BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF008G24

Length=652
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|EPS59790.1|  splicing factor-like protein                            169   4e-49   Genlisea aurea
emb|CDP12845.1|  unnamed protein product                                175   1e-48   Coffea canephora [robusta coffee]
ref|XP_011100931.1|  PREDICTED: RNA-binding protein 39                  176   1e-47   Sesamum indicum [beniseed]
ref|XP_009608714.1|  PREDICTED: RNA-binding protein 39                  175   1e-47   Nicotiana tomentosiformis
ref|XP_009774937.1|  PREDICTED: RNA-binding protein 39                  175   2e-47   Nicotiana sylvestris
ref|XP_010312457.1|  PREDICTED: RNA-binding protein 39                  174   4e-47   Solanum lycopersicum
ref|XP_006351114.1|  PREDICTED: RNA-binding protein 39-like isofo...    169   2e-46   
ref|XP_006351113.1|  PREDICTED: RNA-binding protein 39-like isofo...    172   2e-46   Solanum tuberosum [potatoes]
gb|EYU24065.1|  hypothetical protein MIMGU_mgv1a002916mg                170   2e-45   Erythranthe guttata [common monkey flower]
gb|EYU31126.1|  hypothetical protein MIMGU_mgv1a0042611mg               165   4e-45   Erythranthe guttata [common monkey flower]
gb|KDO57144.1|  hypothetical protein CISIN_1g0063801mg                  146   3e-40   Citrus sinensis [apfelsine]
gb|KJB14931.1|  hypothetical protein B456_002G149800                    152   4e-39   Gossypium raimondii
ref|XP_010680478.1|  PREDICTED: RNA-binding protein 39                  151   5e-39   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003525097.1|  PREDICTED: RNA-binding protein 39-like isofo...    150   1e-38   Glycine max [soybeans]
gb|KCW54323.1|  hypothetical protein EUGRSUZ_I00287                     142   1e-38   Eucalyptus grandis [rose gum]
ref|XP_010246266.1|  PREDICTED: RNA-binding protein 39 isoform X1       149   3e-38   Nelumbo nucifera [Indian lotus]
ref|XP_010246267.1|  PREDICTED: RNA-binding protein 39 isoform X2       149   3e-38   Nelumbo nucifera [Indian lotus]
gb|KHG29994.1|  RNA-binding 39                                          149   3e-38   Gossypium arboreum [tree cotton]
ref|XP_007048198.1|  Splicing factor isoform 1                          148   5e-38   
ref|XP_006427900.1|  hypothetical protein CICLE_v10025229mg             148   6e-38   Citrus clementina [clementine]
ref|XP_003531395.1|  PREDICTED: RNA-binding protein 39-like             147   1e-37   Glycine max [soybeans]
emb|CAC10207.1|  putative splicing factor                               145   2e-37   Cicer arietinum [garbanzo]
emb|CAN82467.1|  hypothetical protein VITISV_002664                     145   2e-37   Vitis vinifera
emb|CBI21551.3|  unnamed protein product                                146   3e-37   Vitis vinifera
ref|XP_004503982.1|  PREDICTED: RNA-binding protein 39-like             146   3e-37   
ref|XP_008351323.1|  PREDICTED: RNA-binding protein 39-like             138   3e-37   
ref|XP_010652895.1|  PREDICTED: RNA-binding protein 39                  146   4e-37   Vitis vinifera
gb|AES72769.2|  CC1-like splicing factor                                146   5e-37   Medicago truncatula
gb|EYU31125.1|  hypothetical protein MIMGU_mgv1a0042611mg               143   6e-37   Erythranthe guttata [common monkey flower]
gb|KJB18367.1|  hypothetical protein B456_003G049000                    145   7e-37   Gossypium raimondii
ref|XP_007137679.1|  hypothetical protein PHAVU_009G146500g             145   7e-37   Phaseolus vulgaris [French bean]
ref|XP_007159797.1|  hypothetical protein PHAVU_002G268000g             145   7e-37   Phaseolus vulgaris [French bean]
gb|KHG26899.1|  RNA-binding 39                                          145   8e-37   Gossypium arboreum [tree cotton]
ref|XP_010546379.1|  PREDICTED: RNA-binding protein 39                  145   1e-36   
ref|XP_003602517.1|  Splicing factor-like protein                       145   3e-36   
ref|XP_003602518.1|  Splicing factor-like protein                       145   4e-36   
gb|KHN09571.1|  RNA-binding protein rsd1                                142   8e-36   Glycine soja [wild soybean]
ref|XP_010027731.1|  PREDICTED: LOW QUALITY PROTEIN: RNA-binding ...    142   8e-36   
ref|XP_003526844.1|  PREDICTED: RNA-binding protein 39-like             142   8e-36   Glycine max [soybeans]
ref|XP_004502884.1|  PREDICTED: RNA-binding protein 39-like isofo...    141   2e-35   
ref|XP_004502883.1|  PREDICTED: RNA-binding protein 39-like isofo...    141   2e-35   Cicer arietinum [garbanzo]
ref|XP_007137677.1|  hypothetical protein PHAVU_009G146500g             141   2e-35   Phaseolus vulgaris [French bean]
ref|XP_011014283.1|  PREDICTED: RNA-binding protein 39-like isofo...    138   7e-35   Populus euphratica
ref|XP_011021826.1|  PREDICTED: RNA-binding protein 39-like             139   9e-35   Populus euphratica
ref|XP_011014282.1|  PREDICTED: RNA-binding protein 39-like isofo...    139   1e-34   Populus euphratica
ref|XP_008231785.1|  PREDICTED: RNA-binding protein 39                  139   1e-34   
ref|XP_007212812.1|  hypothetical protein PRUPE_ppa002854mg             139   2e-34   Prunus persica
ref|XP_003630170.1|  RNA-binding protein                                138   3e-34   Medicago truncatula
ref|XP_008781452.1|  PREDICTED: RNA-binding protein 39-like             137   4e-34   Phoenix dactylifera
ref|XP_004141977.1|  PREDICTED: RNA-binding protein 39-like             137   6e-34   Cucumis sativus [cucumbers]
ref|XP_004160482.1|  PREDICTED: RNA-binding protein 39-like             137   6e-34   
ref|XP_008440991.1|  PREDICTED: RNA-binding protein 39 isoform X2       137   8e-34   Cucumis melo [Oriental melon]
ref|XP_010452994.1|  PREDICTED: RNA-binding protein 39-like isofo...    134   8e-34   
ref|XP_008440993.1|  PREDICTED: RNA-binding protein 39 isoform X4       137   8e-34   Cucumis melo [Oriental melon]
ref|XP_010491632.1|  PREDICTED: RNA-binding protein 39-like             135   3e-33   Camelina sativa [gold-of-pleasure]
ref|XP_010930948.1|  PREDICTED: RNA-binding protein 39                  135   3e-33   
ref|XP_010422929.1|  PREDICTED: RNA-binding protein 39-like             134   4e-33   Camelina sativa [gold-of-pleasure]
ref|XP_007048199.1|  Splicing factor isoform 2                          134   5e-33   
ref|XP_010452992.1|  PREDICTED: RNA-binding protein 39-like isofo...    134   6e-33   Camelina sativa [gold-of-pleasure]
ref|XP_011011956.1|  PREDICTED: RNA-binding protein 39-like             134   8e-33   Populus euphratica
ref|XP_002873428.1|  predicted protein                                  133   8e-33   Arabidopsis lyrata subsp. lyrata
ref|XP_011466737.1|  PREDICTED: RNA-binding protein 39                  134   9e-33   Fragaria vesca subsp. vesca
gb|KHN34036.1|  RNA-binding protein 39                                  133   1e-32   Glycine soja [wild soybean]
ref|XP_008338762.1|  PREDICTED: RNA-binding protein 39 isoform X2       133   1e-32   Malus domestica [apple tree]
ref|XP_008338761.1|  PREDICTED: RNA-binding protein 39 isoform X1       133   1e-32   Malus domestica [apple tree]
ref|XP_010690339.1|  PREDICTED: RNA-binding protein 39                  133   2e-32   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002306512.2|  hypothetical protein POPTR_0005s19200g             131   5e-32   Populus trichocarpa [western balsam poplar]
dbj|BAD93824.1|  splicing factor-like protein                           128   7e-32   Arabidopsis thaliana [mouse-ear cress]
gb|KFK25283.1|  hypothetical protein AALP_AA8G092000                    130   1e-31   Arabis alpina [alpine rockcress]
ref|XP_009399181.1|  PREDICTED: RNA-binding protein 39                  129   3e-31   Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAH57172.1|  AT5G09880                                              128   6e-31   Arabidopsis thaliana [mouse-ear cress]
ref|NP_568220.1|  splicing factor, CC1-like                             128   6e-31   Arabidopsis thaliana [mouse-ear cress]
gb|AES72768.2|  CC1-like splicing factor                                129   6e-31   Medicago truncatula
gb|AAO30095.1|  splicing factor-like protein                            128   7e-31   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006649420.1|  PREDICTED: RNA-binding protein 39-like isofo...    127   7e-31   
ref|XP_007137678.1|  hypothetical protein PHAVU_009G146500g             128   9e-31   Phaseolus vulgaris [French bean]
ref|XP_010912455.1|  PREDICTED: RNA-binding protein 39-like             128   1e-30   Elaeis guineensis
gb|ADE76571.1|  unknown                                                 122   1e-30   Picea sitchensis
ref|XP_010935165.1|  PREDICTED: RNA-binding protein 39-like             127   1e-30   Elaeis guineensis
ref|XP_002465838.1|  hypothetical protein SORBIDRAFT_01g046740          127   2e-30   Sorghum bicolor [broomcorn]
ref|XP_010229190.1|  PREDICTED: RNA-binding protein 39-like isofo...    125   2e-30   Brachypodium distachyon [annual false brome]
ref|XP_006649419.1|  PREDICTED: RNA-binding protein 39-like isofo...    127   3e-30   
ref|XP_011045848.1|  PREDICTED: RNA-binding protein 39                  127   3e-30   Populus euphratica
ref|XP_006847132.1|  hypothetical protein AMTR_s00017p00234440          128   3e-30   
ref|XP_003558785.1|  PREDICTED: RNA-binding protein 39-like isofo...    126   4e-30   Brachypodium distachyon [annual false brome]
gb|KJB12136.1|  hypothetical protein B456_002G002300                    126   4e-30   Gossypium raimondii
gb|KHF98937.1|  RNA-binding 39                                          126   5e-30   Gossypium arboreum [tree cotton]
gb|EEE58341.1|  hypothetical protein OsJ_09449                          125   7e-30   Oryza sativa Japonica Group [Japonica rice]
gb|EEC74539.1|  hypothetical protein OsI_10059                          125   7e-30   Oryza sativa Indica Group [Indian rice]
ref|XP_010266038.1|  PREDICTED: RNA-binding protein 39                  126   7e-30   Nelumbo nucifera [Indian lotus]
ref|XP_002312948.2|  hypothetical protein POPTR_0009s13940g             125   9e-30   
gb|ABF94032.1|  transposon protein, putative, CACTA, En/Spm sub-c...    125   9e-30   Oryza sativa Japonica Group [Japonica rice]
gb|KDP33302.1|  hypothetical protein JCGZ_13089                         125   1e-29   Jatropha curcas
ref|XP_008809443.1|  PREDICTED: RNA-binding protein 39-like isofo...    125   1e-29   
emb|CBI37850.3|  unnamed protein product                                124   1e-29   Vitis vinifera
ref|XP_004985661.1|  PREDICTED: RNA-binding protein 39-like             125   1e-29   Setaria italica
ref|XP_008809442.1|  PREDICTED: RNA-binding protein 39-like isofo...    125   1e-29   
ref|XP_008806137.1|  PREDICTED: RNA-binding protein 39-like             125   1e-29   
emb|CDY40065.1|  BnaC02g00650D                                          124   2e-29   Brassica napus [oilseed rape]
ref|XP_010920083.1|  PREDICTED: RNA-binding protein 39-like             125   2e-29   Elaeis guineensis
ref|XP_009384003.1|  PREDICTED: RNA-binding protein 39 isoform X2       123   2e-29   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007041785.1|  Splicing factor isoform 4                          123   3e-29   
gb|KJB32668.1|  hypothetical protein B456_005G254800                    124   3e-29   Gossypium raimondii
ref|XP_010028763.1|  PREDICTED: RNA-binding protein 39                  124   3e-29   Eucalyptus grandis [rose gum]
ref|XP_009384002.1|  PREDICTED: RNA-binding protein 39 isoform X1       124   3e-29   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006580322.1|  PREDICTED: RNA-binding protein 39-like isofo...    124   4e-29   Glycine max [soybeans]
ref|XP_008784182.1|  PREDICTED: RNA-binding protein 39-like             124   4e-29   Phoenix dactylifera
ref|XP_002279887.2|  PREDICTED: RNA-binding protein 39                  124   4e-29   Vitis vinifera
ref|XP_010530926.1|  PREDICTED: RNA-binding protein 39                  123   5e-29   Tarenaya hassleriana [spider flower]
gb|KHG01335.1|  RNA-binding 39                                          124   5e-29   Gossypium arboreum [tree cotton]
ref|NP_001142242.1|  uncharacterized protein LOC100274411               120   6e-29   Zea mays [maize]
ref|XP_007041782.1|  Splicing factor isoform 1                          123   8e-29   
ref|XP_008338763.1|  PREDICTED: RNA-binding protein 39 isoform X3       123   8e-29   Malus domestica [apple tree]
ref|XP_008377726.1|  PREDICTED: RNA-binding protein 39-like             119   8e-29   
ref|XP_008668579.1|  PREDICTED: uncharacterized protein LOC100274...    120   1e-28   
ref|XP_010548117.1|  PREDICTED: RNA-binding protein 39-like             122   1e-28   Tarenaya hassleriana [spider flower]
gb|AFW68703.1|  hypothetical protein ZEAMMB73_109361                    119   2e-28   
ref|XP_006299838.1|  hypothetical protein CARUB_v10016041mg             121   2e-28   Capsella rubella
ref|NP_001169267.1|  hypothetical protein                               119   2e-28   
gb|KHN29140.1|  RNA-binding protein 39                                  121   2e-28   Glycine soja [wild soybean]
emb|CDX85791.1|  BnaA02g00220D                                          121   2e-28   
ref|XP_006589727.1|  PREDICTED: RNA-binding protein 39-like isofo...    120   2e-28   
gb|EMS53612.1|  RNA-binding protein 39                                  120   3e-28   Triticum urartu
ref|XP_009125340.1|  PREDICTED: RNA-binding protein 39-like             121   3e-28   Brassica rapa
gb|EMT10841.1|  RNA-binding protein 39                                  120   3e-28   
gb|KHN37392.1|  RNA-binding protein 39                                  119   4e-28   Glycine soja [wild soybean]
ref|XP_009122113.1|  PREDICTED: RNA-binding protein 39                  120   4e-28   Brassica rapa
ref|XP_006409370.1|  hypothetical protein EUTSA_v10022624mg             120   4e-28   Eutrema salsugineum [saltwater cress]
emb|CDY21612.1|  BnaC09g46800D                                          120   5e-28   Brassica napus [oilseed rape]
gb|KFK40079.1|  hypothetical protein AALP_AA3G327700                    119   5e-28   Arabis alpina [alpine rockcress]
ref|XP_002886087.1|  hypothetical protein ARALYDRAFT_480573             120   5e-28   
ref|XP_008236127.1|  PREDICTED: RNA-binding protein 39-like             117   5e-28   
ref|XP_002306193.2|  hypothetical protein POPTR_0004s18320g             120   6e-28   Populus trichocarpa [western balsam poplar]
ref|XP_011046657.1|  PREDICTED: RNA-binding protein 39-like             120   7e-28   Populus euphratica
ref|XP_006829172.1|  hypothetical protein AMTR_s00001p00270600          120   8e-28   Amborella trichopoda
ref|XP_006661796.1|  PREDICTED: RNA-binding protein 39-like isofo...    117   9e-28   
ref|XP_007201184.1|  hypothetical protein PRUPE_ppa003064mg             120   9e-28   Prunus persica
ref|XP_003536719.1|  PREDICTED: RNA-binding protein 39-like isofo...    120   1e-27   Glycine max [soybeans]
ref|XP_002516388.1|  splicing factor, putative                          120   1e-27   Ricinus communis
ref|XP_008236128.1|  PREDICTED: LOW QUALITY PROTEIN: RNA-binding ...    120   1e-27   
gb|ACN36244.1|  unknown                                                 118   1e-27   Zea mays [maize]
ref|XP_008382102.1|  PREDICTED: RNA-binding protein 39-like             120   1e-27   
ref|XP_002467180.1|  hypothetical protein SORBIDRAFT_01g021020          119   1e-27   Sorghum bicolor [broomcorn]
ref|XP_008668576.1|  PREDICTED: uncharacterized protein LOC100274...    119   1e-27   
ref|XP_006661795.1|  PREDICTED: RNA-binding protein 39-like isofo...    117   2e-27   
ref|XP_004983028.1|  PREDICTED: RNA-binding protein 39-like isofo...    117   2e-27   Setaria italica
gb|AAM20703.1|  putative splicing factor                                117   2e-27   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009355642.1|  PREDICTED: RNA-binding protein 39 isoform X1       119   2e-27   Pyrus x bretschneideri [bai li]
ref|XP_009355643.1|  PREDICTED: RNA-binding protein 39 isoform X2       119   2e-27   Pyrus x bretschneideri [bai li]
gb|AFK46942.1|  unknown                                                 113   2e-27   Lotus japonicus
ref|XP_011088626.1|  PREDICTED: RNA-binding protein 39 isoform X2       119   2e-27   Sesamum indicum [beniseed]
ref|XP_008644042.1|  PREDICTED: hypothetical protein isoform X1         118   3e-27   
ref|XP_011088625.1|  PREDICTED: RNA-binding protein 39 isoform X1       119   4e-27   Sesamum indicum [beniseed]
dbj|BAB09409.1|  splicing factor-like protein                           118   4e-27   Arabidopsis thaliana [mouse-ear cress]
gb|KJB12137.1|  hypothetical protein B456_002G002300                    118   4e-27   Gossypium raimondii
ref|NP_565399.1|  splicing factor, CC1-like protein                     117   5e-27   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010467428.1|  PREDICTED: RNA-binding protein 39-like isofo...    116   5e-27   Camelina sativa [gold-of-pleasure]
gb|AAM62839.1|  putative splicing factor                                117   5e-27   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010489301.1|  PREDICTED: RNA-binding protein 39-like isofo...    116   6e-27   
ref|XP_004983027.1|  PREDICTED: RNA-binding protein 39-like isofo...    117   6e-27   Setaria italica
ref|XP_008447936.1|  PREDICTED: RNA-binding protein 39 isoform X1       117   8e-27   Cucumis melo [Oriental melon]
ref|XP_008447937.1|  PREDICTED: RNA-binding protein 39 isoform X2       117   8e-27   Cucumis melo [Oriental melon]
ref|XP_004144853.1|  PREDICTED: RNA-binding protein 39-like             117   1e-26   
ref|NP_001189537.1|  splicing factor, CC1-like protein                  117   1e-26   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001189538.1|  splicing factor, CC1-like protein                  117   1e-26   Arabidopsis thaliana [mouse-ear cress]
gb|KGN43267.1|  hypothetical protein Csa_7G014530                       117   1e-26   Cucumis sativus [cucumbers]
ref|XP_010467427.1|  PREDICTED: RNA-binding protein 39-like isofo...    116   2e-26   Camelina sativa [gold-of-pleasure]
ref|XP_010489300.1|  PREDICTED: RNA-binding protein 39-like isofo...    116   2e-26   
ref|XP_001782480.1|  predicted protein                                  114   2e-26   
dbj|BAK06658.1|  predicted protein                                      116   2e-26   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002976923.1|  hypothetical protein SELMODRAFT_151471             115   2e-26   Selaginella moellendorffii
dbj|BAJ92968.1|  predicted protein                                      116   2e-26   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ94512.1|  predicted protein                                      116   2e-26   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003573971.1|  PREDICTED: RNA-binding protein 39-like             116   3e-26   Brachypodium distachyon [annual false brome]
ref|XP_010107642.1|  RNA-binding protein 39                             117   4e-26   
ref|XP_010515902.1|  PREDICTED: LOW QUALITY PROTEIN: RNA-binding ...    115   5e-26   Camelina sativa [gold-of-pleasure]
gb|ACJ85781.1|  unknown                                                 113   5e-26   Medicago truncatula
gb|EYU37971.1|  hypothetical protein MIMGU_mgv1a003198mg                115   6e-26   Erythranthe guttata [common monkey flower]
gb|EMS55916.1|  RNA-binding protein 39                                  115   7e-26   Triticum urartu
gb|EMT08795.1|  RNA-binding protein 39                                  115   9e-26   
ref|XP_007142808.1|  hypothetical protein PHAVU_007G018500g             114   1e-25   Phaseolus vulgaris [French bean]
gb|KCW55580.1|  hypothetical protein EUGRSUZ_I01450                     114   1e-25   Eucalyptus grandis [rose gum]
emb|CDX71317.1|  BnaC07g05960D                                          115   2e-25   
gb|ABB47696.1|  splicing factor, CC1-like family protein, expressed     111   2e-25   Oryza sativa Japonica Group [Japonica rice]
gb|ABB47695.1|  splicing factor, CC1-like family protein, expressed     110   3e-25   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004497188.1|  PREDICTED: RNA-binding protein 39-like             112   6e-25   Cicer arietinum [garbanzo]
ref|XP_006422531.1|  hypothetical protein CICLE_v10027985mg             112   1e-24   
gb|KDO68180.1|  hypothetical protein CISIN_1g006398mg                   112   1e-24   Citrus sinensis [apfelsine]
ref|XP_006486689.1|  PREDICTED: RNA-binding protein 39-like isofo...    112   1e-24   
gb|KDO68179.1|  hypothetical protein CISIN_1g006398mg                   112   1e-24   Citrus sinensis [apfelsine]
ref|XP_006486688.1|  PREDICTED: RNA-binding protein 39-like isofo...    112   1e-24   
ref|XP_006422532.1|  hypothetical protein CICLE_v10027985mg             111   1e-24   Citrus clementina [clementine]
ref|XP_006486686.1|  PREDICTED: RNA-binding protein 39-like isofo...    112   1e-24   Citrus sinensis [apfelsine]
ref|XP_006486687.1|  PREDICTED: RNA-binding protein 39-like isofo...    111   1e-24   
ref|XP_006486685.1|  PREDICTED: RNA-binding protein 39-like isofo...    111   1e-24   Citrus sinensis [apfelsine]
ref|XP_010088741.1|  RNA-binding protein 39                             112   1e-24   
ref|XP_006399474.1|  hypothetical protein EUTSA_v100130050mg            111   1e-24   
emb|CDX89762.1|  BnaC03g46760D                                          105   1e-24   
ref|XP_004290736.1|  PREDICTED: RNA-binding protein 39                  110   2e-24   Fragaria vesca subsp. vesca
gb|EAY78664.1|  hypothetical protein OsI_33765                          110   2e-24   Oryza sativa Indica Group [Indian rice]
ref|XP_009121181.1|  PREDICTED: RNA-binding protein 39 isoform X1       110   3e-24   Brassica rapa
emb|CDP19575.1|  unnamed protein product                                110   3e-24   Coffea canephora [robusta coffee]
gb|EEE51022.1|  hypothetical protein OsJ_31660                          110   3e-24   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009121183.1|  PREDICTED: RNA-binding protein 39 isoform X2       110   3e-24   Brassica rapa
ref|XP_003555861.1|  PREDICTED: RNA-binding protein 39-like             109   8e-24   Glycine max [soybeans]
ref|XP_001776557.1|  predicted protein                                  106   2e-23   
emb|CDY31398.1|  BnaA07g03330D                                          109   3e-23   Brassica napus [oilseed rape]
ref|XP_005650141.1|  splicing factor, CC1-like protein                  105   8e-23   Coccomyxa subellipsoidea C-169
tpg|DAA49863.1|  TPA: hypothetical protein ZEAMMB73_656561              101   6e-22   
ref|XP_002508355.1|  predicted protein                                  102   1e-21   Micromonas commoda
ref|XP_003059052.1|  predicted protein                                96.3    2e-19   Micromonas pusilla CCMP1545
emb|CDH60258.1|  splicing factor cc1-like protein                     93.6    1e-18   Lichtheimia corymbifera JMRC:FSU:9682
emb|CDH60257.1|  splicing factor cc1-like protein                     93.6    1e-18   Lichtheimia corymbifera JMRC:FSU:9682
ref|XP_005850115.1|  hypothetical protein CHLNCDRAFT_57088            92.8    3e-18   Chlorella variabilis
emb|CDS08376.1|  hypothetical protein LRAMOSA02324                    92.4    3e-18   Lichtheimia ramosa
ref|XP_005703854.1|  RNA-binding protein                              92.4    6e-18   Galdieria sulphuraria
ref|XP_010515913.1|  PREDICTED: RNA-binding protein 39-like           85.9    6e-18   Camelina sativa [gold-of-pleasure]
ref|XP_003080863.1|  RNA recognition motif (ISS)                      90.1    8e-18   
ref|XP_007199063.1|  hypothetical protein PRUPE_ppa018661mg           89.4    1e-17   
ref|XP_001419396.1|  predicted protein                                90.9    1e-17   Ostreococcus lucimarinus CCE9901
gb|EXX55443.1|  Pab1p                                                 90.5    1e-17   Rhizophagus irregularis DAOM 197198w
gb|ESA21112.1|  hypothetical protein GLOINDRAFT_92051                 90.5    2e-17   
emb|CEG01539.1|  Nucleotide-binding, alpha-beta plait                 90.1    3e-17   Ostreococcus tauri
gb|KJE89116.1|  RNA binding domain-containing protein 39, variant     88.6    5e-17   Capsaspora owczarzaki ATCC 30864
ref|XP_011401211.1|  RNA-binding protein 39                           86.7    9e-17   Auxenochlorella protothecoides
ref|XP_010495125.1|  PREDICTED: RNA-binding protein 39-like           82.8    1e-16   
ref|XP_004365528.1|  RNA binding domain-containing protein 39         88.6    1e-16   Capsaspora owczarzaki ATCC 30864
gb|EFA79920.1|  putative RNA splicing factor                          88.2    2e-16   Heterostelium album PN500
ref|XP_004334854.1|  splicing factor, CC1like subfamily protein       87.0    3e-16   Acanthamoeba castellanii str. Neff
dbj|GAM16879.1|  hypothetical protein SAMD00019534_000540             87.0    4e-16   Acytostelium subglobosum LB1
ref|XP_004351712.1|  putative RNA splicing factor                     86.3    7e-16   Cavenderia fasciculata
ref|XP_005762142.1|  hypothetical protein EMIHUDRAFT_124866           80.5    1e-15   Emiliania huxleyi CCMP1516
ref|XP_002957532.1|  hypothetical protein VOLCADRAFT_84128            84.0    2e-15   Volvox carteri f. nagariensis
ref|XP_007874255.1|  hypothetical protein PNEG_02266                  83.6    2e-15   Pneumocystis murina B123
ref|XP_007515160.1|  predicted protein                                84.3    3e-15   Bathycoccus prasinos
gb|KFH68543.1|  hypothetical protein MVEG_05356                       82.4    4e-15   Mortierella verticillata NRRL 6337
ref|XP_005784360.1|  hypothetical protein EMIHUDRAFT_231170           80.1    1e-14   Emiliania huxleyi CCMP1516
ref|XP_006454314.1|  hypothetical protein AGABI2DRAFT_189584          81.6    2e-14   Agaricus bisporus var. bisporus H97
ref|XP_007325678.1|  hypothetical protein AGABI1DRAFT_110515          81.6    2e-14   Agaricus bisporus var. burnettii JB137-S8
ref|XP_001869868.1|  splicing factor                                  81.3    3e-14   Culex quinquefasciatus
gb|KFB39087.1|  AGAP008433-PA-like protein                            81.3    3e-14   Anopheles sinensis
ref|XP_003283761.1|  hypothetical protein DICPUDRAFT_74732            81.3    4e-14   Dictyostelium purpureum
ref|XP_001865056.1|  splicing factor                                  80.9    4e-14   Culex quinquefasciatus
ref|XP_002018768.1|  GL25979                                          78.6    5e-14   
ref|XP_002503985.1|  predicted protein                                80.9    6e-14   Micromonas commoda
gb|KDR08287.1|  RNA-binding protein 39                                79.0    6e-14   Zootermopsis nevadensis
gb|KJB14937.1|  hypothetical protein B456_002G149800                  80.1    6e-14   Gossypium raimondii
ref|XP_002108274.1|  hypothetical protein TRIADDRAFT_37071            78.6    8e-14   Trichoplax adhaerens
ref|XP_003054955.1|  predicted protein                                80.5    8e-14   Micromonas pusilla CCMP1545
ref|XP_001650224.1|  AAEL005046-PA                                    80.1    8e-14   
emb|CCJ30702.1|  unnamed protein product                              79.3    1e-13   Pneumocystis jirovecii
ref|XP_317010.3|  AGAP008433-PA                                       79.3    1e-13   Anopheles gambiae str. PEST
emb|CBJ30774.1|  conserved unknown protein                            79.3    1e-13   Ectocarpus siliculosus
ref|XP_002428613.1|  RNA-binding region-containing protein, putative  79.0    2e-13   Pediculus humanus corporis [human body lice]
gb|KIY50466.1|  splicing factor, CC1-like protein                     78.2    2e-13   Fistulina hepatica ATCC 64428
ref|XP_002078467.1|  GD23448                                          78.2    3e-13   
ref|XP_008475058.1|  PREDICTED: RNA-binding protein 39 isoform X3     76.3    3e-13   
ref|XP_002036031.1|  GM16278                                          78.2    4e-13   Drosophila sechellia
ref|XP_638966.1|  hypothetical protein DDB_G0283687                   77.8    5e-13   Dictyostelium discoideum AX4
ref|NP_594422.2|  RNA-binding protein Rsd1 (predicted)                77.8    5e-13   Schizosaccharomyces pombe
ref|XP_002065089.1|  GK15272                                          77.8    5e-13   Drosophila willistoni
ref|XP_005830691.1|  hypothetical protein GUITHDRAFT_163728           77.4    5e-13   Guillardia theta CCMP2712
emb|CBK24895.2|  unnamed protein product                              77.0    6e-13   Blastocystis hominis
ref|XP_001992854.1|  GH13506                                          77.4    6e-13   Drosophila grimshawi
ref|XP_001357388.2|  GA10876                                          77.0    8e-13   Drosophila pseudoobscura pseudoobscura
ref|XP_001970115.1|  GG10454                                          77.0    9e-13   
ref|XP_002088083.1|  GE14328                                          76.6    1e-12   Drosophila yakuba
ref|NP_609095.1|  CG11266, isoform B                                  76.6    1e-12   Drosophila melanogaster
ref|XP_008475057.1|  PREDICTED: RNA-binding protein 39 isoform X2     75.5    1e-12   
ref|XP_004533937.1|  PREDICTED: RNA-binding protein 39-like isofo...  76.6    1e-12   
ref|XP_004533936.1|  PREDICTED: RNA-binding protein 39-like isofo...  76.6    1e-12   Ceratitis capitata [medfly]
ref|XP_001961412.1|  GF14957                                          76.6    1e-12   Drosophila ananassae
gb|EPT03834.1|  splicing factor CC1-like protein                      75.9    1e-12   Fomitopsis pinicola FP-58527 SS1
ref|XP_002057597.1|  GJ18017                                          76.3    1e-12   Drosophila virilis
ref|XP_002002944.1|  GI10246                                          76.3    2e-12   Drosophila mojavensis
ref|XP_005189704.2|  PREDICTED: RNA-binding protein 39                75.9    2e-12   Musca domestica
gb|AEG78359.1|  RNA binding motif protein 39                          73.2    2e-12   Epinephelus coioides [estuary cod]
dbj|GAN03029.1|  splicing factor, CC1-like protein                    75.5    2e-12   Mucor ambiguus
gb|ENN76275.1|  hypothetical protein YQE_07239                        75.9    2e-12   Dendroctonus ponderosae
ref|XP_011475547.1|  PREDICTED: RNA-binding protein 39-like isofo...  75.1    2e-12   
ref|XP_008475056.1|  PREDICTED: RNA-binding protein 39 isoform X1     75.1    3e-12   
gb|KDQ16749.1|  hypothetical protein BOTBODRAFT_106812                74.7    3e-12   
gb|KIJ45270.1|  hypothetical protein M422DRAFT_251452                 75.5    3e-12   
ref|XP_001626026.1|  predicted protein                                75.1    3e-12   
ref|XP_002395467.1|  hypothetical protein MPER_04477                  72.0    3e-12   
ref|XP_004070573.1|  PREDICTED: RNA-binding protein 39-like isofo...  75.1    3e-12   
ref|XP_001873182.1|  predicted protein                                74.7    3e-12   
ref|XP_003037450.1|  hypothetical protein SCHCODRAFT_80935            74.3    4e-12   
gb|EFN77277.1|  RNA-binding protein 39                                73.9    4e-12   
ref|XP_007265705.1|  splicing factor, CC1-like protein                74.3    5e-12   
gb|KIK07027.1|  hypothetical protein K443DRAFT_673923                 74.7    5e-12   
ref|XP_011199818.1|  PREDICTED: RNA-binding protein 39                74.7    5e-12   
gb|KFM61555.1|  RNA-binding protein 39                                74.3    5e-12   
ref|XP_008440992.1|  PREDICTED: RNA-binding protein 39 isoform X3     74.3    6e-12   
ref|XP_006561781.1|  PREDICTED: RNA-binding protein 39-like isofo...  73.6    6e-12   
ref|XP_008440990.1|  PREDICTED: RNA-binding protein 39 isoform X1     74.3    6e-12   
ref|XP_003707644.1|  PREDICTED: RNA-binding protein 39-like isofo...  73.9    7e-12   
ref|XP_011338563.1|  PREDICTED: RNA-binding protein 39 isoform X3     73.9    7e-12   
ref|XP_011338562.1|  PREDICTED: RNA-binding protein 39 isoform X2     73.9    7e-12   
ref|XP_011150397.1|  PREDICTED: RNA-binding protein 39 isoform X1     73.9    7e-12   
ref|XP_011255735.1|  PREDICTED: RNA-binding protein 39 isoform X2     73.9    7e-12   
gb|EPB82230.1|  hypothetical protein HMPREF1544_11035                 73.9    7e-12   
ref|XP_011150398.1|  PREDICTED: RNA-binding protein 39 isoform X2     73.9    7e-12   
ref|XP_003707643.1|  PREDICTED: RNA-binding protein 39-like isofo...  73.9    7e-12   
ref|XP_011338561.1|  PREDICTED: RNA-binding protein 39 isoform X1     73.9    7e-12   
emb|CCA69965.1|  related to splicing factor HCC1                      73.9    7e-12   
ref|XP_011255734.1|  PREDICTED: RNA-binding protein 39 isoform X1     73.9    8e-12   
gb|KIO24728.1|  hypothetical protein M407DRAFT_98450                  73.9    8e-12   
ref|XP_011158188.1|  PREDICTED: RNA-binding protein 39                73.9    8e-12   
ref|XP_003488967.1|  PREDICTED: RNA-binding protein 39-like isofo...  73.9    8e-12   
ref|XP_003397900.1|  PREDICTED: RNA-binding protein 39-like isofo...  73.9    8e-12   
ref|XP_011063536.1|  PREDICTED: RNA-binding protein 39                73.9    8e-12   
gb|KIK70947.1|  hypothetical protein GYMLUDRAFT_66156                 73.9    8e-12   
emb|CDQ85498.1|  unnamed protein product                              69.7    8e-12   
ref|XP_003397899.1|  PREDICTED: RNA-binding protein 39-like isofo...  73.9    8e-12   
ref|XP_003488966.1|  PREDICTED: RNA-binding protein 39-like isofo...  73.9    8e-12   
ref|XP_004929275.1|  PREDICTED: RNA-binding protein 39-like isofo...  72.8    8e-12   
gb|KJA29462.1|  hypothetical protein HYPSUDRAFT_32927                 73.9    8e-12   
gb|KIL70866.1|  hypothetical protein M378DRAFT_183435                 73.9    8e-12   
ref|XP_624668.3|  PREDICTED: RNA-binding protein 39-like isoform X6   73.6    8e-12   
ref|XP_003690330.1|  PREDICTED: LOW QUALITY PROTEIN: RNA-binding ...  73.6    9e-12   
emb|CEG64999.1|  hypothetical protein RMATCC62417_01878               73.6    9e-12   
ref|XP_006561779.1|  PREDICTED: RNA-binding protein 39-like isofo...  73.6    9e-12   
ref|XP_006561778.1|  PREDICTED: RNA-binding protein 39-like isofo...  73.6    9e-12   
ref|XP_006561777.1|  PREDICTED: RNA-binding protein 39-like isofo...  73.6    1e-11   
ref|XP_005167281.1|  PREDICTED: RNA binding motif protein 39b iso...  73.2    1e-11   
gb|ETN62863.1|  splicing factor                                       73.6    1e-11   
ref|XP_011302428.1|  PREDICTED: RNA-binding protein 39 isoform X1     73.2    1e-11   
ref|XP_011302429.1|  PREDICTED: RNA-binding protein 39 isoform X2     73.2    1e-11   
ref|XP_011386110.1|  hypothetical protein UMAG_00164                  73.6    1e-11   
emb|CAG11305.1|  unnamed protein product                              73.2    1e-11   
gb|KDR84953.1|  hypothetical protein GALMADRAFT_131717                73.2    1e-11   
gb|EIE88941.1|  hypothetical protein RO3G_13652                       72.8    2e-11   
emb|CEP10202.1|  hypothetical protein                                 72.8    2e-11   
emb|CDY02226.1|  BnaA03g39410D                                        73.6    2e-11   
ref|XP_011190768.1|  PREDICTED: RNA-binding protein 39 isoform X2     73.2    2e-11   
ref|XP_011190766.1|  PREDICTED: RNA-binding protein 39 isoform X1     73.2    2e-11   
gb|KII93760.1|  hypothetical protein PLICRDRAFT_171473                72.4    2e-11   
ref|NP_001014392.1|  RNA binding motif protein 39b                    72.4    2e-11   
ref|XP_008301948.1|  PREDICTED: RNA-binding protein 39-like           72.4    2e-11   
ref|XP_007378704.1|  splicing factor CC1-like protein                 72.0    3e-11   
ref|XP_010749473.1|  PREDICTED: RNA-binding protein 39 isoform X1     72.0    3e-11   
ref|XP_004929274.1|  PREDICTED: RNA-binding protein 39-like isofo...  72.0    3e-11   
ref|XP_010749479.1|  PREDICTED: RNA-binding protein 39 isoform X2     72.0    3e-11   
gb|KIM48235.1|  hypothetical protein M413DRAFT_63161                  72.0    3e-11   
ref|XP_008317639.1|  PREDICTED: RNA-binding protein 39                71.6    4e-11   
gb|EST09793.1|  transcriptional coactivator CAPER                     71.6    4e-11   
gb|EFX83536.1|  hypothetical protein DAPPUDRAFT_194972                71.2    4e-11   
ref|XP_007390520.1|  hypothetical protein PHACADRAFT_247456           71.6    5e-11   
ref|XP_003963398.1|  PREDICTED: RNA-binding protein 39-like           71.2    5e-11   
gb|KDQ63590.1|  hypothetical protein JAAARDRAFT_120563                71.6    5e-11   
ref|XP_007762617.1|  splicing factor CC1-like protein                 70.5    6e-11   
emb|CDO71619.1|  hypothetical protein BN946_scf184911.g89             71.6    6e-11   
ref|XP_007842790.1|  rna-binding protein 39-like isoform 1            71.2    6e-11   
gb|KFM62488.1|  RNA-binding protein 39                                70.9    7e-11   
ref|XP_001198098.2|  PREDICTED: RNA-binding protein 39-like           71.2    8e-11   
gb|KIJ68490.1|  hypothetical protein HYDPIDRAFT_24760                 70.9    8e-11   
ref|XP_008193890.1|  PREDICTED: RNA-binding protein 39                70.9    8e-11   
ref|XP_006678895.1|  hypothetical protein BATDEDRAFT_11758            70.1    9e-11   
ref|XP_003439056.1|  PREDICTED: RNA-binding protein 39-like isofo...  70.5    9e-11   
gb|KIK47836.1|  hypothetical protein CY34DRAFT_798916                 70.9    9e-11   
ref|XP_005740561.1|  PREDICTED: RNA-binding protein 39-like           70.5    9e-11   
emb|CBQ67560.1|  related to RNA-binding region containing protein 2   70.9    1e-10   
ref|XP_008547303.1|  PREDICTED: RNA-binding protein 39 isoform X1     70.5    1e-10   
ref|XP_008547304.1|  PREDICTED: RNA-binding protein 39 isoform X2     70.5    1e-10   
ref|XP_005448808.1|  PREDICTED: RNA-binding protein 39-like isofo...  70.5    1e-10   
gb|ETO31048.1|  RNA splicing factor                                   70.5    1e-10   
gb|KDQ30832.1|  hypothetical protein PLEOSDRAFT_49497                 70.1    1e-10   
ref|XP_004546125.1|  PREDICTED: RNA-binding protein 39-like           70.5    1e-10   
pdb|4OZ0|A  Chain A, Crystal Structure Of Human Caperalpha U2af H...  66.2    1e-10   
pdb|4J5O|A  Chain A, Room Temperature Crystal Structure Of A Rna ...  66.2    1e-10   
pdb|2LQ5|A  Chain A, Nmr Structure Of The Rna Binding Motif 39 (R...  65.9    1e-10   
gb|KDN53001.1|  splicing factor, CC1-like protein                     70.1    1e-10   
ref|XP_007336725.1|  splicing factor, CC1-like protein                70.1    1e-10   
emb|CAM34544.1|  RNA binding motif protein 39                         66.6    1e-10   
ref|XP_005719036.1|  RNA splicing factor (Pad-1), putative            70.1    2e-10   
emb|CCL99044.1|  predicted protein                                    70.1    2e-10   
emb|CAP32600.2|  Protein CBG13969                                     70.1    2e-10   
ref|XP_002634852.1|  Hypothetical protein CBG13969                    70.1    2e-10   
ref|XP_010864906.1|  PREDICTED: RNA-binding protein 39-like isofo...  69.7    2e-10   
ref|XP_010864905.1|  PREDICTED: RNA-binding protein 39-like isofo...  69.7    2e-10   
ref|XP_002742404.1|  PREDICTED: RNA-binding protein 39-like isofo...  69.7    2e-10   
ref|XP_010864907.1|  PREDICTED: RNA-binding protein 39-like isofo...  69.7    2e-10   
emb|CCA22234.1|  conserved hypothetical protein                       69.3    2e-10   
emb|CAM35485.1|  RNA binding motif protein 39                         65.1    2e-10   
ref|XP_005805707.1|  PREDICTED: RNA-binding protein 39-like           69.7    2e-10   
emb|CDI51110.1|  related to splicing factor HCC1                      69.7    2e-10   
dbj|BAE22009.1|  unnamed protein product                              66.2    2e-10   
gb|EKG12232.1|  hypothetical protein MPH_10639                        69.3    2e-10   
gb|KFW08762.1|  RNA-binding protein 39                                69.3    2e-10   
gb|KIM85156.1|  hypothetical protein PILCRDRAFT_349839                69.3    2e-10   
ref|XP_010153670.1|  PREDICTED: RNA-binding protein 39                69.3    3e-10   
gb|EHJ67964.1|  putative RNA-binding region-containing protein        69.3    3e-10   
dbj|GAK62510.1|  splicing factor CC1-like protein                     69.3    3e-10   
gb|ETS63422.1|  hypothetical protein PaG_01705                        69.3    3e-10   
ref|XP_002159647.1|  PREDICTED: RNA-binding protein 39-like           69.3    3e-10   
gb|EMD42070.1|  hypothetical protein CERSUDRAFT_90674                 69.3    3e-10   
ref|XP_003099004.1|  hypothetical protein CRE_26746                   69.3    3e-10   
dbj|GAC73399.1|  transcriptional coactivator CAPER                    69.3    3e-10   
gb|ACI33760.1|  RNA-binding protein 39                                68.9    3e-10   
gb|KIJ21787.1|  hypothetical protein PAXINDRAFT_165177                68.9    3e-10   
gb|ETI44919.1|  hypothetical protein, variant 1                       68.9    3e-10   
ref|XP_007234801.1|  PREDICTED: RNA-binding protein 39-like isofo...  68.9    3e-10   
gb|ETI44918.1|  hypothetical protein F443_10365                       68.9    3e-10   
ref|XP_007234799.1|  PREDICTED: RNA-binding protein 39-like isofo...  68.9    3e-10   
gb|EGT33870.1|  hypothetical protein CAEBREN_20987                    68.9    4e-10   
ref|XP_007562369.1|  PREDICTED: RNA-binding protein 39-like           68.6    4e-10   
emb|CDQ68309.1|  unnamed protein product                              68.9    4e-10   
emb|CCF53883.1|  related to RNA-binding region containing protein 2   68.9    4e-10   
ref|XP_011503671.1|  PREDICTED: RNA-binding protein 39                68.6    4e-10   
ref|XP_007234797.1|  PREDICTED: RNA-binding protein 39-like isofo...  68.6    4e-10   
ref|XP_008401686.1|  PREDICTED: RNA-binding protein 39-like           68.6    4e-10   
ref|XP_004995203.1|  hypothetical protein PTSG_04304                  68.6    4e-10   
gb|ERG84172.1|  rna-binding protein 39                                68.6    5e-10   
emb|CCJ31450.1|  unnamed protein product                              68.2    5e-10   
pdb|3S6E|A  Chain A, Crystal Structure Of A Rna Binding Motif Pro...  64.3    5e-10   
gb|EYB89537.1|  hypothetical protein Y032_0230g2943                   65.9    6e-10   
gb|KIO08312.1|  hypothetical protein M404DRAFT_937265                 68.2    6e-10   
ref|XP_008031849.1|  splicing factor CC1-like protein                 67.4    6e-10   
gb|KHN88755.1|  RNA-binding protein 39                                68.2    7e-10   
ref|XP_006639711.1|  PREDICTED: LOW QUALITY PROTEIN: RNA-binding ...  67.8    7e-10   
gb|EPS25592.1|  hypothetical protein PDE_00526                        67.8    7e-10   
tpg|DAA49862.1|  TPA: hypothetical protein ZEAMMB73_656561            67.8    8e-10   
emb|CAB70796.1|  hypothetical protein                                 65.1    8e-10   
gb|ELU40879.1|  splicing factor, CC1-like family protein              67.4    8e-10   
ref|XP_008319473.1|  PREDICTED: RNA-binding protein 39-like isofo...  67.4    9e-10   
ref|XP_002903307.1|  conserved hypothetical protein                   67.4    9e-10   
ref|NP_001135964.1|  RNA binding motif protein 39                     67.4    1e-09   
gb|EUC61967.1|  splicing factor CC1-like protein                      67.4    1e-09   
ref|XP_002912089.1|  hypothetical protein CC1G_13622                  67.4    1e-09   
emb|CDQ00335.1|  Protein Bm6851, isoform a                            67.0    1e-09   
ref|XP_009025967.1|  hypothetical protein HELRODRAFT_114532           67.4    1e-09   
ref|XP_008319472.1|  PREDICTED: RNA-binding protein 39-like isofo...  67.4    1e-09   
ref|XP_011108196.1|  hypothetical protein H072_2209                   67.4    1e-09   
ref|XP_008319470.1|  PREDICTED: RNA-binding protein 39-like isofo...  67.4    1e-09   
gb|EJW82425.1|  splicing factor                                       67.0    1e-09   
emb|CCX04394.1|  Similar to RNA-binding protein rsd1; acc. no. O1...  67.0    1e-09   
emb|CCI48613.1|  unnamed protein product                              67.0    1e-09   
ref|XP_007719354.1|  hypothetical protein A1O1_00244                  67.0    1e-09   
gb|KDN40378.1|  hypothetical protein RSAG8_08141                      66.6    1e-09   
ref|NP_001086950.1|  RNA binding motif protein 39                     67.0    1e-09   
gb|KFP45750.1|  RNA-binding protein 39                                66.6    2e-09   
ref|XP_010126667.1|  PREDICTED: RNA-binding protein 39                66.6    2e-09   
ref|XP_010082280.1|  PREDICTED: RNA-binding protein 39                66.6    2e-09   
gb|KFW91694.1|  RNA-binding protein 39                                66.6    2e-09   
gb|EFO25730.2|  hypothetical protein LOAG_02757                       67.0    2e-09   
ref|XP_009504205.1|  PREDICTED: RNA-binding protein 39                66.6    2e-09   
ref|XP_010782098.1|  PREDICTED: RNA-binding protein 39                66.6    2e-09   
ref|XP_003138342.1|  hypothetical protein LOAG_02757                  67.0    2e-09   
ref|XP_004946950.1|  PREDICTED: RNA-binding protein 39-like isofo...  66.6    2e-09   
gb|KFV15753.1|  RNA-binding protein 39                                66.6    2e-09   
gb|EOB02393.1|  RNA-binding protein 39                                66.2    2e-09   
ref|XP_009922370.1|  PREDICTED: RNA-binding protein 39 isoform X4     66.6    2e-09   
ref|XP_009922371.1|  PREDICTED: RNA-binding protein 39 isoform X5     66.6    2e-09   
ref|XP_007875914.1|  hypothetical protein PFL1_00226                  67.0    2e-09   
ref|XP_005056983.1|  PREDICTED: RNA-binding protein 39 isoform X3     66.6    2e-09   
gb|ACI33514.1|  RNA-binding protein 39                                66.6    2e-09   
ref|NP_741301.1|  Protein Y55F3AM.3, isoform c                        66.2    2e-09   
emb|CDQ00334.1|  Protein Bm6851, isoform b                            66.6    2e-09   
pdb|4RU2|A  Chain A, Crystal Structure Of A Rna-binding Protein 3...  62.8    2e-09   
dbj|BAG58357.1|  unnamed protein product                              65.1    2e-09   
emb|CDM38378.1|  Splicing factor, CC1-like                            66.6    2e-09   
emb|CDQ00333.1|  Protein Bm6851, isoform d                            66.6    2e-09   
ref|XP_007585284.1|  putative rna splicing factor protein             66.6    2e-09   
emb|CDQ86615.1|  unnamed protein product                              66.6    2e-09   
ref|XP_009485299.1|  PREDICTED: RNA-binding protein 39                66.2    2e-09   
gb|KFQ63281.1|  RNA-binding protein 39                                66.2    2e-09   
ref|XP_005056981.1|  PREDICTED: RNA-binding protein 39 isoform X1     66.2    2e-09   
ref|XP_003023781.1|  hypothetical protein TRV_02070                   66.6    2e-09   
gb|ETP42815.1|  hypothetical protein F442_10283                       66.6    2e-09   
ref|XP_008893450.1|  hypothetical protein PPTG_01815                  66.6    2e-09   
gb|ETK84920.1|  hypothetical protein L915_10141                       66.6    2e-09   
ref|XP_007312630.1|  hypothetical protein SERLADRAFT_455043           66.6    2e-09   
gb|KFP69473.1|  RNA-binding protein 39                                66.2    2e-09   
ref|XP_003231310.1|  RNA splicing factor                              66.6    2e-09   
ref|XP_005056982.1|  PREDICTED: RNA-binding protein 39 isoform X2     66.2    2e-09   
ref|XP_009995344.1|  PREDICTED: RNA-binding protein 39                66.2    2e-09   
ref|XP_001893221.1|  splicing factor, CC1-like family protein         66.6    2e-09   
ref|XP_008893451.1|  hypothetical protein, variant 1                  66.2    2e-09   
gb|EGO04944.1|  hypothetical protein SERLA73DRAFT_174031              66.2    2e-09   
ref|XP_008504584.1|  PREDICTED: RNA-binding protein 39                66.2    2e-09   
dbj|GAC96764.1|  RNA recognition motif containing protein             66.6    2e-09   
gb|ETP42816.1|  hypothetical protein, variant 1                       66.2    2e-09   
gb|ETK84921.1|  hypothetical protein, variant 1                       66.2    2e-09   
ref|XP_003011578.1|  hypothetical protein ARB_02131                   66.2    2e-09   
gb|ETL91468.1|  hypothetical protein L917_09977                       66.2    2e-09   
gb|ETL91469.1|  hypothetical protein, variant 1                       66.2    2e-09   
gb|KFV45653.1|  RNA-binding protein 39                                66.2    2e-09   
ref|XP_002849949.1|  RNA splicing factor Pad-1                        66.2    2e-09   
ref|NP_500025.1|  Protein Y55F3AM.3, isoform a                        66.2    2e-09   
ref|XP_003171159.1|  RNA-binding protein rsd1                         66.2    2e-09   
gb|KGL94351.1|  RNA-binding protein 39                                66.2    2e-09   
gb|KFV90289.1|  RNA-binding protein 39                                66.2    2e-09   
gb|KFM10187.1|  RNA-binding protein 39                                66.2    2e-09   
ref|XP_008108162.1|  PREDICTED: RNA-binding protein 39 isoform X2     66.2    2e-09   
gb|KFP31531.1|  RNA-binding protein 39                                66.2    2e-09   
ref|XP_010214992.1|  PREDICTED: RNA-binding protein 39 isoform X1     66.2    2e-09   
gb|KFO97981.1|  RNA-binding protein 39                                66.2    2e-09   
ref|XP_004014586.1|  PREDICTED: RNA-binding protein 39 isoform 7      65.9    2e-09   
ref|XP_008641705.1|  PREDICTED: RNA-binding protein 39 isoform X1     66.2    2e-09   



