BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF008G08

Length=667
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP02232.1|  unnamed protein product                                113   8e-26   Coffea canephora [robusta coffee]
ref|XP_010655937.1|  PREDICTED: zinc-finger homeodomain protein 1...    109   1e-25   Vitis vinifera
emb|CBI22215.3|  unnamed protein product                                110   1e-25   Vitis vinifera
ref|XP_002283533.1|  PREDICTED: zinc-finger homeodomain protein 9       112   2e-25   Vitis vinifera
gb|KJB75739.1|  hypothetical protein B456_012G054300                    110   4e-25   Gossypium raimondii
ref|XP_004233363.1|  PREDICTED: zinc-finger homeodomain protein 9...    109   1e-24   
ref|XP_004148695.1|  PREDICTED: transcription factor HB29-like          109   1e-24   
gb|KJB33553.1|  hypothetical protein B456_006G017200                    108   2e-24   Gossypium raimondii
ref|XP_004168480.1|  PREDICTED: transcription factor HB29-like          108   2e-24   
gb|ABY61030.1|  zinc finger-homeodomain protein 1                       108   2e-24   Cucumis sativus [cucumbers]
ref|XP_008443414.1|  PREDICTED: zinc-finger homeodomain protein 9...    108   2e-24   Cucumis melo [Oriental melon]
ref|XP_004147471.1|  PREDICTED: transcription factor HB29-like          107   3e-24   Cucumis sativus [cucumbers]
gb|KHN13618.1|  ZF-HD homeobox protein                                  105   3e-24   Glycine soja [wild soybean]
ref|XP_010257380.1|  PREDICTED: zinc-finger homeodomain protein 9       107   3e-24   Nelumbo nucifera [Indian lotus]
ref|XP_003543789.1|  PREDICTED: transcription factor HB29-like          107   4e-24   Glycine max [soybeans]
ref|XP_011085755.1|  PREDICTED: zinc-finger homeodomain protein 9       107   5e-24   Sesamum indicum [beniseed]
ref|XP_010693250.1|  PREDICTED: zinc-finger homeodomain protein 9...    108   5e-24   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010258352.1|  PREDICTED: zinc-finger homeodomain protein 9...    107   6e-24   Nelumbo nucifera [Indian lotus]
ref|XP_008341574.1|  PREDICTED: zinc-finger homeodomain protein 1...    107   6e-24   
emb|CBI29005.3|  unnamed protein product                                109   7e-24   Vitis vinifera
ref|XP_011098625.1|  PREDICTED: zinc-finger homeodomain protein 9...    107   7e-24   Sesamum indicum [beniseed]
ref|XP_008467057.1|  PREDICTED: zinc-finger homeodomain protein 1...    107   7e-24   Cucumis melo [Oriental melon]
ref|XP_008379353.1|  PREDICTED: zinc-finger homeodomain protein 9...    107   8e-24   Malus domestica [apple tree]
ref|XP_009376317.1|  PREDICTED: zinc-finger homeodomain protein 9       107   9e-24   Pyrus x bretschneideri [bai li]
ref|XP_002534012.1|  conserved hypothetical protein                     106   1e-23   Ricinus communis
ref|XP_004304301.1|  PREDICTED: zinc-finger homeodomain protein 9       106   1e-23   Fragaria vesca subsp. vesca
ref|XP_009787877.1|  PREDICTED: zinc-finger homeodomain protein 9...    106   1e-23   Nicotiana sylvestris
ref|XP_006602909.1|  PREDICTED: transcription factor HB29-like          106   2e-23   Glycine max [soybeans]
ref|XP_002324056.2|  hypothetical protein POPTR_0017s11920g             106   2e-23   
ref|XP_009620291.1|  PREDICTED: zinc-finger homeodomain protein 9...    106   2e-23   Nicotiana tomentosiformis
ref|XP_006363398.1|  PREDICTED: transcription factor HB29-like          105   2e-23   Solanum tuberosum [potatoes]
ref|XP_007151228.1|  hypothetical protein PHAVU_004G028600g             105   2e-23   Phaseolus vulgaris [French bean]
ref|XP_006357697.1|  PREDICTED: transcription factor HB29-like          105   3e-23   Solanum tuberosum [potatoes]
emb|CDX85230.1|  BnaC07g25410D                                          105   3e-23   
ref|XP_007139577.1|  hypothetical protein PHAVU_008G041300g             105   4e-23   Phaseolus vulgaris [French bean]
ref|XP_009621030.1|  PREDICTED: zinc-finger homeodomain protein 9...    104   6e-23   Nicotiana tomentosiformis
ref|XP_003618493.1|  Zinc finger-homeodomain protein                    102   7e-23   
ref|XP_011010066.1|  PREDICTED: zinc-finger homeodomain protein 9...    104   8e-23   Populus euphratica
ref|XP_010088163.1|  hypothetical protein L484_013608                   102   8e-23   
emb|CDX86403.1|  BnaA06g31200D                                          104   9e-23   
ref|XP_003621193.1|  ZF-HD homeobox protein                             103   1e-22   Medicago truncatula
ref|XP_008230766.1|  PREDICTED: zinc-finger homeodomain protein 9...    103   2e-22   Prunus mume [ume]
ref|XP_006395326.1|  hypothetical protein EUTSA_v10004599mg             102   2e-22   Eutrema salsugineum [saltwater cress]
gb|KDP27147.1|  hypothetical protein JCGZ_19846                       99.4    3e-22   Jatropha curcas
ref|XP_004489395.1|  PREDICTED: transcription factor HB29-like          102   3e-22   Cicer arietinum [garbanzo]
gb|AES74711.2|  transcription factor HB29-like protein                  102   3e-22   Medicago truncatula
ref|XP_009151829.1|  PREDICTED: zinc-finger homeodomain protein 9       102   3e-22   Brassica rapa
ref|XP_011097503.1|  PREDICTED: zinc-finger homeodomain protein 2...    101   4e-22   
ref|XP_011070997.1|  PREDICTED: zinc-finger homeodomain protein 10      102   4e-22   Sesamum indicum [beniseed]
gb|AAP44422.1|  ZF-HD homeobox protein-like protein                   98.6    4e-22   Lactuca sativa [cultivated lettuce]
ref|XP_009797863.1|  PREDICTED: zinc-finger homeodomain protein 9...    102   4e-22   Nicotiana sylvestris
ref|XP_006482594.1|  PREDICTED: myb-like protein I-like                 102   4e-22   Citrus sinensis [apfelsine]
dbj|BAE99230.1|  hypothetical protein                                   102   5e-22   Arabidopsis thaliana [mouse-ear cress]
gb|EPS61017.1|  hypothetical protein M569_13783                         100   5e-22   Genlisea aurea
gb|AAP44426.1|  ZF-HD homeobox protein-like protein                   98.2    5e-22   Lactuca saligna
ref|NP_568570.1|  homeobox protein 23                                   102   5e-22   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008220812.1|  PREDICTED: zinc-finger homeodomain protein 5...    102   5e-22   Prunus mume [ume]
ref|XP_008220815.1|  PREDICTED: zinc-finger homeodomain protein 5...    102   6e-22   Prunus mume [ume]
ref|XP_002870762.1|  hypothetical protein ARALYDRAFT_494014             101   6e-22   
gb|AAO62943.1|  ZF-HD homeobox protein-like protein                   97.8    6e-22   Lactuca sativa [cultivated lettuce]
gb|AAM64462.1|  unknown                                                 101   7e-22   Arabidopsis thaliana [mouse-ear cress]
gb|EPS58358.1|  hypothetical protein M569_16456                       99.4    7e-22   Genlisea aurea
ref|XP_011100018.1|  PREDICTED: zinc-finger homeodomain protein 1...  99.8    7e-22   Sesamum indicum [beniseed]
ref|XP_006431147.1|  hypothetical protein CICLE_v10011968mg             101   8e-22   Citrus clementina [clementine]
ref|XP_009111615.1|  PREDICTED: zinc-finger homeodomain protein 9...    101   9e-22   Brassica rapa
ref|XP_002273802.1|  PREDICTED: zinc-finger homeodomain protein 11      101   9e-22   Vitis vinifera
emb|CDY20008.1|  BnaA09g02430D                                          100   9e-22   Brassica napus [oilseed rape]
ref|XP_006405598.1|  hypothetical protein EUTSA_v10028098mg             100   1e-21   Eutrema salsugineum [saltwater cress]
gb|EPS70696.1|  hypothetical protein M569_04063                       99.8    1e-21   Genlisea aurea
ref|XP_007157626.1|  hypothetical protein PHAVU_002G085400g             100   1e-21   Phaseolus vulgaris [French bean]
gb|KHN05023.1|  ZF-HD homeobox protein                                98.6    1e-21   Glycine soja [wild soybean]
ref|XP_010936702.1|  PREDICTED: zinc-finger homeodomain protein 6...    100   1e-21   Elaeis guineensis
ref|XP_003555538.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...  98.6    1e-21   Glycine max [soybeans]
ref|XP_004238801.1|  PREDICTED: zinc-finger homeodomain protein 1...    100   1e-21   Solanum lycopersicum
emb|CAC34413.1|  ZF-HD homeobox protein                               99.8    2e-21   Flaveria trinervia
gb|ABK22835.1|  unknown                                               99.8    2e-21   Picea sitchensis
emb|CDY00104.1|  BnaC09g01970D                                          100   2e-21   
ref|XP_002305381.2|  hypothetical protein POPTR_0004s12500g             100   2e-21   
gb|AAT39967.1|  Putative ZF-HD homeobox protein, identical            99.8    2e-21   Solanum demissum
ref|XP_009788342.1|  PREDICTED: zinc-finger homeodomain protein 9...  99.4    3e-21   Nicotiana sylvestris
ref|XP_006366102.1|  PREDICTED: transcription factor HB29-like        99.4    3e-21   Solanum tuberosum [potatoes]
ref|XP_004233362.1|  PREDICTED: zinc-finger homeodomain protein 9     99.8    3e-21   Solanum lycopersicum
gb|EPS73952.1|  hypothetical protein M569_00810                       97.8    3e-21   Genlisea aurea
gb|ABO92969.1|  ZF-HD homeobox domain-containing protein              99.4    3e-21   Solanum tuberosum [potatoes]
emb|CAC34408.1|  ZF-HD homeobox protein                               98.6    3e-21   Flaveria bidentis
ref|XP_006357111.1|  PREDICTED: transcription factor HB29-like        99.8    3e-21   Solanum tuberosum [potatoes]
gb|ADK63402.1|  homeobox domain zinc finger protein                   96.7    4e-21   Brassica rapa
ref|XP_006373320.1|  hypothetical protein POPTR_0017s11920g           99.4    4e-21   
ref|XP_003517792.1|  PREDICTED: transcription factor HB29-like        99.4    4e-21   Glycine max [soybeans]
ref|XP_006285795.1|  hypothetical protein CARUB_v10007269mg           99.8    4e-21   Capsella rubella
ref|XP_001777987.1|  predicted protein                                96.7    4e-21   
gb|KHN01227.1|  ZF-HD homeobox protein                                95.5    4e-21   Glycine soja [wild soybean]
ref|XP_011010943.1|  PREDICTED: zinc-finger homeodomain protein 9...  99.4    4e-21   Populus euphratica
ref|XP_004491795.1|  PREDICTED: transcription factor HB29-like        99.4    4e-21   Cicer arietinum [garbanzo]
ref|XP_003576623.1|  PREDICTED: zinc-finger homeodomain protein 1     99.0    5e-21   Brachypodium distachyon [annual false brome]
ref|XP_009620302.1|  PREDICTED: zinc-finger homeodomain protein 9...  98.6    5e-21   Nicotiana tomentosiformis
gb|KJB18247.1|  hypothetical protein B456_003G042700                  98.2    6e-21   Gossypium raimondii
emb|CAC34410.1|  ZF-HD homeobox protein                               98.2    6e-21   Flaveria bidentis
ref|XP_008782488.1|  PREDICTED: zinc-finger homeodomain protein 6...  97.4    1e-20   Phoenix dactylifera
ref|XP_010682105.1|  PREDICTED: zinc-finger homeodomain protein 3...  98.2    1e-20   Beta vulgaris subsp. vulgaris [field beet]
ref|NP_189534.1|  homeobox protein 34                                 98.2    1e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010450775.1|  PREDICTED: zinc-finger homeodomain protein 1...  98.2    1e-20   Camelina sativa [gold-of-pleasure]
ref|XP_002460367.1|  hypothetical protein SORBIDRAFT_02g027040        97.8    1e-20   Sorghum bicolor [broomcorn]
ref|XP_006470838.1|  PREDICTED: ZF-HD homeobox protein At5g65410-...  97.8    1e-20   Citrus sinensis [apfelsine]
ref|XP_009139922.1|  PREDICTED: zinc-finger homeodomain protein 10    97.8    1e-20   Brassica rapa
ref|XP_010441087.1|  PREDICTED: zinc-finger homeodomain protein 10    98.2    1e-20   Camelina sativa [gold-of-pleasure]
ref|XP_006431432.1|  hypothetical protein CICLE_v10003702mg           97.8    1e-20   Citrus clementina [clementine]
gb|KDO42061.1|  hypothetical protein CISIN_1g048741mg                 97.8    1e-20   Citrus sinensis [apfelsine]
sp|A2Z259.1|ZHD1_ORYSI  RecName: Full=Zinc-finger homeodomain pro...  97.4    2e-20   Oryza sativa Indica Group [Indian rice]
ref|XP_007048627.1|  Homeobox protein 21, putative                    97.1    2e-20   
ref|XP_002877141.1|  hypothetical protein ARALYDRAFT_484662           97.4    2e-20   
gb|EYU34567.1|  hypothetical protein MIMGU_mgv1a012253mg              96.7    2e-20   Erythranthe guttata [common monkey flower]
ref|XP_006660717.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...  97.1    2e-20   Oryza brachyantha
ref|NP_001063419.1|  Os09g0466400                                     97.1    2e-20   
ref|XP_010552878.1|  PREDICTED: LOW QUALITY PROTEIN: zinc-finger ...  97.4    2e-20   Tarenaya hassleriana [spider flower]
ref|XP_006859182.1|  hypothetical protein AMTR_s00070p00154800        95.9    2e-20   Amborella trichopoda
ref|XP_010527155.1|  PREDICTED: zinc-finger homeodomain protein 1     95.1    2e-20   Tarenaya hassleriana [spider flower]
ref|XP_010086552.1|  hypothetical protein L484_001444                 97.4    2e-20   
ref|XP_010681042.1|  PREDICTED: zinc-finger homeodomain protein 1...  96.7    2e-20   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010514609.1|  PREDICTED: zinc-finger homeodomain protein 9...  97.1    3e-20   Camelina sativa [gold-of-pleasure]
emb|CDP01539.1|  unnamed protein product                              96.3    3e-20   Coffea canephora [robusta coffee]
ref|XP_010425683.1|  PREDICTED: zinc-finger homeodomain protein 9...  97.1    3e-20   Camelina sativa [gold-of-pleasure]
ref|XP_006660219.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...  96.7    3e-20   
ref|XP_004957068.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...  96.7    3e-20   Setaria italica
gb|KJB30399.1|  hypothetical protein B456_005G141400                  96.3    3e-20   Gossypium raimondii
ref|XP_009613099.1|  PREDICTED: zinc-finger homeodomain protein 4     96.7    3e-20   Nicotiana tomentosiformis
ref|XP_010940074.1|  PREDICTED: zinc-finger homeodomain protein 6...  96.7    3e-20   Elaeis guineensis
gb|EEE69868.1|  hypothetical protein OsJ_29679                        95.9    3e-20   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003551238.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...  95.9    3e-20   Glycine max [soybeans]
gb|EMT05330.1|  ZF-HD homeobox protein                                92.0    3e-20   
gb|KHN07843.1|  ZF-HD homeobox protein                                94.4    3e-20   Glycine soja [wild soybean]
ref|XP_006878601.1|  hypothetical protein AMTR_s00011p00255340        95.5    4e-20   
ref|XP_010502894.1|  PREDICTED: zinc-finger homeodomain protein 9     96.3    4e-20   Camelina sativa [gold-of-pleasure]
emb|CBI27705.3|  unnamed protein product                              92.8    4e-20   Vitis vinifera
ref|XP_007154109.1|  hypothetical protein PHAVU_003G091100g           95.9    5e-20   Phaseolus vulgaris [French bean]
ref|XP_008444722.1|  PREDICTED: zinc-finger homeodomain protein 2     96.3    5e-20   Cucumis melo [Oriental melon]
ref|XP_004165400.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...  96.3    5e-20   
ref|XP_010554331.1|  PREDICTED: zinc-finger homeodomain protein 4     96.3    5e-20   
gb|ABY61020.1|  zinc finger-homeodomain protein 1                     95.9    5e-20   Eschscholzia californica
emb|CAN60614.1|  hypothetical protein VITISV_003253                   93.6    5e-20   Vitis vinifera
gb|ADE77597.1|  unknown                                               95.5    5e-20   Picea sitchensis
ref|XP_004152776.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...  95.5    6e-20   
gb|KHN07994.1|  ZF-HD homeobox protein                                94.7    6e-20   Glycine soja [wild soybean]
ref|XP_008388052.1|  PREDICTED: zinc-finger homeodomain protein 2     96.3    6e-20   
gb|KHN07993.1|  ZF-HD homeobox protein                                94.7    7e-20   Glycine soja [wild soybean]
ref|XP_009762783.1|  PREDICTED: zinc-finger homeodomain protein 4...  95.5    7e-20   Nicotiana sylvestris
gb|KHN07995.1|  ZF-HD homeobox protein                                94.7    8e-20   Glycine soja [wild soybean]
ref|XP_006827241.1|  hypothetical protein AMTR_s00010p00261450        94.7    8e-20   Amborella trichopoda
ref|XP_009396485.1|  PREDICTED: zinc-finger homeodomain protein 6...  95.9    8e-20   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006291497.1|  hypothetical protein CARUB_v10017644mg           95.5    8e-20   Capsella rubella
emb|CAC34409.1|  ZF-HD homeobox protein                               95.5    8e-20   Flaveria bidentis
