BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF008G19

Length=700
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011029902.1|  PREDICTED: uncharacterized protein LOC105129478  66.6    1e-09   Populus euphratica
ref|XP_002312099.2|  hypothetical protein POPTR_0008s05620g           65.9    2e-09   Populus trichocarpa [western balsam poplar]
emb|CBI31683.3|  unnamed protein product                              62.0    4e-08   Vitis vinifera
ref|XP_002283687.1|  PREDICTED: uncharacterized protein LOC100251328  62.0    5e-08   Vitis vinifera
gb|KHG26784.1|  Cruciferin BnC2                                       60.8    1e-07   Gossypium arboreum [tree cotton]
ref|XP_011091522.1|  PREDICTED: uncharacterized protein LOC105171942  59.3    4e-07   Sesamum indicum [beniseed]
gb|KDO69311.1|  hypothetical protein CISIN_1g021888mg                 58.9    5e-07   Citrus sinensis [apfelsine]
ref|XP_006435534.1|  hypothetical protein CICLE_v10032209mg           58.9    6e-07   Citrus clementina [clementine]
ref|XP_010264758.1|  PREDICTED: uncharacterized protein LOC104602674  57.8    2e-06   Nelumbo nucifera [Indian lotus]
gb|KJB76091.1|  hypothetical protein B456_012G070400                  57.0    3e-06   Gossypium raimondii
gb|KDP44956.1|  hypothetical protein JCGZ_01456                       56.2    4e-06   Jatropha curcas
ref|XP_002530865.1|  conserved hypothetical protein                   55.5    9e-06   Ricinus communis
ref|XP_010111132.1|  hypothetical protein L484_010745                 54.3    2e-05   Morus notabilis
ref|XP_007218741.1|  hypothetical protein PRUPE_ppa009184mg           54.3    2e-05   Prunus persica
ref|XP_008233625.1|  PREDICTED: uncharacterized protein LOC103332654  54.3    2e-05   Prunus mume [ume]
ref|XP_008371702.1|  PREDICTED: uncharacterized protein LOC103435083  54.3    2e-05   Malus domestica [apple tree]
ref|XP_010256928.1|  PREDICTED: uncharacterized protein LOC104597192  53.9    3e-05   Nelumbo nucifera [Indian lotus]
emb|CDP00094.1|  unnamed protein product                              52.8    7e-05   Coffea canephora [robusta coffee]
ref|XP_009345484.1|  PREDICTED: uncharacterized protein LOC103937278  52.4    1e-04   
ref|XP_008370628.1|  PREDICTED: uncharacterized protein LOC103434094  52.4    1e-04   
ref|XP_007009334.1|  Uncharacterized protein isoform 2                51.2    2e-04   
ref|XP_008458875.1|  PREDICTED: uncharacterized protein LOC103498149  51.2    3e-04   Cucumis melo [Oriental melon]
ref|XP_007009333.1|  Uncharacterized protein isoform 1                51.2    3e-04   
ref|XP_011027197.1|  PREDICTED: uncharacterized protein LOC105127551  49.7    8e-04   Populus euphratica
gb|KHG30352.1|  putative yyaP                                         49.7    9e-04   Gossypium arboreum [tree cotton]
gb|KJB73924.1|  hypothetical protein B456_011G261400                  49.7    0.001   Gossypium raimondii



>ref|XP_011029902.1| PREDICTED: uncharacterized protein LOC105129478 [Populus euphratica]
Length=305

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = -3

Query  698  YQRKFNPDNPNMIRSFASHHIQCVPHLKRLQSTLQPNTEVERILRPVNSD  549
            YQRKF+PDN N     +S+H QC  HLKRLQS+LQ  TE ER+++P+NSD
Sbjct  238  YQRKFDPDNQNFSSVDSSYHKQCGRHLKRLQSSLQFETEGERLMKPINSD  287



>ref|XP_002312099.2| hypothetical protein POPTR_0008s05620g [Populus trichocarpa]
 gb|EEE89466.2| hypothetical protein POPTR_0008s05620g [Populus trichocarpa]
Length=306

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = -3

Query  698  YQRKFNPDNPNMIRSFASHHIQCVPHLKRLQSTLQPNTEVERILRPVNSD  549
            YQR+F PDN N     +S+H QC  HLKRLQS+LQ  TE ER+++P+NSD
Sbjct  239  YQRQFGPDNQNFSSVDSSYHKQCGGHLKRLQSSLQFETEGERLMKPINSD  288



>emb|CBI31683.3| unnamed protein product [Vitis vinifera]
Length=272

 Score = 62.0 bits (149),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = -3