>gb|EPS59790.1| splicing factor-like protein, partial [Genlisea aurea]
Length=161

 Score =   169 bits (428),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 84/104 (81%), Positives = 88/104 (85%), Gaps = 0/104 (0%)
 Frame = -1

Query  589  MVPEPVGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYV  410
            M PEP+G PSECLLLKNMFDP    DPEFDLD+ DDV EECSKYG VKHIHVDKNS GYV
Sbjct  58   MAPEPIGTPSECLLLKNMFDPTTEMDPEFDLDIRDDVHEECSKYGRVKHIHVDKNSCGYV  117

Query  409  YLRFDSXEFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKFKGA  278
            YLRF+S E A RAQ AMHKRWFARR +SAIFLQPY YDAKFKGA
Sbjct  118  YLRFESIEAASRAQQAMHKRWFARRLISAIFLQPYEYDAKFKGA  161



>emb|CDP12845.1| unnamed protein product [Coffea canephora]
Length=409

 Score =   175 bits (444),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 87/105 (83%), Positives = 92/105 (88%), Gaps = 0/105 (0%)
 Frame = -1

Query  589  MVPEPVGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYV  410
            M PEP+GNPSECLLLKNMFDPA  TDPEFDLD+ DDV EECS YG VKHIHVDKNSAGYV
Sbjct  305  MPPEPIGNPSECLLLKNMFDPATETDPEFDLDIRDDVREECSNYGPVKHIHVDKNSAGYV  364

Query  409  YLRFDSXEFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKFKGAA  275
            YLRF++ E A RAQ AMHKRWFARR +SAIFLQPY YDAKFKGAA
Sbjct  365  YLRFENVEAAARAQQAMHKRWFARRLISAIFLQPYEYDAKFKGAA  409



>ref|XP_011100931.1| PREDICTED: RNA-binding protein 39 [Sesamum indicum]
Length=587

 Score =   176 bits (445),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 86/105 (82%), Positives = 90/105 (86%), Gaps = 0/105 (0%)
 Frame = -1

Query  589  MVPEPVGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYV  410
            M PEP+G PSECLLLKNMFDP   TDPEFDLD+ DDV EECSKYG VKHIHVDKNSAGYV
Sbjct  483  MAPEPIGTPSECLLLKNMFDPTTETDPEFDLDIRDDVQEECSKYGRVKHIHVDKNSAGYV  542

Query  409  YLRFDSXEFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKFKGAA  275
            YLRF+S E A RAQ AMHKRWFARR +SAIFLQPY YDAKFKG A
Sbjct  543  YLRFESVEAASRAQQAMHKRWFARRLISAIFLQPYEYDAKFKGTA  587



>ref|XP_009608714.1| PREDICTED: RNA-binding protein 39 [Nicotiana tomentosiformis]
Length=587

 Score =   175 bits (444),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 86/105 (82%), Positives = 90/105 (86%), Gaps = 0/105 (0%)
 Frame = -1

Query  589  MVPEPVGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYV  410
            M PEP+G PSECLLLKNMFDPA  TDPEFDLD+ DDV EECSKYG VKHIHVDKNS+GYV
Sbjct  483  MAPEPIGIPSECLLLKNMFDPATETDPEFDLDIKDDVKEECSKYGRVKHIHVDKNSSGYV  542

Query  409  YLRFDSXEFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKFKGAA  275
            YLRFDS E A RAQ AMHKRWFA RS+SAIFLQPY YDAKFKG  
Sbjct  543  YLRFDSVEGASRAQQAMHKRWFAGRSISAIFLQPYEYDAKFKGTG  587



>ref|XP_009774937.1| PREDICTED: RNA-binding protein 39 [Nicotiana sylvestris]
 ref|XP_009774938.1| PREDICTED: RNA-binding protein 39 [Nicotiana sylvestris]
 ref|XP_009774939.1| PREDICTED: RNA-binding protein 39 [Nicotiana sylvestris]
Length=582

 Score =   175 bits (444),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 86/105 (82%), Positives = 90/105 (86%), Gaps = 0/105 (0%)
 Frame = -1

Query  589  MVPEPVGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYV  410
            M PEP+G PSECLLLKNMFDPA  TDPEFDLD+ DDV EECSKYG VKHIHVDKNS+GYV
Sbjct  478  MAPEPIGIPSECLLLKNMFDPATETDPEFDLDIKDDVKEECSKYGRVKHIHVDKNSSGYV  537

Query  409  YLRFDSXEFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKFKGAA  275
            YLRFDS E A RAQ AMHKRWFA RS+SAIFLQPY YDAKFKG  
Sbjct  538  YLRFDSVEGASRAQQAMHKRWFAGRSISAIFLQPYEYDAKFKGTG  582



>ref|XP_010312457.1| PREDICTED: RNA-binding protein 39 [Solanum lycopersicum]
Length=576

 Score =   174 bits (441),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 84/105 (80%), Positives = 90/105 (86%), Gaps = 0/105 (0%)
 Frame = -1

Query  589  MVPEPVGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYV  410
            M PEP+G PSECLLLKNMFDPA  TDPEFDLD+ DDV EECSKYG VKHIHVDKN++GYV
Sbjct  472  MAPEPIGIPSECLLLKNMFDPATETDPEFDLDIKDDVKEECSKYGRVKHIHVDKNTSGYV  531

Query  409  YLRFDSXEFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKFKGAA  275
            YLRFDS E A RAQ AMHKRWFA RS+SAI+LQPY YDAKFKG  
Sbjct  532  YLRFDSVEAASRAQQAMHKRWFAGRSISAIYLQPYEYDAKFKGTG  576



>ref|XP_006351114.1| PREDICTED: RNA-binding protein 39-like isoform X2 [Solanum tuberosum]
Length=412

 Score =   169 bits (429),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 83/105 (79%), Positives = 90/105 (86%), Gaps = 0/105 (0%)
 Frame = -1

Query  589  MVPEPVGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYV  410
            M PEP+G PSECLLLKNMFDPA  T+PEFDLD+ DDV EECSKYG VKHIHVDKN++GYV
Sbjct  308  MAPEPIGIPSECLLLKNMFDPATETEPEFDLDIKDDVKEECSKYGRVKHIHVDKNTSGYV  367

Query  409  YLRFDSXEFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKFKGAA  275
            YLRFDS E A RAQ AMHKRWFA RS+SAI+LQPY YDAKFKG  
Sbjct  368  YLRFDSVEAASRAQQAMHKRWFAGRSISAIYLQPYEYDAKFKGTG  412



>ref|XP_006351113.1| PREDICTED: RNA-binding protein 39-like isoform X1 [Solanum tuberosum]
Length=578

 Score =   172 bits (436),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 83/105 (79%), Positives = 90/105 (86%), Gaps = 0/105 (0%)
 Frame = -1

Query  589  MVPEPVGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYV  410
            M PEP+G PSECLLLKNMFDPA  T+PEFDLD+ DDV EECSKYG VKHIHVDKN++GYV
Sbjct  474  MAPEPIGIPSECLLLKNMFDPATETEPEFDLDIKDDVKEECSKYGRVKHIHVDKNTSGYV  533

Query  409  YLRFDSXEFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKFKGAA  275
            YLRFDS E A RAQ AMHKRWFA RS+SAI+LQPY YDAKFKG  
Sbjct  534  YLRFDSVEAASRAQQAMHKRWFAGRSISAIYLQPYEYDAKFKGTG  578



>gb|EYU24065.1| hypothetical protein MIMGU_mgv1a002916mg [Erythranthe guttata]
Length=626

 Score =   170 bits (430),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 83/104 (80%), Positives = 90/104 (87%), Gaps = 0/104 (0%)
 Frame = -1

Query  589  MVPEPVGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYV  410
            M PEP+G PSECLLLKNMFDPA   DPEFDLD+ DDV EECSKYG VKHI+VDKN+AGYV
Sbjct  522  MAPEPIGTPSECLLLKNMFDPATEEDPEFDLDIKDDVEEECSKYGRVKHIYVDKNTAGYV  581

Query  409  YLRFDSXEFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKFKGA  278
            YLRF+S E A RAQ AMHKRWFAR+ +SAIFLQPY YDAKFKGA
Sbjct  582  YLRFESVEGAARAQQAMHKRWFARKLISAIFLQPYEYDAKFKGA  625



>gb|EYU31126.1| hypothetical protein MIMGU_mgv1a0042611mg, partial [Erythranthe 
guttata]
Length=375

 Score =   165 bits (417),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 83/105 (79%), Positives = 90/105 (86%), Gaps = 0/105 (0%)
 Frame = -1

Query  589  MVPEPVGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYV  410
            M+PEP+G PSECLLLKNMFDPA   DPEFDLD+ DDV EECSKYG VKHI+VDKNSAGYV
Sbjct  271  MLPEPIGIPSECLLLKNMFDPATEADPEFDLDIKDDVHEECSKYGRVKHIYVDKNSAGYV  330

Query  409  YLRFDSXEFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKFKGAA  275
            YLRF+S E A  AQ AMHKRWFAR+ +SAIFLQ Y YDAKFKGAA
Sbjct  331  YLRFESIEAASGAQQAMHKRWFARKMISAIFLQAYEYDAKFKGAA  375



>gb|KDO57144.1| hypothetical protein CISIN_1g0063801mg, partial [Citrus sinensis]
 gb|KDO57145.1| hypothetical protein CISIN_1g0063801mg, partial [Citrus sinensis]
Length=168

 Score =   146 bits (369),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 72/102 (71%), Positives = 84/102 (82%), Gaps = 0/102 (0%)
 Frame = -1

Query  589  MVPEPVGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYV  410
            M  E +G+PSECLLLKNMFDPAM TDP+FDL++  DV EECSKYG VKHI+VDK SAG+V
Sbjct  66   MAAEFIGSPSECLLLKNMFDPAMETDPDFDLEIQGDVEEECSKYGRVKHIYVDKRSAGFV  125

Query  409  YLRFDSXEFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKFK  284
            YLRF+S E A  AQ AMH RWFARR +SAIF++P  Y+AKFK
Sbjct  126  YLRFESTEAAASAQRAMHMRWFARRLISAIFMKPEDYEAKFK  167



>gb|KJB14931.1| hypothetical protein B456_002G149800 [Gossypium raimondii]
 gb|KJB14932.1| hypothetical protein B456_002G149800 [Gossypium raimondii]
 gb|KJB14933.1| hypothetical protein B456_002G149800 [Gossypium raimondii]
 gb|KJB14934.1| hypothetical protein B456_002G149800 [Gossypium raimondii]
Length=618

 Score =   152 bits (383),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 72/100 (72%), Positives = 85/100 (85%), Gaps = 0/100 (0%)
 Frame = -1

Query  580  EPVGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVYLR  401
            EP+G PSECLLLKNMFDPA  T+P+FDLD+ +DV EECSKYG VKHI+VDKNS G VYLR
Sbjct  519  EPIGQPSECLLLKNMFDPATETEPDFDLDIKEDVEEECSKYGRVKHIYVDKNSGGCVYLR  578

Query  400  FDSXEFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKFKG  281
            FDS E A +AQ AMH RWFA RS+SA+F+QP+ Y+A+FKG
Sbjct  579  FDSTEAAGKAQRAMHMRWFAGRSISALFMQPHEYEARFKG  618



>ref|XP_010680478.1| PREDICTED: RNA-binding protein 39 [Beta vulgaris subsp. vulgaris]
Length=553

 Score =   151 bits (382),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 74/102 (73%), Positives = 85/102 (83%), Gaps = 0/102 (0%)
 Frame = -1

Query  580  EPVGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVYLR  401
            EPVGNPSECLLLKN+FDPA  TDPEFDLD+ +DV EECSK+G VKHI+VDK+SAG+VYLR
Sbjct  452  EPVGNPSECLLLKNLFDPATETDPEFDLDIKEDVEEECSKFGPVKHIYVDKHSAGHVYLR  511

Query  400  FDSXEFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKFKGAA  275
            FD+ E A  AQ  MH RWFARR +SAIF+QP  Y+AKF  AA
Sbjct  512  FDNKEGAMNAQRGMHMRWFARRLISAIFMQPQDYEAKFGAAA  553



>ref|XP_003525097.1| PREDICTED: RNA-binding protein 39-like isoform X1 [Glycine max]
Length=554

 Score =   150 bits (378),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 73/102 (72%), Positives = 85/102 (83%), Gaps = 0/102 (0%)
 Frame = -1

Query  586  VPEPVGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVY  407
            V EPVGNPSECLLLKNMFDP+  T+P+FD+D+ +DV EECSKYG VKHI VDK SAG+VY
Sbjct  451  VVEPVGNPSECLLLKNMFDPSTETEPDFDIDIKEDVEEECSKYGRVKHIFVDKKSAGFVY  510

Query  406  LRFDSXEFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKFKG  281
            LRFD+ E A  AQ AMH RWFARR +SA+F+QP  Y+AKFKG
Sbjct  511  LRFDTVEAASAAQHAMHLRWFARRLISAVFMQPELYEAKFKG  552



>gb|KCW54323.1| hypothetical protein EUGRSUZ_I00287 [Eucalyptus grandis]
Length=159

 Score =   142 bits (358),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 69/102 (68%), Positives = 86/102 (84%), Gaps = 0/102 (0%)
 Frame = -1

Query  580  EPVGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVYLR  401
            EPVG+P+ECLLLKN+FDPA  T+P+FDLD+ DDV EECSK+G VKHI+VDKN+AG+VYLR
Sbjct  58   EPVGSPTECLLLKNLFDPATETEPDFDLDIKDDVGEECSKFGQVKHIYVDKNTAGWVYLR  117

Query  400  FDSXEFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKFKGAA  275
            F++   A  AQ AMH RWFA RS+SAIF+ P+ Y+AKF+G A
Sbjct  118  FENVPAAMNAQRAMHLRWFAGRSISAIFMPPHEYEAKFQGVA  159



>ref|XP_010246266.1| PREDICTED: RNA-binding protein 39 isoform X1 [Nelumbo nucifera]
Length=604