ref|XP_009381483.1|  PREDICTED: zinc-finger homeodomain protein 2...  95.1    9e-20   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001062055.1|  Os08g0479400                                     95.1    9e-20   
ref|XP_003530620.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...  94.7    1e-19   
ref|XP_010065227.1|  PREDICTED: zinc-finger homeodomain protein 4...  95.5    1e-19   Eucalyptus grandis [rose gum]
gb|EPS61775.1|  hypothetical protein M569_13018                       94.7    1e-19   Genlisea aurea
gb|KJB80187.1|  hypothetical protein B456_013G085500                  95.1    1e-19   Gossypium raimondii
gb|KDO82923.1|  hypothetical protein CISIN_1g046396mg                 95.1    1e-19   Citrus sinensis [apfelsine]
ref|XP_010527865.1|  PREDICTED: zinc-finger homeodomain protein 4     95.1    1e-19   Tarenaya hassleriana [spider flower]
gb|KDP40895.1|  hypothetical protein JCGZ_24894                       94.7    1e-19   Jatropha curcas
ref|XP_007046103.1|  Homeobox protein 34, putative                    95.1    1e-19   
ref|XP_006438687.1|  hypothetical protein CICLE_v10032160mg           95.1    1e-19   Citrus clementina [clementine]
ref|XP_004495441.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...  93.6    1e-19   Cicer arietinum [garbanzo]
ref|XP_004499360.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...  95.1    1e-19   Cicer arietinum [garbanzo]
ref|XP_010939727.1|  PREDICTED: zinc-finger homeodomain protein 2     94.7    1e-19   Elaeis guineensis
gb|KJB75536.1|  hypothetical protein B456_012G046200                  93.2    1e-19   Gossypium raimondii
ref|XP_004156724.1|  PREDICTED: LOW QUALITY PROTEIN: ZF-HD homeob...  94.7    1e-19   
gb|KDP29745.1|  hypothetical protein JCGZ_18680                       94.0    1e-19   Jatropha curcas
ref|XP_004142854.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...  94.7    2e-19   Cucumis sativus [cucumbers]
ref|NP_001149424.1|  LOC100283050                                     94.7    2e-19   
gb|KHG22175.1|  hypothetical protein F383_07505                       94.0    2e-19   Gossypium arboreum [tree cotton]
ref|XP_004230410.1|  PREDICTED: zinc-finger homeodomain protein 4     94.4    2e-19   Solanum lycopersicum
gb|KJB18248.1|  hypothetical protein B456_003G042700                  93.6    2e-19   Gossypium raimondii
tpg|DAA48505.1|  TPA: putative homeobox DNA-binding domain superf...  94.4    2e-19   
ref|XP_003520078.1|  PREDICTED: transcription factor HB29-like        94.0    2e-19   Glycine max [soybeans]
ref|XP_006349273.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...  94.0    2e-19   Solanum tuberosum [potatoes]
ref|XP_003633412.1|  PREDICTED: zinc-finger homeodomain protein 4     93.6    3e-19   Vitis vinifera
ref|XP_006426395.1|  hypothetical protein CICLE_v10027184mg           92.8    3e-19   Citrus clementina [clementine]
ref|XP_003574645.1|  PREDICTED: zinc-finger homeodomain protein 1...  94.0    3e-19   Brachypodium distachyon [annual false brome]
ref|XP_011003997.1|  PREDICTED: zinc-finger homeodomain protein 2...  93.6    3e-19   Populus euphratica
gb|KJB70777.1|  hypothetical protein B456_011G090900                  94.0    3e-19   Gossypium raimondii
ref|XP_004973708.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...  94.0    3e-19   Setaria italica
ref|XP_011087615.1|  PREDICTED: zinc-finger homeodomain protein 4     93.6    3e-19   Sesamum indicum [beniseed]
ref|NP_001151888.1|  ZF-HD protein dimerisation region containing...  93.6    3e-19   Zea mays [maize]
ref|XP_009800645.1|  PREDICTED: putative F-box/LRR-repeat protein...  95.1    3e-19   Nicotiana sylvestris
ref|XP_011075633.1|  PREDICTED: zinc-finger homeodomain protein 1...  91.7    3e-19   Sesamum indicum [beniseed]
ref|XP_002267747.1|  PREDICTED: zinc-finger homeodomain protein 3     93.2    3e-19   Vitis vinifera
gb|ABY61023.1|  zinc finger homeodomain protein 1                     92.8    4e-19   Saruma henryi
ref|XP_004299701.1|  PREDICTED: zinc-finger homeodomain protein 2...  93.2    4e-19   Fragaria vesca subsp. vesca
ref|XP_003518249.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...  93.2    4e-19   Glycine max [soybeans]
gb|KHN40205.1|  ZF-HD homeobox protein                                92.0    4e-19   Glycine soja [wild soybean]
ref|XP_011028421.1|  PREDICTED: zinc-finger homeodomain protein 4     93.6    4e-19   Populus euphratica
ref|XP_007226172.1|  hypothetical protein PRUPE_ppa015411mg           93.6    4e-19   
emb|CDP02013.1|  unnamed protein product                              93.6    4e-19   Coffea canephora [robusta coffee]
ref|XP_008338536.1|  PREDICTED: LOW QUALITY PROTEIN: zinc-finger ...  93.2    4e-19   
ref|XP_009393647.1|  PREDICTED: zinc-finger homeodomain protein 2...  93.2    4e-19   
ref|XP_010254805.1|  PREDICTED: zinc-finger homeodomain protein 5...  93.6    4e-19   Nelumbo nucifera [Indian lotus]
ref|XP_003529692.1|  PREDICTED: ZF-HD homeobox protein At5g65410-...  93.2    4e-19   
ref|XP_008795929.1|  PREDICTED: zinc-finger homeodomain protein 6...  93.2    4e-19   
ref|XP_003550152.1|  PREDICTED: ZF-HD homeobox protein At5g65410-...  93.2    4e-19   Glycine max [soybeans]
ref|XP_007143929.1|  hypothetical protein PHAVU_007G114300g           92.0    4e-19   Phaseolus vulgaris [French bean]
ref|XP_006466561.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...  92.4    5e-19   Citrus sinensis [apfelsine]
ref|XP_007023152.1|  Homeobox protein 31                              93.2    5e-19   
emb|CDO97666.1|  unnamed protein product                              93.2    5e-19   Coffea canephora [robusta coffee]
ref|XP_008460585.1|  PREDICTED: zinc-finger homeodomain protein 4     93.2    5e-19   Cucumis melo [Oriental melon]
ref|XP_008218634.1|  PREDICTED: zinc-finger homeodomain protein 4...  93.6    5e-19   Prunus mume [ume]
ref|XP_006385095.1|  hypothetical protein POPTR_0004s23860g           93.2    5e-19   
gb|ABY61025.1|  zinc finger-homeodomain protein 3                     92.0    5e-19   Saruma henryi
ref|XP_004301574.1|  PREDICTED: zinc-finger homeodomain protein 4...  93.6    5e-19   Fragaria vesca subsp. vesca
ref|XP_009365549.1|  PREDICTED: zinc-finger homeodomain protein 2...  93.2    6e-19   Pyrus x bretschneideri [bai li]
ref|XP_009336904.1|  PREDICTED: zinc-finger homeodomain protein 2...  93.2    6e-19   Pyrus x bretschneideri [bai li]
gb|KHN03576.1|  ZF-HD homeobox protein                                92.8    6e-19   Glycine soja [wild soybean]
ref|XP_006291509.1|  hypothetical protein CARUB_v10017657mg           93.2    6e-19   Capsella rubella
ref|XP_004293203.2|  PREDICTED: zinc-finger homeodomain protein 6     93.2    6e-19   Fragaria vesca subsp. vesca
ref|XP_008357201.1|  PREDICTED: zinc-finger homeodomain protein 5...  93.2    6e-19   
gb|ABY61024.1|  zinc finger-homeodomain protein 2                     92.4    6e-19   Saruma henryi
ref|XP_006394037.1|  hypothetical protein EUTSA_v10005568mg           92.8    6e-19   Eutrema salsugineum [saltwater cress]
ref|XP_006836924.1|  hypothetical protein AMTR_s00099p00145100        92.4    6e-19   
ref|XP_008789175.1|  PREDICTED: zinc-finger homeodomain protein 4...  92.4    6e-19   Phoenix dactylifera
ref|XP_009364948.1|  PREDICTED: zinc-finger homeodomain protein 2...  93.2    7e-19   Pyrus x bretschneideri [bai li]
ref|XP_006376247.1|  hypothetical protein POPTR_0013s11330g           92.4    7e-19   
ref|XP_010246039.1|  PREDICTED: zinc-finger homeodomain protein 1...  92.8    7e-19   
ref|XP_007224511.1|  hypothetical protein PRUPE_ppa023369mg           92.8    7e-19   
emb|CDY33960.1|  BnaC02g43770D                                        92.4    7e-19   Brassica napus [oilseed rape]
ref|XP_002445649.1|  hypothetical protein SORBIDRAFT_07g023360        92.8    7e-19   Sorghum bicolor [broomcorn]
gb|KJB48886.1|  hypothetical protein B456_008G092000                  92.0    7e-19   Gossypium raimondii
ref|NP_178358.1|  homeobox protein 21                                 92.8    7e-19   Arabidopsis thaliana [mouse-ear cress]
gb|KEH32742.1|  homeobox domain, ZF-HD class protein                  93.2    7e-19   Medicago truncatula
gb|KJB64195.1|  hypothetical protein B456_010G036300                  92.0    7e-19   Gossypium raimondii
ref|XP_009395689.1|  PREDICTED: zinc-finger homeodomain protein 5...  92.8    8e-19   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007158386.1|  hypothetical protein PHAVU_002G148900g           92.0    8e-19   Phaseolus vulgaris [French bean]
ref|XP_008219382.1|  PREDICTED: zinc-finger homeodomain protein 2     92.4    8e-19   Prunus mume [ume]
ref|XP_007222197.1|  hypothetical protein PRUPE_ppa009679mg           92.4    8e-19   Prunus persica
ref|XP_006426297.1|  hypothetical protein CICLE_v10027024mg           92.0    8e-19   Citrus clementina [clementine]
gb|AAM10791.1|  hypothetical protein At2g02540/T822.16                92.4    8e-19   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003635057.1|  PREDICTED: zinc-finger homeodomain protein 2...  92.0    9e-19   Vitis vinifera
ref|XP_006376248.1|  hypothetical protein POPTR_0013s11330g           92.4    9e-19   Populus trichocarpa [western balsam poplar]
ref|XP_002525870.1|  transcription factor, putative                   92.4    9e-19   
ref|XP_011001095.1|  PREDICTED: zinc-finger homeodomain protein 2...  92.4    9e-19   Populus euphratica
ref|XP_010060081.1|  PREDICTED: zinc-finger homeodomain protein 2...  92.4    9e-19   Eucalyptus grandis [rose gum]
ref|XP_008810728.1|  PREDICTED: zinc-finger homeodomain protein 6...  92.4    9e-19   Phoenix dactylifera
ref|XP_001785616.1|  predicted protein                                92.4    1e-18   
ref|XP_011012906.1|  PREDICTED: zinc-finger homeodomain protein 4...  92.0    1e-18   Populus euphratica
ref|XP_009130511.1|  PREDICTED: zinc-finger homeodomain protein 1...  92.0    1e-18   Brassica rapa
gb|KFK26902.1|  hypothetical protein AALP_AA8G308300                  92.4    1e-18   Arabis alpina [alpine rockcress]
ref|XP_010098663.1|  hypothetical protein L484_026038                 92.0    1e-18   Morus notabilis
ref|XP_008385681.1|  PREDICTED: zinc-finger homeodomain protein 1...  92.0    1e-18   
gb|KJB58948.1|  hypothetical protein B456_009G231800                  91.7    1e-18   Gossypium raimondii
ref|XP_009769511.1|  PREDICTED: zinc-finger homeodomain protein 2...  91.7    1e-18   Nicotiana sylvestris
ref|XP_009769508.1|  PREDICTED: zinc-finger homeodomain protein 2...  91.7    1e-18   Nicotiana sylvestris
ref|XP_009399684.1|  PREDICTED: zinc-finger homeodomain protein 1...  92.0    1e-18   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009619186.1|  PREDICTED: zinc-finger homeodomain protein 2...  91.7    1e-18   Nicotiana tomentosiformis
ref|XP_006346746.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...  91.7    1e-18   Solanum tuberosum [potatoes]
ref|XP_004288462.1|  PREDICTED: zinc-finger homeodomain protein 1...  91.7    1e-18   Fragaria vesca subsp. vesca
ref|XP_004236700.1|  PREDICTED: zinc-finger homeodomain protein 2...  91.7    1e-18   Solanum lycopersicum
ref|XP_009410127.1|  PREDICTED: zinc-finger homeodomain protein 2...  91.7    1e-18   Musa acuminata subsp. malaccensis [pisang utan]
gb|EYU35040.1|  hypothetical protein MIMGU_mgv1a014453mg              90.5    1e-18   Erythranthe guttata [common monkey flower]
gb|KJB44095.1|  hypothetical protein B456_007G233800                  91.3    1e-18   Gossypium raimondii
ref|XP_003544235.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...  91.7    1e-18   Glycine max [soybeans]
gb|ABK25080.1|  unknown                                               91.7    1e-18   Picea sitchensis
ref|XP_007156483.1|  hypothetical protein PHAVU_003G289700g           90.9    1e-18   Phaseolus vulgaris [French bean]
ref|XP_010252306.1|  PREDICTED: zinc-finger homeodomain protein 4     91.7    1e-18   Nelumbo nucifera [Indian lotus]
ref|XP_002514009.1|  transcription factor, putative                   91.7    1e-18   Ricinus communis
ref|XP_009373614.1|  PREDICTED: zinc-finger homeodomain protein 3...  92.4    1e-18   Pyrus x bretschneideri [bai li]
ref|XP_009403170.1|  PREDICTED: zinc-finger homeodomain protein 9...  92.0    1e-18   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDX85059.1|  BnaC05g19960D                                        91.3    2e-18   
gb|ABY61018.1|  zinc finger-homeodomain protein 1                     91.7    2e-18   Welwitschia mirabilis
gb|ABK25143.1|  unknown                                               91.7    2e-18   Picea sitchensis
ref|XP_010099792.1|  hypothetical protein L484_010980                 92.0    2e-18   Morus notabilis
gb|ABR16776.1|  unknown                                               91.7    2e-18   Picea sitchensis
ref|XP_008670258.1|  PREDICTED: zinc-finger homeodomain protein 1...  91.3    2e-18   
gb|KJB44094.1|  hypothetical protein B456_007G233800                  91.3    2e-18   Gossypium raimondii
ref|XP_010272957.1|  PREDICTED: zinc-finger homeodomain protein 1...  90.5    2e-18   Nelumbo nucifera [Indian lotus]
ref|XP_008235400.1|  PREDICTED: zinc-finger homeodomain protein 1...  89.4    2e-18   
gb|KDP41452.1|  hypothetical protein JCGZ_15859                       91.7    2e-18   Jatropha curcas
gb|KHN08326.1|  ZF-HD homeobox protein                                91.3    2e-18   Glycine soja [wild soybean]
ref|XP_009607017.1|  PREDICTED: zinc-finger homeodomain protein 4...  91.3    2e-18   Nicotiana tomentosiformis
ref|XP_001772697.1|  predicted protein                                90.1    2e-18   
ref|XP_008378554.1|  PREDICTED: zinc-finger homeodomain protein 2...  91.3    2e-18   
ref|XP_006342245.1|  PREDICTED: uncharacterized protein LOC102578167  89.4    2e-18   
emb|CDX69541.1|  BnaA10g18900D                                        90.9    2e-18   
ref|XP_010463122.1|  PREDICTED: zinc-finger homeodomain protein 1...  91.3    2e-18   
ref|XP_008806398.1|  PREDICTED: zinc-finger homeodomain protein 1...  89.4    2e-18   
emb|CDY34299.1|  BnaA01g14020D                                        90.5    2e-18   
ref|XP_010484369.1|  PREDICTED: zinc-finger homeodomain protein 1...  91.3    2e-18   
ref|XP_009407034.1|  PREDICTED: zinc-finger homeodomain protein 2...  91.3    2e-18   
ref|XP_009602563.1|  PREDICTED: zinc-finger homeodomain protein 2...  90.9    2e-18   
ref|XP_006581501.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...  90.9    2e-18   
ref|XP_010444532.1|  PREDICTED: zinc-finger homeodomain protein 1     91.3    2e-18   
gb|KJB43477.1|  hypothetical protein B456_007G202500                  91.3    2e-18   
ref|XP_006853040.1|  hypothetical protein AMTR_s00038p00027320        90.5    2e-18   
ref|XP_009758154.1|  PREDICTED: zinc-finger homeodomain protein 2...  90.9    2e-18   
ref|XP_006380765.1|  hypothetical protein POPTR_0007s12970g           91.3    3e-18   
ref|XP_006280898.1|  hypothetical protein CARUB_v10026891mg           90.9    3e-18   
ref|XP_004489767.1|  PREDICTED: ZF-HD homeobox protein At5g65410-...  90.9    3e-18   
ref|XP_002965557.1|  hypothetical protein SELMODRAFT_68508            89.4    3e-18   
ref|XP_010102085.1|  hypothetical protein L484_009028                 91.3    3e-18   
ref|XP_009121598.1|  PREDICTED: zinc-finger homeodomain protein 8     90.9    3e-18   
ref|XP_009138327.1|  PREDICTED: zinc-finger homeodomain protein 2     90.1    3e-18   
ref|XP_010502266.1|  PREDICTED: zinc-finger homeodomain protein 3...  91.3    3e-18   
ref|XP_002310240.2|  zinc finger family protein                       90.9    3e-18   
ref|XP_008812231.1|  PREDICTED: zinc-finger homeodomain protein 2...  90.9    3e-18   
gb|EEC67940.1|  hypothetical protein OsI_35664                        91.3    3e-18   
ref|XP_009355386.1|  PREDICTED: zinc-finger homeodomain protein 3     91.7    3e-18   
emb|CDY03431.1|  BnaC01g16510D                                        90.1    3e-18   
emb|CDP11470.1|  unnamed protein product                              90.5    3e-18   
ref|XP_009341386.1|  PREDICTED: zinc-finger homeodomain protein 3...  91.7    3e-18   
gb|EYU22417.1|  hypothetical protein MIMGU_mgv1a026791mg              87.4    3e-18   
gb|ADE76551.1|  unknown                                               90.5    3e-18   
ref|XP_009403385.1|  PREDICTED: zinc-finger homeodomain protein 4...  90.5    3e-18   
ref|XP_008378952.1|  PREDICTED: LOW QUALITY PROTEIN: zinc-finger ...  91.3    3e-18   
