIT  366
             TK N G SFTN+DLIASLTLNDKGDSLSASYYH V P++NTAVGAEV HSFSSN NTIT
Sbjct  155  LTKCNFGASFTNADLIASLTLNDKGDSLSASYYHTVTPVTNTAVGAEVTHSFSSNENTIT  214

Query  365  VGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALAL  186
            VGTQH LD LTTVKAR+NNFG+A+ALIQHEWRPKSL+T+S EVD K+VDKSAKFGLALAL
Sbjct  215  VGTQHSLDSLTTVKARLNNFGKASALIQHEWRPKSLVTVSSEVDTKSVDKSAKFGLALAL  274

Query  185  KP  180
            KP
Sbjct  275  KP  276



>ref|XP_002282471.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa 
[Vitis vinifera]
 emb|CAN61274.1| hypothetical protein VITISV_039065 [Vitis vinifera]
 emb|CBI22157.3| unnamed protein product [Vitis vinifera]
Length=276

 Score =   308 bits (790),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 145/181 (80%), Positives = 168/181 (93%), Gaps = 0/181 (0%)
 Frame = -2

Query  722  FRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAF  543
            F+VPDQRSGKVELQYLHD+AGISTS+GLTANPIVNFSG +GTN +ALGTD+SFDTKSG F
Sbjct  96   FKVPDQRSGKVELQYLHDYAGISTSIGLTANPIVNFSGTIGTNVVALGTDLSFDTKSGNF  155

Query  542  TKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITV  363
            TK NAG+SF N+DLIASLT+NDKGD+++ASY+H VN L+NTAVGAEV HSFS+N NT+T+
Sbjct  156  TKCNAGVSFCNADLIASLTVNDKGDAVNASYFHSVNLLTNTAVGAEVTHSFSTNQNTLTL  215

Query  362  GTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALK  183
            G QH+LDPLTTVKARVNNFG+A+ALIQHEWRP+SL T+SGEVD KAVDK+AK GLALALK
Sbjct  216  GAQHKLDPLTTVKARVNNFGKASALIQHEWRPRSLFTISGEVDTKAVDKTAKVGLALALK  275

Query  182  P  180
            P
Sbjct  276  P  276



>emb|CDP00287.1| unnamed protein product [Coffea canephora]
Length=276

 Score =   308 bits (789),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 145/182 (80%), Positives = 171/182 (94%), Gaps = 0/182 (0%)
 Frame = -2

Query  725  SFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGA  546
            SF VPDQRSGKVELQYLH++AGIS+S+GLTANPIVNFSGV G + LALGTDVSFDT +G 
Sbjct  95   SFVVPDQRSGKVELQYLHEYAGISSSIGLTANPIVNFSGVAGNDKLALGTDVSFDTATGN  154

Query  545  FTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTIT  366
            FTKYNAGLSFTNSDLIA+LTLNDKGD+L+ASYYH V+PL+NTAVGAE++HSFS+N N++T
Sbjct  155  FTKYNAGLSFTNSDLIAALTLNDKGDTLTASYYHSVSPLTNTAVGAELSHSFSTNENSLT  214

Query  365  VGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALAL  186
            +GTQH LDPLTTVKARVNN+G+A+ALIQHEWRPKSL+T+SGEVD +A++KSAK GLA+AL
Sbjct  215  LGTQHLLDPLTTVKARVNNYGKASALIQHEWRPKSLLTISGEVDTRAIEKSAKIGLAVAL  274

Query  185  KP  180
            KP
Sbjct  275  KP  276



>ref|XP_011085779.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa-like 
[Sesamum indicum]
Length=276

 Score =   308 bits (789),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 148/182 (81%), Positives = 166/182 (91%), Gaps = 0/182 (0%)
 Frame = -2

Query  725  SFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGA  546
            SFRVPDQRSGK+ELQYLH++AGIS+SVGLTANPIVNFSGVVG N LALG+DVSFDTK GA
Sbjct  95   SFRVPDQRSGKLELQYLHEYAGISSSVGLTANPIVNFSGVVGNNKLALGSDVSFDTKEGA  154

Query  545  FTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTIT  366
            F K N G SFTN+DLIA+LTLNDKGD+LSASYYH V+PLSNTAVGAEV HSFS+N NT+ 
Sbjct  155  FIKCNFGASFTNADLIAALTLNDKGDTLSASYYHIVSPLSNTAVGAEVTHSFSTNENTVI  214

Query  365  VGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALAL  186
            VGTQH LDPLT+VKAR+NNFG+A+ALIQHEWRPKSLIT+S EVD K++DKS KFG ALAL
Sbjct  215  VGTQHSLDPLTSVKARLNNFGKASALIQHEWRPKSLITVSTEVDTKSIDKSPKFGFALAL  274

Query  185  KP  180
            KP
Sbjct  275  KP  276



>gb|KHG07129.1| Mitochondrial outer membrane protein porin of 34 kDa [Gossypium 
arboreum]
Length=344

 Score =   310 bits (795),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 146/181 (81%), Positives = 167/181 (92%), Gaps = 0/181 (0%)
 Frame = -2

Query  722  FRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAF  543
            FRVPDQRSGK+ELQYLH++AGIS+S+GLTANPIVNFSGV+GTN LALGTD+SFDTK+G F
Sbjct  164  FRVPDQRSGKIELQYLHEYAGISSSIGLTANPIVNFSGVLGTNVLALGTDISFDTKTGNF  223

Query  542  TKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITV  363
            TK NAG SFTN+DLIASL LN+KGDS++ASYYH VNP +NTAVGAEV HSFS+NVNTITV
Sbjct  224  TKCNAGFSFTNADLIASLALNEKGDSVNASYYHIVNPSTNTAVGAEVTHSFSTNVNTITV  283

Query  362  GTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALK  183
            GTQH LDPLTT+KARVNN G+A+ALIQHEWRPKSL ++SGEVD K++DKS K GLALALK
Sbjct  284  GTQHALDPLTTIKARVNNAGKASALIQHEWRPKSLFSISGEVDTKSIDKSPKVGLALALK  343

Query  182  P  180
            P
Sbjct  344  P  344



>ref|XP_002520135.1| voltage-dependent anion-selective channel, putative [Ricinus 
communis]
 gb|EEF42190.1| voltage-dependent anion-selective channel, putative [Ricinus 
communis]
Length=276

 Score =   308 bits (788),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 144/182 (79%), Positives = 170/182 (93%), Gaps = 0/182 (0%)
 Frame = -2

Query  725  SFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGA  546
            SF++PDQRSGKVELQY H+HAGISTS+GLTANPIVNFSGV+G++A+ALGTD+SFDT SG 
Sbjct  95   SFKIPDQRSGKVELQYQHEHAGISTSIGLTANPIVNFSGVIGSSAVALGTDLSFDTASGN  154

Query  545  FTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTIT  366
            FTK NAGLS++N+DLIASLTLNDKGD+L+ASYYH V+PL+NTAVGAE+ HSFSSN NT+T
Sbjct  155  FTKLNAGLSYSNTDLIASLTLNDKGDTLNASYYHIVSPLTNTAVGAELTHSFSSNENTLT  214

Query  365  VGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALAL  186
             GTQH LDPLTTVKARVN++G+A+ALIQHEWRPKSL T+SGEVD +A++KSAK GLALAL
Sbjct  215  FGTQHALDPLTTVKARVNSYGKASALIQHEWRPKSLFTISGEVDTRAIEKSAKIGLALAL  274

Query  185  KP  180
            KP
Sbjct  275  KP  276



>gb|KHN11584.1| Outer plastidial membrane protein porin [Glycine soja]
Length=276

 Score =   307 bits (787),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 146/182 (80%), Positives = 163/182 (90%), Gaps = 0/182 (0%)
 Frame = -2

Query  725  SFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGA  546
            SF+VPDQRSGKVE+QYLHD+AGISTSVGLTANPIVNFSGV+GTN LALG D+SFDTK G 
Sbjct  95   SFKVPDQRSGKVEVQYLHDYAGISTSVGLTANPIVNFSGVIGTNVLALGADLSFDTKIGE  154

Query  545  FTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTIT  366
             TK NAGLSFT  DLIASLTLNDKGD+L+A+YYH VNPL+NTAVGAEV H FS+N NT+T
Sbjct  155  LTKSNAGLSFTKDDLIASLTLNDKGDALNAAYYHVVNPLTNTAVGAEVTHRFSTNENTLT  214

Query  365  VGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALAL  186
            +GTQHQLDPLTT+KARVNNFGR +ALIQHEWRPKS  T+SGEVD KA++KSAK GL L L
Sbjct  215  LGTQHQLDPLTTLKARVNNFGRTSALIQHEWRPKSFFTISGEVDTKAIEKSAKVGLGLVL  274

Query  185  KP  180
            KP
Sbjct  275  KP  276



>gb|KHN45480.1| Mitochondrial outer membrane protein porin of 34 kDa [Glycine 
soja]
Length=267

 Score =   307 bits (786),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 147/182 (81%), Positives = 164/182 (90%), Gaps = 0/182 (0%)
 Frame = -2

Query  725  SFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGA  546
            SFRVPDQRSGKVE+QYLHD+AGISTSVGLTANPIVNFSGVVGTN LALGTDVSFDTK G 
Sbjct  86   SFRVPDQRSGKVEVQYLHDYAGISTSVGLTANPIVNFSGVVGTNVLALGTDVSFDTKIGE  145

Query  545  FTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTIT  366
             TK+NAGL+FT  DL+ASLT+N+KGDSL+ASYYH VN L+NTAVGAEV H FS+N NT+T
Sbjct  146  LTKFNAGLNFTKDDLVASLTVNNKGDSLNASYYHTVNRLTNTAVGAEVTHQFSTNENTLT  205

Query  365  VGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALAL  186
            +GTQH LDPLTTVKARVNN G+ANALIQHEWRP+S  T+SGEVD KA++KSAK GL LAL
Sbjct  206  LGTQHALDPLTTVKARVNNLGKANALIQHEWRPRSFFTISGEVDTKAIEKSAKVGLGLAL  265

Query  185  KP  180
            KP
Sbjct  266  KP  267



>ref|NP_001238377.1| peroxisomal voltage-dependent anion-selective channel protein 
[Glycine max]
 dbj|BAG09368.1| peroxisomal voltage-dependent anion-selective channel protein 
[Glycine max]
Length=276

 Score =   307 bits (787),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 146/182 (80%), Positives = 163/182 (90%), Gaps = 0/182 (0%)
 Frame = -2

Query  725  SFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGA  546
            SF+VPDQRSGKVE+QYLHD+AGISTSVGLTANPIVNFSGV+GTN LALG D+SFDTK G 
Sbjct  95   SFKVPDQRSGKVEVQYLHDYAGISTSVGLTANPIVNFSGVIGTNVLALGADLSFDTKIGE  154

Query  545  FTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTIT  366
             TK NAGLSFT  DLIASLTLNDKGD+L+A+YYH VNPL+NTAVGAEV H FS+N NT+T
Sbjct  155  LTKSNAGLSFTKDDLIASLTLNDKGDALNAAYYHVVNPLTNTAVGAEVTHRFSTNENTLT  214

Query  365  VGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALAL  186
            +GTQHQLDPLTT+KARVNNFGR +ALIQHEWRPKS  T+SGEVD KA++KSAK GL L L
Sbjct  215  LGTQHQLDPLTTLKARVNNFGRTSALIQHEWRPKSFFTISGEVDTKAIEKSAKVGLGLVL  274

Query  185  KP  180
            KP
Sbjct  275  KP  276



>ref|XP_003554316.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa 
[Glycine max]
Length=276

 Score =   307 bits (786),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 147/182 (81%), Positives = 164/182 (90%), Gaps = 0/182 (0%)
 Frame = -2

Query  725  SFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGA  546
            SFRVPDQRSGKVE+QYLHD+AGISTSVGLTANPIVNFSGVVGTN LALGTDVSFDTK G 
Sbjct  95   SFRVPDQRSGKVEVQYLHDYAGISTSVGLTANPIVNFSGVVGTNVLALGTDVSFDTKIGE  154

Query  545  FTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTIT  366
             TK+NAGL+FT  DL+ASLT+N+KGDSL+ASYYH VN L+NTAVGAEV H FS+N NT+T
Sbjct  155  LTKFNAGLNFTKDDLVASLTVNNKGDSLNASYYHTVNRLTNTAVGAEVTHQFSTNENTLT  214

Query  365  VGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALAL  186
            +GTQH LDPLTTVKARVNN G+ANALIQHEWRP+S  T+SGEVD KA++KSAK GL LAL
Sbjct  215  LGTQHALDPLTTVKARVNNLGKANALIQHEWRPRSFFTISGEVDTKAIEKSAKVGLGLAL  274

Query  185  KP  180
            KP
Sbjct  275  KP  276



>ref|XP_003552508.1| PREDICTED: outer plastidial membrane protein porin-like isoform 
1 [Glycine max]
 gb|KHN13654.1| Outer plastidial membrane protein porin [Glycine soja]
Length=276

 Score =   306 bits (785),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 145/182 (80%), Positives = 164/182 (90%), Gaps = 0/182 (0%)
 Frame = -2

Query  725  SFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGA  546
            SF+VPDQRSGKVE+QYLHD+AGISTSVGLTANPIVNFSGV+GTN LALG D+SFD+K G 
Sbjct  95   SFKVPDQRSGKVEVQYLHDYAGISTSVGLTANPIVNFSGVIGTNVLALGADLSFDSKIGE  154

Query  545  FTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTIT  366
             TK NAGLSFT  DLIASLTLNDKGD+L+A+YYH VNPL+NTAVGAEV H FS+N NT+T
Sbjct  155  LTKSNAGLSFTKDDLIASLTLNDKGDALNAAYYHVVNPLTNTAVGAEVTHRFSTNENTLT  214

Query  365  VGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALAL  186
            +GTQHQLDPLTT+KARVNNFGR +ALIQHEWRPKS  T+SGEVD KA++KSAK GL+L L
Sbjct  215  LGTQHQLDPLTTLKARVNNFGRTSALIQHEWRPKSFFTISGEVDTKAIEKSAKVGLSLVL  274

Query  185  KP  180
            KP
Sbjct  275  KP  276



>ref|XP_011034213.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa-like 
[Populus euphratica]
Length=276

 Score =   306 bits (783),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 142/182 (78%), Positives = 169/182 (93%), Gaps = 0/182 (0%)
 Frame = -2

Query  725  SFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGA  546
            SF+VPDQRSGKVELQY H++AGISTS+GLTANPIVNFSGV+G+N ++LGTD+SFDT +G 
Sbjct  95   SFKVPDQRSGKVELQYQHEYAGISTSLGLTANPIVNFSGVIGSNVVSLGTDLSFDTATGN  154

Query  545  FTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTIT  366
            FTKYNAGLS+TN+DLIASLT+NDKGD+L+ASYYH V PL++TAVGAE+  SFSSN NT+T
Sbjct  155  FTKYNAGLSYTNADLIASLTVNDKGDTLTASYYHTVRPLTSTAVGAELTRSFSSNENTLT  214

Query  365  VGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALAL  186
            +GTQH LDPLTTVKAR+NN+G+A+ALIQHEWRPKSL T+SGEVD KA++KSAK GLALAL
Sbjct  215  IGTQHALDPLTTVKARLNNYGKASALIQHEWRPKSLFTISGEVDTKAIEKSAKIGLALAL  274

Query  185  KP  180
            KP
Sbjct  275  KP  276



>ref|XP_002312708.1| porin family protein [Populus trichocarpa]
 gb|ABK94257.1| unknown [Populus trichocarpa]
 gb|EEE90075.1| porin family protein [Populus trichocarpa]
Length=276

 Score =   306 bits (783),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 142/182 (78%), Positives = 169/182 (93%), Gaps = 0/182 (0%)
 Frame = -2

Query  725  SFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGA  546
            SF+VPDQRSGKVELQY H++AGISTS+GLTANPIVNFSGV+G+N ++LGTD+SFDT +G 
Sbjct  95   SFKVPDQRSGKVELQYQHEYAGISTSLGLTANPIVNFSGVIGSNVVSLGTDLSFDTATGN  154

Query  545  FTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTIT  366
            FTKYNAGLS+TN+DLIASLT+NDKGD+L+ASYYH V PL++TAVGAE+  SFSSN NT+T
Sbjct  155  FTKYNAGLSYTNADLIASLTVNDKGDTLTASYYHTVRPLTSTAVGAELTRSFSSNENTLT  214

Query  365  VGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALAL  186
            +GTQH LDPLTTVKAR+NN+G+A+ALIQHEWRPKSL T+SGEVD KA++KSAK GLALAL
Sbjct  215  IGTQHALDPLTTVKARLNNYGKASALIQHEWRPKSLFTISGEVDTKAIEKSAKIGLALAL  274

Query  185  KP  180
            KP
Sbjct  275  KP  276



>gb|ACU20122.1| unknown [Glycine max]
Length=276

 Score =   305 bits (782),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 145/182 (80%), Positives = 163/182 (90%), Gaps = 0/182 (0%)
 Frame = -2

Query  725  SFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGA  546
            SF+VPDQRSGKVE+QYLHD+AGISTSVGLTANPIVNFSGV+GTN LALG D+SFDTK G 
Sbjct  95   SFKVPDQRSGKVEVQYLHDYAGISTSVGLTANPIVNFSGVIGTNVLALGADLSFDTKIGE  154

Query  545  FTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTIT  366
             TK NAGLSFT  DLIASLTLNDKGD+L+A+YYH VNPL+NTAVGAEV H FS+N NT+T
Sbjct  155  LTKSNAGLSFTKDDLIASLTLNDKGDALNAAYYHVVNPLTNTAVGAEVTHRFSTNENTLT  214

Query  365  VGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALAL  186
            +GTQHQLDPLTT+KARVNNFGR +ALIQH+WRPKS  T+SGEVD KA++KSAK GL L L
Sbjct  215  LGTQHQLDPLTTLKARVNNFGRTSALIQHKWRPKSFFTISGEVDTKAIEKSAKVGLGLVL  274

Query  185  KP  180
            KP
Sbjct  275  KP  276



>gb|AAQ87020.1| VDAC1.2 [Lotus japonicus]
Length=276

 Score =   305 bits (781),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 146/182 (80%), Positives = 164/182 (90%), Gaps = 0/182 (0%)
 Frame = -2

Query  725  SFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGA  546
            SFRVPDQRSGKVELQYLHD+AGISTSVGLT NPIVNFSGVVGTNALA+GTD+SFDTK G 
Sbjct  95   SFRVPDQRSGKVELQYLHDYAGISTSVGLTPNPIVNFSGVVGTNALAVGTDLSFDTKIGE  154

Query  545  FTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTIT  366
             TK+NAGL+FT +DLIASLT+NDKGD+L+ASYYH VNPL+NTA GAEV H FS+N NT+T
Sbjct  155  LTKFNAGLNFTKADLIASLTVNDKGDALNASYYHIVNPLTNTAFGAEVTHRFSTNENTLT  214

Query  365  VGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALAL  186
            +GTQH LDPLT+VKARVNN G+ANALIQHEWR KS  T+SGEVD KA++KSAK GL LAL
Sbjct  215  LGTQHALDPLTSVKARVNNLGKANALIQHEWRAKSFFTISGEVDTKAIEKSAKIGLGLAL  274

Query  185  KP  180
            KP
Sbjct  275  KP  276



>gb|AAY82249.1| mitochrondrial voltage-dependent anion-selective channel [Phaseolus 
coccineus]
Length=276

 Score =   305 bits (780),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 146/181 (81%), Positives = 163/181 (90%), Gaps = 0/181 (0%)
 Frame = -2

Query  722  FRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAF  543
            F+VPDQRSGKVELQYLHD+AGISTSVGLTANPIVNFSGVVGTN LALG D+SFDTK G  
Sbjct  96   FKVPDQRSGKVELQYLHDYAGISTSVGLTANPIVNFSGVVGTNILALGADLSFDTKIGEL  155

Query  542  TKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITV  363
            TK NAGLSFT  DLIASLTLNDKGD+L+A+YYH VNPL+NTAVGAEV H FS+N NTIT+
Sbjct  156  TKSNAGLSFTKDDLIASLTLNDKGDALNAAYYHVVNPLTNTAVGAEVTHRFSTNENTITL  215

Query  362  GTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALK  183
            GTQH LDPLTT+KARVNNFG+++ALIQHEWRPKS  T+SGEVD KA++KSAK GL+L LK
Sbjct  216  GTQHALDPLTTLKARVNNFGKSSALIQHEWRPKSFFTISGEVDTKAIEKSAKVGLSLVLK  275

Query  182  P  180
            P
Sbjct  276  P  276



>gb|AAQ87019.1| VDAC1.1 [Lotus japonicus]
 gb|AFK40743.1| unknown [Lotus japonicus]
Length=276

 Score =   304 bits (779),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 144/182 (79%), Positives = 165/182 (91%), Gaps = 0/182 (0%)
 Frame = -2

Query  725  SFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGA  546
            SF+VPDQRSGKVELQYLHD+AGIS+S+GLTANPIVNFSGV+GTN LALG D++FDTK G 
Sbjct  95   SFKVPDQRSGKVELQYLHDYAGISSSIGLTANPIVNFSGVIGTNVLALGADLTFDTKIGE  154

Query  545  FTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTIT  366
             TK NAGLSFT  DLIA+LTLNDKGD+L+ASYYH V+PL+NTAVGAEV H FS+N NT+T
Sbjct  155  LTKSNAGLSFTKDDLIAALTLNDKGDALNASYYHVVSPLTNTAVGAEVTHRFSTNENTLT  214

Query  365  VGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALAL  186
            +GTQH LDPLTT+KARVNNFG+A+ALIQHEWRPKS  T+SGEVD KA++KSAK GLALAL
Sbjct  215  LGTQHALDPLTTLKARVNNFGKASALIQHEWRPKSFFTISGEVDTKAIEKSAKVGLALAL  274

Query  185  KP  180
            KP
Sbjct  275  KP  276



>gb|KJB11405.1| hypothetical protein B456_001G256800 [Gossypium raimondii]
Length=214

 Score =   302 bits (773),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 144/181 (80%), Positives = 164/181 (91%), Gaps = 0/181 (0%)
 Frame = -2

Query  722  FRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAF  543
            FRVPDQRSGK+ELQYLH++AGIS+S+GLTANPIVNFSGV+GTN LALGTD+SFDTK+G F
Sbjct  34   FRVPDQRSGKIELQYLHEYAGISSSIGLTANPIVNFSGVLGTNVLALGTDISFDTKTGNF  93

Query  542  TKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITV  363
            TK NAG SFTN+DLIASL LN+KGDS++ASYYH VN  +NT VGAEV HSFS+NVNTITV
Sbjct  94   TKCNAGFSFTNADLIASLALNEKGDSVNASYYHIVNLSTNTVVGAEVTHSFSTNVNTITV  153

Query  362  GTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALK  183
            GTQH LDP TT+KARVNN G+A+ALIQHEWRPKSL T+SGEVD K++DKS K GLALALK
Sbjct  154  GTQHALDPSTTIKARVNNAGKASALIQHEWRPKSLFTISGEVDTKSIDKSPKVGLALALK  213

Query  182  P  180
            P
Sbjct  214  P  214



>gb|KCW56275.1| hypothetical protein EUGRSUZ_I02018 [Eucalyptus grandis]
Length=260

 Score =   303 bits (777),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 144/182 (79%), Positives = 165/182 (91%), Gaps = 0/182 (0%)
 Frame = -2

Query  725  SFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGA  546
            SF+VPDQRSGK+ELQYLH+HAGIS+S+GLTANPIV FSGV+GT+ALALGTDVSFDTKSG 
Sbjct  79   SFKVPDQRSGKIELQYLHEHAGISSSIGLTANPIVTFSGVIGTSALALGTDVSFDTKSGD  138

Query  545  FTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTIT  366
            F K NAGLSF+N+DLIASLT+NDKGD+L+ASYYH VN L+NTAVGAE  H FS+N NTIT
Sbjct  139  FAKCNAGLSFSNADLIASLTVNDKGDTLAASYYHLVNGLTNTAVGAEFTHRFSTNENTIT  198

Query  365  VGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALAL  186
            VGTQH LDPLT+VKARV N G+ +ALIQHEWRP+SL T+SGEVD K++DKSAK GLALAL
Sbjct  199  VGTQHALDPLTSVKARVTNAGKVSALIQHEWRPRSLFTISGEVDSKSIDKSAKVGLALAL  258

Query  185  KP  180
            KP
Sbjct  259  KP  260



>gb|AAB38498.1| porin [Mesembryanthemum crystallinum]
Length=276

 Score =   304 bits (778),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 143/182 (79%), Positives = 164/182 (90%), Gaps = 0/182 (0%)
 Frame = -2

Query  725  SFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGA  546
            SFRVPDQRSGK+ELQYLHD+AGI TSVGLTANPIVNFSGV+GTN LA GTDVSFD+K+G 
Sbjct  95   SFRVPDQRSGKLELQYLHDYAGICTSVGLTANPIVNFSGVLGTNLLAFGTDVSFDSKTGN  154

Query  545  FTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTIT  366
            FTK NAGLSF N+DLIASLTLNDKGD+L+ASYYH ++PL+++AVGAEV HSFS+N NTIT
Sbjct  155  FTKCNAGLSFANADLIASLTLNDKGDTLNASYYHTISPLTSSAVGAEVAHSFSTNQNTIT  214

Query  365  VGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALAL  186
            +G QH +DPLT +K RVNNFG+A ALIQHEWRPKSL+T S EVD KA++KSAK GLALAL
Sbjct  215  LGAQHAIDPLTNLKGRVNNFGKATALIQHEWRPKSLVTFSAEVDTKAIEKSAKVGLALAL  274

Query  185  KP  180
            KP
Sbjct  275  KP  276



>emb|CDP00288.1| unnamed protein product [Coffea canephora]
Length=276

 Score =   304 bits (778),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 142/182 (78%), Positives = 166/182 (91%), Gaps = 0/182 (0%)
 Frame = -2

Query  725  SFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGA  546
            SF VPDQRSGKVELQYLH++AGIST +GLTANPIVNFSGV G + LALG D+SFDT +G 
Sbjct  95   SFVVPDQRSGKVELQYLHEYAGISTGIGLTANPIVNFSGVAGNDKLALGADLSFDTATGN  154

Query  545  FTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTIT  366
            FTKYNAG SFTNSDLIA+LTLNDKGD+L+ASYYH V+PL+NTAVGAE++H FSSN NT+T
Sbjct  155  FTKYNAGFSFTNSDLIAALTLNDKGDTLTASYYHSVSPLTNTAVGAELSHGFSSNENTLT  214

Query  365  VGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALAL  186
            +GTQH LDPLTT+KARVNN+G+A+ALIQHEWRPKSL T+SGEVD +A++KSAK GLA+AL
Sbjct  215  IGTQHSLDPLTTLKARVNNYGKASALIQHEWRPKSLFTISGEVDTRAIEKSAKIGLAVAL  274

Query  185  KP  180
            KP
Sbjct  275  KP  276



>ref|XP_006482536.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa-like 
[Citrus sinensis]
Length=274

 Score =   303 bits (777),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 151/182 (83%), Positives = 166/182 (91%), Gaps = 2/182 (1%)
 Frame = -2

Query  725  SFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGA  546
            SF+VPDQRSGKVELQYLHD+AGISTSVGLTANPIVNFS V+GTN L+LGTD+SFD+KSG 
Sbjct  95   SFKVPDQRSGKVELQYLHDYAGISTSVGLTANPIVNFSAVIGTNVLSLGTDLSFDSKSGN  154

Query  545  FTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTIT  366
            FTK NAGLSF N+DLIASL LN+KGDSL+ASYYH VNPL  TAVGAEV HSFS+N NTIT
Sbjct  155  FTKCNAGLSFNNADLIASLNLNNKGDSLAASYYHFVNPL--TAVGAEVIHSFSTNDNTIT  212

Query  365  VGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALAL  186
            VGTQH LDPLTT+KARVNN G A+ALIQHEWRPKSL T+SGEVD KA++KSAKFGLALAL
Sbjct  213  VGTQHILDPLTTLKARVNNAGIASALIQHEWRPKSLFTISGEVDTKAIEKSAKFGLALAL  272

Query  185  KP  180
            KP
Sbjct  273  KP  274



>gb|KJB50697.1| hypothetical protein B456_008G182700 [Gossypium raimondii]
Length=210

 Score =   301 bits (770),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 144/182 (79%), Positives = 168/182 (92%), Gaps = 0/182 (0%)
 Frame = -2

Query  725  SFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGA  546
            SF  PDQRSGKVELQY H++AGISTS+GLTANP+VNFSGVVG N++ +GTD+SFDT SG 
Sbjct  29   SFIAPDQRSGKVELQYQHEYAGISTSIGLTANPLVNFSGVVGNNSVTVGTDLSFDTASGN  88

Query  545  FTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTIT  366
            FTK NAGL+FT+SDLIASLTLNDKGD+L+ASYYH V+PL+NTAVGAE++HSFSSN NT+T
Sbjct  89   FTKLNAGLNFTHSDLIASLTLNDKGDTLNASYYHIVSPLTNTAVGAELSHSFSSNENTLT  148

Query  365  VGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALAL  186
            +GTQH LDPLTTVKAR+NN+GRA+ALIQHEWRPKSLIT+SGEVD  A++KSAK GLALAL
Sbjct  149  IGTQHALDPLTTVKARLNNYGRASALIQHEWRPKSLITISGEVDTGAIEKSAKVGLALAL  208

Query  185  KP  180
            KP
Sbjct  209  KP  210



>gb|AFK40985.1| unknown [Lotus japonicus]
Length=276

 Score =   303 bits (775),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 145/182 (80%), Positives = 163/182 (90%), Gaps = 0/182 (0%)
 Frame = -2

Query  725  SFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGA  546
            SFRVPDQRSGKVELQYLHD+AGISTSVGLT NPIVNFSGVVGTNA A+GTD+SFDTK G 
Sbjct  95   SFRVPDQRSGKVELQYLHDYAGISTSVGLTPNPIVNFSGVVGTNARAVGTDLSFDTKIGE  154

Query  545  FTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTIT  366
             TK+NAGL+FT +DLIASLT+NDKGD+L+ASYYH VNPL+NTA GAEV H FS+N NT+T
Sbjct  155  LTKFNAGLNFTKADLIASLTVNDKGDALNASYYHIVNPLTNTAFGAEVTHRFSTNENTLT  214

Query  365  VGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALAL  186
            +GTQH LDPLT+VKARVNN G+ANALIQHEWR KS  T+SGEVD KA++KSAK GL LAL
Sbjct  215  LGTQHALDPLTSVKARVNNLGKANALIQHEWRAKSFFTISGEVDTKAIEKSAKIGLGLAL  274

Query  185  KP  180
            KP
Sbjct  275  KP  276



>gb|KJB11402.1| hypothetical protein B456_001G256800 [Gossypium raimondii]
Length=276

 Score =   303 bits (775),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 144/181 (80%), Positives = 164/181 (91%), Gaps = 0/181 (0%)
 Frame = -2

Query  722  FRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAF  543
            FRVPDQRSGK+ELQYLH++AGIS+S+GLTANPIVNFSGV+GTN LALGTD+SFDTK+G F
Sbjct  96   FRVPDQRSGKIELQYLHEYAGISSSIGLTANPIVNFSGVLGTNVLALGTDISFDTKTGNF  155

Query  542  TKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITV  363
            TK NAG SFTN+DLIASL LN+KGDS++ASYYH VN  +NT VGAEV HSFS+NVNTITV
Sbjct  156  TKCNAGFSFTNADLIASLALNEKGDSVNASYYHIVNLSTNTVVGAEVTHSFSTNVNTITV  215

Query  362  GTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALK  183
            GTQH LDP TT+KARVNN G+A+ALIQHEWRPKSL T+SGEVD K++DKS K GLALALK
Sbjct  216  GTQHALDPSTTIKARVNNAGKASALIQHEWRPKSLFTISGEVDTKSIDKSPKVGLALALK  275

Query  182  P  180
            P
Sbjct  276  P  276



>gb|KJB11404.1| hypothetical protein B456_001G256800 [Gossypium raimondii]
Length=275

 Score =   302 bits (774),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 144/181 (80%), Positives = 164/181 (91%), Gaps = 0/181 (0%)
 Frame = -2

Query  722  FRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAF  543
            FRVPDQRSGK+ELQYLH++AGIS+S+GLTANPIVNFSGV+GTN LALGTD+SFDTK+G F
Sbjct  95   FRVPDQRSGKIELQYLHEYAGISSSIGLTANPIVNFSGVLGTNVLALGTDISFDTKTGNF  154

Query  542  TKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITV  363
            TK NAG SFTN+DLIASL LN+KGDS++ASYYH VN  +NT VGAEV HSFS+NVNTITV
Sbjct  155  TKCNAGFSFTNADLIASLALNEKGDSVNASYYHIVNLSTNTVVGAEVTHSFSTNVNTITV  214

Query  362  GTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALK  183
            GTQH LDP TT+KARVNN G+A+ALIQHEWRPKSL T+SGEVD K++DKS K GLALALK
Sbjct  215  GTQHALDPSTTIKARVNNAGKASALIQHEWRPKSLFTISGEVDTKSIDKSPKVGLALALK  274

Query  182  P  180
            P
Sbjct  275  P  275



>ref|XP_008456460.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa-like 
[Cucumis melo]
Length=276

 Score =   303 bits (775),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 143/182 (79%), Positives = 167/182 (92%), Gaps = 0/182 (0%)
 Frame = -2

Query  725  SFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGA  546
            SFRVPDQRSGKVELQY H++AGIST +GLTA+PIVNF+GV+G   L+LGTD+SFDT SG 
Sbjct  95   SFRVPDQRSGKVELQYQHEYAGISTGIGLTASPIVNFAGVIGNEKLSLGTDLSFDTASGN  154

Query  545  FTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTIT  366
             TK NAGLS+T+SDLIA+LTLNDKGD+L+ASYYH V+PLSNTAVGAE++HSFSSN NT+T
Sbjct  155  ITKLNAGLSYTHSDLIAALTLNDKGDALTASYYHLVSPLSNTAVGAELSHSFSSNENTLT  214

Query  365  VGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALAL  186
            +GTQH LDPLT+VKARVNN+GRA+ALIQHEWRPKSL T+SGEVD +A+DKSAK GLALAL
Sbjct  215  IGTQHALDPLTSVKARVNNYGRASALIQHEWRPKSLFTISGEVDTRAIDKSAKIGLALAL  274

Query  185  KP  180
            KP
Sbjct  275  KP  276



>ref|XP_006438620.1| hypothetical protein CICLE_v10032366mg [Citrus clementina]
 gb|ESR51860.1| hypothetical protein CICLE_v10032366mg [Citrus clementina]
Length=276

 Score =   302 bits (774),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 143/182 (79%), Positives = 167/182 (92%), Gaps = 0/182 (0%)
 Frame = -2

Query  725  SFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGA  546
            SF VPDQRSGKVELQY H++AGIST +G TANPIVNFSGVVG N++ALGTD+SFDT +G 
Sbjct  95   SFIVPDQRSGKVELQYQHEYAGISTGIGFTANPIVNFSGVVGNNSVALGTDLSFDTATGN  154

Query  545  FTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTIT  366
            FTK NAGLS+T++DLIASLTLNDKGD+L+ASYYH V+PL+NTAVGAE+ HSFSSN NT+T
Sbjct  155  FTKCNAGLSYTHTDLIASLTLNDKGDTLNASYYHIVSPLTNTAVGAELTHSFSSNENTLT  214

Query  365  VGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALAL  186
            +GTQH LDPLT+VKARVNN+GRA+ALIQHEWRPKSL T+SGEVD +A++KSAK GLALAL
Sbjct  215  IGTQHALDPLTSVKARVNNYGRASALIQHEWRPKSLFTISGEVDTRAIEKSAKIGLALAL  274

Query  185  KP  180
            KP
Sbjct  275  KP  276



>ref|XP_010029375.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa-like 
[Eucalyptus grandis]
 gb|KCW56274.1| hypothetical protein EUGRSUZ_I02018 [Eucalyptus grandis]
Length=276

 Score =   302 bits (773),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 145/187 (78%), Positives = 168/187 (90%), Gaps = 0/187 (0%)
 Frame = -2