 Score =   149 bits (377),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 70/103 (68%), Positives = 85/103 (83%), Gaps = 0/103 (0%)
 Frame = -1

Query  586  VPEPVGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVY  407
            V EP+GNPSECLLLKNMFDPA  TDP+FDLD+ ++V EECSK G VKHI+VDKNSAGYVY
Sbjct  501  VTEPIGNPSECLLLKNMFDPATETDPDFDLDIKEEVQEECSKLGPVKHIYVDKNSAGYVY  560

Query  406  LRFDSXEFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKFKGA  278
            LRF++   A   Q AMH RWFARR +SA+F+ P+ Y+AKF+G+
Sbjct  561  LRFETVAAAASTQRAMHMRWFARRLISAVFMPPHEYEAKFRGS  603



>ref|XP_010246267.1| PREDICTED: RNA-binding protein 39 isoform X2 [Nelumbo nucifera]
Length=603

 Score =   149 bits (377),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 70/103 (68%), Positives = 85/103 (83%), Gaps = 0/103 (0%)
 Frame = -1

Query  586  VPEPVGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVY  407
            V EP+GNPSECLLLKNMFDPA  TDP+FDLD+ ++V EECSK G VKHI+VDKNSAGYVY
Sbjct  500  VTEPIGNPSECLLLKNMFDPATETDPDFDLDIKEEVQEECSKLGPVKHIYVDKNSAGYVY  559

Query  406  LRFDSXEFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKFKGA  278
            LRF++   A   Q AMH RWFARR +SA+F+ P+ Y+AKF+G+
Sbjct  560  LRFETVAAAASTQRAMHMRWFARRLISAVFMPPHEYEAKFRGS  602



>gb|KHG29994.1| RNA-binding 39 [Gossypium arboreum]
Length=613

 Score =   149 bits (377),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 71/100 (71%), Positives = 84/100 (84%), Gaps = 0/100 (0%)
 Frame = -1

Query  580  EPVGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVYLR  401
            EP+G PSECLLLKNMFDP   T+P+FDLD+ +DV EECSKYG VKHI+VDKNS G VYLR
Sbjct  514  EPIGQPSECLLLKNMFDPTTETEPDFDLDIKEDVEEECSKYGRVKHIYVDKNSGGCVYLR  573

Query  400  FDSXEFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKFKG  281
            F+S E A +AQ AMH RWFA RS+SA+F+QP+ Y+AKFKG
Sbjct  574  FESTEAAGKAQRAMHMRWFAGRSISALFMQPHEYEAKFKG  613



>ref|XP_007048198.1| Splicing factor isoform 1 [Theobroma cacao]
 gb|EOX92355.1| Splicing factor isoform 1 [Theobroma cacao]
Length=568

 Score =   148 bits (374),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 70/100 (70%), Positives = 83/100 (83%), Gaps = 0/100 (0%)
 Frame = -1

Query  580  EPVGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVYLR  401
            +P G PSECLLLKNMFDPA   +P+FDL++ +DV EECSKYG VKHIHVDKNSAG VYLR
Sbjct  469  DPTGQPSECLLLKNMFDPATEMEPDFDLEIKEDVEEECSKYGRVKHIHVDKNSAGCVYLR  528

Query  400  FDSXEFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKFKG  281
            FDS E A +AQ AMH RWFA RS+SA+F+QP+ Y+A+F G
Sbjct  529  FDSAEAAGKAQRAMHMRWFAGRSISALFMQPHEYEARFNG  568



>ref|XP_006427900.1| hypothetical protein CICLE_v10025229mg [Citrus clementina]
 ref|XP_006464535.1| PREDICTED: RNA-binding protein 39-like [Citrus sinensis]
 gb|ESR41140.1| hypothetical protein CICLE_v10025229mg [Citrus clementina]
Length=589

 Score =   148 bits (374),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 72/102 (71%), Positives = 84/102 (82%), Gaps = 0/102 (0%)
 Frame = -1

Query  589  MVPEPVGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYV  410
            M  E +G+PSECLLLKNMFDPAM TDP+FDL++  DV EECSKYG VKHI+VDK SAG+V
Sbjct  487  MAAEFIGSPSECLLLKNMFDPAMETDPDFDLEIQGDVEEECSKYGRVKHIYVDKRSAGFV  546

Query  409  YLRFDSXEFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKFK  284
            YLRF+S E A  AQ AMH RWFARR +SAIF++P  Y+AKFK
Sbjct  547  YLRFESTEAAASAQRAMHMRWFARRLISAIFMKPEDYEAKFK  588



>ref|XP_003531395.1| PREDICTED: RNA-binding protein 39-like [Glycine max]
Length=550

 Score =   147 bits (372),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 70/100 (70%), Positives = 84/100 (84%), Gaps = 0/100 (0%)
 Frame = -1

Query  580  EPVGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVYLR  401
            EPVGNPS+CLLLKNMFDP+  T+P+FD+D+ +DV EECSKYG VKHI VDK S+G+VYLR
Sbjct  449  EPVGNPSDCLLLKNMFDPSTETEPDFDIDIKEDVEEECSKYGRVKHIFVDKKSSGFVYLR  508

Query  400  FDSXEFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKFKG  281
            FD+ E A  AQ AMH RWFARR +SA+F+QP  Y+AKFKG
Sbjct  509  FDTVEAASGAQRAMHMRWFARRLISAVFMQPELYEAKFKG  548



>emb|CAC10207.1| putative splicing factor [Cicer arietinum]
Length=392

 Score =   145 bits (365),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 71/102 (70%), Positives = 86/102 (84%), Gaps = 0/102 (0%)
 Frame = -1

Query  586  VPEPVGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVY  407
            V EPVG PSECLLLKNMFDP+  T+P+FDLD+ +DV EECSKYG VKHI+VDK SAG+VY
Sbjct  289  VVEPVGVPSECLLLKNMFDPSTETEPDFDLDIKEDVEEECSKYGRVKHIYVDKRSAGFVY  348

Query  406  LRFDSXEFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKFKG  281
            LRF++ E +  AQ AMH RWFARR ++AIF+QP+ Y+AKFKG
Sbjct  349  LRFETVEASSAAQRAMHMRWFARRLITAIFMQPHLYEAKFKG  390



>emb|CAN82467.1| hypothetical protein VITISV_002664 [Vitis vinifera]
Length=461

 Score =   145 bits (367),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 70/100 (70%), Positives = 83/100 (83%), Gaps = 0/100 (0%)
 Frame = -1

Query  580  EPVGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVYLR  401
            EPVG P+ECLLLKNMFDPA   DP+FDLD+ ++V EECS +G VKHI+V+K+SAGYVYLR
Sbjct  360  EPVGTPTECLLLKNMFDPATEIDPDFDLDIKEEVQEECSNFGRVKHIYVEKHSAGYVYLR  419

Query  400  FDSXEFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKFKG  281
            F++ E A  AQ AMH RWFARR +SAIFLQP  Y+AKFKG
Sbjct  420  FETVEAAVTAQRAMHMRWFARRLISAIFLQPRDYEAKFKG  459



>emb|CBI21551.3| unnamed protein product [Vitis vinifera]
Length=504

 Score =   146 bits (368),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 70/100 (70%), Positives = 83/100 (83%), Gaps = 0/100 (0%)
 Frame = -1

Query  580  EPVGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVYLR  401
            EPVG P+ECLLLKNMFDPA   DP+FDLD+ ++V EECS +G VKHI+V+K+SAGYVYLR
Sbjct  403  EPVGTPTECLLLKNMFDPATEIDPDFDLDIKEEVQEECSNFGRVKHIYVEKHSAGYVYLR  462

Query  400  FDSXEFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKFKG  281
            F++ E A  AQ AMH RWFARR +SAIFLQP  Y+AKFKG
Sbjct  463  FETVEAAVTAQRAMHMRWFARRLISAIFLQPRDYEAKFKG  502



>ref|XP_004503982.1| PREDICTED: RNA-binding protein 39-like [Cicer arietinum]
Length=583

 Score =   146 bits (369),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 71/102 (70%), Positives = 86/102 (84%), Gaps = 0/102 (0%)
 Frame = -1

Query  586  VPEPVGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVY  407
            V EPVG PSECLLLKNMFDP+  T+P+FDLD+ +DV EECSKYG VKHI+VDK SAG+VY
Sbjct  480  VVEPVGVPSECLLLKNMFDPSTETEPDFDLDIKEDVEEECSKYGRVKHIYVDKRSAGFVY  539

Query  406  LRFDSXEFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKFKG  281
            LRF++ E +  AQ AMH RWFARR ++AIF+QP+ Y+AKFKG
Sbjct  540  LRFETVEASSAAQRAMHMRWFARRLITAIFMQPHLYEAKFKG  581



>ref|XP_008351323.1| PREDICTED: RNA-binding protein 39-like [Malus domestica]
Length=154

 Score =   138 bits (348),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 69/100 (69%), Positives = 82/100 (82%), Gaps = 0/100 (0%)
 Frame = -1

Query  586  VPEPVGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVY  407
            V EPVGNPSECLLLKNMFDPA   +P+FD+D+ +DV EECSKYG VKHI+VDKNSAG+VY
Sbjct  53   VNEPVGNPSECLLLKNMFDPATEREPDFDIDIKEDVEEECSKYGHVKHIYVDKNSAGFVY  112

Query  406  LRFDSXEFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKF  287
            L F++ E A  AQ AMH RWFA R +SA+F+QP  Y+AKF
Sbjct  113  LWFETVEAAAGAQRAMHWRWFAGRLISALFMQPQVYEAKF  152



>ref|XP_010652895.1| PREDICTED: RNA-binding protein 39 [Vitis vinifera]
Length=608

 Score =   146 bits (368),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 70/100 (70%), Positives = 83/100 (83%), Gaps = 0/100 (0%)
 Frame = -1

Query  580  EPVGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVYLR  401
            EPVG P+ECLLLKNMFDPA   DP+FDLD+ ++V EECS +G VKHI+V+K+SAGYVYLR
Sbjct  507  EPVGTPTECLLLKNMFDPATEIDPDFDLDIKEEVQEECSNFGRVKHIYVEKHSAGYVYLR  566

Query  400  FDSXEFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKFKG  281
            F++ E A  AQ AMH RWFARR +SAIFLQP  Y+AKFKG
Sbjct  567  FETVEAAVTAQRAMHMRWFARRLISAIFLQPRDYEAKFKG  606



>gb|AES72769.2| CC1-like splicing factor [Medicago truncatula]
Length=587

 Score =   146 bits (368),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 70/102 (69%), Positives = 84/102 (82%), Gaps = 0/102 (0%)
 Frame = -1

Query  586  VPEPVGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVY  407
            V EPVG PS CLLLKNMFDP   T+P+FDLD+ +DV EECSKYG VKHI+VDKNSAG+VY
Sbjct  484  VAEPVGTPSNCLLLKNMFDPTTETEPDFDLDIKEDVEEECSKYGRVKHIYVDKNSAGFVY  543

Query  406  LRFDSXEFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKFKG  281
            L F++ E A  AQ AMH RWFAR+ +SAI++QP+ Y+AKFKG
Sbjct  544  LMFETVEAASAAQRAMHMRWFARKMISAIYMQPHEYEAKFKG  585



>gb|EYU31125.1| hypothetical protein MIMGU_mgv1a0042611mg, partial [Erythranthe 
guttata]
Length=379

 Score =   143 bits (361),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 72/92 (78%), Positives = 79/92 (86%), Gaps = 0/92 (0%)
 Frame = -1

Query  589  MVPEPVGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYV  410
            M+PEP+G PSECLLLKNMFDPA   DPEFDLD+ DDV EECSKYG VKHI+VDKNSAGYV
Sbjct  271  MLPEPIGIPSECLLLKNMFDPATEADPEFDLDIKDDVHEECSKYGRVKHIYVDKNSAGYV  330

Query  409  YLRFDSXEFAXRAQXAMHKRWFARRSVSAIFL  314
            YLRF+S E A  AQ AMHKRWFAR+ +SAIFL
Sbjct  331  YLRFESIEAASGAQQAMHKRWFARKMISAIFL  362



>gb|KJB18367.1| hypothetical protein B456_003G049000 [Gossypium raimondii]
Length=579

 Score =   145 bits (366),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 71/99 (72%), Positives = 83/99 (84%), Gaps = 0/99 (0%)
 Frame = -1

Query  580  EPVGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVYLR  401
            + VG PSECLLLKNMFDPA  T+P+FDLD+ +DV EECSKYG VKHI+VDKNSAG VYLR
Sbjct  480  DSVGQPSECLLLKNMFDPATETEPDFDLDIKEDVEEECSKYGRVKHIYVDKNSAGCVYLR  539

Query  400  FDSXEFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKFK  284
            FDS E A +AQ AMH RWFA RS+SA+F+QP  Y+A+FK
Sbjct  540  FDSAEAAGKAQRAMHMRWFAGRSISALFMQPQEYEARFK  578



>ref|XP_007137679.1| hypothetical protein PHAVU_009G146500g [Phaseolus vulgaris]
 gb|ESW09673.1| hypothetical protein PHAVU_009G146500g [Phaseolus vulgaris]
Length=592

 Score =   145 bits (366),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 71/102 (70%), Positives = 83/102 (81%), Gaps = 0/102 (0%)
 Frame = -1

Query  586  VPEPVGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVY  407
            V EPVGNPSECLLLKNMFDP   T+P+FDLD+ +DV EECSKYG VKHI+VDK S G+VY
Sbjct  488  VIEPVGNPSECLLLKNMFDPNTETEPDFDLDIKEDVEEECSKYGRVKHIYVDKRSTGFVY  547

Query  406  LRFDSXEFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKFKG  281
            L+F++ E A  AQ AMH RWFA R +SAI++QP  YDAKFKG
Sbjct  548  LQFETVEAASAAQRAMHTRWFAGRMISAIYMQPQIYDAKFKG  589



>ref|XP_007159797.1| hypothetical protein PHAVU_002G268000g [Phaseolus vulgaris]
 gb|ESW31791.1| hypothetical protein PHAVU_002G268000g [Phaseolus vulgaris]
Length=547

 Score =   145 bits (366),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 70/102 (69%), Positives = 84/102 (82%), Gaps = 0/102 (0%)
 Frame = -1

Query  586  VPEPVGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVY  407
            V EPVG+PSECLLLKNMFDP   ++P+FD+D+ +DV EECSKYG VKHI VDK SAG+VY
Sbjct  445  VVEPVGSPSECLLLKNMFDPTTESEPDFDIDIKEDVEEECSKYGRVKHIFVDKKSAGFVY  504

Query  406  LRFDSXEFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKFKG  281
            LRF++ E +  AQ AMH RWFARR +SAIF+QP  Y+AKFKG
Sbjct  505  LRFETVEASSAAQRAMHMRWFARRLISAIFMQPQIYEAKFKG  546



>gb|KHG26899.1| RNA-binding 39 [Gossypium arboreum]
Length=581

 Score =   145 bits (366),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 71/99 (72%), Positives = 83/99 (84%), Gaps = 0/99 (0%)
 Frame = -1

Query  580  EPVGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVYLR  401
            + VG PSECLLLKNMFDPA  T+P+FDLD+ +DV EECSKYG VKHI+VDKNSAG VYLR
Sbjct  482  DSVGQPSECLLLKNMFDPATETEPDFDLDIKEDVEEECSKYGRVKHIYVDKNSAGCVYLR  541

Query  400  FDSXEFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKFK  284
            FDS E A +AQ AMH RWFA RS+SA+F+QP  Y+A+FK
Sbjct  542  FDSAEAAGKAQRAMHMRWFAGRSISALFMQPQEYEARFK  580



>ref|XP_010546379.1| PREDICTED: RNA-binding protein 39 [Tarenaya hassleriana]
Length=568

 Score =   145 bits (365),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 70/98 (71%), Positives = 82/98 (84%), Gaps = 0/98 (0%)
 Frame = -1

Query  580  EPVGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVYLR  401
            EPVG PSECLLLKNMFDPA  T+P+FDLD+ +DV EECSKYG VKHI+VDKNSAG+VYLR
Sbjct  469  EPVGQPSECLLLKNMFDPATETEPDFDLDIKEDVEEECSKYGRVKHIYVDKNSAGFVYLR  528

Query  400  FDSXEFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKF  287
            F++ + A  AQ AMH RWFARR +SAIF+ P  Y+AKF
Sbjct  529  FETVQGAAGAQRAMHTRWFARRMISAIFMSPDEYEAKF  566



>ref|XP_003602517.1| Splicing factor-like protein [Medicago truncatula]
Length=731

 Score =   145 bits (365),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 70/102 (69%), Positives = 84/102 (82%), Gaps = 0/102 (0%)
 Frame = -1

Query  586  VPEPVGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVY  407
            V EPVG PS CLLLKNMFDP   T+P+FDLD+ +DV EECSKYG VKHI+VDKNSAG+VY
Sbjct  628  VAEPVGTPSNCLLLKNMFDPTTETEPDFDLDIKEDVEEECSKYGRVKHIYVDKNSAGFVY  687

Query  406  LRFDSXEFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKFKG  281
            L F++ E A  AQ AMH RWFAR+ +SAI++QP+ Y+AKFKG
Sbjct  688  LMFETVEAASAAQRAMHMRWFARKMISAIYMQPHEYEAKFKG  729



>ref|XP_003602518.1| Splicing factor-like protein [Medicago truncatula]
Length=766

 Score =   145 bits (365),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 70/102 (69%), Positives = 84/102 (82%), Gaps = 0/102 (0%)
 Frame = -1

Query  586  VPEPVGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVY  407
            V EPVG PS CLLLKNMFDP   T+P+FDLD+ +DV EECSKYG VKHI+VDKNSAG+VY
Sbjct  663  VAEPVGTPSNCLLLKNMFDPTTETEPDFDLDIKEDVEEECSKYGRVKHIYVDKNSAGFVY  722

Query  406  LRFDSXEFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKFKG  281
            L F++ E A  AQ AMH RWFAR+ +SAI++QP+ Y+AKFKG
Sbjct  723  LMFETVEAASAAQRAMHMRWFARKMISAIYMQPHEYEAKFKG  764



>gb|KHN09571.1| RNA-binding protein rsd1 [Glycine soja]
Length=545

 Score =   142 bits (358),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 70/104 (67%), Positives = 83/104 (80%), Gaps = 0/104 (0%)
 Frame = -1

Query  586  VPEPVGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVY  407
            V EPVGNPSECLLLKNMFDP   T+P+FDLD+ +DV EECSKYG VKHI+VDK SAG+VY
Sbjct  442  VTEPVGNPSECLLLKNMFDPNTETEPDFDLDIKEDVEEECSKYGRVKHIYVDKRSAGFVY  501

Query  406  LRFDSXEFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKFKGAA  275
            L+F++ E A  AQ AMH RWFA R +SAI++ P  Y+ KFKG A
Sbjct  502  LQFETVEAASAAQRAMHTRWFAGRMISAIYMLPQMYETKFKGDA  545



>ref|XP_010027731.1| PREDICTED: LOW QUALITY PROTEIN: RNA-binding protein 39 [Eucalyptus 
grandis]
Length=576

 Score =   142 bits (358),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 69/102 (68%), Positives = 86/102 (84%), Gaps = 0/102 (0%)
 Frame = -1

Query  580  EPVGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVYLR  401
            EPVG+P+ECLLLKN+FDPA  T+P+FDLD+ DDV EECSK+G VKHI+VDKN+AG+VYLR
Sbjct  475  EPVGSPTECLLLKNLFDPATETEPDFDLDIKDDVGEECSKFGQVKHIYVDKNTAGWVYLR  534

Query  400  FDSXEFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKFKGAA  275
            F++   A  AQ AMH RWFA RS+SAIF+ P+ Y+AKF+G A
Sbjct  535  FENVPAAMNAQRAMHLRWFAGRSISAIFMPPHEYEAKFQGVA  576



>ref|XP_003526844.1| PREDICTED: RNA-binding protein 39-like [Glycine max]
Length=549

 Score =   142 bits (358),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 70/104 (67%), Positives = 83/104 (80%), Gaps = 0/104 (0%)
 Frame = -1

Query  586  VPEPVGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVY  407
            V EPVGNPSECLLLKNMFDP   T+P+FDLD+ +DV EECSKYG VKHI+VDK SAG+VY
Sbjct  446  VTEPVGNPSECLLLKNMFDPNTETEPDFDLDIKEDVEEECSKYGRVKHIYVDKRSAGFVY  505

Query  406  LRFDSXEFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKFKGAA  275
            L+F++ E A  AQ AMH RWFA R +SAI++ P  Y+ KFKG A
Sbjct  506  LQFETVEAASAAQRAMHTRWFAGRMISAIYMLPQMYETKFKGDA  549



>ref|XP_004502884.1| PREDICTED: RNA-binding protein 39-like isoform X2 [Cicer arietinum]
Length=567

 Score =   141 bits (355),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 70/102 (69%), Positives = 83/102 (81%), Gaps = 0/102 (0%)
 Frame = -1

Query  586  VPEPVGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVY  407
            V EPVG PSECLLLKNMFDP   T+P+FDLD+ +DV EECSKYG VKHI+VDK SAG+VY
Sbjct  464  VAEPVGTPSECLLLKNMFDPTTETEPDFDLDIKEDVEEECSKYGRVKHIYVDKKSAGFVY  523

Query  406  LRFDSXEFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKFKG  281
            L F++ E A  AQ AMH RWFARR ++AI++QP  Y+AKFKG
Sbjct  524  LMFETVEAAAAAQRAMHMRWFARRLIAAIYMQPQVYEAKFKG  565



>ref|XP_004502883.1| PREDICTED: RNA-binding protein 39-like isoform X1 [Cicer arietinum]
Length=583

 Score =   141 bits (355),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 70/102 (69%), Positives = 83/102 (81%), Gaps = 0/102 (0%)
 Frame = -1

Query  586  VPEPVGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVY  407
            V EPVG PSECLLLKNMFDP   T+P+FDLD+ +DV EECSKYG VKHI+VDK SAG+VY
Sbjct  480  VAEPVGTPSECLLLKNMFDPTTETEPDFDLDIKEDVEEECSKYGRVKHIYVDKKSAGFVY  539

Query  406  LRFDSXEFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKFKG  281
            L F++ E A  AQ AMH RWFARR ++AI++QP  Y+AKFKG
Sbjct  540  LMFETVEAAAAAQRAMHMRWFARRLIAAIYMQPQVYEAKFKG  581



>ref|XP_007137677.1| hypothetical protein PHAVU_009G146500g [Phaseolus vulgaris]
 gb|ESW09671.1| hypothetical protein PHAVU_009G146500g [Phaseolus vulgaris]
Length=591

 Score =   141 bits (355),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 71/102 (70%), Positives = 83/102 (81%), Gaps = 1/102 (1%)
 Frame = -1

Query  586  VPEPVGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVY  407
            V EPVGNPSECLLLKNMFDP   T+P+FDLD+ +DV EECSKYG VKHI+VDK S G+VY
Sbjct  488  VIEPVGNPSECLLLKNMFDPNTETEPDFDLDIKEDVEEECSKYGRVKHIYVDK-STGFVY  546

Query  406  LRFDSXEFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKFKG  281
            L+F++ E A  AQ AMH RWFA R +SAI++QP  YDAKFKG
Sbjct  547  LQFETVEAASAAQRAMHTRWFAGRMISAIYMQPQIYDAKFKG  588



>ref|XP_011014283.1| PREDICTED: RNA-binding protein 39-like isoform X2 [Populus euphratica]
Length=395

 Score =   138 bits (348),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 67/102 (66%), Positives = 82/102 (80%), Gaps = 0/102 (0%)
 Frame = -1

Query  580  EPVGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVYLR  401
            E +G PSECLLLKNMFDPA  T+P+FDLD+ +DV EECS+YG VKHI VDKNSAG+VYL 
Sbjct  294  ESIGKPSECLLLKNMFDPATETEPDFDLDIKEDVEEECSRYGQVKHIWVDKNSAGHVYLH  353

Query  400  FDSXEFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKFKGAA  275
            FDS E A RAQ AMH RWFA+RS+ A+F+  + Y+A+F+  A
Sbjct  354  FDSMEAAARAQRAMHMRWFAQRSILAVFMPTHEYEARFQNGA  395



>ref|XP_011021826.1| PREDICTED: RNA-binding protein 39-like [Populus euphratica]
Length=572

 Score =   139 bits (351),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 68/102 (67%), Positives = 82/102 (80%), Gaps = 0/102 (0%)
 Frame = -1

Query  580  EPVGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVYLR  401
            E +G PSECLLLKNMFDPA  T+P+FDLD+ +DV EECS+YG VKHI VDKNSAG+VYL 
Sbjct  471  ESIGQPSECLLLKNMFDPATETEPDFDLDIKEDVEEECSRYGRVKHIWVDKNSAGHVYLH  530

Query  400  FDSXEFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKFKGAA  275
            FDS E A RAQ AMH RWFA+RS+ AIF+  + Y+A+F+  A
Sbjct  531  FDSMEAAARAQRAMHMRWFAQRSILAIFMPTHEYEARFQNGA  572



>ref|XP_011014282.1| PREDICTED: RNA-binding protein 39-like isoform X1 [Populus euphratica]
Length=564

 Score =   139 bits (349),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 67/102 (66%), Positives = 82/102 (80%), Gaps = 0/102 (0%)
 Frame = -1

Query  580  EPVGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVYLR  401
            E +G PSECLLLKNMFDPA  T+P+FDLD+ +DV EECS+YG VKHI VDKNSAG+VYL 
Sbjct  463  ESIGKPSECLLLKNMFDPATETEPDFDLDIKEDVEEECSRYGQVKHIWVDKNSAGHVYLH  522

Query  400  FDSXEFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKFKGAA  275
            FDS E A RAQ AMH RWFA+RS+ A+F+  + Y+A+F+  A
Sbjct  523  FDSMEAAARAQRAMHMRWFAQRSILAVFMPTHEYEARFQNGA  564



>ref|XP_008231785.1| PREDICTED: RNA-binding protein 39 [Prunus mume]
Length=575

 Score =   139 bits (349),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 66/100 (66%), Positives = 82/100 (82%), Gaps = 0/100 (0%)
 Frame = -1

Query  586  VPEPVGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVY  407
            V EP+GNPSECLLLKNMFDPA   +P+FD+D+ DDV EECSK G VKHI+VDKN+AG+VY
Sbjct  474  VTEPIGNPSECLLLKNMFDPATEREPDFDIDIKDDVEEECSKCGRVKHIYVDKNTAGFVY  533

Query  406  LRFDSXEFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKF  287
            LRF++ E A  AQ +MH RWFA R +SA+F+QP  Y+A+F
Sbjct  534  LRFETVEAAAAAQQSMHLRWFAGRQISALFMQPQVYEARF  573



>ref|XP_007212812.1| hypothetical protein PRUPE_ppa002854mg [Prunus persica]
 gb|EMJ14011.1| hypothetical protein PRUPE_ppa002854mg [Prunus persica]
Length=628

 Score =   139 bits (349),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 66/100 (66%), Positives = 82/100 (82%), Gaps = 0/100 (0%)
 Frame = -1

Query  586  VPEPVGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVY  407
            V EP+GNPSECLLLKNMFDPA   +P+FD+D+ DDV EECSK G VKHI+VDKN+AG+VY
Sbjct  527  VTEPIGNPSECLLLKNMFDPATEREPDFDIDIKDDVEEECSKCGRVKHIYVDKNTAGFVY  586

Query  406  LRFDSXEFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKF  287
            LRF++ E A  AQ +MH RWFA R +SA+F+QP  Y+A+F
Sbjct  587  LRFETVEAAAAAQQSMHLRWFAGRQISALFMQPQVYEARF  626



>ref|XP_003630170.1| RNA-binding protein [Medicago truncatula]
 gb|AET04646.1| CC1-like splicing factor [Medicago truncatula]
Length=567

 Score =   138 bits (347),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 66/101 (65%), Positives = 83/101 (82%), Gaps = 0/101 (0%)
 Frame = -1

Query  586  VPEPVGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVY  407
            V EPVG PSECLLLKNMFDP+   +P+FD+D+ +DV EECSKYG V HI+VDK SAG+VY
Sbjct  464  VAEPVGIPSECLLLKNMFDPSTEIEPDFDIDIKEDVEEECSKYGRVMHIYVDKRSAGFVY  523

Query  406  LRFDSXEFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKFK  284
            L+F++ E +  AQ AMH RWFARR ++AIF+QP+ Y+AKFK
Sbjct  524  LQFETVEASSAAQRAMHMRWFARRLITAIFMQPHLYEAKFK  564



>ref|XP_008781452.1| PREDICTED: RNA-binding protein 39-like [Phoenix dactylifera]
Length=568

 Score =   137 bits (345),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 64/104 (62%), Positives = 83/104 (80%), Gaps = 0/104 (0%)
 Frame = -1

Query  586  VPEPVGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVY  407
            + EP+G PSEC+LLKNMFDP+  TDP+FDLD+ ++V EECSK+G+VKHI+VDKNS GYVY
Sbjct  465  LAEPIGEPSECVLLKNMFDPSTETDPDFDLDIKEEVEEECSKFGSVKHIYVDKNSHGYVY  524

Query  406  LRFDSXEFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKFKGAA  275
            L F S   A   Q AMH RW+ARR++SA F++P  Y+AKF+G +
Sbjct  525  LWFGSMAAAASCQHAMHMRWYARRTISATFMRPQEYEAKFRGVS  568



>ref|XP_004141977.1| PREDICTED: RNA-binding protein 39-like [Cucumis sativus]
 gb|KGN48400.1| hypothetical protein Csa_6G486730 [Cucumis sativus]
Length=598

 Score =   137 bits (345),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 66/103 (64%), Positives = 82/103 (80%), Gaps = 0/103 (0%)
 Frame = -1

Query  586  VPEPVGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVY  407
            V + VG+PSECLLLKNMFDP+  T P+FD+++ +DV EECSKYG VKHI+VDKNSAG VY
Sbjct  496  VLQSVGSPSECLLLKNMFDPSTETAPDFDMEIKEDVEEECSKYGRVKHIYVDKNSAGCVY  555

Query  406  LRFDSXEFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKFKGA  278
            L++D+ E A  AQ AMH RWFA R +S +F+QP  Y+AKF GA
Sbjct  556  LQYDTVEAAINAQRAMHLRWFAGRQISVLFMQPQVYEAKFIGA  598



>ref|XP_004160482.1| PREDICTED: RNA-binding protein 39-like [Cucumis sativus]
Length=598

 Score =   137 bits (345),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 66/103 (64%), Positives = 82/103 (80%), Gaps = 0/103 (0%)
 Frame = -1

Query  586  VPEPVGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVY  407
            V + VG+PSECLLLKNMFDP+  T P+FD+++ +DV EECSKYG VKHI+VDKNSAG VY
Sbjct  496  VLQSVGSPSECLLLKNMFDPSTETAPDFDMEIKEDVEEECSKYGRVKHIYVDKNSAGCVY  555

Query  406  LRFDSXEFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKFKGA  278
            L++D+ E A  AQ AMH RWFA R +S +F+QP  Y+AKF GA
Sbjct  556  LQYDTVEAAINAQRAMHLRWFAGRQISVLFMQPQVYEAKFIGA  598



>ref|XP_008440991.1| PREDICTED: RNA-binding protein 39 isoform X2 [Cucumis melo]
Length=600

 Score =   137 bits (344),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 66/103 (64%), Positives = 82/103 (80%), Gaps = 0/103 (0%)
 Frame = -1

Query  586  VPEPVGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVY  407
            V + VG+PSECLLLKNMFDP+  T P+FD+++ +DV EECSKYG VKHI+VDKNSAG VY
Sbjct  498  VLQSVGSPSECLLLKNMFDPSTETAPDFDMEIKEDVEEECSKYGHVKHIYVDKNSAGCVY  557

Query  406  LRFDSXEFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKFKGA  278
            L++D+ E A  AQ AMH RWFA R +S +F+QP  Y+AKF GA
Sbjct  558  LQYDTVEAAVNAQRAMHLRWFAGRQISVLFMQPQVYEAKFIGA  600



>ref|XP_010452994.1| PREDICTED: RNA-binding protein 39-like isoform X2 [Camelina sativa]
 ref|XP_010452995.1| PREDICTED: RNA-binding protein 39-like isoform X2 [Camelina sativa]
Length=306

 Score =   134 bits (336),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 62/101 (61%), Positives = 81/101 (80%), Gaps = 0/101 (0%)
 Frame = -1

Query  586  VPEPVGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVY  407
            + EPVG PS+CLLLKNMFDPA  TDPEFDL++ +DV EECS+YG V HI+VDKNSAG+VY
Sbjct  202  ITEPVGQPSDCLLLKNMFDPATETDPEFDLEIREDVKEECSRYGRVSHIYVDKNSAGFVY  261

Query  406  LRFDSXEFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKFK  284
            LRF++ + A  AQ  MH+RWFA++ ++A F+  + Y+AK K
Sbjct  262  LRFETVQGAVAAQGVMHRRWFAQKMITATFMPRHEYEAKAK  302



>ref|XP_008440993.1| PREDICTED: RNA-binding protein 39 isoform X4 [Cucumis melo]
Length=598

 Score =   137 bits (344),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 66/103 (64%), Positives = 82/103 (80%), Gaps = 0/103 (0%)
 Frame = -1

Query  586  VPEPVGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVY  407
            V + VG+PSECLLLKNMFDP+  T P+FD+++ +DV EECSKYG VKHI+VDKNSAG VY
Sbjct  496  VLQSVGSPSECLLLKNMFDPSTETAPDFDMEIKEDVEEECSKYGHVKHIYVDKNSAGCVY  555

Query  406  LRFDSXEFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKFKGA  278
            L++D+ E A  AQ AMH RWFA R +S +F+QP  Y+AKF GA
Sbjct  556  LQYDTVEAAVNAQRAMHLRWFAGRQISVLFMQPQVYEAKFIGA  598