gb|EAY87240.1|  hypothetical protein OsI_08642                        87.8    3e-18   
ref|XP_009406459.1|  PREDICTED: zinc-finger homeodomain protein 4...  90.5    3e-18   
ref|XP_008788352.1|  PREDICTED: zinc-finger homeodomain protein 4...  90.1    4e-18   
ref|XP_008339432.1|  PREDICTED: zinc-finger homeodomain protein 3...  91.3    4e-18   
ref|XP_006290001.1|  hypothetical protein CARUB_v10003631mg           90.5    4e-18   
gb|KDP38514.1|  hypothetical protein JCGZ_04439                       90.5    4e-18   
gb|ABY61021.1|  zinc finger-homeodomain protein 2                     90.5    4e-18   
ref|XP_002285709.1|  PREDICTED: zinc-finger homeodomain protein 1     89.7    4e-18   
ref|XP_010263641.1|  PREDICTED: zinc-finger homeodomain protein 5     90.9    4e-18   
ref|XP_002534484.1|  transcription factor, putative                   90.1    4e-18   
ref|XP_010927875.1|  PREDICTED: zinc-finger homeodomain protein 4...  90.1    5e-18   
ref|XP_002443023.1|  hypothetical protein SORBIDRAFT_08g006490        90.5    5e-18   
ref|XP_009416998.1|  PREDICTED: zinc-finger homeodomain protein 4...  90.1    5e-18   
ref|XP_002867654.1|  ATHB22/MEE68                                     89.4    5e-18   
ref|XP_007224765.1|  hypothetical protein PRUPE_ppa024080mg           90.5    5e-18   
ref|XP_002325543.2|  hypothetical protein POPTR_0019s11070g           89.7    5e-18   
ref|XP_003530618.2|  PREDICTED: ZF-HD homeobox protein At4g24660-...  90.1    5e-18   
ref|XP_006400038.1|  hypothetical protein EUTSA_v10016088mg           90.1    5e-18   
ref|XP_007205692.1|  hypothetical protein PRUPE_ppa009712mg           90.1    5e-18   
ref|XP_008781669.1|  PREDICTED: zinc-finger homeodomain protein 8...  89.7    5e-18   
ref|XP_007141241.1|  hypothetical protein PHAVU_008G179200g           89.7    5e-18   
ref|XP_010930757.1|  PREDICTED: zinc-finger homeodomain protein 2...  89.7    6e-18   
ref|XP_009385760.1|  PREDICTED: zinc-finger homeodomain protein 2...  89.7    6e-18   
emb|CBI19706.3|  unnamed protein product                              90.1    6e-18   
emb|CAC34447.1|  ZF-HD homeobox protein                               89.4    6e-18   
ref|XP_008678040.1|  PREDICTED: zinc-finger homeodomain protein 4...  90.5    6e-18   
ref|XP_007018165.1|  Transcription factor, putative                   89.7    6e-18   
ref|XP_010266504.1|  PREDICTED: zinc-finger homeodomain protein 1...  89.0    6e-18   
gb|AES96050.2|  homeobox domain, ZF-HD class protein                  89.7    6e-18   
ref|XP_010530124.1|  PREDICTED: zinc-finger homeodomain protein 2     89.0    7e-18   
ref|XP_003519839.2|  PREDICTED: ZF-HD homeobox protein At4g24660-...  89.7    7e-18   
ref|XP_003530619.2|  PREDICTED: ZF-HD homeobox protein At4g24660-...  89.7    7e-18   
emb|CDX81284.1|  BnaC09g06950D                                        89.4    7e-18   
ref|XP_008678039.1|  PREDICTED: zinc-finger homeodomain protein 4...  90.9    7e-18   
ref|XP_010925945.1|  PREDICTED: LOW QUALITY PROTEIN: zinc-finger ...  90.1    7e-18   
ref|XP_010104483.1|  hypothetical protein L484_025452                 89.7    7e-18   
ref|XP_009150629.1|  PREDICTED: zinc-finger homeodomain protein 1...  89.7    8e-18   
gb|EAZ19969.1|  hypothetical protein OsJ_35560                        86.7    8e-18   
ref|XP_010425030.1|  PREDICTED: zinc-finger homeodomain protein 3...  89.7    8e-18   
emb|CDY14559.1|  BnaC03g49000D                                        89.7    8e-18   
emb|CBI19232.3|  unnamed protein product                              89.0    8e-18   
ref|XP_006663328.1|  PREDICTED: uncharacterized protein LOC102703731  90.5    8e-18   
emb|CAN75153.1|  hypothetical protein VITISV_035994                   89.4    8e-18   
ref|XP_010448536.1|  PREDICTED: zinc-finger homeodomain protein 2     88.6    9e-18   
ref|NP_001144285.1|  uncharacterized protein LOC100277167             89.7    9e-18   
gb|ACG39295.1|  hypothetical protein                                  89.7    9e-18   
ref|XP_004237971.1|  PREDICTED: zinc-finger homeodomain protein 2     89.0    9e-18   
ref|XP_010453650.1|  PREDICTED: zinc-finger homeodomain protein 8...  89.4    9e-18   
gb|AAZ07989.1|  zinc finger homeodomain protein 1                     89.7    9e-18   
ref|XP_009405659.1|  PREDICTED: zinc-finger homeodomain protein 6...  89.7    9e-18   
ref|NP_194197.1|  ZF-HD homeobox protein                              88.6    9e-18   
emb|CDY54719.1|  BnaA09g52500D                                        89.0    1e-17   
ref|XP_010930367.1|  PREDICTED: zinc-finger homeodomain protein 4...  89.4    1e-17   
ref|XP_008808961.1|  PREDICTED: zinc-finger homeodomain protein 4...  89.4    1e-17   
ref|XP_003615230.1|  Zinc finger-homeodomain protein                  89.0    1e-17   
ref|XP_004232414.1|  PREDICTED: zinc-finger homeodomain protein 5     89.4    1e-17   
ref|XP_006395776.1|  hypothetical protein EUTSA_v10004643mg           89.4    1e-17   
ref|XP_010433740.1|  PREDICTED: zinc-finger homeodomain protein 2...  88.6    1e-17   
ref|XP_006286279.1|  hypothetical protein CARUB_v10007856mg           88.6    1e-17   
ref|XP_009112180.1|  PREDICTED: zinc-finger homeodomain protein 1...  89.0    1e-17   
ref|XP_002449277.1|  hypothetical protein SORBIDRAFT_05g007050        90.5    1e-17   
ref|XP_009393644.1|  PREDICTED: zinc-finger homeodomain protein 2...  89.0    1e-17   
ref|XP_004501619.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...  89.0    1e-17   
ref|XP_010438998.1|  PREDICTED: zinc-finger homeodomain protein 2...  88.6    1e-17   
ref|XP_002864955.1|  hypothetical protein ARALYDRAFT_919872           89.0    1e-17   
gb|EYU28753.1|  hypothetical protein MIMGU_mgv1a025639mg              89.0    1e-17   
gb|KFK33764.1|  hypothetical protein AALP_AA5G057200                  89.4    1e-17   
ref|XP_001778248.1|  predicted protein                                89.0    1e-17   
gb|KFK28242.1|  hypothetical protein AALP_AA8G490700                  89.0    1e-17   
ref|XP_002302329.1|  hypothetical protein POPTR_0002s10330g           89.0    1e-17   
ref|XP_004143516.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...  89.4    1e-17   
dbj|BAK05545.1|  predicted protein                                    90.1    1e-17   
ref|XP_002994344.1|  hypothetical protein SELMODRAFT_236945           87.0    1e-17   
ref|XP_011016887.1|  PREDICTED: zinc-finger homeodomain protein 2     88.6    1e-17   
ref|XP_009393645.1|  PREDICTED: zinc-finger homeodomain protein 2...  89.0    1e-17   
ref|XP_011025804.1|  PREDICTED: zinc-finger homeodomain protein 6     89.4    1e-17   
ref|XP_006338094.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...  88.6    1e-17   
ref|XP_004143449.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...  88.6    1e-17   
ref|XP_007017558.1|  Homeobox protein 33 isoform 1                    89.0    1e-17   
ref|XP_006413402.1|  hypothetical protein EUTSA_v10026163mg           88.2    1e-17   
ref|XP_010926548.1|  PREDICTED: zinc-finger homeodomain protein 9...  88.6    1e-17   
ref|XP_008440565.1|  PREDICTED: zinc-finger homeodomain protein 1...  88.6    1e-17   
ref|XP_003602944.1|  Zinc finger-homeodomain protein                  88.6    2e-17   
emb|CDP20040.1|  unnamed protein product                              87.4    2e-17   
ref|XP_004490406.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...  88.6    2e-17   
ref|XP_002966118.1|  hypothetical protein SELMODRAFT_85536            87.0    2e-17   
ref|XP_008221618.1|  PREDICTED: zinc-finger homeodomain protein 1...  89.0    2e-17   
ref|XP_007046919.1|  Homeobox protein 24, putative                    89.4    2e-17   
ref|XP_006425664.1|  hypothetical protein CICLE_v10025926mg           89.0    2e-17   
emb|CDY08945.1|  BnaC08g11750D                                        87.8    2e-17   
ref|XP_010675490.1|  PREDICTED: zinc-finger homeodomain protein 1...  88.6    2e-17   
ref|XP_006841247.1|  hypothetical protein AMTR_s00135p00085840        87.8    2e-17   
dbj|BAJ92783.1|  predicted protein                                    89.7    2e-17   
ref|XP_011099626.1|  PREDICTED: zinc-finger homeodomain protein 6     89.0    2e-17   
sp|Q53N87.2|ZHD4_ORYSJ  RecName: Full=Zinc-finger homeodomain pro...  89.7    2e-17   
emb|CDX88950.1|  BnaA04g02360D                                        87.4    2e-17   
ref|XP_010514025.1|  PREDICTED: zinc-finger homeodomain protein 3     88.6    2e-17   
emb|CDX81638.1|  BnaC08g39630D                                        88.6    2e-17   
ref|XP_006305389.1|  hypothetical protein CARUB_v10009782mg           88.6    2e-17   
ref|XP_007158652.1|  hypothetical protein PHAVU_002G171000g           89.0    2e-17   
ref|XP_006434579.1|  hypothetical protein CICLE_v10004050mg           87.4    2e-17   
ref|XP_004152612.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...  87.8    2e-17   
ref|XP_006473167.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...  87.4    2e-17   
ref|XP_010908151.1|  PREDICTED: zinc-finger homeodomain protein 4...  87.8    2e-17   
ref|XP_002875135.1|  hypothetical protein ARALYDRAFT_484166           88.2    2e-17   
ref|XP_009788413.1|  PREDICTED: zinc-finger homeodomain protein 9...  87.4    2e-17   
ref|XP_009129138.1|  PREDICTED: zinc-finger homeodomain protein 3     88.2    2e-17   
gb|KDO36261.1|  hypothetical protein CISIN_1g048824mg                 87.0    2e-17   
emb|CAN64849.1|  hypothetical protein VITISV_004128                   87.8    2e-17   
ref|XP_002892806.1|  ATHB31                                           88.2    3e-17   
emb|CBI18514.3|  unnamed protein product                              87.8    3e-17   
ref|XP_008444884.1|  PREDICTED: zinc-finger homeodomain protein 2     87.4    3e-17   
gb|ABY61029.1|  zinc finger-homeodomain protein 1                     87.8    3e-17   
ref|XP_010665240.1|  PREDICTED: zinc-finger homeodomain protein 2...  87.8    3e-17   
ref|XP_006433874.1|  hypothetical protein CICLE_v10002355mg           87.4    3e-17   
ref|NP_197025.1|  zinc finger homeodomain transcriptional factor ...  87.8    3e-17   
ref|XP_010438997.1|  PREDICTED: zinc-finger homeodomain protein 2...  87.4    3e-17   
ref|XP_002306552.2|  hypothetical protein POPTR_0005s17620g           87.8    3e-17   
ref|XP_008440716.1|  PREDICTED: zinc-finger homeodomain protein 2     88.2    3e-17   
ref|XP_008385682.1|  PREDICTED: zinc-finger homeodomain protein 1...  87.8    3e-17   
ref|NP_201344.1|  homeobox protein 25                                 87.8    3e-17   
ref|XP_001752347.1|  predicted protein                                87.8    3e-17   
ref|XP_010912718.1|  PREDICTED: zinc-finger homeodomain protein 4...  87.8    3e-17   
ref|XP_010551857.1|  PREDICTED: zinc-finger homeodomain protein 8...  87.8    3e-17   
ref|XP_004978993.1|  PREDICTED: ZF-HD homeobox protein At5g65410-...  88.6    3e-17   
ref|XP_009403138.1|  PREDICTED: zinc-finger homeodomain protein 2...  87.8    3e-17   
ref|XP_008339904.1|  PREDICTED: zinc-finger homeodomain protein 1...  87.8    3e-17   
ref|XP_008385680.1|  PREDICTED: zinc-finger homeodomain protein 1...  87.8    3e-17   
gb|ABY61028.1|  zinc finger-homeodomain protein 1                     87.4    3e-17   
gb|KFK40227.1|  hypothetical protein AALP_AA3G347100                  87.4    3e-17   
ref|XP_010539898.1|  PREDICTED: zinc-finger homeodomain protein 5...  87.4    3e-17   
ref|XP_010420179.1|  PREDICTED: zinc-finger homeodomain protein 8...  87.4    3e-17   
ref|XP_003528585.2|  PREDICTED: transcription factor HB29-like        88.2    4e-17   
ref|XP_002281371.1|  PREDICTED: zinc-finger homeodomain protein 6     87.8    4e-17   
ref|XP_007136351.1|  hypothetical protein PHAVU_009G037900g           87.8    4e-17   
ref|XP_003613092.1|  Zinc finger-homeodomain protein                  88.2    4e-17   
ref|XP_010238617.1|  PREDICTED: zinc-finger homeodomain protein 3...  87.8    4e-17   
ref|NP_172896.1|  homeobox protein 31                                 87.8    4e-17   
ref|XP_007032534.1|  Homeobox protein 34, putative                    87.8    4e-17   
emb|CDX85886.1|  BnaC06g22480D                                        87.4    4e-17   
ref|XP_006340630.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...  87.4    4e-17   
ref|XP_008800713.1|  PREDICTED: zinc-finger homeodomain protein 6...  87.8    4e-17   
ref|XP_009373696.1|  PREDICTED: zinc-finger homeodomain protein 2...  87.4    4e-17   
gb|AHC04641.1|  zinc-finger homeodomain 1                             88.6    4e-17   
sp|Q2QW44.3|ZHD3_ORYSJ  RecName: Full=Zinc-finger homeodomain pro...  87.8    4e-17   
ref|XP_009410002.1|  PREDICTED: zinc-finger homeodomain protein 9     87.4    4e-17   
ref|XP_002518018.1|  conserved hypothetical protein                   87.4    4e-17   
ref|XP_006383190.1|  hypothetical protein POPTR_0005s12420g           87.8    4e-17   
ref|XP_002510399.1|  transcription factor, putative                   87.4    4e-17   
ref|XP_011010389.1|  PREDICTED: zinc-finger homeodomain protein 2...  87.0    5e-17   
gb|KHN00536.1|  ZF-HD homeobox protein                                87.4    5e-17   
ref|XP_003520309.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...  87.4    5e-17   
ref|XP_010937133.1|  PREDICTED: zinc-finger homeodomain protein 9...  87.4    5e-17   
ref|XP_009593275.1|  PREDICTED: zinc-finger homeodomain protein 1...  86.7    5e-17   
ref|XP_003526539.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...  87.0    5e-17   
ref|XP_007047820.1|  ZF-HD homeobox protein, putative                 87.0    5e-17   
gb|KEH19725.1|  homeobox domain, ZF-HD class protein                  88.2    6e-17   
ref|XP_004961117.1|  PREDICTED: ZF-HD homeobox protein At5g65410-...  87.0    6e-17   
ref|XP_010060080.1|  PREDICTED: zinc-finger homeodomain protein 2...  87.4    6e-17   
ref|XP_002981261.1|  hypothetical protein SELMODRAFT_59934            82.4    6e-17   
gb|KDP34399.1|  hypothetical protein JCGZ_12803                       87.4    7e-17   
ref|XP_003576527.1|  PREDICTED: zinc-finger homeodomain protein 9...  87.4    7e-17   
ref|XP_006655627.1|  PREDICTED: ZF-HD homeobox protein At5g65410-...  84.3    7e-17   
ref|XP_008807662.1|  PREDICTED: zinc-finger homeodomain protein 8...  86.7    7e-17   
gb|KDP34832.1|  hypothetical protein JCGZ_11194                       85.9    7e-17   
ref|XP_010414224.1|  PREDICTED: zinc-finger homeodomain protein 6...  86.7    7e-17   
ref|XP_004512050.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...  86.7    8e-17   
gb|AFW79306.1|  ZF-HD homeobox protein                                86.3    8e-17   
ref|NP_001152263.1|  ZF-HD homeobox protein                           86.3    8e-17   
ref|XP_009405919.1|  PREDICTED: zinc-finger homeodomain protein 8...  86.7    8e-17   
ref|XP_008780606.1|  PREDICTED: zinc-finger homeodomain protein 9...  86.7    8e-17   
ref|XP_003576116.2|  PREDICTED: zinc-finger homeodomain protein 4...  87.0    9e-17   
ref|XP_009117900.1|  PREDICTED: zinc-finger homeodomain protein 4...  86.7    9e-17   
ref|XP_009624224.1|  PREDICTED: zinc-finger homeodomain protein 2...  85.9    9e-17   
ref|XP_009421143.1|  PREDICTED: zinc-finger homeodomain protein 4...  86.3    9e-17   
ref|XP_008792837.1|  PREDICTED: zinc-finger homeodomain protein 9...  86.7    9e-17   
ref|XP_008389477.1|  PREDICTED: zinc-finger homeodomain protein 1...  86.7    1e-16   
gb|ABY61027.1|  zinc finger-homeodomain protein 1                     86.3    1e-16   
ref|XP_008338913.1|  PREDICTED: zinc-finger homeodomain protein 2...  86.3    1e-16   
ref|XP_008353097.1|  PREDICTED: LOW QUALITY PROTEIN: zinc-finger ...  86.7    1e-16   
ref|XP_011004015.1|  PREDICTED: zinc-finger homeodomain protein 5...  86.3    1e-16   
gb|ACG35864.1|  ZF-HD homeobox protein                                87.0    1e-16   
emb|CDY41692.1|  BnaC02g34620D                                        86.3    1e-16   
ref|NP_565436.1|  homeobox protein 24                                 85.9    1e-16   
ref|XP_009104712.1|  PREDICTED: zinc-finger homeodomain protein 5...  86.3    1e-16   
ref|XP_002873714.1|  ATHB30/ZFHD3                                     85.9    1e-16   
ref|XP_006409164.1|  hypothetical protein EUTSA_v10022806mg           85.9    1e-16   
emb|CDY09363.1|  BnaA02g26470D                                        86.3    1e-16   
ref|NP_565106.1|  homeobox protein 33                                 86.3    1e-16   