Query  740  LENHSSFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFD  561
            L++  SF+VPDQRSGK+ELQYLH+HAGIS+S+GLTANPIV FSGV+GT+ALALGTDVSFD
Sbjct  90   LKSIFSFKVPDQRSGKIELQYLHEHAGISSSIGLTANPIVTFSGVIGTSALALGTDVSFD  149

Query  560  TKSGAFTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSN  381
            TKSG F K NAGLSF+N+DLIASLT+NDKGD+L+ASYYH VN L+NTAVGAE  H FS+N
Sbjct  150  TKSGDFAKCNAGLSFSNADLIASLTVNDKGDTLAASYYHLVNGLTNTAVGAEFTHRFSTN  209

Query  380  VNTITVGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFG  201
             NTITVGTQH LDPLT+VKARV N G+ +ALIQHEWRP+SL T+SGEVD K++DKSAK G
Sbjct  210  ENTITVGTQHALDPLTSVKARVTNAGKVSALIQHEWRPRSLFTISGEVDSKSIDKSAKVG  269

Query  200  LALALKP  180
            LALALKP
Sbjct  270  LALALKP  276



>gb|ABB02635.1| unknown [Solanum tuberosum]
Length=171

 Score =   298 bits (763),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 146/171 (85%), Positives = 157/171 (92%), Gaps = 0/171 (0%)
 Frame = -2

Query  692  VELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFT  513
            +ELQYLHD+AGI TSVGLTANPIVNFSGV+GTN LALGTDVSFDTK+GA TK NAGLSFT
Sbjct  1    MELQYLHDYAGICTSVGLTANPIVNFSGVLGTNVLALGTDVSFDTKAGAITKCNAGLSFT  60

Query  512  NSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLT  333
            N+DLI SL LN+KGDSLSASYYH V PL++TAVGAEV HSFS++ NTITVGTQHQLDPLT
Sbjct  61   NADLITSLNLNNKGDSLSASYYHIVTPLTSTAVGAEVTHSFSTSENTITVGTQHQLDPLT  120

Query  332  TVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  180
            TVKARVNNFG A ALIQHEWRPKSL T+SGEVD KAVDKSAKFGLALALKP
Sbjct  121  TVKARVNNFGTATALIQHEWRPKSLFTISGEVDTKAVDKSAKFGLALALKP  171



>gb|ACU24178.1| unknown [Glycine max]
Length=276

 Score =   302 bits (773),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 143/182 (79%), Positives = 162/182 (89%), Gaps = 0/182 (0%)
 Frame = -2

Query  725  SFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGA  546
            SF+VPDQRSGKVE+QYLHD+AGISTSVGLTANPIVNFSGV+GTN LALG D+SFD+K G 
Sbjct  95   SFKVPDQRSGKVEVQYLHDYAGISTSVGLTANPIVNFSGVIGTNVLALGADLSFDSKIGE  154

Query  545  FTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTIT  366
             TK NAGLSFT  DLIASL LNDKGD+L+A+YYH VNPL+NTAVGAEV H FS+N NT+T
Sbjct  155  LTKSNAGLSFTKDDLIASLALNDKGDALNAAYYHVVNPLTNTAVGAEVTHRFSTNENTLT  214

Query  365  VGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALAL  186
            +GTQHQLDPLTT+KARVNNFGR +ALIQHEWRPKS  T+ GEVD KA++KSAK GL+L L
Sbjct  215  LGTQHQLDPLTTLKARVNNFGRTSALIQHEWRPKSFFTIFGEVDTKAIEKSAKVGLSLVL  274

Query  185  KP  180
            KP
Sbjct  275  KP  276



>gb|AFK39621.1| unknown [Lotus japonicus]
Length=276

 Score =   302 bits (773),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 142/182 (78%), Positives = 164/182 (90%), Gaps = 0/182 (0%)
 Frame = -2

Query  725  SFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGA  546
            SF+VPDQRSGKVELQYLHD+AGIS+S+GLTANPIVNFSGV+GTN LALG D++FDTK G 
Sbjct  95   SFKVPDQRSGKVELQYLHDYAGISSSIGLTANPIVNFSGVIGTNVLALGADLTFDTKIGG  154

Query  545  FTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTIT  366
             TK NAGL FT  DLIA+LTLND+GD+L+ASYYH V+PL+NTAVGAEV H FS+N NT+T
Sbjct  155  LTKSNAGLGFTKDDLIAALTLNDRGDALNASYYHVVSPLTNTAVGAEVTHRFSTNENTLT  214

Query  365  VGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALAL  186
            +GTQH LDPLTT+KARVNNFG+A+ALIQHEWRPKS  T+SGEVD KA++KSAK GLALAL
Sbjct  215  LGTQHALDPLTTLKARVNNFGKASALIQHEWRPKSFFTISGEVDTKAIEKSAKVGLALAL  274

Query  185  KP  180
            KP
Sbjct  275  KP  276



>gb|KJB50696.1| hypothetical protein B456_008G182700 [Gossypium raimondii]
Length=276

 Score =   301 bits (772),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 144/182 (79%), Positives = 168/182 (92%), Gaps = 0/182 (0%)
 Frame = -2

Query  725  SFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGA  546
            SF  PDQRSGKVELQY H++AGISTS+GLTANP+VNFSGVVG N++ +GTD+SFDT SG 
Sbjct  95   SFIAPDQRSGKVELQYQHEYAGISTSIGLTANPLVNFSGVVGNNSVTVGTDLSFDTASGN  154

Query  545  FTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTIT  366
            FTK NAGL+FT+SDLIASLTLNDKGD+L+ASYYH V+PL+NTAVGAE++HSFSSN NT+T
Sbjct  155  FTKLNAGLNFTHSDLIASLTLNDKGDTLNASYYHIVSPLTNTAVGAELSHSFSSNENTLT  214

Query  365  VGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALAL  186
            +GTQH LDPLTTVKAR+NN+GRA+ALIQHEWRPKSLIT+SGEVD  A++KSAK GLALAL
Sbjct  215  IGTQHALDPLTTVKARLNNYGRASALIQHEWRPKSLITISGEVDTGAIEKSAKVGLALAL  274

Query  185  KP  180
            KP
Sbjct  275  KP  276



>gb|KHG01383.1| Mitochondrial outer membrane porin of 36 kDa [Gossypium arboreum]
 gb|KHG16984.1| Mitochondrial outer membrane porin of 36 kDa [Gossypium arboreum]
Length=270

 Score =   301 bits (771),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 144/182 (79%), Positives = 168/182 (92%), Gaps = 0/182 (0%)
 Frame = -2

Query  725  SFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGA  546
            SF  PDQRSGKVELQY H++AGISTS+GLTANP+VNFSGVVG N++ +GTD+SFDT SG 
Sbjct  89   SFIAPDQRSGKVELQYQHEYAGISTSIGLTANPLVNFSGVVGNNSVTVGTDLSFDTASGN  148

Query  545  FTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTIT  366
            FTK NAGL+FT+SDLIASLTLNDKGD+L+ASYYH V+PL+NTAVGAE++HSFSSN NT+T
Sbjct  149  FTKLNAGLNFTHSDLIASLTLNDKGDTLNASYYHIVSPLTNTAVGAELSHSFSSNENTLT  208

Query  365  VGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALAL  186
            +GTQH LDPLTTVKAR+NN+GRA+ALIQHEWRPKSLIT+SGEVD  A++KSAK GLALAL
Sbjct  209  IGTQHALDPLTTVKARLNNYGRASALIQHEWRPKSLITISGEVDTGAIEKSAKVGLALAL  268

Query  185  KP  180
            KP
Sbjct  269  KP  270



>ref|XP_006431074.1| hypothetical protein CICLE_v10012445mg [Citrus clementina]
 gb|ESR44314.1| hypothetical protein CICLE_v10012445mg [Citrus clementina]
 gb|KDO72482.1| hypothetical protein CISIN_1g023969mg [Citrus sinensis]
 gb|KDO72483.1| hypothetical protein CISIN_1g023969mg [Citrus sinensis]
Length=274

 Score =   301 bits (772),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 150/182 (82%), Positives = 165/182 (91%), Gaps = 2/182 (1%)
 Frame = -2

Query  725  SFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGA  546
            SF+VPDQRSGKVELQYLHD+AGISTSVGLTANPIVNFS V+GTN L+LGTD+SFD+KSG 
Sbjct  95   SFKVPDQRSGKVELQYLHDYAGISTSVGLTANPIVNFSAVIGTNVLSLGTDLSFDSKSGN  154

Query  545  FTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTIT  366
            FTK NAGLSF N+DLIASL LN+KGDSL+ASYYH VNPL  TAVGAEV HSFS+  NTIT
Sbjct  155  FTKCNAGLSFNNADLIASLNLNNKGDSLAASYYHFVNPL--TAVGAEVIHSFSTTDNTIT  212

Query  365  VGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALAL  186
            VGTQH LDPLTT+KARVNN G A+ALIQHEWRPKSL T+SGEVD KA++KSAKFGLALAL
Sbjct  213  VGTQHILDPLTTLKARVNNAGIASALIQHEWRPKSLFTISGEVDTKAIEKSAKFGLALAL  272

Query  185  KP  180
            KP
Sbjct  273  KP  274



>ref|XP_010033217.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa-like 
[Eucalyptus grandis]
 gb|KCW52798.1| hypothetical protein EUGRSUZ_J02133 [Eucalyptus grandis]
Length=276

 Score =   301 bits (772),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 141/182 (77%), Positives = 168/182 (92%), Gaps = 0/182 (0%)
 Frame = -2

Query  725  SFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGA  546
            SF VPDQRSG++ELQYLHD+AGISTSVGLTANP+VNF+ V+G+N L+LGTDVSFD+K+  
Sbjct  95   SFTVPDQRSGQIELQYLHDYAGISTSVGLTANPVVNFAAVLGSNVLSLGTDVSFDSKASN  154

Query  545  FTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTIT  366
            FTK NAG+SF+N+DLIASL LN+KGDSL+ASYYH VNP+++TA+GAEV HSFSSNVNTIT
Sbjct  155  FTKCNAGISFSNADLIASLALNNKGDSLTASYYHIVNPVTSTAIGAEVTHSFSSNVNTIT  214

Query  365  VGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALAL  186
            VGTQH LDPLTT+KAR+NN G+A+ALIQHEWRP+SL T+SGEVD K++DKSAK GLALAL
Sbjct  215  VGTQHALDPLTTLKARINNSGKASALIQHEWRPRSLFTVSGEVDTKSIDKSAKVGLALAL  274

Query  185  KP  180
            KP
Sbjct  275  KP  276



>ref|XP_006483230.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa-like 
[Citrus sinensis]
Length=276

 Score =   301 bits (771),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 143/182 (79%), Positives = 166/182 (91%), Gaps = 0/182 (0%)
 Frame = -2

Query  725  SFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGA  546
            SF VPDQRSGKVELQY H++AGIST +G TANPIVNFSGVVG N++ALGTD+SFDT +G 
Sbjct  95   SFIVPDQRSGKVELQYQHEYAGISTGIGFTANPIVNFSGVVGNNSVALGTDLSFDTATGN  154

Query  545  FTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTIT  366
            FTK NAGLS+T+ DLIASLTLNDKGD+L+ASYYH V+PL+NTAVGAE+ HSFSSN NT+T
Sbjct  155  FTKCNAGLSYTHIDLIASLTLNDKGDTLNASYYHIVSPLTNTAVGAELTHSFSSNENTLT  214

Query  365  VGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALAL  186
            +GTQH LDPLT+VKARVNN+GRA+ALIQHEWRPKSL T+SGEVD +A++KSAK GLALAL
Sbjct  215  IGTQHALDPLTSVKARVNNYGRASALIQHEWRPKSLFTISGEVDTRAIEKSAKIGLALAL  274

Query  185  KP  180
            KP
Sbjct  275  KP  276



>ref|XP_010096343.1| Mitochondrial outer membrane protein porin of 36 kDa [Morus notabilis]
 gb|EXB63818.1| Mitochondrial outer membrane protein porin of 36 kDa [Morus notabilis]
Length=276

 Score =   301 bits (770),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 143/182 (79%), Positives = 166/182 (91%), Gaps = 0/182 (0%)
 Frame = -2

Query  725  SFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGA  546
            SF VPDQRSGKVELQY H++AGISTS+GLTANP VNFSG VG N LA+GTD+SFDT +G 
Sbjct  95   SFIVPDQRSGKVELQYQHEYAGISTSIGLTANPSVNFSGAVGNNTLAIGTDLSFDTATGN  154

Query  545  FTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTIT  366
            FTK+NAGL+FT SDLIASLTLNDKGD+L+ASYYH V+PL+NTAVGAE++HSFSSN NT+T
Sbjct  155  FTKFNAGLNFTRSDLIASLTLNDKGDALTASYYHSVSPLTNTAVGAELSHSFSSNENTLT  214

Query  365  VGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALAL  186
            +GTQH LDPLTT+KARVNN G+A+ALIQHEWRPKSL T+SGEVD +A++KSAK GLALAL
Sbjct  215  IGTQHALDPLTTLKARVNNSGKASALIQHEWRPKSLFTISGEVDTRAIEKSAKIGLALAL  274

Query  185  KP  180
            KP
Sbjct  275  KP  276



>ref|XP_004146750.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa-like 
[Cucumis sativus]
 ref|XP_004162535.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa-like 
[Cucumis sativus]
Length=276

 Score =   301 bits (770),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 142/182 (78%), Positives = 167/182 (92%), Gaps = 0/182 (0%)
 Frame = -2

Query  725  SFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGA  546
            SFRVPDQRSGKVELQY H++AGIST +GLTA+PIVNF+GV+G + L+LGTD+SFDT SG 
Sbjct  95   SFRVPDQRSGKVELQYQHEYAGISTGIGLTASPIVNFAGVIGNDKLSLGTDLSFDTASGN  154

Query  545  FTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTIT  366
             TK NAGLS+T+SDLIA+LTLNDKGD+L+ASYYH V+PLSNTAVGAE++HSFSSN NT+T
Sbjct  155  ITKLNAGLSYTHSDLIAALTLNDKGDALTASYYHLVSPLSNTAVGAELSHSFSSNENTLT  214

Query  365  VGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALAL  186
            +GTQH LDPLT+VKARVNN+GRA+ALIQHEWRPKSL T+SGEVD +A+DKSAK GLAL L
Sbjct  215  IGTQHALDPLTSVKARVNNYGRASALIQHEWRPKSLFTISGEVDTRAIDKSAKIGLALVL  274

Query  185  KP  180
            KP
Sbjct  275  KP  276



>emb|CDY66736.1| BnaCnng52100D [Brassica napus]
Length=276

 Score =   301 bits (770),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 146/182 (80%), Positives = 162/182 (89%), Gaps = 0/182 (0%)
 Frame = -2

Query  725  SFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGA  546
            SFR PDQ SGK+ELQYLH++AGISTS+GLT NP VNFSGVVGTN LALGTDVSFDTKSG 
Sbjct  95   SFRAPDQNSGKIELQYLHEYAGISTSMGLTQNPTVNFSGVVGTNVLALGTDVSFDTKSGN  154

Query  545  FTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTIT  366
            FTK NAG++FT  DLIASLTLNDKGDS++ASYYH VNPL NTAVGAEVNH FS+NVNTIT
Sbjct  155  FTKINAGVNFTKDDLIASLTLNDKGDSVNASYYHIVNPLFNTAVGAEVNHKFSTNVNTIT  214

Query  365  VGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALAL  186
            VGTQH LDPLTTVKARVN+ G ANALIQH+W P+S  T+SGEVD KA+DK+AK GLAL+L
Sbjct  215  VGTQHSLDPLTTVKARVNSAGIANALIQHQWTPRSFFTISGEVDTKAIDKNAKVGLALSL  274

Query  185  KP  180
            KP
Sbjct  275  KP  276



>ref|XP_006378154.1| porin family protein [Populus trichocarpa]
 gb|ABK92505.1| unknown [Populus trichocarpa]
 gb|ERP55951.1| porin family protein [Populus trichocarpa]
Length=276

 Score =   301 bits (770),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 142/182 (78%), Positives = 168/182 (92%), Gaps = 0/182 (0%)
 Frame = -2

Query  725  SFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGA  546
            SF+VPDQRSGKVELQY H++AGISTS+GLTANPIVNFSGVVG+N +ALGTD+SFDT +G 
Sbjct  95   SFKVPDQRSGKVELQYQHEYAGISTSLGLTANPIVNFSGVVGSNVVALGTDLSFDTATGN  154

Query  545  FTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTIT  366
            FTK NAGLS+TNSDLIASLT+NDKGD+LSASYYH V+PL++TAVGAE+ HSFSSN N +T
Sbjct  155  FTKCNAGLSYTNSDLIASLTVNDKGDTLSASYYHTVSPLTSTAVGAELTHSFSSNENILT  214

Query  365  VGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALAL  186
            +GTQH LDPLTTVKAR+NN+G+ +ALIQ+EWRPKSL T+SGEVD KA++KSAK GLAL+L
Sbjct  215  IGTQHALDPLTTVKARLNNYGKVSALIQNEWRPKSLFTISGEVDTKAIEKSAKVGLALSL  274

Query  185  KP  180
            KP
Sbjct  275  KP  276



>ref|XP_009125035.1| PREDICTED: mitochondrial outer membrane protein porin 1-like 
[Brassica rapa]
Length=276

 Score =   300 bits (769),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 148/187 (79%), Positives = 163/187 (87%), Gaps = 0/187 (0%)
 Frame = -2

Query  740  LENHSSFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFD  561
            L++  SF+ PDQ SGK+ELQYLHD+AGISTS+GLT NP VNFSGVVG N LALGTDVSFD
Sbjct  90   LKSIFSFKAPDQNSGKIELQYLHDYAGISTSMGLTQNPTVNFSGVVGNNLLALGTDVSFD  149

Query  560  TKSGAFTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSN  381
            TKSG+FTK NAGL+FT  DLIASLTLNDKGDS++ASYYH VNPL NTAVGAEVNH FSS 
Sbjct  150  TKSGSFTKINAGLNFTKDDLIASLTLNDKGDSVNASYYHIVNPLFNTAVGAEVNHKFSSK  209

Query  380  VNTITVGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFG  201
            VNTITVGTQH +DPLT VKARVN+ G ANALIQHEW PKS  T+SGEVD KA+DKSAK G
Sbjct  210  VNTITVGTQHSIDPLTMVKARVNSAGIANALIQHEWSPKSFFTVSGEVDTKAIDKSAKVG  269

Query  200  LALALKP  180
            LAL+LKP
Sbjct  270  LALSLKP  276



>ref|XP_010683253.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa 
[Beta vulgaris subsp. vulgaris]
Length=276

 Score =   300 bits (768),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 142/182 (78%), Positives = 166/182 (91%), Gaps = 0/182 (0%)
 Frame = -2

Query  725  SFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGA  546
            SFRVPDQRSGKVELQYLH++AGISTS+GLTANPIVNFSGV+G + LALGTD+SFDT SG 
Sbjct  95   SFRVPDQRSGKVELQYLHEYAGISTSLGLTANPIVNFSGVIGNSTLALGTDLSFDTASGN  154

Query  545  FTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTIT  366
            FTK NAGL+FTN+DLIASL +NDK D L+ASYYH V+PL+NTAVGAE++HSFSSN NT+T
Sbjct  155  FTKCNAGLNFTNTDLIASLNVNDKADILNASYYHIVSPLTNTAVGAELSHSFSSNENTLT  214

Query  365  VGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALAL  186
            +GTQH LDPLT+VKARVNN+G+A+ALIQHEWRPKS +T+SGEVD  A++KSAK GLAL L
Sbjct  215  IGTQHALDPLTSVKARVNNYGKASALIQHEWRPKSTVTISGEVDTSAIEKSAKLGLALVL  274

Query  185  KP  180
            KP
Sbjct  275  KP  276



>ref|XP_009131920.1| PREDICTED: mitochondrial outer membrane protein porin 1 [Brassica 
rapa]
Length=276

 Score =   300 bits (768),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 146/182 (80%), Positives = 160/182 (88%), Gaps = 0/182 (0%)
 Frame = -2

Query  725  SFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGA  546
            SF+ PDQ SGK+ELQYLHD+AGISTS+GLT NP VNFSGV+G NALA+GTDVSFDTKSG 
Sbjct  95   SFKAPDQNSGKIELQYLHDYAGISTSMGLTQNPTVNFSGVIGNNALAVGTDVSFDTKSGN  154

Query  545  FTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTIT  366
            FTK NAGL+FT  DLIASLTLNDKGDS++ASYYH VNPL NTAVGAEVNH FSS VNTIT
Sbjct  155  FTKINAGLNFTKDDLIASLTLNDKGDSVNASYYHIVNPLFNTAVGAEVNHKFSSKVNTIT  214

Query  365  VGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALAL  186
            VGTQH +DPLT VKARVN+ G ANALIQHEW PKS  T+SGEVD KA+DKSAK GLAL+L
Sbjct  215  VGTQHSIDPLTMVKARVNSAGIANALIQHEWSPKSFFTVSGEVDTKAIDKSAKVGLALSL  274

Query  185  KP  180
            KP
Sbjct  275  KP  276



>emb|CDY28690.1| BnaCnng05760D [Brassica napus]
Length=276

 Score =   300 bits (767),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 147/187 (79%), Positives = 163/187 (87%), Gaps = 0/187 (0%)
 Frame = -2

Query  740  LENHSSFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFD  561
            L++  SF+ PDQ SGK+ELQYLHD+AGISTS+GLT NP VNFSGVVG N LALGTDVSFD
Sbjct  90   LKSIFSFKAPDQNSGKIELQYLHDYAGISTSMGLTQNPTVNFSGVVGNNLLALGTDVSFD  149

Query  560  TKSGAFTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSN  381
            TKSG+FTK NAGL+FT  DLIASLTLNDKGDS++ASYYH VNPL NTAVGAEVNH F+S 
Sbjct  150  TKSGSFTKINAGLNFTKDDLIASLTLNDKGDSVNASYYHIVNPLFNTAVGAEVNHKFASK  209

Query  380  VNTITVGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFG  201
            VNTITVGTQH +DPLT VKARVN+ G ANALIQHEW PKS  T+SGEVD KA+DKSAK G
Sbjct  210  VNTITVGTQHSIDPLTMVKARVNSAGIANALIQHEWSPKSFFTVSGEVDTKAIDKSAKVG  269

Query  200  LALALKP  180
            LAL+LKP
Sbjct  270  LALSLKP  276



>ref|XP_007139603.1| hypothetical protein PHAVU_008G043800g [Phaseolus vulgaris]
 gb|ESW11597.1| hypothetical protein PHAVU_008G043800g [Phaseolus vulgaris]
Length=276

 Score =   299 bits (766),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 143/181 (79%), Positives = 160/181 (88%), Gaps = 0/181 (0%)
 Frame = -2

Query  722  FRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAF  543
            F+VPDQRSGKVELQYLHD+AGISTSVGLTANPIVNFSGVVGTN LALG D+SFDTK G  
Sbjct  96   FKVPDQRSGKVELQYLHDYAGISTSVGLTANPIVNFSGVVGTNILALGADLSFDTKIGEL  155

Query  542  TKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITV  363
            TK NAGLSFT  DLIASLTLNDKGD+L+A+YYH VNPL+NTAVGAEV H FS+N NT+ +
Sbjct  156  TKSNAGLSFTKDDLIASLTLNDKGDALNAAYYHVVNPLTNTAVGAEVTHRFSTNENTLIL  215

Query  362  GTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALK  183
            GTQH LDPLTT+KARV NFG+ +ALIQHEWRPKS  T+SGEVD KA++KSAK GL+L LK
Sbjct  216  GTQHALDPLTTLKARVTNFGKTSALIQHEWRPKSFFTISGEVDTKAIEKSAKVGLSLVLK  275

Query  182  P  180
            P
Sbjct  276  P  276



>gb|EPS57816.1| hypothetical protein M569_17001 [Genlisea aurea]
Length=276

 Score =   299 bits (766),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 143/182 (79%), Positives = 166/182 (91%), Gaps = 0/182 (0%)
 Frame = -2

Query  725  SFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGA  546
            SF+VPDQRSGK+ELQYLHD+AGIS+SVGLTANPIVNFSGV+G NA ALG+D+SFDTK G 
Sbjct  95   SFKVPDQRSGKLELQYLHDYAGISSSVGLTANPIVNFSGVLGNNAFALGSDLSFDTKEGN  154

Query  545  FTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTIT  366
             TK+N G S++N+DLIA+L LNDKGD+LSASYYH V+P++NTAVG EV HSFSSN NTIT
Sbjct  155  VTKWNFGASYSNADLIAALALNDKGDTLSASYYHLVSPVTNTAVGGEVTHSFSSNENTIT  214

Query  365  VGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALAL  186
            VGTQH LDPLT+VKAR+NN G+A+ALIQHEWRPKSL+TLS EVD ++VDKSAKFGLALAL
Sbjct  215  VGTQHLLDPLTSVKARINNSGKASALIQHEWRPKSLLTLSTEVDTRSVDKSAKFGLALAL  274

Query  185  KP  180
            KP
Sbjct  275  KP  276



>gb|KJB30018.1| hypothetical protein B456_005G139100 [Gossypium raimondii]
 gb|KJB30019.1| hypothetical protein B456_005G139100 [Gossypium raimondii]
Length=276

 Score =   299 bits (765),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 142/182 (78%), Positives = 166/182 (91%), Gaps = 0/182 (0%)
 Frame = -2

Query  725  SFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGA  546
            SF VPDQRSGKVELQY H++AGISTS+GL ANP+VNFSGVVG N +++GTD+SFDT SG 
Sbjct  95   SFIVPDQRSGKVELQYQHEYAGISTSIGLNANPLVNFSGVVGNNCVSVGTDLSFDTGSGN  154

Query  545  FTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTIT  366
            FTK NAGL+FT+SDLIASLTLNDKGD+L+ASYYH V+PL+NTAVGAE+ HSFSSN NT+T
Sbjct  155  FTKLNAGLNFTHSDLIASLTLNDKGDTLNASYYHIVSPLTNTAVGAELTHSFSSNENTLT  214

Query  365  VGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALAL  186
            +GTQH LDPLTTVKAR+NN+GRA+ LIQHEWRPKSL T+SGEVD +A++KSAK GLALAL
Sbjct  215  IGTQHALDPLTTVKARLNNYGRASGLIQHEWRPKSLFTISGEVDTRAIEKSAKVGLALAL  274

Query  185  KP  180
            KP
Sbjct  275  KP  276



>gb|KJB30017.1| hypothetical protein B456_005G139100 [Gossypium raimondii]
Length=255

 Score =   298 bits (763),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 142/182 (78%), Positives = 166/182 (91%), Gaps = 0/182 (0%)
 Frame = -2

Query  725  SFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGA  546
            SF VPDQRSGKVELQY H++AGISTS+GL ANP+VNFSGVVG N +++GTD+SFDT SG 
Sbjct  74   SFIVPDQRSGKVELQYQHEYAGISTSIGLNANPLVNFSGVVGNNCVSVGTDLSFDTGSGN  133

Query  545  FTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTIT  366
            FTK NAGL+FT+SDLIASLTLNDKGD+L+ASYYH V+PL+NTAVGAE+ HSFSSN NT+T
Sbjct  134  FTKLNAGLNFTHSDLIASLTLNDKGDTLNASYYHIVSPLTNTAVGAELTHSFSSNENTLT  193

Query  365  VGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALAL  186
            +GTQH LDPLTTVKAR+NN+GRA+ LIQHEWRPKSL T+SGEVD +A++KSAK GLALAL
Sbjct  194  IGTQHALDPLTTVKARLNNYGRASGLIQHEWRPKSLFTISGEVDTRAIEKSAKVGLALAL  253

Query  185  KP  180
            KP
Sbjct  254  KP  255



>ref|XP_011010796.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa 
[Populus euphratica]
Length=276

 Score =   298 bits (764),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 140/182 (77%), Positives = 168/182 (92%), Gaps = 0/182 (0%)
 Frame = -2

Query  725  SFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGA  546
            SF+VPDQRSGKVELQY H++AGISTS+GLTANPIVNFSGVVG+N +ALGTD+SFDT +G 
Sbjct  95   SFKVPDQRSGKVELQYQHEYAGISTSLGLTANPIVNFSGVVGSNVVALGTDLSFDTATGN  154

Query  545  FTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTIT  366
            FTK NAGLS+TNSDLIASLT+NDKGD+LSASYYH V+PL++TAVGAE+ HSFS+N N +T
Sbjct  155  FTKCNAGLSYTNSDLIASLTVNDKGDTLSASYYHTVSPLTSTAVGAELTHSFSNNENILT  214

Query  365  VGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALAL  186
            +GTQH LDPLTTVKAR+NN+G+ +ALIQ+EWRPK+L T+SGEVD KA++KSAK GLAL+L
Sbjct  215  IGTQHALDPLTTVKARLNNYGKGSALIQNEWRPKALFTISGEVDTKAIEKSAKVGLALSL  274

Query  185  KP  180
            KP
Sbjct  275  KP  276



>gb|KHG13762.1| Mitochondrial outer membrane porin of 36 kDa [Gossypium arboreum]
Length=276

 Score =   298 bits (764),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 141/182 (77%), Positives = 166/182 (91%), Gaps = 0/182 (0%)
 Frame = -2

Query  725  SFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGA  546
            SF VPDQRSGKVELQY H++AGISTS+GL ANP+VNFSGVVG N +++GTD+SFDT SG 
Sbjct  95   SFIVPDQRSGKVELQYQHEYAGISTSIGLNANPLVNFSGVVGNNCVSVGTDLSFDTASGN  154

Query  545  FTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTIT  366
            FTK NAGL+FT+SDLIASLTLNDKGD+L+ASYYH V+PL+NTAVGAE+ HSFSSN NT+T
Sbjct  155  FTKLNAGLNFTHSDLIASLTLNDKGDTLNASYYHIVSPLTNTAVGAELTHSFSSNENTLT  214

Query  365  VGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALAL  186
            +GTQH LDPLTTV+ R+NN+GRA+ALIQHEWRPKSL T+SGEVD +A++KSAK GLALAL
Sbjct  215  IGTQHALDPLTTVRTRLNNYGRASALIQHEWRPKSLFTISGEVDTRAIEKSAKVGLALAL  274

Query  185  KP  180
            KP
Sbjct  275  KP  276



>ref|XP_008221678.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa 
[Prunus mume]
Length=276

 Score =   298 bits (764),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 141/182 (77%), Positives = 166/182 (91%), Gaps = 0/182 (0%)
 Frame = -2

Query  725  SFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGA  546
            SF VPDQRSGKVELQY H++AGISTS+GLTANPIVNFSGVVG N L+LGTD+SFDT SG 
Sbjct  95   SFIVPDQRSGKVELQYQHEYAGISTSIGLTANPIVNFSGVVGNNLLSLGTDLSFDTASGN  154

Query  545  FTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTIT  366
            FTK+NAGL+FT++DLIASL LNDK D+++ASYYH V+PL+NTAVGAE++HSFSSN N++T
Sbjct  155  FTKWNAGLNFTHTDLIASLILNDKADTVTASYYHTVSPLTNTAVGAELSHSFSSNENSLT  214

Query  365  VGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALAL  186
            +GTQH LDPLTTVK RVNN+GRA+ALIQHEWRPKS  T+SGEVD +A++KSAK GLALAL
Sbjct  215  IGTQHALDPLTTVKGRVNNYGRASALIQHEWRPKSFFTISGEVDTRAIEKSAKIGLALAL  274

Query  185  KP  180
            KP
Sbjct  275  KP  276



>gb|KFK37589.1| hypothetical protein AALP_AA3G002700 [Arabis alpina]
Length=276

 Score =   298 bits (764),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 144/187 (77%), Positives = 162/187 (87%), Gaps = 0/187 (0%)
 Frame = -2

Query  740  LENHSSFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFD  561
            L++  SF+VPDQ SGK+ELQYLHD+AGISTS+GLT NP VNFSGV+GTNALA+GTDVSFD
Sbjct  90   LKSIFSFKVPDQNSGKIELQYLHDYAGISTSMGLTQNPTVNFSGVIGTNALAIGTDVSFD  149

Query  560  TKSGAFTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSN  381
            TKSG FTK N GLSF   DLIASLTLN+KGD L+ASYYHHVNPL NTAVGAEV+H FSS 
Sbjct  150  TKSGNFTKINGGLSFIKEDLIASLTLNEKGDLLNASYYHHVNPLFNTAVGAEVSHKFSSK  209

Query  380  VNTITVGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFG  201
             NTITVGTQH LDPLT+VKARVN+ G A+ALIQHEW+PKS  T+ GEVD KA+DKSAK G
Sbjct  210  DNTITVGTQHSLDPLTSVKARVNSVGIASALIQHEWKPKSFFTICGEVDTKAIDKSAKVG  269

Query  200  LALALKP  180
             A+ALKP
Sbjct  270  FAIALKP  276



>ref|XP_009147408.1| PREDICTED: mitochondrial outer membrane protein porin 1-like 
[Brassica rapa]
Length=276

 Score =   298 bits (764),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 145/182 (80%), Positives = 160/182 (88%), Gaps = 0/182 (0%)
 Frame = -2

Query  725  SFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGA  546
            SFR PDQ SGK+ELQYLH++AGISTS+GLT NP VNFS V+GTN LA GTDVSFDTKSG 
Sbjct  95   SFRAPDQNSGKIELQYLHEYAGISTSMGLTQNPTVNFSAVMGTNVLAAGTDVSFDTKSGN  154

Query  545  FTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTIT  366
            FTK NAGLSFT  DLIASLTLNDKGDS++ASYYH VNPL NTAVGAEVNH FS+NVNTIT
Sbjct  155  FTKINAGLSFTKDDLIASLTLNDKGDSVNASYYHIVNPLFNTAVGAEVNHKFSTNVNTIT  214

Query  365  VGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALAL  186
            VGTQH LDPLTTVKARVN+ G ANALIQH+W P+S  T+SGEVD KA+DK+AK GLAL+L
Sbjct  215  VGTQHSLDPLTTVKARVNSAGIANALIQHQWTPRSFFTISGEVDTKAIDKNAKVGLALSL  274

Query  185  KP  180
            KP
Sbjct  275  KP  276



>gb|KGN47800.1| hypothetical protein Csa_6G404150 [Cucumis sativus]
Length=342

 Score =   300 bits (769),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 142/182 (78%), Positives = 167/182 (92%), Gaps = 0/182 (0%)
 Frame = -2

Query  725  SFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGA  546
            SFRVPDQRSGKVELQY H++AGIST +GLTA+PIVNF+GV+G + L+LGTD+SFDT SG 
Sbjct  161  SFRVPDQRSGKVELQYQHEYAGISTGIGLTASPIVNFAGVIGNDKLSLGTDLSFDTASGN  220

Query  545  FTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTIT  366
             TK NAGLS+T+SDLIA+LTLNDKGD+L+ASYYH V+PLSNTAVGAE++HSFSSN NT+T
Sbjct  221  ITKLNAGLSYTHSDLIAALTLNDKGDALTASYYHLVSPLSNTAVGAELSHSFSSNENTLT  280

Query  365  VGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALAL  186
            +GTQH LDPLT+VKARVNN+GRA+ALIQHEWRPKSL T+SGEVD +A+DKSAK GLAL L
Sbjct  281  IGTQHALDPLTSVKARVNNYGRASALIQHEWRPKSLFTISGEVDTRAIDKSAKIGLALVL  340

Query  185  KP  180
            KP
Sbjct  341  KP  342



>ref|XP_010256458.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa-like 
[Nelumbo nucifera]
Length=276

 Score =   298 bits (762),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 140/182 (77%), Positives = 167/182 (92%), Gaps = 0/182 (0%)
 Frame = -2

Query  725  SFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGA  546
            SF+VPDQRSGK ELQYLHD+AGIS S+GLTANPIVNFSGVVGT+A ++GTD+SFDT SG 
Sbjct  95   SFKVPDQRSGKAELQYLHDYAGISASIGLTANPIVNFSGVVGTSAASVGTDLSFDTASGN  154

Query  545  FTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTIT  366
            FTK+NAG S +N+DLIASLTLNDKGD+L+ASYYH V+PL++TAVGAE+  +FSSN NT+T
Sbjct  155  FTKFNAGASLSNADLIASLTLNDKGDTLTASYYHIVSPLTHTAVGAELTRTFSSNDNTLT  214