>ref|XP_010491632.1| PREDICTED: RNA-binding protein 39-like [Camelina sativa]
Length=532

 Score =   135 bits (339),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 63/101 (62%), Positives = 81/101 (80%), Gaps = 0/101 (0%)
 Frame = -1

Query  586  VPEPVGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVY  407
            V EPVG PS+CLLLKNMFDPA  TDPEFDL++ +DV EECS+YG V HI+VDKNSAG+VY
Sbjct  428  VTEPVGQPSDCLLLKNMFDPATETDPEFDLEIREDVKEECSRYGRVSHIYVDKNSAGFVY  487

Query  406  LRFDSXEFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKFK  284
            LRF++ + A  AQ  MH+RWFA++ ++A F+  + Y+AK K
Sbjct  488  LRFETVQGAVAAQNVMHRRWFAQKMITATFMPRHEYEAKAK  528



>ref|XP_010930948.1| PREDICTED: RNA-binding protein 39 [Elaeis guineensis]
Length=595

 Score =   135 bits (340),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 64/102 (63%), Positives = 80/102 (78%), Gaps = 0/102 (0%)
 Frame = -1

Query  580  EPVGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVYLR  401
            EP+G PSEC+LLKNMFDP+   DP+FDLD+ ++V EECSK+G VKHI+VDKNS GYVYL 
Sbjct  494  EPIGEPSECVLLKNMFDPSTEMDPDFDLDIKEEVEEECSKFGLVKHIYVDKNSHGYVYLW  553

Query  400  FDSXEFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKFKGAA  275
            F S E A   Q AMH RW+ARRS+SA F++P  Y+AKF+  +
Sbjct  554  FGSMEAAASCQLAMHTRWYARRSISATFMRPQEYEAKFRSVS  595



>ref|XP_010422929.1| PREDICTED: RNA-binding protein 39-like [Camelina sativa]
Length=528

 Score =   134 bits (338),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 63/101 (62%), Positives = 81/101 (80%), Gaps = 0/101 (0%)
 Frame = -1

Query  586  VPEPVGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVY  407
            V EPVG PS+CLLLKNMFDPA  TDPEFDL++ +DV EECS+YG V HI+VDKNSAG+VY
Sbjct  424  VTEPVGQPSDCLLLKNMFDPATETDPEFDLEIREDVKEECSRYGRVSHIYVDKNSAGFVY  483

Query  406  LRFDSXEFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKFK  284
            LRF++ + A  AQ  MH+RWFA++ ++A F+  + Y+AK K
Sbjct  484  LRFETVQGAVAAQSVMHRRWFAQKMITATFMPRHEYEAKAK  524



>ref|XP_007048199.1| Splicing factor isoform 2 [Theobroma cacao]
 gb|EOX92356.1| Splicing factor isoform 2 [Theobroma cacao]
Length=497

 Score =   134 bits (337),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 64/89 (72%), Positives = 74/89 (83%), Gaps = 0/89 (0%)
 Frame = -1

Query  580  EPVGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVYLR  401
            +P G PSECLLLKNMFDPA   +P+FDL++ +DV EECSKYG VKHIHVDKNSAG VYLR
Sbjct  400  DPTGQPSECLLLKNMFDPATEMEPDFDLEIKEDVEEECSKYGRVKHIHVDKNSAGCVYLR  459

Query  400  FDSXEFAXRAQXAMHKRWFARRSVSAIFL  314
            FDS E A +AQ AMH RWFA RS+SA+F+
Sbjct  460  FDSAEAAGKAQRAMHMRWFAGRSISALFM  488



>ref|XP_010452992.1| PREDICTED: RNA-binding protein 39-like isoform X1 [Camelina sativa]
 ref|XP_010452993.1| PREDICTED: RNA-binding protein 39-like isoform X1 [Camelina sativa]
Length=528

 Score =   134 bits (337),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 62/101 (61%), Positives = 81/101 (80%), Gaps = 0/101 (0%)
 Frame = -1

Query  586  VPEPVGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVY  407
            + EPVG PS+CLLLKNMFDPA  TDPEFDL++ +DV EECS+YG V HI+VDKNSAG+VY
Sbjct  424  ITEPVGQPSDCLLLKNMFDPATETDPEFDLEIREDVKEECSRYGRVSHIYVDKNSAGFVY  483

Query  406  LRFDSXEFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKFK  284
            LRF++ + A  AQ  MH+RWFA++ ++A F+  + Y+AK K
Sbjct  484  LRFETVQGAVAAQGVMHRRWFAQKMITATFMPRHEYEAKAK  524



>ref|XP_011011956.1| PREDICTED: RNA-binding protein 39-like [Populus euphratica]
Length=558

 Score =   134 bits (336),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 67/102 (66%), Positives = 79/102 (77%), Gaps = 0/102 (0%)
 Frame = -1

Query  580  EPVGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVYLR  401
            EP+G PSECLLLKNMFDPA  T+P+FDLD+ +DV EECSKYG V+HI VDK SAG VYLR
Sbjct  457  EPIGQPSECLLLKNMFDPATETEPDFDLDIKEDVEEECSKYGRVEHIFVDKKSAGCVYLR  516

Query  400  FDSXEFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKFKGAA  275
            FDS E A  AQ AMH RWFARR + A+F+    Y+A+F+  A
Sbjct  517  FDSIEAAAGAQRAMHMRWFARRLILAVFMPTREYEARFQIGA  558



>ref|XP_002873428.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49687.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=520

 Score =   133 bits (335),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 65/101 (64%), Positives = 79/101 (78%), Gaps = 0/101 (0%)
 Frame = -1

Query  586  VPEPVGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVY  407
            V EPVG PSECLLLKNMFDPA  T+ +FD ++ +DV +ECSKYG V HI+VDKNSAG+VY
Sbjct  419  VNEPVGQPSECLLLKNMFDPATETERDFDFEIREDVADECSKYGEVNHIYVDKNSAGFVY  478

Query  406  LRFDSXEFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKFK  284
            LRF S E A  AQ AMH RWFA++ +SA F+ P+ Y+AK K
Sbjct  479  LRFQSVEAAVAAQRAMHMRWFAQKMISATFMPPHEYEAKAK  519



>ref|XP_011466737.1| PREDICTED: RNA-binding protein 39 [Fragaria vesca subsp. vesca]
Length=606

 Score =   134 bits (337),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 67/98 (68%), Positives = 81/98 (83%), Gaps = 0/98 (0%)
 Frame = -1

Query  580  EPVGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVYLR  401
            EP+GNPSECLLLK+MFDPA  T+P+FD+D+ DDV EECSKYG VKHI+V+KNSAG+VYL 
Sbjct  507  EPIGNPSECLLLKDMFDPATETEPDFDVDIKDDVEEECSKYGRVKHIYVEKNSAGFVYLW  566

Query  400  FDSXEFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKF  287
            F++ E A  AQ AMH RWFA R +SA+F+QP  Y AKF
Sbjct  567  FETVEAAAAAQRAMHLRWFAGRQISALFMQPQVYAAKF  604



>gb|KHN34036.1| RNA-binding protein 39 [Glycine soja]
Length=564

 Score =   133 bits (334),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 65/91 (71%), Positives = 76/91 (84%), Gaps = 0/91 (0%)
 Frame = -1

Query  586  VPEPVGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVY  407
            V EPVGNPSECLLLKNMFDP+  T+P+FD+D+ +DV EECSKYG VKHI VDK SAG+VY
Sbjct  451  VVEPVGNPSECLLLKNMFDPSTETEPDFDIDIKEDVEEECSKYGRVKHIFVDKKSAGFVY  510

Query  406  LRFDSXEFAXRAQXAMHKRWFARRSVSAIFL  314
            LRFD+ E A  AQ AMH RWFARR +SA+F+
Sbjct  511  LRFDTVEAASAAQHAMHLRWFARRLISAVFM  541



>ref|XP_008338762.1| PREDICTED: RNA-binding protein 39 isoform X2 [Malus domestica]
Length=598

 Score =   133 bits (335),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 70/100 (70%), Positives = 83/100 (83%), Gaps = 0/100 (0%)
 Frame = -1

Query  586  VPEPVGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVY  407
            V EPVGNPSECLLLKNMFDPA   +P+FD+D+ +DV EECSKYG VKHI+VDKNSAG+VY
Sbjct  497  VNEPVGNPSECLLLKNMFDPATEREPDFDVDIKEDVEEECSKYGRVKHIYVDKNSAGFVY  556

Query  406  LRFDSXEFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKF  287
            LRF++ E A  AQ AMH RWFA R +SA+F+QP  Y+AKF
Sbjct  557  LRFEAVEAAAAAQRAMHLRWFAGRLISALFMQPQVYEAKF  596



>ref|XP_008338761.1| PREDICTED: RNA-binding protein 39 isoform X1 [Malus domestica]
Length=599

 Score =   133 bits (335),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 70/100 (70%), Positives = 83/100 (83%), Gaps = 0/100 (0%)
 Frame = -1

Query  586  VPEPVGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVY  407
            V EPVGNPSECLLLKNMFDPA   +P+FD+D+ +DV EECSKYG VKHI+VDKNSAG+VY
Sbjct  498  VNEPVGNPSECLLLKNMFDPATEREPDFDVDIKEDVEEECSKYGRVKHIYVDKNSAGFVY  557

Query  406  LRFDSXEFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKF  287
            LRF++ E A  AQ AMH RWFA R +SA+F+QP  Y+AKF
Sbjct  558  LRFEAVEAAAAAQRAMHLRWFAGRLISALFMQPQVYEAKF  597



>ref|XP_010690339.1| PREDICTED: RNA-binding protein 39 [Beta vulgaris subsp. vulgaris]
Length=615

 Score =   133 bits (335),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 63/100 (63%), Positives = 80/100 (80%), Gaps = 0/100 (0%)
 Frame = -1

Query  586  VPEPVGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVY  407
            + +PVG PSECLLLKNMFDP + T+P+FDLD+ +DV EEC KYGAVKHI VDK+S GYVY
Sbjct  512  IADPVGVPSECLLLKNMFDPKLETEPDFDLDIKEDVQEECGKYGAVKHIFVDKDSEGYVY  571

Query  406  LRFDSXEFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKF  287
            L+FDS + A  AQ A+H RWFA + +SA ++ P+ Y+AKF
Sbjct  572  LKFDSTQAAMNAQRALHGRWFAAKMISATYIAPHDYEAKF  611



>ref|XP_002306512.2| hypothetical protein POPTR_0005s19200g [Populus trichocarpa]
 gb|EEE93508.2| hypothetical protein POPTR_0005s19200g [Populus trichocarpa]
Length=551

 Score =   131 bits (330),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 65/102 (64%), Positives = 78/102 (76%), Gaps = 0/102 (0%)
 Frame = -1

Query  580  EPVGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVYLR  401
            EP+G PSECL+LKNMFDPA  T+P+FDLD+ +DV EECSKYG V+HI VDKNS G VYLR
Sbjct  450  EPIGQPSECLMLKNMFDPATETEPDFDLDIKEDVEEECSKYGQVEHIFVDKNSTGCVYLR  509

Query  400  FDSXEFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKFKGAA  275
            F S E A  AQ AMH RWFARR + A+F+    Y+A+F+  A
Sbjct  510  FGSIEAAAGAQRAMHMRWFARRLILAVFMPTREYEARFQIGA  551



>dbj|BAD93824.1| splicing factor-like protein [Arabidopsis thaliana]
Length=308

 Score =   128 bits (322),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 67/101 (66%), Positives = 79/101 (78%), Gaps = 0/101 (0%)
 Frame = -1

Query  586  VPEPVGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVY  407
            V E VG PSECLLLKNMFDPA  T+P FDL++ DDV +ECSKYG V HI+VDKNSAG+VY
Sbjct  207  VNEHVGLPSECLLLKNMFDPATETEPNFDLEIRDDVADECSKYGPVNHIYVDKNSAGFVY  266

Query  406  LRFDSXEFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKFK  284
            LRF S E A  AQ AMH RWFA++ +SA F+ P+ Y+AK K
Sbjct  267  LRFQSVEAAAAAQRAMHMRWFAQKMISATFMPPHEYEAKAK  307



>gb|KFK25283.1| hypothetical protein AALP_AA8G092000 [Arabis alpina]
Length=522

 Score =   130 bits (326),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 62/101 (61%), Positives = 80/101 (79%), Gaps = 0/101 (0%)
 Frame = -1

Query  586  VPEPVGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVY  407
            V EP+G PSECLLLKNMFDPA   +P+F+ ++ DDV +ECSKYG V+HI+VD+NSAG+VY
Sbjct  421  VAEPIGQPSECLLLKNMFDPATEMEPDFENEIKDDVVDECSKYGTVEHIYVDRNSAGFVY  480

Query  406  LRFDSXEFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKFK  284
            LRF+S   A  AQ AMH RWFA++ +SAIF+  + Y+AK K
Sbjct  481  LRFESVHAAAAAQKAMHTRWFAQKMISAIFMPRHEYEAKVK  521



>ref|XP_009399181.1| PREDICTED: RNA-binding protein 39 [Musa acuminata subsp. malaccensis]
Length=544

 Score =   129 bits (324),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 63/100 (63%), Positives = 76/100 (76%), Gaps = 0/100 (0%)
 Frame = -1

Query  586  VPEPVGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVY  407
             P  V  PSECLLLKNMFDP+  T+P+FDL++ +DV EECSK+G VKHIHV+KNS G+VY
Sbjct  445  TPTSVVEPSECLLLKNMFDPSTETEPDFDLEIKEDVQEECSKFGPVKHIHVEKNSTGFVY  504

Query  406  LRFDSXEFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKF  287
            LRF+S   A   Q AM  RWFA RSVSA F++P  Y+AKF
Sbjct  505  LRFESVTAAVSCQRAMQGRWFAGRSVSATFMRPQEYEAKF  544



>dbj|BAH57172.1| AT5G09880 [Arabidopsis thaliana]
Length=505

 Score =   128 bits (321),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 67/101 (66%), Positives = 79/101 (78%), Gaps = 0/101 (0%)
 Frame = -1

Query  586  VPEPVGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVY  407
            V E VG PSECLLLKNMFDPA  T+P FDL++ DDV +ECSKYG V HI+VDKNSAG+VY
Sbjct  404  VNEHVGLPSECLLLKNMFDPATETEPNFDLEIRDDVADECSKYGPVNHIYVDKNSAGFVY  463

Query  406  LRFDSXEFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKFK  284
            LRF S E A  AQ AMH RWFA++ +SA F+ P+ Y+AK K
Sbjct  464  LRFQSVEAAAAAQRAMHMRWFAQKMISATFMPPHEYEAKAK  504



>ref|NP_568220.1| splicing factor, CC1-like [Arabidopsis thaliana]
 gb|AAK96794.1| splicing factor-like protein [Arabidopsis thaliana]
 gb|AED91460.1| splicing factor, CC1-like [Arabidopsis thaliana]
Length=527

 Score =   128 bits (322),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 67/101 (66%), Positives = 79/101 (78%), Gaps = 0/101 (0%)
 Frame = -1

Query  586  VPEPVGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVY  407
            V E VG PSECLLLKNMFDPA  T+P FDL++ DDV +ECSKYG V HI+VDKNSAG+VY
Sbjct  426  VNEHVGLPSECLLLKNMFDPATETEPNFDLEIRDDVADECSKYGPVNHIYVDKNSAGFVY  485

Query  406  LRFDSXEFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKFK  284
            LRF S E A  AQ AMH RWFA++ +SA F+ P+ Y+AK K
Sbjct  486  LRFQSVEAAAAAQRAMHMRWFAQKMISATFMPPHEYEAKAK  526



>gb|AES72768.2| CC1-like splicing factor [Medicago truncatula]
Length=576

 Score =   129 bits (323),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 62/92 (67%), Positives = 75/92 (82%), Gaps = 0/92 (0%)
 Frame = -1

Query  586  VPEPVGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVY  407
            V EPVG PS CLLLKNMFDP   T+P+FDLD+ +DV EECSKYG VKHI+VDKNSAG+VY
Sbjct  484  VAEPVGTPSNCLLLKNMFDPTTETEPDFDLDIKEDVEEECSKYGRVKHIYVDKNSAGFVY  543

Query  406  LRFDSXEFAXRAQXAMHKRWFARRSVSAIFLQ  311
            L F++ E A  AQ AMH RWFAR+ +SAI+++
Sbjct  544  LMFETVEAASAAQRAMHMRWFARKMISAIYME  575



>gb|AAO30095.1| splicing factor-like protein [Arabidopsis thaliana]
Length=527

 Score =   128 bits (321),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 67/101 (66%), Positives = 79/101 (78%), Gaps = 0/101 (0%)
 Frame = -1

Query  586  VPEPVGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVY  407
            V E VG PSECLLLKNMFDPA  T+P FDL++ DDV +ECSKYG V HI+VDKNSAG+VY
Sbjct  426  VNEHVGLPSECLLLKNMFDPATETEPNFDLEIRDDVADECSKYGPVNHIYVDKNSAGFVY  485

Query  406  LRFDSXEFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKFK  284
            LRF S E A  AQ AMH RWFA++ +SA F+ P+ Y+AK K
Sbjct  486  LRFQSVEAAAAAQRAMHMRWFAQKMISATFMPPHEYEAKAK  526



>ref|XP_006649420.1| PREDICTED: RNA-binding protein 39-like isoform X2 [Oryza brachyantha]
Length=401

 Score =   127 bits (319),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 61/93 (66%), Positives = 73/93 (78%), Gaps = 0/93 (0%)
 Frame = -1

Query  565  PSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVYLRFDSXE  386
            PSECLLLKNMFDPA+ TDP+FDLD+ +DV EECSK+G VKHI VDKN+AG+VYLRFDS  
Sbjct  307  PSECLLLKNMFDPAVETDPDFDLDIKEDVQEECSKFGQVKHIFVDKNTAGFVYLRFDSIT  366

Query  385  FAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKF  287
             A  AQ A+H RWFA + ++A F+ P  Y  KF
Sbjct  367  AAMSAQKALHGRWFAGKMITATFMTPQQYSMKF  399



>ref|XP_007137678.1| hypothetical protein PHAVU_009G146500g [Phaseolus vulgaris]
 gb|ESW09672.1| hypothetical protein PHAVU_009G146500g [Phaseolus vulgaris]
Length=590

 Score =   128 bits (322),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 63/93 (68%), Positives = 75/93 (81%), Gaps = 0/93 (0%)
 Frame = -1

Query  586  VPEPVGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVY  407
            V EPVGNPSECLLLKNMFDP   T+P+FDLD+ +DV EECSKYG VKHI+VDK S G+VY
Sbjct  488  VIEPVGNPSECLLLKNMFDPNTETEPDFDLDIKEDVEEECSKYGRVKHIYVDKRSTGFVY  547

Query  406  LRFDSXEFAXRAQXAMHKRWFARRSVSAIFLQP  308
            L+F++ E A  AQ AMH RWFA R +SAI++ P
Sbjct  548  LQFETVEAASAAQRAMHTRWFAGRMISAIYMVP  580



>ref|XP_010912455.1| PREDICTED: RNA-binding protein 39-like [Elaeis guineensis]
Length=574

 Score =   128 bits (321),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 61/104 (59%), Positives = 77/104 (74%), Gaps = 3/104 (3%)
 Frame = -1

Query  586  VPEPVGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVY  407
            + EP+G PSEC++LKNMFDP+   DP+FDL+    V EECSK+G VKHI VDKNS G+VY
Sbjct  474  LTEPIGEPSECVILKNMFDPSTEMDPDFDLEE---VEEECSKFGPVKHIFVDKNSFGHVY  530

Query  406  LRFDSXEFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKFKGAA  275
            LRF S   A   Q AMH RW+ARRS+SA F++P  Y+AKF+  +
Sbjct  531  LRFHSVAAAASCQQAMHMRWYARRSISATFMRPQEYEAKFRSVS  574



>gb|ADE76571.1| unknown [Picea sitchensis]
Length=203

 Score =   122 bits (307),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 59/98 (60%), Positives = 78/98 (80%), Gaps = 0/98 (0%)
 Frame = -1

Query  580  EPVGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVYLR  401
            +P+G P++CLLLKNMFDP   T+P+FDLD+ +DV +ECSK+GAV+HI VDK+SAG+VYLR
Sbjct  102  DPIGVPNDCLLLKNMFDPNNETEPDFDLDIKEDVQDECSKFGAVRHIFVDKHSAGHVYLR  161

Query  400  FDSXEFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKF  287
            FDS   A  AQ A+H RWFA + ++A F+  Y Y+AKF
Sbjct  162  FDSATSAIGAQRALHGRWFAGKMITATFMPSYTYEAKF  199



>ref|XP_010935165.1| PREDICTED: RNA-binding protein 39-like [Elaeis guineensis]
Length=572

 Score =   127 bits (320),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 63/102 (62%), Positives = 79/102 (77%), Gaps = 0/102 (0%)
 Frame = -1

Query  580  EPVGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVYLR  401
            E VG PSECLLLKNMFDP + T+P+FDLD+ +DV +ECSK+G VKHI VDKNSAG+VY+R
Sbjct  471  ETVGAPSECLLLKNMFDPNVETEPDFDLDIKEDVQDECSKFGPVKHIFVDKNSAGHVYIR  530

Query  400  FDSXEFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKFKGAA  275
            FDS   A  AQ A+H RWFA + ++A F+ P  Y+AKF  A+
Sbjct  531  FDSPTSAINAQRALHGRWFAGKMITATFMLPQNYEAKFPSAS  572



>ref|XP_002465838.1| hypothetical protein SORBIDRAFT_01g046740 [Sorghum bicolor]
 gb|EER92836.1| hypothetical protein SORBIDRAFT_01g046740 [Sorghum bicolor]
Length=541

 Score =   127 bits (318),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 61/93 (66%), Positives = 74/93 (80%), Gaps = 0/93 (0%)
 Frame = -1

Query  565  PSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVYLRFDSXE  386
            PSECLLLKNMFDPA+ TDP+FDLD+ DDV EECSK+G +KHI VDKN+AG+VYLRFDS  
Sbjct  447  PSECLLLKNMFDPALETDPDFDLDIRDDVQEECSKFGQLKHIFVDKNTAGFVYLRFDSIT  506

Query  385  FAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKF  287
             A  AQ A+H RWFA + ++A F+ P  Y+ KF
Sbjct  507  AAMSAQKALHGRWFAGKMITATFMTPQQYEMKF  539



>ref|XP_010229190.1| PREDICTED: RNA-binding protein 39-like isoform X3 [Brachypodium 
distachyon]
Length=407

 Score =   125 bits (315),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 61/103 (59%), Positives = 79/103 (77%), Gaps = 2/103 (2%)
 Frame = -1

Query  589  MVPEPVGN--PSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAG  416
            ++ +P+    PSECLLLKNMFDPA+ TDP+FDLD+ DDV EECSK+G ++HI VDKN+AG
Sbjct  303  VISQPIATAPPSECLLLKNMFDPAVETDPDFDLDIKDDVREECSKFGQIRHIFVDKNTAG  362

Query  415  YVYLRFDSXEFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKF  287
            +VYLRFDS   A  AQ A+  RWFA + ++A F+ P  Y+AKF
Sbjct  363  FVYLRFDSITAAMGAQKALQGRWFAGKMITATFMSPQQYEAKF  405



>ref|XP_006649419.1| PREDICTED: RNA-binding protein 39-like isoform X1 [Oryza brachyantha]
Length=575

 Score =   127 bits (318),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 61/93 (66%), Positives = 73/93 (78%), Gaps = 0/93 (0%)
 Frame = -1

Query  565  PSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVYLRFDSXE  386
            PSECLLLKNMFDPA+ TDP+FDLD+ +DV EECSK+G VKHI VDKN+AG+VYLRFDS  
Sbjct  481  PSECLLLKNMFDPAVETDPDFDLDIKEDVQEECSKFGQVKHIFVDKNTAGFVYLRFDSIT  540

Query  385  FAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKF  287
             A  AQ A+H RWFA + ++A F+ P  Y  KF
Sbjct  541  AAMSAQKALHGRWFAGKMITATFMTPQQYSMKF  573



>ref|XP_011045848.1| PREDICTED: RNA-binding protein 39 [Populus euphratica]
Length=595

 Score =   127 bits (318),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 59/98 (60%), Positives = 78/98 (80%), Gaps = 0/98 (0%)
 Frame = -1

Query  580  EPVGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVYLR  401
            E +G PS+CLLLKNMFDP   T+P+FDLD+ +DV EECS++G VKHIHVDKNSAG+VY+R
Sbjct  494  ETIGVPSDCLLLKNMFDPKTETEPDFDLDIKEDVQEECSRFGNVKHIHVDKNSAGFVYMR  553

Query  400  FDSXEFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKF  287
            F++ + A  AQ A+H RWFA + ++A F+ P  Y+AKF
Sbjct  554  FENMQGAVNAQRALHGRWFAGKMITATFMVPQAYEAKF  591



>ref|XP_006847132.1| hypothetical protein AMTR_s00017p00234440 [Amborella trichopoda]
 gb|ERN08713.1| hypothetical protein AMTR_s00017p00234440 [Amborella trichopoda]
Length=716

 Score =   128 bits (321),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 61/104 (59%), Positives = 78/104 (75%), Gaps = 1/104 (1%)
 Frame = -1

Query  586  VPEPVGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDK-NSAGYV  410
            V + +G PSECLLLKNMFDP+  TDPEFDL++ + V +ECS++G+VKHIHVDK N  G+V
Sbjct  612  VVDSLGVPSECLLLKNMFDPSTETDPEFDLEIKEQVADECSRFGSVKHIHVDKYNPGGHV  671

Query  409  YLRFDSXEFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKFKGA  278
            YLRFDS   A  AQ  +H RWFA++ +SA F+ P  Y+AKF G 
Sbjct  672  YLRFDSAASAINAQRGLHGRWFAQKMISATFIPPQQYEAKFSGG  715



>ref|XP_003558785.1| PREDICTED: RNA-binding protein 39-like isoform X1 [Brachypodium 
distachyon]
Length=551

 Score =   126 bits (317),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 61/103 (59%), Positives = 79/103 (77%), Gaps = 2/103 (2%)
 Frame = -1

Query  589  MVPEPVGN--PSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAG  416
            ++ +P+    PSECLLLKNMFDPA+ TDP+FDLD+ DDV EECSK+G ++HI VDKN+AG
Sbjct  447  VISQPIATAPPSECLLLKNMFDPAVETDPDFDLDIKDDVREECSKFGQIRHIFVDKNTAG  506

Query  415  YVYLRFDSXEFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKF  287
            +VYLRFDS   A  AQ A+  RWFA + ++A F+ P  Y+AKF
Sbjct  507  FVYLRFDSITAAMGAQKALQGRWFAGKMITATFMSPQQYEAKF  549



>gb|KJB12136.1| hypothetical protein B456_002G002300 [Gossypium raimondii]
Length=591

 Score =   126 bits (317),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 58/100 (58%), Positives = 79/100 (79%), Gaps = 0/100 (0%)
 Frame = -1

Query  586  VPEPVGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVY  407
            V + +G+PSECLLLKNMFDP + T+PEFDLD+ +DV EECSK+G +KHIHVD++SAG+VY
Sbjct  487  VIDTIGSPSECLLLKNMFDPTLETEPEFDLDIKEDVQEECSKFGKLKHIHVDRDSAGFVY  546

Query  406  LRFDSXEFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKF  287
            LRF+  + A  AQ  +H RWFA + ++A ++ P  Y+AKF
Sbjct  547  LRFEDAQGAINAQRNLHGRWFAGKMITATYMVPQTYEAKF  586



>gb|KHF98937.1| RNA-binding 39 [Gossypium arboreum]
Length=619

 Score =   126 bits (317),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 58/100 (58%), Positives = 79/100 (79%), Gaps = 0/100 (0%)
 Frame = -1

Query  586  VPEPVGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVY  407
            V + +G+PSECLLLKNMFDP + T+PEFDLD+ +DV EECSK+G +KHIHVD++SAG+VY
Sbjct  515  VIDTIGSPSECLLLKNMFDPTLETEPEFDLDIKEDVQEECSKFGKLKHIHVDRDSAGFVY  574

Query  406  LRFDSXEFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKF  287
            LRF+  + A  AQ  +H RWFA + ++A ++ P  Y+AKF
Sbjct  575  LRFEDAQGAINAQRNLHGRWFAGKMITATYMVPQTYEAKF  614



>gb|EEE58341.1| hypothetical protein OsJ_09449 [Oryza sativa Japonica Group]
Length=565

 Score =   125 bits (315),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 60/93 (65%), Positives = 73/93 (78%), Gaps = 0/93 (0%)
 Frame = -1

Query  565  PSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVYLRFDSXE  386
            PSECLLLKNMFDP++ TDP+FDLD+ DDV EECSK+G VKHI VDKN++G+VYLRFDS  
Sbjct  471  PSECLLLKNMFDPSVETDPDFDLDIKDDVQEECSKFGQVKHIFVDKNTSGFVYLRFDSIT  530

Query  385  FAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKF  287
             A  AQ A+H RWFA + ++A F+ P  Y  KF
Sbjct  531  AAMSAQKALHGRWFAGKMITATFMSPQQYSTKF  563



>gb|EEC74539.1| hypothetical protein OsI_10059 [Oryza sativa Indica Group]
Length=567

 Score =   125 bits (315),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 60/93 (65%), Positives = 73/93 (78%), Gaps = 0/93 (0%)
 Frame = -1

Query  565  PSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVYLRFDSXE  386
            PSECLLLKNMFDP++ TDP+FDLD+ DDV EECSK+G VKHI VDKN++G+VYLRFDS  
Sbjct  473  PSECLLLKNMFDPSVETDPDFDLDIKDDVQEECSKFGQVKHIFVDKNTSGFVYLRFDSIT  532

Query  385  FAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKF  287
             A  AQ A+H RWFA + ++A F+ P  Y  KF
Sbjct  533  AAMSAQKALHGRWFAGKMITATFMSPQQYSTKF  565



>ref|XP_010266038.1| PREDICTED: RNA-binding protein 39 [Nelumbo nucifera]
Length=602

 Score =   126 bits (316),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 59/98 (60%), Positives = 79/98 (81%), Gaps = 0/98 (0%)
 Frame = -1

Query  580  EPVGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVYLR  401
            + +G PSECLLLKNMFDP + T+P+FDLD+ +DV +ECSK+G VKHI+VDKNSAGYVYLR
Sbjct  501  DTLGAPSECLLLKNMFDPKVETEPDFDLDIKEDVQDECSKFGTVKHIYVDKNSAGYVYLR  560

Query  400  FDSXEFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKF  287
            F++ + A  AQ ++H RWFA + ++A F+ P  Y+AKF
Sbjct  561  FENAQSAMNAQRSLHGRWFAGKMITATFMLPQNYEAKF  598



>ref|XP_002312948.2| hypothetical protein POPTR_0009s13940g [Populus trichocarpa]
 gb|EEE86903.2| hypothetical protein POPTR_0009s13940g [Populus trichocarpa]
Length=599

 Score =   125 bits (315),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 58/98 (59%), Positives = 78/98 (80%), Gaps = 0/98 (0%)
 Frame = -1

Query  580  EPVGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVYLR  401
            E +G PS+C+LLKNMFDP   T+P+FDLD+ +DV EECS++G VKHIHVDKNSAG+VY+R
Sbjct  498  ETIGVPSDCILLKNMFDPKKETEPDFDLDIKEDVQEECSRFGNVKHIHVDKNSAGFVYMR  557

Query  400  FDSXEFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKF  287
            F++ + A  AQ A+H RWFA + ++A F+ P  Y+AKF
Sbjct  558  FENMQGAVNAQRALHGRWFAGKMITATFMVPQTYEAKF  595



>gb|ABF94032.1| transposon protein, putative, CACTA, En/Spm sub-class, expressed 
[Oryza sativa Japonica Group]
Length=566

 Score =   125 bits (314),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 60/93 (65%), Positives = 73/93 (78%), Gaps = 0/93 (0%)
 Frame = -1

Query  565  PSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVYLRFDSXE  386
            PSECLLLKNMFDP++ TDP+FDLD+ DDV EECSK+G VKHI VDKN++G+VYLRFDS  
Sbjct  472  PSECLLLKNMFDPSVETDPDFDLDIKDDVQEECSKFGQVKHIFVDKNTSGFVYLRFDSIT  531

Query  385  FAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKF  287
             A  AQ A+H RWFA + ++A F+ P  Y  KF
Sbjct  532  AAMSAQKALHGRWFAGKMITATFMSPQQYSTKF  564



>gb|KDP33302.1| hypothetical protein JCGZ_13089 [Jatropha curcas]
Length=611

 Score =   125 bits (315),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 58/96 (60%), Positives = 79/96 (82%), Gaps = 0/96 (0%)
 Frame = -1

Query  574  VGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVYLRFD  395
            +G PSECLLLKNMFDP + T+P+FDLD+ +DV EECSK+G++KHI+VDKNSAG+VYLRF+
Sbjct  512  IGVPSECLLLKNMFDPKLETEPDFDLDIREDVQEECSKFGSLKHIYVDKNSAGFVYLRFE  571

Query  394  SXEFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKF  287
            + + A  AQ A+H RWFA + ++A ++ P  Y+AKF
Sbjct  572  NTQAAINAQRALHGRWFAGKMITATYMVPQVYEAKF  607



>ref|XP_008809443.1| PREDICTED: RNA-binding protein 39-like isoform X2 [Phoenix dactylifera]
Length=601

 Score =   125 bits (314),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 62/98 (63%), Positives = 76/98 (78%), Gaps = 0/98 (0%)
 Frame = -1