>emb|CDP02232.1| unnamed protein product [Coffea canephora]
Length=362

 Score =   113 bits (282),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 51/65 (78%), Positives = 56/65 (86%), Gaps = 0/65 (0%)
 Frame = -1

Query  658  GRKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNT  479
            GRK FRTKFT  QK KM DFAE+IGWKIQK DE+LI +FC EIGV++GVLKVWMHNNKNT
Sbjct  225  GRKRFRTKFTPNQKEKMLDFAEKIGWKIQKRDEDLIAEFCNEIGVDKGVLKVWMHNNKNT  284

Query  478  VGKRD  464
             GKRD
Sbjct  285  FGKRD  289



>ref|XP_010655937.1| PREDICTED: zinc-finger homeodomain protein 10-like [Vitis vinifera]
Length=195

 Score =   109 bits (273),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 48/65 (74%), Positives = 57/65 (88%), Gaps = 0/65 (0%)
 Frame = -1

Query  658  GRKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNT  479
            GRK FRTKF+Q QK KM +FAER+GWK+QK DEEL+ +FC E+GV++GVLKVWMHNNKNT
Sbjct  95   GRKRFRTKFSQGQKKKMFEFAERVGWKMQKRDEELVAEFCNEVGVDKGVLKVWMHNNKNT  154

Query  478  VGKRD  464
             GKRD
Sbjct  155  FGKRD  159



>emb|CBI22215.3| unnamed protein product [Vitis vinifera]
Length=238

 Score =   110 bits (275),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 48/65 (74%), Positives = 57/65 (88%), Gaps = 0/65 (0%)
 Frame = -1

Query  658  GRKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNT  479
            GRK FRTKF+Q QK KM +FAER+GWK+QK DEEL+ +FC E+GV++GVLKVWMHNNKNT
Sbjct  131  GRKRFRTKFSQGQKEKMFEFAERVGWKMQKRDEELVAEFCNEVGVDKGVLKVWMHNNKNT  190

Query  478  VGKRD  464
             GKRD
Sbjct  191  FGKRD  195



>ref|XP_002283533.1| PREDICTED: zinc-finger homeodomain protein 9 [Vitis vinifera]
Length=341

 Score =   112 bits (279),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 48/65 (74%), Positives = 57/65 (88%), Gaps = 0/65 (0%)
 Frame = -1

Query  658  GRKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNT  479
            GRK FRTKF+Q QK KM +FAER+GWK+QK DEEL+ +FC E+GV++GVLKVWMHNNKNT
Sbjct  202  GRKRFRTKFSQGQKEKMFEFAERVGWKMQKRDEELVAEFCNEVGVDKGVLKVWMHNNKNT  261

Query  478  VGKRD  464
             GKRD
Sbjct  262  FGKRD  266



>gb|KJB75739.1| hypothetical protein B456_012G054300 [Gossypium raimondii]
Length=337

 Score =   110 bits (276),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 49/64 (77%), Positives = 56/64 (88%), Gaps = 0/64 (0%)
 Frame = -1

Query  655  RKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNTV  476
            +K FRTKFTQ QK KM +FAE+IGWKIQK DEE I +FCRE+GV+RGVLKVWMHNNKNT 
Sbjct  198  KKRFRTKFTQYQKDKMLEFAEKIGWKIQKRDEEDIQEFCREVGVDRGVLKVWMHNNKNTF  257

Query  475  GKRD  464
            GK+D
Sbjct  258  GKKD  261



>ref|XP_004233363.1| PREDICTED: zinc-finger homeodomain protein 9-like [Solanum lycopersicum]
Length=354

 Score =   109 bits (273),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 48/69 (70%), Positives = 58/69 (84%), Gaps = 0/69 (0%)
 Frame = -1

Query  667  HMKGRKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNN  488
            H  GRK FRTKFT  QK KM +FAER+GWK+QK DE+L+++FC EIGVE+GVLKVWMHNN
Sbjct  200  HSNGRKRFRTKFTPDQKVKMQEFAERVGWKMQKRDEDLVSNFCNEIGVEKGVLKVWMHNN  259

Query  487  KNTVGKRDN  461
            KNT GK+ +
Sbjct  260  KNTFGKKSD  268



>ref|XP_004148695.1| PREDICTED: transcription factor HB29-like [Cucumis sativus]
Length=304

 Score =   109 bits (272),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 46/65 (71%), Positives = 56/65 (86%), Gaps = 0/65 (0%)
 Frame = -1

Query  655  RKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNTV  476
            RK FRTKF+  QK KM DFAER+GWK+QK DE+L+ DFC ++GVERGVLKVWMHNNKNT+
Sbjct  196  RKRFRTKFSNEQKEKMLDFAERVGWKMQKRDEDLVRDFCNQVGVERGVLKVWMHNNKNTM  255

Query  475  GKRDN  461
            GK+ +
Sbjct  256  GKKPD  260



>gb|KJB33553.1| hypothetical protein B456_006G017200 [Gossypium raimondii]
Length=326

 Score =   108 bits (271),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 47/64 (73%), Positives = 55/64 (86%), Gaps = 0/64 (0%)
 Frame = -1

Query  655  RKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNTV  476
            +K FRTKFTQ QK KM +FAE++GWKIQK DEE I +FC E+GV+RGVLKVWMHNNKNT 
Sbjct  209  KKRFRTKFTQFQKDKMLEFAEKVGWKIQKRDEEAIQEFCSEVGVDRGVLKVWMHNNKNTF  268

Query  475  GKRD  464
            GK+D
Sbjct  269  GKKD  272



>ref|XP_004168480.1| PREDICTED: transcription factor HB29-like [Cucumis sativus]
 gb|KGN52458.1| hypothetical protein Csa_5G636510 [Cucumis sativus]
Length=307

 Score =   108 bits (271),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 46/65 (71%), Positives = 56/65 (86%), Gaps = 0/65 (0%)
 Frame = -1

Query  655  RKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNTV  476
            RK FRTKF+  QK KM DFAER+GWK+QK DE+L+ DFC ++GVERGVLKVWMHNNKNT+
Sbjct  199  RKRFRTKFSNEQKEKMLDFAERVGWKMQKRDEDLVRDFCNQVGVERGVLKVWMHNNKNTM  258

Query  475  GKRDN  461
            GK+ +
Sbjct  259  GKKPD  263



>gb|ABY61030.1| zinc finger-homeodomain protein 1, partial [Cucumis sativus]
Length=302

 Score =   108 bits (270),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 46/65 (71%), Positives = 56/65 (86%), Gaps = 0/65 (0%)
 Frame = -1

Query  655  RKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNTV  476
            RK FRTKF+  QK KM DFAER+GWK+QK DE+L+ DFC ++GVERGVLKVWMHNNKNT+
Sbjct  194  RKRFRTKFSNEQKEKMLDFAERVGWKMQKRDEDLVRDFCNQVGVERGVLKVWMHNNKNTM  253

Query  475  GKRDN  461
            GK+ +
Sbjct  254  GKKPD  258



>ref|XP_008443414.1| PREDICTED: zinc-finger homeodomain protein 9-like [Cucumis melo]
Length=298

 Score =   108 bits (269),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 57/64 (89%), Gaps = 0/64 (0%)
 Frame = -1

Query  655  RKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNTV  476
            RK FRTKFTQ QK +M +FAE++GWKIQK DE++I +FC ++GV+RGVLKVWMHNNKNT+
Sbjct  200  RKRFRTKFTQNQKERMYEFAEKVGWKIQKRDEDMIQEFCSDVGVDRGVLKVWMHNNKNTL  259

Query  475  GKRD  464
            GK+D
Sbjct  260  GKKD  263



>ref|XP_004147471.1| PREDICTED: transcription factor HB29-like [Cucumis sativus]
 ref|XP_004163533.1| PREDICTED: transcription factor HB29-like [Cucumis sativus]
 gb|KGN59574.1| hypothetical protein Csa_3G826680 [Cucumis sativus]
Length=298

 Score =   107 bits (268),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 57/64 (89%), Gaps = 0/64 (0%)
 Frame = -1

Query  655  RKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNTV  476
            RK FRTKFTQ QK +M +FAE++GWKIQK DE++I +FC ++GV+RGVLKVWMHNNKNT+
Sbjct  200  RKRFRTKFTQNQKERMYEFAEKVGWKIQKRDEDMIQEFCSDVGVDRGVLKVWMHNNKNTL  259

Query  475  GKRD  464
            GK+D
Sbjct  260  GKKD  263



>gb|KHN13618.1| ZF-HD homeobox protein [Glycine soja]
Length=163

 Score =   105 bits (261),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 46/65 (71%), Positives = 55/65 (85%), Gaps = 0/65 (0%)
 Frame = -1

Query  655  RKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNTV  476
            RK FRTKF+Q QK KM  FAE++GWKIQK DE+LI++FC E+GV+R VLKVWMHNNKNT 
Sbjct  25   RKRFRTKFSQEQKEKMHKFAEKVGWKIQKRDEDLIHEFCNEVGVDRSVLKVWMHNNKNTF  84

Query  475  GKRDN  461
             K+DN
Sbjct  85   AKKDN  89



>ref|XP_010257380.1| PREDICTED: zinc-finger homeodomain protein 9 [Nelumbo nucifera]
Length=300

 Score =   107 bits (268),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 46/65 (71%), Positives = 55/65 (85%), Gaps = 0/65 (0%)
 Frame = -1

Query  658  GRKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNT  479
            GRK FRTKF+Q QK KM  F+ER+GWK+QK DEE++ +FC EIGV +GVLKVWMHNNK+T
Sbjct  203  GRKRFRTKFSQEQKEKMHAFSERLGWKMQKTDEEVVEEFCNEIGVGKGVLKVWMHNNKHT  262

Query  478  VGKRD  464
             GKRD
Sbjct  263  FGKRD  267



>ref|XP_003543789.1| PREDICTED: transcription factor HB29-like [Glycine max]
Length=331