Query  365  VGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALAL  186
             GTQH LDPLTTVKAR+NN+G+A+ALIQHEWRPKSL+T+SGEVD +A++KSAK GLALAL
Sbjct  215  FGTQHALDPLTTVKARLNNYGKASALIQHEWRPKSLLTISGEVDTRAIEKSAKVGLALAL  274

Query  185  KP  180
            KP
Sbjct  275  KP  276



>ref|XP_009797869.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa-like 
[Nicotiana sylvestris]
Length=276

 Score =   298 bits (762),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 141/182 (77%), Positives = 164/182 (90%), Gaps = 0/182 (0%)
 Frame = -2

Query  725  SFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGA  546
            SF VPDQ+SGKVELQYLH++AGISTS+GL A+P+VNFSGV G N +ALGTD+SFDT SG 
Sbjct  95   SFVVPDQKSGKVELQYLHEYAGISTSIGLAASPLVNFSGVAGNNKIALGTDLSFDTSSGN  154

Query  545  FTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTIT  366
            FTK NAGL+FT SDLIASL LNDKGD+LSASYYH VNPL+NTAVGAE+ HSFSSN NT+T
Sbjct  155  FTKCNAGLNFTTSDLIASLALNDKGDTLSASYYHTVNPLTNTAVGAELTHSFSSNENTMT  214

Query  365  VGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALAL  186
            +GT H LDPLTTVKARVN++G+A+ALIQHEWRPKSL T+SGEVD +A++KSAK GLA+AL
Sbjct  215  IGTHHSLDPLTTVKARVNSYGKASALIQHEWRPKSLFTISGEVDTRAIEKSAKVGLAVAL  274

Query  185  KP  180
            KP
Sbjct  275  KP  276



>ref|XP_010242364.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa 
[Nelumbo nucifera]
Length=276

 Score =   298 bits (762),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 140/187 (75%), Positives = 166/187 (89%), Gaps = 0/187 (0%)
 Frame = -2

Query  740  LENHSSFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFD  561
            L+   SF VPDQ+SGK ELQYLHDHAGISTS+GLTA+PIVNFSGVVGT+A ++GTD+SFD
Sbjct  90   LKTIVSFVVPDQKSGKAELQYLHDHAGISTSIGLTASPIVNFSGVVGTSAASIGTDLSFD  149

Query  560  TKSGAFTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSN  381
            T +G F KYNAGLSF+N+DLIASLTLNDKGD L+ASYYH V+PL+NTAVGAE+   FSS 
Sbjct  150  TSTGKFVKYNAGLSFSNADLIASLTLNDKGDKLTASYYHTVSPLTNTAVGAEMTRIFSSK  209

Query  380  VNTITVGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFG  201
             NT+T+GTQH LDPLT VKAR+N++G+A+ALIQHEWRPKSL T+SGEVD +A++KSAK G
Sbjct  210  ENTLTIGTQHALDPLTMVKARLNSYGKASALIQHEWRPKSLFTISGEVDTRAIEKSAKVG  269

Query  200  LALALKP  180
            LALALKP
Sbjct  270  LALALKP  276



>ref|XP_009772199.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa 
[Nicotiana sylvestris]
 dbj|BAF95071.1| voltage-dependent anion channel [Nicotiana tabacum]
Length=276

 Score =   297 bits (761),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 141/187 (75%), Positives = 166/187 (89%), Gaps = 0/187 (0%)
 Frame = -2

Query  740  LENHSSFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFD  561
            L+   SF +PDQRSGKVELQYLH++AGIST +GLTA+P+VNFSGV G N +ALGTD+SFD
Sbjct  90   LKTIVSFVLPDQRSGKVELQYLHEYAGISTGIGLTASPLVNFSGVAGNNTVALGTDLSFD  149

Query  560  TKSGAFTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSN  381
            T SG FTK NAGLSF+ SDLIASL LNDKGD+LSASYYH V P++NTAVGAE+ HSFSSN
Sbjct  150  TASGNFTKCNAGLSFSTSDLIASLALNDKGDTLSASYYHTVKPVTNTAVGAELTHSFSSN  209

Query  380  VNTITVGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFG  201
             NT+T+GTQH LDPLTTVKARVN++G+A+ALIQHEWRPKSL T+SGEVD +A++KSAK G
Sbjct  210  ENTLTIGTQHLLDPLTTVKARVNSYGKASALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  269

Query  200  LALALKP  180
            LA+ALKP
Sbjct  270  LAVALKP  276



>gb|AAD38145.1|AF139498_1 porin [Prunus armeniaca]
Length=276

 Score =   297 bits (761),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 141/182 (77%), Positives = 165/182 (91%), Gaps = 0/182 (0%)
 Frame = -2

Query  725  SFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGA  546
            SF VPDQRSGKVELQY H++AGISTS+GLTANPIVNFSGVVG N L+LGTD+SFDT SG 
Sbjct  95   SFIVPDQRSGKVELQYQHEYAGISTSIGLTANPIVNFSGVVGNNLLSLGTDLSFDTASGN  154

Query  545  FTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTIT  366
            FTK NAGL+FT++DLIASL LNDK D+++ASYYH V+PL+NTAVGAE++HSFSSN N++T
Sbjct  155  FTKCNAGLNFTHTDLIASLILNDKADTVTASYYHTVSPLTNTAVGAELSHSFSSNENSLT  214

Query  365  VGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALAL  186
            +GTQH LDPLTTVK RVNN+GRA+ALIQHEWRPKS  T+SGEVD +A++KSAK GLALAL
Sbjct  215  IGTQHALDPLTTVKGRVNNYGRASALIQHEWRPKSFFTISGEVDTRAIEKSAKIGLALAL  274

Query  185  KP  180
            KP
Sbjct  275  KP  276



>ref|XP_002276636.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa 
[Vitis vinifera]
Length=276

 Score =   297 bits (760),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 140/182 (77%), Positives = 164/182 (90%), Gaps = 0/182 (0%)
 Frame = -2

Query  725  SFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGA  546
            SF +PDQRSGKVELQYLH++AGISTS+GLTANPIVNFSGVVG N L+LGTD+SFDT +G 
Sbjct  95   SFIIPDQRSGKVELQYLHEYAGISTSIGLTANPIVNFSGVVGNNTLSLGTDLSFDTATGN  154

Query  545  FTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTIT  366
            FTK NAGL F+N+DLIA+LTLNDKGD+L+ASYYH V+PL+NTAVGAE++H FS+N NT+T
Sbjct  155  FTKCNAGLGFSNADLIAALTLNDKGDTLNASYYHTVSPLTNTAVGAELSHCFSTNENTLT  214

Query  365  VGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALAL  186
            +GTQH LDPLT VKAR NN G+ +ALIQHEWRPKSL T+SGEVD +AV+KSAK GLALAL
Sbjct  215  IGTQHALDPLTKVKARANNSGKVSALIQHEWRPKSLFTISGEVDARAVEKSAKIGLALAL  274

Query  185  KP  180
            KP
Sbjct  275  KP  276



>emb|CDY68122.1| BnaA05g37480D [Brassica napus]
Length=276

 Score =   296 bits (759),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 144/182 (79%), Positives = 159/182 (87%), Gaps = 0/182 (0%)
 Frame = -2

Query  725  SFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGA  546
            SFR PDQ SGK+ELQYLH++AGISTS+GLT NP VNFS V+GTN LA GTDVSFDTKSG 
Sbjct  95   SFRAPDQNSGKIELQYLHEYAGISTSMGLTQNPTVNFSAVMGTNVLAAGTDVSFDTKSGN  154

Query  545  FTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTIT  366
            FTK NAGLSFT  DL+ASLTLNDKGDS++ASYYH VNPL NTAVGAEVNH FS+NVNTIT
Sbjct  155  FTKINAGLSFTKDDLVASLTLNDKGDSVNASYYHIVNPLFNTAVGAEVNHKFSTNVNTIT  214

Query  365  VGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALAL  186
            VGTQH LDPLTTVKARVN+ G ANALIQH+W P S  T+SGEVD KA+DK+AK GLAL+L
Sbjct  215  VGTQHSLDPLTTVKARVNSAGIANALIQHQWTPSSFFTISGEVDTKAIDKNAKVGLALSL  274

Query  185  KP  180
            KP
Sbjct  275  KP  276



>ref|XP_002884286.1| hypothetical protein ARALYDRAFT_477400 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60545.1| hypothetical protein ARALYDRAFT_477400 [Arabidopsis lyrata subsp. 
lyrata]
Length=276

 Score =   296 bits (758),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 145/187 (78%), Positives = 164/187 (88%), Gaps = 0/187 (0%)
 Frame = -2

Query  740  LENHSSFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFD  561
            L++  SF+VPDQ SGK+ELQYLHD+AGISTS+GLT NP VNFSGV+GTN LA+GTDVSFD
Sbjct  90   LKSIFSFKVPDQNSGKIELQYLHDYAGISTSMGLTQNPTVNFSGVIGTNVLAVGTDVSFD  149

Query  560  TKSGAFTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSN  381
            TKSG FTK NAGLSFT  DLIASLT+N+KGD L+ASYYH VNPL NTAVGAEV+H FSS 
Sbjct  150  TKSGNFTKINAGLSFTKDDLIASLTVNEKGDLLNASYYHIVNPLFNTAVGAEVSHKFSSK  209

Query  380  VNTITVGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFG  201
             NTITVGTQH LDPLT+VKARVN+ G A+ALIQHEW+PKS  T+SGEVD K++DKSAK G
Sbjct  210  DNTITVGTQHSLDPLTSVKARVNSAGIASALIQHEWKPKSFFTISGEVDTKSIDKSAKVG  269

Query  200  LALALKP  180
            LALALKP
Sbjct  270  LALALKP  276



>ref|XP_008339931.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa 
[Malus domestica]
Length=276

 Score =   296 bits (757),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 141/182 (77%), Positives = 164/182 (90%), Gaps = 0/182 (0%)
 Frame = -2

Query  725  SFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGA  546
            SF  PDQRSGKVELQY H++AGISTS+GLTANPIVNFSGVVG N L+LGTD+SFDT SG 
Sbjct  95   SFIAPDQRSGKVELQYQHEYAGISTSIGLTANPIVNFSGVVGNNLLSLGTDLSFDTASGN  154

Query  545  FTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTIT  366
            FTK NAGL+FT+SDLIASL LNDK D+++ASYYH V+PL+NTAVGAE++HSFSSN N++T
Sbjct  155  FTKVNAGLNFTHSDLIASLLLNDKADTITASYYHTVSPLTNTAVGAELSHSFSSNENSLT  214

Query  365  VGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALAL  186
            +GT H LDPLTTVKARVNN+GRA+ALIQHEWRPKS  T+SGEVD +A++KSAK GLALAL
Sbjct  215  IGTAHALDPLTTVKARVNNYGRASALIQHEWRPKSFFTISGEVDTRAIEKSAKIGLALAL  274

Query  185  KP  180
            KP
Sbjct  275  KP  276



>ref|XP_004228386.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa 
[Solanum lycopersicum]
Length=276

 Score =   296 bits (757),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 139/182 (76%), Positives = 166/182 (91%), Gaps = 0/182 (0%)
 Frame = -2

Query  725  SFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGA  546
            SF VPDQ+SGKVELQYLH++AGI+TS+GLTA+P+VNFSGV G N +ALGTDVSFDT +G 
Sbjct  95   SFVVPDQKSGKVELQYLHEYAGINTSIGLTASPLVNFSGVAGNNIVALGTDVSFDTATGN  154

Query  545  FTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTIT  366
            FTK NAGLSF++SDLIASL LNDKGD++SASYYH V P++NTAVGAE+ HSFSSN NT+T
Sbjct  155  FTKCNAGLSFSSSDLIASLALNDKGDTVSASYYHTVKPVTNTAVGAELTHSFSSNENTLT  214

Query  365  VGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALAL  186
            +GTQH LDPLTTVKARVN++G+A+ALIQHEWRPKSL T+SGEVD +A++KSAK GLA+AL
Sbjct  215  IGTQHLLDPLTTVKARVNSYGKASALIQHEWRPKSLFTISGEVDTRAIEKSAKIGLAVAL  274

Query  185  KP  180
            KP
Sbjct  275  KP  276



>ref|XP_006408480.1| hypothetical protein EUTSA_v10021076mg [Eutrema salsugineum]
 gb|ESQ49933.1| hypothetical protein EUTSA_v10021076mg [Eutrema salsugineum]
Length=341

 Score =   298 bits (763),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 145/187 (78%), Positives = 164/187 (88%), Gaps = 0/187 (0%)
 Frame = -2

Query  740  LENHSSFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFD  561
            L++  SF+VPDQ SGK+ELQYLHD+AGISTS+GLT NP VNFSGV+G+N +ALGTDVSFD
Sbjct  155  LKSIFSFKVPDQNSGKIELQYLHDYAGISTSMGLTQNPTVNFSGVIGSNVVALGTDVSFD  214

Query  560  TKSGAFTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSN  381
            TKSG FTK NAGLSFT  DLIASLTLN+KGD+++ SYYH VNPL NTAVGAEV+H FSS 
Sbjct  215  TKSGNFTKINAGLSFTKDDLIASLTLNEKGDAMNLSYYHIVNPLFNTAVGAEVSHKFSSK  274

Query  380  VNTITVGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFG  201
             NTITVGTQH LDPLT+VKARVN+ G A+ALIQHEWRPKS  T+SGEVD KA+DKSAK G
Sbjct  275  DNTITVGTQHSLDPLTSVKARVNSAGIASALIQHEWRPKSFFTISGEVDTKAIDKSAKVG  334

Query  200  LALALKP  180
            LALALKP
Sbjct  335  LALALKP  341



>gb|AAA96275.1| voltage-dependent anion channel protein [Spinacia oleracea]
Length=276

 Score =   295 bits (756),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 141/182 (77%), Positives = 164/182 (90%), Gaps = 0/182 (0%)
 Frame = -2

Query  725  SFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGA  546
            SFRVPDQRSGKVELQYLH++AGISTS+GLTANPIVNFSGV G + LALGTD+SFDT SG 
Sbjct  95   SFRVPDQRSGKVELQYLHEYAGISTSLGLTANPIVNFSGVFGNSTLALGTDLSFDTASGN  154

Query  545  FTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTIT  366
            FTK NAGLSFTN DLIAS+ +NDK D L+ASYYH V+PL+NTAVGAE++HSFSSN NT+ 
Sbjct  155  FTKCNAGLSFTNDDLIASVNVNDKLDILNASYYHIVSPLTNTAVGAELSHSFSSNENTLN  214

Query  365  VGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALAL  186
            +GTQH LDPLT+VKARVNN+G+A+ALIQHEWRPKS++T+SGEVD  A++KSAK GLAL L
Sbjct  215  IGTQHALDPLTSVKARVNNYGKASALIQHEWRPKSIVTISGEVDTSAIEKSAKLGLALVL  274

Query  185  KP  180
            KP
Sbjct  275  KP  276



>gb|AID59897.1| voltage-dependent anion channel protein [Prunus persica]
Length=276

 Score =   295 bits (755),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 139/182 (76%), Positives = 165/182 (91%), Gaps = 0/182 (0%)
 Frame = -2

Query  725  SFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGA  546
            SF VPDQRSGKVELQY H++AGIST +GLTANPIVNFSGVVG N L+LGTD+SFDT SG 
Sbjct  95   SFIVPDQRSGKVELQYQHEYAGISTGIGLTANPIVNFSGVVGNNLLSLGTDLSFDTASGN  154

Query  545  FTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTIT  366
            FTK+NAGL+FT++DLIASL LNDK D+++ASYYH V+PL+NTAVGAE++HSFSSN N++T
Sbjct  155  FTKWNAGLNFTHTDLIASLILNDKADTVTASYYHTVSPLTNTAVGAELSHSFSSNENSLT  214

Query  365  VGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALAL  186
            +GT+H LDPLTTVK RVNN+GRA+ALIQHEWRPKS  T+SGEVD +A++KSAK GLALAL
Sbjct  215  IGTRHALDPLTTVKGRVNNYGRASALIQHEWRPKSFFTISGEVDTRAIEKSAKIGLALAL  274

Query  185  KP  180
            KP
Sbjct  275  KP  276



>ref|NP_001275134.1| mitochondrial outer membrane protein porin of 36 kDa [Solanum 
tuberosum]
 sp|P42056.2|VDAC2_SOLTU RecName: Full=Mitochondrial outer membrane protein porin of 36 
kDa; AltName: Full=POM 36; AltName: Full=Voltage-dependent 
anion-selective channel protein; Short=VDAC [Solanum tuberosum]
 emb|CAA56600.1| 36kDA porin II [Solanum tuberosum]
Length=276

 Score =   295 bits (755),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 138/182 (76%), Positives = 166/182 (91%), Gaps = 0/182 (0%)
 Frame = -2

Query  725  SFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGA  546
            SF VPDQ+SGKVELQYLH++AGI+TS+GLTA+P+VNFSGV G N +ALGTD+SFDT +G 
Sbjct  95   SFVVPDQKSGKVELQYLHEYAGINTSIGLTASPLVNFSGVAGNNTVALGTDLSFDTATGN  154

Query  545  FTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTIT  366
            FTK NAGLSF++SDLIASL LNDKGD++SASYYH V P++NTAVGAE+ HSFSSN NT+T
Sbjct  155  FTKCNAGLSFSSSDLIASLALNDKGDTVSASYYHTVKPVTNTAVGAELTHSFSSNENTLT  214

Query  365  VGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALAL  186
            +GTQH LDPLTTVKARVN++G+A+ALIQHEWRPKSL T+SGEVD +A++KSAK GLA+AL
Sbjct  215  IGTQHLLDPLTTVKARVNSYGKASALIQHEWRPKSLFTISGEVDTRAIEKSAKIGLAVAL  274

Query  185  KP  180
            KP
Sbjct  275  KP  276



>emb|CAA56601.1| 36kDa porin I [Solanum tuberosum]
Length=276

 Score =   295 bits (755),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 138/182 (76%), Positives = 166/182 (91%), Gaps = 0/182 (0%)
 Frame = -2

Query  725  SFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGA  546
            SF VPDQ+SGKVELQYLH++AGI+TS+GLTA+P+VNFSGV G N +ALGTD+SFDT +G 
Sbjct  95   SFVVPDQKSGKVELQYLHEYAGINTSIGLTASPLVNFSGVAGNNTVALGTDLSFDTATGN  154

Query  545  FTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTIT  366
            FTK NAGLSF++SDLIASL LNDKGD++SASYYH V P++NTAVGAE+ HSFSSN NT+T
Sbjct  155  FTKCNAGLSFSSSDLIASLALNDKGDTVSASYYHTVKPVTNTAVGAELTHSFSSNENTLT  214

Query  365  VGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALAL  186
            +GTQH LDPLTTVKARVN++G+A+ALIQHEWRPKSL T+SGEVD +A++KSAK GLA+AL
Sbjct  215  IGTQHLLDPLTTVKARVNSYGKASALIQHEWRPKSLFTISGEVDTRAIEKSAKIGLAVAL  274

Query  185  KP  180
            KP
Sbjct  275  KP  276



>gb|EYU34669.1| hypothetical protein MIMGU_mgv1a011608mg [Erythranthe guttata]
Length=276

 Score =   294 bits (753),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 141/182 (77%), Positives = 162/182 (89%), Gaps = 0/182 (0%)
 Frame = -2

Query  725  SFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGA  546
            SF+ PDQRSGK+ELQYLHD+AG+S+S+GLTANP+VNF+GV+G N LALG+DVSFDTK GA
Sbjct  95   SFKAPDQRSGKLELQYLHDYAGLSSSIGLTANPVVNFAGVLGNNKLALGSDVSFDTKEGA  154

Query  545  FTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTIT  366
            F KYN G SFTN+DLIA++TLN+K DS+SASYYH V+PL+NTAVG E  HSFSS+ NTIT
Sbjct  155  FLKYNFGASFTNADLIAAVTLNNKFDSVSASYYHTVSPLTNTAVGGEFTHSFSSSENTIT  214

Query  365  VGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALAL  186
            VGTQH LDPLT VKARVNN G+ +ALIQHEWRPKSLIT+S EVD KA DKSAKFGLALAL
Sbjct  215  VGTQHSLDPLTNVKARVNNAGKVSALIQHEWRPKSLITVSTEVDAKAFDKSAKFGLALAL  274

Query  185  KP  180
            KP
Sbjct  275  KP  276



>ref|XP_007222361.1| hypothetical protein PRUPE_ppa008111mg [Prunus persica]
 gb|EMJ23560.1| hypothetical protein PRUPE_ppa008111mg [Prunus persica]
Length=344

 Score =   296 bits (758),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 140/182 (77%), Positives = 165/182 (91%), Gaps = 0/182 (0%)
 Frame = -2

Query  725  SFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGA  546
            SF VPDQRSGKVELQY H++AGIST +GLTANPIVNFSGVVG N L+LGTD+SFDT SG 
Sbjct  163  SFIVPDQRSGKVELQYQHEYAGISTGIGLTANPIVNFSGVVGNNLLSLGTDLSFDTASGN  222

Query  545  FTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTIT  366
            FTK+NAGL+FT++DLIASL LNDK D+++ASYYH V+PL+NTAVGAE++HSFSSN N++T
Sbjct  223  FTKWNAGLNFTHTDLIASLILNDKADTVTASYYHTVSPLTNTAVGAELSHSFSSNENSLT  282

Query  365  VGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALAL  186
            +GTQH LDPLTTVK RVNN+GRA+ALIQHEWRPKS  T+SGEVD +A++KSAK GLALAL
Sbjct  283  IGTQHALDPLTTVKGRVNNYGRASALIQHEWRPKSFFTISGEVDTRAIEKSAKIGLALAL  342

Query  185  KP  180
            KP
Sbjct  343  KP  344



>ref|XP_010932447.1| PREDICTED: mitochondrial outer membrane protein porin 1-like 
[Elaeis guineensis]
Length=275

 Score =   293 bits (751),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 139/182 (76%), Positives = 160/182 (88%), Gaps = 0/182 (0%)
 Frame = -2

Query  725  SFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGA  546
            SF VPDQRSGKVELQYLHD+AG++  +GLTANPIVN SGVVGT AL++G DVSFDT SG 
Sbjct  94   SFVVPDQRSGKVELQYLHDYAGVNAGIGLTANPIVNLSGVVGTKALSVGADVSFDTASGN  153

Query  545  FTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTIT  366
            FTKYNAGLS TN+DLIA+LTLN+KGDSLSASYYH VNPLS+TAVGAE+ HSFS N NT+T
Sbjct  154  FTKYNAGLSVTNADLIAALTLNNKGDSLSASYYHLVNPLSSTAVGAEITHSFSGNENTLT  213

Query  365  VGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALAL  186
             GTQH LDPLT VKAR NN+G+A+ALIQHEWRPKS  T+SGEVD KA++KS+K GL+L L
Sbjct  214  FGTQHALDPLTLVKARFNNYGKASALIQHEWRPKSFFTISGEVDTKAIEKSSKVGLSLVL  273

Query  185  KP  180
            +P
Sbjct  274  RP  275



>ref|XP_009627246.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa 
[Nicotiana tomentosiformis]
Length=276

 Score =   293 bits (750),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 139/187 (74%), Positives = 165/187 (88%), Gaps = 0/187 (0%)
 Frame = -2

Query  740  LENHSSFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFD  561
            L+   SF +PDQ+SGKVELQYLH++AGIST +GLTA+P+VNFSGV G N +ALGTD+SF+
Sbjct  90   LKTIVSFVLPDQKSGKVELQYLHEYAGISTGIGLTASPLVNFSGVAGNNTVALGTDLSFN  149

Query  560  TKSGAFTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSN  381
            T SG FTK NAGLSF+ SDLIASL LNDKGD+LSASYYH V P++NTAVGAE+ HSFSSN
Sbjct  150  TASGNFTKCNAGLSFSTSDLIASLALNDKGDTLSASYYHTVKPVTNTAVGAELTHSFSSN  209

Query  380  VNTITVGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFG  201
             NT+T+GTQH LDPLTTVKARVN++G+A ALIQHEWRPKSL T+SGEVD +A++KSAK G
Sbjct  210  ENTLTIGTQHLLDPLTTVKARVNSYGKACALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  269

Query  200  LALALKP  180
            LA+ALKP
Sbjct  270  LAVALKP  276



>ref|XP_008389525.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa-like 
[Malus domestica]
Length=276

 Score =   293 bits (750),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 140/182 (77%), Positives = 164/182 (90%), Gaps = 0/182 (0%)
 Frame = -2

Query  725  SFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGA  546
            SF  PDQRSGKVELQY H++AGISTS+GLTANPIV+FSGVVG N L+LGTD+SFDT SG 
Sbjct  95   SFIAPDQRSGKVELQYQHEYAGISTSIGLTANPIVHFSGVVGNNLLSLGTDLSFDTASGN  154

Query  545  FTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTIT  366
            FTK NAGL+FT+SDLIASL LNDK D+++ASYYH V+PL+NTAVGAE++HSFSSN N++T
Sbjct  155  FTKVNAGLNFTHSDLIASLLLNDKADTITASYYHTVSPLTNTAVGAELSHSFSSNENSLT  214

Query  365  VGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALAL  186
            +GT H LDPLTTVKARVNN+GRA+ALIQHEWRPKS  T+SGEVD +A++KSAK GLALAL
Sbjct  215  IGTAHALDPLTTVKARVNNYGRASALIQHEWRPKSFFTISGEVDTRAIEKSAKVGLALAL  274

Query  185  KP  180
            KP
Sbjct  275  KP  276



>ref|XP_006298184.1| hypothetical protein CARUB_v10014234mg, partial [Capsella rubella]
 gb|EOA31082.1| hypothetical protein CARUB_v10014234mg, partial [Capsella rubella]
Length=267

 Score =   293 bits (749),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 144/187 (77%), Positives = 163/187 (87%), Gaps = 0/187 (0%)
 Frame = -2

Query  740  LENHSSFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFD  561
            L++  SF+ PDQ SGK+ELQYLHD+AGISTS+GLT NP VNFSGV+GTN LA+GTDVSFD
Sbjct  81   LKSIFSFKAPDQNSGKIELQYLHDYAGISTSMGLTQNPTVNFSGVIGTNVLAVGTDVSFD  140

Query  560  TKSGAFTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSN  381
            TKSG FTK NAGLSFT  DLIASLT+N+KGD L+ASYYH VNPL NTAVGAEV+H FSS 
Sbjct  141  TKSGNFTKINAGLSFTKDDLIASLTVNEKGDLLNASYYHIVNPLFNTAVGAEVSHKFSSK  200

Query  380  VNTITVGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFG  201
             NTITVGTQH LDPLT+VKARVN+ G A+ALIQHEWRPKS  T+SGEVD KA+DK+A+ G
Sbjct  201  DNTITVGTQHSLDPLTSVKARVNSAGIASALIQHEWRPKSFFTISGEVDTKAIDKNARVG  260

Query  200  LALALKP  180
            LALALKP
Sbjct  261  LALALKP  267



>emb|CDY59668.1| BnaCnng35410D [Brassica napus]
Length=276

 Score =   293 bits (750),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 143/187 (76%), Positives = 160/187 (86%), Gaps = 0/187 (0%)
 Frame = -2

Query  740  LENHSSFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFD  561
            L+   S +VPDQ+S KVELQYLH HAGI TSVGLTANP+VNFSGV+GT+ LALGTDVSFD
Sbjct  90   LKTIVSAKVPDQKSAKVELQYLHPHAGICTSVGLTANPVVNFSGVIGTSVLALGTDVSFD  149

Query  560  TKSGAFTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSN  381
            T+SG F  +NAG+SFT  DLIASLTLNDKG+ L+ASYYH VNPL NT VGAEV+H+  S 
Sbjct  150  TESGNFKHFNAGVSFTKDDLIASLTLNDKGEKLNASYYHIVNPLKNTVVGAEVSHNLKSQ  209

Query  380  VNTITVGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFG  201
            VN+ITVGTQH LDPLTTVKARVNN G ANALIQHEWRPKS IT+SGEVD KA++KSAK G
Sbjct  210  VNSITVGTQHALDPLTTVKARVNNAGIANALIQHEWRPKSFITISGEVDSKAIEKSAKVG  269

Query  200  LALALKP  180
             ALALKP
Sbjct  270  FALALKP  276



>ref|XP_010925058.1| PREDICTED: mitochondrial outer membrane protein porin 1-like 
[Elaeis guineensis]
Length=275

 Score =   293 bits (750),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 139/182 (76%), Positives = 159/182 (87%), Gaps = 0/182 (0%)
 Frame = -2

Query  725  SFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGA  546
            SF VPDQRSGKVELQYLHD+AG++TS+GLTANPIVN S V GT A A+G DVSFDT SG 
Sbjct  94   SFVVPDQRSGKVELQYLHDYAGVNTSIGLTANPIVNISSVFGTKAFAVGADVSFDTASGN  153

Query  545  FTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTIT  366
            FTKYNAGLS TN+DLIA+LTLN+KGDSLS SYYH V+PLS+TAVGAE+ HSFSSN NT+T
Sbjct  154  FTKYNAGLSVTNADLIAALTLNNKGDSLSGSYYHLVSPLSSTAVGAEITHSFSSNENTLT  213

Query  365  VGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALAL  186
             G QH LDPLTTVKAR NN+G+A+ALIQHEWRPKS  T+SGEVD KA++KS+K GL+L L
Sbjct  214  FGMQHALDPLTTVKARFNNYGKASALIQHEWRPKSFFTISGEVDTKAIEKSSKVGLSLVL  273

Query  185  KP  180
            KP
Sbjct  274  KP  275



>ref|XP_006298185.1| hypothetical protein CARUB_v10014234mg, partial [Capsella rubella]
 gb|EOA31083.1| hypothetical protein CARUB_v10014234mg, partial [Capsella rubella]
Length=309

 Score =   294 bits (752),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 144/187 (77%), Positives = 163/187 (87%), Gaps = 0/187 (0%)
 Frame = -2

Query  740  LENHSSFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFD  561
            L++  SF+ PDQ SGK+ELQYLHD+AGISTS+GLT NP VNFSGV+GTN LA+GTDVSFD
Sbjct  123  LKSIFSFKAPDQNSGKIELQYLHDYAGISTSMGLTQNPTVNFSGVIGTNVLAVGTDVSFD  182

Query  560  TKSGAFTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSN  381
            TKSG FTK NAGLSFT  DLIASLT+N+KGD L+ASYYH VNPL NTAVGAEV+H FSS 
Sbjct  183  TKSGNFTKINAGLSFTKDDLIASLTVNEKGDLLNASYYHIVNPLFNTAVGAEVSHKFSSK  242

Query  380  VNTITVGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFG  201
             NTITVGTQH LDPLT+VKARVN+ G A+ALIQHEWRPKS  T+SGEVD KA+DK+A+ G
Sbjct  243  DNTITVGTQHSLDPLTSVKARVNSAGIASALIQHEWRPKSFFTISGEVDTKAIDKNARVG  302

Query  200  LALALKP  180
            LALALKP
Sbjct  303  LALALKP  309



>emb|CDX91952.1| BnaC03g32540D [Brassica napus]
Length=276

 Score =   293 bits (749),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 143/182 (79%), Positives = 158/182 (87%), Gaps = 0/182 (0%)
 Frame = -2

Query  725  SFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGA  546
            SFR PDQ SGK+ELQYLHD+AGISTS+GLT NP VNFSGV+GTN LA GTDVSFDTKSG 
Sbjct  95   SFRAPDQNSGKIELQYLHDYAGISTSMGLTQNPTVNFSGVIGTNVLAAGTDVSFDTKSGN  154

Query  545  FTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTIT  366
            FTK NAG++FT  DLIASLTLNDKGDS++ASYYH VNPL NTAVGAEV+H FSS  NTIT
Sbjct  155  FTKINAGVNFTKDDLIASLTLNDKGDSVNASYYHIVNPLFNTAVGAEVSHKFSSKTNTIT  214

Query  365  VGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALAL  186
            VGTQH LDPLTTVKARVN+ G ANALIQH+W P S  T+SGEVD KA+DK+AK GLAL+L
Sbjct  215  VGTQHSLDPLTTVKARVNSAGIANALIQHQWTPGSFFTISGEVDTKAIDKNAKVGLALSL  274

Query  185  KP  180
            KP
Sbjct  275  KP  276



>ref|XP_009599229.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa-like 
[Nicotiana tomentosiformis]
Length=276

 Score =   292 bits (747),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 138/181 (76%), Positives = 162/181 (90%), Gaps = 0/181 (0%)
 Frame = -2

Query  725  SFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGA  546
            SF VPDQ+SGKVELQYLH++AGISTS+GL A+P+VNFSGV G N +ALGTD+SFDT SG 
Sbjct  95   SFVVPDQKSGKVELQYLHEYAGISTSIGLAASPLVNFSGVAGNNKIALGTDLSFDTSSGN  154

Query  545  FTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTIT  366
            FTK NAGL+FT SDLIASL LNDK D+L+ASYYH VNPL+NTAVGAE+ HSFSSN NT+T
Sbjct  155  FTKCNAGLNFTTSDLIASLALNDKADTLTASYYHTVNPLTNTAVGAELTHSFSSNENTMT  214

Query  365  VGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALAL  186
            +GT H LDPLTTVKARVN++G+A+ALIQHEWRPKSL T+SGEVD +A++KSAK GLA+AL
Sbjct  215  IGTHHSLDPLTTVKARVNSYGKASALIQHEWRPKSLFTISGEVDTRAIEKSAKVGLAVAL  274

Query  185  K  183
            K
Sbjct  275  K  275



>ref|XP_004302356.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa 
[Fragaria vesca subsp. vesca]
Length=276

 Score =   291 bits (746),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 139/182 (76%), Positives = 160/182 (88%), Gaps = 0/182 (0%)
 Frame = -2

Query  725  SFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGA  546
            SF+VPDQ SGK ELQYLHD+AGISTSVGLTANP+VNFSGV+GTN LALGTDVSFDTKSG 
Sbjct  95   SFKVPDQNSGKAELQYLHDYAGISTSVGLTANPVVNFSGVLGTNLLALGTDVSFDTKSGN  154

Query  545  FTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTIT  366
            FTK NAGL+F+N+DL+ASL LN+KGD +S S+YH + P  NTAVGAEV H FS++ NTIT
Sbjct  155  FTKCNAGLNFSNADLMASLNLNEKGDVVSGSFYHSLYPEQNTAVGAEVTHRFSNSENTIT  214

Query  365  VGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALAL  186
            +G QH LDPLT+VKARVNN G+ANALIQHEWRPKS  T+SGEVD +A++KSAK GLALAL
Sbjct  215  LGAQHALDPLTSVKARVNNIGKANALIQHEWRPKSFFTISGEVDTRAIEKSAKIGLALAL  274

Query  185  KP  180
            KP
Sbjct  275  KP  276



>gb|KDP21225.1| hypothetical protein JCGZ_21696 [Jatropha curcas]
Length=276

 Score =   291 bits (746),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 137/182 (75%), Positives = 165/182 (91%), Gaps = 0/182 (0%)
 Frame = -2

Query  725  SFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGA  546
            SF++PDQRSGKV+LQY H+++GIST +GLTANPIVNFSGVVG + +ALGTD+SFDT SG 
Sbjct  95   SFKIPDQRSGKVDLQYQHEYSGISTGIGLTANPIVNFSGVVGNSTIALGTDLSFDTASGN  154

Query  545  FTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTIT  366
            FTK NAGLS+TN+DLIAS+TLNDKGD+L+ASYYH V+PL++TAVGAE+ HSFSSN NT+T
Sbjct  155  FTKLNAGLSYTNADLIASVTLNDKGDTLNASYYHTVSPLTDTAVGAELTHSFSSNENTLT  214

Query  365  VGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALAL  186
            +GT+H LDPLTTVKAR NN+G A+ALIQHEWR KSL T+SGEVD +A++KSAK GLALAL
Sbjct  215  IGTKHALDPLTTVKARANNYGIASALIQHEWRLKSLFTISGEVDTRAIEKSAKIGLALAL  274