Query  580  EPVGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVYLR  401
            E VG PSECLLLKNMFDP + T+P+FDLD+ +DV +ECSK+G VKHI VDKNSAG VYLR
Sbjct  500  ETVGIPSECLLLKNMFDPNVETEPDFDLDIKEDVQDECSKFGTVKHIFVDKNSAGNVYLR  559

Query  400  FDSXEFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKF  287
            FD+   A  AQ A+H RWFA + ++A F+ P  Y+AKF
Sbjct  560  FDNITSAMNAQRALHGRWFAGKMITATFMLPQQYEAKF  597



>emb|CBI37850.3| unnamed protein product [Vitis vinifera]
Length=427

 Score =   124 bits (311),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 57/98 (58%), Positives = 79/98 (81%), Gaps = 0/98 (0%)
 Frame = -1

Query  580  EPVGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVYLR  401
            + +G PSECL+LKNMFDP + T+P+FDLD+ +DV +ECSK+G VKHI+VDKNSAG+V+LR
Sbjct  326  DTIGVPSECLMLKNMFDPKLETEPDFDLDIKEDVQDECSKFGTVKHIYVDKNSAGFVFLR  385

Query  400  FDSXEFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKF  287
            F++ + A  AQ A+H RWFA + ++A F+ P  Y+AKF
Sbjct  386  FENTQAAISAQRALHGRWFAGKMITATFMLPQNYEAKF  423



>ref|XP_004985661.1| PREDICTED: RNA-binding protein 39-like [Setaria italica]
Length=552

 Score =   125 bits (313),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 60/93 (65%), Positives = 74/93 (80%), Gaps = 0/93 (0%)
 Frame = -1

Query  565  PSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVYLRFDSXE  386
            PSECLLLKNMFDPA+ TDP+FDLD+ DDV +ECSK+G +KHI VDKN+AG+VYLRFDS  
Sbjct  458  PSECLLLKNMFDPAVETDPDFDLDIRDDVQDECSKFGQLKHIFVDKNTAGFVYLRFDSIT  517

Query  385  FAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKF  287
             A  AQ A+H RWFA + ++A F+ P  Y+ KF
Sbjct  518  AAMSAQKALHGRWFAGKMITATFMTPQQYEMKF  550



>ref|XP_008809442.1| PREDICTED: RNA-binding protein 39-like isoform X1 [Phoenix dactylifera]
Length=646

 Score =   125 bits (315),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 62/98 (63%), Positives = 76/98 (78%), Gaps = 0/98 (0%)
 Frame = -1

Query  580  EPVGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVYLR  401
            E VG PSECLLLKNMFDP + T+P+FDLD+ +DV +ECSK+G VKHI VDKNSAG VYLR
Sbjct  545  ETVGIPSECLLLKNMFDPNVETEPDFDLDIKEDVQDECSKFGTVKHIFVDKNSAGNVYLR  604

Query  400  FDSXEFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKF  287
            FD+   A  AQ A+H RWFA + ++A F+ P  Y+AKF
Sbjct  605  FDNITSAMNAQRALHGRWFAGKMITATFMLPQQYEAKF  642



>ref|XP_008806137.1| PREDICTED: RNA-binding protein 39-like [Phoenix dactylifera]
 ref|XP_008806138.1| PREDICTED: RNA-binding protein 39-like [Phoenix dactylifera]
 ref|XP_008806139.1| PREDICTED: RNA-binding protein 39-like [Phoenix dactylifera]
Length=580

 Score =   125 bits (313),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 60/98 (61%), Positives = 77/98 (79%), Gaps = 0/98 (0%)
 Frame = -1

Query  580  EPVGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVYLR  401
            E +G PSECLLLKNMFDP + T+P+FDLD+ +DV +ECSK+G VKHI V+KNSAG+VY+R
Sbjct  479  ETLGAPSECLLLKNMFDPNVETEPDFDLDIKEDVQDECSKFGTVKHIFVEKNSAGHVYIR  538

Query  400  FDSXEFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKF  287
            FDS   A  AQ A+H RWFA + ++A F+ P  Y+AKF
Sbjct  539  FDSATSAMNAQRALHGRWFAGKMITATFMLPQNYEAKF  576



>emb|CDY40065.1| BnaC02g00650D [Brassica napus]
Length=531

 Score =   124 bits (311),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 65/102 (64%), Positives = 81/102 (79%), Gaps = 0/102 (0%)
 Frame = -1

Query  589  MVPEPVGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYV  410
            +V EP+G PSECLLLKNMFDPA  T+  FD D+ +DV +ECSKYG VKHI+VDKNSAG+V
Sbjct  429  VVTEPIGQPSECLLLKNMFDPATETELNFDEDIKEDVGDECSKYGEVKHIYVDKNSAGFV  488

Query  409  YLRFDSXEFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKFK  284
            YLRF+S + A  AQ AMH RWFA++ +SA FL P+ Y+A+ K
Sbjct  489  YLRFESVQAAMAAQRAMHTRWFAQKMISATFLPPHEYEARAK  530



>ref|XP_010920083.1| PREDICTED: RNA-binding protein 39-like [Elaeis guineensis]
Length=597

 Score =   125 bits (313),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 60/98 (61%), Positives = 77/98 (79%), Gaps = 0/98 (0%)
 Frame = -1

Query  580  EPVGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVYLR  401
            E VG PSECLLLKN+FDP + T+P+FDLD+ +DV +ECSK+G VKHI VDKN+AG+VYLR
Sbjct  496  ETVGIPSECLLLKNLFDPNVETEPDFDLDIKEDVQDECSKFGTVKHIFVDKNTAGHVYLR  555

Query  400  FDSXEFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKF  287
            FD+   A  AQ A+H RWFA + ++A F+ P  Y+AKF
Sbjct  556  FDNITSAMNAQRALHGRWFAGKMITATFMLPQQYEAKF  593



>ref|XP_009384003.1| PREDICTED: RNA-binding protein 39 isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=425

 Score =   123 bits (309),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 60/98 (61%), Positives = 76/98 (78%), Gaps = 0/98 (0%)
 Frame = -1

Query  580  EPVGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVYLR  401
            +  G PSECLLLKNMFDP++  +P+FDLD+ DDV +ECSK+G VKHI VDKNSAGYVYLR
Sbjct  324  QTAGVPSECLLLKNMFDPSVEAEPDFDLDIKDDVQDECSKFGTVKHISVDKNSAGYVYLR  383

Query  400  FDSXEFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKF  287
            FD+   A +AQ A+H RWFA + ++A F+    Y+AKF
Sbjct  384  FDNITSAMKAQNALHGRWFAGKMITATFMSLQQYEAKF  421



>ref|XP_007041785.1| Splicing factor isoform 4 [Theobroma cacao]
 gb|EOX97616.1| Splicing factor isoform 4 [Theobroma cacao]
Length=452

 Score =   123 bits (308),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 56/98 (57%), Positives = 77/98 (79%), Gaps = 0/98 (0%)
 Frame = -1

Query  580  EPVGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVYLR  401
            + +G PSECLLLKNMFDP + T+P+FDLD+ +DV EECSK+G +KHI+VD++SAG+VYLR
Sbjct  347  DTIGTPSECLLLKNMFDPDLETEPDFDLDIKEDVQEECSKFGKLKHIYVDRDSAGFVYLR  406

Query  400  FDSXEFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKF  287
            F+  + A  AQ  +H RWFA + ++A F+ P  Y+AKF
Sbjct  407  FEDTQAAMSAQRNLHGRWFAAKMITATFMVPQTYEAKF  444



>gb|KJB32668.1| hypothetical protein B456_005G254800 [Gossypium raimondii]
 gb|KJB32669.1| hypothetical protein B456_005G254800 [Gossypium raimondii]
Length=577

 Score =   124 bits (311),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 56/96 (58%), Positives = 77/96 (80%), Gaps = 0/96 (0%)
 Frame = -1

Query  574  VGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVYLRFD  395
            +G PSECLLLKNMFDP++ T+P+FDLD+ +DV EECSK+G +KHI+VD+NSAG+VYLRF+
Sbjct  478  IGTPSECLLLKNMFDPSLETEPDFDLDIKEDVQEECSKFGKLKHIYVDRNSAGFVYLRFE  537

Query  394  SXEFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKF  287
              + A  AQ  +H RWFA + ++A ++ P  Y+AKF
Sbjct  538  DAQGAINAQRNLHGRWFAGKMITATYMIPQTYEAKF  573



>ref|XP_010028763.1| PREDICTED: RNA-binding protein 39 [Eucalyptus grandis]
 gb|KCW55579.1| hypothetical protein EUGRSUZ_I01450 [Eucalyptus grandis]
Length=598

 Score =   124 bits (311),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 57/96 (59%), Positives = 76/96 (79%), Gaps = 0/96 (0%)
 Frame = -1

Query  574  VGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVYLRFD  395
            VG PSECLLLKNMFDP + T+P+F+LD+ +DV EECSK+G ++HI VDKNS+G+VYLRF+
Sbjct  499  VGVPSECLLLKNMFDPTLETEPDFELDIKEDVQEECSKFGNLRHIFVDKNSSGFVYLRFE  558

Query  394  SXEFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKF  287
              + A  AQ A+H RWFA + ++A F+ P  Y+AKF
Sbjct  559  DTQSASNAQRALHGRWFAGKMITATFMVPLTYEAKF  594



>ref|XP_009384002.1| PREDICTED: RNA-binding protein 39 isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=574

 Score =   124 bits (310),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 60/98 (61%), Positives = 76/98 (78%), Gaps = 0/98 (0%)
 Frame = -1

Query  580  EPVGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVYLR  401
            +  G PSECLLLKNMFDP++  +P+FDLD+ DDV +ECSK+G VKHI VDKNSAGYVYLR
Sbjct  473  QTAGVPSECLLLKNMFDPSVEAEPDFDLDIKDDVQDECSKFGTVKHISVDKNSAGYVYLR  532

Query  400  FDSXEFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKF  287
            FD+   A +AQ A+H RWFA + ++A F+    Y+AKF
Sbjct  533  FDNITSAMKAQNALHGRWFAGKMITATFMSLQQYEAKF  570



>ref|XP_006580322.1| PREDICTED: RNA-binding protein 39-like isoform X2 [Glycine max]
Length=566

 Score =   124 bits (310),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 62/87 (71%), Positives = 71/87 (82%), Gaps = 0/87 (0%)
 Frame = -1

Query  586  VPEPVGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVY  407
            V EPVGNPSECLLLKNMFDP+  T+P+FD+D+ +DV EECSKYG VKHI VDK SAG+VY
Sbjct  451  VVEPVGNPSECLLLKNMFDPSTETEPDFDIDIKEDVEEECSKYGRVKHIFVDKKSAGFVY  510

Query  406  LRFDSXEFAXRAQXAMHKRWFARRSVS  326
            LRFD+ E A  AQ AMH RWFAR + S
Sbjct  511  LRFDTVEAASAAQHAMHLRWFARSNQS  537



>ref|XP_008784182.1| PREDICTED: RNA-binding protein 39-like [Phoenix dactylifera]
Length=584

 Score =   124 bits (310),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 62/108 (57%), Positives = 77/108 (71%), Gaps = 3/108 (3%)
 Frame = -1

Query  586  VPEPVGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVY  407
            + E +G PSEC++LKNMFDP    DP+FDLD    V EECSK+G VKHI+VDKNS G+VY
Sbjct  479  LTEAIGEPSECVILKNMFDPGTEMDPDFDLDE---VEEECSKFGPVKHIYVDKNSLGHVY  535

Query  406  LRFDSXEFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKFKGAA*TSN  263
            LRFDS   A     AMH RW+ARRS+SA F++P  Y+A F+  + TS 
Sbjct  536  LRFDSVAAAASCVRAMHMRWYARRSISAAFMRPEEYEAIFRSVSRTSE  583



>ref|XP_002279887.2| PREDICTED: RNA-binding protein 39 [Vitis vinifera]
Length=609

 Score =   124 bits (311),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 57/98 (58%), Positives = 79/98 (81%), Gaps = 0/98 (0%)
 Frame = -1

Query  580  EPVGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVYLR  401
            + +G PSECL+LKNMFDP + T+P+FDLD+ +DV +ECSK+G VKHI+VDKNSAG+V+LR
Sbjct  508  DTIGVPSECLMLKNMFDPKLETEPDFDLDIKEDVQDECSKFGTVKHIYVDKNSAGFVFLR  567

Query  400  FDSXEFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKF  287
            F++ + A  AQ A+H RWFA + ++A F+ P  Y+AKF
Sbjct  568  FENTQAAISAQRALHGRWFAGKMITATFMLPQNYEAKF  605



>ref|XP_010530926.1| PREDICTED: RNA-binding protein 39 [Tarenaya hassleriana]
Length=577

 Score =   123 bits (309),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 58/98 (59%), Positives = 76/98 (78%), Gaps = 0/98 (0%)
 Frame = -1

Query  580  EPVGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVYLR  401
            +PVG P+ECLLLKNMFDP   T+P+FDLD+ +DV EECSK+G + HI VDKNSAG+VYLR
Sbjct  476  DPVGVPTECLLLKNMFDPNSETEPDFDLDIKEDVQEECSKFGKLNHIFVDKNSAGFVYLR  535

Query  400  FDSXEFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKF  287
            F++ + A  AQ A+H RWFA   ++A ++ P  Y+AKF
Sbjct  536  FETTQAAMSAQRALHGRWFAGNMITATYMTPQAYEAKF  573



>gb|KHG01335.1| RNA-binding 39 [Gossypium arboreum]
Length=620

 Score =   124 bits (310),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 56/98 (57%), Positives = 78/98 (80%), Gaps = 0/98 (0%)
 Frame = -1

Query  580  EPVGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVYLR  401
            + +G PSECLLLKNMFDP++ T+P+FDLD+ +DV EECSK+G +KHI+VD+NSAG+VYLR
Sbjct  518  DTIGTPSECLLLKNMFDPSLETEPDFDLDIKEDVQEECSKFGKLKHIYVDRNSAGFVYLR  577

Query  400  FDSXEFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKF  287
            F+  + A  AQ  +H RWFA + ++A ++ P  Y+AKF
Sbjct  578  FEDAQGAINAQRNLHGRWFAGKMITATYMVPQTYEAKF  615



>ref|NP_001142242.1| uncharacterized protein LOC100274411 [Zea mays]
 gb|ACF79521.1| unknown [Zea mays]
 gb|ACF87970.1| unknown [Zea mays]
 tpg|DAA49864.1| TPA: hypothetical protein ZEAMMB73_656561 [Zea mays]
 tpg|DAA49865.1| TPA: hypothetical protein ZEAMMB73_656561 [Zea mays]
Length=318

 Score =   120 bits (302),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 58/94 (62%), Positives = 73/94 (78%), Gaps = 0/94 (0%)
 Frame = -1

Query  568  NPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVYLRFDSX  389
             P+E LLLKNMFDPA+ TDP+FDLD+ DDV +ECSK+GAVKHI VDKN+AG+VYL+FDS 
Sbjct  222  TPTEFLLLKNMFDPALETDPDFDLDIRDDVQDECSKFGAVKHIFVDKNTAGFVYLQFDSV  281

Query  388  EFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKF  287
              A +AQ A+H RWFA + ++A F+    Y  KF
Sbjct  282  TAAAKAQNALHGRWFAGKMITATFMSALEYSTKF  315



>ref|XP_007041782.1| Splicing factor isoform 1 [Theobroma cacao]
 ref|XP_007041783.1| Splicing factor isoform 1 [Theobroma cacao]
 gb|EOX97613.1| Splicing factor isoform 1 [Theobroma cacao]
 gb|EOX97614.1| Splicing factor isoform 1 [Theobroma cacao]
Length=581

 Score =   123 bits (308),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 56/98 (57%), Positives = 77/98 (79%), Gaps = 0/98 (0%)
 Frame = -1

Query  580  EPVGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVYLR  401
            + +G PSECLLLKNMFDP + T+P+FDLD+ +DV EECSK+G +KHI+VD++SAG+VYLR
Sbjct  476  DTIGTPSECLLLKNMFDPDLETEPDFDLDIKEDVQEECSKFGKLKHIYVDRDSAGFVYLR  535

Query  400  FDSXEFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKF  287
            F+  + A  AQ  +H RWFA + ++A F+ P  Y+AKF
Sbjct  536  FEDTQAAMSAQRNLHGRWFAAKMITATFMVPQTYEAKF  573



>ref|XP_008338763.1| PREDICTED: RNA-binding protein 39 isoform X3 [Malus domestica]
Length=597

 Score =   123 bits (308),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 67/100 (67%), Positives = 81/100 (81%), Gaps = 2/100 (2%)
 Frame = -1

Query  586  VPEPVGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVY  407
            V EPVGNPSECLLLKNMFDPA   +P+FD+D+ +DV EECSKYG VKHI+VD  +AG+VY
Sbjct  498  VNEPVGNPSECLLLKNMFDPATEREPDFDVDIKEDVEEECSKYGRVKHIYVD--NAGFVY  555

Query  406  LRFDSXEFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKF  287
            LRF++ E A  AQ AMH RWFA R +SA+F+QP  Y+AKF
Sbjct  556  LRFEAVEAAAAAQRAMHLRWFAGRLISALFMQPQVYEAKF  595



>ref|XP_008377726.1| PREDICTED: RNA-binding protein 39-like [Malus domestica]
Length=239

 Score =   119 bits (297),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 56/98 (57%), Positives = 75/98 (77%), Gaps = 0/98 (0%)
 Frame = -1

Query  580  EPVGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVYLR  401
            + +G PSECLLLKNMFDP   ++P FDLD+ DDV +ECSKYG +KHI+VDKN+AG+VYLR
Sbjct  138  DTIGVPSECLLLKNMFDPTAESEPNFDLDIKDDVQDECSKYGTLKHIYVDKNTAGHVYLR  197

Query  400  FDSXEFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKF  287
            F++ + A  A+  +H RWFA + + A F+ P  Y+AKF
Sbjct  198  FENTQAAISARHVLHGRWFAGKMIEATFMLPQTYEAKF  235



>ref|XP_008668579.1| PREDICTED: uncharacterized protein LOC100274411 isoform X2 [Zea 
mays]
Length=337

 Score =   120 bits (301),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 58/94 (62%), Positives = 73/94 (78%), Gaps = 0/94 (0%)
 Frame = -1

Query  568  NPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVYLRFDSX  389
             P+E LLLKNMFDPA+ TDP+FDLD+ DDV +ECSK+GAVKHI VDKN+AG+VYL+FDS 
Sbjct  241  TPTEFLLLKNMFDPALETDPDFDLDIRDDVQDECSKFGAVKHIFVDKNTAGFVYLQFDSV  300

Query  388  EFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKF  287
              A +AQ A+H RWFA + ++A F+    Y  KF
Sbjct  301  TAAAKAQNALHGRWFAGKMITATFMSALEYSTKF  334



>ref|XP_010548117.1| PREDICTED: RNA-binding protein 39-like [Tarenaya hassleriana]
Length=565

 Score =   122 bits (306),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 56/100 (56%), Positives = 76/100 (76%), Gaps = 0/100 (0%)
 Frame = -1

Query  586  VPEPVGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVY  407
            +P+PVG P+ECLLLKNMFDP   T+P+FDLD+ +DV EECSK+G + HI VDKNS+G+VY
Sbjct  462  LPDPVGVPTECLLLKNMFDPKTETEPDFDLDIKEDVQEECSKFGKLNHIFVDKNSSGFVY  521

Query  406  LRFDSXEFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKF  287
            LRF++ + A   Q A+H RWFA   ++A ++ P  Y+ KF
Sbjct  522  LRFETVQAAMNGQRALHGRWFAGNMITATYMTPQMYEEKF  561



>gb|AFW68703.1| hypothetical protein ZEAMMB73_109361 [Zea mays]
Length=300

 Score =   119 bits (298),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 57/94 (61%), Positives = 73/94 (78%), Gaps = 0/94 (0%)
 Frame = -1

Query  568  NPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVYLRFDSX  389
             P+E LLLKNMFDP++ TDP+FDLD+ DDV +ECSK+GAVKHI VDKN+AG+VYL+FDS 
Sbjct  204  TPTEFLLLKNMFDPSLETDPDFDLDIRDDVQDECSKFGAVKHIFVDKNTAGFVYLQFDSV  263

Query  388  EFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKF  287
              A +AQ A+H RWFA + ++A F+    Y  KF
Sbjct  264  TAAGKAQQALHGRWFAGKMITATFMSDQEYSTKF  297



>ref|XP_006299838.1| hypothetical protein CARUB_v10016041mg [Capsella rubella]
 gb|EOA32736.1| hypothetical protein CARUB_v10016041mg [Capsella rubella]
Length=550

 Score =   121 bits (304),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 57/100 (57%), Positives = 76/100 (76%), Gaps = 0/100 (0%)
 Frame = -1

Query  586  VPEPVGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVY  407
            V +PVG PSECLLLKNMFDP+  T+P FD D+ +DV EECSK+G + HI+VDKNS G+VY
Sbjct  445  VLDPVGIPSECLLLKNMFDPSTETEPHFDEDIKEDVKEECSKFGQLDHIYVDKNSVGFVY  504

Query  406  LRFDSXEFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKF  287
            LRF++ + A  AQ A+H RWFA + ++A ++    Y+AKF
Sbjct  505  LRFENTQAAMGAQRALHGRWFAGKMITATYMTTEVYEAKF  544



>ref|NP_001169267.1| hypothetical protein [Zea mays]
 gb|ACN32166.1| unknown [Zea mays]
 gb|AFW68702.1| hypothetical protein ZEAMMB73_109361 [Zea mays]
Length=318

 Score =   119 bits (298),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 57/94 (61%), Positives = 73/94 (78%), Gaps = 0/94 (0%)
 Frame = -1

Query  568  NPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVYLRFDSX  389
             P+E LLLKNMFDP++ TDP+FDLD+ DDV +ECSK+GAVKHI VDKN+AG+VYL+FDS 
Sbjct  222  TPTEFLLLKNMFDPSLETDPDFDLDIRDDVQDECSKFGAVKHIFVDKNTAGFVYLQFDSV  281

Query  388  EFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKF  287
              A +AQ A+H RWFA + ++A F+    Y  KF
Sbjct  282  TAAGKAQQALHGRWFAGKMITATFMSDQEYSTKF  315



>gb|KHN29140.1| RNA-binding protein 39 [Glycine soja]
Length=573

 Score =   121 bits (304),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 59/87 (68%), Positives = 71/87 (82%), Gaps = 0/87 (0%)
 Frame = -1

Query  580  EPVGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVYLR  401
            EPVGNPS+CLLLKNMFDP+  T+P+FD+D+ +DV EECSKYG VKHI VDK S+G+VYLR
Sbjct  449  EPVGNPSDCLLLKNMFDPSTETEPDFDIDIKEDVEEECSKYGRVKHIFVDKKSSGFVYLR  508

Query  400  FDSXEFAXRAQXAMHKRWFARRSVSAI  320
            FD+ E A  AQ AMH RWFAR + S +
Sbjct  509  FDTVEAASGAQRAMHMRWFARSNQSCM  535



>emb|CDX85791.1| BnaA02g00220D [Brassica napus]
Length=537

 Score =   121 bits (303),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 64/102 (63%), Positives = 80/102 (78%), Gaps = 0/102 (0%)
 Frame = -1

Query  589  MVPEPVGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYV  410
            +V EP+G PSECLLLKNMFDPA  T+  FD D+ +DV +ECSKYG VK I+VDKNSAG+V
Sbjct  435  VVTEPIGQPSECLLLKNMFDPATETELNFDEDIKEDVGDECSKYGEVKDIYVDKNSAGFV  494

Query  409  YLRFDSXEFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKFK  284
            YLRF+S + A  AQ AMH RWFA++ +SA FL P+ Y+A+ K
Sbjct  495  YLRFESVQAAMAAQRAMHTRWFAQKMISATFLPPHEYEARAK  536



>ref|XP_006589727.1| PREDICTED: RNA-binding protein 39-like isoform X2 [Glycine max]
Length=421

 Score =   120 bits (301),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 57/98 (58%), Positives = 76/98 (78%), Gaps = 0/98 (0%)
 Frame = -1

Query  580  EPVGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVYLR  401
            +P+G PSECL+LKNMFDP   T+P+FDLD+ +DV  ECSK+GA+KHI+VDK SAG+VYLR
Sbjct  320  DPIGVPSECLMLKNMFDPKDETEPDFDLDIKEDVEAECSKFGALKHIYVDKKSAGFVYLR  379

Query  400  FDSXEFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKF  287
            F+  + A  AQ A+H RWFA + ++A F+ P  Y+ KF
Sbjct  380  FEDTQSAISAQQALHGRWFAGKMITASFMVPQSYEDKF  417



>gb|EMS53612.1| RNA-binding protein 39 [Triticum urartu]
Length=440

 Score =   120 bits (301),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 59/93 (63%), Positives = 72/93 (77%), Gaps = 0/93 (0%)
 Frame = -1

Query  565  PSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVYLRFDSXE  386
            PSECLLLKNMFDPA+ TDP+FDLD+ DDV EECSK+G V+HI VDKN+AG+VYLRFDS  
Sbjct  346  PSECLLLKNMFDPAVETDPDFDLDIRDDVREECSKFGQVRHIFVDKNTAGFVYLRFDSIT  405

Query  385  FAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKF  287
             A  AQ A+  RWFA + ++A F+    Y+ KF
Sbjct  406  AAMGAQKALQGRWFAGKMITATFMSTQQYEMKF  438



>ref|XP_009125340.1| PREDICTED: RNA-binding protein 39-like [Brassica rapa]
Length=546

 Score =   121 bits (303),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 64/102 (63%), Positives = 80/102 (78%), Gaps = 0/102 (0%)
 Frame = -1

Query  589  MVPEPVGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYV  410
            +V EP+G PSECLLLKNMFDPA  T+  FD D+ +DV +ECSKYG VK I+VDKNSAG+V
Sbjct  444  VVTEPIGQPSECLLLKNMFDPATETELNFDEDIKEDVGDECSKYGEVKDIYVDKNSAGFV  503

Query  409  YLRFDSXEFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKFK  284
            YLRF+S + A  AQ AMH RWFA++ +SA FL P+ Y+A+ K
Sbjct  504  YLRFESVQAAMAAQRAMHTRWFAQKMISATFLPPHEYEARAK  545



>gb|EMT10841.1| RNA-binding protein 39 [Aegilops tauschii]
Length=469

 Score =   120 bits (301),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 59/93 (63%), Positives = 72/93 (77%), Gaps = 0/93 (0%)
 Frame = -1

Query  565  PSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVYLRFDSXE  386
            PSECLLLKNMFDPA+ TDP+FDLD+ DDV EECSK+G V+HI VDKN+AG+VYLRFDS  
Sbjct  375  PSECLLLKNMFDPAVETDPDFDLDIRDDVREECSKFGQVRHIFVDKNTAGFVYLRFDSIT  434

Query  385  FAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKF  287
             A  AQ A+  RWFA + ++A F+    Y+ KF
Sbjct  435  AAMGAQKALQGRWFAGKMITATFMSTQQYEMKF  467



>gb|KHN37392.1| RNA-binding protein 39 [Glycine soja]
Length=351

 Score =   119 bits (298),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 57/98 (58%), Positives = 76/98 (78%), Gaps = 0/98 (0%)
 Frame = -1

Query  580  EPVGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVYLR  401
            +P+G PSECL+LKNMFDP   T+P+FDLD+ +DV  ECSK+GA+KHI+VDK SAG+VYLR
Sbjct  250  DPIGVPSECLMLKNMFDPKDETEPDFDLDIKEDVEAECSKFGALKHIYVDKKSAGFVYLR  309

Query  400  FDSXEFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKF  287
            F+  + A  AQ A+H RWFA + ++A F+ P  Y+ KF
Sbjct  310  FEDTQSAISAQQALHGRWFAGKMITASFMVPQSYEDKF  347



>ref|XP_009122113.1| PREDICTED: RNA-binding protein 39 [Brassica rapa]
 emb|CDX69880.1| BnaA10g22290D [Brassica napus]
Length=538

 Score =   120 bits (302),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 63/101 (62%), Positives = 78/101 (77%), Gaps = 0/101 (0%)
 Frame = -1

Query  586  VPEPVGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVY  407
            V EPVG PS+CLLLKNMFDPA  T+ +FD ++ DDV +ECSKYG V HI+VDK SAG+VY
Sbjct  437  VTEPVGQPSQCLLLKNMFDPATETELDFDEEIEDDVGQECSKYGQVNHIYVDKKSAGFVY  496

Query  406  LRFDSXEFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKFK  284
            LRF+S + A  AQ AMH RWFA++ +SA F+ P  Y+AK K
Sbjct  497  LRFESVQAAAAAQRAMHMRWFAQKMISATFMPPNEYEAKAK  537



>ref|XP_006409370.1| hypothetical protein EUTSA_v10022624mg [Eutrema salsugineum]
 gb|ESQ50823.1| hypothetical protein EUTSA_v10022624mg [Eutrema salsugineum]
Length=566

 Score =   120 bits (302),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 57/98 (58%), Positives = 76/98 (78%), Gaps = 0/98 (0%)
 Frame = -1

Query  580  EPVGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVYLR  401
            +PVG PSECLLLKNMFDP+  T+P+FDLD+ +DV EECSK+G + HI VDKNS G+VYLR
Sbjct  465  DPVGVPSECLLLKNMFDPSTETEPDFDLDIKEDVQEECSKFGNLNHIFVDKNSVGFVYLR  524

Query  400  FDSXEFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKF  287
            F++ + A  AQ A+H RWFA + ++A ++    Y+AKF
Sbjct  525  FENAQAAMGAQRALHGRWFAGKMITATYMTTETYEAKF  562



>emb|CDY21612.1| BnaC09g46800D [Brassica napus]
Length=536

 Score =   120 bits (301),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 62/101 (61%), Positives = 78/101 (77%), Gaps = 0/101 (0%)
 Frame = -1

Query  586  VPEPVGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVY  407
            V EP+G PS+CLLLKNMFDPA  T+ +FD ++ DDV +ECSKYG V HI+VDK SAG+VY
Sbjct  435  VTEPIGQPSQCLLLKNMFDPATETELDFDEEIKDDVGQECSKYGQVNHIYVDKKSAGFVY  494

Query  406  LRFDSXEFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKFK  284
            LRF+S + A  AQ AMH RWFA++ +SA F+ P  Y+AK K
Sbjct  495  LRFESVQAAAAAQRAMHMRWFAQKMISATFMPPNEYEAKAK  535



>gb|KFK40079.1| hypothetical protein AALP_AA3G327700 [Arabis alpina]
Length=408

 Score =   119 bits (298),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 59/100 (59%), Positives = 75/100 (75%), Gaps = 0/100 (0%)
 Frame = -1

Query  586  VPEPVGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVY  407
            V +PVG PSECLLLKNMFDP+  T+PEFDLD+ DDV +EC K+G + HI VDKNS G+VY
Sbjct  305  VLDPVGVPSECLLLKNMFDPSTETEPEFDLDIKDDVKDECKKFGELNHIFVDKNSVGFVY  364

Query  406  LRFDSXEFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKF  287
            LRF + E A  AQ A+H RWFA + ++A ++    Y+AKF
Sbjct  365  LRFANVEAAMGAQRALHGRWFAGKMITATYMTTEAYEAKF  404



>ref|XP_002886087.1| hypothetical protein ARALYDRAFT_480573 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH62346.1| hypothetical protein ARALYDRAFT_480573 [Arabidopsis lyrata subsp. 
lyrata]
Length=557

 Score =   120 bits (301),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 56/100 (56%), Positives = 76/100 (76%), Gaps = 0/100 (0%)
 Frame = -1

Query  586  VPEPVGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVY  407
            V +PVG PSECLLLKNMFDP+  T+ +FD D+ +DV EECSK+G + HI+VDKNS G+VY
Sbjct  452  VIDPVGVPSECLLLKNMFDPSTQTEDDFDKDIEEDVKEECSKFGNLNHIYVDKNSVGFVY  511

Query  406  LRFDSXEFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKF  287
            LRF++ + A  AQ A+H RWFA + ++A ++    Y+AKF
Sbjct  512  LRFENAQAAIGAQRALHGRWFAGKMITATYMTTVAYEAKF  551



>ref|XP_008236127.1| PREDICTED: RNA-binding protein 39-like [Prunus mume]
Length=279

 Score =   117 bits (294),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 57/98 (58%), Positives = 75/98 (77%), Gaps = 0/98 (0%)
 Frame = -1

Query  580  EPVGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVYLR  401
            + +G PSECLLLKNMFDPA+ T+P FDLD+ +DV EECSKYG ++HI VDKN+AG+VYLR
Sbjct  178  DTIGVPSECLLLKNMFDPAVETEPNFDLDIKEDVQEECSKYGNLRHIFVDKNTAGHVYLR  237

Query  400  FDSXEFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKF  287
            F++ + A  A+  +H R FA + + A F+ P  YDAKF
Sbjct  238  FENTQAAINARHVLHGRRFAGKMIEATFMLPQNYDAKF  275



>ref|XP_002306193.2| hypothetical protein POPTR_0004s18320g [Populus trichocarpa]
 gb|EEE86704.2| hypothetical protein POPTR_0004s18320g [Populus trichocarpa]
Length=609

 Score =   120 bits (302),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 56/98 (57%), Positives = 77/98 (79%), Gaps = 0/98 (0%)
 Frame = -1

Query  580  EPVGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVYLR  401
            + +G PS+CL LKNMFDP   T+P+FDLD+ +DV EECS++G VKHI+VDKNSAG+VY+R
Sbjct  508  DTIGVPSDCLFLKNMFDPKTETEPDFDLDIKEDVQEECSRFGNVKHIYVDKNSAGFVYMR  567

Query  400  FDSXEFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKF  287
            F++ + A  AQ A+H RWFA + ++A F+ P  Y+AKF
Sbjct  568  FENMQAAINAQHALHGRWFAGKLITATFMVPQTYEAKF  605