 Score =   107 bits (268),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 62/128 (48%), Positives = 78/128 (61%), Gaps = 7/128 (5%)
 Frame = -1

Query  655  RKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNTV  476
            RK FRTKFTQ QK KM +FA+++GWK+Q+ DEE++ +FC EIGV+RGVLKVWMHNNKNT 
Sbjct  185  RKRFRTKFTQEQKEKMHEFADKVGWKMQRRDEEMVMEFCNEIGVDRGVLKVWMHNNKNTF  244

Query  475  GKRDNIXTTPaaaaaADNGNAHSXGFDXGRVNSAPXTSDFNLRPES----NNNGSHSQNH  308
             K+DN+        A  + N  +     G V SA   S  ++        N NGS   NH
Sbjct  245  AKKDNLNGNSIGNVAIVSANGVA---PIGAVGSATVRSSVHVHEHEHGGINGNGSGDNNH  301

Query  307  YALHSGDV  284
              L S DV
Sbjct  302  NPLGSRDV  309



>ref|XP_011085755.1| PREDICTED: zinc-finger homeodomain protein 9 [Sesamum indicum]
Length=345

 Score =   107 bits (268),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 46/64 (72%), Positives = 56/64 (88%), Gaps = 0/64 (0%)
 Frame = -1

Query  655  RKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNTV  476
            RK FRTKFTQ QK KM +FAER+GWK+QK DE++I++FC EIGV++GV KVWMHNNKNT 
Sbjct  201  RKRFRTKFTQDQKEKMFEFAERVGWKMQKRDEDVISEFCSEIGVDKGVFKVWMHNNKNTF  260

Query  475  GKRD  464
            GK+D
Sbjct  261  GKKD  264



>ref|XP_010693250.1| PREDICTED: zinc-finger homeodomain protein 9-like [Beta vulgaris 
subsp. vulgaris]
Length=400

 Score =   108 bits (269),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 49/70 (70%), Positives = 56/70 (80%), Gaps = 1/70 (1%)
 Frame = -1

Query  655  RKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNTV  476
            RK FRTKFTQ QK KM DFAE++GWK+QK +E+++N FC EIGVERGV KVWMHNNKNT 
Sbjct  242  RKRFRTKFTQEQKDKMHDFAEKVGWKMQKTNEDMVNGFCNEIGVERGVFKVWMHNNKNTF  301

Query  475  GK-RDNIXTT  449
            GK R N   T
Sbjct  302  GKIRSNTTIT  311



>ref|XP_010258352.1| PREDICTED: zinc-finger homeodomain protein 9-like [Nelumbo nucifera]
Length=296

 Score =   107 bits (266),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 46/65 (71%), Positives = 56/65 (86%), Gaps = 0/65 (0%)
 Frame = -1

Query  658  GRKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNT  479
            GRK FRTKF+Q QK KM  F+ER+GWK+QK DEE++++FC EIGV +GVLKVWMHNNK+T
Sbjct  196  GRKRFRTKFSQEQKEKMYAFSERLGWKMQKSDEEVVDEFCNEIGVGKGVLKVWMHNNKHT  255

Query  478  VGKRD  464
             GKRD
Sbjct  256  FGKRD  260



>ref|XP_008341574.1| PREDICTED: zinc-finger homeodomain protein 10-like [Malus domestica]
Length=309

 Score =   107 bits (266),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 46/65 (71%), Positives = 54/65 (83%), Gaps = 0/65 (0%)
 Frame = -1

Query  658  GRKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNT  479
             RK FRTKFTQ QK KM  FAER+GWK+QK +EE++ +FC E+GVE+GVLKVWMHNNKNT
Sbjct  206  ARKRFRTKFTQDQKDKMHQFAERVGWKMQKREEEIVQEFCNEVGVEKGVLKVWMHNNKNT  265

Query  478  VGKRD  464
              KRD
Sbjct  266  FTKRD  270



>emb|CBI29005.3| unnamed protein product [Vitis vinifera]
Length=587

 Score =   109 bits (273),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 48/66 (73%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = -1

Query  658  GRKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNT  479
            GRK FRTKF+Q QK KM +FAER+GWK+QK DEEL+ +FC E+GV++GVLKVWMHNNKNT
Sbjct  101  GRKRFRTKFSQGQKKKMFEFAERVGWKMQKRDEELVAEFCNEVGVDKGVLKVWMHNNKNT  160

Query  478  VGKRDN  461
             GKRD+
Sbjct  161  FGKRDD  166



>ref|XP_011098625.1| PREDICTED: zinc-finger homeodomain protein 9-like [Sesamum indicum]
Length=325

 Score =   107 bits (267),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 56/64 (88%), Gaps = 0/64 (0%)
 Frame = -1

Query  655  RKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNTV  476
            RK FRTKFTQ QK KM +FAE++GWK+QK DE++I++FCREIGV++GV KVWMHNNKNT 
Sbjct  177  RKRFRTKFTQDQKEKMHEFAEKVGWKMQKRDEDVISEFCREIGVDKGVFKVWMHNNKNTF  236

Query  475  GKRD  464
             K+D
Sbjct  237  AKKD  240



>ref|XP_008467057.1| PREDICTED: zinc-finger homeodomain protein 10-like [Cucumis melo]
Length=315

 Score =   107 bits (266),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 45/65 (69%), Positives = 56/65 (86%), Gaps = 0/65 (0%)
 Frame = -1

Query  655  RKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNTV  476
            RK FRTKF+  QK KM DFAER+GWK+QK D++L+ DFC ++GVERGVLKVWMHNNKNT+
Sbjct  207  RKRFRTKFSNEQKEKMLDFAERVGWKMQKRDDDLVRDFCNQVGVERGVLKVWMHNNKNTM  266

Query  475  GKRDN  461
            GK+ +
Sbjct  267  GKKPD  271



>ref|XP_008379353.1| PREDICTED: zinc-finger homeodomain protein 9-like [Malus domestica]
Length=353

 Score =   107 bits (267),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 47/67 (70%), Positives = 54/67 (81%), Gaps = 0/67 (0%)
 Frame = -1

Query  658  GRKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNT  479
             RK FRTKFTQ QK KM  FAER+GWK+QK DEE++ +FC E GVE+GVLKVWMHNNKNT
Sbjct  208  ARKRFRTKFTQDQKEKMYQFAERVGWKMQKRDEEIVREFCNEAGVEKGVLKVWMHNNKNT  267

Query  478  VGKRDNI  458
              KRD +
Sbjct  268  FSKRDVL  274



>ref|XP_009376317.1| PREDICTED: zinc-finger homeodomain protein 9 [Pyrus x bretschneideri]
Length=323

 Score =   107 bits (266),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 46/65 (71%), Positives = 53/65 (82%), Gaps = 0/65 (0%)
 Frame = -1

Query  658  GRKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNT  479
             RK FRTKFTQ QK KM  FAER+GWK+QK DEE++ +FC E G+E+GVLKVWMHNNKNT
Sbjct  182  ARKRFRTKFTQDQKEKMYQFAERVGWKMQKRDEEIVQEFCNEAGIEKGVLKVWMHNNKNT  241

Query  478  VGKRD  464
              KRD
Sbjct  242  FSKRD  246



>ref|XP_002534012.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF28370.1| conserved hypothetical protein [Ricinus communis]
Length=335

 Score =   106 bits (265),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 55/64 (86%), Gaps = 0/64 (0%)
 Frame = -1

Query  655  RKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNTV  476
            RK FRTKF+Q QK +M +FAER+GWK+QK DEEL+ +FC E+GV++GVLKVWMHNNKNT 
Sbjct  217  RKRFRTKFSQTQKERMHEFAERVGWKMQKRDEELVQEFCNEVGVDKGVLKVWMHNNKNTF  276

Query  475  GKRD  464
             +RD
Sbjct  277  ARRD  280



>ref|XP_004304301.1| PREDICTED: zinc-finger homeodomain protein 9 [Fragaria vesca 
subsp. vesca]
Length=360

 Score =   106 bits (265),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 45/68 (66%), Positives = 57/68 (84%), Gaps = 0/68 (0%)
 Frame = -1

Query  655  RKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNTV  476
            RK FRTKF+Q QK KM  FAER+GWK+QK DE+++++FC EIGV++GVLKVWMHNNKNT 
Sbjct  201  RKRFRTKFSQEQKDKMFQFAERVGWKMQKRDEDIVHEFCNEIGVDKGVLKVWMHNNKNTF  260

Query  475  GKRDNIXT  452
             KRD + +
Sbjct  261  AKRDGVVS  268



>ref|XP_009787877.1| PREDICTED: zinc-finger homeodomain protein 9-like [Nicotiana 
sylvestris]
Length=358

 Score =   106 bits (265),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 47/64 (73%), Positives = 54/64 (84%), Gaps = 0/64 (0%)
 Frame = -1

Query  658  GRKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNT  479
            GRK FRTKFT  QK KM +FAER+GWK+QK DE+L+  FC EIGVE+GVLKVWMHNNKNT
Sbjct  214  GRKRFRTKFTPDQKVKMLEFAERVGWKMQKRDEDLVRSFCNEIGVEKGVLKVWMHNNKNT  273

Query  478  VGKR  467
             GK+
Sbjct  274  FGKK  277



>ref|XP_006602909.1| PREDICTED: transcription factor HB29-like [Glycine max]
Length=338

 Score =   106 bits (264),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 46/66 (70%), Positives = 55/66 (83%), Gaps = 0/66 (0%)
 Frame = -1

Query  658  GRKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNT  479
             RK FRTKF+Q QK KM  FAE++GWKIQK DE+LI++FC E+GV+R VLKVWMHNNKNT
Sbjct  199  SRKRFRTKFSQEQKEKMHKFAEKVGWKIQKRDEDLIHEFCNEVGVDRSVLKVWMHNNKNT  258

Query  478  VGKRDN  461
              K+DN
Sbjct  259  FAKKDN  264



>ref|XP_002324056.2| hypothetical protein POPTR_0017s11920g [Populus trichocarpa]
 ref|XP_006373321.1| hypothetical protein POPTR_0017s11920g [Populus trichocarpa]
 gb|EEF04189.2| hypothetical protein POPTR_0017s11920g [Populus trichocarpa]
 gb|ERP51118.1| hypothetical protein POPTR_0017s11920g [Populus trichocarpa]
Length=340

 Score =   106 bits (264),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 43/66 (65%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = -1

Query  655  RKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNTV  476
            RK FRTKF+Q QK +M  FAER+GWK+QK DE+L+ +FC E+GV+RGVLKVWMHNNKN++
Sbjct  209  RKRFRTKFSQSQKERMYQFAERVGWKMQKRDEDLVQEFCNEVGVDRGVLKVWMHNNKNSL  268

Query  475  GKRDNI  458
            GK++++
Sbjct  269  GKKEHL  274



>ref|XP_009620291.1| PREDICTED: zinc-finger homeodomain protein 9-like [Nicotiana 
tomentosiformis]
Length=361

 Score =   106 bits (264),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 62/135 (46%), Positives = 79/135 (59%), Gaps = 10/135 (7%)
 Frame = -1

Query  658  GRKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNK--  485
            GRK FRTKFTQ QK +M +FAE++ WKIQK DEELINDFC +IGVE+GVLKVWMHNNK  
Sbjct  222  GRKRFRTKFTQDQKERMLEFAEKVEWKIQKRDEELINDFCSKIGVEKGVLKVWMHNNKCK  281

Query  484  ---NTVGKRDNIXTTPaaaaaADNGNAHSXGFDXGRVNSAPXTSDFNLRPESNNNGSHSQ  314
                T     N   TP      +     +      R N+    S+F+L  ES+ +     
Sbjct  282  KDQATAAAAINTVATPNLLNGNNG----NGFGLISRNNTDTIASEFHLHHESSKDNDKDH  337

Query  313  NHYALHSGDVXAANG  269
            +H  LH+ D  +A+G
Sbjct  338  SHQ-LHNNDSVSAHG  351



>ref|XP_006363398.1| PREDICTED: transcription factor HB29-like [Solanum tuberosum]
Length=346

 Score =   105 bits (263),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 47/66 (71%), Positives = 56/66 (85%), Gaps = 0/66 (0%)
 Frame = -1

Query  658  GRKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNT  479
            GRK FRTKFT  QK KM + AERIGWK+QK DE+L+++FC EIGVE+GVLKVWMHNNKNT
Sbjct  198  GRKRFRTKFTPDQKVKMLELAERIGWKMQKRDEDLVSNFCNEIGVEKGVLKVWMHNNKNT  257

Query  478  VGKRDN  461
             GK+ +
Sbjct  258  FGKKSD  263



>ref|XP_007151228.1| hypothetical protein PHAVU_004G028600g [Phaseolus vulgaris]
 gb|ESW23222.1| hypothetical protein PHAVU_004G028600g [Phaseolus vulgaris]
Length=343

 Score =   105 bits (263),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 44/66 (67%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = -1

Query  655  RKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNTV  476
            RK FRTKF+Q QK KM +FA+++GWK+QK DE ++ +FC EIGV+RGVLKVWMHNNKNT+
Sbjct  197  RKRFRTKFSQEQKEKMHEFADKVGWKMQKRDENMVMEFCNEIGVDRGVLKVWMHNNKNTL  256

Query  475  GKRDNI  458
             K+DN+
Sbjct  257  AKKDNL  262



>ref|XP_006357697.1| PREDICTED: transcription factor HB29-like [Solanum tuberosum]
Length=307

 Score =   105 bits (262),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 44/65 (68%), Positives = 54/65 (83%), Gaps = 0/65 (0%)
 Frame = -1

Query  658  GRKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNT  479
            GRK +RTKFTQ QK KM +F+ER+GW++QK DEE+IN  C EI VE+GVLKVWMHNNKN 
Sbjct  196  GRKRYRTKFTQNQKEKMLEFSERVGWRMQKQDEEIINKLCHEISVEKGVLKVWMHNNKNN  255

Query  478  VGKRD  464
             G++D
Sbjct  256  FGRKD  260



>emb|CDX85230.1| BnaC07g25410D [Brassica napus]
Length=339

 Score =   105 bits (262),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 52/86 (60%), Positives = 62/86 (72%), Gaps = 1/86 (1%)
 Frame = -1

Query  655  RKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNTV  476
            RK FRTKF+Q QK KM +FA+RIGWKIQK DE+ + DFCRE+GV++GVLKVWMHNNKNT 
Sbjct  202  RKRFRTKFSQTQKDKMHEFADRIGWKIQKRDEDEVRDFCREVGVDKGVLKVWMHNNKNTF  261

Query  475  G-KRDNIXTTPaaaaaADNGNAHSXG  401
              +RD   +        DNG A S G
Sbjct  262  NTRRDQPFSGDTTVQKIDNGVAVSGG  287



>ref|XP_007139577.1| hypothetical protein PHAVU_008G041300g [Phaseolus vulgaris]
 gb|ESW11571.1| hypothetical protein PHAVU_008G041300g [Phaseolus vulgaris]
Length=326

 Score =   105 bits (261),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 44/65 (68%), Positives = 56/65 (86%), Gaps = 0/65 (0%)
 Frame = -1

Query  655  RKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNTV  476
            RK FRTKF+Q QK KM  FA+++GWK+QK DE+L+++FC EIGV+R VLKVWMHNNKNT+
Sbjct  198  RKRFRTKFSQEQKEKMHKFADKVGWKMQKRDEDLVHEFCNEIGVDRSVLKVWMHNNKNTL  257

Query  475  GKRDN  461
             K+DN
Sbjct  258  AKKDN  262



>ref|XP_009621030.1| PREDICTED: zinc-finger homeodomain protein 9-like [Nicotiana 
tomentosiformis]
Length=356

 Score =   104 bits (260),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 54/64 (84%), Gaps = 0/64 (0%)
 Frame = -1

Query  658  GRKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNT  479
            GRK FRTKFT  QK KM +FAER+GWK+QK DE+L+  FC +IG+E+GVLKVWMHNNKNT
Sbjct  211  GRKRFRTKFTPDQKVKMLEFAERVGWKMQKRDEDLVRSFCNQIGIEKGVLKVWMHNNKNT  270

Query  478  VGKR  467
             GK+
Sbjct  271  FGKK  274



>ref|XP_003618493.1| Zinc finger-homeodomain protein [Medicago truncatula]
Length=223

 Score =   102 bits (255),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 43/66 (65%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = -1