Query  185  KP  180
            KP
Sbjct  275  KP  276



>emb|CDX74294.1| BnaA03g27530D [Brassica napus]
Length=276

 Score =   291 bits (746),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 143/187 (76%), Positives = 161/187 (86%), Gaps = 0/187 (0%)
 Frame = -2

Query  740  LENHSSFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFD  561
            L++  SFR PDQ SGK+ELQYLHD+AGISTS+GLT NP VNFSGV+GTN LA GTDVSFD
Sbjct  90   LKSIFSFRAPDQNSGKIELQYLHDYAGISTSMGLTQNPTVNFSGVIGTNVLAAGTDVSFD  149

Query  560  TKSGAFTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSN  381
            TKSG FTK NAG++FT  DLIASLTLNDKGDS++ASYYH VNPL NTAVGAEV+H FSS 
Sbjct  150  TKSGNFTKINAGVNFTKDDLIASLTLNDKGDSVNASYYHIVNPLFNTAVGAEVSHKFSSK  209

Query  380  VNTITVGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFG  201
             NTITVGTQH LDPLTTVKARVN+ G ANALIQH+W P S  T+SGEVD KA+DK+AK G
Sbjct  210  TNTITVGTQHSLDPLTTVKARVNSAGIANALIQHQWTPGSFFTISGEVDTKAIDKNAKVG  269

Query  200  LALALKP  180
            LAL+L+P
Sbjct  270  LALSLRP  276



>gb|AAS48868.1| voltage-dependent anion-selective channel [Brassica rapa subsp. 
pekinensis]
 emb|CDY69321.1| BnaA10g29750D [Brassica napus]
Length=276

 Score =   291 bits (746),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 140/182 (77%), Positives = 157/182 (86%), Gaps = 0/182 (0%)
 Frame = -2

Query  725  SFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGA  546
            S +VPDQ+S KVELQY+H HAGI TSVGLTANP+VNFSGV+GT+ LALGTDVSFDT+SG 
Sbjct  95   SAKVPDQKSAKVELQYMHPHAGICTSVGLTANPVVNFSGVIGTSVLALGTDVSFDTESGN  154

Query  545  FTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTIT  366
            F  +N G+SFT  DLIASLTLNDKG+ L+ASYYH VNPL NT VGAEV+H+  S VN+IT
Sbjct  155  FKHFNTGVSFTKDDLIASLTLNDKGEKLTASYYHIVNPLKNTVVGAEVSHNLKSQVNSIT  214

Query  365  VGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALAL  186
            VGTQH LDPLTTVKARVNN G ANALIQHEWRPKS IT+SGEVD KA++KSAK G ALAL
Sbjct  215  VGTQHALDPLTTVKARVNNAGIANALIQHEWRPKSFITISGEVDSKAIEKSAKVGFALAL  274

Query  185  KP  180
            KP
Sbjct  275  KP  276



>gb|AAW22621.1| outer mitochondrial membrane protein porin 1 [Brassica napus]
Length=276

 Score =   291 bits (746),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 142/182 (78%), Positives = 160/182 (88%), Gaps = 0/182 (0%)
 Frame = -2

Query  725  SFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGA  546
            SFR PDQ SGK+ELQYLH++AGISTS+GLT NP VNFSGVVGTN LALGTDVSFDTKSG 
Sbjct  95   SFRAPDQNSGKIELQYLHEYAGISTSMGLTQNPTVNFSGVVGTNVLALGTDVSFDTKSGN  154

Query  545  FTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTIT  366
            FTK NAG++FT  DLIASLTLNDKGDS++ASYYH VNPL NTAVGAEVNH FS+NVNTIT
Sbjct  155  FTKINAGVNFTKDDLIASLTLNDKGDSVNASYYHIVNPLFNTAVGAEVNHKFSTNVNTIT  214

Query  365  VGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALAL  186
            VGTQ+ LDPLTTVKA VN+ G A +LIQH+W P+S  T+SGEVD KA+DK+AK GLAL+L
Sbjct  215  VGTQNSLDPLTTVKAPVNSAGIAKSLIQHQWTPRSFFTISGEVDTKAIDKNAKVGLALSL  274

Query  185  KP  180
            KP
Sbjct  275  KP  276



>ref|XP_009360395.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa 
[Pyrus x bretschneideri]
Length=276

 Score =   291 bits (745),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 139/182 (76%), Positives = 161/182 (88%), Gaps = 0/182 (0%)
 Frame = -2

Query  725  SFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGA  546
            SF  PDQRSGKVELQY H++AGISTS+GLTANPIVNFSGVVG N L+LGTD+SFDT SG 
Sbjct  95   SFIAPDQRSGKVELQYQHEYAGISTSIGLTANPIVNFSGVVGNNLLSLGTDLSFDTASGN  154

Query  545  FTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTIT  366
            FTK NAGL+F + DLIASL LNDK D+++ASYYH V+PL+NTAVGAE+ HSFSSN N++T
Sbjct  155  FTKVNAGLNFIHCDLIASLLLNDKADTITASYYHTVSPLTNTAVGAELAHSFSSNENSLT  214

Query  365  VGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALAL  186
            +GT H LDPLTTVKARVNN+GRA+ALIQHEWRPKS  T+SGEVD +A++KSAK GLALAL
Sbjct  215  IGTAHALDPLTTVKARVNNYGRASALIQHEWRPKSFFTISGEVDTRAIEKSAKVGLALAL  274

Query  185  KP  180
            KP
Sbjct  275  KP  276



>ref|XP_009134621.1| PREDICTED: mitochondrial outer membrane protein porin 1-like 
[Brassica rapa]
Length=276

 Score =   291 bits (745),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 143/187 (76%), Positives = 161/187 (86%), Gaps = 0/187 (0%)
 Frame = -2

Query  740  LENHSSFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFD  561
            L++  SFR PDQ SGK+ELQYLHD+AGISTS+GLT NP VNFSGV+GTN LA GTDVSFD
Sbjct  90   LKSIFSFRAPDQNSGKIELQYLHDYAGISTSMGLTQNPTVNFSGVIGTNVLAAGTDVSFD  149

Query  560  TKSGAFTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSN  381
            TKSG FTK NAG++FT  DLIASLTLNDKGDS++ASYYH VNPL NTAVGAEV+H FSS 
Sbjct  150  TKSGNFTKINAGVNFTKDDLIASLTLNDKGDSVNASYYHIVNPLFNTAVGAEVSHKFSSK  209

Query  380  VNTITVGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFG  201
             NTITVGTQH LDPLTTVKARVN+ G ANALIQH+W P S  T+SGEVD KA+DK+AK G
Sbjct  210  TNTITVGTQHSLDPLTTVKARVNSAGIANALIQHQWTPGSFFTISGEVDTKAIDKNAKVG  269

Query  200  LALALKP  180
            LAL+L+P
Sbjct  270  LALSLRP  276



>gb|KJB11403.1| hypothetical protein B456_001G256800 [Gossypium raimondii]
Length=275

 Score =   291 bits (745),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 142/181 (78%), Positives = 161/181 (89%), Gaps = 1/181 (1%)
 Frame = -2

Query  722  FRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAF  543
            FRVPDQRSGK+ELQYLH++AGIS+S+GLTANPIVNFSGV+GTN LALGTD+SFDTK+G F
Sbjct  96   FRVPDQRSGKIELQYLHEYAGISSSIGLTANPIVNFSGVLGTNVLALGTDISFDTKTGNF  155

Query  542  TKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITV  363
            TK NAG SFTN+DLIASL L   GDS++ASYYH VN  +NT VGAEV HSFS+NVNTITV
Sbjct  156  TKCNAGFSFTNADLIASLALY-VGDSVNASYYHIVNLSTNTVVGAEVTHSFSTNVNTITV  214

Query  362  GTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALK  183
            GTQH LDP TT+KARVNN G+A+ALIQHEWRPKSL T+SGEVD K++DKS K GLALALK
Sbjct  215  GTQHALDPSTTIKARVNNAGKASALIQHEWRPKSLFTISGEVDTKSIDKSPKVGLALALK  274

Query  182  P  180
            P
Sbjct  275  P  275



>ref|NP_186777.1| voltage dependent anion channel 1 [Arabidopsis thaliana]
 sp|Q9SRH5.3|VDAC1_ARATH RecName: Full=Mitochondrial outer membrane protein porin 1; AltName: 
Full=Voltage-dependent anion-selective channel protein 
1; Short=AtVDAC1; Short=VDAC-1 [Arabidopsis thaliana]
 gb|AAF03498.1|AC010676_8 putative porin [Arabidopsis thaliana]
 gb|AAK59817.1| AT3g01280/T22N4_9 [Arabidopsis thaliana]
 gb|AAM47472.1| AT3g01280/T22N4_9 [Arabidopsis thaliana]
 gb|AEE73632.1| voltage dependent anion channel 1 [Arabidopsis thaliana]
Length=276

 Score =   291 bits (744),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 142/182 (78%), Positives = 160/182 (88%), Gaps = 0/182 (0%)
 Frame = -2

Query  725  SFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGA  546
            SF+VPDQ SGKVELQYLH++AGISTS+GLT NP VNFSGV+G+N LA+GTDVSFDTKSG 
Sbjct  95   SFKVPDQNSGKVELQYLHEYAGISTSMGLTQNPTVNFSGVIGSNVLAVGTDVSFDTKSGN  154

Query  545  FTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTIT  366
            FTK NAGLSFT  DLIASLT+NDKGD L+ASYYH VNPL NTAVGAEV+H  SS  +TIT
Sbjct  155  FTKINAGLSFTKEDLIASLTVNDKGDLLNASYYHIVNPLFNTAVGAEVSHKLSSKDSTIT  214

Query  365  VGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALAL  186
            VGTQH LDPLT+VKARVN+ G A+ALIQHEW+PKS  T+SGEVD K++DKSAK GLALAL
Sbjct  215  VGTQHSLDPLTSVKARVNSAGIASALIQHEWKPKSFFTISGEVDTKSIDKSAKVGLALAL  274

Query  185  KP  180
            KP
Sbjct  275  KP  276



>ref|NP_001288856.1| mitochondrial outer membrane protein porin 3-like [Brassica rapa]
 gb|AAS21632.1| voltage-dependent anion-selective channel protein [Brassica rapa]
Length=276

 Score =   291 bits (744),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 140/182 (77%), Positives = 157/182 (86%), Gaps = 0/182 (0%)
 Frame = -2

Query  725  SFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGA  546
            S +VPDQ+S KVELQY+H HAGI TSVGLTANP+VNFSGV+GT+ LALGTDVSFDT+SG 
Sbjct  95   SAKVPDQKSAKVELQYMHPHAGICTSVGLTANPVVNFSGVIGTSVLALGTDVSFDTESGN  154

Query  545  FTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTIT  366
            F  +N G+SFT  DLIASLTLNDKG+ L+ASYYH VNPL NT VGAEV+H+  S VN+IT
Sbjct  155  FKHFNTGVSFTKDDLIASLTLNDKGEKLNASYYHIVNPLKNTVVGAEVSHNLKSQVNSIT  214

Query  365  VGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALAL  186
            VGTQH LDPLTTVKARVNN G ANALIQHEWRPKS IT+SGEVD KA++KSAK G ALAL
Sbjct  215  VGTQHALDPLTTVKARVNNAGIANALIQHEWRPKSFITISGEVDSKAIEKSAKVGFALAL  274

Query  185  KP  180
            KP
Sbjct  275  KP  276



>ref|XP_006400027.1| hypothetical protein EUTSA_v10014354mg [Eutrema salsugineum]
 gb|ESQ41480.1| hypothetical protein EUTSA_v10014354mg [Eutrema salsugineum]
Length=276

 Score =   290 bits (743),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 140/182 (77%), Positives = 160/182 (88%), Gaps = 0/182 (0%)
 Frame = -2

Query  725  SFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGA  546
            S ++PDQ+SGKVELQYLHD+AGISTSVGLTANPIVNFSGVVGTN LALG DVSF+T+SG 
Sbjct  95   SAKLPDQKSGKVELQYLHDYAGISTSVGLTANPIVNFSGVVGTNVLALGADVSFNTESGN  154

Query  545  FTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTIT  366
            F  +NAG SFT  DLIASLTLNDKG+ L+ASYYH VNPLSNT VGAEV+H+F++  N IT
Sbjct  155  FKHFNAGFSFTKDDLIASLTLNDKGEKLNASYYHIVNPLSNTVVGAEVSHNFTTKENAIT  214

Query  365  VGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALAL  186
            VGTQH LDPLTTVKARVN+ G ANALIQHEWRPKS +T+SGEVD K+++K+ KFG ALAL
Sbjct  215  VGTQHALDPLTTVKARVNHAGVANALIQHEWRPKSFVTISGEVDSKSIEKNPKFGFALAL  274

Query  185  KP  180
            KP
Sbjct  275  KP  276



>ref|XP_011071026.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa-like 
[Sesamum indicum]
Length=278

 Score =   290 bits (743),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 136/182 (75%), Positives = 162/182 (89%), Gaps = 0/182 (0%)
 Frame = -2

Query  725  SFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGA  546
            SF  PDQ+SGKVELQYLH++AGISTS+GLTA PIVNFSGV G +  A GTD+SFDT +G 
Sbjct  97   SFVAPDQKSGKVELQYLHEYAGISTSLGLTAKPIVNFSGVAGNHKAAFGTDISFDTATGN  156

Query  545  FTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTIT  366
            FTKYNAG+SFT +DLIASL LNDKG +++ASY+H ++PL+NTAVGAE+ HSFSSN NT+T
Sbjct  157  FTKYNAGVSFTTTDLIASLILNDKGQTVTASYFHTISPLTNTAVGAELTHSFSSNENTLT  216

Query  365  VGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALAL  186
            +GTQH LDPLT+VKARVNN GRA+ALIQHEWRPKSLIT+SGEVD +A++KSAK GLA+AL
Sbjct  217  IGTQHSLDPLTSVKARVNNHGRASALIQHEWRPKSLITISGEVDTRAIEKSAKIGLAVAL  276

Query  185  KP  180
            KP
Sbjct  277  KP  278



>gb|AAM65525.1| putative porin [Arabidopsis thaliana]
Length=276

 Score =   290 bits (743),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 141/182 (77%), Positives = 160/182 (88%), Gaps = 0/182 (0%)
 Frame = -2

Query  725  SFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGA  546
            SF+VPDQ SGKVELQYLH++AGISTS+GLT NP VNFSGV+G+N LA+GTDVSFDTKSG 
Sbjct  95   SFKVPDQNSGKVELQYLHEYAGISTSMGLTQNPTVNFSGVIGSNVLAVGTDVSFDTKSGN  154

Query  545  FTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTIT  366
            FTK NAGLSFT  DLIASLT+NDKGD L+ASYYH VNPL NTAVGAEV+H  SS  +TIT
Sbjct  155  FTKINAGLSFTKEDLIASLTVNDKGDLLNASYYHIVNPLFNTAVGAEVSHKLSSKDSTIT  214

Query  365  VGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALAL  186
            VGTQH LDPLT+VKARVN+ G A+ALIQHEW+PKS  T+SGE+D K++DKSAK GLALAL
Sbjct  215  VGTQHSLDPLTSVKARVNSAGIASALIQHEWKPKSFFTISGEIDTKSIDKSAKVGLALAL  274

Query  185  KP  180
            KP
Sbjct  275  KP  276



>gb|KDP45473.1| hypothetical protein JCGZ_09722 [Jatropha curcas]
Length=274

 Score =   290 bits (743),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 136/182 (75%), Positives = 164/182 (90%), Gaps = 2/182 (1%)
 Frame = -2

Query  725  SFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGA  546
            SF+VPDQRSGK+E+QYLHD+A +S+S+GLT NPIVNFSGV+G+NA++LGTD+SFDTKSG 
Sbjct  95   SFKVPDQRSGKLEVQYLHDYAAVSSSIGLTPNPIVNFSGVIGSNAVSLGTDLSFDTKSGN  154

Query  545  FTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTIT  366
            FTK NAGLS++N+DL+A+LTLNDKGDSL ASYYH VNP    AVGAEV+HSFS+N NT+T
Sbjct  155  FTKCNAGLSYSNADLVAALTLNDKGDSLKASYYHIVNPTH--AVGAEVSHSFSTNENTVT  212

Query  365  VGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALAL  186
            VG+QH LDPLTT+KARVNNFG+ +ALIQHEWRPKS  T++GEVD KA++KS K GLALAL
Sbjct  213  VGSQHALDPLTTLKARVNNFGKVSALIQHEWRPKSFFTVTGEVDTKAIEKSTKIGLALAL  272

Query  185  KP  180
            KP
Sbjct  273  KP  274



>ref|XP_007046221.1| Voltage dependent anion channel 1 isoform 1 [Theobroma cacao]
 gb|EOY02053.1| Voltage dependent anion channel 1 isoform 1 [Theobroma cacao]
Length=276

 Score =   290 bits (741),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 138/182 (76%), Positives = 166/182 (91%), Gaps = 0/182 (0%)
 Frame = -2

Query  725  SFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGA  546
            SF VPDQRSGKVELQY H++AGISTS+GLTANP+VNFSGVVG N +++GTD+SFDT SG 
Sbjct  95   SFVVPDQRSGKVELQYQHEYAGISTSIGLTANPLVNFSGVVGNNCVSVGTDLSFDTASGN  154

Query  545  FTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTIT  366
            FTK NAGL+FT+SDLIAS+T+NDK D+L+ASYYH V+PL+NTAVGAE+ HSFSSN NT+T
Sbjct  155  FTKLNAGLNFTHSDLIASVTVNDKCDNLTASYYHIVSPLTNTAVGAELTHSFSSNENTLT  214

Query  365  VGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALAL  186
             GTQ++LDPLTTVKAR NNFGRA+ALIQHE+RPKSL+T+SGEVD +A++KSAK G+AL L
Sbjct  215  FGTQYELDPLTTVKARWNNFGRASALIQHEFRPKSLLTISGEVDTRAIEKSAKVGMALLL  274

Query  185  KP  180
            KP
Sbjct  275  KP  276



>gb|KHG20441.1| Mitochondrial outer membrane porin of 36 kDa [Gossypium arboreum]
Length=276

 Score =   290 bits (741),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 135/182 (74%), Positives = 165/182 (91%), Gaps = 0/182 (0%)
 Frame = -2

Query  725  SFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGA  546
            SF VPDQ+SGKVELQY H++AGIST +GLTA P+V+FSGV+G +++++GTD+SFDT SG 
Sbjct  95   SFVVPDQKSGKVELQYRHEYAGISTGIGLTAKPLVSFSGVIGNDSVSVGTDLSFDTASGN  154

Query  545  FTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTIT  366
            F K NAGL+ T+SDLIAS+TLNDKGD+L+ASYYH V+PL+NTAVGAE+ HSFSSN NT+T
Sbjct  155  FIKLNAGLNITHSDLIASMTLNDKGDTLTASYYHIVSPLTNTAVGAELTHSFSSNENTLT  214

Query  365  VGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALAL  186
            +GTQH LDPLTTVKAR+NN+GRA+ALIQHEWRPKSL T+SGEVD +A++KSAK GLALAL
Sbjct  215  IGTQHALDPLTTVKARMNNYGRASALIQHEWRPKSLFTISGEVDTRAIEKSAKVGLALAL  274

Query  185  KP  180
            KP
Sbjct  275  KP  276



>ref|XP_008775594.1| PREDICTED: mitochondrial outer membrane protein porin 1-like 
[Phoenix dactylifera]
Length=275

 Score =   289 bits (739),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 138/182 (76%), Positives = 158/182 (87%), Gaps = 0/182 (0%)
 Frame = -2

Query  725  SFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGA  546
            SF VPDQRSGKVELQYLHD+AG++  +GLTANPIVN SGVVGT  L++G DVSFDT SG 
Sbjct  94   SFVVPDQRSGKVELQYLHDYAGVNAGIGLTANPIVNLSGVVGTRGLSVGADVSFDTASGN  153

Query  545  FTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTIT  366
            FTKYNAGLS  N+DLIA+LTLN+KGDSLSASYYH VNPL NTAVGAE+ HSFSSN NT+T
Sbjct  154  FTKYNAGLSVINADLIAALTLNNKGDSLSASYYHLVNPLWNTAVGAEITHSFSSNENTLT  213

Query  365  VGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALAL  186
             GTQH LDPLT VKAR NN+G+A+ALIQHEWR KS +T+SGEVD KA++KS+K GL+L L
Sbjct  214  FGTQHALDPLTLVKARFNNYGKASALIQHEWRLKSFLTISGEVDTKAIEKSSKVGLSLVL  273

Query  185  KP  180
            KP
Sbjct  274  KP  275



>emb|CDY63765.1| BnaCnng42590D [Brassica napus]
Length=276

 Score =   288 bits (738),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 139/182 (76%), Positives = 157/182 (86%), Gaps = 0/182 (0%)
 Frame = -2

Query  725  SFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGA  546
            S +VPDQ+SGKVELQYLHD+AGI TSVGLTA+PIVNFSGVVG N LALGTDVSF+T+SG 
Sbjct  95   SAKVPDQKSGKVELQYLHDYAGICTSVGLTASPIVNFSGVVGNNVLALGTDVSFNTQSGG  154

Query  545  FTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTIT  366
            F  +NAG SFT  DLIA+LTLNDKGD L+ASYYH VNPLSNT VGAEV HSF++  N IT
Sbjct  155  FKHFNAGFSFTKDDLIAALTLNDKGDKLNASYYHIVNPLSNTVVGAEVTHSFTTQKNAIT  214

Query  365  VGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALAL  186
            VG QH +DPLTTVKAR+NN G ANALIQH+WRPKS IT+SGEVD +A++KSAK G ALAL
Sbjct  215  VGAQHAIDPLTTVKARLNNDGVANALIQHQWRPKSFITVSGEVDSRAIEKSAKVGFALAL  274

Query  185  KP  180
            KP
Sbjct  275  KP  276



>ref|XP_002324035.1| hypothetical protein POPTR_0017s11430g [Populus trichocarpa]
 gb|ABK94151.1| unknown [Populus trichocarpa]
 gb|EEF04168.1| hypothetical protein POPTR_0017s11430g [Populus trichocarpa]
Length=274

 Score =   288 bits (738),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 139/182 (76%), Positives = 161/182 (88%), Gaps = 2/182 (1%)
 Frame = -2

Query  725  SFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGA  546
            SF+VPDQRSGKVE+QYLHD+A +S+SVGLT NPIVNFSGV+GTN  +LGTD+SFDTK+G 
Sbjct  95   SFKVPDQRSGKVEIQYLHDYAAVSSSVGLTVNPIVNFSGVIGTNVASLGTDLSFDTKTGD  154

Query  545  FTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTIT  366
            F K NAG+S +  DLIASLTLNDKGDSL+ASYYH VNPL  TAVGAEV+HSFSSN NTIT
Sbjct  155  FIKCNAGVSLSKVDLIASLTLNDKGDSLNASYYHIVNPL--TAVGAEVSHSFSSNENTIT  212

Query  365  VGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALAL  186
            VG QH LDPLTT+KARVNN G+A+AL+QH+WRPKS  T+SGEVD KA++K+AK GLALAL
Sbjct  213  VGAQHALDPLTTLKARVNNAGKASALVQHQWRPKSFFTVSGEVDTKAIEKTAKVGLALAL  272

Query  185  KP  180
            KP
Sbjct  273  KP  274



>ref|XP_009410756.1| PREDICTED: mitochondrial outer membrane protein porin 1-like 
[Musa acuminata subsp. malaccensis]
Length=275

 Score =   287 bits (735),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 133/182 (73%), Positives = 161/182 (88%), Gaps = 0/182 (0%)
 Frame = -2

Query  725  SFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGA  546
            SF +PDQRSGKVELQYLHD+AG++ S+GLTANP+VN SGVVG+  +++G DV+FDT +G 
Sbjct  94   SFVIPDQRSGKVELQYLHDYAGVNASIGLTANPVVNLSGVVGSKNVSVGADVAFDTATGN  153

Query  545  FTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTIT  366
            F KYNAGLS TN+DLIASLTLN+KGDSLSASYYH VNPLS+TAVGAE+NHSFSSN NT+T
Sbjct  154  FIKYNAGLSITNTDLIASLTLNNKGDSLSASYYHLVNPLSSTAVGAELNHSFSSNENTLT  213

Query  365  VGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALAL  186
             GTQH LDPLTT KAR NN+G+A+ALIQHEW+PKS +T+SGEVD KA++ S+K GL+L L
Sbjct  214  FGTQHALDPLTTAKARFNNYGKASALIQHEWKPKSFLTISGEVDTKAIENSSKIGLSLVL  273

Query  185  KP  180
            +P
Sbjct  274  RP  275



>ref|XP_011005064.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa-like 
[Populus euphratica]
Length=274

 Score =   287 bits (734),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 137/182 (75%), Positives = 161/182 (88%), Gaps = 2/182 (1%)
 Frame = -2

Query  725  SFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGA  546
            SF+VPDQRSGKVE+QYLHD+A +S+S+GLT NPIVNFSGV+GTN  +LGTD+SFDTK+G 
Sbjct  95   SFKVPDQRSGKVEIQYLHDYAAVSSSIGLTVNPIVNFSGVIGTNVASLGTDLSFDTKTGD  154

Query  545  FTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTIT  366
            F K NAG+S +  DLIASLTLN+KGDSL+ASYYH VNPL  TAVGAEV+HSFSSN NTIT
Sbjct  155  FIKCNAGVSLSKVDLIASLTLNNKGDSLNASYYHIVNPL--TAVGAEVSHSFSSNDNTIT  212

Query  365  VGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALAL  186
            +G QH LDPLTT+KARVNN G+A+AL+QHEWRPKS  T+SGEVD KA++K+AK GLALAL
Sbjct  213  IGAQHALDPLTTLKARVNNAGKASALVQHEWRPKSFFTVSGEVDTKAIEKTAKVGLALAL  272

Query  185  KP  180
            KP
Sbjct  273  KP  274



>emb|CDX85566.1| BnaA02g02470D [Brassica napus]
Length=276

 Score =   286 bits (733),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 138/182 (76%), Positives = 157/182 (86%), Gaps = 0/182 (0%)
 Frame = -2

Query  725  SFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGA  546
            S +VPDQ+SGKVELQYLHD+AGI TSVGLTA+PIVNFSGVVG N LALGTDVSF+T+SG 
Sbjct  95   SAKVPDQKSGKVELQYLHDYAGICTSVGLTASPIVNFSGVVGNNVLALGTDVSFNTQSGD  154

Query  545  FTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTIT  366
            F ++NAG SFT  DLIA+LTLNDKGD L+ASYYH VNPLSNT VGAEV HSF++  N IT
Sbjct  155  FKQFNAGFSFTKDDLIAALTLNDKGDKLNASYYHIVNPLSNTVVGAEVTHSFTTQKNAIT  214

Query  365  VGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALAL  186
            VG QH LDPLTT+KARVNN G ANALIQH+WRPKS IT+SGEV+ +A++K AK G ALAL
Sbjct  215  VGAQHALDPLTTLKARVNNDGVANALIQHQWRPKSFITVSGEVNSRAIEKGAKVGFALAL  274

Query  185  KP  180
            KP
Sbjct  275  KP  276



>ref|XP_011086392.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa 
[Sesamum indicum]
Length=278

 Score =   286 bits (733),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 133/182 (73%), Positives = 160/182 (88%), Gaps = 0/182 (0%)
 Frame = -2

Query  725  SFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGA  546
            SF  PDQ+SGKVELQY H+HAGISTS+GLTA PIVNFSGV G    A GTD+SFDT +G 
Sbjct  97   SFVAPDQKSGKVELQYFHEHAGISTSLGLTAKPIVNFSGVAGNQKAAFGTDISFDTATGN  156

Query  545  FTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTIT  366
            FTK NAG+SFT +DLIASL LNDKG++++ASY+H V+PL+NTAVGAE+ HSFS+N NT+T
Sbjct  157  FTKCNAGVSFTTTDLIASLMLNDKGETVTASYFHTVSPLTNTAVGAELTHSFSTNENTLT  216

Query  365  VGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALAL  186
            +GTQH LDPLT+VKARVNN+G+ +ALIQHEWRPKSLIT+SGEVD +A++KSAK GLA+AL
Sbjct  217  IGTQHLLDPLTSVKARVNNYGKVSALIQHEWRPKSLITISGEVDTRAIEKSAKVGLAVAL  276

Query  185  KP  180
            KP
Sbjct  277  KP  278



>ref|XP_004297335.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa-like 
[Fragaria vesca subsp. vesca]
Length=276

 Score =   286 bits (732),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 135/182 (74%), Positives = 162/182 (89%), Gaps = 0/182 (0%)
 Frame = -2

Query  725  SFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGA  546
            SF VPDQ+S +VELQY H++AGISTS+GLTANP++NFSGVVG  AL+LGTDVSFDT SG 
Sbjct  95   SFIVPDQKSARVELQYQHEYAGISTSLGLTANPVINFSGVVGNAALSLGTDVSFDTASGN  154

Query  545  FTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTIT  366
             TK NAGL+F ++DLIASL +NDKGD+L+ASYY  V+P++ TAVGAE++HSFSSN NT T
Sbjct  155  LTKLNAGLNFIHTDLIASLLVNDKGDTLTASYYQTVSPITCTAVGAELSHSFSSNENTFT  214

Query  365  VGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALAL  186
            +GTQH LDPLT+VKARVNN+GRA+ALIQHEWRPKSL T+SGEVD +A++KSAK GLALAL
Sbjct  215  IGTQHALDPLTSVKARVNNYGRASALIQHEWRPKSLFTISGEVDTRAIEKSAKIGLALAL  274

Query  185  KP  180
            KP
Sbjct  275  KP  276



>ref|XP_010925360.1| PREDICTED: mitochondrial outer membrane protein porin 1-like 
[Elaeis guineensis]
Length=275

 Score =   286 bits (732),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 134/182 (74%), Positives = 161/182 (88%), Gaps = 0/182 (0%)
 Frame = -2

Query  725  SFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGA  546
            SF +PDQRSG+VELQY HDHAG++ S+GLTANPIV+ SGVVGTNA+A+G DVSFDT  G 
Sbjct  94   SFVLPDQRSGQVELQYQHDHAGVNASIGLTANPIVSLSGVVGTNAVAVGADVSFDTAVGD  153

Query  545  FTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTIT  366
            F KYNAGLS TN+DLIASLT+NDKGDS++ASYYH V+PLS+TAVGAE+ HSFSSN NT+T
Sbjct  154  FIKYNAGLSITNADLIASLTVNDKGDSVNASYYHLVSPLSSTAVGAELTHSFSSNQNTLT  213

Query  365  VGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALAL  186
             GTQH LDPLT VKAR NN+G+A+ALIQHEWRPKS +T++GEVD KA++KS+K GL+L L
Sbjct  214  FGTQHALDPLTLVKARFNNYGKASALIQHEWRPKSFLTVTGEVDTKAIEKSSKVGLSLVL  273

Query  185  KP  180
            +P
Sbjct  274  RP  275



>ref|XP_008808420.1| PREDICTED: mitochondrial outer membrane protein porin 1-like 
[Phoenix dactylifera]
Length=275

 Score =   286 bits (732),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 135/182 (74%), Positives = 156/182 (86%), Gaps = 0/182 (0%)
 Frame = -2

Query  725  SFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGA  546
            SF VP+QRSGKVELQYLHD+AG++TS+GLTANPIVN SGV GT   A+G DVSFDT SG 
Sbjct  94   SFVVPEQRSGKVELQYLHDYAGVNTSIGLTANPIVNLSGVFGTKGFAVGADVSFDTASGN  153

Query  545  FTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTIT  366
            FTKYNAGLS TN+DLIA+LTLN+KGDSLSASYYH  +PLS+ AVGAE+ HSFSSN NT+T
Sbjct  154  FTKYNAGLSVTNADLIAALTLNNKGDSLSASYYHLASPLSSAAVGAEITHSFSSNENTLT  213

Query  365  VGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALAL  186
             G Q  LDPLT VKAR NN+G+A+ALIQHEWRPKS  T+SGEVD KA++KS+K GL+L L
Sbjct  214  FGMQQALDPLTMVKARFNNYGKASALIQHEWRPKSFFTISGEVDTKAIEKSSKVGLSLVL  273

Query  185  KP  180
            KP
Sbjct  274  KP  275



>ref|XP_010485517.1| PREDICTED: mitochondrial outer membrane protein porin 1-like 
[Camelina sativa]
Length=276

 Score =   286 bits (731),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 140/187 (75%), Positives = 161/187 (86%), Gaps = 0/187 (0%)
 Frame = -2

Query  740  LENHSSFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFD  561
            L++  SF+ PDQ SGK+E+QYLHD+AGISTS+GLT NP VNFSGV+GTN LA+GTDVSFD
Sbjct  90   LKSIFSFKAPDQNSGKIEVQYLHDYAGISTSMGLTQNPTVNFSGVIGTNVLAVGTDVSFD  149

Query  560  TKSGAFTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSN  381
            TKSG FTK NAGLSF   DLIASLT+N+K D L+ASYYH VNPL NTAVGAEV+H FS+ 
Sbjct  150  TKSGNFTKINAGLSFAKEDLIASLTVNEKFDLLNASYYHIVNPLFNTAVGAEVSHRFSNK  209

Query  380  VNTITVGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFG  201
             NTITVGTQH LDPLT+VKARVN+ G A+ALIQHEW+PKS  T+SGEVD KA+DK+AK G
Sbjct  210  DNTITVGTQHSLDPLTSVKARVNSAGIASALIQHEWKPKSFFTISGEVDTKAIDKNAKVG  269

Query  200  LALALKP  180
            LALALKP
Sbjct  270  LALALKP  276



>gb|KJB60739.1| hypothetical protein B456_009G323300 [Gossypium raimondii]
Length=276

 Score =   285 bits (729),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 133/182 (73%), Positives = 162/182 (89%), Gaps = 0/182 (0%)
 Frame = -2

Query  725  SFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGA  546
            SF VPDQ+SG VELQY H++AGIS  +GLTA P+V+FSGV+G + +++GTD+SFDT SG 
Sbjct  95   SFVVPDQKSGMVELQYRHEYAGISNGIGLTAKPLVSFSGVIGNDCVSVGTDLSFDTASGN  154

Query  545  FTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTIT  366
            F K NAGL+ T+SDLIAS+TLNDKGD+L+ASYYH V+PL+NTAVGAE+ HSFSSN NT+T
Sbjct  155  FIKLNAGLNITHSDLIASMTLNDKGDTLTASYYHIVSPLTNTAVGAELTHSFSSNENTLT  214

Query  365  VGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALAL  186
            +GTQH LDPLTTVKAR+NN+GRA+ALIQHEWRPKSL T+SGEVD +A++KSAK GLALAL
Sbjct  215  IGTQHALDPLTTVKARMNNYGRASALIQHEWRPKSLFTISGEVDTRAIEKSAKVGLALAL  274

Query  185  KP  180
            KP
Sbjct  275  KP  276



>ref|NP_001288964.1| mitochondrial outer membrane protein porin 3 [Brassica rapa]
 gb|ABB97031.1| unknown [Brassica rapa]
Length=276

 Score =   285 bits (728),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 137/182 (75%), Positives = 156/182 (86%), Gaps = 0/182 (0%)
 Frame = -2

Query  725  SFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGA  546
            S +VPDQ+SGKVELQYLHD+AGI TSVGLTA+PIVNFSGVVG N LALGTDVSF+T+SG 
Sbjct  95   SAKVPDQKSGKVELQYLHDYAGICTSVGLTASPIVNFSGVVGNNVLALGTDVSFNTQSGD  154

Query  545  FTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTIT  366
            F ++NAG SFT  DLIA+LTLNDKGD L+ASYYH VNPLSNT VGAEV HSF++  N IT
Sbjct  155  FKQFNAGFSFTKDDLIAALTLNDKGDKLNASYYHIVNPLSNTVVGAEVTHSFTTQKNAIT  214

Query  365  VGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALAL  186
            VG QH LDPL T+KARVNN G ANALIQH+WRPKS IT+SGEV+ +A++K AK G ALAL
Sbjct  215  VGAQHALDPLATLKARVNNDGVANALIQHQWRPKSFITVSGEVNSRAIEKGAKVGFALAL  274

Query  185  KP  180
            KP
Sbjct  275  KP  276



>ref|XP_010670319.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa-like 
[Beta vulgaris subsp. vulgaris]
Length=276