Query  698  YQRKFNPDNPNMIRSFASHHIQCVPHLKRLQSTLQPNTEVERILRPVNSD  549
            YQR+FNPD  ++    +S H QC  HLKRLQ  LQ   E ER+L+P+NSD
Sbjct  205  YQRQFNPDGESIKNGISSDHKQCSEHLKRLQHALQLEVEAERLLKPINSD  254



>ref|XP_002283687.1| PREDICTED: uncharacterized protein LOC100251328 [Vitis vinifera]
Length=307

 Score = 62.0 bits (149),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = -3

Query  698  YQRKFNPDNPNMIRSFASHHIQCVPHLKRLQSTLQPNTEVERILRPVNSD  549
            YQR+FNPD  ++    +S H QC  HLKRLQ  LQ   E ER+L+P+NSD
Sbjct  240  YQRQFNPDGESIKNGISSDHKQCSEHLKRLQHALQLEVEAERLLKPINSD  289



>gb|KHG26784.1| Cruciferin BnC2 [Gossypium arboreum]
Length=307

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/67 (54%), Positives = 42/67 (63%), Gaps = 0/67 (0%)
 Frame = -3

Query  698  YQRKFNPDNPNMIRSFASHHIQCVPHLKRLQSTLQPNTEVERILRPVNSDrprlnlgrrr  519
            YQRKF PD  N+  +  S H QC  HL+RLQS+LQ   E ER+L+PVN D  R     RR
Sbjct  241  YQRKFTPDEHNISGNILSAHKQCNGHLRRLQSSLQSELEAERLLKPVNVDCNRRLKLDRR  300

Query  518  rPSFLAL  498
            R SF AL
Sbjct  301  RQSFKAL  307



>ref|XP_011091522.1| PREDICTED: uncharacterized protein LOC105171942 [Sesamum indicum]
Length=302

 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = -3

Query  698  YQRKFNPDNPNMIRSFASHHIQCVPHLKRLQSTLQPNTEVERILRPVNSD  549
            YQRKF+PD P+   +F+  H +C  HLKRL S+L    EVER L+P N D
Sbjct  239  YQRKFDPDEPSYNTTFSVEHKKCAGHLKRLHSSLLSEIEVERTLKPFNRD  288



>gb|KDO69311.1| hypothetical protein CISIN_1g021888mg [Citrus sinensis]
Length=306

 Score = 58.9 bits (141),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = -3

Query  698  YQRKFNPDNPNMIRSFASHHIQCVPHLKRLQSTLQPNTEVERILRPVNSD  549
            +QR FNPD  N+  +++  H QC  HLKRLQS+L    E ER L P+NSD
Sbjct  239  HQRDFNPDEQNITTTYSLDHKQCRGHLKRLQSSLHSEVEAERFLNPINSD  288



>ref|XP_006435534.1| hypothetical protein CICLE_v10032209mg [Citrus clementina]
 ref|XP_006486486.1| PREDICTED: uncharacterized protein LOC102627296 [Citrus sinensis]
 gb|ESR48774.1| hypothetical protein CICLE_v10032209mg [Citrus clementina]
Length=306

 Score = 58.9 bits (141),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = -3

Query  698  YQRKFNPDNPNMIRSFASHHIQCVPHLKRLQSTLQPNTEVERILRPVNSD  549
            +QR FNPD  N+  +++  H QC  HLKRLQS+L    E ER L P+NSD
Sbjct  239  HQRDFNPDEQNITTTYSLDHKQCRGHLKRLQSSLHSEVEAERFLNPINSD  288



>ref|XP_010264758.1| PREDICTED: uncharacterized protein LOC104602674, partial [Nelumbo 
nucifera]
Length=368

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = -3

Query  698  YQRKFNPDNPNMIRSFASHHIQCVPHLKRLQSTLQPNTEVERILRPVNSD  549
            YQRK NPD   +     S H QC+ HL+RL+S+LQ   E ER+L+P+N+D
Sbjct  302  YQRKLNPDEQGIHDRSYSDHKQCIGHLRRLKSSLQSEIEAERLLKPINND  351



>gb|KJB76091.1| hypothetical protein B456_012G070400 [Gossypium raimondii]
Length=307

 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 34/67 (51%), Positives = 43/67 (64%), Gaps = 0/67 (0%)
 Frame = -3

Query  698  YQRKFNPDNPNMIRSFASHHIQCVPHLKRLQSTLQPNTEVERILRPVNSDrprlnlgrrr  519
            YQRKF+PD  ++  +  S H QC  +L+RLQS+LQ   E ER+L+PVN D  R     RR
Sbjct  241  YQRKFSPDEHDISGNILSAHKQCNGNLRRLQSSLQSELEAERLLKPVNVDCNRRLKLDRR  300