Query  655  RKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNTV  476
            RK FRTKFTQ QK KM +FA+++GWK+QK DEE++N FC E+GV+R VLKVWMHNNKNT+
Sbjct  109  RKRFRTKFTQEQKEKMHEFADKVGWKMQKRDEEMVNGFCNEVGVDRSVLKVWMHNNKNTL  168

Query  475  GKRDNI  458
            G++ ++
Sbjct  169  GRKLSL  174



>ref|XP_011010066.1| PREDICTED: zinc-finger homeodomain protein 9-like [Populus euphratica]
Length=335

 Score =   104 bits (259),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 42/66 (64%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = -1

Query  655  RKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNTV  476
            RK FRTKF+Q QK +M  FAER+GWK+QK DE+L+ +FC E+GV++GVLKVWMHNNKN++
Sbjct  202  RKRFRTKFSQSQKERMFQFAERVGWKMQKRDEDLVQEFCNEVGVDKGVLKVWMHNNKNSL  261

Query  475  GKRDNI  458
            GK++++
Sbjct  262  GKKEHL  267



>ref|XP_010088163.1| hypothetical protein L484_013608 [Morus notabilis]
 gb|EXB31975.1| hypothetical protein L484_013608 [Morus notabilis]
Length=195

 Score =   102 bits (253),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 45/65 (69%), Positives = 55/65 (85%), Gaps = 0/65 (0%)
 Frame = -1

Query  655  RKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNTV  476
            RK FRTKF+Q QK KM  FAE++GWK+QK DEEL+ +FC EIGV++GVLKVWMHNNKNT 
Sbjct  48   RKRFRTKFSQDQKEKMCQFAEKVGWKMQKRDEELVREFCGEIGVDKGVLKVWMHNNKNTF  107

Query  475  GKRDN  461
             K+D+
Sbjct  108  AKKDH  112



>emb|CDX86403.1| BnaA06g31200D [Brassica napus]
Length=344

 Score =   104 bits (259),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 51/86 (59%), Positives = 62/86 (72%), Gaps = 1/86 (1%)
 Frame = -1

Query  655  RKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNTV  476
            RK FRTKF+Q QK KM +FA+RIGWKIQK DE+ + DFCR++GV++GVLKVWMHNNKNT 
Sbjct  205  RKRFRTKFSQTQKDKMHEFADRIGWKIQKRDEDEVRDFCRDVGVDKGVLKVWMHNNKNTF  264

Query  475  G-KRDNIXTTPaaaaaADNGNAHSXG  401
              +RD   +        DNG A S G
Sbjct  265  NTRRDQPFSGDTTVQKIDNGVAVSGG  290



>ref|XP_003621193.1| ZF-HD homeobox protein [Medicago truncatula]
 gb|ABN05735.1| Homeobox domain, ZF-HD class; ZF-HD homeobox protein Cys/His-rich 
dimerisation region; Homeodomain-like [Medicago truncatula]
 gb|ABN08930.1| Homeobox domain, ZF-HD class; ZF-HD homeobox protein Cys/His-rich 
dimerisation region; Homeodomain-like [Medicago truncatula]
 gb|AES77411.1| homeobox domain, ZF-HD class protein [Medicago truncatula]
Length=341

 Score =   103 bits (258),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 44/65 (68%), Positives = 54/65 (83%), Gaps = 0/65 (0%)
 Frame = -1

Query  658  GRKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNT  479
             RK FRTKFTQ QK KM  FAE++GWK+QK D+E +++FC EIGV+R VLKVWMHNNKNT
Sbjct  219  SRKRFRTKFTQDQKDKMLKFAEKVGWKMQKKDDEFVHEFCNEIGVDRSVLKVWMHNNKNT  278

Query  478  VGKRD  464
            + KR+
Sbjct  279  LAKRE  283



>ref|XP_008230766.1| PREDICTED: zinc-finger homeodomain protein 9-like [Prunus mume]
Length=357

 Score =   103 bits (257),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 45/67 (67%), Positives = 52/67 (78%), Gaps = 0/67 (0%)
 Frame = -1

Query  658  GRKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNT  479
             RK  RTKF Q QK KM  FAER+GWK+QK DEE++ +FC EI V++GVLKVWMHNNKNT
Sbjct  209  ARKRIRTKFCQEQKDKMYQFAERVGWKMQKRDEEIVQEFCNEINVDKGVLKVWMHNNKNT  268

Query  478  VGKRDNI  458
              KRD I
Sbjct  269  FAKRDVI  275



>ref|XP_006395326.1| hypothetical protein EUTSA_v10004599mg [Eutrema salsugineum]
 gb|ESQ32612.1| hypothetical protein EUTSA_v10004599mg [Eutrema salsugineum]
Length=323

 Score =   102 bits (255),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = -1

Query  655  RKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNTV  476
            RK FRTKF+ +QK KM +FA+RIGWKIQK DEE + DFCREIGV++GVLKVWMHNNKNT 
Sbjct  192  RKRFRTKFSPIQKEKMHEFADRIGWKIQKRDEEEVRDFCREIGVDKGVLKVWMHNNKNTF  251

Query  475  GKR  467
              R
Sbjct  252  NNR  254



>gb|KDP27147.1| hypothetical protein JCGZ_19846 [Jatropha curcas]
Length=148

 Score = 99.4 bits (246),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 45/67 (67%), Positives = 53/67 (79%), Gaps = 0/67 (0%)
 Frame = -1

Query  664  MKGRKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNK  485
            +  RK FRTKF+Q QK  M   AER+GWK+QK DEELI +FC E+G ++GVLKVWMHNNK
Sbjct  25   VSARKRFRTKFSQDQKEIMYQVAERVGWKMQKRDEELIQEFCNEVGGDKGVLKVWMHNNK  84

Query  484  NTVGKRD  464
            NT GKRD
Sbjct  85   NTFGKRD  91



>ref|XP_004489395.1| PREDICTED: transcription factor HB29-like [Cicer arietinum]
Length=322

 Score =   102 bits (255),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 44/63 (70%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = -1

Query  655  RKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNTV  476
            RK FRTKFTQ QK KM +FAE +GWK+QK DEE +N FC E+GV+R VLKVWMHNNKNT+
Sbjct  212  RKRFRTKFTQEQKEKMHEFAESVGWKMQKRDEETVNGFCNEVGVDRSVLKVWMHNNKNTL  271

Query  475  GKR  467
            G++
Sbjct  272  GRK  274



>gb|AES74711.2| transcription factor HB29-like protein [Medicago truncatula]
Length=333

 Score =   102 bits (255),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 43/66 (65%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = -1

Query  655  RKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNTV  476
            RK FRTKFTQ QK KM +FA+++GWK+QK DEE++N FC E+GV+R VLKVWMHNNKNT+
Sbjct  222  RKRFRTKFTQEQKEKMHEFADKVGWKMQKRDEEMVNGFCNEVGVDRSVLKVWMHNNKNTL  281

Query  475  GKRDNI  458
            G++ ++
Sbjct  282  GRKLSL  287



>ref|XP_009151829.1| PREDICTED: zinc-finger homeodomain protein 9 [Brassica rapa]
Length=344

 Score =   102 bits (255),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 51/86 (59%), Positives = 61/86 (71%), Gaps = 1/86 (1%)
 Frame = -1

Query  655  RKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNTV  476
            RK FRTKF+Q QK KM +FA+RIGWKIQK DE  + DFCR++GV++GVLKVWMHNNKNT 
Sbjct  205  RKRFRTKFSQTQKDKMHEFADRIGWKIQKRDEGEVRDFCRDVGVDKGVLKVWMHNNKNTF  264

Query  475  G-KRDNIXTTPaaaaaADNGNAHSXG  401
              +RD   +        DNG A S G
Sbjct  265  NTRRDQPFSGDTTVQKIDNGVAVSGG  290



>ref|XP_011097503.1| PREDICTED: zinc-finger homeodomain protein 2-like [Sesamum indicum]
Length=249

 Score =   101 bits (251),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = -1

Query  658  GRKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNT  479
            G+K FRTKFTQ QK KM +FAER+GWKIQK DEE++  FC E+G++R VLKVWMHNNK+T
Sbjct  183  GKKRFRTKFTQEQKDKMLNFAERLGWKIQKQDEEMVQQFCSELGIKRHVLKVWMHNNKHT  242

Query  478  VG  473
            +G
Sbjct  243  LG  244



>ref|XP_011070997.1| PREDICTED: zinc-finger homeodomain protein 10 [Sesamum indicum]
Length=295

 Score =   102 bits (253),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 44/65 (68%), Positives = 54/65 (83%), Gaps = 0/65 (0%)
 Frame = -1

Query  658  GRKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNT  479
            GRK FRTKF+Q QK KM  F+E++GWK+QK DE  + +FC+EIGV +GVLKVWMHNNKNT
Sbjct  179  GRKRFRTKFSQEQKEKMHSFSEKLGWKMQKSDEVAVREFCQEIGVPKGVLKVWMHNNKNT  238

Query  478  VGKRD  464
             GK+D
Sbjct  239  FGKKD  243



>gb|AAP44422.1| ZF-HD homeobox protein-like protein, partial [Lactuca sativa]
 gb|AAP44423.1| ZF-HD homeobox protein-like protein, partial [Lactuca sativa]
 gb|AAP44424.1| ZF-HD homeobox protein-like protein, partial [Lactuca sativa]
 gb|AAP44425.1| ZF-HD homeobox protein-like protein, partial [Lactuca serriola]
Length=132

 Score = 98.6 bits (244),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 44/71 (62%), Positives = 54/71 (76%), Gaps = 0/71 (0%)
 Frame = -1

Query  658  GRKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNT  479
            GRK FRTKF+  QK KM  FAE++GWK+Q+ D++LI DFC EIG+ RG+ KVWMHNNKN 
Sbjct  26   GRKRFRTKFSLDQKEKMTIFAEKLGWKMQRCDDKLIADFCNEIGIRRGIFKVWMHNNKNN  85

Query  478  VGKRDNIXTTP  446
             GKR+   TT 
Sbjct  86   FGKREKDITTT  96



>ref|XP_009797863.1| PREDICTED: zinc-finger homeodomain protein 9-like [Nicotiana 
sylvestris]
Length=358

 Score =   102 bits (254),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 44/58 (76%), Positives = 51/58 (88%), Gaps = 0/58 (0%)
 Frame = -1

Query  658  GRKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNK  485
            GRK FRTKFTQ QK +M +FAE++ WKIQK DEELI+DFC +IGVE+GVLKVWMHNNK
Sbjct  219  GRKRFRTKFTQDQKERMLEFAEKVEWKIQKRDEELISDFCSKIGVEKGVLKVWMHNNK  276



>ref|XP_006482594.1| PREDICTED: myb-like protein I-like [Citrus sinensis]
 gb|KDO72568.1| hypothetical protein CISIN_1g016972mg [Citrus sinensis]
Length=379

 Score =   102 bits (254),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 55/64 (86%), Gaps = 0/64 (0%)
 Frame = -1

Query  655  RKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNTV  476
            RK FRTKF+Q QK KM +FAER+GWK+QK D++L+++FC E+GV+R VLKVWMHNNK+T 
Sbjct  233  RKRFRTKFSQSQKEKMFEFAERVGWKMQKRDDDLVHEFCNEVGVDRTVLKVWMHNNKSTF  292

Query  475  GKRD  464
             KRD
Sbjct  293  AKRD  296



>dbj|BAE99230.1| hypothetical protein [Arabidopsis thaliana]
Length=334

 Score =   102 bits (253),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 54/64 (84%), Gaps = 0/64 (0%)
 Frame = -1

Query  655  RKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNTV  476
            RK FRTKF+Q QK KM +FAER+GWK+QK DE+ + DFCR+IGV++ VLKVWMHNNKNT 
Sbjct  200  RKRFRTKFSQFQKEKMHEFAERVGWKMQKRDEDDVRDFCRQIGVDKSVLKVWMHNNKNTF  259

Query  475  GKRD  464
             +RD
Sbjct  260  NRRD  263



>gb|EPS61017.1| hypothetical protein M569_13783, partial [Genlisea aurea]
Length=244

 Score =   100 bits (250),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 42/64 (66%), Positives = 55/64 (86%), Gaps = 0/64 (0%)
 Frame = -1

Query  658  GRKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNT  479
            G+K FRTKFTQ QK KM +F+ER+GW+IQK DEEL+  FC E+G++R VLKVWMHNNK+T
Sbjct  181  GKKRFRTKFTQEQKDKMLNFSERLGWRIQKQDEELVQQFCHEVGIKRHVLKVWMHNNKHT  240

Query  478  VGKR  467
            +G++
Sbjct  241  LGEK  244



>gb|AAP44426.1| ZF-HD homeobox protein-like protein, partial [Lactuca saligna]
 gb|AAP44427.1| ZF-HD homeobox protein-like protein, partial [Lactuca saligna]
 gb|AAP44428.1| ZF-HD homeobox protein-like protein, partial [Lactuca saligna]
Length=132

 Score = 98.2 bits (243),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 43/65 (66%), Positives = 52/65 (80%), Gaps = 0/65 (0%)
 Frame = -1

Query  658  GRKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNT  479
            GRK FRTKF+  QK KM  FAER+GWK+Q+ D++LI DFC EIG+ RG+ KVWMHNNKN 
Sbjct  26   GRKRFRTKFSLDQKEKMTIFAERLGWKMQRCDDKLIADFCNEIGIRRGIFKVWMHNNKNN  85

Query  478  VGKRD  464
             GKR+
Sbjct  86   FGKRE  90



>ref|NP_568570.1| homeobox protein 23 [Arabidopsis thaliana]
 sp|Q9FIW9.1|ZHD10_ARATH RecName: Full=Zinc-finger homeodomain protein 10; Short=AtZHD10; 
AltName: Full=Homeobox protein 23; Short=AtHB-23 [Arabidopsis 
thaliana]
 dbj|BAB11382.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAM13855.1| unknown protein [Arabidopsis thaliana]
 gb|AAM51422.1| unknown protein [Arabidopsis thaliana]
 gb|AED94472.1| homeobox protein 23 [Arabidopsis thaliana]
Length=334

 Score =   102 bits (253),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 54/64 (84%), Gaps = 0/64 (0%)
 Frame = -1

Query  655  RKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNTV  476
            RK FRTKF+Q QK KM +FAER+GWK+QK DE+ + DFCR+IGV++ VLKVWMHNNKNT 
Sbjct  200  RKRFRTKFSQFQKEKMHEFAERVGWKMQKRDEDDVRDFCRQIGVDKSVLKVWMHNNKNTF  259

Query  475  GKRD  464
             +RD
Sbjct  260  NRRD  263



>ref|XP_008220812.1| PREDICTED: zinc-finger homeodomain protein 5 isoform X1 [Prunus 
mume]
Length=356

 Score =   102 bits (253),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 43/71 (61%), Positives = 56/71 (79%), Gaps = 0/71 (0%)
 Frame = -1

Query  658  GRKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNT  479
             +K FRTKFTQ QK +M +FAE++GW+IQK DEE +  FC E+GV+R VL+VWMHNNKN+
Sbjct  261  SKKRFRTKFTQEQKERMTEFAEKVGWRIQKQDEEEVERFCSEVGVKRQVLRVWMHNNKNS  320

Query  478  VGKRDNIXTTP  446
              K+ +I TTP
Sbjct  321  AKKQSDILTTP  331



>ref|XP_008220815.1| PREDICTED: zinc-finger homeodomain protein 5 isoform X2 [Prunus 
mume]
 ref|XP_008220816.1| PREDICTED: zinc-finger homeodomain protein 5 isoform X2 [Prunus 
mume]
Length=350

 Score =   102 bits (253),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 43/71 (61%), Positives = 56/71 (79%), Gaps = 0/71 (0%)
 Frame = -1

Query  658  GRKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNT  479
             +K FRTKFTQ QK +M +FAE++GW+IQK DEE +  FC E+GV+R VL+VWMHNNKN+
Sbjct  255  SKKRFRTKFTQEQKERMTEFAEKVGWRIQKQDEEEVERFCSEVGVKRQVLRVWMHNNKNS  314

Query  478  VGKRDNIXTTP  446
              K+ +I TTP
Sbjct  315  AKKQSDILTTP  325



>ref|XP_002870762.1| hypothetical protein ARALYDRAFT_494014 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47021.1| hypothetical protein ARALYDRAFT_494014 [Arabidopsis lyrata subsp. 
lyrata]
Length=327

 Score =   101 bits (252),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 54/64 (84%), Gaps = 0/64 (0%)
 Frame = -1