 Score =   285 bits (728),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 128/182 (70%), Positives = 159/182 (87%), Gaps = 0/182 (0%)
 Frame = -2

Query  725  SFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGA  546
            SF+VPDQRSGK+ELQYLHD+ G+ TSVG TANPIVNFSGV+GTN +ALGTDVSFDTK+G 
Sbjct  95   SFKVPDQRSGKLELQYLHDYVGVCTSVGATANPIVNFSGVIGTNMVALGTDVSFDTKTGN  154

Query  545  FTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTIT  366
            FTKYNAGLSF + DLIA+LT NDKG++L+AS+YH+VNP++  ++GAEV HS S+  NT+T
Sbjct  155  FTKYNAGLSFASEDLIAALTFNDKGNNLNASFYHYVNPMTKLSIGAEVTHSLSTKENTVT  214

Query  365  VGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALAL  186
            +G QH LDPLT VKAR+NN G+A+AL+QHEWRP S +T+S EVD +A++K+AK GLALAL
Sbjct  215  LGAQHALDPLTNVKARINNLGKASALLQHEWRPMSTVTVSAEVDTRAIEKTAKVGLALAL  274

Query  185  KP  180
            KP
Sbjct  275  KP  276



>ref|XP_010463547.1| PREDICTED: mitochondrial outer membrane protein porin 1-like 
[Camelina sativa]
Length=276

 Score =   284 bits (727),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 139/187 (74%), Positives = 161/187 (86%), Gaps = 0/187 (0%)
 Frame = -2

Query  740  LENHSSFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFD  561
            L++  SF+ PDQ SGK+E+QYLHD+AGISTS+GLT NP VNFSGV+GTN LA+GTDVSFD
Sbjct  90   LKSIFSFKAPDQNSGKIEVQYLHDYAGISTSMGLTQNPTVNFSGVIGTNVLAVGTDVSFD  149

Query  560  TKSGAFTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSN  381
            TKSG FTK NAGLSF   DLIASLT+N+K D L+ASYYH VNP+ NTAVGAEV+H FS+ 
Sbjct  150  TKSGNFTKINAGLSFAKEDLIASLTVNEKFDLLNASYYHIVNPVFNTAVGAEVSHRFSNK  209

Query  380  VNTITVGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFG  201
             NTITVGTQH LDPLT+VKARVN+ G A+ALIQHEW+PKS  T+SGEVD KA+DK+AK G
Sbjct  210  DNTITVGTQHSLDPLTSVKARVNSAGIASALIQHEWKPKSFFTISGEVDTKAIDKNAKVG  269

Query  200  LALALKP  180
            LALALKP
Sbjct  270  LALALKP  276



>ref|XP_010512938.1| PREDICTED: mitochondrial outer membrane protein porin 1 [Camelina 
sativa]
Length=276

 Score =   283 bits (725),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 138/187 (74%), Positives = 161/187 (86%), Gaps = 0/187 (0%)
 Frame = -2

Query  740  LENHSSFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFD  561
            L++  SF+ PDQ SGK+E+QYLH++AGISTS+GLT NP VNFSGV+GTN LA+GTD+SFD
Sbjct  90   LKSIFSFKAPDQNSGKIEVQYLHEYAGISTSMGLTQNPTVNFSGVIGTNVLAVGTDISFD  149

Query  560  TKSGAFTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSN  381
            TKSG FTK NAGLSF   DLIASLT+N+K D L+ASYYH VNPL NTAVGAEV+H FS+ 
Sbjct  150  TKSGNFTKINAGLSFAKEDLIASLTVNEKFDLLNASYYHIVNPLFNTAVGAEVSHRFSNK  209

Query  380  VNTITVGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFG  201
             NTITVGTQH LDPLT+VKARVN+ G A+ALIQHEW+PKS  T+SGEVD KA+DK+AK G
Sbjct  210  DNTITVGTQHSLDPLTSVKARVNSAGIASALIQHEWKPKSFFTISGEVDTKAIDKNAKVG  269

Query  200  LALALKP  180
            LALALKP
Sbjct  270  LALALKP  276



>gb|AAQ87021.1| VDAC1.3 [Lotus japonicus]
Length=276

 Score =   283 bits (723),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 133/182 (73%), Positives = 163/182 (90%), Gaps = 0/182 (0%)
 Frame = -2

Query  725  SFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGA  546
            SF  PDQ+SGKVELQY H++AGISTS+GLTA+PIVNFSG++G N +A+GTD+SFDT SG 
Sbjct  95   SFIFPDQKSGKVELQYQHEYAGISTSIGLTASPIVNFSGIIGNNLVAVGTDLSFDTASGN  154

Query  545  FTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTIT  366
            FTKYNAGL+ T++DLIASLTLNDKGDSL+ASYYH V+PL+NTAVGAE++HSFSSN N +T
Sbjct  155  FTKYNAGLNVTHADLIASLTLNDKGDSLNASYYHVVSPLTNTAVGAELSHSFSSNENILT  214

Query  365  VGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALAL  186
            +GTQH LDP+T +KARVNN+GRA+ALIQHEW P++ ++L GEVD  A++KSAK GLALAL
Sbjct  215  IGTQHALDPITLLKARVNNYGRASALIQHEWNPRTRVSLVGEVDTGAIEKSAKVGLALAL  274

Query  185  KP  180
            KP
Sbjct  275  KP  276



>ref|XP_009408682.1| PREDICTED: mitochondrial outer membrane protein porin 1-like 
[Musa acuminata subsp. malaccensis]
Length=275

 Score =   282 bits (722),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 130/182 (71%), Positives = 158/182 (87%), Gaps = 0/182 (0%)
 Frame = -2

Query  725  SFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGA  546
            SF +PDQRSGKVEL YLHD+AG++ S+GLTANP+VNFSGVVG+  +++G DV+FDT +G 
Sbjct  94   SFVIPDQRSGKVELHYLHDYAGVNASIGLTANPVVNFSGVVGSKTVSVGADVAFDTATGN  153

Query  545  FTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTIT  366
            F KYNA LS TN+DLIA+L LN+KGDSLSASYYH VNPLS+TAVGAE+ HSFSSN NT+ 
Sbjct  154  FIKYNASLSITNADLIAALALNNKGDSLSASYYHLVNPLSSTAVGAELTHSFSSNENTLA  213

Query  365  VGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALAL  186
             GTQH LDPLTT+KAR NN+G+A+ALIQHEW+PKS  T+SGEVD KA++KS+K GL+L L
Sbjct  214  FGTQHALDPLTTIKARFNNYGKASALIQHEWKPKSFFTISGEVDTKAIEKSSKIGLSLVL  273

Query  185  KP  180
            KP
Sbjct  274  KP  275



>gb|EYU22439.1| hypothetical protein MIMGU_mgv1a011543mg [Erythranthe guttata]
Length=278

 Score =   282 bits (721),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 131/182 (72%), Positives = 160/182 (88%), Gaps = 0/182 (0%)
 Frame = -2

Query  725  SFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGA  546
            SF  PDQ+SGKVELQY H++A ISTS+GLTA PIVNFSGV G++  A GTDVSFDT +G 
Sbjct  97   SFAAPDQKSGKVELQYFHEYAAISTSLGLTAKPIVNFSGVAGSHKAAFGTDVSFDTATGN  156

Query  545  FTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTIT  366
            FTKYNAG+SFT +DLIAS  LNDKG SL+ASY+H V+PL+NTAVGAE+ HSF+SN NT+T
Sbjct  157  FTKYNAGVSFTTTDLIASFILNDKGQSLTASYFHTVSPLTNTAVGAELTHSFTSNENTLT  216

Query  365  VGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALAL  186
            +GTQH LD LT+VKAR+NN+G+A+ALIQH+WRPKSL+T+SGEVD +A+DK+AK GLA+AL
Sbjct  217  IGTQHSLDHLTSVKARLNNYGKASALIQHQWRPKSLVTISGEVDTRAIDKTAKIGLAVAL  276

Query  185  KP  180
            KP
Sbjct  277  KP  278



>ref|XP_010453637.1| PREDICTED: mitochondrial outer membrane protein porin 3-like 
[Camelina sativa]
Length=276

 Score =   282 bits (721),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 133/180 (74%), Positives = 158/180 (88%), Gaps = 0/180 (0%)
 Frame = -2

Query  719  RVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFT  540
            ++PDQ+SGK+ELQYLHD+AGI+TS+GLT +P VNFSGVVGTN LALGTDVSF+T SG F 
Sbjct  97   KLPDQKSGKLELQYLHDYAGIATSIGLTGSPTVNFSGVVGTNVLALGTDVSFETDSGNFK  156

Query  539  KYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVG  360
             +NAGLSFT  DLIASLTLNDKG+ L+ASYYH VNP++NT VGAEV+H+F++  N ITVG
Sbjct  157  HFNAGLSFTKDDLIASLTLNDKGEKLNASYYHIVNPVTNTVVGAEVSHNFTTKENAITVG  216

Query  359  TQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  180
            +Q+ +DPLTTVKARVNN G ANALIQHEWRPKS  T+SGEVD KA++KSAK G+ALALKP
Sbjct  217  SQYAMDPLTTVKARVNNAGIANALIQHEWRPKSFFTVSGEVDSKAIEKSAKVGIALALKP  276



>ref|XP_004489372.1| PREDICTED: outer plastidial membrane protein porin-like [Cicer 
arietinum]
Length=276

 Score =   282 bits (721),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 133/182 (73%), Positives = 155/182 (85%), Gaps = 0/182 (0%)
 Frame = -2

Query  725  SFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGA  546
            SFR+PDQRSGKVE+QYLHD+ GI  SVGLTANPI+N SG +GTN +ALG D+++DTK G 
Sbjct  95   SFRIPDQRSGKVEVQYLHDYFGIGASVGLTANPIINVSGTLGTNVIALGHDLTYDTKIGE  154

Query  545  FTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTIT  366
            FTK N GL+FT  DL+ASLTL DKGD L+ASYYH VN L+ TAVGAEV H FS+  NT+T
Sbjct  155  FTKLNTGLNFTKDDLVASLTLTDKGDVLNASYYHVVNHLTKTAVGAEVTHRFSNTENTLT  214

Query  365  VGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALAL  186
            +GTQH LDPLTTVKAR NNFG+ANALIQHEWRP+S +T+SGEVD KA++KSAK GLALAL
Sbjct  215  LGTQHALDPLTTVKARFNNFGKANALIQHEWRPRSFLTISGEVDTKAIEKSAKVGLALAL  274

Query  185  KP  180
            KP
Sbjct  275  KP  276



>ref|XP_008786741.1| PREDICTED: mitochondrial outer membrane protein porin 1-like 
[Phoenix dactylifera]
Length=276

 Score =   281 bits (720),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 134/183 (73%), Positives = 160/183 (87%), Gaps = 1/183 (1%)
 Frame = -2

Query  725  SFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGA  546
            SF VPDQRSGKVELQYLHDH G++ S+GLTANPIVN SGVVGT+A+A+G DVSFDT +G 
Sbjct  94   SFVVPDQRSGKVELQYLHDHGGVNASIGLTANPIVNLSGVVGTDAVAVGADVSFDTANGD  153

Query  545  FTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNV-NTI  369
            F K NAGLS TN+DLIASLT+NDKGD ++ASYYH V+PLS+TAVGAE+ HSFSSN  NT+
Sbjct  154  FIKCNAGLSITNADLIASLTVNDKGDCVNASYYHLVSPLSSTAVGAELTHSFSSNQKNTL  213

Query  368  TVGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALA  189
            T GTQH LDPLT VKAR NN+G+A+ALIQHEWRPKS +T++GEVD KA++KS+K GL+L 
Sbjct  214  TFGTQHALDPLTLVKARFNNYGKASALIQHEWRPKSFLTITGEVDTKAIEKSSKVGLSLV  273

Query  188  LKP  180
            L+P
Sbjct  274  LRP  276



>ref|XP_010492333.1| PREDICTED: mitochondrial outer membrane protein porin 3-like 
[Camelina sativa]
Length=276

 Score =   280 bits (716),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 135/182 (74%), Positives = 157/182 (86%), Gaps = 0/182 (0%)
 Frame = -2

Query  725  SFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGA  546
            S R+PDQ+SGK+ELQYLHD+AGISTSVGLT +P VNFSGVVGTN LALGTDVSF+T SG 
Sbjct  95   SARLPDQKSGKLELQYLHDYAGISTSVGLTGSPTVNFSGVVGTNVLALGTDVSFETDSGN  154

Query  545  FTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTIT  366
            F  +NAGLSFT  DLIASL L+DKG+ L+ASYY  VNPL+NT VGAEV+H+F++  N IT
Sbjct  155  FKHFNAGLSFTKEDLIASLILSDKGEKLNASYYQIVNPLTNTVVGAEVSHNFTTKENAIT  214

Query  365  VGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALAL  186
            VG+Q+ +DPLTTVKARVNN G ANALIQHEWRPKS  T+SGEVD KA++KSAK G+ALAL
Sbjct  215  VGSQYAIDPLTTVKARVNNAGIANALIQHEWRPKSFFTVSGEVDSKAIEKSAKVGIALAL  274

Query  185  KP  180
            KP
Sbjct  275  KP  276



>ref|XP_006286537.1| hypothetical protein CARUB_v10001678mg [Capsella rubella]
 gb|EOA19435.1| hypothetical protein CARUB_v10001678mg [Capsella rubella]
Length=276

 Score =   280 bits (715),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 134/182 (74%), Positives = 159/182 (87%), Gaps = 0/182 (0%)
 Frame = -2

Query  725  SFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGA  546
            S ++PDQ+SGK ELQYL+D+AGI+TS+ LT +PIVNFSGVVGTN +ALGTDVSF+T+SG 
Sbjct  95   SAKLPDQKSGKFELQYLNDYAGIATSLSLTGSPIVNFSGVVGTNVVALGTDVSFETESGN  154

Query  545  FTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTIT  366
            F  +NAG+SFT  DLIASLTLNDKG+ L+ASYYH VNPLSNT VGAEV+H+F++  N IT
Sbjct  155  FKHFNAGVSFTKDDLIASLTLNDKGEKLNASYYHIVNPLSNTVVGAEVSHNFTTKENAIT  214

Query  365  VGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALAL  186
            VGTQH +DPLTTVKARVNN G ANALIQHEWRPKS  T+SGEVD +A++KSAK G+ALAL
Sbjct  215  VGTQHAIDPLTTVKARVNNAGIANALIQHEWRPKSFFTVSGEVDSRAIEKSAKVGIALAL  274

Query  185  KP  180
            KP
Sbjct  275  KP  276



>ref|XP_010420161.1| PREDICTED: mitochondrial outer membrane protein porin 3 [Camelina 
sativa]
Length=276

 Score =   279 bits (714),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 133/182 (73%), Positives = 157/182 (86%), Gaps = 0/182 (0%)
 Frame = -2

Query  725  SFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGA  546
            S ++PDQ+SGK+ELQY HD+AGI+TS+GLT +P VNFSGVVGTN LALGTDVSF+T SG 
Sbjct  95   SAKLPDQKSGKLELQYFHDYAGIATSIGLTGSPTVNFSGVVGTNVLALGTDVSFETDSGN  154

Query  545  FTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTIT  366
            F  +NAGLSFT  DLIASLTLNDKG+ L+ASYYH V+PL+NT VGAEV+H+F++  N IT
Sbjct  155  FKHFNAGLSFTKDDLIASLTLNDKGEKLNASYYHIVSPLTNTVVGAEVSHNFTTKENAIT  214

Query  365  VGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALAL  186
            VG+QH +DPLT VKARVNN G ANALIQHEWRPKS  T+SGEVD KA++KSAK G+ALAL
Sbjct  215  VGSQHAIDPLTIVKARVNNAGIANALIQHEWRPKSFFTVSGEVDSKAIEKSAKVGIALAL  274

Query  185  KP  180
            KP
Sbjct  275  KP  276



>ref|NP_001241054.1| uncharacterized protein LOC100805016 [Glycine max]
 gb|ACU21099.1| unknown [Glycine max]
 gb|KHN31779.1| Mitochondrial outer membrane protein porin of 36 kDa [Glycine 
soja]
Length=276

 Score =   279 bits (713),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 132/182 (73%), Positives = 160/182 (88%), Gaps = 0/182 (0%)
 Frame = -2

Query  725  SFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGA  546
            SF  PDQ+SGKVELQY H++AGISTS+GLTANP+VNFSGVVG N +A+GTD+SFDT SG 
Sbjct  95   SFNFPDQKSGKVELQYQHEYAGISTSIGLTANPVVNFSGVVGNNLVAVGTDLSFDTTSGN  154

Query  545  FTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTIT  366
            FTKYNAGL+ T++DLIASLTLNDKGD+L+ASYYH VNPL+N+AVGAE++HSFS N N +T
Sbjct  155  FTKYNAGLNITHADLIASLTLNDKGDNLTASYYHIVNPLTNSAVGAELSHSFSGNENILT  214

Query  365  VGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALAL  186
             GTQH LDPLT +KARVNN+GRA+ALIQH+W P++  +L GEVD  A++KSAK GLA+AL
Sbjct  215  FGTQHALDPLTLLKARVNNYGRASALIQHDWTPRTRFSLVGEVDTGAIEKSAKVGLAVAL  274

Query  185  KP  180
            KP
Sbjct  275  KP  276



>gb|EYU28705.1| hypothetical protein MIMGU_mgv1a011554mg [Erythranthe guttata]
Length=278

 Score =   278 bits (712),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 130/182 (71%), Positives = 160/182 (88%), Gaps = 0/182 (0%)
 Frame = -2

Query  725  SFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGA  546
            SF  PDQ+SGKVELQY H+++GISTS+GLTA PIVNFSGV G +  A GTDVSFDT++G 
Sbjct  97   SFVAPDQKSGKVELQYFHEYSGISTSLGLTAKPIVNFSGVAGNHTFAFGTDVSFDTETGN  156

Query  545  FTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTIT  366
            F K NA LSFT +DL+ASL L+DKG++++ASY+H V+PL+NTAVGAE+ HSFS+N NT+T
Sbjct  157  FIKSNAALSFTTADLVASLGLSDKGETVTASYFHTVSPLTNTAVGAEMVHSFSTNENTLT  216

Query  365  VGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALAL  186
            +GTQH LDPLT VKARVNN+G+A+ALIQHEWRPKSLIT+SGEVD +A++KSAK GLA+AL
Sbjct  217  IGTQHLLDPLTAVKARVNNYGKASALIQHEWRPKSLITISGEVDTRAIEKSAKVGLAVAL  276

Query  185  KP  180
            KP
Sbjct  277  KP  278



>sp|P42054.2|VDAC_PEA RecName: Full=Outer plastidial membrane protein porin; AltName: 
Full=Voltage-dependent anion-selective channel protein; Short=VDAC 
[Pisum sativum]
 emb|CAA80988.1| Porin [Pisum sativum]
Length=276

 Score =   278 bits (711),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 132/182 (73%), Positives = 154/182 (85%), Gaps = 0/182 (0%)
 Frame = -2

Query  725  SFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGA  546
            SF+VP+Q SGKVELQYLH++AGIS+SVGL ANPIVNFS V+GTNALA G D+SFDTK G 
Sbjct  95   SFKVPEQTSGKVELQYLHEYAGISSSVGLKANPIVNFSSVIGTNALAFGADISFDTKLGE  154

Query  545  FTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTIT  366
             TK NA ++F   DLI SLTLN+KGD LSASYYH +NPLSNTAVG +++H FS+  NT T
Sbjct  155  LTKSNAAVNFVKDDLIGSLTLNEKGDLLSASYYHAINPLSNTAVGVDISHRFSTKENTFT  214

Query  365  VGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALAL  186
            +GTQH LDPLTTVK RV N G+A+ALIQHEWRPKSLIT+S EVD KA++KSAK GL+LAL
Sbjct  215  LGTQHALDPLTTVKGRVTNSGKASALIQHEWRPKSLITISSEVDTKAIEKSAKIGLSLAL  274

Query  185  KP  180
            KP
Sbjct  275  KP  276



>ref|XP_006842115.1| hypothetical protein AMTR_s00078p00100600 [Amborella trichopoda]
 gb|ERN03790.1| hypothetical protein AMTR_s00078p00100600 [Amborella trichopoda]
Length=276

 Score =   278 bits (711),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 128/178 (72%), Positives = 155/178 (87%), Gaps = 0/178 (0%)
 Frame = -2

Query  713  PDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKY  534
            PDQRSGKVELQYLHD+AGIS+S+GLTA PIVNFSGV+G    ALGTDV+FDT +   TK 
Sbjct  99   PDQRSGKVELQYLHDYAGISSSIGLTATPIVNFSGVLGNETFALGTDVAFDTATSKLTKC  158

Query  533  NAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQ  354
            NAG SFT SDLIA+ T+NDKG++L+ASYYH V+PL+ T+VGAE++HS S+N NT+T+GTQ
Sbjct  159  NAGFSFTTSDLIAAATVNDKGNTLTASYYHTVSPLTRTSVGAELSHSLSTNENTLTIGTQ  218

Query  353  HQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  180
            H LDPLTTVK R+NNFG+A+ALIQHEWRPKSL TL GEVD +A++KSAK GL++ALKP
Sbjct  219  HSLDPLTTVKGRLNNFGKASALIQHEWRPKSLFTLCGEVDARAIEKSAKVGLSVALKP  276



>ref|XP_007153842.1| hypothetical protein PHAVU_003G069300g [Phaseolus vulgaris]
 gb|ESW25836.1| hypothetical protein PHAVU_003G069300g [Phaseolus vulgaris]
Length=276

 Score =   278 bits (710),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 133/182 (73%), Positives = 162/182 (89%), Gaps = 0/182 (0%)
 Frame = -2

Query  725  SFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGA  546
            SF  PDQ+SGKVELQYLH++AGISTS+GLTANPIVNFSGVVG N +A+GTD+SFDT SG 
Sbjct  95   SFIFPDQKSGKVELQYLHEYAGISTSIGLTANPIVNFSGVVGNNLVAVGTDLSFDTASGN  154

Query  545  FTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTIT  366
            FTKYNAGL+ T++DLIASLTLNDKGD+L+ASYYH V+PL+NTAVGAE++H+FSSN N++T
Sbjct  155  FTKYNAGLNITHADLIASLTLNDKGDTLNASYYHIVSPLTNTAVGAELSHNFSSNENSLT  214

Query  365  VGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALAL  186
            +GTQH LDPLT +KARVNN+G A+ALIQH+W P++  +L GEVD  A+ KSAK GLA+AL
Sbjct  215  IGTQHALDPLTHLKARVNNYGLASALIQHDWNPRTRFSLVGEVDTGAIGKSAKVGLAVAL  274

Query  185  KP  180
            KP
Sbjct  275  KP  276



>ref|XP_003532049.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa-like 
[Glycine max]
 gb|KHN13488.1| Mitochondrial outer membrane protein porin of 36 kDa [Glycine 
soja]
Length=276

 Score =   277 bits (709),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 131/182 (72%), Positives = 160/182 (88%), Gaps = 0/182 (0%)
 Frame = -2

Query  725  SFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGA  546
            SF  PDQ+SGKVELQY H++AGI+TS+GLTANP+VNFSGVVG N +A+GTD+SFDT SG 
Sbjct  95   SFNFPDQKSGKVELQYQHEYAGINTSIGLTANPVVNFSGVVGNNLVAVGTDLSFDTASGN  154

Query  545  FTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTIT  366
            FTKYNAGL+ T++DLIASLTLNDKGD+L+ASYYH VNPL+NTAVGAE++HSFS N N +T
Sbjct  155  FTKYNAGLNITHADLIASLTLNDKGDNLTASYYHIVNPLTNTAVGAELSHSFSGNENILT  214

Query  365  VGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALAL  186
             GTQH LDPLT +K+RVNN+GRA+ALIQH+W P++  +L GEVD  A++KSAK GLA+AL
Sbjct  215  FGTQHALDPLTLLKSRVNNYGRASALIQHDWTPRTRFSLVGEVDTGAIEKSAKVGLAVAL  274

Query  185  KP  180
            KP
Sbjct  275  KP  276



>gb|KFK25745.1| hypothetical protein AALP_AA8G154100 [Arabis alpina]
Length=276

 Score =   277 bits (708),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 133/182 (73%), Positives = 155/182 (85%), Gaps = 0/182 (0%)
 Frame = -2

Query  725  SFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGA  546
            S ++PDQ+SGK+ELQYLHD+AGI TSVGLTANP VNF+GVVGTN LALGTD SF+T++G 
Sbjct  95   SAKLPDQKSGKLELQYLHDYAGICTSVGLTANPTVNFAGVVGTNILALGTDASFNTETGN  154

Query  545  FTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTIT  366
                N GLSFT  DLIASL LNDKG+ L+ASYYH VNPL+NT VGAEVNH+FS+N NTIT
Sbjct  155  LKHLNFGLSFTKDDLIASLNLNDKGEKLNASYYHIVNPLTNTVVGAEVNHNFSTNQNTIT  214

Query  365  VGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALAL  186
            VGTQH LD LTTVKARVNN G ANALIQH+WRPKS +T+S E+D KA++K+ K G+ALAL
Sbjct  215  VGTQHALDSLTTVKARVNNAGVANALIQHQWRPKSFVTISSEIDSKAIEKTPKVGIALAL  274

Query  185  KP  180
            KP
Sbjct  275  KP  276



>ref|XP_002517470.1| voltage-dependent anion-selective channel, putative [Ricinus 
communis]
 gb|EEF45012.1| voltage-dependent anion-selective channel, putative [Ricinus 
communis]
Length=274

 Score =   275 bits (704),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 130/182 (71%), Positives = 157/182 (86%), Gaps = 2/182 (1%)
 Frame = -2

Query  725  SFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGA  546
            S ++PDQRSGK+E+QYLHD+A +S+SVGL  NP VNFSGV+GTN ++LGT++SFDTKSG 
Sbjct  95   SCKLPDQRSGKLEIQYLHDYAAVSSSVGLAPNPTVNFSGVIGTNVVSLGTELSFDTKSGN  154

Query  545  FTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTIT  366
            FTK NAG S++N+DLIASLTLNDKGDSL ASYY  VNP+   AVGAEV+HSFS+N NTIT
Sbjct  155  FTKCNAGFSYSNADLIASLTLNDKGDSLKASYYQIVNPVH--AVGAEVSHSFSTNENTIT  212

Query  365  VGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALAL  186
            +G+QH LDPLTT+K RVNNFG+A+AL QHEWRPKS IT+S EVD KA++ + K GLALAL
Sbjct  213  LGSQHALDPLTTMKTRVNNFGKASALFQHEWRPKSFITVSAEVDTKAIESNPKIGLALAL  272

Query  185  KP  180
            KP
Sbjct  273  KP  274



>ref|XP_004489166.1| PREDICTED: outer plastidial membrane protein porin-like [Cicer 
arietinum]
Length=276

 Score =   274 bits (701),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 133/182 (73%), Positives = 153/182 (84%), Gaps = 0/182 (0%)
 Frame = -2

Query  725  SFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGA  546
            SF+VPDQ SGKVELQYLHD+AG+S S GL ANPIVN S VVGTN LA+G D+SFDTK G 
Sbjct  95   SFKVPDQTSGKVELQYLHDYAGLSGSFGLKANPIVNLSSVVGTNVLAIGADLSFDTKLGE  154

Query  545  FTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTIT  366
             TK NAGLS+   DLIASLTLN+KGD+L+AS+YH VNPL+NTA G +VNH FS+  NT T
Sbjct  155  LTKSNAGLSYAKDDLIASLTLNNKGDALNASFYHLVNPLTNTAFGVDVNHRFSTKENTFT  214

Query  365  VGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALAL  186
            +GTQH LD LTTVKARV N G+A+ALIQHEWRPKSL T+SGEVD KA++KSAK GL+LAL
Sbjct  215  LGTQHALDSLTTVKARVTNAGKASALIQHEWRPKSLFTISGEVDTKAIEKSAKVGLSLAL  274

Query  185  KP  180
            KP
Sbjct  275  KP  276



>ref|XP_004956656.1| PREDICTED: mitochondrial outer membrane protein porin 1-like 
[Setaria italica]
Length=276

 Score =   274 bits (700),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 128/182 (70%), Positives = 155/182 (85%), Gaps = 0/182 (0%)
 Frame = -2

Query  725  SFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGA  546
            SF VPDQRSGK ELQYLHD+AG++ S+G+TANPIVN SG  GT ALA+G D+S DT +G 
Sbjct  95   SFAVPDQRSGKFELQYLHDYAGVNASIGMTANPIVNLSGSFGTKALAVGADISLDTATGN  154

Query  545  FTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTIT  366
            FTKYNAGLS T+ DLIASL LN+KGDSL+A+YYH V+ L++TAVGAE+ HSFSSN NT+T
Sbjct  155  FTKYNAGLSVTHEDLIASLNLNNKGDSLTAAYYHSVSQLTSTAVGAELTHSFSSNENTLT  214

Query  365  VGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALAL  186
             GTQH LDPLT +KAR NN G+A+ALIQHEWRPKSL+T+S EVD K ++KS+K G+A+AL
Sbjct  215  FGTQHALDPLTVLKARFNNSGKASALIQHEWRPKSLVTISAEVDTKTIEKSSKVGIAVAL  274

Query  185  KP  180
            KP
Sbjct  275  KP  276



>ref|XP_009393634.1| PREDICTED: mitochondrial outer membrane protein porin 1-like 
[Musa acuminata subsp. malaccensis]
Length=275

 Score =   273 bits (699),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 125/182 (69%), Positives = 156/182 (86%), Gaps = 0/182 (0%)
 Frame = -2

Query  725  SFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGA  546
            SF VPDQRSGKVE+QYLHD+ GI+ S+GLTANP+VN SG VG+  L++G DV+FDT +G 
Sbjct  94   SFVVPDQRSGKVEIQYLHDYTGINASIGLTANPVVNLSGAVGSKTLSVGADVAFDTTTGK  153

Query  545  FTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTIT  366
            F KYNAGLS TN+DLIA+LTLN++GDSL+ASYYH V  LS TAVGAE+ HSFSSN NT+T
Sbjct  154  FIKYNAGLSITNADLIAALTLNNRGDSLTASYYHLVKSLSRTAVGAELTHSFSSNENTLT  213

Query  365  VGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALAL  186
             GTQH LD LTTVK R+N++G+A+ALIQHEW+PKS +T+SGE+D KA++KS+K GL+L L
Sbjct  214  FGTQHALDRLTTVKGRINSYGKASALIQHEWKPKSFLTISGEIDTKAIEKSSKVGLSLVL  273

Query  185  KP  180
            +P
Sbjct  274  RP  275



>ref|XP_002873707.1| voltage-dependent anion-selective channel protein hsr2 [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH49966.1| voltage-dependent anion-selective channel protein hsr2 [Arabidopsis 
lyrata subsp. lyrata]
Length=276

 Score =   273 bits (697),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 128/180 (71%), Positives = 154/180 (86%), Gaps = 0/180 (0%)
 Frame = -2

Query  719  RVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFT  540
            ++PD +SGK E+QY HD+A ISTSVG TA+PIVNFSGVVGTN LALGTDV+F+T+SG F 
Sbjct  97   KLPDHKSGKAEVQYFHDYAAISTSVGFTASPIVNFSGVVGTNVLALGTDVAFNTESGNFK  156

Query  539  KYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVG  360
             +NAGL+FT  DLIASL LN+KG+ L+ASYY  VNPL+NT VGAE++H+F++  N ITVG
Sbjct  157  HFNAGLNFTKDDLIASLILNEKGEKLNASYYQIVNPLTNTVVGAEISHNFTTKENAITVG  216

Query  359  TQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  180
            TQH +DPLTTVKARVNN G ANALIQHEWRPKS  T+SGEVD +A++KSAK G+ALALKP
Sbjct  217  TQHAIDPLTTVKARVNNVGVANALIQHEWRPKSFFTVSGEVDSRAIEKSAKVGIALALKP  276



>ref|XP_003578022.1| PREDICTED: mitochondrial outer membrane porin [Brachypodium distachyon]
Length=276

 Score =   271 bits (693),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 129/182 (71%), Positives = 153/182 (84%), Gaps = 0/182 (0%)
 Frame = -2

Query  725  SFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGA  546
            SF +PDQRSGK+ELQYLHD+AGI+ S+GLTANP+VN SG  GTNALA+G DVS DT +  
Sbjct  95   SFAIPDQRSGKLELQYLHDYAGINASIGLTANPVVNLSGSFGTNALAVGADVSLDTATKN  154

Query  545  FTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTIT  366
            FTKYNAGLSFTN DL ASL LN+KGDSL+ASYYH V   + TAVGAE+ HSFSSN NT+ 
Sbjct  155  FTKYNAGLSFTNDDLTASLNLNNKGDSLTASYYHFVEKSTKTAVGAELTHSFSSNENTLI  214

Query  365  VGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALAL  186
             GTQH LDPLT VKAR+NN G+A+ALIQHE+RP+SL T+S EVD KA++KS+K G+A+AL
Sbjct  215  FGTQHTLDPLTLVKARINNSGKASALIQHEFRPRSLCTISAEVDTKAIEKSSKVGIAVAL  274

Query  185  KP  180
            KP
Sbjct  275  KP  276



>ref|XP_009403419.1| PREDICTED: mitochondrial outer membrane protein porin 1-like 
[Musa acuminata subsp. malaccensis]
Length=273

 Score =   271 bits (693),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 129/182 (71%), Positives = 153/182 (84%), Gaps = 1/182 (1%)
 Frame = -2

Query  725  SFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGA  546
            S  +PDQRSGKVELQYLH++AG++  +GLTANP+VN SGVVGTN  A+G DVSFDT +G 
Sbjct  93   SVIIPDQRSGKVELQYLHNYAGVTAGIGLTANPVVNLSGVVGTNTYAVGADVSFDTATGN  152

Query  545  FTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTIT  366
            F K N GL+  N+DLIASLT+NDKGDS++ASYYH V+PLS TAVGAE+ H FSSN NT+T
Sbjct  153  FIKCNGGLNVINADLIASLTVNDKGDSVTASYYHLVSPLS-TAVGAELTHCFSSNENTMT  211

Query  365  VGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALAL  186
             GTQH LDPLT VKAR NN G+A+ALIQHEWRPKS +T+SGEVD KA++KSAK GLAL L
Sbjct  212  FGTQHTLDPLTNVKARFNNCGKASALIQHEWRPKSFVTISGEVDTKAIEKSAKVGLALVL  271

Query  185  KP  180
            +P
Sbjct  272  RP  273



>ref|XP_002460110.1| hypothetical protein SORBIDRAFT_02g022910 [Sorghum bicolor]
 gb|EER96631.1| hypothetical protein SORBIDRAFT_02g022910 [Sorghum bicolor]
Length=276

 Score =   271 bits (692),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 124/182 (68%), Positives = 154/182 (85%), Gaps = 0/182 (0%)
 Frame = -2

Query  725  SFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGA  546
            SF VPDQRSGKVELQYLHD+AG++ S+GLTANP+VN S   GT ALA+G DVS DT +G 
Sbjct  95   SFAVPDQRSGKVELQYLHDYAGVNASIGLTANPVVNLSAAFGTKALAVGADVSLDTATGN  154

Query  545  FTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTIT  366
             TKYN+GL FT+ DLIASL+LN++GDSL+ +YYH V+ L+NTAVGAE+ HSFS+N NT+T
Sbjct  155  LTKYNSGLRFTHEDLIASLSLNNRGDSLTGAYYHKVSELTNTAVGAELTHSFSTNENTVT  214

Query  365  VGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALAL  186
             G QH LDPLT +KAR+NN G+A+ALIQHEWRPKSL+T+S EVD K ++KS+K G+A+AL
Sbjct  215  FGGQHALDPLTVLKARINNSGKASALIQHEWRPKSLVTISAEVDTKTIEKSSKVGIAVAL  274

Query  185  KP  180
            KP
Sbjct  275  KP  276



>ref|XP_009408829.1| PREDICTED: mitochondrial outer membrane protein porin 1-like 
[Musa acuminata subsp. malaccensis]
Length=275

 Score =   271 bits (692),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 125/181 (69%), Positives = 154/181 (85%), Gaps = 0/181 (0%)
 Frame = -2