>ref|XP_011046657.1| PREDICTED: RNA-binding protein 39-like [Populus euphratica]
 ref|XP_011046658.1| PREDICTED: RNA-binding protein 39-like [Populus euphratica]
 ref|XP_011046659.1| PREDICTED: RNA-binding protein 39-like [Populus euphratica]
Length=607

 Score =   120 bits (302),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 56/98 (57%), Positives = 77/98 (79%), Gaps = 0/98 (0%)
 Frame = -1

Query  580  EPVGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVYLR  401
            + +G PS+CL LKNMFDP   T+P+FDLD+ +DV EECS++G VKHI+VDKNSAG+VY+R
Sbjct  506  DTIGVPSDCLFLKNMFDPKAETEPDFDLDIKEDVQEECSRFGNVKHIYVDKNSAGFVYMR  565

Query  400  FDSXEFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKF  287
            F++ + A  AQ A+H RWFA + ++A F+ P  Y+AKF
Sbjct  566  FENMQAAINAQRALHGRWFAGKLITATFMVPQTYEAKF  603



>ref|XP_006829172.1| hypothetical protein AMTR_s00001p00270600 [Amborella trichopoda]
 gb|ERM96588.1| hypothetical protein AMTR_s00001p00270600 [Amborella trichopoda]
Length=641

 Score =   120 bits (302),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 59/96 (61%), Positives = 73/96 (76%), Gaps = 0/96 (0%)
 Frame = -1

Query  574  VGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVYLRFD  395
            +G PSECLLLKNMFDP   T+P+FD+D+ +DV EECSK+G +KHI VDK S G+VYLRFD
Sbjct  542  IGVPSECLLLKNMFDPKAETEPDFDVDIKEDVQEECSKFGTLKHIFVDKISEGHVYLRFD  601

Query  394  SXEFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKF  287
            S   A  AQ AMH RWFA + ++A F+ P  Y+AKF
Sbjct  602  SATAAIGAQRAMHGRWFAGKMITATFMLPQNYEAKF  637



>ref|XP_006661796.1| PREDICTED: RNA-binding protein 39-like isoform X2 [Oryza brachyantha]
Length=332

 Score =   117 bits (294),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 58/96 (60%), Positives = 72/96 (75%), Gaps = 0/96 (0%)
 Frame = -1

Query  574  VGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVYLRFD  395
            +G P+E LLLKNMFDPA+ TDP+FDLD+ DDV +ECSK+GAV HI VDKN+AG+VYL FD
Sbjct  235  IGPPTEFLLLKNMFDPALETDPDFDLDIKDDVQDECSKFGAVNHIFVDKNTAGFVYLHFD  294

Query  394  SXEFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKF  287
            S   A  AQ A+H RWFA + ++A F+    Y  KF
Sbjct  295  SVAAATNAQRALHGRWFAGKMITATFMTAQQYKMKF  330



>ref|XP_007201184.1| hypothetical protein PRUPE_ppa003064mg [Prunus persica]
 gb|EMJ02383.1| hypothetical protein PRUPE_ppa003064mg [Prunus persica]
Length=607

 Score =   120 bits (301),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 57/98 (58%), Positives = 76/98 (78%), Gaps = 0/98 (0%)
 Frame = -1

Query  580  EPVGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVYLR  401
            + +G PSECLLLKNMFDPA+ T+P FDLD+ +DV EECSKYG ++HI VDKN+AG+VYLR
Sbjct  506  DTIGVPSECLLLKNMFDPAVETEPNFDLDIKEDVQEECSKYGNLRHIFVDKNTAGHVYLR  565

Query  400  FDSXEFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKF  287
            F++ + A  A+  +H RWFA + + A F+ P  Y+AKF
Sbjct  566  FENTQAAINARHVLHGRWFAGKMIEATFMLPQNYEAKF  603



>ref|XP_003536719.1| PREDICTED: RNA-binding protein 39-like isoform X1 [Glycine max]
Length=597

 Score =   120 bits (300),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 57/98 (58%), Positives = 76/98 (78%), Gaps = 0/98 (0%)
 Frame = -1

Query  580  EPVGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVYLR  401
            +P+G PSECL+LKNMFDP   T+P+FDLD+ +DV  ECSK+GA+KHI+VDK SAG+VYLR
Sbjct  496  DPIGVPSECLMLKNMFDPKDETEPDFDLDIKEDVEAECSKFGALKHIYVDKKSAGFVYLR  555

Query  400  FDSXEFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKF  287
            F+  + A  AQ A+H RWFA + ++A F+ P  Y+ KF
Sbjct  556  FEDTQSAISAQQALHGRWFAGKMITASFMVPQSYEDKF  593



>ref|XP_002516388.1| splicing factor, putative [Ricinus communis]
 gb|EEF46005.1| splicing factor, putative [Ricinus communis]
Length=609

 Score =   120 bits (301),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 56/98 (57%), Positives = 78/98 (80%), Gaps = 0/98 (0%)
 Frame = -1

Query  580  EPVGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVYLR  401
            + +G PSECLLLKNMFDP++ T+P+FDLD+ +DV  ECSK+G ++HI+VDKNSAG+VYLR
Sbjct  508  DTIGVPSECLLLKNMFDPSIETEPDFDLDIKEDVQLECSKFGNLQHIYVDKNSAGFVYLR  567

Query  400  FDSXEFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKF  287
            F++ + A  AQ A+H RWFA + ++A F+ P  Y+ KF
Sbjct  568  FENTQSAISAQRALHGRWFAGKMITATFMVPQVYETKF  605



>ref|XP_008236128.1| PREDICTED: LOW QUALITY PROTEIN: RNA-binding protein 39 [Prunus 
mume]
Length=624

 Score =   120 bits (301),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 57/96 (59%), Positives = 75/96 (78%), Gaps = 0/96 (0%)
 Frame = -1

Query  574  VGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVYLRFD  395
            +G PSECLLLKNMFDPA+ T+P FDLD+ +DV EECSKYG ++HI VDKN+AG+VYLRF+
Sbjct  525  IGVPSECLLLKNMFDPAVETEPNFDLDIKEDVQEECSKYGNLRHIFVDKNTAGHVYLRFE  584

Query  394  SXEFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKF  287
            + + A  A+  +H RWFA + + A F+ P  Y+AKF
Sbjct  585  NTQAAINARHVLHGRWFAGKMIEATFMLPQNYEAKF  620



>gb|ACN36244.1| unknown [Zea mays]
Length=410

 Score =   118 bits (296),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 57/94 (61%), Positives = 73/94 (78%), Gaps = 0/94 (0%)
 Frame = -1

Query  568  NPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVYLRFDSX  389
             P+E LLLKNMFDP++ TDP+FDLD+ DDV +ECSK+GAVKHI VDKN+AG+VYL+FDS 
Sbjct  314  TPTEFLLLKNMFDPSLETDPDFDLDIRDDVQDECSKFGAVKHIFVDKNTAGFVYLQFDSV  373

Query  388  EFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKF  287
              A +AQ A+H RWFA + ++A F+    Y  KF
Sbjct  374  TAAGKAQQALHGRWFAGKMITATFMSDQEYSTKF  407



>ref|XP_008382102.1| PREDICTED: RNA-binding protein 39-like [Malus domestica]
Length=601

 Score =   120 bits (300),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 58/98 (59%), Positives = 75/98 (77%), Gaps = 0/98 (0%)
 Frame = -1

Query  580  EPVGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVYLR  401
            + VG PSECLLLKNMFDP   ++P+FDLD+ DDV EECSKYG +KHI+VDKN+AG+VYLR
Sbjct  500  DTVGVPSECLLLKNMFDPTAESEPDFDLDIKDDVQEECSKYGKLKHIYVDKNTAGHVYLR  559

Query  400  FDSXEFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKF  287
            F++ E A  A+  +H RWFA + +   F+ P  Y+AKF
Sbjct  560  FETIEAALNARHVLHGRWFAGKMIETTFMLPQTYEAKF  597



>ref|XP_002467180.1| hypothetical protein SORBIDRAFT_01g021020 [Sorghum bicolor]
 gb|EER94178.1| hypothetical protein SORBIDRAFT_01g021020 [Sorghum bicolor]
Length=535

 Score =   119 bits (297),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 58/94 (62%), Positives = 73/94 (78%), Gaps = 0/94 (0%)
 Frame = -1

Query  568  NPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVYLRFDSX  389
             P+E LLLKNMFDPA+ TDP+FDLD+ DDV +ECSK+GAVKHI VDKN+AG+VYL+FDS 
Sbjct  439  TPTEFLLLKNMFDPALETDPDFDLDIRDDVQDECSKFGAVKHIFVDKNTAGFVYLQFDSV  498

Query  388  EFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKF  287
              A +AQ A+H RWFA + ++A F+    Y  KF
Sbjct  499  AAAGKAQQALHGRWFAGKMITATFMSAQEYSTKF  532



>ref|XP_008668576.1| PREDICTED: uncharacterized protein LOC100274411 isoform X1 [Zea 
mays]
 gb|ACF86417.1| unknown [Zea mays]
 tpg|DAA49861.1| TPA: hypothetical protein ZEAMMB73_656561 [Zea mays]
Length=537

 Score =   119 bits (297),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 58/94 (62%), Positives = 73/94 (78%), Gaps = 0/94 (0%)
 Frame = -1

Query  568  NPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVYLRFDSX  389
             P+E LLLKNMFDPA+ TDP+FDLD+ DDV +ECSK+GAVKHI VDKN+AG+VYL+FDS 
Sbjct  441  TPTEFLLLKNMFDPALETDPDFDLDIRDDVQDECSKFGAVKHIFVDKNTAGFVYLQFDSV  500

Query  388  EFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKF  287
              A +AQ A+H RWFA + ++A F+    Y  KF
Sbjct  501  TAAAKAQNALHGRWFAGKMITATFMSALEYSTKF  534



>ref|XP_006661795.1| PREDICTED: RNA-binding protein 39-like isoform X1 [Oryza brachyantha]
Length=383

 Score =   117 bits (294),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 58/96 (60%), Positives = 72/96 (75%), Gaps = 0/96 (0%)
 Frame = -1

Query  574  VGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVYLRFD  395
            +G P+E LLLKNMFDPA+ TDP+FDLD+ DDV +ECSK+GAV HI VDKN+AG+VYL FD
Sbjct  286  IGPPTEFLLLKNMFDPALETDPDFDLDIKDDVQDECSKFGAVNHIFVDKNTAGFVYLHFD  345

Query  394  SXEFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKF  287
            S   A  AQ A+H RWFA + ++A F+    Y  KF
Sbjct  346  SVAAATNAQRALHGRWFAGKMITATFMTAQQYKMKF  381



>ref|XP_004983028.1| PREDICTED: RNA-binding protein 39-like isoform X2 [Setaria italica]
Length=407

 Score =   117 bits (294),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 58/93 (62%), Positives = 72/93 (77%), Gaps = 0/93 (0%)
 Frame = -1

Query  565  PSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVYLRFDSXE  386
            P+E LLLKNMFDP + TDP+FDLD+ DDV +ECSK+GAVKHI VDKN+AG+VYL FDS  
Sbjct  312  PTEFLLLKNMFDPTVETDPDFDLDIRDDVQDECSKFGAVKHIFVDKNTAGFVYLHFDSVT  371

Query  385  FAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKF  287
             A +AQ A+H RWFA + ++A F+    Y AKF
Sbjct  372  AAAKAQQALHGRWFAGKMITATFMTAQEYSAKF  404



>gb|AAM20703.1| putative splicing factor [Arabidopsis thaliana]
Length=420

 Score =   117 bits (294),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 54/98 (55%), Positives = 74/98 (76%), Gaps = 0/98 (0%)
 Frame = -1

Query  580  EPVGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVYLR  401
            +P+G PSECLLLKNMFDP+  T+ +FD D+ +DV EECSK+G + HI VDKNS G+VYLR
Sbjct  317  DPIGVPSECLLLKNMFDPSTETEDDFDEDIKEDVKEECSKFGKLNHIFVDKNSVGFVYLR  376

Query  400  FDSXEFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKF  287
            F++ + A  AQ A+H RWFA + ++A ++    Y+AKF
Sbjct  377  FENAQAAIGAQRALHGRWFAGKMITATYMTTEAYEAKF  414



>ref|XP_009355642.1| PREDICTED: RNA-binding protein 39 isoform X1 [Pyrus x bretschneideri]
Length=601

 Score =   119 bits (298),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 57/98 (58%), Positives = 75/98 (77%), Gaps = 0/98 (0%)
 Frame = -1

Query  580  EPVGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVYLR  401
            + +G PSECLLLKNMFDP   ++P FDLD+ DDV EECSKYG +KHI+VDKN+AG+VYLR
Sbjct  500  DTIGVPSECLLLKNMFDPTAESEPNFDLDIKDDVQEECSKYGTLKHIYVDKNTAGHVYLR  559

Query  400  FDSXEFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKF  287
            F++ + A  A+  +H RWFA + + A F+ P  Y+AKF
Sbjct  560  FENTQAAISARHVLHGRWFAGKMIEATFMLPQTYEAKF  597



>ref|XP_009355643.1| PREDICTED: RNA-binding protein 39 isoform X2 [Pyrus x bretschneideri]
Length=601

 Score =   119 bits (298),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 57/98 (58%), Positives = 75/98 (77%), Gaps = 0/98 (0%)
 Frame = -1

Query  580  EPVGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVYLR  401
            + +G PSECLLLKNMFDP   ++P FDLD+ DDV EECSKYG +KHI+VDKN+AG+VYLR
Sbjct  500  DTIGVPSECLLLKNMFDPTAESEPNFDLDIKDDVQEECSKYGTLKHIYVDKNTAGHVYLR  559

Query  400  FDSXEFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKF  287
            F++ + A  A+  +H RWFA + + A F+ P  Y+AKF
Sbjct  560  FENTQAAISARHVLHGRWFAGKMIEATFMLPQTYEAKF  597



>gb|AFK46942.1| unknown [Lotus japonicus]
Length=175

 Score =   113 bits (283),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 53/98 (54%), Positives = 74/98 (76%), Gaps = 0/98 (0%)
 Frame = -1

Query  580  EPVGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVYLR  401
            + +G PSECL+LKNMFDP   T+P+FDLD+ +DV  ECSK+G +KHI+VDK SAG+VYLR
Sbjct  74   DTIGVPSECLMLKNMFDPKAETEPDFDLDIKEDVEAECSKFGKLKHIYVDKKSAGFVYLR  133

Query  400  FDSXEFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKF  287
            F++ + A  AQ A+H RWFA + ++  F+ P  Y+ +F
Sbjct  134  FEATQAAIGAQRALHGRWFAGKMITVSFMVPQSYEDRF  171



>ref|XP_011088626.1| PREDICTED: RNA-binding protein 39 isoform X2 [Sesamum indicum]
Length=578

 Score =   119 bits (297),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 58/98 (59%), Positives = 77/98 (79%), Gaps = 0/98 (0%)
 Frame = -1

Query  580  EPVGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVYLR  401
            + +G PSECLLLKNMFDP    +P+FDLD+ DDV EECSK+G +KHI+V+KNSAG+VYLR
Sbjct  476  DTIGAPSECLLLKNMFDPNSEAEPDFDLDIKDDVQEECSKFGRLKHIYVEKNSAGFVYLR  535

Query  400  FDSXEFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKF  287
            F++ E A  AQ A+H RWFA + ++A F+  + Y+AKF
Sbjct  536  FENAESAIAAQRALHGRWFAGKMITATFMLHHNYEAKF  573



>ref|XP_008644042.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|AFW68704.1| hypothetical protein ZEAMMB73_109361 [Zea mays]
 gb|AFW68705.1| hypothetical protein ZEAMMB73_109361 [Zea mays]
Length=536

 Score =   118 bits (295),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 57/94 (61%), Positives = 73/94 (78%), Gaps = 0/94 (0%)
 Frame = -1

Query  568  NPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVYLRFDSX  389
             P+E LLLKNMFDP++ TDP+FDLD+ DDV +ECSK+GAVKHI VDKN+AG+VYL+FDS 
Sbjct  440  TPTEFLLLKNMFDPSLETDPDFDLDIRDDVQDECSKFGAVKHIFVDKNTAGFVYLQFDSV  499

Query  388  EFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKF  287
              A +AQ A+H RWFA + ++A F+    Y  KF
Sbjct  500  TAAGKAQQALHGRWFAGKMITATFMSDQEYSTKF  533



>ref|XP_011088625.1| PREDICTED: RNA-binding protein 39 isoform X1 [Sesamum indicum]
Length=604

 Score =   119 bits (297),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 58/98 (59%), Positives = 77/98 (79%), Gaps = 0/98 (0%)
 Frame = -1

Query  580  EPVGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVYLR  401
            + +G PSECLLLKNMFDP    +P+FDLD+ DDV EECSK+G +KHI+V+KNSAG+VYLR
Sbjct  502  DTIGAPSECLLLKNMFDPNSEAEPDFDLDIKDDVQEECSKFGRLKHIYVEKNSAGFVYLR  561

Query  400  FDSXEFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKF  287
            F++ E A  AQ A+H RWFA + ++A F+  + Y+AKF
Sbjct  562  FENAESAIAAQRALHGRWFAGKMITATFMLHHNYEAKF  599



>dbj|BAB09409.1| splicing factor-like protein [Arabidopsis thaliana]
Length=604

 Score =   118 bits (296),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 62/91 (68%), Positives = 72/91 (79%), Gaps = 0/91 (0%)
 Frame = -1

Query  586  VPEPVGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVY  407
            V E VG PSECLLLKNMFDPA  T+P FDL++ DDV +ECSKYG V HI+VDKNSAG+VY
Sbjct  426  VNEHVGLPSECLLLKNMFDPATETEPNFDLEIRDDVADECSKYGPVNHIYVDKNSAGFVY  485

Query  406  LRFDSXEFAXRAQXAMHKRWFARRSVSAIFL  314
            LRF S E A  AQ AMH RWFA++ +SA F+
Sbjct  486  LRFQSVEAAAAAQRAMHMRWFAQKMISATFM  516



>gb|KJB12137.1| hypothetical protein B456_002G002300 [Gossypium raimondii]
Length=585

 Score =   118 bits (295),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 54/96 (56%), Positives = 75/96 (78%), Gaps = 0/96 (0%)
 Frame = -1

Query  586  VPEPVGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVY  407
            V + +G+PSECLLLKNMFDP + T+PEFDLD+ +DV EECSK+G +KHIHVD++SAG+VY
Sbjct  487  VIDTIGSPSECLLLKNMFDPTLETEPEFDLDIKEDVQEECSKFGKLKHIHVDRDSAGFVY  546

Query  406  LRFDSXEFAXRAQXAMHKRWFARRSVSAIFLQPYXY  299
            LRF+  + A  AQ  +H RWFA + ++A ++  Y +
Sbjct  547  LRFEDAQGAINAQRNLHGRWFAGKMITATYMVKYHF  582



>ref|NP_565399.1| splicing factor, CC1-like protein [Arabidopsis thaliana]
 gb|AAC64224.2| putative splicing factor [Arabidopsis thaliana]
 gb|ABO38752.1| At2g16940 [Arabidopsis thaliana]
 gb|AEC06558.1| splicing factor, CC1-like protein [Arabidopsis thaliana]
Length=561

 Score =   117 bits (294),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 54/98 (55%), Positives = 74/98 (76%), Gaps = 0/98 (0%)
 Frame = -1

Query  580  EPVGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVYLR  401
            +P+G PSECLLLKNMFDP+  T+ +FD D+ +DV EECSK+G + HI VDKNS G+VYLR
Sbjct  458  DPIGVPSECLLLKNMFDPSTETEDDFDEDIKEDVKEECSKFGKLNHIFVDKNSVGFVYLR  517

Query  400  FDSXEFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKF  287
            F++ + A  AQ A+H RWFA + ++A ++    Y+AKF
Sbjct  518  FENAQAAIGAQRALHGRWFAGKMITATYMTTEAYEAKF  555



>ref|XP_010467428.1| PREDICTED: RNA-binding protein 39-like isoform X2 [Camelina sativa]
Length=418

 Score =   116 bits (291),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 55/100 (55%), Positives = 75/100 (75%), Gaps = 0/100 (0%)
 Frame = -1

Query  586  VPEPVGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVY  407
            V +P+G PSECLLLKNMFDP+  T+P FD D+ +DV +ECSK+G + HI+VDK S G+VY
Sbjct  313  VVDPLGVPSECLLLKNMFDPSTETEPHFDEDIKEDVKDECSKFGELNHIYVDKYSIGFVY  372

Query  406  LRFDSXEFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKF  287
            LRF++ E A  AQ A+H RWFA + ++A ++    Y+AKF
Sbjct  373  LRFENVEAAMGAQRALHGRWFAGKMITATYMTTEAYEAKF  412



>gb|AAM62839.1| putative splicing factor [Arabidopsis thaliana]
Length=560

 Score =   117 bits (294),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 54/98 (55%), Positives = 74/98 (76%), Gaps = 0/98 (0%)
 Frame = -1

Query  580  EPVGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVYLR  401
            +P+G PSECLLLKNMFDP+  T+ +FD D+ +DV EECSK+G + HI VDKNS G+VYLR
Sbjct  457  DPIGVPSECLLLKNMFDPSTETEDDFDEDIKEDVKEECSKFGKLNHIFVDKNSVGFVYLR  516

Query  400  FDSXEFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKF  287
            F++ + A  AQ A+H RWFA + ++A ++    Y+AKF
Sbjct  517  FENAQAAIGAQRALHGRWFAGKMITATYMTTEAYEAKF  554



>ref|XP_010489301.1| PREDICTED: RNA-binding protein 39-like isoform X2 [Camelina sativa]
 ref|XP_010489302.1| PREDICTED: RNA-binding protein 39-like isoform X2 [Camelina sativa]
Length=409

 Score =   116 bits (291),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 55/98 (56%), Positives = 74/98 (76%), Gaps = 0/98 (0%)
 Frame = -1

Query  580  EPVGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVYLR  401
            +PVG PSECLLLKNMFDP+  T+P FD D+ +DV EECSK+G + HI+VDK S G+VYLR
Sbjct  306  DPVGVPSECLLLKNMFDPSTETEPHFDEDIKEDVKEECSKFGELNHIYVDKYSIGFVYLR  365

Query  400  FDSXEFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKF  287
            F++ + A  AQ A+H RWFA + ++A ++    Y+AKF
Sbjct  366  FENVKAAMGAQHALHGRWFAGKMITATYMTTEAYEAKF  403



>ref|XP_004983027.1| PREDICTED: RNA-binding protein 39-like isoform X1 [Setaria italica]
Length=542

 Score =   117 bits (293),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 58/93 (62%), Positives = 72/93 (77%), Gaps = 0/93 (0%)
 Frame = -1

Query  565  PSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVYLRFDSXE  386
            P+E LLLKNMFDP + TDP+FDLD+ DDV +ECSK+GAVKHI VDKN+AG+VYL FDS  
Sbjct  447  PTEFLLLKNMFDPTVETDPDFDLDIRDDVQDECSKFGAVKHIFVDKNTAGFVYLHFDSVT  506

Query  385  FAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKF  287
             A +AQ A+H RWFA + ++A F+    Y AKF
Sbjct  507  AAAKAQQALHGRWFAGKMITATFMTAQEYSAKF  539



>ref|XP_008447936.1| PREDICTED: RNA-binding protein 39 isoform X1 [Cucumis melo]
Length=593

 Score =   117 bits (294),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 58/96 (60%), Positives = 73/96 (76%), Gaps = 0/96 (0%)
 Frame = -1

Query  574  VGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVYLRFD  395
            VG PSECLLLKNMFDP   ++P FDLD+ DDV EECS++G +KHI+VDKNSAG+VYLRF+
Sbjct  494  VGTPSECLLLKNMFDPTAESEPTFDLDIRDDVEEECSRFGKLKHIYVDKNSAGFVYLRFE  553

Query  394  SXEFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKF  287
              E A  AQ A++ RWFA + + A F+    Y+AKF
Sbjct  554  KPESATEAQRALNGRWFAGKMIGATFMDIPSYEAKF  589



>ref|XP_008447937.1| PREDICTED: RNA-binding protein 39 isoform X2 [Cucumis melo]
Length=592

 Score =   117 bits (293),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 58/96 (60%), Positives = 73/96 (76%), Gaps = 0/96 (0%)
 Frame = -1

Query  574  VGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVYLRFD  395
            VG PSECLLLKNMFDP   ++P FDLD+ DDV EECS++G +KHI+VDKNSAG+VYLRF+
Sbjct  493  VGTPSECLLLKNMFDPTAESEPTFDLDIRDDVEEECSRFGKLKHIYVDKNSAGFVYLRFE  552

Query  394  SXEFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKF  287
              E A  AQ A++ RWFA + + A F+    Y+AKF
Sbjct  553  KPESATEAQRALNGRWFAGKMIGATFMDIPSYEAKF  588



>ref|XP_004144853.1| PREDICTED: RNA-binding protein 39-like [Cucumis sativus]
 ref|XP_004162902.1| PREDICTED: RNA-binding protein 39-like [Cucumis sativus]
Length=562

 Score =   117 bits (292),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 57/96 (59%), Positives = 73/96 (76%), Gaps = 0/96 (0%)
 Frame = -1

Query  574  VGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVYLRFD  395
            VG PSECLLLKNMFDP   ++P FDLD+ DDV EECS++G +KHI+VD+NSAG+VYLRF+
Sbjct  463  VGTPSECLLLKNMFDPTAESEPTFDLDIRDDVEEECSRFGKLKHIYVDRNSAGFVYLRFE  522

Query  394  SXEFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKF  287
              E A  AQ A++ RWFA + + A F+    Y+AKF
Sbjct  523  KSESAMEAQRALNGRWFAGKMIGATFMDIPSYEAKF  558



>ref|NP_001189537.1| splicing factor, CC1-like protein [Arabidopsis thaliana]
 gb|AEC06559.1| splicing factor, CC1-like protein [Arabidopsis thaliana]
Length=599

 Score =   117 bits (292),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 54/98 (55%), Positives = 74/98 (76%), Gaps = 0/98 (0%)
 Frame = -1

Query  580  EPVGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVYLR  401
            +P+G PSECLLLKNMFDP+  T+ +FD D+ +DV EECSK+G + HI VDKNS G+VYLR
Sbjct  496  DPIGVPSECLLLKNMFDPSTETEDDFDEDIKEDVKEECSKFGKLNHIFVDKNSVGFVYLR  555

Query  400  FDSXEFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKF  287
            F++ + A  AQ A+H RWFA + ++A ++    Y+AKF
Sbjct  556  FENAQAAIGAQRALHGRWFAGKMITATYMTTEAYEAKF  593



>ref|NP_001189538.1| splicing factor, CC1-like protein [Arabidopsis thaliana]
 gb|AEC06560.1| splicing factor, CC1-like protein [Arabidopsis thaliana]
Length=610

 Score =   117 bits (293),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 54/98 (55%), Positives = 74/98 (76%), Gaps = 0/98 (0%)
 Frame = -1

Query  580  EPVGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVYLR  401
            +P+G PSECLLLKNMFDP+  T+ +FD D+ +DV EECSK+G + HI VDKNS G+VYLR
Sbjct  507  DPIGVPSECLLLKNMFDPSTETEDDFDEDIKEDVKEECSKFGKLNHIFVDKNSVGFVYLR  566

Query  400  FDSXEFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKF  287
            F++ + A  AQ A+H RWFA + ++A ++    Y+AKF
Sbjct  567  FENAQAAIGAQRALHGRWFAGKMITATYMTTEAYEAKF  604



>gb|KGN43267.1| hypothetical protein Csa_7G014530 [Cucumis sativus]
Length=593

 Score =   117 bits (292),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 57/96 (59%), Positives = 73/96 (76%), Gaps = 0/96 (0%)
 Frame = -1

Query  574  VGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVYLRFD  395
            VG PSECLLLKNMFDP   ++P FDLD+ DDV EECS++G +KHI+VD+NSAG+VYLRF+
Sbjct  494  VGTPSECLLLKNMFDPTAESEPTFDLDIRDDVEEECSRFGKLKHIYVDRNSAGFVYLRFE  553

Query  394  SXEFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKF  287
              E A  AQ A++ RWFA + + A F+    Y+AKF
Sbjct  554  KSESAMEAQRALNGRWFAGKMIGATFMDIPSYEAKF  589



>ref|XP_010467427.1| PREDICTED: RNA-binding protein 39-like isoform X1 [Camelina sativa]
Length=564

 Score =   116 bits (290),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 55/100 (55%), Positives = 75/100 (75%), Gaps = 0/100 (0%)
 Frame = -1

Query  586  VPEPVGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVY  407
            V +P+G PSECLLLKNMFDP+  T+P FD D+ +DV +ECSK+G + HI+VDK S G+VY
Sbjct  459  VVDPLGVPSECLLLKNMFDPSTETEPHFDEDIKEDVKDECSKFGELNHIYVDKYSIGFVY  518

Query  406  LRFDSXEFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKF  287
            LRF++ E A  AQ A+H RWFA + ++A ++    Y+AKF
Sbjct  519  LRFENVEAAMGAQRALHGRWFAGKMITATYMTTEAYEAKF  558



>ref|XP_010489300.1| PREDICTED: RNA-binding protein 39-like isoform X1 [Camelina sativa]
Length=555

 Score =   116 bits (290),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 55/98 (56%), Positives = 74/98 (76%), Gaps = 0/98 (0%)
 Frame = -1

Query  580  EPVGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVYLR  401
            +PVG PSECLLLKNMFDP+  T+P FD D+ +DV EECSK+G + HI+VDK S G+VYLR
Sbjct  452  DPVGVPSECLLLKNMFDPSTETEPHFDEDIKEDVKEECSKFGELNHIYVDKYSIGFVYLR  511

Query  400  FDSXEFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKF  287
            F++ + A  AQ A+H RWFA + ++A ++    Y+AKF
Sbjct  512  FENVKAAMGAQHALHGRWFAGKMITATYMTTEAYEAKF  549



>ref|XP_001782480.1| predicted protein [Physcomitrella patens]
 gb|EDQ52699.1| predicted protein [Physcomitrella patens]
Length=363

 Score =   114 bits (286),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 57/96 (59%), Positives = 72/96 (75%), Gaps = 0/96 (0%)
 Frame = -1

Query  574  VGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVYLRFD  395
            +G PSE LLLKNMFDP+  +DPEFDLD+ +DV +ECSK+GAVKHI VDKNSAG+VYL F+
Sbjct  264  IGQPSEYLLLKNMFDPSTESDPEFDLDIKEDVQDECSKFGAVKHIFVDKNSAGHVYLCFE  323

Query  394  SXEFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKF  287
            S   A  AQ A+H RWFA + ++A ++    Y  KF
Sbjct  324  STPAAMAAQRALHGRWFAGKMITATYMSALAYQTKF  359



>dbj|BAK06658.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=592

 Score =   116 bits (291),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 56/96 (58%), Positives = 74/96 (77%), Gaps = 0/96 (0%)
 Frame = -1

Query  574  VGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVYLRFD  395
            +G P+E LLLKNMFDP++ TDP+FDLD+ DDV EECSK+G VKHI VDK++AG+VYL FD
Sbjct  490  IGTPTEFLLLKNMFDPSVETDPDFDLDIRDDVQEECSKFGVVKHIFVDKHTAGFVYLHFD  549

Query  394  SXEFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKF  287
            S   A  AQ ++H RWFA + ++A F+  + Y+ KF
Sbjct  550  SATAAASAQRSLHGRWFAGKMITATFMTAHQYEMKF  585



>ref|XP_002976923.1| hypothetical protein SELMODRAFT_151471 [Selaginella moellendorffii]
 ref|XP_002980666.1| hypothetical protein SELMODRAFT_178258 [Selaginella moellendorffii]
 gb|EFJ18317.1| hypothetical protein SELMODRAFT_178258 [Selaginella moellendorffii]
 gb|EFJ22033.1| hypothetical protein SELMODRAFT_151471 [Selaginella moellendorffii]
Length=532

 Score =   115 bits (289),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 57/98 (58%), Positives = 73/98 (74%), Gaps = 0/98 (0%)
 Frame = -1

Query  580  EPVGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVYLR  401
            EP+G PSECLLLKNMFDPA  TDPEFD+D+ +DV +ECSK+G VKHI VDK S G+VY+R
Sbjct  429  EPIGPPSECLLLKNMFDPATETDPEFDIDIKNDVQDECSKFGPVKHISVDKYSQGHVYVR  488

Query  400  FDSXEFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKF  287
            F +   A  AQ  ++KRWFA +++ A F+    Y+ KF
Sbjct  489  FGTAIDALAAQLNLNKRWFAGKTIRATFMNVQVYEEKF  526



>dbj|BAJ92968.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=592

 Score =   116 bits (291),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 56/96 (58%), Positives = 74/96 (77%), Gaps = 0/96 (0%)
 Frame = -1

Query  574  VGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVYLRFD  395
            +G P+E LLLKNMFDP++ TDP+FDLD+ DDV EECSK+G VKHI VDK++AG+VYL FD
Sbjct  490  IGTPTEFLLLKNMFDPSVETDPDFDLDIRDDVQEECSKFGVVKHIFVDKHTAGFVYLHFD  549

Query  394  SXEFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKF  287
            S   A  AQ ++H RWFA + ++A F+  + Y+ KF
Sbjct  550  SATAAASAQRSLHGRWFAGKMITATFMTAHQYEMKF  585



>dbj|BAJ94512.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=592

 Score =   116 bits (291),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 56/96 (58%), Positives = 74/96 (77%), Gaps = 0/96 (0%)
 Frame = -1