Query  655  RKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNTV  476
            RK FRTKF+Q QK KM +FAER+GWK+QK DE+ + DFCR+IGV++ VLKVWMHNNKNT 
Sbjct  195  RKRFRTKFSQFQKEKMHEFAERLGWKMQKRDEDDVRDFCRQIGVDKSVLKVWMHNNKNTF  254

Query  475  GKRD  464
             +RD
Sbjct  255  NRRD  258



>gb|AAO62943.1| ZF-HD homeobox protein-like protein [Lactuca sativa]
 gb|AAO62944.1| ZF-HD homeobox protein-like protein, partial [Lactuca sativa]
Length=128

 Score = 97.8 bits (242),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 44/71 (62%), Positives = 54/71 (76%), Gaps = 0/71 (0%)
 Frame = -1

Query  658  GRKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNT  479
            GRK FRTKF+  QK KM  FAE++GWK+Q+ D++LI DFC EIG+ RG+ KVWMHNNKN 
Sbjct  20   GRKRFRTKFSLDQKEKMTIFAEKLGWKMQRCDDKLIADFCNEIGIRRGIFKVWMHNNKNN  79

Query  478  VGKRDNIXTTP  446
             GKR+   TT 
Sbjct  80   FGKREKDITTT  90



>gb|AAM64462.1| unknown [Arabidopsis thaliana]
Length=333

 Score =   101 bits (252),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 54/64 (84%), Gaps = 0/64 (0%)
 Frame = -1

Query  655  RKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNTV  476
            RK FRTKF+Q QK KM +FAER+GWK+QK D++ + DFCR+IGV++ VLKVWMHNNKNT 
Sbjct  199  RKRFRTKFSQFQKEKMHEFAERVGWKMQKRDZDDVRDFCRQIGVDKSVLKVWMHNNKNTF  258

Query  475  GKRD  464
             +RD
Sbjct  259  NRRD  262



>gb|EPS58358.1| hypothetical protein M569_16456, partial [Genlisea aurea]
Length=195

 Score = 99.4 bits (246),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 42/64 (66%), Positives = 54/64 (84%), Gaps = 0/64 (0%)
 Frame = -1

Query  655  RKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNTV  476
            RK FRTKF+Q QK KM + AE++GWK+QK D++LIN+ C +IGV++GV KVWMHNNKNT 
Sbjct  125  RKRFRTKFSQFQKVKMLELAEKVGWKMQKRDDDLINESCSDIGVDKGVFKVWMHNNKNTF  184

Query  475  GKRD  464
            GK+D
Sbjct  185  GKKD  188



>ref|XP_011100018.1| PREDICTED: zinc-finger homeodomain protein 1-like [Sesamum indicum]
Length=215

 Score = 99.8 bits (247),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = -1

Query  658  GRKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNT  479
            G+K FRTKFTQ QK KM + AER+ WKIQK DEEL+  FC E+GV+R VLKVWMHNNK+T
Sbjct  151  GKKRFRTKFTQEQKDKMLNLAERLDWKIQKQDEELVQQFCSEVGVKRHVLKVWMHNNKHT  210

Query  478  VGKR  467
            +GK+
Sbjct  211  LGKK  214



>ref|XP_006431147.1| hypothetical protein CICLE_v10011968mg [Citrus clementina]
 gb|ESR44387.1| hypothetical protein CICLE_v10011968mg [Citrus clementina]
Length=379

 Score =   101 bits (252),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 54/64 (84%), Gaps = 0/64 (0%)
 Frame = -1

Query  655  RKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNTV  476
            RK FRTKF+Q QK KM +FAER+GWK+QK D++L++ FC E+GV+R VLKVWMHNNK+T 
Sbjct  232  RKRFRTKFSQSQKEKMFEFAERVGWKMQKRDDDLVHQFCNEVGVDRTVLKVWMHNNKSTF  291

Query  475  GKRD  464
             KRD
Sbjct  292  AKRD  295



>ref|XP_009111615.1| PREDICTED: zinc-finger homeodomain protein 9-like [Brassica rapa]
Length=309

 Score =   101 bits (251),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 51/90 (57%), Positives = 61/90 (68%), Gaps = 1/90 (1%)
 Frame = -1

Query  655  RKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNTV  476
            RK FRTKF+Q QK KM +FA+RIGWK QK DE+ + DFCRE+GV++GVLKVWMHNNKNT 
Sbjct  185  RKRFRTKFSQAQKEKMHEFADRIGWKFQKRDEDDVRDFCREVGVDKGVLKVWMHNNKNTF  244

Query  475  -GKRDNIXTTPaaaaaADNGNAHSXGFDXG  389
              +RD            DNG A +   D G
Sbjct  245  NNRRDQPVAGGTTVHCVDNGVAVNNAEDDG  274



>ref|XP_002273802.1| PREDICTED: zinc-finger homeodomain protein 11 [Vitis vinifera]
Length=326

 Score =   101 bits (251),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 44/65 (68%), Positives = 54/65 (83%), Gaps = 0/65 (0%)
 Frame = -1

Query  658  GRKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNT  479
            GRK FRTKF+Q QK KM  F+E++GWK+QK DE L+ +FC E+GV +GVLKVWMHNNK+T
Sbjct  201  GRKRFRTKFSQEQKEKMFSFSEKLGWKMQKSDEGLVEEFCNEVGVGKGVLKVWMHNNKHT  260

Query  478  VGKRD  464
             GKRD
Sbjct  261  FGKRD  265



>emb|CDY20008.1| BnaA09g02430D [Brassica napus]
Length=281

 Score =   100 bits (250),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 44/63 (70%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = -1

Query  655  RKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNTV  476
            RK FRTKF+Q QK KM +FA+RIGWK QK DE+ + DFCRE+GV++GVLKVWMHNNKNT 
Sbjct  157  RKRFRTKFSQAQKEKMHEFADRIGWKFQKRDEDDVRDFCREVGVDKGVLKVWMHNNKNTF  216

Query  475  GKR  467
              R
Sbjct  217  NNR  219



>ref|XP_006405598.1| hypothetical protein EUTSA_v10028098mg [Eutrema salsugineum]
 dbj|BAJ34518.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ47051.1| hypothetical protein EUTSA_v10028098mg [Eutrema salsugineum]
Length=320

 Score =   100 bits (250),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 54/64 (84%), Gaps = 0/64 (0%)
 Frame = -1

Query  655  RKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNTV  476
            RK FRTKF+Q QK KM +FA+R+GWK+QK DE+ + DFCR+IGV++ VLKVWMHNNKNT 
Sbjct  187  RKRFRTKFSQFQKEKMHEFADRVGWKMQKRDEDDVRDFCRQIGVDKSVLKVWMHNNKNTF  246

Query  475  GKRD  464
             +RD
Sbjct  247  NRRD  250



>gb|EPS70696.1| hypothetical protein M569_04063, partial [Genlisea aurea]
Length=242

 Score = 99.8 bits (247),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 42/65 (65%), Positives = 52/65 (80%), Gaps = 0/65 (0%)
 Frame = -1

Query  658  GRKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNT  479
             RK FRTKFTQ QK KM + AE++GWK+QK DE+LI  FC +IGV++ V +VWMHNNKNT
Sbjct  178  SRKRFRTKFTQFQKDKMLELAEKVGWKMQKRDEDLIAQFCCDIGVDKAVFRVWMHNNKNT  237

Query  478  VGKRD  464
             GK+D
Sbjct  238  FGKKD  242



>ref|XP_007157626.1| hypothetical protein PHAVU_002G085400g [Phaseolus vulgaris]
 gb|ESW29620.1| hypothetical protein PHAVU_002G085400g [Phaseolus vulgaris]
Length=264

 Score =   100 bits (248),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 52/64 (81%), Gaps = 0/64 (0%)
 Frame = -1

Query  658  GRKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNT  479
            G+K FRTKF+Q QK KM +F+E++GW++QK DE L+ DFC EIGV RGV KVWMHNNKNT
Sbjct  172  GKKRFRTKFSQEQKEKMQNFSEKLGWRMQKGDEGLVQDFCNEIGVSRGVFKVWMHNNKNT  231

Query  478  VGKR  467
              KR
Sbjct  232  CRKR  235



>gb|KHN05023.1| ZF-HD homeobox protein [Glycine soja]
Length=190

 Score = 98.6 bits (244),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 45/66 (68%), Positives = 52/66 (79%), Gaps = 0/66 (0%)
 Frame = -1

Query  661  KGRKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKN  482
            K +K FRTKFTQ QK KM  FAER GW+IQK DE L+  FC+EIG++R VLKVWMHNNKN
Sbjct  121  KVKKRFRTKFTQEQKEKMLAFAERAGWRIQKLDESLVQKFCQEIGIKRRVLKVWMHNNKN  180

Query  481  TVGKRD  464
            T  KR+
Sbjct  181  TFAKRN  186



>ref|XP_010936702.1| PREDICTED: zinc-finger homeodomain protein 6-like [Elaeis guineensis]
Length=293

 Score =   100 bits (249),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 43/67 (64%), Positives = 53/67 (79%), Gaps = 0/67 (0%)
 Frame = -1

Query  667  HMKGRKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNN  488
            +M  +K FRTKFT  QK +M DFAER+GW+IQK DE L+ DFC E+GV R VLKVWMHNN
Sbjct  217  YMASKKRFRTKFTAEQKERMLDFAERMGWRIQKQDEALVEDFCAEVGVSRQVLKVWMHNN  276

Query  487  KNTVGKR  467
            K+T+ K+
Sbjct  277  KHTIRKQ  283



>ref|XP_003555538.1| PREDICTED: ZF-HD homeobox protein At4g24660-like [Glycine max]
Length=200

 Score = 98.6 bits (244),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 45/66 (68%), Positives = 52/66 (79%), Gaps = 0/66 (0%)
 Frame = -1

Query  661  KGRKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKN  482
            K +K FRTKFTQ QK KM  FAER GW+IQK DE L+  FC+EIG++R VLKVWMHNNKN
Sbjct  131  KVKKRFRTKFTQEQKEKMLAFAERAGWRIQKLDESLVQKFCQEIGIKRRVLKVWMHNNKN  190

Query  481  TVGKRD  464
            T  KR+
Sbjct  191  TFAKRN  196



>ref|XP_004238801.1| PREDICTED: zinc-finger homeodomain protein 10-like [Solanum lycopersicum]
Length=297

 Score =   100 bits (249),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 43/65 (66%), Positives = 53/65 (82%), Gaps = 0/65 (0%)
 Frame = -1

Query  658  GRKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNT  479
            GRK FRTKFT  QK KM  F+E++GWK+QK DE  +++FC EIGV +GVL+VWMHNNKNT
Sbjct  171  GRKRFRTKFTAEQKEKMHSFSEKLGWKLQKCDEAAVDEFCNEIGVGKGVLRVWMHNNKNT  230

Query  478  VGKRD  464
             GK+D
Sbjct  231  FGKKD  235



>emb|CAC34413.1| ZF-HD homeobox protein [Flaveria trinervia]
Length=263

 Score = 99.8 bits (247),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 41/67 (61%), Positives = 54/67 (81%), Gaps = 0/67 (0%)
 Frame = -1

Query  664  MKGRKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNK  485
            + GRK FRTKF+Q QK KM  FAE++GWK+Q+ D++++ DFC EIG+ R VLKVWMHNNK
Sbjct  159  ISGRKRFRTKFSQDQKEKMLTFAEKVGWKLQRCDDKMVADFCSEIGIRRRVLKVWMHNNK  218

Query  484  NTVGKRD  464
            NT  K++
Sbjct  219  NTSAKKE  225



>gb|ABK22835.1| unknown [Picea sitchensis]
Length=249

 Score = 99.8 bits (247),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 42/65 (65%), Positives = 55/65 (85%), Gaps = 0/65 (0%)
 Frame = -1

Query  655  RKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNTV  476
            +K FRTKFTQ QK +M DFAE++GW+IQK DE+ +  FC++IGV+R VLKVWMHNNKNT+
Sbjct  185  KKRFRTKFTQEQKDRMLDFAEKVGWRIQKHDEQAVQQFCQDIGVKRRVLKVWMHNNKNTL  244

Query  475  GKRDN  461
            GK+ +
Sbjct  245  GKKSD  249



>emb|CDY00104.1| BnaC09g01970D [Brassica napus]
Length=312

 Score =   100 bits (248),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 44/63 (70%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = -1

Query  655  RKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNTV  476
            RK FRTKF+Q QK KM +FA+RIGWK QK DE+ + DFCRE+GV++GVLKVWMHNNKNT 
Sbjct  188  RKRFRTKFSQAQKEKMHEFADRIGWKFQKRDEDDVRDFCREVGVDKGVLKVWMHNNKNTF  247

Query  475  GKR  467
              R
Sbjct  248  NNR  250



>ref|XP_002305381.2| hypothetical protein POPTR_0004s12500g [Populus trichocarpa]
 gb|EEE85892.2| hypothetical protein POPTR_0004s12500g [Populus trichocarpa]
Length=334

 Score =   100 bits (248),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 40/66 (61%), Positives = 55/66 (83%), Gaps = 0/66 (0%)
 Frame = -1

Query  655  RKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNTV  476
            RK FRTKF+Q QK +M  FAE++GWK+QK DE+L+ +FC E+GV+R  LKVWMHNNKN+ 
Sbjct  213  RKRFRTKFSQSQKERMHQFAEKVGWKMQKRDEDLVQEFCNEVGVDRSALKVWMHNNKNSF  272

Query  475  GKRDNI  458
            GK++++
Sbjct  273  GKKEHL  278



>gb|AAT39967.1| Putative ZF-HD homeobox protein, identical [Solanum demissum]
Length=291

 Score = 99.8 bits (247),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 42/65 (65%), Positives = 53/65 (82%), Gaps = 0/65 (0%)
 Frame = -1

Query  658  GRKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNT  479
            GRK FRTKFT  QK KM  F+E++GWK+QK DE  +++FC EIGV + VL+VWMHNNKNT
Sbjct  165  GRKRFRTKFTAEQKEKMHSFSEKLGWKLQKCDETAVDEFCNEIGVGKSVLRVWMHNNKNT  224

Query  478  VGKRD  464
            +GK+D
Sbjct  225  IGKKD  229



>ref|XP_009788342.1| PREDICTED: zinc-finger homeodomain protein 9-like [Nicotiana 
sylvestris]
Length=265

 Score = 99.4 bits (246),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 42/66 (64%), Positives = 53/66 (80%), Gaps = 0/66 (0%)
 Frame = -1

Query  658  GRKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNT  479
            GRK FRTKFTQ QK KM  F+E++GWK+QK DE  + +FC E+GV +GVL+VWMHNNKNT
Sbjct  158  GRKRFRTKFTQEQKEKMHSFSEKLGWKLQKCDEAKVEEFCNEVGVGKGVLRVWMHNNKNT  217

Query  478  VGKRDN  461
              K+D+
Sbjct  218  FAKKDD  223



>ref|XP_006366102.1| PREDICTED: transcription factor HB29-like [Solanum tuberosum]
Length=287

 Score = 99.4 bits (246),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 42/65 (65%), Positives = 53/65 (82%), Gaps = 0/65 (0%)
 Frame = -1

Query  658  GRKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNT  479
            GRK FRTKFT  QK KM  F+E++GWK+QK DE  +++FC EIGV + VL+VWMHNNKNT
Sbjct  165  GRKRFRTKFTAEQKEKMHSFSEKLGWKLQKCDETAVDEFCNEIGVGKSVLRVWMHNNKNT  224

Query  478  VGKRD  464
            +GK+D
Sbjct  225  IGKKD  229



>ref|XP_004233362.1| PREDICTED: zinc-finger homeodomain protein 9 [Solanum lycopersicum]
Length=331

 Score = 99.8 bits (247),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 53/95 (56%), Positives = 64/95 (67%), Gaps = 9/95 (9%)
 Frame = -1

Query  658  GRKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNT  479
            GRK FRTKFT  QK KM +FAE++ WK+QK DE+L+N+FC EIGVE+GVLKVWMHNNK T
Sbjct  189  GRKRFRTKFTPDQKIKMLEFAEKVEWKMQKRDEDLVNNFCNEIGVEKGVLKVWMHNNKTT  248

Query  478  --VGKRDNIXTTPaaaaaADNGNAHSXGFDXGRVN  380
               GK+ +   T       DNG+ H  G     VN
Sbjct  249  SISGKKLDQPNT-------DNGHNHQNGNSNYTVN  276