Query  722  FRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAF  543
            F +PDQ+ GKVELQYLHD+ G++ +VGLTANPIVN SGVVGTN  ++G DVSFDT +G F
Sbjct  95   FIIPDQQLGKVELQYLHDYVGVTAAVGLTANPIVNLSGVVGTNVYSVGADVSFDTATGNF  154

Query  542  TKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITV  363
             K N GLS  N+DLIASLT+NDKGDS++ASYYH V+PLS+TAVGAE+ H+FS+N N++T 
Sbjct  155  IKCNGGLSVINADLIASLTVNDKGDSINASYYHLVSPLSSTAVGAELTHNFSTNENSLTF  214

Query  362  GTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALK  183
            GTQH LDPLT VKAR+NN+G+A+ALIQHEWRPKS  T+SGE+D KA++K AK GLAL L+
Sbjct  215  GTQHALDPLTIVKARLNNYGKASALIQHEWRPKSFFTISGEIDSKAIEKGAKVGLALVLR  274

Query  182  P  180
            P
Sbjct  275  P  275



>ref|XP_006660565.1| PREDICTED: mitochondrial outer membrane protein porin 1-like 
[Oryza brachyantha]
Length=274

 Score =   271 bits (692),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 133/182 (73%), Positives = 153/182 (84%), Gaps = 1/182 (1%)
 Frame = -2

Query  725  SFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGA  546
            SF VPDQRSGK ELQYLHD+AG+S S+GLTANP+VN S V GT ALA+G DVS DT +G 
Sbjct  94   SFAVPDQRSGKFELQYLHDYAGVSASIGLTANPVVNLSSVFGTKALAVGADVSLDTATGN  153

Query  545  FTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTIT  366
             TKYNAGLSFTN DLIASL LN+KGDSL+ASYYH VN  S TAVGAE+ HSFSSN N++T
Sbjct  154  LTKYNAGLSFTNDDLIASLNLNNKGDSLTASYYHIVNH-SATAVGAELTHSFSSNENSLT  212

Query  365  VGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALAL  186
             GTQH LDPLT VKAR NN G+A+AL+QHEWRPKSL T+S EVD KA++KS+K G+A+AL
Sbjct  213  FGTQHTLDPLTVVKARFNNSGKASALLQHEWRPKSLWTISAEVDTKAIEKSSKVGIAVAL  272

Query  185  KP  180
            KP
Sbjct  273  KP  274



>ref|NP_001105619.1| voltage-dependent anion channel protein1a [Zea mays]
 gb|AAD56651.1|AF178950_1 voltage-dependent anion channel protein 1a [Zea mays]
Length=276

 Score =   269 bits (687),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 123/182 (68%), Positives = 152/182 (84%), Gaps = 0/182 (0%)
 Frame = -2

Query  725  SFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGA  546
            SF VPDQRSGKVELQYLHD+AG++ S+GLTANP+VN S   GT A+ALG D+S DT +G 
Sbjct  95   SFAVPDQRSGKVELQYLHDYAGVNASIGLTANPVVNLSAAFGTKAVALGADISLDTATGN  154

Query  545  FTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTIT  366
             TKYNA L FT+ DL+ASL LN+KGDSL+ +YYH V+ L+NTAVGAE+ HSFS+N NT+T
Sbjct  155  LTKYNAALRFTHEDLVASLNLNNKGDSLTGAYYHKVSELTNTAVGAELTHSFSTNENTLT  214

Query  365  VGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALAL  186
             G QH LDPLT +KAR+NN G+A+ALIQHEWRPKSL+T+S EVD K ++KS+K G+A+AL
Sbjct  215  FGGQHALDPLTVLKARINNSGKASALIQHEWRPKSLVTISAEVDTKTIEKSSKVGIAVAL  274

Query  185  KP  180
            KP
Sbjct  275  KP  276



>gb|ACF85328.1| unknown [Zea mays]
 gb|ACG42313.1| isochorismate synthase 1 [Zea mays]
 tpg|DAA39954.1| TPA: voltage-dependent anion channel protein 1a [Zea mays]
Length=276

 Score =   268 bits (684),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 122/182 (67%), Positives = 152/182 (84%), Gaps = 0/182 (0%)
 Frame = -2

Query  725  SFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGA  546
            SF VPDQRSGKVELQYLHD+AG++ S+GLTANP+VN S   GT A+A+G D+S DT +G 
Sbjct  95   SFAVPDQRSGKVELQYLHDYAGVNASIGLTANPVVNLSAAFGTKAVAVGADISLDTATGN  154

Query  545  FTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTIT  366
             TKYNA L FT+ DL+ASL LN+KGDSL+ +YYH V+ L+NTAVGAE+ HSFS+N NT+T
Sbjct  155  LTKYNAALRFTHEDLVASLNLNNKGDSLTGAYYHKVSELTNTAVGAELTHSFSTNENTLT  214

Query  365  VGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALAL  186
             G QH LDPLT +KAR+NN G+A+ALIQHEWRPKSL+T+S EVD K ++KS+K G+A+AL
Sbjct  215  FGGQHALDPLTVLKARINNSGKASALIQHEWRPKSLVTISAEVDTKTIEKSSKVGIAVAL  274

Query  185  KP  180
            KP
Sbjct  275  KP  276



>tpg|DAA61162.1| TPA: voltage-dependent anion-selective channel protein [Zea mays]
Length=276

 Score =   266 bits (679),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 121/182 (66%), Positives = 152/182 (84%), Gaps = 0/182 (0%)
 Frame = -2

Query  725  SFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGA  546
            SF VPDQRSGKVELQYLHD+AG++ SV LTANP+ N S   GT ALA+G ++SFD+ +G 
Sbjct  95   SFAVPDQRSGKVELQYLHDYAGVNASVSLTANPVANLSAAFGTKALAVGAEISFDSATGN  154

Query  545  FTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTIT  366
            FTKYNAGL FT+ DLIASL +N+KGD+L+ +YYH V+ L+NTAVGAE+ HSFS+N NT+T
Sbjct  155  FTKYNAGLMFTHEDLIASLNMNNKGDNLTGAYYHKVSELTNTAVGAELTHSFSTNENTLT  214

Query  365  VGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALAL  186
             G QH LDPLT +KAR+NN G+A+ LIQHEWRPKSL+T+S EVD K ++KS+K G+A+AL
Sbjct  215  FGGQHTLDPLTVLKARINNSGKASVLIQHEWRPKSLVTISAEVDTKTIEKSSKVGIAVAL  274

Query  185  KP  180
            KP
Sbjct  275  KP  276



>ref|NP_001062983.1| Os09g0361400 [Oryza sativa Japonica Group]
 sp|Q6K548.3|VDAC1_ORYSJ RecName: Full=Mitochondrial outer membrane protein porin 1; AltName: 
Full=Voltage-dependent anion-selective channel protein 
1; Short=OsVDAC1 [Oryza sativa Japonica Group]
 emb|CAB82853.1| voltage-dependent anion channel [Oryza sativa]
 dbj|BAD23330.1| voltage-dependent anion channel [Oryza sativa Japonica Group]
 dbj|BAF24897.1| Os09g0361400 [Oryza sativa Japonica Group]
 dbj|BAG87823.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG87525.1| unnamed protein product [Oryza sativa Japonica Group]
Length=274

 Score =   265 bits (677),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 130/182 (71%), Positives = 152/182 (84%), Gaps = 1/182 (1%)
 Frame = -2

Query  725  SFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGA  546
            SF VPDQRSGK ELQY HD+AG+S S+GLTA+P+VN S V GT ALA+G DVS DT +G 
Sbjct  94   SFAVPDQRSGKFELQYSHDYAGVSASIGLTASPVVNLSSVFGTKALAVGADVSLDTATGN  153

Query  545  FTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTIT  366
             TKYNAGLSF+N DLIASL LN+KGDSL+ASYYH VN  S TAVGAE+ HSFSSN N++T
Sbjct  154  LTKYNAGLSFSNDDLIASLNLNNKGDSLTASYYHIVNH-SATAVGAELTHSFSSNENSLT  212

Query  365  VGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALAL  186
             GTQH LDPLT VKAR NN G+A+AL+QHEWRPKS+ T+S EVD KA+DKS+K G+A+AL
Sbjct  213  FGTQHTLDPLTVVKARFNNSGKASALLQHEWRPKSVWTISAEVDTKAIDKSSKVGIAVAL  272

Query  185  KP  180
            KP
Sbjct  273  KP  274



>gb|EAZ44453.1| hypothetical protein OsJ_29066 [Oryza sativa Japonica Group]
Length=274

 Score =   265 bits (677),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 130/182 (71%), Positives = 151/182 (83%), Gaps = 1/182 (1%)
 Frame = -2

Query  725  SFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGA  546
            SF VPDQRSGK ELQY HD+AG+S S+GLTA+P+VN S V GT ALA+G DVS DT +G 
Sbjct  94   SFAVPDQRSGKFELQYSHDYAGVSASIGLTASPVVNLSSVFGTKALAVGADVSLDTATGN  153

Query  545  FTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTIT  366
             TKYNAGLSF+N DLIASL LN+KGDSL+ASYYH VN  S TAVGAE+ HSFSSN N++T
Sbjct  154  LTKYNAGLSFSNDDLIASLNLNNKGDSLTASYYHIVNH-SATAVGAELTHSFSSNENSLT  212

Query  365  VGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALAL  186
             GTQH LDPLT VKAR NN G+A AL+QHEWRPKS+ T+S EVD KA+DKS+K G+A+AL
Sbjct  213  FGTQHTLDPLTVVKARFNNSGKARALLQHEWRPKSVWTISAEVDTKAIDKSSKVGIAVAL  272

Query  185  KP  180
            KP
Sbjct  273  KP  274



>ref|NP_001104948.1| voltage-dependent anion channel protein1b [Zea mays]
 gb|AAD56652.1|AF178951_1 voltage-dependent anion channel protein 1b [Zea mays]
Length=276

 Score =   264 bits (675),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 121/182 (66%), Positives = 152/182 (84%), Gaps = 0/182 (0%)
 Frame = -2

Query  725  SFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGA  546
            SF VPDQRSGKVELQYLHD+AG++ SV LTANP+ N S   GT ALA+G ++SFD+ +G 
Sbjct  95   SFAVPDQRSGKVELQYLHDYAGVNASVSLTANPVANLSAGFGTKALAVGAEISFDSATGN  154

Query  545  FTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTIT  366
            FTKYNAGL FT+ DLIASL +N+KGD+L+ +YYH V+ L+NTAVGAE+ HSFS+N NT+T
Sbjct  155  FTKYNAGLMFTHEDLIASLNMNNKGDNLTGAYYHKVSELTNTAVGAELTHSFSTNENTLT  214

Query  365  VGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALAL  186
             G QH LDPLT +KAR+NN G+A+ LIQHEWRPKSL+T+S EVD K ++KS+K G+A+AL
Sbjct  215  FGGQHTLDPLTVLKARINNSGKASVLIQHEWRPKSLVTISAEVDTKTIEKSSKVGIAVAL  274

Query  185  KP  180
            KP
Sbjct  275  KP  276



>gb|AFK34190.1| unknown [Medicago truncatula]
 gb|KEH24972.1| porin/voltage-dependent anion-selective channel protein [Medicago 
truncatula]
Length=278

 Score =   264 bits (675),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 123/184 (67%), Positives = 154/184 (84%), Gaps = 2/184 (1%)
 Frame = -2

Query  725  SFRVPDQ--RSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKS  552
            SFR+P+   +SGK E+QYLHD+AGIS S+GLTANP+ NFSGV+G N +ALG D+S+DTK+
Sbjct  95   SFRIPEPELKSGKAEVQYLHDYAGISASIGLTANPVANFSGVIGNNVVALGGDLSYDTKT  154

Query  551  GAFTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNT  372
            G FT+ NAGL+FT  DLIASLTLN+K ++L+ASYYH VNP++ TAVGAEV+H FS+  NT
Sbjct  155  GVFTRLNAGLNFTKDDLIASLTLNEKANALNASYYHVVNPVTKTAVGAEVSHRFSTKENT  214

Query  371  ITVGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLAL  192
            +T+GTQH +D LTT K R NNFG A+ LIQHEWRPKS  T+SGEVD KA++KSA+ G+AL
Sbjct  215  LTLGTQHAIDSLTTAKLRFNNFGLASGLIQHEWRPKSFFTISGEVDTKAIEKSARIGIAL  274

Query  191  ALKP  180
            ALKP
Sbjct  275  ALKP  278



>ref|XP_004514771.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa-like 
[Cicer arietinum]
Length=276

 Score =   264 bits (674),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 125/182 (69%), Positives = 156/182 (86%), Gaps = 0/182 (0%)
 Frame = -2

Query  725  SFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGA  546
            SF  PDQ S KVELQY H++ GI+TS+GLTA+PIVNFS V+G N +++G+DVSFDT SG 
Sbjct  95   SFIFPDQNSAKVELQYQHEYVGINTSIGLTASPIVNFSSVIGNNLVSVGSDVSFDTASGN  154

Query  545  FTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTIT  366
            F KYNAGL+ T++DLIASLT+NDKGD+L+ASYYH V+PL+NTAVGAE++ SFSSN N +T
Sbjct  155  FIKYNAGLNVTHADLIASLTINDKGDTLNASYYHVVSPLTNTAVGAELSRSFSSNENLLT  214

Query  365  VGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALAL  186
            +GTQH LDP+T +KARVNN+GRA+ALIQH+W P++ I+L GEVD  A+ KSAK GLALAL
Sbjct  215  IGTQHALDPITLLKARVNNYGRASALIQHDWNPRTRISLVGEVDTVAIQKSAKVGLALAL  274

Query  185  KP  180
            KP
Sbjct  275  KP  276



>sp|P46274.1|VDAC1_WHEAT RecName: Full=Mitochondrial outer membrane porin; AltName: Full=Voltage-dependent 
anion-selective channel protein; Short=VDAC 
[Triticum aestivum]
 emb|CAA54788.1| voltage dependent anion channel (VDAC) [Triticum aestivum]
Length=275

 Score =   264 bits (674),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 128/182 (70%), Positives = 152/182 (84%), Gaps = 1/182 (1%)
 Frame = -2

Query  725  SFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGA  546
            SF VPDQ+SGKVELQYLHD+AGI+ S+GLTANP+VN SG  GT+ALA+G DVS DT +  
Sbjct  95   SFAVPDQKSGKVELQYLHDYAGINASIGLTANPVVNLSGAFGTSALAVGADVSLDTATKN  154

Query  545  FTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTIT  366
            F KYNA LS+TN DLIASL LN+KGDSL+ASYYH V   S TAVGAE+ HSFSSN N++T
Sbjct  155  FAKYNAALSYTNQDLIASLNLNNKGDSLTASYYHIVEK-SGTAVGAELTHSFSSNENSLT  213

Query  365  VGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALAL  186
             GTQH LDPLT VKAR+NN G+A+ALIQHE+ PKSL T+S EVD KA++KS+K G+A+AL
Sbjct  214  FGTQHTLDPLTLVKARINNSGKASALIQHEFMPKSLCTISAEVDTKAIEKSSKVGIAIAL  273

Query  185  KP  180
            KP
Sbjct  274  KP  275



>gb|ABK24200.1| unknown [Picea sitchensis]
Length=276

 Score =   263 bits (673),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 123/182 (68%), Positives = 151/182 (83%), Gaps = 0/182 (0%)
 Frame = -2

Query  725  SFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGA  546
            SF VPDQRSGKVELQYLHD+AG+STS+GLT +PI +FSGV+G +  ++G +VSFDT SG 
Sbjct  95   SFTVPDQRSGKVELQYLHDYAGVSTSIGLTPSPITHFSGVIGNDTFSVGGEVSFDTASGN  154

Query  545  FTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTIT  366
            F KY+AGLSF+  D ++SLTL  KGD+L ASY H V+PL+ TAVGAE++HSFS + NT T
Sbjct  155  FLKYDAGLSFSKPDFVSSLTLTGKGDTLKASYLHTVSPLTKTAVGAEISHSFSRSENTFT  214

Query  365  VGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALAL  186
            +GTQH LDPLTTVK R+NN+G+A AL+QHEWRPKS +TLSGEVD KA+  SAK GL+L L
Sbjct  215  IGTQHALDPLTTVKGRLNNYGKAAALLQHEWRPKSFVTLSGEVDTKALHNSAKVGLSLIL  274

Query  185  KP  180
            KP
Sbjct  275  KP  276



>gb|EPS68383.1| hypothetical protein M569_06388 [Genlisea aurea]
Length=278

 Score =   263 bits (672),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 122/182 (67%), Positives = 152/182 (84%), Gaps = 0/182 (0%)
 Frame = -2

Query  725  SFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGA  546
            S   PDQ+SGKVELQY H++AGISTS+ LTA PIVNFSGV G   +  GTDVSFDT +G 
Sbjct  97   SITAPDQKSGKVELQYFHEYAGISTSLFLTAKPIVNFSGVAGNKNVFFGTDVSFDTATGN  156

Query  545  FTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTIT  366
            FTKYNAG+SFT +DLIASL LNDKG+ ++ASY+H V+PL+NTAVGAE  H+ ++  N + 
Sbjct  157  FTKYNAGISFTTADLIASLNLNDKGEKITASYFHTVSPLTNTAVGAEFTHNLTTKENVVF  216

Query  365  VGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALAL  186
            VGTQH LDPLT VK R+N++G+A+A+IQHEWRPKSLIT+SGEVD +A++K+AK GLA+AL
Sbjct  217  VGTQHLLDPLTAVKGRLNSYGQASAVIQHEWRPKSLITISGEVDTRAIEKTAKIGLAVAL  276

Query  185  KP  180
            KP
Sbjct  277  KP  278



>gb|EAZ08792.1| hypothetical protein OsI_31052 [Oryza sativa Indica Group]
Length=274

 Score =   263 bits (671),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 129/182 (71%), Positives = 152/182 (84%), Gaps = 1/182 (1%)
 Frame = -2

Query  725  SFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGA  546
            SF VPDQRSGK ELQY HD+AG+S S+GLTA+P+VN S V GT ALA+G DVS DT +G 
Sbjct  94   SFAVPDQRSGKFELQYSHDYAGVSASIGLTASPVVNLSSVFGTKALAVGADVSLDTATGN  153

Query  545  FTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTIT  366
             TKYNAGLSF+N DLIASL+LN+KGDSL+ASYYH VN  S TAVGAE+ HSFSSN N++T
Sbjct  154  LTKYNAGLSFSNDDLIASLSLNNKGDSLTASYYHIVNH-SATAVGAELTHSFSSNENSLT  212

Query  365  VGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALAL  186
             GTQH LDPLT VKA  NN G+A+AL+QHEWRPKS+ T+S EVD KA+DKS+K G+A+AL
Sbjct  213  FGTQHTLDPLTVVKAHFNNSGKASALLQHEWRPKSVWTISAEVDTKAIDKSSKVGIAVAL  272

Query  185  KP  180
            KP
Sbjct  273  KP  274



>gb|AAM62480.1| voltage-dependent anion-selective channel protein hsr2 [Arabidopsis 
thaliana]
Length=274

 Score =   261 bits (668),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 126/180 (70%), Positives = 150/180 (83%), Gaps = 2/180 (1%)
 Frame = -2

Query  719  RVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFT  540
            ++PD +SGK E+QY HD+AGISTSVG TA PIVNFSGVVGTN L+LGTDV+++T+SG F 
Sbjct  97   KLPDHKSGKAEVQYFHDYAGISTSVGFTATPIVNFSGVVGTNGLSLGTDVAYNTESGNFK  156

Query  539  KYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVG  360
             +NAG +FT  DL ASL LNDKG+ L+ASYY  V+P  +T VGAE++H+F++  N ITVG
Sbjct  157  HFNAGFNFTKDDLTASLILNDKGEKLNASYYQIVSP--STVVGAEISHNFTTKENAITVG  214

Query  359  TQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  180
            TQH LDPLTTVKARVNN G ANALIQHEWRPKS  T+SGEVD KA+DKSAK G+ALALKP
Sbjct  215  TQHALDPLTTVKARVNNAGVANALIQHEWRPKSFFTVSGEVDSKAIDKSAKVGIALALKP  274



>ref|NP_197013.1| voltage dependent anion channel 3 [Arabidopsis thaliana]
 ref|NP_001190314.1| voltage dependent anion channel 3 [Arabidopsis thaliana]
 sp|Q9SMX3.3|VDAC3_ARATH RecName: Full=Mitochondrial outer membrane protein porin 3; AltName: 
Full=Protein HYPERSENSITIVE RESPONSE 2; Short=Athsr2; 
AltName: Full=Voltage-dependent anion-selective channel protein 
3; Short=AtVDAC3; Short=VDAC-3 [Arabidopsis thaliana]
 emb|CAA10363.1| voltage-dependent anion-selective channel protein [Arabidopsis 
thaliana]
 emb|CAC01828.1| voltage-dependent anion-selective channel protein hsr2 [Arabidopsis 
thaliana]
 gb|AAL36247.1| putative voltage-dependent anion-selective channel protein hsr2 
[Arabidopsis thaliana]
 gb|AAM67451.1| putative voltage-dependent anion-selective channel protein hsr2 
[Arabidopsis thaliana]
 gb|AED92115.1| voltage dependent anion channel 3 [Arabidopsis thaliana]
 gb|AED92116.1| voltage dependent anion channel 3 [Arabidopsis thaliana]
Length=274

 Score =   261 bits (668),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 126/180 (70%), Positives = 150/180 (83%), Gaps = 2/180 (1%)
 Frame = -2

Query  719  RVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFT  540
            ++PD +SGK E+QY HD+AGISTSVG TA PIVNFSGVVGTN L+LGTDV+++T+SG F 
Sbjct  97   KLPDHKSGKAEVQYFHDYAGISTSVGFTATPIVNFSGVVGTNGLSLGTDVAYNTESGNFK  156

Query  539  KYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVG  360
             +NAG +FT  DL ASL LNDKG+ L+ASYY  V+P  +T VGAE++H+F++  N ITVG
Sbjct  157  HFNAGFNFTKDDLTASLILNDKGEKLNASYYQIVSP--STVVGAEISHNFTTKENAITVG  214

Query  359  TQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  180
            TQH LDPLTTVKARVNN G ANALIQHEWRPKS  T+SGEVD KA+DKSAK G+ALALKP
Sbjct  215  TQHALDPLTTVKARVNNAGVANALIQHEWRPKSFFTVSGEVDSKAIDKSAKVGIALALKP  274



>gb|KJB31318.1| hypothetical protein B456_005G186100, partial [Gossypium raimondii]
Length=247

 Score =   260 bits (665),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 130/181 (72%), Positives = 150/181 (83%), Gaps = 8/181 (4%)
 Frame = -2

Query  722  FRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAF  543
            FRV DQRS K        +AGIS+S+GLTANPIVN SGV+GTN LALGTD+SFDTK+  F
Sbjct  75   FRVSDQRSCK--------YAGISSSIGLTANPIVNLSGVLGTNVLALGTDISFDTKTKNF  126

Query  542  TKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITV  363
            TK NA LSFTN+DLIASL LN+KG+S++ASYYH VNP +NT VG EV HSFS+NVNTITV
Sbjct  127  TKCNARLSFTNADLIASLALNEKGNSINASYYHIVNPSTNTVVGVEVTHSFSTNVNTITV  186

Query  362  GTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALK  183
            GTQH LDPLTT KARVN+ G+A+ LIQH+WRPKSL T+S EVD K++DKS K GLALALK
Sbjct  187  GTQHVLDPLTTTKARVNHAGKASTLIQHKWRPKSLFTISREVDTKSIDKSPKVGLALALK  246

Query  182  P  180
            P
Sbjct  247  P  247



>gb|KJB30164.1| hypothetical protein B456_005G132100 [Gossypium raimondii]
Length=335

 Score =   263 bits (673),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 129/185 (70%), Positives = 154/185 (83%), Gaps = 4/185 (2%)
 Frame = -2

Query  722  FRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAF  543
            F+VPDQRSGK++LQYL+++A IS+S+GLT NPIVNFSGV GTN LALGTD+SF+ K G F
Sbjct  151  FKVPDQRSGKIKLQYLYEYARISSSIGLTTNPIVNFSGVFGTNVLALGTDISFNMKFGNF  210

Query  542  TKYNAGLSFTNSDLIASLTL----NDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVN  375
            TK NAGLSFTN+DLIASL L    N+KGDS++ASYYH VNP +N  VGAEV +SF++NVN
Sbjct  211  TKCNAGLSFTNADLIASLALHVVMNEKGDSVNASYYHIVNPSTNIVVGAEVTYSFTTNVN  270

Query  374  TITVGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLA  195
            TITVGTQ+ LDPLTT+KA VNN    +ALIQHEW  KSL T+ GEVD +++DKS K GLA
Sbjct  271  TITVGTQYALDPLTTIKAWVNNASMVSALIQHEWLSKSLFTIYGEVDTESIDKSPKVGLA  330

Query  194  LALKP  180
            LALKP
Sbjct  331  LALKP  335



>pir||B55017 porin, plastid - garden pea
Length=275

 Score =   256 bits (655),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 120/181 (66%), Positives = 148/181 (82%), Gaps = 0/181 (0%)
 Frame = -2

Query  725  SFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGA  546
            S +VP+QRSGK+E QYLH++AG++ SVGL +NP+VN SG  G+ AL++G DVSFDT +  
Sbjct  95   SEKVPEQRSGKLEFQYLHEYAGVNASVGLNSNPMVNLSGAFGSKALSVGVDVSFDTATSD  154

Query  545  FTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTIT  366
            FTKYNA ++F    LI SLTLN+KGD LSASYYH +NPLSNTAVG +++H FS+  N  T
Sbjct  155  FTKYNAAVNFVKDSLIGSLTLNEKGDLLSASYYHAINPLSNTAVGVDISHRFSTKENDFT  214

Query  365  VGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALAL  186
            +GTQH LDPLTTVK RV N G+A+ALIQHEWRPKSLIT+S EVD KA++KSAK GL+LAL
Sbjct  215  LGTQHALDPLTTVKGRVTNSGKASALIQHEWRPKSLITISSEVDTKAIEKSAKIGLSLAL  274

Query  185  K  183
            K
Sbjct  275  K  275



>emb|CAA57647.1| Voltage dependent anion channel (VDAC) [Triticum aestivum]
Length=273

 Score =   256 bits (653),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 129/184 (70%), Positives = 146/184 (79%), Gaps = 4/184 (2%)
 Frame = -2

Query  725  SFRVPDQRS--GKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKS  552
            S   P Q+S  GK ELQYLH H GI+ SVGL +NP+VNFSGV+GT A A G DV+FDT S
Sbjct  92   SLPFPYQKSTPGKAELQYLHPHLGINGSVGLNSNPLVNFSGVIGTKAFAFGVDVAFDTAS  151

Query  551  GAFTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNT  372
            G FTKYNAGLS TN DL ASL LN+K ++L+ASYYH V     TAVGAE+ HSFSSN NT
Sbjct  152  GDFTKYNAGLSHTNQDLTASLNLNNKVNTLAASYYHQVQ--RTTAVGAEIAHSFSSNENT  209

Query  371  ITVGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLAL  192
            IT+GTQH+LDPLTTVK R NNFG A+ALIQH WRPKSLIT S EVD KA++KS KFGLAL
Sbjct  210  ITIGTQHELDPLTTVKGRYNNFGVASALIQHAWRPKSLITFSTEVDTKAIEKSPKFGLAL  269

Query  191  ALKP  180
            +LKP
Sbjct  270  SLKP  273



>dbj|BAJ99317.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ86472.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=290

 Score =   254 bits (649),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 129/184 (70%), Positives = 146/184 (79%), Gaps = 4/184 (2%)
 Frame = -2

Query  725  SFRVPDQRS--GKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKS  552
            S   P Q+S  GK ELQYLH H GI+ SVGL  NP+VN SGV+GT ALA G DV+FDT S
Sbjct  109  SLPFPYQKSTPGKAELQYLHPHLGINGSVGLNPNPLVNISGVIGTKALAFGLDVAFDTAS  168

Query  551  GAFTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNT  372
            G FTKYNAG+S TN DL ASL LN+KG++L+ASYYH V     TAVGAE+ HSFSSN NT
Sbjct  169  GDFTKYNAGMSHTNQDLTASLMLNNKGNTLAASYYHQVQ--LTTAVGAEIAHSFSSNENT  226

Query  371  ITVGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLAL  192
            ITVGTQH+LDPLTT+K R NNFG A+ALIQH WRPKS+IT S EVD KAV+KS KFGLAL
Sbjct  227  ITVGTQHELDPLTTLKGRYNNFGIASALIQHAWRPKSVITFSTEVDTKAVEKSPKFGLAL  286

Query  191  ALKP  180
            +LKP
Sbjct  287  SLKP  290



>ref|NP_001043433.1| Os01g0588200 [Oryza sativa Japonica Group]
 sp|Q7F4F8.1|VDAC3_ORYSJ RecName: Full=Mitochondrial outer membrane protein porin 3; AltName: 
Full=Voltage-dependent anion-selective channel protein 
3; Short=OsVDAC3 [Oryza sativa Japonica Group]
 emb|CAC80851.1| voltage-dependent anion channel [Oryza sativa Japonica Group]
 dbj|BAB89921.1| putative porin [Oryza sativa Japonica Group]
 dbj|BAF05347.1| Os01g0588200 [Oryza sativa Japonica Group]
 gb|EAY74735.1| hypothetical protein OsI_02626 [Oryza sativa Indica Group]
 gb|EAZ12509.1| hypothetical protein OsJ_02405 [Oryza sativa Japonica Group]
 dbj|BAG92122.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96666.1| unnamed protein product [Oryza sativa Japonica Group]
Length=275

 Score =   253 bits (647),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 123/181 (68%), Positives = 148/181 (82%), Gaps = 0/181 (0%)
 Frame = -2

Query  725  SFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGA  546
            S  VPDQRSGK+ELQYLH++AGI+ SVGL +NP+VN SGV G+  L++G DV+FDT +  
Sbjct  94   SLVVPDQRSGKLELQYLHEYAGINASVGLNSNPMVNLSGVFGSKELSVGVDVAFDTATSN  153

Query  545  FTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTIT  366
            FTKYNA LS TNSDLIASL LN+ GD+L ASYYH V   SNTAVGAE++HSFS N +T+ 
Sbjct  154  FTKYNAALSLTNSDLIASLHLNNHGDTLIASYYHLVKHHSNTAVGAELSHSFSRNESTLI  213

Query  365  VGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALAL  186
             G+QH LDP TTVKAR NN+G A+AL+QHEWRPKSLIT+SGEVD KA++KS K GL+L L
Sbjct  214  FGSQHSLDPHTTVKARFNNYGMASALVQHEWRPKSLITISGEVDTKAIEKSTKVGLSLVL  273

Query  185  K  183
            K
Sbjct  274  K  274



>ref|NP_001104949.1| voltage-dependent anion channel protein2 [Zea mays]
 gb|AAD56653.1|AF178952_1 voltage-dependent anion channel protein 2 [Zea mays]
 gb|ACF85067.1| unknown [Zea mays]
 gb|ACG34248.1| outer mitochondrial membrane protein porin [Zea mays]
 gb|AFW78894.1| outer membrane protein porinVoltage-dependent anion channel protein 
2 [Zea mays]
Length=276

 Score =   253 bits (647),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 120/178 (67%), Positives = 146/178 (82%), Gaps = 2/178 (1%)
 Frame = -2

Query  713  PDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKY  534
            P Q+S K ELQYLH HAG++ SVGL ANP+VN SGV GT A+A+G D +FDT SG  TKY
Sbjct  101  PYQKSAKAELQYLHHHAGVAASVGLNANPVVNLSGVFGTKAIAVGADAAFDTSSGDLTKY  160

Query  533  NAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQ  354
            NAGLS+T  D +A+ TLN+KGD+++ASYYH V+P   TAVG E++HSFS+N NTIT GTQ
Sbjct  161  NAGLSYTTPDFVAAATLNNKGDNIAASYYHSVSP--TTAVGGELSHSFSTNGNTITFGTQ  218

Query  353  HQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  180
            H LDPLTTVKAR NN+G A+ALIQHEWRPKSL+T+S EVD KA++KS+K GL+L LKP
Sbjct  219  HALDPLTTVKARFNNYGMASALIQHEWRPKSLVTISTEVDTKAIEKSSKVGLSLVLKP  276



>ref|XP_004961383.1| PREDICTED: mitochondrial outer membrane protein porin 2-like 
[Setaria italica]
Length=276

 Score =   253 bits (646),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 122/178 (69%), Positives = 143/178 (80%), Gaps = 2/178 (1%)
 Frame = -2

Query  713  PDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKY  534
            P Q+S K ELQYLH HAG++ SVGL ANP+VN SGV GT  +A+G D SFDT SG  TKY
Sbjct  101  PYQKSAKAELQYLHHHAGVAASVGLNANPVVNLSGVFGTKTIAVGADASFDTSSGDLTKY  160

Query  533  NAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQ  354
            NAGLS+   D +A+ TLN+KGDSL+ASYYH VN  S TAVG E+ HSFSSN NT+T GTQ
Sbjct  161  NAGLSYNAGDFVAAATLNNKGDSLAASYYHLVN--STTAVGGELTHSFSSNENTLTFGTQ  218

Query  353  HQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  180
            H LDPLTTVKAR NN+G A+ALIQHEWRPKSL+T+S EVD KA++KS+K GL+L LKP
Sbjct  219  HALDPLTTVKARFNNYGMASALIQHEWRPKSLVTISTEVDTKAIEKSSKVGLSLVLKP  276



>ref|XP_002440144.1| hypothetical protein SORBIDRAFT_09g026790 [Sorghum bicolor]
 gb|EES18574.1| hypothetical protein SORBIDRAFT_09g026790 [Sorghum bicolor]
Length=276

 Score =   251 bits (642),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 119/178 (67%), Positives = 145/178 (81%), Gaps = 2/178 (1%)
 Frame = -2

Query  713  PDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKY  534
            P Q+S K ELQYLH HAG++ SVGL ANP+VN SGV GT  +A+G D ++DT SG  TKY
Sbjct  101  PYQKSAKAELQYLHHHAGVAASVGLNANPVVNLSGVFGTKTIAVGADAAYDTSSGDLTKY  160

Query  533  NAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQ  354
            NAGLS+T SD +A+ TLN KGD+++ASYYH V+P   TAVG E++HSFS+N NTIT GTQ
Sbjct  161  NAGLSYTTSDFVAAATLNHKGDNIAASYYHLVSP--TTAVGGELSHSFSTNGNTITFGTQ  218

Query  353  HQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  180
            H LDPLTTVKAR NN+G A+ALIQHEWRPKSL+T+S EVD KA++KS+K GL+L LKP
Sbjct  219  HALDPLTTVKARFNNYGMASALIQHEWRPKSLVTISAEVDTKAIEKSSKVGLSLVLKP  276



>ref|XP_006646048.1| PREDICTED: mitochondrial outer membrane protein porin 3-like 
[Oryza brachyantha]
Length=275

 Score =   251 bits (642),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 120/181 (66%), Positives = 148/181 (82%), Gaps = 0/181 (0%)
 Frame = -2

Query  725  SFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGA  546
            S  VPDQRSGK+ELQYLH++AGI+ SVGL +NP+VN SGV G+  L++G DV+FDT +  
Sbjct  94   SLVVPDQRSGKLELQYLHEYAGINASVGLNSNPMVNLSGVFGSKELSVGVDVAFDTATSN  153

Query  545  FTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTIT  366
            FTKYNA LS TNS+LIAS+ LN+ GD+L+ SYYH V   SNTAVGAE++HSFS N +T+ 
Sbjct  154  FTKYNAALSLTNSELIASMHLNNHGDTLTTSYYHLVKHHSNTAVGAELSHSFSRNESTLI  213

Query  365  VGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALAL  186
             G+QH LDP TTVKAR NN+G A+AL+QHEWRPKSLIT+SGEVD KA++KS K GL+L L
Sbjct  214  FGSQHSLDPHTTVKARFNNYGMASALVQHEWRPKSLITISGEVDTKAIEKSTKVGLSLVL  273

Query  185  K  183
            K
Sbjct  274  K  274



>gb|ACJ85279.1| unknown [Medicago truncatula]
 gb|AFK33360.1| unknown [Medicago truncatula]
 gb|KEH19832.1| porin/voltage-dependent anion-selective channel protein [Medicago 
truncatula]
Length=276