Query  518  rPSFLAL  498
            R SF AL
Sbjct  301  RQSFKAL  307



>gb|KDP44956.1| hypothetical protein JCGZ_01456 [Jatropha curcas]
Length=305

 Score = 56.2 bits (134),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 32/65 (49%), Positives = 39/65 (60%), Gaps = 0/65 (0%)
 Frame = -3

Query  698  YQRKFNPDNPNMIRSFASHHIQCVPHLKRLQSTLQPNTEVERILRPVNSDrprlnlgrrr  519
            YQR   PD  N     +S H QC  HLKRLQS+LQ   E ER+L+P+N+D     +  RR
Sbjct  238  YQRHLTPDEQNFGSFNSSDHKQCSGHLKRLQSSLQSEMEEERLLKPMNTDSNWRVMRERR  297

Query  518  rPSFL  504
            R SFL
Sbjct  298  RHSFL  302



>ref|XP_002530865.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF31539.1| conserved hypothetical protein [Ricinus communis]
Length=307

 Score = 55.5 bits (132),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = -3

Query  698  YQRKFNPDNPNMIRSFASHHIQCVPHLKRLQSTLQPNTEVERILRPVNSD  549
            YQR  +PD  +     +S H QC  HLKRLQS+LQ   E ER+L+P+N+D
Sbjct  240  YQRHLSPDEQDFSSINSSDHKQCCEHLKRLQSSLQSEMEEERLLKPINTD  289



>ref|XP_010111132.1| hypothetical protein L484_010745 [Morus notabilis]
 gb|EXC30497.1| hypothetical protein L484_010745 [Morus notabilis]
Length=304

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = -3

Query  698  YQRKFNPDNPNMIRSFASHHIQCVPHLKRLQSTLQPNTEVERILRPVNSD  549
            YQR+  PD   M R+ +  H QC  HLKRLQS LQ   E ER+L+P+ S+
Sbjct  236  YQRQLYPDEKGMNRANSFDHKQCNGHLKRLQSLLQAEIETERLLKPIKSE  285



>ref|XP_007218741.1| hypothetical protein PRUPE_ppa009184mg [Prunus persica]
 gb|EMJ19940.1| hypothetical protein PRUPE_ppa009184mg [Prunus persica]
Length=303

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = -3

Query  698  YQRKFNPDNPNMIRSFASHHIQCVPHLKRLQSTLQPNTEVERILRPVNSD  549
            YQR+FN D  N   +++S H QC   LK LQS LQ   E +R+L+P+N+D
Sbjct  236  YQREFNLDEENANGAYSSDHKQCSGQLKMLQSLLQSEIEADRMLKPINND  285



>ref|XP_008233625.1| PREDICTED: uncharacterized protein LOC103332654 [Prunus mume]
Length=303

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = -3

Query  698  YQRKFNPDNPNMIRSFASHHIQCVPHLKRLQSTLQPNTEVERILRPVNSD  549
            YQR+FN D  N   +++S H QC   LK LQS LQ   E +R+L+P+N+D
Sbjct  236  YQREFNLDEENANGAYSSDHKQCSGQLKMLQSLLQSEIEADRMLKPINND  285



>ref|XP_008371702.1| PREDICTED: uncharacterized protein LOC103435083 [Malus domestica]
Length=304

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = -3

Query  698  YQRKFNPDNPNMIRSFASHHIQCVPHLKRLQSTLQPNTEVERILRPVNSD  549
            YQR+FN +  N+  S+   H +C  HLK LQS LQ   E ER+LRP+N+D
Sbjct  237  YQRQFNLEEQNVNGSYNFDHKKCSAHLKMLQSLLQSEIEAERLLRPINND  286



>ref|XP_010256928.1| PREDICTED: uncharacterized protein LOC104597192 [Nelumbo nucifera]
Length=338

 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 42/69 (61%), Gaps = 2/69 (3%)
 Frame = -3

Query  698  YQRKFNPDNPNMIR--SFASHHIQCVPHLKRLQSTLQPNTEVERILRPVNSDrprlnlgr  525
            YQRK NPD  ++    +  S H QC+ HLKRLQS++Q   E ER+L+P ++D  R     
Sbjct  270  YQRKLNPDERSIPEPETCCSDHKQCMGHLKRLQSSIQSEIEAERLLKPKSNDHQRRWKLE  329

Query  524  rrrPSFLAL  498
            R R SF AL
Sbjct  330  RWRQSFRAL  338



>emb|CDP00094.1| unnamed protein product [Coffea canephora]
Length=271

 Score = 52.8 bits (125),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 33/50 (66%), Gaps = 4/50 (8%)
 Frame = -3