Query  574  VGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVYLRFD  395
            +G P+E LLLKNMFDP++ TDP+FDLD+ DDV EECSK+G VKHI VDK++AG+VYL FD
Sbjct  490  IGTPTEFLLLKNMFDPSVETDPDFDLDIRDDVQEECSKFGVVKHIFVDKHTAGFVYLHFD  549

Query  394  SXEFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKF  287
            S   A  AQ ++H RWFA + ++A F+  + Y+ KF
Sbjct  550  SATAAASAQRSLHGRWFAGKMITATFMTAHQYEMKF  585



>ref|XP_003573971.1| PREDICTED: RNA-binding protein 39-like [Brachypodium distachyon]
Length=597

 Score =   116 bits (290),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 57/96 (59%), Positives = 73/96 (76%), Gaps = 0/96 (0%)
 Frame = -1

Query  574  VGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVYLRFD  395
            +G P+E LLLKNMFDPA+ TDP+FDLD+ DDV EECSK+G VKHI VDK++AG+VYL FD
Sbjct  496  IGTPTEFLLLKNMFDPAVETDPDFDLDIRDDVQEECSKFGVVKHIFVDKHTAGFVYLHFD  555

Query  394  SXEFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKF  287
            S   A  AQ ++H RWFA + ++A F+    Y+ KF
Sbjct  556  SSTAATSAQRSLHGRWFAGKMITATFMTAQQYEMKF  591



>ref|XP_010107642.1| RNA-binding protein 39 [Morus notabilis]
 gb|EXC16553.1| RNA-binding protein 39 [Morus notabilis]
Length=811

 Score =   117 bits (292),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 56/97 (58%), Positives = 75/97 (77%), Gaps = 0/97 (0%)
 Frame = -1

Query  580  EPVGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVYLR  401
            + +G PSECL LKNMFDPA  T+P FDLD+ +DV +ECSK+G ++HI+VDKNSAGYVYLR
Sbjct  375  DTIGAPSECLQLKNMFDPAAETEPNFDLDIKEDVQDECSKFGNLQHIYVDKNSAGYVYLR  434

Query  400  FDSXEFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAK  290
            F+  + A  AQ A+H RWFA + ++A F+ P  Y+A+
Sbjct  435  FEHTQSAIAAQRALHGRWFAGKMITASFMLPQDYEAR  471



>ref|XP_010515902.1| PREDICTED: LOW QUALITY PROTEIN: RNA-binding protein 39-like [Camelina 
sativa]
Length=569

 Score =   115 bits (288),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 55/98 (56%), Positives = 74/98 (76%), Gaps = 0/98 (0%)
 Frame = -1

Query  580  EPVGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVYLR  401
            +PVG PSECLLLKNMFDP+  T+P FD D+ +DV +ECSK+G + HI+VDK S G+VYLR
Sbjct  466  DPVGVPSECLLLKNMFDPSTETEPHFDDDIKEDVKDECSKFGELNHIYVDKYSIGFVYLR  525

Query  400  FDSXEFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKF  287
            F++ E A  AQ A+H RWFA + ++A ++    Y+AKF
Sbjct  526  FENVEAAMGAQHALHGRWFAGKMITASYMTTEAYEAKF  563



>gb|ACJ85781.1| unknown [Medicago truncatula]
Length=346

 Score =   113 bits (282),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 54/98 (55%), Positives = 74/98 (76%), Gaps = 0/98 (0%)
 Frame = -1

Query  580  EPVGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVYLR  401
            + +G PSECLLLKNMFDP    +P+FDLD+ +DV  ECSK+G +KHI+VDK SAG+VYLR
Sbjct  245  DTIGTPSECLLLKNMFDPEDEKEPDFDLDVKEDVEAECSKFGNLKHIYVDKRSAGFVYLR  304

Query  400  FDSXEFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKF  287
            F++ + A  AQ A+H RWFA + ++A F+ P  Y+ +F
Sbjct  305  FENTQPAISAQRALHGRWFAGKMITASFMVPQLYEDRF  342



>gb|EYU37971.1| hypothetical protein MIMGU_mgv1a003198mg [Erythranthe guttata]
Length=600

 Score =   115 bits (287),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 55/96 (57%), Positives = 75/96 (78%), Gaps = 0/96 (0%)
 Frame = -1

Query  574  VGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVYLRFD  395
             G PSECLLLKNMFDP+   +P+FDLD+ +DV EECSK+G +KHI+V+KNSAG+VYLRF+
Sbjct  501  TGVPSECLLLKNMFDPSSEVEPDFDLDIKEDVQEECSKFGRLKHIYVEKNSAGFVYLRFE  560

Query  394  SXEFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKF  287
            + E A  AQ A+H RWFA + ++A ++    Y+A+F
Sbjct  561  NTEAAMAAQRALHGRWFAGKMITATYMLHQDYEARF  596



>gb|EMS55916.1| RNA-binding protein 39 [Triticum urartu]
Length=626

 Score =   115 bits (288),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 56/96 (58%), Positives = 73/96 (76%), Gaps = 0/96 (0%)
 Frame = -1

Query  574  VGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVYLRFD  395
            +G P+E LLLKNMFDPA+ TDP+FDLD+ DDV +ECSK+G VKHI VDK++AG+VYL FD
Sbjct  524  IGTPTEFLLLKNMFDPAVETDPDFDLDIRDDVQDECSKFGVVKHIFVDKHTAGFVYLHFD  583

Query  394  SXEFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKF  287
            S   A  AQ ++H RWFA + ++A F+    Y+ KF
Sbjct  584  SATAAASAQRSLHGRWFAGKMITATFMTAQQYEMKF  619



>gb|EMT08795.1| RNA-binding protein 39 [Aegilops tauschii]
Length=647

 Score =   115 bits (287),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 56/96 (58%), Positives = 73/96 (76%), Gaps = 0/96 (0%)
 Frame = -1

Query  574  VGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVYLRFD  395
            +G P+E LLLKNMFDPA+ TDP+FDLD+ DDV +ECSK+G VKHI VDK++AG+VYL FD
Sbjct  545  IGTPTEFLLLKNMFDPAVETDPDFDLDIRDDVQDECSKFGVVKHIFVDKHTAGFVYLHFD  604

Query  394  SXEFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKF  287
            S   A  AQ ++H RWFA + ++A F+    Y+ KF
Sbjct  605  SATAAASAQRSLHGRWFAGKMITATFMTAQQYEMKF  640



>ref|XP_007142808.1| hypothetical protein PHAVU_007G018500g [Phaseolus vulgaris]
 gb|ESW14802.1| hypothetical protein PHAVU_007G018500g [Phaseolus vulgaris]
Length=603

 Score =   114 bits (286),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 54/98 (55%), Positives = 74/98 (76%), Gaps = 0/98 (0%)
 Frame = -1

Query  580  EPVGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVYLR  401
            + +G PSECL+LKNMFDP   T+P+FDLD+ +DV  ECSK+G +KHI+VDK SAG+VYLR
Sbjct  502  DTIGVPSECLMLKNMFDPKDETEPDFDLDIKEDVEAECSKFGTLKHIYVDKKSAGFVYLR  561

Query  400  FDSXEFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKF  287
            F+  + A  AQ ++H RWFA + ++A F+ P  Y+ KF
Sbjct  562  FEETQSAISAQRSLHGRWFAGKMITASFMVPQSYEDKF  599



>gb|KCW55580.1| hypothetical protein EUGRSUZ_I01450 [Eucalyptus grandis]
Length=610

 Score =   114 bits (285),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 56/110 (51%), Positives = 77/110 (70%), Gaps = 12/110 (11%)
 Frame = -1

Query  580  EPVGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVD----------  431
            + VG PSECLLLKNMFDP + T+P+F+LD+ +DV EECSK+G ++HI VD          
Sbjct  497  DTVGVPSECLLLKNMFDPTLETEPDFELDIKEDVQEECSKFGNLRHIFVDNFVACVSFLP  556

Query  430  --KNSAGYVYLRFDSXEFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKF  287
              +NS+G+VYLRF+  + A  AQ A+H RWFA + ++A F+ P  Y+AKF
Sbjct  557  KNRNSSGFVYLRFEDTQSASNAQRALHGRWFAGKMITATFMVPLTYEAKF  606



>emb|CDX71317.1| BnaC07g05960D [Brassica napus]
Length=1644

 Score =   115 bits (288),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 55/100 (55%), Positives = 75/100 (75%), Gaps = 0/100 (0%)
 Frame = -1

Query  586  VPEPVGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVY  407
            V +PVG PSECLLLKNMFDP+  T+ +FD D+ +DV +ECSK+G + HI VDKNS G+VY
Sbjct  493  VVDPVGVPSECLLLKNMFDPSTETELDFDKDIEEDVRDECSKFGELNHIFVDKNSMGFVY  552

Query  406  LRFDSXEFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKF  287
            LRF++ + A  AQ A+H RWFA + ++A ++    Y+AKF
Sbjct  553  LRFENAQAAMGAQRALHGRWFAGKMITATYMTTETYEAKF  592



>gb|ABB47696.1| splicing factor, CC1-like family protein, expressed [Oryza sativa 
Japonica Group]
 dbj|BAG90413.1| unnamed protein product [Oryza sativa Japonica Group]
Length=320

 Score =   111 bits (277),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 58/96 (60%), Positives = 73/96 (76%), Gaps = 0/96 (0%)
 Frame = -1

Query  574  VGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVYLRFD  395
            +G+P+E LLLKNMFDPA+ TDP+FDLD+ DDV +ECSK+GAV HI VDKN+AG+VYL FD
Sbjct  223  IGSPTEFLLLKNMFDPAVETDPDFDLDIKDDVQDECSKFGAVNHIFVDKNTAGFVYLHFD  282

Query  394  SXEFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKF  287
            S   A  AQ A+H RWFA + ++A F+    Y  KF
Sbjct  283  SVAAATAAQRALHGRWFAGKMITATFMTAQQYKMKF  318



>gb|ABB47695.1| splicing factor, CC1-like family protein, expressed [Oryza sativa 
Japonica Group]
 dbj|BAG86782.1| unnamed protein product [Oryza sativa Japonica Group]
Length=339

 Score =   110 bits (276),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 58/96 (60%), Positives = 73/96 (76%), Gaps = 0/96 (0%)
 Frame = -1

Query  574  VGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVYLRFD  395
            +G+P+E LLLKNMFDPA+ TDP+FDLD+ DDV +ECSK+GAV HI VDKN+AG+VYL FD
Sbjct  242  IGSPTEFLLLKNMFDPAVETDPDFDLDIKDDVQDECSKFGAVNHIFVDKNTAGFVYLHFD  301

Query  394  SXEFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKF  287
            S   A  AQ A+H RWFA + ++A F+    Y  KF
Sbjct  302  SVAAATAAQRALHGRWFAGKMITATFMTAQQYKMKF  337



>ref|XP_004497188.1| PREDICTED: RNA-binding protein 39-like [Cicer arietinum]
Length=613

 Score =   112 bits (280),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 53/98 (54%), Positives = 72/98 (73%), Gaps = 0/98 (0%)
 Frame = -1

Query  580  EPVGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVYLR  401
            E +G PSECLLL+NMFDP    +P+FD D+ +DV  ECSK+G ++HI+VDK SAG+VYLR
Sbjct  512  ETIGVPSECLLLRNMFDPENEKEPDFDFDVKEDVEAECSKFGNLQHIYVDKKSAGFVYLR  571

Query  400  FDSXEFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKF  287
            F+  + A  AQ A+H RWFA + ++A F+ P  Y+ KF
Sbjct  572  FEDTQSAISAQRALHGRWFAGKMITASFMVPQSYEDKF  609



>ref|XP_006422531.1| hypothetical protein CICLE_v10027985mg [Citrus clementina]
 gb|ESR35771.1| hypothetical protein CICLE_v10027985mg [Citrus clementina]
Length=647

 Score =   112 bits (279),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 55/98 (56%), Positives = 74/98 (76%), Gaps = 0/98 (0%)
 Frame = -1

Query  580  EPVGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVYLR  401
            + +G PSECLLLKNMFDP   T  EFD+D+ +DV  ECSK+G +KHI V+K+SAG+VYLR
Sbjct  546  DTIGVPSECLLLKNMFDPKNETYEEFDMDIKEDVEGECSKFGKLKHIFVEKDSAGFVYLR  605

Query  400  FDSXEFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKF  287
            F++ + A  AQ A+H RWFA + ++A F+ P  Y+AKF
Sbjct  606  FENTQSAFAAQRALHGRWFAGKMITATFMVPQTYEAKF  643



>gb|KDO68180.1| hypothetical protein CISIN_1g006398mg [Citrus sinensis]
Length=639

 Score =   112 bits (279),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 55/98 (56%), Positives = 74/98 (76%), Gaps = 0/98 (0%)
 Frame = -1

Query  580  EPVGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVYLR  401
            + +G PSECLLLKNMFDP   T  EFD+D+ +DV  ECSK+G +KHI V+K+SAG+VYLR
Sbjct  538  DTIGVPSECLLLKNMFDPKNETYEEFDMDIKEDVEGECSKFGKLKHIFVEKDSAGFVYLR  597

Query  400  FDSXEFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKF  287
            F++ + A  AQ A+H RWFA + ++A F+ P  Y+AKF
Sbjct  598  FENTQSAFAAQRALHGRWFAGKMITATFMVPQTYEAKF  635



>ref|XP_006486689.1| PREDICTED: RNA-binding protein 39-like isoform X5 [Citrus sinensis]
Length=639

 Score =   112 bits (279),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 55/98 (56%), Positives = 74/98 (76%), Gaps = 0/98 (0%)
 Frame = -1

Query  580  EPVGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVYLR  401
            + +G PSECLLLKNMFDP   T  EFD+D+ +DV  ECSK+G +KHI V+K+SAG+VYLR
Sbjct  538  DTIGVPSECLLLKNMFDPKNETYEEFDMDIKEDVEGECSKFGKLKHIFVEKDSAGFVYLR  597

Query  400  FDSXEFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKF  287
            F++ + A  AQ A+H RWFA + ++A F+ P  Y+AKF
Sbjct  598  FENTQSAFAAQRALHGRWFAGKMITATFMVPQTYEAKF  635



>gb|KDO68179.1| hypothetical protein CISIN_1g006398mg [Citrus sinensis]
Length=647

 Score =   112 bits (279),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 55/98 (56%), Positives = 74/98 (76%), Gaps = 0/98 (0%)
 Frame = -1

Query  580  EPVGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVYLR  401
            + +G PSECLLLKNMFDP   T  EFD+D+ +DV  ECSK+G +KHI V+K+SAG+VYLR
Sbjct  546  DTIGVPSECLLLKNMFDPKNETYEEFDMDIKEDVEGECSKFGKLKHIFVEKDSAGFVYLR  605

Query  400  FDSXEFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKF  287
            F++ + A  AQ A+H RWFA + ++A F+ P  Y+AKF
Sbjct  606  FENTQSAFAAQRALHGRWFAGKMITATFMVPQTYEAKF  643



>ref|XP_006486688.1| PREDICTED: RNA-binding protein 39-like isoform X4 [Citrus sinensis]
Length=647

 Score =   112 bits (279),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 55/98 (56%), Positives = 74/98 (76%), Gaps = 0/98 (0%)
 Frame = -1

Query  580  EPVGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVYLR  401
            + +G PSECLLLKNMFDP   T  EFD+D+ +DV  ECSK+G +KHI V+K+SAG+VYLR
Sbjct  546  DTIGVPSECLLLKNMFDPKNETYEEFDMDIKEDVEGECSKFGKLKHIFVEKDSAGFVYLR  605

Query  400  FDSXEFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKF  287
            F++ + A  AQ A+H RWFA + ++A F+ P  Y+AKF
Sbjct  606  FENTQSAFAAQRALHGRWFAGKMITATFMVPQTYEAKF  643



>ref|XP_006422532.1| hypothetical protein CICLE_v10027985mg [Citrus clementina]
 gb|ESR35772.1| hypothetical protein CICLE_v10027985mg [Citrus clementina]
Length=639

 Score =   111 bits (278),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 55/98 (56%), Positives = 74/98 (76%), Gaps = 0/98 (0%)
 Frame = -1

Query  580  EPVGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVYLR  401
            + +G PSECLLLKNMFDP   T  EFD+D+ +DV  ECSK+G +KHI V+K+SAG+VYLR
Sbjct  538  DTIGVPSECLLLKNMFDPKNETYEEFDMDIKEDVEGECSKFGKLKHIFVEKDSAGFVYLR  597

Query  400  FDSXEFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKF  287
            F++ + A  AQ A+H RWFA + ++A F+ P  Y+AKF
Sbjct  598  FENTQSAFAAQRALHGRWFAGKMITATFMVPQTYEAKF  635



>ref|XP_006486686.1| PREDICTED: RNA-binding protein 39-like isoform X2 [Citrus sinensis]
Length=661

 Score =   112 bits (279),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 55/98 (56%), Positives = 74/98 (76%), Gaps = 0/98 (0%)
 Frame = -1

Query  580  EPVGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVYLR  401
            + +G PSECLLLKNMFDP   T  EFD+D+ +DV  ECSK+G +KHI V+K+SAG+VYLR
Sbjct  560  DTIGVPSECLLLKNMFDPKNETYEEFDMDIKEDVEGECSKFGKLKHIFVEKDSAGFVYLR  619

Query  400  FDSXEFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKF  287
            F++ + A  AQ A+H RWFA + ++A F+ P  Y+AKF
Sbjct  620  FENTQSAFAAQRALHGRWFAGKMITATFMVPQTYEAKF  657



>ref|XP_006486687.1| PREDICTED: RNA-binding protein 39-like isoform X3 [Citrus sinensis]
Length=658

 Score =   111 bits (278),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 55/98 (56%), Positives = 74/98 (76%), Gaps = 0/98 (0%)
 Frame = -1

Query  580  EPVGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVYLR  401
            + +G PSECLLLKNMFDP   T  EFD+D+ +DV  ECSK+G +KHI V+K+SAG+VYLR
Sbjct  557  DTIGVPSECLLLKNMFDPKNETYEEFDMDIKEDVEGECSKFGKLKHIFVEKDSAGFVYLR  616

Query  400  FDSXEFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKF  287
            F++ + A  AQ A+H RWFA + ++A F+ P  Y+AKF
Sbjct  617  FENTQSAFAAQRALHGRWFAGKMITATFMVPQTYEAKF  654



>ref|XP_006486685.1| PREDICTED: RNA-binding protein 39-like isoform X1 [Citrus sinensis]
Length=669

 Score =   111 bits (278),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 55/98 (56%), Positives = 74/98 (76%), Gaps = 0/98 (0%)
 Frame = -1

Query  580  EPVGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVYLR  401
            + +G PSECLLLKNMFDP   T  EFD+D+ +DV  ECSK+G +KHI V+K+SAG+VYLR
Sbjct  568  DTIGVPSECLLLKNMFDPKNETYEEFDMDIKEDVEGECSKFGKLKHIFVEKDSAGFVYLR  627

Query  400  FDSXEFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKF  287
            F++ + A  AQ A+H RWFA + ++A F+ P  Y+AKF
Sbjct  628  FENTQSAFAAQRALHGRWFAGKMITATFMVPQTYEAKF  665



>ref|XP_010088741.1| RNA-binding protein 39 [Morus notabilis]
 gb|EXB36922.1| RNA-binding protein 39 [Morus notabilis]
Length=773

 Score =   112 bits (279),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 60/88 (68%), Positives = 71/88 (81%), Gaps = 0/88 (0%)
 Frame = -1

Query  577  PVGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVYLRF  398
            PVG+P+ECLLL NMFDPA  TDPEFD+D+ +DV EECSK G V HI+VDKNSAG VYLRF
Sbjct  477  PVGSPTECLLLNNMFDPATETDPEFDVDIKEDVEEECSKCGRVVHIYVDKNSAGCVYLRF  536

Query  397  DSXEFAXRAQXAMHKRWFARRSVSAIFL  314
            ++ E A  AQ AMH RWFA R +SA+F+
Sbjct  537  ETAEAAAAAQRAMHGRWFAGRQISALFM  564



>ref|XP_006399474.1| hypothetical protein EUTSA_v100130050mg, partial [Eutrema salsugineum]
 gb|ESQ40927.1| hypothetical protein EUTSA_v100130050mg, partial [Eutrema salsugineum]
Length=583

 Score =   111 bits (277),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 61/120 (51%), Positives = 76/120 (63%), Gaps = 28/120 (23%)
 Frame = -1

Query  589  MVPEPVGNPSECLLLKNMFDPA----------------------------MXTDPEFdld  494
            +V EP+G PSECLLLKNMFDPA                            + T+P+F+ D
Sbjct  442  LVTEPIGQPSECLLLKNMFDPATEVRFRASSSSFCSRFKGSNYSHEVVTWLQTEPDFEED  501

Query  493  lxdDVXEECSKYGAVKHIHVDKNSAGYVYLRFDSXEFAXRAQXAMHKRWFARRSVSAIFL  314
            +  DV EECSKYG V HI+VDKNSAG+VY+RFDS + A  AQ AMH RWFA++ +SAIF+
Sbjct  502  IKVDVEEECSKYGRVNHIYVDKNSAGFVYVRFDSVQAAAAAQRAMHTRWFAQKMISAIFM  561



>emb|CDX89762.1| BnaC03g46760D [Brassica napus]
Length=172

 Score =   105 bits (263),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 51/100 (51%), Positives = 73/100 (73%), Gaps = 0/100 (0%)
 Frame = -1

Query  586  VPEPVGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVY  407
            V +PVG PSECLLLKNMFDP+  T+PEFD D+ +DV ++ S++G +  I VD+NS  +VY
Sbjct  69   VVDPVGVPSECLLLKNMFDPSTETEPEFDEDIKEDVKDKFSQFGELNRIFVDENSIAFVY  128

Query  406  LRFDSXEFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKF  287
            LRF++ + A  AQ A+H RWFA + ++A ++    Y+AKF
Sbjct  129  LRFENAQAAMGAQRALHGRWFAGKMITATYMTKESYEAKF  168



>ref|XP_004290736.1| PREDICTED: RNA-binding protein 39 [Fragaria vesca subsp. vesca]
 ref|XP_011458688.1| PREDICTED: RNA-binding protein 39 [Fragaria vesca subsp. vesca]
Length=588

 Score =   110 bits (276),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 52/99 (53%), Positives = 73/99 (74%), Gaps = 1/99 (1%)
 Frame = -1

Query  580  EPVGNPSECLLLKNMFDPA-MXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVYL  404
            + +G PSECLLL NMFDP  +  +P+ D+D+ +DV EECSKYG +KHI VDKN+AG+VYL
Sbjct  486  DTIGVPSECLLLTNMFDPKEIEAEPDIDVDIKEDVQEECSKYGKLKHIFVDKNTAGFVYL  545

Query  403  RFDSXEFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKF  287
            RF++ + A  A+  +H RWFA + ++A F+ P  Y+ KF
Sbjct  546  RFENTQAAINARQVLHGRWFAGKMITATFMSPQNYETKF  584



>gb|EAY78664.1| hypothetical protein OsI_33765 [Oryza sativa Indica Group]
Length=549

 Score =   110 bits (275),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 58/96 (60%), Positives = 73/96 (76%), Gaps = 0/96 (0%)
 Frame = -1

Query  574  VGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVYLRFD  395
            +G+P+E LLLKNMFDPA+ TDP+FDLD+ DDV +ECSK+GAV HI VDKN+AG+VYL FD
Sbjct  452  IGSPTEFLLLKNMFDPAVETDPDFDLDIKDDVQDECSKFGAVNHIFVDKNTAGFVYLHFD  511

Query  394  SXEFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKF  287
            S   A  AQ A+H RWFA + ++A F+    Y  KF
Sbjct  512  SVAAATAAQRALHGRWFAGKMITATFMTAQQYKMKF  547



>ref|XP_009121181.1| PREDICTED: RNA-binding protein 39 isoform X1 [Brassica rapa]
Length=559

 Score =   110 bits (274),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 54/100 (54%), Positives = 73/100 (73%), Gaps = 0/100 (0%)
 Frame = -1

Query  586  VPEPVGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVY  407
            V +PVG PSE LLLKNMFDP+  T+  FD D+ +DV +ECSK+G + HI VDKNS G+VY
Sbjct  456  VVDPVGVPSEFLLLKNMFDPSTETELGFDKDIEEDVRDECSKFGELNHIFVDKNSMGFVY  515

Query  406  LRFDSXEFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKF  287
            LRF++ + A  AQ A+H RWFA + ++A ++    Y+AKF
Sbjct  516  LRFENAQAAMGAQRALHGRWFAGKMITATYMTTETYEAKF  555



>emb|CDP19575.1| unnamed protein product [Coffea canephora]
Length=593

 Score =   110 bits (275),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 53/98 (54%), Positives = 72/98 (73%), Gaps = 0/98 (0%)
 Frame = -1

Query  580  EPVGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVYLR  401
            + +G PSECLLLKN+FDP + ++PEFD D+ DDV +ECSK+G +KHI+VDK S G VYLR
Sbjct  492  DTIGIPSECLLLKNVFDPKLESEPEFDQDIKDDVEDECSKFGKLKHIYVDKKSDGLVYLR  551

Query  400  FDSXEFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKF  287
            F++ + A  AQ A+H RWFA + + A F+ P  Y+  F
Sbjct  552  FENNQAAIAAQRALHGRWFAGKMILATFMVPQNYEVTF  589



>gb|EEE51022.1| hypothetical protein OsJ_31660 [Oryza sativa Japonica Group]
Length=548

 Score =   110 bits (274),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 58/96 (60%), Positives = 73/96 (76%), Gaps = 0/96 (0%)
 Frame = -1

Query  574  VGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVYLRFD  395
            +G+P+E LLLKNMFDPA+ TDP+FDLD+ DDV +ECSK+GAV HI VDKN+AG+VYL FD
Sbjct  451  IGSPTEFLLLKNMFDPAVETDPDFDLDIKDDVQDECSKFGAVNHIFVDKNTAGFVYLHFD  510

Query  394  SXEFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKF  287
            S   A  AQ A+H RWFA + ++A F+    Y  KF
Sbjct  511  SVAAATAAQRALHGRWFAGKMITATFMTAQQYKMKF  546



>ref|XP_009121183.1| PREDICTED: RNA-binding protein 39 isoform X2 [Brassica rapa]
Length=587

 Score =   110 bits (274),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 54/100 (54%), Positives = 73/100 (73%), Gaps = 0/100 (0%)
 Frame = -1

Query  586  VPEPVGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVY  407
            V +PVG PSE LLLKNMFDP+  T+  FD D+ +DV +ECSK+G + HI VDKNS G+VY
Sbjct  484  VVDPVGVPSEFLLLKNMFDPSTETELGFDKDIEEDVRDECSKFGELNHIFVDKNSMGFVY  543

Query  406  LRFDSXEFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKF  287
            LRF++ + A  AQ A+H RWFA + ++A ++    Y+AKF
Sbjct  544  LRFENAQAAMGAQRALHGRWFAGKMITATYMTTETYEAKF  583



>ref|XP_003555861.1| PREDICTED: RNA-binding protein 39-like [Glycine max]
 gb|KHN11495.1| RNA-binding protein 39 [Glycine soja]
Length=600

 Score =   109 bits (272),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 53/98 (54%), Positives = 71/98 (72%), Gaps = 0/98 (0%)
 Frame = -1

Query  580  EPVGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVYLR  401
            + +G  SECL+LKNMFDP    +P+FDLD+ +DV  ECSK G +KHI+VDK SAG+VYLR
Sbjct  499  DTIGVASECLMLKNMFDPKDEIEPDFDLDIKEDVEAECSKLGTLKHIYVDKKSAGFVYLR  558

Query  400  FDSXEFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKF  287
            F+  + A  AQ A+H RWFA + ++A F+ P  Y+ KF
Sbjct  559  FEDTQSAISAQQALHGRWFAGKMITASFMVPQSYEDKF  596



>ref|XP_001776557.1| predicted protein [Physcomitrella patens]
 gb|EDQ58690.1| predicted protein [Physcomitrella patens]
Length=372

 Score =   106 bits (264),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 56/91 (62%), Positives = 71/91 (78%), Gaps = 0/91 (0%)
 Frame = -1

Query  580  EPVGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVYLR  401
            + +G PSE LLLKNMFDP+  +DP+FD+D+ DDV EECSK+G VKHI VDKNSAG+VYL 
Sbjct  262  DAIGQPSEYLLLKNMFDPSTESDPDFDMDIKDDVQEECSKFGVVKHIFVDKNSAGHVYLC  321

Query  400  FDSXEFAXRAQXAMHKRWFARRSVSAIFLQP  308
            FDS   A  AQ A+H RWFA + ++A +L+P
Sbjct  322  FDSIAAAMAAQRALHGRWFAGKMITATYLKP  352



>emb|CDY31398.1| BnaA07g03330D [Brassica napus]
Length=1649

 Score =   109 bits (272),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 54/100 (54%), Positives = 73/100 (73%), Gaps = 0/100 (0%)
 Frame = -1

Query  586  VPEPVGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVY  407
            V +PVG PSE LLLKNMFDP+  T+  FD D+ +DV +ECSK+G + HI VDKNS G+VY
Sbjct  505  VVDPVGVPSEFLLLKNMFDPSTETELGFDKDIEEDVRDECSKFGELNHIFVDKNSMGFVY  564

Query  406  LRFDSXEFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKF  287
            LRF++ + A  AQ A+H RWFA + ++A ++    Y+AKF
Sbjct  565  LRFENAQAAMGAQRALHGRWFAGKMITATYMTTETYEAKF  604



>ref|XP_005650141.1| splicing factor, CC1-like protein [Coccomyxa subellipsoidea C-169]
 gb|EIE25597.1| splicing factor, CC1-like protein [Coccomyxa subellipsoidea C-169]
Length=497

 Score =   105 bits (262),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 51/94 (54%), Positives = 66/94 (70%), Gaps = 0/94 (0%)
 Frame = -1

Query  565  PSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVYLRFDSXE  386
            P++CLLLKNMFDP   T+P++D ++  DV EECSKYG V H HVDKNS G+VYL+F + E
Sbjct  403  PTQCLLLKNMFDPKEETEPDWDQEIATDVTEECSKYGPVSHTHVDKNSKGFVYLKFVTVE  462

Query  385  FAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKFK  284
             +  AQ A+H RWFA R V A F     Y++ F+
Sbjct  463  GSAAAQKALHGRWFAGRQVVAEFQFTQIYNSYFQ  496



>tpg|DAA49863.1| TPA: hypothetical protein ZEAMMB73_656561 [Zea mays]
Length=357

 Score =   101 bits (252),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 58/133 (44%), Positives = 73/133 (55%), Gaps = 39/133 (29%)
 Frame = -1

Query  568  NPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDK-------------  428
             P+E LLLKNMFDPA+ TDP+FDLD+ DDV +ECSK+GAVKHI VDK             
Sbjct  222  TPTEFLLLKNMFDPALETDPDFDLDIRDDVQDECSKFGAVKHIFVDKCYYIFLKTGSTLE  281

Query  427  --------------------------NSAGYVYLRFDSXEFAXRAQXAMHKRWFARRSVS  326
                                      N+AG+VYL+FDS   A +AQ A+H RWFA + ++
Sbjct  282  KIDLGQVNYNLDAGSGICLGCPTIVVNTAGFVYLQFDSVTAAAKAQNALHGRWFAGKMIT  341

Query  325  AIFLQPYXYDAKF  287
            A F+    Y  KF
Sbjct  342  ATFMSALEYSTKF  354



>ref|XP_002508355.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO69613.1| predicted protein [Micromonas sp. RCC299]
Length=518

 Score =   102 bits (255),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 48/83 (58%), Positives = 64/83 (77%), Gaps = 0/83 (0%)
 Frame = -1

Query  565  PSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVYLRFDSXE  386
            P++CLLLKNMFDPA  T+PE+ +D+ +DV +ECSK+G V HIHVDK S G+VYL+F S E
Sbjct  424  PTQCLLLKNMFDPAEETEPEWWIDIGEDVKDECSKHGPVSHIHVDKESRGFVYLKFGSTE  483

Query  385  FAXRAQXAMHKRWFARRSVSAIF  317
             A  A+ A+H RWFA + ++A F
Sbjct  484  GASAARQALHGRWFAGKMIAAEF  506



>ref|XP_003059052.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH57507.1| predicted protein [Micromonas pusilla CCMP1545]
Length=515

 Score = 96.3 bits (238),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 46/93 (49%), Positives = 64/93 (69%), Gaps = 0/93 (0%)
 Frame = -1

Query  565  PSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVYLRFDSXE  386
            P++ LLLKN+FDP   T+PE+  D+ +DV +EC K+GAV H HVDK+S G+VYL+F   +
Sbjct  421  PTQTLLLKNLFDPKEETEPEWWNDIAEDVKDECGKHGAVAHCHVDKDSEGFVYLKFAEVK  480

Query  385  FAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKF  287
             A RAQ A+H RWFA R ++A +     Y+  F
Sbjct  481  GAERAQAALHSRWFAGRMIAAEYQFTAVYNKHF  513



>emb|CDH60258.1| splicing factor cc1-like protein [Lichtheimia corymbifera JMRC:FSU:9682]
Length=474

 Score = 93.6 bits (231),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 44/92 (48%), Positives = 64/92 (70%), Gaps = 0/92 (0%)
 Frame = -1

Query  562  SECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVYLRFDSXEF  383
            S  ++L NMF+PA  T+P++  DL  DV EEC+K+G V+HIHV+++S G VYL+F+S E 
Sbjct  381  SRTIMLNNMFNPAEETEPDWVKDLETDVKEECTKFGQVEHIHVNEDSLGEVYLKFESVES  440

Query  382  AXRAQXAMHKRWFARRSVSAIFLQPYXYDAKF  287
            A  A  A+  RWF  + +SA+F+    Y+AKF
Sbjct  441  AQNALEALDGRWFGGKQISAVFVPEAIYNAKF  472