 Score =   251 bits (640),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 118/182 (65%), Positives = 153/182 (84%), Gaps = 0/182 (0%)
 Frame = -2

Query  725  SFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGA  546
            SF  P+Q+SGKVELQYLHD+AGISTS+GLTA P VN S V+G N +++G+DVSF+T SG+
Sbjct  95   SFIYPEQKSGKVELQYLHDYAGISTSIGLTATPTVNISAVLGNNLVSVGSDVSFETSSGS  154

Query  545  FTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTIT  366
              K N GL+ T++DLIASLT+ND+GDSL+ASYYH V+PL+NTAVGAE++HSFSSN N +T
Sbjct  155  LNKCNFGLNVTHADLIASLTVNDRGDSLNASYYHVVSPLTNTAVGAELSHSFSSNENVLT  214

Query  365  VGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALAL  186
            +GTQH LDP+T +KA+VNN+G+A+ALIQH+W  ++  +L GEVD  A+ K+AK GLA AL
Sbjct  215  IGTQHALDPVTLLKAKVNNYGKASALIQHDWSRQARFSLVGEVDTAAIQKTAKVGLACAL  274

Query  185  KP  180
            KP
Sbjct  275  KP  276



>ref|XP_010231957.1| PREDICTED: mitochondrial outer membrane protein porin 3 [Brachypodium 
distachyon]
Length=275

 Score =   251 bits (640),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 120/181 (66%), Positives = 146/181 (81%), Gaps = 0/181 (0%)
 Frame = -2

Query  725  SFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGA  546
            S  VPDQRSGK+E QYLH+ AGI+ +VGL  NP+VN SGV G+  L++G DVSFDT +  
Sbjct  94   SLVVPDQRSGKLEFQYLHEFAGINANVGLNPNPMVNLSGVFGSKELSVGVDVSFDTATSN  153

Query  545  FTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTIT  366
            FTKYNA LS TN DLIASL LN+ GD+L+ASYYH V P S+TAVGAE++HSFS N +T+ 
Sbjct  154  FTKYNAALSLTNPDLIASLHLNNHGDTLTASYYHLVKPHSSTAVGAELSHSFSRNESTLI  213

Query  365  VGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALAL  186
             G+QH LDP TTVKAR NN+G A+AL+QHEWRPKSL+T+SGEVD KA++KS K GL+L L
Sbjct  214  FGSQHSLDPHTTVKARFNNYGMASALVQHEWRPKSLVTISGEVDTKAIEKSTKVGLSLVL  273

Query  185  K  183
            K
Sbjct  274  K  274



>ref|XP_004969745.1| PREDICTED: mitochondrial outer membrane protein porin 4-like 
[Setaria italica]
Length=275

 Score =   250 bits (639),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 120/178 (67%), Positives = 145/178 (81%), Gaps = 0/178 (0%)
 Frame = -2

Query  713  PDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKY  534
            P+Q +GK E+QYLHD+AGI+ S GL + P+VN SGV GT A+A+G DV++DT +G FTKY
Sbjct  98   PNQAAGKAEVQYLHDYAGINASFGLNSKPLVNLSGVFGTKAIAVGADVAYDTATGDFTKY  157

Query  533  NAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQ  354
            NAGL+FTN+DLIAS+TLN+KGDSL+ASYYH VN   NTAVGAEV  SFSS  N +T GTQ
Sbjct  158  NAGLNFTNTDLIASVTLNNKGDSLTASYYHLVNAEKNTAVGAEVTRSFSSKKNIVTFGTQ  217

Query  353  HQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  180
            H LDP TTVKAR N+ G A+ALIQHEWRPKS +TL+ EVD KA +KS+K GL+L LKP
Sbjct  218  HALDPSTTVKARYNSNGMASALIQHEWRPKSFVTLTTEVDTKAFEKSSKVGLSLVLKP  275



>gb|KHG11726.1| Mitochondrial outer membrane porin of 34 kDa [Gossypium arboreum]
Length=205

 Score =   246 bits (628),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 121/168 (72%), Positives = 139/168 (83%), Gaps = 2/168 (1%)
 Frame = -2

Query  677  LHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDLI  498
            LH++ GIS+S+GLTANPIVNFSGV+GTN LAL  D SFDTK G FTK NAGLSFTN DLI
Sbjct  38   LHEYVGISSSIGLTANPIVNFSGVLGTNVLALRIDTSFDTKIGNFTKCNAGLSFTNVDLI  97

Query  497  ASLTL--NDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLTTVK  324
            A L L  N+KGDS++ASYYH VNP +N  VG EV HSFS+NVNTITVGTQH LDPLTT+K
Sbjct  98   ACLALHVNEKGDSVNASYYHIVNPSTNIVVGVEVTHSFSTNVNTITVGTQHALDPLTTIK  157

Query  323  ARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  180
            A+ NN G+A+ LIQHEW PKSL T+SGEVD +++DKS   GLALALKP
Sbjct  158  AQANNAGKASVLIQHEWHPKSLFTISGEVDTESIDKSPNVGLALALKP  205



>ref|XP_003621109.1| Outer plastidial membrane protein porin [Medicago truncatula]
 gb|AES77327.1| porin/voltage-dependent anion-selective channel protein [Medicago 
truncatula]
Length=277

 Score =   248 bits (634),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 116/182 (64%), Positives = 144/182 (79%), Gaps = 0/182 (0%)
 Frame = -2

Query  725  SFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGA  546
            S +VPD  SGKVELQYLHD+AGIS ++GL ANP+VN SGV GTNALA G D+S+DTK   
Sbjct  96   SCKVPDPASGKVELQYLHDYAGISGNIGLKANPVVNLSGVFGTNALAFGGDISYDTKLRE  155

Query  545  FTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTIT  366
             TK N G+SF   DL+ +LTLN+KGD L+ASYYH +NP++NTAVG ++ H FS+  N  T
Sbjct  156  LTKSNVGVSFIKDDLLGALTLNEKGDVLNASYYHVINPVTNTAVGVDMGHRFSTRENNFT  215

Query  365  VGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALAL  186
            +G QH LDPLTT+K R+ N  +A+ALIQHEWRPKSLIT+S E+D KA++KSAK GL+L L
Sbjct  216  LGVQHALDPLTTLKGRITNSAKASALIQHEWRPKSLITISTELDTKAIEKSAKVGLSLVL  275

Query  185  KP  180
            KP
Sbjct  276  KP  277



>gb|ACJ85253.1| unknown [Medicago truncatula]
Length=277

 Score =   248 bits (633),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 116/182 (64%), Positives = 144/182 (79%), Gaps = 0/182 (0%)
 Frame = -2

Query  725  SFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGA  546
            S +VPD  SGKVELQYLHD+AGIS ++GL ANP+VN SGV GTNALA G D+S+DTK   
Sbjct  96   SCKVPDPASGKVELQYLHDYAGISGNIGLKANPVVNLSGVFGTNALAFGGDISYDTKLRE  155

Query  545  FTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTIT  366
             TK N G+SF   DL+ +LTLN+KGD L+ASYYH +NP++NTAVG ++ H FS+  N  T
Sbjct  156  LTKSNVGVSFIKDDLLGALTLNEKGDVLNASYYHVINPVTNTAVGVDMGHRFSTRENNFT  215

Query  365  VGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALAL  186
            +G QH LDPLTT+K R+ N  +A+ALIQHEWRPKSLIT+S E+D KA++KSAK GL+L L
Sbjct  216  LGVQHALDPLTTLKGRITNSAKASALIQHEWRPKSLITISTELDTKAIEKSAKVGLSLVL  275

Query  185  KP  180
            KP
Sbjct  276  KP  277



>ref|XP_003568015.1| PREDICTED: mitochondrial outer membrane protein porin 2-like 
[Brachypodium distachyon]
Length=278

 Score =   246 bits (629),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 122/174 (70%), Positives = 140/174 (80%), Gaps = 2/174 (1%)
 Frame = -2

Query  701  SGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGL  522
            SGK ELQYLH HAGI+ SVGL ANP+VN SGV+GT  LA G DV+FDT SG FTKYNAG+
Sbjct  107  SGKAELQYLHAHAGINASVGLNANPLVNLSGVLGTKDLAFGADVAFDTASGDFTKYNAGV  166

Query  521  SFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLD  342
            S TN DL AS+ LN+KGD+L+ASYY  V    +TAVGAE+ HSFSSN NT+T+GTQH LD
Sbjct  167  SLTNEDLTASVVLNNKGDTLAASYYQQVK--GSTAVGAELAHSFSSNANTLTIGTQHALD  224

Query  341  PLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  180
            PLTTVK R NN G A+ALIQH WRP SL+T+S E D KA++KS KFGLALALKP
Sbjct  225  PLTTVKGRFNNNGIASALIQHAWRPNSLVTVSTEFDTKAMEKSPKFGLALALKP  278



>ref|NP_001056162.1| Os05g0536200 [Oryza sativa Japonica Group]
 sp|Q6L5I5.1|VDAC2_ORYSJ RecName: Full=Mitochondrial outer membrane protein porin 2; AltName: 
Full=Voltage-dependent anion-selective channel protein 
2; Short=OsVDAC2 [Oryza sativa Japonica Group]
 emb|CAC80850.1| voltage-dependent anion channel [Oryza sativa Japonica Group]
 gb|AAT39214.1| voltage-dependent anion-selective channel (VDAC) protein [Oryza 
sativa Japonica Group]
 dbj|BAF18076.1| Os05g0536200 [Oryza sativa Japonica Group]
 dbj|BAG92718.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC79592.1| hypothetical protein OsI_20774 [Oryza sativa Indica Group]
 gb|EEE64499.1| hypothetical protein OsJ_19349 [Oryza sativa Japonica Group]
Length=280

 Score =   246 bits (629),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 124/182 (68%), Positives = 146/182 (80%), Gaps = 2/182 (1%)
 Frame = -2

Query  725  SFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGA  546
            S   P Q+S K E+QYLH HAG++  VGL ANP+V+FSGV GT A A+GTDV+FDT +G 
Sbjct  101  SIPFPYQKSAKAEVQYLHPHAGLNAIVGLNANPLVSFSGVFGTGAFAVGTDVAFDTATGD  160

Query  545  FTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTIT  366
            FTKYNAGLS T  DL A+L LN+KGDSL+ASYYH V+  S  AVGAE+ HSFSSN NT+T
Sbjct  161  FTKYNAGLSHTTPDLTAALLLNNKGDSLAASYYHKVSKTS--AVGAELAHSFSSNENTLT  218

Query  365  VGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALAL  186
             GTQH LD LTTVKAR NNFG A+ALIQHE+RPKSL+T+S EVD KA+DKS+K GL+L L
Sbjct  219  FGTQHALDELTTVKARFNNFGMASALIQHEFRPKSLVTISTEVDTKAIDKSSKVGLSLVL  278

Query  185  KP  180
            KP
Sbjct  279  KP  280



>ref|XP_004969385.1| PREDICTED: mitochondrial outer membrane protein porin 3-like 
[Setaria italica]
Length=275

 Score =   246 bits (628),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 118/181 (65%), Positives = 145/181 (80%), Gaps = 0/181 (0%)
 Frame = -2

Query  725  SFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGA  546
            S  VPDQRSGK+ELQYLH++AG++ SVGL +NP+VN SGV G+  L++G DVSFDT +  
Sbjct  94   SLVVPDQRSGKLELQYLHEYAGVNASVGLNSNPMVNLSGVFGSKELSVGVDVSFDTATSN  153

Query  545  FTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTIT  366
            FTKYNA LS TN DLIASL LN+ GD++ ASYYH V   S TAVGAE++HSFS N +T+ 
Sbjct  154  FTKYNAALSLTNPDLIASLHLNNHGDTMVASYYHLVKHHSGTAVGAELSHSFSRNESTLI  213

Query  365  VGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALAL  186
             G+QH LDP TTVKAR NN+G A+AL+QHEWRPKS IT+SGEVD KA++KS K GL++ L
Sbjct  214  FGSQHSLDPHTTVKARFNNYGMASALVQHEWRPKSFITISGEVDTKAIEKSTKVGLSVVL  273

Query  185  K  183
            K
Sbjct  274  K  274



>gb|AFW82970.1| outer membrane protein porin, partial [Zea mays]
Length=206

 Score =   243 bits (621),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 116/178 (65%), Positives = 143/178 (80%), Gaps = 2/178 (1%)
 Frame = -2

Query  713  PDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKY  534
            P ++S K ELQYLH HAG++ SVGL ANP+V  SGV GT  +A+G DV+FDT SG  TKY
Sbjct  31   PYKKSAKAELQYLHHHAGVAASVGLNANPVVKLSGVFGTKTVAVGADVAFDTSSGNLTKY  90

Query  533  NAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQ  354
            NAGLS++ SD +A+ TLN+KGD ++ASYYH V+P   TAVG E++HSFS+N NTIT GTQ
Sbjct  91   NAGLSYSTSDFVAAATLNNKGDKIAASYYHSVSP--TTAVGGELSHSFSTNGNTITFGTQ  148

Query  353  HQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  180
            H LD LTTVKAR NN G A+ALIQH+WRPKSL+T+S EVD KA++KS+K GL+L LKP
Sbjct  149  HALDRLTTVKARFNNCGMASALIQHKWRPKSLVTISMEVDTKAIEKSSKIGLSLVLKP  206



>gb|AFK38338.1| unknown [Medicago truncatula]
Length=277

 Score =   246 bits (627),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 115/182 (63%), Positives = 143/182 (79%), Gaps = 0/182 (0%)
 Frame = -2

Query  725  SFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGA  546
            S +VPD  SGKVELQYLHD+AGIS ++GL ANP+VN SGV GTNALA G D+S+DTK   
Sbjct  96   SCKVPDPASGKVELQYLHDYAGISGNIGLKANPVVNLSGVFGTNALAFGGDISYDTKLRE  155

Query  545  FTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTIT  366
             TK N G+SF   DL+ +LTLN+KGD L+ASYYH +NP++NTAVG ++ H FS+  N  T
Sbjct  156  LTKSNVGVSFIKDDLLGALTLNEKGDVLNASYYHVINPVTNTAVGVDMGHRFSTRENNFT  215

Query  365  VGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALAL  186
            +G QH LDPLTT+K R+ N  +A+ALIQHEWRPKSLIT+  E+D KA++KSAK GL+L L
Sbjct  216  LGVQHALDPLTTLKGRITNSAKASALIQHEWRPKSLITIFTELDTKAIEKSAKVGLSLVL  275

Query  185  KP  180
            KP
Sbjct  276  KP  277



>gb|EMT20213.1| Mitochondrial outer membrane porin [Aegilops tauschii]
Length=902

 Score =   260 bits (664),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 130/184 (71%), Positives = 146/184 (79%), Gaps = 4/184 (2%)
 Frame = -2

Query  725  SFRVPDQRS--GKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKS  552
            S   P Q+S  GK ELQYLH H GI+ SVGL +NP+VNFSGV+GT A A G DV+FDT S
Sbjct  721  SLPFPYQKSTPGKAELQYLHPHLGINGSVGLNSNPLVNFSGVIGTKAFAFGVDVAFDTAS  780

Query  551  GAFTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNT  372
            G FTKYNAGLS TN DL ASL LN+K ++L+ASYYH V     TAVGAE+ HSFSSN NT
Sbjct  781  GDFTKYNAGLSHTNQDLTASLNLNNKANTLAASYYHQVQ--RTTAVGAEIAHSFSSNENT  838

Query  371  ITVGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLAL  192
            ITVGTQH+LDPLTTVK R NNFG A+ALIQH WRPKSLIT S EVD KA++KS KFGLAL
Sbjct  839  ITVGTQHELDPLTTVKGRYNNFGIASALIQHAWRPKSLITFSTEVDTKAIEKSPKFGLAL  898

Query  191  ALKP  180
            +LKP
Sbjct  899  SLKP  902



>gb|AFW82971.1| hypothetical protein ZEAMMB73_507543 [Zea mays]
Length=238

 Score =   243 bits (620),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 116/178 (65%), Positives = 143/178 (80%), Gaps = 2/178 (1%)
 Frame = -2

Query  713  PDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKY  534
            P ++S K ELQYLH HAG++ SVGL ANP+V  SGV GT  +A+G DV+FDT SG  TKY
Sbjct  63   PYKKSAKAELQYLHHHAGVAASVGLNANPVVKLSGVFGTKTVAVGADVAFDTSSGNLTKY  122

Query  533  NAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQ  354
            NAGLS++ SD +A+ TLN+KGD ++ASYYH V+P   TAVG E++HSFS+N NTIT GTQ
Sbjct  123  NAGLSYSTSDFVAAATLNNKGDKIAASYYHSVSP--TTAVGGELSHSFSTNGNTITFGTQ  180

Query  353  HQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  180
            H LD LTTVKAR NN G A+ALIQH+WRPKSL+T+S EVD KA++KS+K GL+L LKP
Sbjct  181  HALDRLTTVKARFNNCGMASALIQHKWRPKSLVTISMEVDTKAIEKSSKIGLSLVLKP  238



>emb|CDM83072.1| unnamed protein product [Triticum aestivum]
Length=275

 Score =   244 bits (623),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 117/182 (64%), Positives = 145/182 (80%), Gaps = 0/182 (0%)
 Frame = -2

Query  725  SFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGA  546
            S  VPDQRSGK+ELQYLH+ AG++ SVGL  NP+VN SGV G+  L++G DVSFDT +  
Sbjct  94   SLVVPDQRSGKLELQYLHEFAGVNASVGLNPNPMVNLSGVFGSKELSVGVDVSFDTATSN  153

Query  545  FTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTIT  366
            FTKYNA LS T  DLIASL LN+ GD+L+ASYYH V   S+TAVGAE++H+F  N +T+ 
Sbjct  154  FTKYNAALSLTYPDLIASLHLNNHGDTLTASYYHLVKSHSSTAVGAELSHNFPRNESTLI  213

Query  365  VGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALAL  186
             G+QH LDP T+VKAR NN+G A+AL+QHEWRPKSL+T+SGEVD KA++KS K GL+L L
Sbjct  214  FGSQHSLDPHTSVKARFNNYGMASALVQHEWRPKSLVTISGEVDTKAIEKSTKVGLSLVL  273

Query  185  KP  180
            KP
Sbjct  274  KP  275



>gb|EMS62963.1| Mitochondrial outer membrane protein porin [Triticum urartu]
Length=981

 Score =   259 bits (663),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 129/184 (70%), Positives = 146/184 (79%), Gaps = 4/184 (2%)
 Frame = -2

Query  725  SFRVPDQRS--GKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKS  552
            S   P Q+S  GK ELQYLH H GI+ SVGL +NP+VNFSGV+GT A A G DV+FDT S
Sbjct  800  SLPFPYQKSTPGKAELQYLHPHLGINGSVGLNSNPLVNFSGVIGTKAFAFGVDVAFDTAS  859

Query  551  GAFTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNT  372
            G FTKYNAGLS TN DL ASL LN+K ++L+ASYYH V     TAVGAE+ HSFSSN NT
Sbjct  860  GDFTKYNAGLSHTNQDLTASLNLNNKANTLAASYYHQVQ--RTTAVGAEIAHSFSSNENT  917

Query  371  ITVGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLAL  192
            IT+GTQH+LDPLTTVK R NNFG A+ALIQH WRPKSLIT S EVD KA++KS KFGLAL
Sbjct  918  ITIGTQHELDPLTTVKGRYNNFGVASALIQHAWRPKSLITFSTEVDTKAIEKSPKFGLAL  977

Query  191  ALKP  180
            +LKP
Sbjct  978  SLKP  981



>gb|EEC71387.1| hypothetical protein OsI_03508 [Oryza sativa Indica Group]
 gb|EEE55296.1| hypothetical protein OsJ_03247 [Oryza sativa Japonica Group]
Length=305

 Score =   244 bits (624),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 119/187 (64%), Positives = 143/187 (76%), Gaps = 0/187 (0%)
 Frame = -2

Query  740  LENHSSFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFD  561
            L+   S   P Q +GK ELQYLHD+AGIS  VGLT+ P+VN SGV G  ++A+G DV+ D
Sbjct  119  LKQIVSLPFPYQTAGKAELQYLHDYAGISLGVGLTSKPLVNLSGVFGNKSVAVGADVAVD  178

Query  560  TKSGAFTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSN  381
            T +G FTKY+AGL+  NSDL A LTLN+KGDSL+ASYYH VN  S TA GAE+ HSFS+ 
Sbjct  179  TSTGDFTKYDAGLTINNSDLAADLTLNNKGDSLTASYYHLVNKESGTAAGAELTHSFSTK  238

Query  380  VNTITVGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFG  201
             NT++ G QH LDPLTTVKAR NN G  +ALIQHEWRPKS +TLS EVD KA+DK++K G
Sbjct  239  ENTLSFGMQHALDPLTTVKARYNNHGMVSALIQHEWRPKSFLTLSAEVDTKAIDKASKVG  298

Query  200  LALALKP  180
            L+L LKP
Sbjct  299  LSLVLKP  305



>sp|Q0JJV1.3|VDAC4_ORYSJ RecName: Full=Mitochondrial outer membrane protein porin 4; AltName: 
Full=Voltage-dependent anion-selective channel protein 
4; Short=OsVDAC4 [Oryza sativa Japonica Group]
Length=317

 Score =   245 bits (625),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 119/187 (64%), Positives = 143/187 (76%), Gaps = 0/187 (0%)
 Frame = -2

Query  740  LENHSSFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFD  561
            L+   S   P Q +GK ELQYLHD+AGIS  VGLT+ P+VN SGV G  ++A+G DV+ D
Sbjct  131  LKQIVSLPFPYQTAGKAELQYLHDYAGISLGVGLTSKPLVNLSGVFGNKSVAVGADVAVD  190

Query  560  TKSGAFTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSN  381
            T +G FTKY+AGL+  NSDL A LTLN+KGDSL+ASYYH VN  S TA GAE+ HSFS+ 
Sbjct  191  TSTGDFTKYDAGLTINNSDLAADLTLNNKGDSLTASYYHLVNKESGTAAGAELTHSFSTK  250

Query  380  VNTITVGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFG  201
             NT++ G QH LDPLTTVKAR NN G  +ALIQHEWRPKS +TLS EVD KA+DK++K G
Sbjct  251  ENTLSFGMQHALDPLTTVKARYNNHGMVSALIQHEWRPKSFLTLSAEVDTKAIDKASKVG  310

Query  200  LALALKP  180
            L+L LKP
Sbjct  311  LSLVLKP  317



>ref|XP_006655528.1| PREDICTED: mitochondrial outer membrane protein porin 2-like 
[Oryza brachyantha]
Length=281

 Score =   243 bits (621),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 122/182 (67%), Positives = 143/182 (79%), Gaps = 2/182 (1%)
 Frame = -2

Query  725  SFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGA  546
            S   P Q+S K E+QYLH HAG++  VGL+ANP+V+FSG  GT A A+G DV+FDT +G 
Sbjct  102  SIPFPYQKSAKAEVQYLHPHAGLNACVGLSANPLVSFSGAFGTRAFAVGADVTFDTATGD  161

Query  545  FTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTIT  366
            FTKYNA LS T  DL ASL LN+KGDSL  SYYH V+ +S  AVGAE+ HSFSSN NT+T
Sbjct  162  FTKYNAALSHTTEDLTASLLLNNKGDSLVTSYYHSVSKVS--AVGAELAHSFSSNENTLT  219

Query  365  VGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALAL  186
             GTQH LD LTTVKAR NNFG A+ALIQHE+RPKSLIT+S EVD KA+DKS+K GL+L L
Sbjct  220  FGTQHALDELTTVKARFNNFGLASALIQHEFRPKSLITISTEVDTKAIDKSSKVGLSLVL  279

Query  185  KP  180
            KP
Sbjct  280  KP  281



>ref|NP_001044063.2| Os01g0715500 [Oryza sativa Japonica Group]
 dbj|BAF05977.2| Os01g0715500 [Oryza sativa Japonica Group]
Length=318

 Score =   244 bits (624),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 119/187 (64%), Positives = 143/187 (76%), Gaps = 0/187 (0%)
 Frame = -2

Query  740  LENHSSFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFD  561
            L+   S   P Q +GK ELQYLHD+AGIS  VGLT+ P+VN SGV G  ++A+G DV+ D
Sbjct  132  LKQIVSLPFPYQTAGKAELQYLHDYAGISLGVGLTSKPLVNLSGVFGNKSVAVGADVAVD  191

Query  560  TKSGAFTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSN  381
            T +G FTKY+AGL+  NSDL A LTLN+KGDSL+ASYYH VN  S TA GAE+ HSFS+ 
Sbjct  192  TSTGDFTKYDAGLTINNSDLAADLTLNNKGDSLTASYYHLVNKESGTAAGAELTHSFSTK  251

Query  380  VNTITVGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFG  201
             NT++ G QH LDPLTTVKAR NN G  +ALIQHEWRPKS +TLS EVD KA+DK++K G
Sbjct  252  ENTLSFGMQHALDPLTTVKARYNNHGMVSALIQHEWRPKSFLTLSAEVDTKAIDKASKVG  311

Query  200  LALALKP  180
            L+L LKP
Sbjct  312  LSLVLKP  318



>gb|ADE76112.1| unknown [Picea sitchensis]
Length=174

 Score =   239 bits (611),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 115/172 (67%), Positives = 136/172 (79%), Gaps = 0/172 (0%)
 Frame = -2

Query  695  KVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSF  516
            +VELQYLHD+AGISTS+GLTA P+V  S V+G   +ALG + +FDT SG FTKYNAGL+F
Sbjct  3    QVELQYLHDYAGISTSIGLTAAPVVETSVVIGNEGVALGGEFAFDTASGNFTKYNAGLNF  62

Query  515  TNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPL  336
               D I+SL L D+GD+L ASY H V+PL+ TAVGAE+ HS S N NT T+GTQH  DP 
Sbjct  63   VQPDFISSLNLTDRGDTLKASYLHTVSPLTKTAVGAEIAHSISRNENTFTMGTQHAFDPF  122

Query  335  TTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  180
            TTVKAR+NN G+  AL+QHEWRPKSLITLSGEVD KA+D SAK GL+L LKP
Sbjct  123  TTVKARLNNHGKVAALVQHEWRPKSLITLSGEVDSKALDNSAKIGLSLVLKP  174



>emb|CAA57646.1| Voltage dependent anion channel (VDAC) [Triticum aestivum]
Length=275

 Score =   242 bits (617),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 117/182 (64%), Positives = 144/182 (79%), Gaps = 0/182 (0%)
 Frame = -2

Query  725  SFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGA  546
            S  VPDQRSGK+ELQYLH+ AGI+ SVGL  NP+VN SGV G+  L++G DVSFDT +  
Sbjct  94   SLVVPDQRSGKLELQYLHEFAGINASVGLNPNPMVNLSGVFGSKELSVGVDVSFDTATSN  153

Query  545  FTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTIT  366
            FTKYNA LS T  DLIASL LN+ GD+L+ASYYH V   S+TAVGAE++H+F  N +T+ 
Sbjct  154  FTKYNAALSLTYPDLIASLHLNNHGDTLTASYYHLVKYTSSTAVGAELSHNFPRNESTLI  213

Query  365  VGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALAL  186
             G+QH LDP T+VKAR NN+G A+AL+QHEWR KSL+T+SGEVD KA++KS K GL+L L
Sbjct  214  FGSQHSLDPHTSVKARFNNYGMASALVQHEWRAKSLVTISGEVDTKAIEKSTKVGLSLVL  273

Query  185  KP  180
            KP
Sbjct  274  KP  275



>gb|EMS47295.1| Outer plastidial membrane protein porin [Triticum urartu]
Length=275

 Score =   242 bits (617),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 117/182 (64%), Positives = 144/182 (79%), Gaps = 0/182 (0%)
 Frame = -2

Query  725  SFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGA  546
            S  VPDQRSGK+ELQYLH+ AGI+ SVGL  NP+VN SGV G+  L++G DVSFDT +  
Sbjct  94   SLVVPDQRSGKLELQYLHEFAGINASVGLNPNPMVNLSGVFGSKELSVGVDVSFDTATSN  153

Query  545  FTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTIT  366
            FTKYNA LS T  DLIASL LN+ GD+L+ASYYH V   S+TAVGAE++H+F  N +T+ 
Sbjct  154  FTKYNAALSLTYPDLIASLHLNNHGDTLTASYYHLVKSHSSTAVGAELSHNFPRNESTLI  213

Query  365  VGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALAL  186
             G+QH LDP T+VKAR NN+G A+AL+QHEWR KSL+T+SGEVD KA++KS K GL+L L
Sbjct  214  FGSQHSLDPHTSVKARFNNYGMASALVQHEWRAKSLVTISGEVDTKAIEKSTKVGLSLVL  273

Query  185  KP  180
            KP
Sbjct  274  KP  275



>ref|XP_002458065.1| hypothetical protein SORBIDRAFT_03g026350 [Sorghum bicolor]
 gb|EES03185.1| hypothetical protein SORBIDRAFT_03g026350 [Sorghum bicolor]
Length=275

 Score =   241 bits (616),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 117/181 (65%), Positives = 142/181 (78%), Gaps = 0/181 (0%)
 Frame = -2

Query  725  SFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGA  546
            S  VPDQRSGK ELQYLH++AG++ S+GL  NP+VN SGV G+ AL++G DVSFDT +  
Sbjct  94   SLVVPDQRSGKFELQYLHEYAGVNASIGLNPNPMVNISGVFGSKALSVGVDVSFDTATSN  153

Query  545  FTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTIT  366
            FTKYNA LS T+ DLIASL LN+ GD+L  SYYH V   S TAVGAE++HS S N +T+ 
Sbjct  154  FTKYNAALSLTSPDLIASLHLNNHGDTLVGSYYHLVKHHSGTAVGAELSHSISRNESTLI  213

Query  365  VGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALAL  186
             G+QH LDP TTVKAR NN+G A+AL+QHEWRPKS IT+SGEVD KA++KS K GL+L L
Sbjct  214  FGSQHSLDPHTTVKARFNNYGMASALVQHEWRPKSFITISGEVDTKAIEKSTKVGLSLVL  273

Query  185  K  183
            K
Sbjct  274  K  274



>gb|ACG25664.1| outer plastidial membrane protein porin [Zea mays]
Length=275

 Score =   241 bits (615),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 115/178 (65%), Positives = 142/178 (80%), Gaps = 0/178 (0%)
 Frame = -2

Query  716  VPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTK  537
            VPDQRSGK+ELQYLH++ G++ S+GL +NP+VN SG  G+ AL++G DVSFDT+S  FTK
Sbjct  97   VPDQRSGKLELQYLHEYTGVNASIGLNSNPMVNLSGAFGSKALSVGVDVSFDTESSNFTK  156

Query  536  YNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGT  357
            YNA LS  N DLIASL LN+ GD+L ASYYH V   S TAVGAE++HS S N +T+  G+
Sbjct  157  YNAALSLANPDLIASLHLNNHGDTLVASYYHLVKHHSGTAVGAELSHSISRNESTLIFGS  216

Query  356  QHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALK  183
            QH LDP TTVKAR NN+G A+AL+QHEWRPKS IT+SGEVD +A++KS K GL+L LK
Sbjct  217  QHSLDPHTTVKARFNNYGMASALVQHEWRPKSFITVSGEVDTRAIEKSTKVGLSLVLK  274



>gb|KJB29688.1| hypothetical protein B456_005G114000, partial [Gossypium raimondii]
Length=208

 Score =   238 bits (607),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 120/171 (70%), Positives = 137/171 (80%), Gaps = 4/171 (2%)
 Frame = -2

Query  680  YLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKYNAGLSFTNSDL  501
            YLH+ A IS+S+GLT NPIVNF GV+GTN LALGTD+SFDTK+G FTK N GLSF N DL
Sbjct  38   YLHECARISSSIGLTDNPIVNFLGVLGTNVLALGTDISFDTKTGNFTKRNVGLSFNNPDL  97

Query  500  IASLTL----NDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQHQLDPLT  333
            IASL L    N+KG  +++S YH VNP +N  VG EV HSFS+NVNTITVGTQH LDPLT
Sbjct  98   IASLALHVVMNEKGYPVNSSSYHIVNPSTNIVVGVEVTHSFSTNVNTITVGTQHALDPLT  157

Query  332  TVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  180
            T+KARVNN   A+ALIQHEWRPKSL T+S EVD K++DKS K  LALALKP
Sbjct  158  TIKARVNNIDNASALIQHEWRPKSLFTISREVDTKSIDKSPKVRLALALKP  208



>ref|NP_001141587.1| outer plastidial membrane protein porin [Zea mays]
 gb|ACF86667.1| unknown [Zea mays]
 tpg|DAA58725.1| TPA: outer plastidial membrane protein porin [Zea mays]
Length=275

 Score =   240 bits (612),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 114/178 (64%), Positives = 142/178 (80%), Gaps = 0/178 (0%)
 Frame = -2

Query  716  VPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTK  537
            VPDQRSGK+ELQYLH++ G++ S+GL +NP+VN SG  G+ AL++G DVSFDT++  FTK
Sbjct  97   VPDQRSGKLELQYLHEYTGVNASIGLNSNPMVNLSGAFGSKALSVGVDVSFDTETSNFTK  156

Query  536  YNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGT  357
            YNA LS  N DLIASL LN+ GD+L ASYYH V   S TAVGAE++HS S N +T+  G+
Sbjct  157  YNAALSLANPDLIASLHLNNHGDTLVASYYHLVKHHSGTAVGAELSHSISRNESTLIFGS  216

Query  356  QHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALK  183
            QH LDP TTVKAR NN+G A+AL+QHEWRPKS IT+SGEVD +A++KS K GL+L LK
Sbjct  217  QHSLDPHTTVKARFNNYGMASALVQHEWRPKSFITVSGEVDTRAIEKSTKVGLSLVLK  274



>dbj|BAJ99489.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ88464.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=275

 Score =   238 bits (608),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 114/182 (63%), Positives = 143/182 (79%), Gaps = 0/182 (0%)
 Frame = -2

Query  725  SFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGA  546
            S  VPDQRSGK+ELQYLH+ A ++ SVGL  +P+VN SGV G+  L++G DVSFDT +  
Sbjct  94   SLVVPDQRSGKLELQYLHEFASVNASVGLNPSPMVNLSGVFGSKELSVGVDVSFDTATSN  153

Query  545  FTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTIT  366
            FTKYNA LS    DLIASL LN+ GD+L+ASYYH V   S+TAVGAE++H+F  N +T+ 
Sbjct  154  FTKYNAALSLAYPDLIASLHLNNHGDTLTASYYHLVKSHSSTAVGAELSHNFPRNESTLI  213

Query  365  VGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALAL  186
             G+QH LDP T+VKAR NN+G A+AL+QHEWRPKSL+T+SGEVD KA++KS K GL+L L
Sbjct  214  FGSQHSLDPHTSVKARFNNYGMASALVQHEWRPKSLVTISGEVDTKAIEKSTKVGLSLVL  273

Query  185  KP  180
            KP
Sbjct  274  KP  275



>gb|EMS51310.1| Mitochondrial outer membrane porin [Triticum urartu]
Length=596

 Score =   247 bits (631),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 124/174 (71%), Positives = 145/174 (83%), Gaps = 2/174 (1%)
 Frame = -2

Query  725  SFRVPDQRSGKV-ELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSG  549
            SF VPDQ+SGKV ELQYLHD+AGI+ S+GLTANP+VN SG  GT+ALALG DVS DT + 
Sbjct  95   SFAVPDQKSGKVVELQYLHDYAGINASIGLTANPVVNLSGAFGTSALALGADVSLDTATK  154

Query  548  AFTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTI  369
             FTKYNA LS+TN DLIASL LN+KGDSL+ASYYH V   S TAVGAE+ HSFSSN N++
Sbjct  155  NFTKYNAALSYTNQDLIASLNLNNKGDSLTASYYHIVEK-SGTAVGAELTHSFSSNENSL  213

Query  368  TVGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAK  207
            T GTQH LDPLT VKAR+NN G+A+ALIQHE+ PKSL T+S EVD KA++KS+K
Sbjct  214  TFGTQHTLDPLTLVKARINNSGKASALIQHEFMPKSLCTISAEVDTKAIEKSSK  267