Query  698  YQRKFNPDNPNMIRSFASHHIQCVPHLKRLQSTLQPNTEVERILRPVNSD  549
            YQRKF+P+ PN     +  H QC  HL+RLQS L    E+ER+L+PV S+
Sbjct  208  YQRKFSPEEPNAYGGSSMEHKQCGGHLRRLQSEL----EIERLLKPVKSN  253



>ref|XP_009345484.1| PREDICTED: uncharacterized protein LOC103937278 [Pyrus x bretschneideri]
Length=279

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = -3

Query  698  YQRKFNPDNPNMIRSFASHHIQCVPHLKRLQSTLQPNTEVERILRPVNSD  549
            YQR+FN D  N+  S+   H QC  HLK LQS LQ   E +R+L+ +N+D
Sbjct  212  YQRQFNIDEQNVNGSYNFDHKQCSAHLKMLQSLLQSEIEADRLLKQINND  261



>ref|XP_008370628.1| PREDICTED: uncharacterized protein LOC103434094 [Malus domestica]
Length=304

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = -3

Query  698  YQRKFNPDNPNMIRSFASHHIQCVPHLKRLQSTLQPNTEVERILRPVNSD  549
            YQR+FN D  N+  S+   H QC  HLK LQS LQ   E +R+L+ +N+D
Sbjct  237  YQRQFNIDEQNVNGSYNFDHKQCSAHLKMLQSLLQSEIEADRLLKQINND  286



>ref|XP_007009334.1| Uncharacterized protein isoform 2 [Theobroma cacao]
 gb|EOY18144.1| Uncharacterized protein isoform 2 [Theobroma cacao]
Length=253

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = -3

Query  698  YQRKFNPDNPNMIRSFASHHIQCVPHLKRLQSTLQPNTEVERILRPVNSD  549
            YQR+F P   ++  + +S H QC  HLK LQ++LQ   E ER+L+P+N D
Sbjct  186  YQRQFTPYEHDINGNVSSDHKQCNGHLKGLQASLQSELEAERLLKPINID  235



>ref|XP_008458875.1| PREDICTED: uncharacterized protein LOC103498149 [Cucumis melo]
Length=311

 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 31/51 (61%), Gaps = 2/51 (4%)
 Frame = -3

Query  695  QRKFNPDNPNMI--RSFASHHIQCVPHLKRLQSTLQPNTEVERILRPVNSD  549
            QR  +P+    +  +     H QC+ HLKRLQS LQ  TE +R LRPVNSD
Sbjct  243  QRMLHPEEQQQLGAKDMLMSHKQCIGHLKRLQSVLQSETETDRFLRPVNSD  293



>ref|XP_007009333.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOY18143.1| Uncharacterized protein isoform 1 [Theobroma cacao]
Length=316

 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = -3

Query  698  YQRKFNPDNPNMIRSFASHHIQCVPHLKRLQSTLQPNTEVERILRPVNSD  549
            YQR+F P   ++  + +S H QC  HLK LQ++LQ   E ER+L+P+N D
Sbjct  249  YQRQFTPYEHDINGNVSSDHKQCNGHLKGLQASLQSELEAERLLKPINID  298



>ref|XP_011027197.1| PREDICTED: uncharacterized protein LOC105127551 [Populus euphratica]
Length=306

 Score = 49.7 bits (117),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 30/50 (60%), Gaps = 0/50 (0%)
 Frame = -3

Query  698  YQRKFNPDNPNMIRSFASHHIQCVPHLKRLQSTLQPNTEVERILRPVNSD  549
            YQR+F+P   N     +S H QC  HLK L S+LQ   E ER ++P+ SD
Sbjct  239  YQRQFDPGEQNFSSGDSSDHKQCSGHLKSLPSSLQFEMEGERFVKPIKSD  288



>gb|KHG30352.1| putative yyaP [Gossypium arboreum]
Length=310

 Score = 49.7 bits (117),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = -3

Query  698  YQRKFNPDNPNMIRSFASHHIQCVPHLKRLQSTLQPNTEVERILRPVNSD  549
            YQR+F P   ++    +S H QC  HL+RLQ +LQ   E ER+L+P+N D
Sbjct  243  YQRQFAPLEHDISSDSSSCHKQCKGHLRRLQPSLQSELEAERLLKPINID  292



>gb|KJB73924.1| hypothetical protein B456_011G261400 [Gossypium raimondii]
Length=310

 Score = 49.7 bits (117),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = -3

Query  698  YQRKFNPDNPNMIRSFASHHIQCVPHLKRLQSTLQPNTEVERILRPVNSD  549
            YQR+F P   ++  + +S H QC  HL+RLQ +LQ   E ER+L+P+N D
Sbjct  243  YQRQFAPLEHDISGNSSSCHKQCKGHLRRLQPSLQSELEAERLLKPINID  292



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1179751321320