>emb|CDH60257.1| splicing factor cc1-like protein [Lichtheimia corymbifera JMRC:FSU:9682]
Length=475

 Score = 93.6 bits (231),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 44/92 (48%), Positives = 64/92 (70%), Gaps = 0/92 (0%)
 Frame = -1

Query  562  SECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVYLRFDSXEF  383
            S  ++L NMF+PA  T+P++  DL  DV EEC+K+G V+HIHV+++S G VYL+F+S E 
Sbjct  382  SRTIMLNNMFNPAEETEPDWVKDLETDVKEECTKFGQVEHIHVNEDSLGEVYLKFESVES  441

Query  382  AXRAQXAMHKRWFARRSVSAIFLQPYXYDAKF  287
            A  A  A+  RWF  + +SA+F+    Y+AKF
Sbjct  442  AQNALEALDGRWFGGKQISAVFVPEAIYNAKF  473



>ref|XP_005850115.1| hypothetical protein CHLNCDRAFT_57088 [Chlorella variabilis]
 gb|EFN58013.1| hypothetical protein CHLNCDRAFT_57088 [Chlorella variabilis]
Length=546

 Score = 92.8 bits (229),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 43/83 (52%), Positives = 59/83 (71%), Gaps = 0/83 (0%)
 Frame = -1

Query  565  PSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVYLRFDSXE  386
            P++CLLLKNMFDPA  T   +D ++ +DV  EC KYG V+H+ VD+NS G+VY++F +  
Sbjct  452  PTQCLLLKNMFDPAEETADNWDAEIAEDVGSECQKYGPVEHVFVDRNSRGFVYVKFTAIS  511

Query  385  FAXRAQXAMHKRWFARRSVSAIF  317
             A  AQ A+H RWFA R ++A F
Sbjct  512  SAANAQRALHGRWFAARQIAADF  534



>emb|CDS08376.1| hypothetical protein LRAMOSA02324 [Absidia idahoensis var. thermophila]
Length=463

 Score = 92.4 bits (228),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 43/92 (47%), Positives = 64/92 (70%), Gaps = 0/92 (0%)
 Frame = -1

Query  562  SECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVYLRFDSXEF  383
            S  ++L NMF+PA  T+P++  DL  DV EEC+K+G V+HIHV+++S G VYL+F + E 
Sbjct  370  SRTIMLNNMFNPAEETEPDWVKDLETDVKEECTKFGQVEHIHVNEDSLGEVYLKFATVES  429

Query  382  AXRAQXAMHKRWFARRSVSAIFLQPYXYDAKF  287
            A +A  A+  RWF  + +SA+F+    Y+AKF
Sbjct  430  AQKALEALDGRWFGGKQISAVFVPEAIYNAKF  461



>ref|XP_005703854.1| RNA-binding protein [Galdieria sulphuraria]
 gb|EME27334.1| RNA-binding protein [Galdieria sulphuraria]
Length=596

 Score = 92.4 bits (228),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 45/95 (47%), Positives = 65/95 (68%), Gaps = 1/95 (1%)
 Frame = -1

Query  568  NPSECLLLKNMFDPAMXTDPEFdldlxdDVXEEC-SKYGAVKHIHVDKNSAGYVYLRFDS  392
            +PS CL+L+NMFDPA  TDP F L++ +DV +EC SK+G ++HI VDKNSAG VY++F++
Sbjct  492  SPSTCLMLRNMFDPAQETDPNFHLEVQEDVRDECISKFGPLRHIFVDKNSAGLVYVQFET  551

Query  391  XEFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKF  287
               A +A+  +H RWFA   V   ++    Y  +F
Sbjct  552  MSDAMKAKQGLHGRWFAGHQVIVEYISESVYYIRF  586



>ref|XP_010515913.1| PREDICTED: RNA-binding protein 39-like [Camelina sativa]
 ref|XP_010515921.1| PREDICTED: RNA-binding protein 39-like [Camelina sativa]
Length=88

 Score = 85.9 bits (211),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 44/84 (52%), Positives = 59/84 (70%), Gaps = 0/84 (0%)
 Frame = -1

Query  538  MFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVYLRFDSXEFAXRAQXAM  359
            MFDP+  T P FD+D+ +DV EECS +G +KHI+VD NSAG+VYLRF   + A  AQ A+
Sbjct  1    MFDPSTETYPYFDVDVREDVIEECSNFGRMKHIYVDTNSAGFVYLRFVKAQAAMGAQRAL  60

Query  358  HKRWFARRSVSAIFLQPYXYDAKF  287
            H RWF  R ++A ++    Y+AKF
Sbjct  61   HGRWFGGRMMTATYMTREAYEAKF  84



>ref|XP_003080863.1| RNA recognition motif (ISS) [Ostreococcus tauri]
Length=387

 Score = 90.1 bits (222),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 44/93 (47%), Positives = 61/93 (66%), Gaps = 0/93 (0%)
 Frame = -1

Query  565  PSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVYLRFDSXE  386
            P+ CLLLKN+F+ A  TDPE+ LD+ +DV  EC K+G + H  VDK+S G+VYL+F    
Sbjct  291  PTPCLLLKNLFNAAEETDPEWWLDIAEDVKGECEKFGEITHTFVDKDSQGFVYLKFADVA  350

Query  385  FAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKF  287
             + RAQ A+H RWFA R ++A +     Y+  F
Sbjct  351  SSTRAQQALHTRWFAGRKIAAEYQFAATYNGHF  383



>ref|XP_007199063.1| hypothetical protein PRUPE_ppa018661mg, partial [Prunus persica]
 gb|EMJ00262.1| hypothetical protein PRUPE_ppa018661mg, partial [Prunus persica]
Length=349

 Score = 89.4 bits (220),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 44/75 (59%), Positives = 60/75 (80%), Gaps = 0/75 (0%)
 Frame = -1

Query  580  EPVGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVYLR  401
            + +G PSECLLLKNMF+PA+ T+P FDLD+ +DV EECSKY  ++HI VDKN+AG+VYLR
Sbjct  268  DTIGVPSECLLLKNMFNPAVETEPNFDLDIKEDVQEECSKYRNLRHIFVDKNTAGHVYLR  327

Query  400  FDSXEFAXRAQXAMH  356
            F++ + A  A+  +H
Sbjct  328  FENTQAAINARHVLH  342



>ref|XP_001419396.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO97689.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=516

 Score = 90.9 bits (224),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 45/93 (48%), Positives = 61/93 (66%), Gaps = 0/93 (0%)
 Frame = -1

Query  565  PSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVYLRFDSXE  386
            P+ C+LLKN+F+ A  TDPE+ LD+ +DV  EC K+G + H  VDK+S G+VYL+F    
Sbjct  420  PTPCILLKNLFNAAEETDPEWWLDIAEDVKGECEKFGEITHAFVDKDSQGFVYLKFVDTA  479

Query  385  FAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKF  287
             + RAQ A+H RWFA R ++A F     YD  F
Sbjct  480  SSTRAQQALHARWFAGRKIAAEFQFAEVYDGHF  512



>gb|EXX55443.1| Pab1p [Rhizophagus irregularis DAOM 197198w]
 gb|EXX55444.1| Pab1p [Rhizophagus irregularis DAOM 197198w]
Length=471

 Score = 90.5 bits (223),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 44/102 (43%), Positives = 63/102 (62%), Gaps = 0/102 (0%)
 Frame = -1

Query  580  EPVGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVYLR  401
            +P  NP+ C+LLKNMF+P   T+  +  +L +DV  EC KYG V HI VD+ SAG +Y++
Sbjct  368  QPRVNPTRCVLLKNMFNPDEETESNWAEELEEDVKSECIKYGPVVHISVDRESAGDIYMK  427

Query  400  FDSXEFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKFKGAA  275
            FDS   A  A   ++ RWF    +SA+F+    Y+ +F  AA
Sbjct  428  FDSVSSAQAAVNGLNGRWFGGNQISAVFILDMFYNVRFPKAA  469



>gb|ESA21112.1| hypothetical protein GLOINDRAFT_92051 [Rhizophagus irregularis 
DAOM 181602]
Length=466

 Score = 90.5 bits (223),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 44/102 (43%), Positives = 63/102 (62%), Gaps = 0/102 (0%)
 Frame = -1

Query  580  EPVGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVYLR  401
            +P  NP+ C+LLKNMF+P   T+  +  +L +DV  EC KYG V HI VD+ SAG +Y++
Sbjct  363  QPRVNPTRCVLLKNMFNPDEETESNWAEELEEDVKSECIKYGPVVHISVDRESAGDIYMK  422

Query  400  FDSXEFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKFKGAA  275
            FDS   A  A   ++ RWF    +SA+F+    Y+ +F  AA
Sbjct  423  FDSVSSAQAAVNGLNGRWFGGNQISAVFILDMFYNVRFPKAA  464



>emb|CEG01539.1| Nucleotide-binding, alpha-beta plait [Ostreococcus tauri]
Length=528

 Score = 90.1 bits (222),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 44/93 (47%), Positives = 61/93 (66%), Gaps = 0/93 (0%)
 Frame = -1

Query  565  PSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVYLRFDSXE  386
            P+ CLLLKN+F+ A  TDPE+ LD+ +DV  EC K+G + H  VDK+S G+VYL+F    
Sbjct  432  PTPCLLLKNLFNAAEETDPEWWLDIAEDVKGECEKFGEITHTFVDKDSQGFVYLKFADVA  491

Query  385  FAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKF  287
             + RAQ A+H RWFA R ++A +     Y+  F
Sbjct  492  SSTRAQQALHTRWFAGRKIAAEYQFAATYNGHF  524



>gb|KJE89116.1| RNA binding domain-containing protein 39, variant [Capsaspora 
owczarzaki ATCC 30864]
Length=441

 Score = 88.6 bits (218),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 44/92 (48%), Positives = 61/92 (66%), Gaps = 0/92 (0%)
 Frame = -1

Query  562  SECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVYLRFDSXEF  383
            ++ LLLKNMFDPA   DPE+ LD+ D V +EC K+G+V HI VD NS G+V+++F S E 
Sbjct  336  TQFLLLKNMFDPAQERDPEWQLDIRDTVLDECVKHGSVTHIFVDANSPGFVFIKFSSVEA  395

Query  382  AXRAQXAMHKRWFARRSVSAIFLQPYXYDAKF  287
                Q  MH RWFA + ++A ++    Y A+F
Sbjct  396  CIAVQRTMHGRWFAGKLITADYVPEPMYHARF  427



>ref|XP_011401211.1| RNA-binding protein 39 [Auxenochlorella protothecoides]
 gb|KFM28198.1| RNA-binding protein 39 [Auxenochlorella protothecoides]
Length=350

 Score = 86.7 bits (213),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 43/93 (46%), Positives = 63/93 (68%), Gaps = 0/93 (0%)
 Frame = -1

Query  565  PSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVYLRFDSXE  386
            P++C+LLKNMFDP   ++P +  D+  DV EEC+K+G ++H+HVD  S G+VYL+F +  
Sbjct  256  PTQCVLLKNMFDPEEESEPGWSEDIAADVGEECAKFGELQHLHVDAASKGFVYLKFVAVP  315

Query  385  FAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKF  287
             A  A  AM+ RWFA + V+A+F     Y+A F
Sbjct  316  AAAAAVQAMNGRWFAGKQVAAVFQFAAMYNAHF  348



>ref|XP_010495125.1| PREDICTED: RNA-binding protein 39-like [Camelina sativa]
Length=99

 Score = 82.8 bits (203),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 42/75 (56%), Positives = 58/75 (77%), Gaps = 0/75 (0%)
 Frame = -1

Query  508  EFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVYLRFDSXEFAXRAQXAMHKRWFARRSV  329
            EFDL++ +DV EECS+YG V HI+VDKNSAG+VYLRF++ + A  AQ  MH+RWFA++ +
Sbjct  24   EFDLEIREDVKEECSRYGRVSHIYVDKNSAGFVYLRFETVQGAVAAQNVMHRRWFAQKMI  83

Query  328  SAIFLQPYXYDAKFK  284
            +A F+    Y+AK K
Sbjct  84   TATFMPRDEYEAKAK  98



>ref|XP_004365528.1| RNA binding domain-containing protein 39 [Capsaspora owczarzaki 
ATCC 30864]
 gb|KJE89115.1| RNA binding domain-containing protein 39 [Capsaspora owczarzaki 
ATCC 30864]
Length=600

 Score = 88.6 bits (218),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 44/92 (48%), Positives = 61/92 (66%), Gaps = 0/92 (0%)
 Frame = -1

Query  562  SECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVYLRFDSXEF  383
            ++ LLLKNMFDPA   DPE+ LD+ D V +EC K+G+V HI VD NS G+V+++F S E 
Sbjct  495  TQFLLLKNMFDPAQERDPEWQLDIRDTVLDECVKHGSVTHIFVDANSPGFVFIKFSSVEA  554

Query  382  AXRAQXAMHKRWFARRSVSAIFLQPYXYDAKF  287
                Q  MH RWFA + ++A ++    Y A+F
Sbjct  555  CIAVQRTMHGRWFAGKLITADYVPEPMYHARF  586



>gb|EFA79920.1| putative RNA splicing factor [Polysphondylium pallidum PN500]
Length=606

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 47/97 (48%), Positives = 62/97 (64%), Gaps = 0/97 (0%)
 Frame = -1

Query  577  PVGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVYLRF  398
            PV   S C++LKNMFDP   T  ++D ++  DV  ECS YG VKHI +DKNS GY+YL +
Sbjct  504  PVTITSTCIVLKNMFDPDTETGDDWDKEIERDVELECSTYGNVKHIFLDKNSQGYIYLCY  563

Query  397  DSXEFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKF  287
            DS E A  A   +++RWFA + +SA  +    Y AKF
Sbjct  564  DSIEGASTAINKLNRRWFAGKMLSAESIPENIYFAKF  600



>ref|XP_004334854.1| splicing factor, CC1like subfamily protein [Acanthamoeba castellanii 
str. Neff]
 gb|ELR12841.1| splicing factor, CC1like subfamily protein [Acanthamoeba castellanii 
str. Neff]
Length=594

 Score = 87.0 bits (214),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 51/103 (50%), Positives = 67/103 (65%), Gaps = 2/103 (2%)
 Frame = -1

Query  589  MVPEPVGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNS-AGY  413
            + P PV   S  +LLKNMFDPA  T+P F LD+ +DV EECSKYG V   HV ++S +G 
Sbjct  492  VAPRPV-VASAFMLLKNMFDPAQETEPNFHLDIQEDVTEECSKYGKVLQCHVVRDSPSGL  550

Query  412  VYLRFDSXEFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKFK  284
            VYLRF+S E A +A  A++ RWFA + +SA F+    + A  K
Sbjct  551  VYLRFESSEGAAKAIQALNGRWFAGKVISAEFIDENTFAAGCK  593



>dbj|GAM16879.1| hypothetical protein SAMD00019534_000540 [Acytostelium subglobosum 
LB1]
Length=633

 Score = 87.0 bits (214),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 41/95 (43%), Positives = 61/95 (64%), Gaps = 0/95 (0%)
 Frame = -1

Query  562  SECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVYLRFDSXEF  383
            S C++LKNMFDPA  T   ++ ++  DV  ECS YG + HIH+++NS GY+YLR+D  E 
Sbjct  526  STCMVLKNMFDPATETGENWETEIEKDVELECSNYGNIIHIHLERNSQGYIYLRYDKVES  585

Query  382  AXRAQXAMHKRWFARRSVSAIFLQPYXYDAKFKGA  278
            A  A   +++RWFA + ++A  +    Y A+F  A
Sbjct  586  AALAISKLNRRWFASKMLTAESIPEPTYLARFPNA  620



>ref|XP_004351712.1| putative RNA splicing factor [Dictyostelium fasciculatum]
 gb|EGG14992.1| putative RNA splicing factor [Dictyostelium fasciculatum]
Length=637

 Score = 86.3 bits (212),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 39/93 (42%), Positives = 61/93 (66%), Gaps = 0/93 (0%)
 Frame = -1

Query  565  PSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVYLRFDSXE  386
            PS C++LKNMFDP   T  E+  ++  DV EEC+ +G +KHI +D+ S GY+YL++D+ +
Sbjct  539  PSPCMVLKNMFDPDSETGDEWPQEIQKDVEEECTNFGNIKHIFLDRYSQGYIYLKYDNSD  598

Query  385  FAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKF  287
             A  A   +++RWF+ + +SA F+    Y  KF
Sbjct  599  MAALAISKLNRRWFSSKMLSAEFIPETIYYQKF  631



>ref|XP_005762142.1| hypothetical protein EMIHUDRAFT_124866, partial [Emiliania huxleyi 
CCMP1516]
 gb|EOD09713.1| hypothetical protein EMIHUDRAFT_124866, partial [Emiliania huxleyi 
CCMP1516]
Length=120

 Score = 80.5 bits (197),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 42/92 (46%), Positives = 58/92 (63%), Gaps = 3/92 (3%)
 Frame = -1

Query  565  PSECLLLKNMFDPAM---XTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVYLRFD  395
            PS  +LLKNMFDPA     +DP+F  DL +D+ EEC K+G V+   VD+ S G+V L+FD
Sbjct  23   PSPYVLLKNMFDPAGKDETSDPDFFGDLREDIMEECGKFGKVEAAKVDRASQGHVLLQFD  82

Query  394  SXEFAXRAQXAMHKRWFARRSVSAIFLQPYXY  299
            S   A +A  +MH RWFA + ++A F     +
Sbjct  83   STGSATKAASSMHSRWFAGKQITAEFTDEAAF  114



>ref|XP_002957532.1| hypothetical protein VOLCADRAFT_84128 [Volvox carteri f. nagariensis]
 gb|EFJ41426.1| hypothetical protein VOLCADRAFT_84128 [Volvox carteri f. nagariensis]
Length=386

 Score = 84.0 bits (206),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 49/97 (51%), Positives = 63/97 (65%), Gaps = 3/97 (3%)
 Frame = -1

Query  565  PSECLLLKNMFDPAMXTD---PEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVYLRFD  395
            P+ CLL+KNMFDPA   +    ++  ++  DV +ECSKYGAV HIHVDK+S G VYL+  
Sbjct  289  PTPCLLIKNMFDPAAAQEEMGQDWAEEIAQDVQDECSKYGAVVHIHVDKSSKGCVYLKCG  348

Query  394  SXEFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKFK  284
            S E A  AQ AM+ RWFA R ++  F     Y+A FK
Sbjct  349  SVEAASAAQAAMNGRWFAGRQLAVEFQFLAPYNAHFK  385



>ref|XP_007874255.1| hypothetical protein PNEG_02266 [Pneumocystis murina B123]
 gb|EMR09306.1| hypothetical protein PNEG_02266 [Pneumocystis murina B123]
Length=391

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 44/93 (47%), Positives = 59/93 (63%), Gaps = 1/93 (1%)
 Frame = -1

Query  562  SECLLLKNMFDPAMXTDPEFdldlxdDVXEEC-SKYGAVKHIHVDKNSAGYVYLRFDSXE  386
            S C+LLKNMF+P   +   +  +L +DV  EC +KYG V HIHV++NS G VY++FD+  
Sbjct  293  SRCVLLKNMFNPQEESGDNWVRELEEDVKAECENKYGKVLHIHVEENSPGEVYIKFDNVV  352

Query  385  FAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKF  287
               RA   ++ RWF  R+VSA FL    Y AKF
Sbjct  353  AGERAIQGLNGRWFGGRTVSASFLIDAVYTAKF  385



>ref|XP_007515160.1| predicted protein [Bathycoccus prasinos]
 emb|CCO14039.1| predicted protein [Bathycoccus prasinos]
Length=641

 Score = 84.3 bits (207),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 46/90 (51%), Positives = 61/90 (68%), Gaps = 3/90 (3%)
 Frame = -1

Query  565  PSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDK-NSAGYVYLRFDSX  389
            P++C+LLKN+FDPA  TD E+ LD+ +DV  E SKYG   H HVDK N  G+ YL+FD  
Sbjct  546  PTKCVLLKNLFDPAEETDEEWWLDIEEDVKGEVSKYGECVHAHVDKENPYGFCYLKFDDV  605

Query  388  EFAXRAQXAMHKRWFARRSVSA--IFLQPY  305
            E A +AQ  ++ RWFA RS+     F++PY
Sbjct  606  EAAKKAQFGLNNRWFAGRSIICDFQFVEPY  635



>gb|KFH68543.1| hypothetical protein MVEG_05356 [Mortierella verticillata NRRL 
6337]
Length=365

 Score = 82.4 bits (202),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 45/101 (45%), Positives = 62/101 (61%), Gaps = 0/101 (0%)
 Frame = -1

Query  577  PVGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVYLRF  398
            PV  PS  +LLKNMF     T+PE+  +L +DV EE  K GAV HIHV++ S G +YL+F
Sbjct  263  PVVMPSRSVLLKNMFTEEDKTEPEWAKELEEDVKEEAEKSGAVVHIHVEQESLGEIYLKF  322

Query  397  DSXEFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKFKGAA  275
            DS + A  A  ++  R+FA R + A +L    Y+ +F  AA
Sbjct  323  DSVQSATNAVQSLGGRFFAGRQIIAAYLPEMLYNVRFPRAA  363



>ref|XP_005784360.1| hypothetical protein EMIHUDRAFT_231170 [Emiliania huxleyi CCMP1516]
 gb|EOD31931.1| hypothetical protein EMIHUDRAFT_231170 [Emiliania huxleyi CCMP1516]
Length=281

 Score = 80.1 bits (196),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 42/86 (49%), Positives = 57/86 (66%), Gaps = 3/86 (3%)
 Frame = -1

Query  565  PSECLLLKNMFDPAM---XTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVYLRFD  395
            PS  +LLKNMFDPA     +DP+F  DL +D+ EEC K+G V+   VD+ S G+V L+FD
Sbjct  184  PSPYVLLKNMFDPAGKDETSDPDFFGDLREDIMEECGKFGKVEAAKVDRASQGHVLLQFD  243

Query  394  SXEFAXRAQXAMHKRWFARRSVSAIF  317
            S   A +A  +MH RWFA + ++A F
Sbjct  244  STGSATKAASSMHSRWFAGKQITAEF  269



>ref|XP_006454314.1| hypothetical protein AGABI2DRAFT_189584 [Agaricus bisporus var. 
bisporus H97]
 gb|EKV51332.1| hypothetical protein AGABI2DRAFT_189584 [Agaricus bisporus var. 
bisporus H97]
Length=563

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 45/98 (46%), Positives = 62/98 (63%), Gaps = 8/98 (8%)
 Frame = -1

Query  583  PEPVGNP-------SECLLLKNMFDPAMXTDPEFdldlxdDVXEEC-SKYGAVKHIHVDK  428
            PEPV  P       S  +LLKNMFDP   T+ ++D +L  DV  EC SKYG V  I V+K
Sbjct  457  PEPVQRPNIPQAMQSRSVLLKNMFDPDEETEKDWDRELAQDVKGECESKYGKVLAIKVEK  516

Query  427  NSAGYVYLRFDSXEFAXRAQXAMHKRWFARRSVSAIFL  314
            +S G +Y++FDS ++A +A   ++ RWF  R VSA+F+
Sbjct  517  DSQGEIYVKFDSIDYAQKAIQGLNGRWFGGRQVSAVFI  554



>ref|XP_007325678.1| hypothetical protein AGABI1DRAFT_110515 [Agaricus bisporus var. 
burnettii JB137-S8]
 gb|EKM83907.1| hypothetical protein AGABI1DRAFT_110515 [Agaricus bisporus var. 
burnettii JB137-S8]
Length=563

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 45/98 (46%), Positives = 62/98 (63%), Gaps = 8/98 (8%)
 Frame = -1

Query  583  PEPVGNP-------SECLLLKNMFDPAMXTDPEFdldlxdDVXEEC-SKYGAVKHIHVDK  428
            PEPV  P       S  +LLKNMFDP   T+ ++D +L  DV  EC SKYG V  I V+K
Sbjct  457  PEPVQRPNIPQAMQSRSVLLKNMFDPDEETEKDWDRELAQDVKGECESKYGKVLAIKVEK  516

Query  427  NSAGYVYLRFDSXEFAXRAQXAMHKRWFARRSVSAIFL  314
            +S G +Y++FDS ++A +A   ++ RWF  R VSA+F+
Sbjct  517  DSQGEIYVKFDSIDYAQKAIQGLNGRWFGGRQVSAVFI  554



>ref|XP_001869868.1| splicing factor [Culex quinquefasciatus]
 gb|EDS30585.1| splicing factor [Culex quinquefasciatus]
Length=524

 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 44/97 (45%), Positives = 64/97 (66%), Gaps = 1/97 (1%)
 Frame = -1

Query  562  SECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNS-AGYVYLRFDSXE  386
            ++C LL NMFDPA  T+P +D+++ DDV EEC+K+G V H++VDK S AG VY++  S  
Sbjct  416  TQCFLLSNMFDPATETNPSWDVEIEDDVIEECNKHGGVLHVYVDKQSPAGNVYVKCPSIA  475

Query  385  FAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKFKGAA  275
             A  A  A+H RWFA R ++A ++    Y   F+ +A
Sbjct  476  TAVLAVNALHGRWFAGRVIAAAYVPLVNYHTLFQESA  512



>gb|KFB39087.1| AGAP008433-PA-like protein [Anopheles sinensis]
Length=586

 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 45/97 (46%), Positives = 63/97 (65%), Gaps = 1/97 (1%)
 Frame = -1

Query  562  SECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNS-AGYVYLRFDSXE  386
            ++C LL NMFDPA  T+P +D+++ DDV EEC+K+G V+H++VDK S AG VY++  S  
Sbjct  478  TQCFLLSNMFDPATETNPSWDVEIQDDVIEECNKHGGVQHVYVDKQSPAGNVYVKCPSIA  537

Query  385  FAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKFKGAA  275
             A  A  A+H RWFA R + A ++    Y   F  AA
Sbjct  538  TAVLAVNALHGRWFAGRVIGAAYVPLVNYYNLFPDAA  574



>ref|XP_003283761.1| hypothetical protein DICPUDRAFT_74732 [Dictyostelium purpureum]
 gb|EGC39775.1| hypothetical protein DICPUDRAFT_74732 [Dictyostelium purpureum]
Length=630

 Score = 81.3 bits (199),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 36/95 (38%), Positives = 60/95 (63%), Gaps = 0/95 (0%)
 Frame = -1

Query  571  GNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVYLRFDS  392
            G  S CL+L+NMFDP   T+ ++D D+  +   ECS++G ++HI++DKN+ G +Y+R+D+
Sbjct  534  GFSSTCLILRNMFDPDTETEEDWDQDITTETHSECSQFGKIQHIYLDKNTKGCIYIRYDN  593

Query  391  XEFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKF  287
             E   +A   +H RWF++  + A  +    Y  KF
Sbjct  594  PESPLKAIQKLHGRWFSKNEIIAELVPEPVYKLKF  628



>ref|XP_001865056.1| splicing factor [Culex quinquefasciatus]
 gb|EDS41115.1| splicing factor [Culex quinquefasciatus]
Length=546

 Score = 80.9 bits (198),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 44/97 (45%), Positives = 64/97 (66%), Gaps = 1/97 (1%)
 Frame = -1

Query  562  SECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNS-AGYVYLRFDSXE  386
            ++C LL NMFDPA  T+P +D+++ DDV EEC+K+G V H++VDK S AG VY++  S  
Sbjct  438  TQCFLLSNMFDPATETNPSWDVEIEDDVIEECNKHGGVLHVYVDKQSPAGNVYVKCPSIA  497

Query  385  FAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKFKGAA  275
             A  A  A+H RWFA R ++A ++    Y   F+ +A
Sbjct  498  TAVLAVNALHGRWFAGRVIAAAYVPLVNYHTLFQESA  534



>ref|XP_002018768.1| GL25979 [Drosophila persimilis]
 gb|EDW36964.1| GL25979 [Drosophila persimilis]
Length=289

 Score = 78.6 bits (192),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 43/100 (43%), Positives = 62/100 (62%), Gaps = 1/100 (1%)
 Frame = -1

Query  562  SECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNS-AGYVYLRFDSXE  386
            ++C +L NMFDP   T+P +D+++ DDV EEC+K+G V HIHVD  S  G VY++  S  
Sbjct  177  TQCFILSNMFDPRTETNPTWDVEIRDDVLEECAKHGGVLHIHVDTASPTGTVYVKCPSTT  236

Query  385  FAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKFKGAA*TS  266
             A  A  A+H RWFA R ++A ++    Y + F  +  TS
Sbjct  237  TAVLAVNALHGRWFAGRVITAAYVPVVNYHSMFPDSVGTS  276



>ref|XP_002503985.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO65243.1| predicted protein [Micromonas sp. RCC299]
Length=809

 Score = 80.9 bits (198),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 41/96 (43%), Positives = 60/96 (63%), Gaps = 4/96 (4%)
 Frame = -1

Query  565  PSECLLLKNMFDPAMXTDP----EFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVYLRF  398
            P+ CL LKNMFDPA   D      + +D+ ++V EEC+K+GAV H+ VD++S G+V+++F
Sbjct  710  PTRCLTLKNMFDPAQIGDGGEGDAWWVDIGEEVREECAKHGAVTHLAVDRHSQGFVFVKF  769

Query  397  DSXEFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAK  290
             + E A  A+  +H RWF  R V+  F     YD K
Sbjct  770  ATPEAATGARSTLHARWFGGRLVTCEFTAEDEYDVK  805



>gb|KDR08287.1| RNA-binding protein 39, partial [Zootermopsis nevadensis]
Length=361

 Score = 79.0 bits (193),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 42/96 (44%), Positives = 63/96 (66%), Gaps = 1/96 (1%)
 Frame = -1

Query  562  SECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNS-AGYVYLRFDSXE  386
            ++C +L NMFDPAM T+P +D+++ DDV EEC+K+G V H++VDK S  G VY++  S  
Sbjct  250  TQCFMLANMFDPAMETNPTWDVEIRDDVIEECNKHGGVLHVYVDKASPQGNVYVKCPSIA  309

Query  385  FAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKFKGA  278
             A  A  ++H RWFA R ++A ++    Y + F  A
Sbjct  310  TAVAAVNSLHGRWFAGRVITAAYVPLINYHSLFPDA  345



>gb|KJB14937.1| hypothetical protein B456_002G149800 [Gossypium raimondii]
Length=569

 Score = 80.1 bits (196),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 39/51 (76%), Positives = 45/51 (88%), Gaps = 0/51 (0%)
 Frame = -1

Query  580  EPVGNPSECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDK  428
            EP+G PSECLLLKNMFDPA  T+P+FDLD+ +DV EECSKYG VKHI+VDK
Sbjct  519  EPIGQPSECLLLKNMFDPATETEPDFDLDIKEDVEEECSKYGRVKHIYVDK  569



>ref|XP_002108274.1| hypothetical protein TRIADDRAFT_37071 [Trichoplax adhaerens]
 gb|EDV29072.1| hypothetical protein TRIADDRAFT_37071 [Trichoplax adhaerens]
Length=351

 Score = 78.6 bits (192),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 44/97 (45%), Positives = 62/97 (64%), Gaps = 1/97 (1%)
 Frame = -1

Query  562  SECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDKNS-AGYVYLRFDSXE  386
            S C L+ NMFDPA  TD ++DLD+ DD+ EEC+K+G V H++VDK S  G VY++  + +
Sbjct  244  SPCFLISNMFDPAKETDQDWDLDIRDDIIEECNKHGNVYHVYVDKTSPKGIVYVKCQTID  303

Query  385  FAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKFKGAA  275
             A RA  +++ RWFA   ++A FL    Y   F  AA
Sbjct  304  VAARAVKSLNGRWFAGNMITAQFLSLASYHTTFPQAA  340



>ref|XP_003054955.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH60207.1| predicted protein [Micromonas pusilla CCMP1545]
Length=811

 Score = 80.5 bits (197),  Expect = 8e-14, Method: Composition-based stats.
 Identities = 42/95 (44%), Positives = 58/95 (61%), Gaps = 1/95 (1%)
 Frame = -1

Query  565  PSECLLLKNMFDPAMXT-DPEFdldlxdDVXEECSKYGAVKHIHVDKNSAGYVYLRFDSX  389
            PS C+ LKNMFDPA  + D     ++ +DV  EC  +G V H  VDKNS G+VY++FD+ 
Sbjct  714  PSTCVNLKNMFDPAHASRDASVVSEVHEDVRLECGNHGVVTHSAVDKNSQGFVYVKFDTV  773

Query  388  EFAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKFK  284
            + A  A+  ++ RWFA R V+  F+    YDA  K
Sbjct  774  QAATEARRTLNARWFAGRLVTCDFIAEDEYDAVVK  808



>ref|XP_001650224.1| AAEL005046-PA [Aedes aegypti]
 gb|EAT43555.1| AAEL005046-PA [Aedes aegypti]
Length=544

 Score = 80.1 bits (196),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 43/97 (44%), Positives = 61/97 (63%), Gaps = 1/97 (1%)
 Frame = -1

Query  562  SECLLLKNMFDPAMXTDPEFdldlxdDVXEECSKYGAVKHIHVDK-NSAGYVYLRFDSXE  386
            ++C LL NMFDP   T+P +D ++ DDV EEC+K+G V H++VDK N AG VY++  S  
Sbjct  436  TQCFLLSNMFDPTTETNPTWDTEIEDDVIEECNKHGGVLHVYVDKENPAGNVYVKCPSIA  495

Query  385  FAXRAQXAMHKRWFARRSVSAIFLQPYXYDAKFKGAA  275
             A  A  A+H RWFA R ++A ++    Y   F  +A
Sbjct  496  TAVLAVNALHGRWFAGRIITAAYVPLVNYHTLFPDSA  532



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1001432574250