>ref|NP_001278544.1| outer plastidial membrane protein porin [Zea mays]
 gb|ACF81491.1| unknown [Zea mays]
Length=275

 Score =   238 bits (606),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 113/178 (63%), Positives = 141/178 (79%), Gaps = 0/178 (0%)
 Frame = -2

Query  716  VPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTK  537
            VPDQRSGK+E QYLH++AG++ SVGL +NP+VN SG  G+ AL++G DVSFDT S  FTK
Sbjct  97   VPDQRSGKLEFQYLHEYAGVNASVGLNSNPMVNLSGAFGSKALSVGVDVSFDTASSDFTK  156

Query  536  YNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGT  357
            YNA LS T+ DLIASL LN+ GD+L ASYYH V   S TAVGAE++HS S N +T+  G+
Sbjct  157  YNAALSLTSPDLIASLHLNNHGDTLVASYYHLVKNHSGTAVGAELSHSMSRNESTLIFGS  216

Query  356  QHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALK  183
            QH LDP TT+K R NN+G A+AL+QHEWRPKS +T+SG+VD KA++KS K GL+L LK
Sbjct  217  QHSLDPHTTIKTRFNNYGMASALVQHEWRPKSFVTISGDVDTKAIEKSTKVGLSLVLK  274



>sp|P42057.1|VDAC_MAIZE RecName: Full=Outer plastidial membrane protein porin; AltName: 
Full=Voltage-dependent anion-selective channel protein; Short=VDAC 
[Zea mays]
 emb|CAA51828.1| porin [Zea mays]
Length=277

 Score =   237 bits (604),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 112/178 (63%), Positives = 141/178 (79%), Gaps = 0/178 (0%)
 Frame = -2

Query  716  VPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTK  537
            VPDQRSGK+E QYLH++AG++ SVGL +NP+VN SG  G+ AL++G DVSFDT +  FTK
Sbjct  99   VPDQRSGKLEFQYLHEYAGVNASVGLNSNPMVNLSGAFGSKALSVGVDVSFDTATSDFTK  158

Query  536  YNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGT  357
            YNA LS T+ DLIASL LN+ GD+L ASYYH V   S TAVGAE++HS S N +T+  G+
Sbjct  159  YNAALSLTSPDLIASLHLNNHGDTLVASYYHLVKNHSGTAVGAELSHSMSRNESTLIFGS  218

Query  356  QHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALK  183
            QH LDP TT+K R NN+G A+AL+QHEWRPKS +T+SG+VD KA++KS K GL+L LK
Sbjct  219  QHSLDPHTTIKTRFNNYGMASALVQHEWRPKSFVTISGDVDTKAIEKSTKVGLSLVLK  276



>gb|KEH19833.1| porin/voltage-dependent anion-selective channel protein [Medicago 
truncatula]
Length=278

 Score =   237 bits (604),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 111/173 (64%), Positives = 146/173 (84%), Gaps = 0/173 (0%)
 Frame = -2

Query  725  SFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGA  546
            SF  P+Q+SGKVELQYLHD+AGISTS+GLTA P VN S V+G N +++G+DVSF+T SG+
Sbjct  95   SFIYPEQKSGKVELQYLHDYAGISTSIGLTATPTVNISAVLGNNLVSVGSDVSFETSSGS  154

Query  545  FTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTIT  366
              K N GL+ T++DLIASLT+ND+GDSL+ASYYH V+PL+NTAVGAE++HSFSSN N +T
Sbjct  155  LNKCNFGLNVTHADLIASLTVNDRGDSLNASYYHVVSPLTNTAVGAELSHSFSSNENVLT  214

Query  365  VGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAK  207
            +GTQH LDP+T +KA+VNN+G+A+ALIQH+W  ++  +L GEVD  A+ K+AK
Sbjct  215  IGTQHALDPVTLLKAKVNNYGKASALIQHDWSRQARFSLVGEVDTAAIQKTAK  267



>gb|ACG45954.1| outer plastidial membrane protein porin [Zea mays]
Length=275

 Score =   237 bits (604),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 112/178 (63%), Positives = 141/178 (79%), Gaps = 0/178 (0%)
 Frame = -2

Query  716  VPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTK  537
            VPDQRSGK+E QYLH++AG++ SVGL +NP+VN SG  G+ AL++G DVSFDT +  FTK
Sbjct  97   VPDQRSGKLEFQYLHEYAGVNASVGLNSNPMVNLSGAFGSKALSVGVDVSFDTATSDFTK  156

Query  536  YNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGT  357
            YNA LS T+ DLIASL LN+ GD+L ASYYH V   S TAVGAE++HS S N +T+  G+
Sbjct  157  YNAALSLTSPDLIASLHLNNHGDTLVASYYHLVKNHSGTAVGAELSHSMSRNESTLIFGS  216

Query  356  QHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALK  183
            QH LDP TT+K R NN+G A+AL+QHEWRPKS +T+SG+VD KA++KS K GL+L LK
Sbjct  217  QHSLDPHTTIKTRFNNYGMASALVQHEWRPKSFVTISGDVDTKAIEKSTKVGLSLVLK  274



>gb|AFW83107.1| outer plastidial membrane protein porin [Zea mays]
Length=275

 Score =   237 bits (604),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 112/178 (63%), Positives = 141/178 (79%), Gaps = 0/178 (0%)
 Frame = -2

Query  716  VPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTK  537
            VPDQRSGK+E QYLH++AG++ SVGL +NP+VN SG  G+ AL++G DVSFDT +  FTK
Sbjct  97   VPDQRSGKLEFQYLHEYAGVNASVGLNSNPMVNLSGAFGSKALSVGVDVSFDTATSDFTK  156

Query  536  YNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGT  357
            YNA LS T+ DLIASL LN+ GD+L ASYYH V   S TAVGAE++HS S N +T+  G+
Sbjct  157  YNAALSLTSPDLIASLHLNNHGDTLVASYYHLVKNHSGTAVGAELSHSMSRNESTLIFGS  216

Query  356  QHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALK  183
            QH LDP TT+K R NN+G A+AL+QHEWRPKS +T+SG+VD KA++KS K GL+L LK
Sbjct  217  QHSLDPHTTIKTRFNNYGMASALVQHEWRPKSFVTISGDVDTKAIEKSTKVGLSLVLK  274



>ref|NP_001152335.1| outer mitochondrial membrane protein porin [Zea mays]
 gb|ACG47097.1| outer mitochondrial membrane protein porin [Zea mays]
Length=314

 Score =   237 bits (605),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 113/178 (63%), Positives = 142/178 (80%), Gaps = 2/178 (1%)
 Frame = -2

Query  713  PDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKY  534
            P ++S K ELQYLH HAG++ SVGL ANP+V  SGV GT  +++G DV+FDT SG  TKY
Sbjct  139  PYKKSAKAELQYLHHHAGVAASVGLNANPVVKLSGVFGTKTVSVGADVAFDTSSGNLTKY  198

Query  533  NAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQ  354
            NAGLS++ SD +A+ TLN+KGD ++ASYYH V+P   TAVG E++HSFS+N +TIT GTQ
Sbjct  199  NAGLSYSTSDFVAAATLNNKGDKIAASYYHSVSP--TTAVGGELSHSFSTNGSTITFGTQ  256

Query  353  HQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  180
            H LD LTTVKAR NN G A+ALIQH+WRPKSL+T+S EVD KA++KS+K  L+L LKP
Sbjct  257  HALDRLTTVKARFNNCGMASALIQHKWRPKSLVTISMEVDTKAIEKSSKIELSLVLKP  314



>emb|CDY70638.1| BnaCnng69120D [Brassica napus]
Length=250

 Score =   235 bits (599),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 120/185 (65%), Positives = 138/185 (75%), Gaps = 17/185 (9%)
 Frame = -2

Query  725  SFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDV---SFDTK  555
            S +V DQ+S +VELQYLH H GI TSVGLTANP+VNFSGV+GT+ LALGTDV   SFDT+
Sbjct  80   SAKVSDQKSAEVELQYLHPHVGICTSVGLTANPVVNFSGVIGTSVLALGTDVYQVSFDTE  139

Query  554  SGAFTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVN  375
            SG F  +N G+SFT  DLIA+LTLNDKG+              NT VGAEVNH+  S V 
Sbjct  140  SGNFKHFNTGVSFTKDDLIAALTLNDKGE--------------NTVVGAEVNHNLKSQVI  185

Query  374  TITVGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLA  195
            +ITVG QH LDPLTTVKARVNN G AN LIQHEWRPKS IT+ GEVD + ++KSAK G  
Sbjct  186  SITVGAQHSLDPLTTVKARVNNAGIANPLIQHEWRPKSFITIFGEVDSRGIEKSAKVGFT  245

Query  194  LALKP  180
            +ALKP
Sbjct  246  IALKP  250



>gb|EMT02908.1| Mitochondrial outer membrane porin [Aegilops tauschii]
Length=667

 Score =   245 bits (626),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 123/174 (71%), Positives = 145/174 (83%), Gaps = 2/174 (1%)
 Frame = -2

Query  725  SFRVPDQRSGKV-ELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSG  549
            SF VPDQ+SGKV ELQYLHD+AGI+ S+GLTANP+VN SG  GT+ALA+G DVS DT + 
Sbjct  95   SFAVPDQKSGKVVELQYLHDYAGINASIGLTANPVVNLSGAFGTSALAVGADVSLDTATK  154

Query  548  AFTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTI  369
             FTKYNA LS+TN DLIASL LN+KGDSL+ASYYH V   S TAVGAE+ HSF SN N++
Sbjct  155  NFTKYNAALSYTNQDLIASLNLNNKGDSLTASYYHIVEK-SGTAVGAELTHSFLSNENSL  213

Query  368  TVGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAK  207
            T GTQH LDPLT VKAR+NN G+A+ALIQHE+RPKSL T+S EVD KA++KS+K
Sbjct  214  TFGTQHTLDPLTLVKARINNSGKASALIQHEFRPKSLCTISAEVDTKAIEKSSK  267



>ref|XP_003569678.1| PREDICTED: mitochondrial outer membrane protein porin 2-like 
[Brachypodium distachyon]
Length=327

 Score =   235 bits (599),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 112/178 (63%), Positives = 138/178 (78%), Gaps = 2/178 (1%)
 Frame = -2

Query  713  PDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAFTKY  534
            P+Q +GKVE+QYLHD+AG++ SVGL + P++N SGV G  ALA G DV++D+ +G FTKY
Sbjct  152  PNQTAGKVEVQYLHDYAGLNVSVGLNSKPLINLSGVFGNKALAAGADVAYDSATGNFTKY  211

Query  533  NAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITVGTQ  354
            NAG+S TN DL A++ LN+KGDSL+ASYYH VN    TAVGAEV HSFSS  NT T G+Q
Sbjct  212  NAGVSLTNEDLSAAVMLNNKGDSLTASYYHSVN--KETAVGAEVTHSFSSKENTFTFGSQ  269

Query  353  HQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALKP  180
            + LDPLTT K R NN G  + LIQHEWRPKS + LS EVD KA+DKS+K GL+L L+P
Sbjct  270  YSLDPLTTAKLRYNNLGMVSTLIQHEWRPKSFLALSTEVDTKAIDKSSKIGLSLVLEP  327



>gb|ABK23226.1| unknown [Picea sitchensis]
Length=276

 Score =   232 bits (591),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 104/182 (57%), Positives = 143/182 (79%), Gaps = 0/182 (0%)
 Frame = -2

Query  725  SFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGA  546
            SF++PDQ+SGKV+LQY HDH G+S+S+GLT  PIV  SG +G++ +++G +++FDT S  
Sbjct  95   SFKIPDQKSGKVDLQYFHDHVGLSSSIGLTPTPIVEVSGALGSDGISVGGEMAFDTASST  154

Query  545  FTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTIT  366
            F+KY+AG+  +  +  A++ L DKGD++ ASY H VNP++ TAV AE  H FS+N NT T
Sbjct  155  FSKYSAGIGVSKPEYTAAVILADKGDTVKASYTHIVNPITKTAVAAEFTHKFSTNENTYT  214

Query  365  VGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALAL  186
            VG+ H +D LTT+K+R++N G+  ALIQHEWRPKSL+T+SGE D KA+DKSAK GL+LAL
Sbjct  215  VGSSHAIDRLTTMKSRLDNRGKLAALIQHEWRPKSLVTISGEFDTKALDKSAKIGLSLAL  274

Query  185  KP  180
            KP
Sbjct  275  KP  276



>ref|XP_002458403.1| hypothetical protein SORBIDRAFT_03g032840 [Sorghum bicolor]
 gb|EES03523.1| hypothetical protein SORBIDRAFT_03g032840 [Sorghum bicolor]
Length=277

 Score =   231 bits (588),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 116/189 (61%), Positives = 142/189 (75%), Gaps = 2/189 (1%)
 Frame = -2

Query  740  LENHSSFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFD  561
            L+   +   P +  GK E+QYLHD+AGIS S G+ A P+VN S V G  A+A G DV++D
Sbjct  89   LKKTMTIPFPHRGFGKFEIQYLHDYAGISASAGMNAKPLVNLSAVFGNKAIAAGADVAYD  148

Query  560  TKSGAFTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSN  381
            T +  FTKYNAGLSFTN+DLIA++TLN+KG+SL+ASYYH VN   NTAVGAEV H+FS+ 
Sbjct  149  TATRDFTKYNAGLSFTNADLIAAVTLNNKGESLTASYYHIVNTEKNTAVGAEVTHNFSTK  208

Query  380  VNTITVGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKA--VDKSAK  207
             +T+T GTQH LDP TTVKAR ++ G A+ALIQHEWRPKS  TLS EVD+ A  V KS K
Sbjct  209  GSTVTFGTQHALDPTTTVKARYSSNGMASALIQHEWRPKSFFTLSTEVDIDASGVKKSPK  268

Query  206  FGLALALKP  180
             GL+L LKP
Sbjct  269  VGLSLVLKP  277



>dbj|BAD87377.1| putative 36kDA porin II [Oryza sativa Japonica Group]
 dbj|BAD87575.1| putative 36kDA porin II [Oryza sativa Japonica Group]
Length=379

 Score =   234 bits (596),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 114/181 (63%), Positives = 138/181 (76%), Gaps = 0/181 (0%)
 Frame = -2

Query  740  LENHSSFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFD  561
            L+   S   P Q +GK ELQYLHD+AGIS  VGLT+ P+VN SGV G  ++A+G DV+ D
Sbjct  184  LKQIVSLPFPYQTAGKAELQYLHDYAGISLGVGLTSKPLVNLSGVFGNKSVAVGADVAVD  243

Query  560  TKSGAFTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSN  381
            T +G FTKY+AGL+  NSDL A LTLN+KGDSL+ASYYH VN  S TA GAE+ HSFS+ 
Sbjct  244  TSTGDFTKYDAGLTINNSDLAADLTLNNKGDSLTASYYHLVNKESGTAAGAELTHSFSTK  303

Query  380  VNTITVGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFG  201
             NT++ G QH LDPLTTVKAR NN G  +ALIQHEWRPKS +TLS EVD KA+DK++K G
Sbjct  304  ENTLSFGMQHALDPLTTVKARYNNHGMVSALIQHEWRPKSFLTLSAEVDTKAIDKASKDG  363

Query  200  L  198
            +
Sbjct  364  I  364



>emb|CBI32017.3| unnamed protein product [Vitis vinifera]
Length=240

 Score =   228 bits (582),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 108/142 (76%), Positives = 128/142 (90%), Gaps = 0/142 (0%)
 Frame = -2

Query  725  SFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGA  546
            SF +PDQRSGKVELQYLH++AGISTS+GLTANPIVNFSGVVG N L+LGTD+SFDT +G 
Sbjct  95   SFIIPDQRSGKVELQYLHEYAGISTSIGLTANPIVNFSGVVGNNTLSLGTDLSFDTATGN  154

Query  545  FTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTIT  366
            FTK NAGL F+N+DLIA+LTLNDKGD+L+ASYYH V+PL+NTAVGAE++H FS+N NT+T
Sbjct  155  FTKCNAGLGFSNADLIAALTLNDKGDTLNASYYHTVSPLTNTAVGAELSHCFSTNENTLT  214

Query  365  VGTQHQLDPLTTVKARVNNFGR  300
            +GTQH LDPLT VKAR NN G+
Sbjct  215  IGTQHALDPLTKVKARANNSGK  236



>emb|CAJ42303.1| VDAC-like porin [Plantago major]
Length=250

 Score =   225 bits (574),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 110/135 (81%), Positives = 121/135 (90%), Gaps = 0/135 (0%)
 Frame = -2

Query  725  SFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGA  546
            SF+VPDQRSGK+ELQYLHD+AGI+TSVGLTANPIVNFSGV+GT  LA G D+SFDTK GA
Sbjct  116  SFKVPDQRSGKLELQYLHDYAGITTSVGLTANPIVNFSGVLGTKTLAAGADLSFDTKEGA  175

Query  545  FTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTIT  366
             TKYN G SF+N DLIASL LNDKGD+LSASYYH VNPL++T+VGAEV HSFSSN NTIT
Sbjct  176  LTKYNFGASFSNVDLIASLALNDKGDTLSASYYHIVNPLTSTSVGAEVTHSFSSNENTIT  235

Query  365  VGTQHQLDPLTTVKA  321
            VGTQH LDPLTTVKA
Sbjct  236  VGTQHALDPLTTVKA  250



>gb|ADE77918.1| unknown [Picea sitchensis]
Length=276

 Score =   223 bits (569),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 99/182 (54%), Positives = 134/182 (74%), Gaps = 0/182 (0%)
 Frame = -2

Query  725  SFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGA  546
            SF++PD++SGK++ QY H+H G+S+SVGLT  P V+FSG +G++   +G +V FDT SG 
Sbjct  95   SFKLPDEKSGKLDFQYSHEHVGLSSSVGLTPKPQVDFSGAIGSDVFTVGGEVGFDTSSGL  154

Query  545  FTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTIT  366
            FTKYN G+  T  +  A++   DKGD+L ASY H +NP++ T   AE++  FS+N NT T
Sbjct  155  FTKYNGGIGITKPEFSAAILFADKGDTLKASYLHELNPITKTCFAAEISRKFSANQNTFT  214

Query  365  VGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALAL  186
            VG+ + LDPLTT+K R+NN G+   ++QHEW+PKSLITLS E D KA+DKS K GLALA 
Sbjct  215  VGSSYALDPLTTMKTRLNNHGKLGTVLQHEWKPKSLITLSSEFDTKALDKSPKIGLALAF  274

Query  185  KP  180
            KP
Sbjct  275  KP  276



>ref|XP_001781995.1| predicted protein [Physcomitrella patens]
 gb|EDQ53219.1| predicted protein [Physcomitrella patens]
Length=276

 Score =   222 bits (566),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 106/182 (58%), Positives = 134/182 (74%), Gaps = 0/182 (0%)
 Frame = -2

Query  725  SFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGA  546
            +F +PD +SGK+EL Y  D+ GIS S+GLT +PIV  +G +G    ++G +++FDT SG+
Sbjct  95   TFTIPDHKSGKLELLYKQDYCGISGSIGLTPSPIVEATGALGNEGFSVGGELAFDTASGS  154

Query  545  FTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTIT  366
              KYNAG+ F   D  ASL L +KGD L ASY H V+P+S T V AE+ H FS N NT T
Sbjct  155  LIKYNAGVGFVKPDFNASLMLAEKGDLLKASYLHTVSPVSRTTVAAEIAHKFSKNENTFT  214

Query  365  VGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALAL  186
            VG  ++LD LTTVKAR+NN G+  AL+QHEWRPKSLIT SGEVD K++DK+AK GLALAL
Sbjct  215  VGGLYELDTLTTVKARLNNHGKLAALLQHEWRPKSLITFSGEVDTKSLDKTAKIGLALAL  274

Query  185  KP  180
            KP
Sbjct  275  KP  276



>ref|XP_010918628.1| PREDICTED: mitochondrial outer membrane protein porin 6 isoform 
X2 [Elaeis guineensis]
Length=271

 Score =   218 bits (556),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 100/182 (55%), Positives = 133/182 (73%), Gaps = 0/182 (0%)
 Frame = -2

Query  725  SFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGA  546
            SF++PDQ+S K+++QYLHDHA I++S+GLT  P++  +  VG+  LALG +V FD+ S +
Sbjct  90   SFKIPDQKSSKLDVQYLHDHAAINSSIGLTPTPLLELAAAVGSKELALGVEVGFDSASAS  149

Query  545  FTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTIT  366
             TKYNAG+ F   D  A+L L DKG++L ASY H VNP++  AV AE+ H F++  NT T
Sbjct  150  VTKYNAGIGFNKHDFSAALILADKGETLKASYVHVVNPITGAAVAAEIVHRFNTYENTFT  209

Query  365  VGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALAL  186
            +G+ H LDPLTT+K R NN G+A  + QHEWRPKSLITLS E D KA+   ++ GLALAL
Sbjct  210  IGSCHSLDPLTTLKTRFNNSGKAAVVCQHEWRPKSLITLSAEYDPKAISAPSRVGLALAL  269

Query  185  KP  180
            KP
Sbjct  270  KP  271



>ref|XP_010918626.1| PREDICTED: mitochondrial outer membrane protein porin 6 isoform 
X1 [Elaeis guineensis]
 ref|XP_010918627.1| PREDICTED: mitochondrial outer membrane protein porin 6 isoform 
X1 [Elaeis guineensis]
Length=276

 Score =   218 bits (556),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 100/182 (55%), Positives = 133/182 (73%), Gaps = 0/182 (0%)
 Frame = -2

Query  725  SFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGA  546
            SF++PDQ+S K+++QYLHDHA I++S+GLT  P++  +  VG+  LALG +V FD+ S +
Sbjct  95   SFKIPDQKSSKLDVQYLHDHAAINSSIGLTPTPLLELAAAVGSKELALGVEVGFDSASAS  154

Query  545  FTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTIT  366
             TKYNAG+ F   D  A+L L DKG++L ASY H VNP++  AV AE+ H F++  NT T
Sbjct  155  VTKYNAGIGFNKHDFSAALILADKGETLKASYVHVVNPITGAAVAAEIVHRFNTYENTFT  214

Query  365  VGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALAL  186
            +G+ H LDPLTT+K R NN G+A  + QHEWRPKSLITLS E D KA+   ++ GLALAL
Sbjct  215  IGSCHSLDPLTTLKTRFNNSGKAAVVCQHEWRPKSLITLSAEYDPKAISAPSRVGLALAL  274

Query  185  KP  180
            KP
Sbjct  275  KP  276



>ref|XP_001779057.1| predicted protein [Physcomitrella patens]
 gb|EDQ56094.1| predicted protein [Physcomitrella patens]
Length=276

 Score =   218 bits (555),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 101/182 (55%), Positives = 136/182 (75%), Gaps = 0/182 (0%)
 Frame = -2

Query  725  SFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGA  546
            SF +PD +SGK+E+QY  D+ GI+ S+GL+ +PIV  +G +G +  ++G +V+FD+ +G+
Sbjct  95   SFTIPDHKSGKLEIQYKQDYCGITGSIGLSPSPIVEATGALGNDGFSVGGEVAFDSANGS  154

Query  545  FTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTIT  366
              KYNAG+     D  AS+ L +KGD L ASY H V+P+S T + AE+ H FS N NT T
Sbjct  155  LIKYNAGVGLVKPDFNASIILAEKGDLLKASYLHTVSPISRTTMAAEIAHRFSKNENTFT  214

Query  365  VGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALAL  186
            VG  ++LD LTTVKAR+NN G+  AL+QHEWRPKSL+TLSGEVD K++DK+AK GLALAL
Sbjct  215  VGGLYELDTLTTVKARLNNHGKLAALLQHEWRPKSLVTLSGEVDTKSLDKTAKIGLALAL  274

Query  185  KP  180
            KP
Sbjct  275  KP  276



>ref|XP_002973372.1| hypothetical protein SELMODRAFT_271012 [Selaginella moellendorffii]
 gb|EFJ25746.1| hypothetical protein SELMODRAFT_271012 [Selaginella moellendorffii]
Length=278

 Score =   217 bits (553),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 96/181 (53%), Positives = 136/181 (75%), Gaps = 0/181 (0%)
 Frame = -2

Query  722  FRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAF  543
            F +PDQ+SGK+ELQY H +AG++ SVGL ++P+V  +   G+N + +G + +FDT SG F
Sbjct  98   FSLPDQKSGKMELQYCHQYAGVTASVGLASSPVVECTSAFGSNDVVIGGEAAFDTASGNF  157

Query  542  TKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITV  363
            TKYNAG+     +  A++ + DKGD+L ASY H ++P + T VGAE++H  S+  NT ++
Sbjct  158  TKYNAGVGINKPEFTAAVVVADKGDTLKASYSHVLSPFTRTTVGAEISHKLSTKANTFSI  217

Query  362  GTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALK  183
            G  + LD LTT+KAR+NN GR  A++QHEWRPKS+I++SGEVD KA++KSAK GLAL+LK
Sbjct  218  GGMYGLDALTTIKARLNNHGRIAAVVQHEWRPKSVISISGEVDTKALEKSAKLGLALSLK  277

Query  182  P  180
            P
Sbjct  278  P  278



>ref|XP_002976531.1| hypothetical protein SELMODRAFT_267998 [Selaginella moellendorffii]
 gb|EFJ22200.1| hypothetical protein SELMODRAFT_267998 [Selaginella moellendorffii]
Length=278

 Score =   217 bits (552),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 96/181 (53%), Positives = 136/181 (75%), Gaps = 0/181 (0%)
 Frame = -2

Query  722  FRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGAF  543
            F +PDQ+SGK+ELQY H +AG++ SVGL ++P+V  +   G+N + +G + +FDT SG F
Sbjct  98   FSLPDQKSGKMELQYCHQYAGVTGSVGLASSPVVECTSAFGSNDVVIGGEAAFDTASGNF  157

Query  542  TKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTITV  363
            TKYNAG+     +  A++ + DKGD+L ASY H ++P + T VGAE++H  S+  NT ++
Sbjct  158  TKYNAGVGINKPEFTAAVVVADKGDTLKASYSHVLSPFTRTTVGAEISHKLSTKANTFSI  217

Query  362  GTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALALK  183
            G  + LD LTT+KAR+NN GR  A++QHEWRPKS+I++SGEVD KA++KSAK GLAL+LK
Sbjct  218  GGMYGLDALTTIKARLNNHGRIAAVVQHEWRPKSVISMSGEVDTKALEKSAKLGLALSLK  277

Query  182  P  180
            P
Sbjct  278  P  278



>ref|XP_008787191.1| PREDICTED: mitochondrial outer membrane protein porin 5-like 
[Phoenix dactylifera]
Length=275

 Score =   216 bits (550),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 97/183 (53%), Positives = 136/183 (74%), Gaps = 0/183 (0%)
 Frame = -2

Query  728  SSFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSG  549
            +SF++PD  SGK+E+QY HDHAG++T+V L  +P+V+ SG +G + +A G +  FDT SG
Sbjct  93   ASFKLPDYNSGKLEIQYFHDHAGVATAVALKQSPVVDLSGTIGIHGIAFGAEAGFDTASG  152

Query  548  AFTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTI  369
             FTKYNAG+S    D  AS+ L DKGD+L ASY +H++ +  +A+  E+   FS+N NT 
Sbjct  153  TFTKYNAGISLGKPDYNASIILADKGDTLRASYVYHLDEMQKSAMVGEITRRFSTNENTF  212

Query  368  TVGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALA  189
            TVG Q+ +DP TTVK+R+NN G+  AL+QHE +PKS++T+SGE D K +D++ KFGLALA
Sbjct  213  TVGGQYIIDPQTTVKSRLNNSGKLAALLQHELKPKSILTISGEFDTKDLDRAPKFGLALA  272

Query  188  LKP  180
            LKP
Sbjct  273  LKP  275



>ref|XP_008777257.1| PREDICTED: mitochondrial outer membrane protein porin 6-like 
isoform X2 [Phoenix dactylifera]
Length=269

 Score =   215 bits (548),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 99/182 (54%), Positives = 131/182 (72%), Gaps = 0/182 (0%)
 Frame = -2

Query  725  SFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGA  546
            SF++PDQ+SGK+++QYLH HA I++ +GLT  P++  +  VG+  LALG +V FD+ S +
Sbjct  82   SFKIPDQKSGKLDVQYLHGHAAINSGIGLTPTPVLELAAAVGSKELALGAEVGFDSASAS  141

Query  545  FTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTIT  366
            FTKYNAG+ F   D  A+L L DKG++L ASY H VNP++ TAV AE+ H F+   N+ T
Sbjct  142  FTKYNAGIGFNKHDFSAALILADKGETLKASYVHVVNPITGTAVAAEIIHRFNKYENSFT  201

Query  365  VGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALAL  186
            +G  H L+PLTTVK R NN G+A+ L QHEWRPKS ITLS E D K +   ++ GLALAL
Sbjct  202  IGGCHSLNPLTTVKTRFNNSGKASILCQHEWRPKSFITLSAEYDPKNISAPSRVGLALAL  261

Query  185  KP  180
            KP
Sbjct  262  KP  263



>ref|XP_008453611.1| PREDICTED: mitochondrial outer membrane protein porin 4 [Cucumis 
melo]
 ref|XP_008453612.1| PREDICTED: mitochondrial outer membrane protein porin 4 [Cucumis 
melo]
 ref|XP_008453613.1| PREDICTED: mitochondrial outer membrane protein porin 4 [Cucumis 
melo]
 ref|XP_008453614.1| PREDICTED: mitochondrial outer membrane protein porin 4 [Cucumis 
melo]
Length=276

 Score =   215 bits (548),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 98/182 (54%), Positives = 131/182 (72%), Gaps = 0/182 (0%)
 Frame = -2

Query  725  SFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGA  546
            SFRVPD +SGK+++QY H HA I +S+GL  +P++ FS  +G+   +LG DV FDT S +
Sbjct  95   SFRVPDHKSGKLDVQYFHPHAAIDSSIGLHPSPLLEFSAAIGSKNFSLGGDVGFDTTSAS  154

Query  545  FTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTIT  366
            FTKYNAG+S   SD  A+L L DKG +L ASY H ++PL+ T V AE+ H FS++ N+ T
Sbjct  155  FTKYNAGISLNKSDFSAALMLTDKGQALKASYIHSLDPLNETMVAAEMTHKFSTSENSFT  214

Query  365  VGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALAL  186
            +G+ H LDP+T +K R ++ G+A  L Q EWRPKSL+TLS E D KA+D S K GLA+AL
Sbjct  215  IGSSHVLDPVTLMKTRFSDKGKAAMLFQREWRPKSLVTLSAEYDSKAIDSSPKIGLAIAL  274

Query  185  KP  180
            KP
Sbjct  275  KP  276



>ref|XP_008777255.1| PREDICTED: mitochondrial outer membrane protein porin 6-like 
isoform X1 [Phoenix dactylifera]
 ref|XP_008777256.1| PREDICTED: mitochondrial outer membrane protein porin 6-like 
isoform X1 [Phoenix dactylifera]
Length=282

 Score =   215 bits (547),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 99/182 (54%), Positives = 131/182 (72%), Gaps = 0/182 (0%)
 Frame = -2

Query  725  SFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGA  546
            SF++PDQ+SGK+++QYLH HA I++ +GLT  P++  +  VG+  LALG +V FD+ S +
Sbjct  95   SFKIPDQKSGKLDVQYLHGHAAINSGIGLTPTPVLELAAAVGSKELALGAEVGFDSASAS  154

Query  545  FTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTIT  366
            FTKYNAG+ F   D  A+L L DKG++L ASY H VNP++ TAV AE+ H F+   N+ T
Sbjct  155  FTKYNAGIGFNKHDFSAALILADKGETLKASYVHVVNPITGTAVAAEIIHRFNKYENSFT  214

Query  365  VGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALAL  186
            +G  H L+PLTTVK R NN G+A+ L QHEWRPKS ITLS E D K +   ++ GLALAL
Sbjct  215  IGGCHSLNPLTTVKTRFNNSGKASILCQHEWRPKSFITLSAEYDPKNISAPSRVGLALAL  274

Query  185  KP  180
            KP
Sbjct  275  KP  276



>gb|EYU34672.1| hypothetical protein MIMGU_mgv1a021682mg, partial [Erythranthe 
guttata]
Length=133

 Score =   209 bits (532),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 103/133 (77%), Positives = 115/133 (86%), Gaps = 0/133 (0%)
 Frame = -2

Query  578  TDVSFDTKSGAFTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVN  399
            +DVSFDTK GAF KYN G SFTN+DLIA++TLN+K D +SASYYH V+PL+NTAVG E  
Sbjct  1    SDVSFDTKEGAFLKYNFGASFTNADLIAAVTLNNKFDLVSASYYHTVSPLTNTAVGGEFT  60

Query  398  HSFSSNVNTITVGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVD  219
            HSFSS+ NTITVGTQH LDPLT VKARVNN G+ +ALIQHEWRPKSLIT+S EVD KA D
Sbjct  61   HSFSSSENTITVGTQHSLDPLTNVKARVNNAGKVSALIQHEWRPKSLITVSTEVDAKAFD  120

Query  218  KSAKFGLALALKP  180
            KSAKFGLALALKP
Sbjct  121  KSAKFGLALALKP  133



>ref|XP_004172904.1| PREDICTED: mitochondrial outer membrane protein porin 4-like, 
partial [Cucumis sativus]
Length=248

 Score =   213 bits (541),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 97/182 (53%), Positives = 130/182 (71%), Gaps = 0/182 (0%)
 Frame = -2

Query  725  SFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGA  546
            SFRVPD +SGK+++QY H HA I +S+GL  +P++ FS  +G+   +LG DV FDT S +
Sbjct  67   SFRVPDHKSGKLDVQYFHPHAAIDSSIGLHPSPLLEFSAAIGSKNCSLGGDVGFDTTSAS  126

Query  545  FTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTIT  366
            FTKYNAG+S   SD  A+L L DKG  L ASY H ++PL+ T V AE+ H FS++ N+ T
Sbjct  127  FTKYNAGISLNKSDFSAALMLTDKGQGLKASYVHSLDPLNETMVAAEMTHKFSTSENSFT  186

Query  365  VGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALAL  186
            +G+ H LDP+T +K R ++ G+A  L Q +WRPKSL+TLS E D KA+D S K GLA+AL
Sbjct  187  IGSSHVLDPVTLMKTRFSDKGKAAMLFQRQWRPKSLVTLSAEYDSKAIDSSPKIGLAIAL  246

Query  185  KP  180
            KP
Sbjct  247  KP  248



>ref|XP_004146313.1| PREDICTED: mitochondrial outer membrane protein porin 4-like 
[Cucumis sativus]
 gb|KGN65451.1| hypothetical protein Csa_1G423090 [Cucumis sativus]
Length=276

 Score =   213 bits (543),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 97/182 (53%), Positives = 131/182 (72%), Gaps = 0/182 (0%)
 Frame = -2

Query  725  SFRVPDQRSGKVELQYLHDHAGISTSVGLTANPIVNFSGVVGTNALALGTDVSFDTKSGA  546
            SFRVPD +SGK+++QY H HA I +S+GL  +P++ FS  +G+   +LG DV FDT S +
Sbjct  95   SFRVPDHKSGKLDVQYFHPHAAIDSSIGLHPSPLLEFSAAIGSKNCSLGGDVGFDTTSAS  154

Query  545  FTKYNAGLSFTNSDLIASLTLNDKGDSLSASYYHHVNPLSNTAVGAEVNHSFSSNVNTIT  366
            FTKYNAG+S   SD  A+L L DKG +L ASY H ++PL+ T V AE+ H FS++ N+ T
Sbjct  155  FTKYNAGISLNKSDFSAALMLTDKGQALKASYVHSLDPLNETMVAAEMTHKFSTSENSFT  214

Query  365  VGTQHQLDPLTTVKARVNNFGRANALIQHEWRPKSLITLSGEVDVKAVDKSAKFGLALAL  186
            +G+ H LDP+T +K R ++ G+A  L Q +WRPKSL+TLS E D KA+D S K GLA+AL
Sbjct  215  IGSSHVLDPVTLMKTRFSDKGKAAMLFQRQWRPKSLVTLSAEYDSKAIDSSPKIGLAIAL  274

Query  185  KP  180
            KP
Sbjct  275  KP  276



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1347639082210