>gb|EPS73952.1| hypothetical protein M569_00810, partial [Genlisea aurea]
Length=199

 Score = 97.8 bits (242),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 42/67 (63%), Positives = 51/67 (76%), Gaps = 0/67 (0%)
 Frame = -1

Query  664  MKGRKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNK  485
            + GRK FRTKF+Q QK KM  F+E+IGWK+QK D+  + DFC EIGV RGV KVWMHNNK
Sbjct  133  LSGRKRFRTKFSQEQKDKMHSFSEKIGWKMQKCDDSEVRDFCSEIGVSRGVFKVWMHNNK  192

Query  484  NTVGKRD  464
              + K+D
Sbjct  193  TLIAKKD  199



>gb|ABO92969.1| ZF-HD homeobox domain-containing protein [Solanum tuberosum]
Length=285

 Score = 99.4 bits (246),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 42/65 (65%), Positives = 53/65 (82%), Gaps = 0/65 (0%)
 Frame = -1

Query  658  GRKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNT  479
            GRK FRTKFT  QK KM  F+E++GWK+QK DE  +++FC EIGV + VL+VWMHNNKNT
Sbjct  159  GRKRFRTKFTAEQKEKMHSFSEKLGWKLQKCDETAVDEFCNEIGVGKNVLRVWMHNNKNT  218

Query  478  VGKRD  464
            +GK+D
Sbjct  219  IGKKD  223



>emb|CAC34408.1| ZF-HD homeobox protein [Flaveria bidentis]
Length=241

 Score = 98.6 bits (244),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 41/67 (61%), Positives = 55/67 (82%), Gaps = 0/67 (0%)
 Frame = -1

Query  664  MKGRKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNK  485
            + GRK FRTKF+Q QK KM  FAE++GWK+Q+ D++++ DFC EIG+ R VLKVWMHNNK
Sbjct  137  ISGRKRFRTKFSQDQKEKMLTFAEKVGWKLQRCDDKMVADFCSEIGIRRRVLKVWMHNNK  196

Query  484  NTVGKRD  464
            NT+ K++
Sbjct  197  NTLAKKE  203



>ref|XP_006357111.1| PREDICTED: transcription factor HB29-like [Solanum tuberosum]
Length=329

 Score = 99.8 bits (247),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 60/138 (43%), Positives = 79/138 (57%), Gaps = 8/138 (6%)
 Frame = -1

Query  658  GRKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNT  479
            GRK FRTKFT  QK KM  FAE++ WK+QK DE+L+N+FC EIGVE+GVLKVWMHNNK T
Sbjct  187  GRKRFRTKFTPDQKMKMLKFAEKVEWKMQKRDEDLVNNFCNEIGVEKGVLKVWMHNNKTT  246

Query  478  --VGKRDNIXTTPaaaaaADNGNAHSXGFDXGRVNSAPXT------SDFNLRPESNNNGS  323
               GK+ +   T        N N    GF     N+          S+F++  ES+ N  
Sbjct  247  SVSGKKLDQPITGNGDHQNGNTNNIVNGFCIVSRNNTTHPDQNNTDSEFHIHHESSMNDD  306

Query  322  HSQNHYALHSGDVXAANG  269
            + + H +  + +V   NG
Sbjct  307  NKKEHLSFDANNVVVTNG  324



>gb|ADK63402.1| homeobox domain zinc finger protein [Brassica rapa]
Length=163

 Score = 96.7 bits (239),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 41/64 (64%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = -1

Query  655  RKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNTV  476
            RK FRTKF+Q QK KM +FA+R+GWK+QK DE+ + +FCR+IGV++ VLKVWMHNNKN  
Sbjct  28   RKRFRTKFSQFQKEKMHEFADRVGWKMQKRDEDDVREFCRQIGVDKSVLKVWMHNNKNNF  87

Query  475  GKRD  464
             +RD
Sbjct  88   NRRD  91



>ref|XP_006373320.1| hypothetical protein POPTR_0017s11920g [Populus trichocarpa]
 gb|ERP51117.1| hypothetical protein POPTR_0017s11920g [Populus trichocarpa]
Length=286

 Score = 99.4 bits (246),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 41/60 (68%), Positives = 52/60 (87%), Gaps = 0/60 (0%)
 Frame = -1

Query  655  RKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNTV  476
            RK FRTKF+Q QK +M  FAER+GWK+QK DE+L+ +FC E+GV+RGVLKVWMHNNKN++
Sbjct  209  RKRFRTKFSQSQKERMYQFAERVGWKMQKRDEDLVQEFCNEVGVDRGVLKVWMHNNKNSL  268



>ref|XP_003517792.1| PREDICTED: transcription factor HB29-like [Glycine max]
Length=296

 Score = 99.4 bits (246),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 41/67 (61%), Positives = 54/67 (81%), Gaps = 0/67 (0%)
 Frame = -1

Query  658  GRKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNT  479
            G+K  RTKF+  QK KM +FAE++GW++QK DE L+ DFC+EIGV RGV KVWMHNNKNT
Sbjct  198  GKKRHRTKFSHEQKEKMHNFAEKLGWRMQKGDEGLVQDFCKEIGVSRGVFKVWMHNNKNT  257

Query  478  VGKRDNI  458
             G++ ++
Sbjct  258  SGRKKSL  264



>ref|XP_006285795.1| hypothetical protein CARUB_v10007269mg [Capsella rubella]
 gb|EOA18693.1| hypothetical protein CARUB_v10007269mg [Capsella rubella]
Length=341

 Score = 99.8 bits (247),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 54/64 (84%), Gaps = 0/64 (0%)
 Frame = -1

Query  655  RKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNTV  476
            RK FRTKF+Q QK KM +FAER+GWK+QK DE+ + +FCR+IGV++ VLKVWMHNNKNT 
Sbjct  204  RKRFRTKFSQFQKEKMHEFAERLGWKMQKRDEDDVREFCRQIGVDKSVLKVWMHNNKNTF  263

Query  475  GKRD  464
             +RD
Sbjct  264  NRRD  267



>ref|XP_001777987.1| predicted protein [Physcomitrella patens]
 gb|EDQ57200.1| predicted protein [Physcomitrella patens]
Length=165

 Score = 96.7 bits (239),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 44/66 (67%), Positives = 53/66 (80%), Gaps = 0/66 (0%)
 Frame = -1

Query  664  MKGRKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNK  485
            + GRK FRTKFT  QK KM  FAE++GWKIQK DE  + +FC E+GV+R VLKVWMHNNK
Sbjct  98   IMGRKRFRTKFTNEQKEKMGVFAEKLGWKIQKHDEAAVQEFCAEVGVKRHVLKVWMHNNK  157

Query  484  NTVGKR  467
            NT+GK+
Sbjct  158  NTIGKK  163



>gb|KHN01227.1| ZF-HD homeobox protein [Glycine soja]
Length=116

 Score = 95.5 bits (236),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 41/67 (61%), Positives = 54/67 (81%), Gaps = 0/67 (0%)
 Frame = -1

Query  658  GRKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNT  479
            G+K  RTKF+  QK KM +FAE++GW++QK DE L+ DFC+EIGV RGV KVWMHNNKNT
Sbjct  18   GKKRHRTKFSHEQKEKMHNFAEKLGWRMQKGDEGLVQDFCKEIGVSRGVFKVWMHNNKNT  77

Query  478  VGKRDNI  458
             G++ ++
Sbjct  78   SGRKKSL  84



>ref|XP_011010943.1| PREDICTED: zinc-finger homeodomain protein 9-like [Populus euphratica]
Length=324

 Score = 99.4 bits (246),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 40/66 (61%), Positives = 55/66 (83%), Gaps = 0/66 (0%)
 Frame = -1

Query  655  RKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNTV  476
            RK FRTKF+Q QK +M  FAE++GWK+QK DE+L+ +FC E+GV+R  LKVWMHNNKN+ 
Sbjct  205  RKRFRTKFSQGQKERMHQFAEKVGWKMQKGDEDLVQEFCNEVGVDRSALKVWMHNNKNSF  264

Query  475  GKRDNI  458
            GK++++
Sbjct  265  GKKEHL  270



>ref|XP_004491795.1| PREDICTED: transcription factor HB29-like [Cicer arietinum]
Length=328

 Score = 99.4 bits (246),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 52/64 (81%), Gaps = 0/64 (0%)
 Frame = -1

Query  655  RKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNTV  476
            RK FRTKF+Q QK KM  FAE++GWKIQK D++LI++ C EIGV+R VLKVWMHNNKN  
Sbjct  205  RKRFRTKFSQEQKDKMLKFAEKVGWKIQKRDDDLIHEVCNEIGVDRTVLKVWMHNNKNNF  264

Query  475  GKRD  464
             KRD
Sbjct  265  TKRD  268



>ref|XP_003576623.1| PREDICTED: zinc-finger homeodomain protein 1 [Brachypodium distachyon]
Length=290

 Score = 99.0 bits (245),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 42/66 (64%), Positives = 53/66 (80%), Gaps = 0/66 (0%)
 Frame = -1

Query  655  RKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNTV  476
            +K FRTKFTQ QK +M  FAER+GW+IQK DE  +  FC E+GV+R VLKVWMHNNK+T+
Sbjct  225  KKRFRTKFTQEQKDRMLAFAERVGWRIQKHDEAAVQQFCDEVGVKRHVLKVWMHNNKHTL  284

Query  475  GKRDNI  458
            GK+ +I
Sbjct  285  GKKPSI  290



>ref|XP_009620302.1| PREDICTED: zinc-finger homeodomain protein 9-like [Nicotiana 
tomentosiformis]
Length=263

 Score = 98.6 bits (244),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 41/67 (61%), Positives = 53/67 (79%), Gaps = 0/67 (0%)
 Frame = -1

Query  658  GRKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNT  479
            GRK FRTKFTQ QK KM  F+E++GWK+QK DE  + +FC E+GV +GVL+VWMHNNKNT
Sbjct  158  GRKRFRTKFTQQQKEKMHSFSEKLGWKLQKCDEAKVEEFCNEVGVGKGVLRVWMHNNKNT  217

Query  478  VGKRDNI  458
              K++ +
Sbjct  218  FAKKEEL  224



>gb|KJB18247.1| hypothetical protein B456_003G042700 [Gossypium raimondii]
Length=270

 Score = 98.2 bits (243),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 51/64 (80%), Gaps = 0/64 (0%)
 Frame = -1

Query  655  RKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNTV  476
            RK FRTKFTQ QK KM   AER+GW+IQK DEE++  FC E GV+R VLKVWMHNNK+T+
Sbjct  207  RKRFRTKFTQEQKEKMLSLAERLGWRIQKHDEEIVQQFCNETGVKRHVLKVWMHNNKHTL  266

Query  475  GKRD  464
            GK+ 
Sbjct  267  GKKP  270



>emb|CAC34410.1| ZF-HD homeobox protein [Flaveria bidentis]
Length=259

 Score = 98.2 bits (243),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 45/67 (67%), Positives = 55/67 (82%), Gaps = 1/67 (1%)
 Frame = -1

Query  658  GRKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNT  479
            G+K FRTKFTQ QK KM + AER+GWK+QK DE+LI +FC EIGV++GV KVWMHNNK T
Sbjct  129  GKKRFRTKFTQDQKQKMHELAERVGWKMQKKDEDLIINFCNEIGVDKGVFKVWMHNNKMT  188

Query  478  -VGKRDN  461
              GK+D+
Sbjct  189  SAGKKDS  195



>ref|XP_008782488.1| PREDICTED: zinc-finger homeodomain protein 6-like [Phoenix dactylifera]
Length=259

 Score = 97.4 bits (241),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 41/67 (61%), Positives = 53/67 (79%), Gaps = 0/67 (0%)
 Frame = -1

Query  667  HMKGRKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNN  488
            +M  RK FRTKF+  QK +M DFAER+GW+IQK DE L+ +FC E+GV R VLKVWMHNN
Sbjct  183  YMVSRKRFRTKFSAEQKERMLDFAERVGWRIQKQDEALVEEFCAEVGVSRQVLKVWMHNN  242

Query  487  KNTVGKR  467
            K+++ K+
Sbjct  243  KHSIRKQ  249



>ref|XP_010682105.1| PREDICTED: zinc-finger homeodomain protein 3-like [Beta vulgaris 
subsp. vulgaris]
Length=342

 Score = 98.2 bits (243),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 42/66 (64%), Positives = 56/66 (85%), Gaps = 0/66 (0%)
 Frame = -1

Query  655  RKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNTV  476
            +K FRTKF+Q QK KM +FAE++GWKIQK +EE++  FC+EIGV+R VLKVWMHNNK+ +
Sbjct  268  KKRFRTKFSQEQKEKMMEFAEKVGWKIQKQEEEVVQQFCQEIGVKRRVLKVWMHNNKHNL  327

Query  475  GKRDNI  458
            GK+ +I
Sbjct  328  GKKSDI  333



>ref|NP_189534.1| homeobox protein 34 [Arabidopsis thaliana]
 sp|Q9LHF0.1|ZHD9_ARATH RecName: Full=Zinc-finger homeodomain protein 9; Short=AtZHD9; 
AltName: Full=Homeobox protein 34; Short=AtHB-34 [Arabidopsis 
thaliana]
 dbj|BAB02255.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAM13170.1| unknown protein [Arabidopsis thaliana]
 gb|AAM91220.1| unknown protein [Arabidopsis thaliana]
 gb|AEE77508.1| homeobox protein 34 [Arabidopsis thaliana]
Length=312

 Score = 98.2 bits (243),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 43/59 (73%), Positives = 51/59 (86%), Gaps = 0/59 (0%)
 Frame = -1

Query  655  RKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNT  479
            RK FRTKF+  QK KM +FA+RIGWKIQK DE+ + DFCREIGV++GVLKVWMHNNKN+
Sbjct  192  RKRFRTKFSSNQKEKMHEFADRIGWKIQKRDEDEVRDFCREIGVDKGVLKVWMHNNKNS  250



>ref|XP_010450775.1| PREDICTED: zinc-finger homeodomain protein 10-like [Camelina 
sativa]
Length=334

 Score = 98.2 bits (243),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 42/64 (66%), Positives = 54/64 (84%), Gaps = 0/64 (0%)
 Frame = -1

Query  655  RKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNTV  476
            RK FRTKF+Q QK KM +FAER+GWK+QK D++ + +FCR+IGV++ VLKVWMHNNKNT 
Sbjct  199  RKRFRTKFSQFQKEKMHEFAERLGWKMQKRDDDDVREFCRQIGVDKSVLKVWMHNNKNTF  258

Query  475  GKRD  464
             +RD
Sbjct  259  NRRD  262



>ref|XP_002460367.1| hypothetical protein SORBIDRAFT_02g027040 [Sorghum bicolor]
 gb|EER96888.1| hypothetical protein SORBIDRAFT_02g027040 [Sorghum bicolor]
Length=302

 Score = 97.8 bits (242),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 42/64 (66%), Positives = 51/64 (80%), Gaps = 0/64 (0%)
 Frame = -1

Query  655  RKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNTV  476
            +K FRTKFTQ QK KM  FAER+GW+IQK DE  +  FC E+GV+R VLKVWMHNNK+T+
Sbjct  239  KKRFRTKFTQEQKDKMLAFAERVGWRIQKHDEAAVQQFCDEVGVKRHVLKVWMHNNKHTL  298

Query  475  GKRD  464
            GK+ 
Sbjct  299  GKKP  302



>ref|XP_006470838.1| PREDICTED: ZF-HD homeobox protein At5g65410-like [Citrus sinensis]
Length=314

 Score = 97.8 bits (242),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 42/66 (64%), Positives = 55/66 (83%), Gaps = 0/66 (0%)
 Frame = -1

Query  655  RKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNTV  476
            +K FRTKFTQ QK KM +FAE++GWKIQK +E ++  FC+EIGV+R VLKVWMHNNK+ +
Sbjct  241  KKRFRTKFTQEQKEKMFNFAEKVGWKIQKQEESVVQQFCQEIGVKRRVLKVWMHNNKHNL  300

Query  475  GKRDNI  458
             K++NI
Sbjct  301  AKKNNI  306



>ref|XP_009139922.1| PREDICTED: zinc-finger homeodomain protein 10 [Brassica rapa]
 emb|CDX74428.1| BnaA04g09610D [Brassica napus]
Length=317

 Score = 97.8 bits (242),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 41/64 (64%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = -1

Query  655  RKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNTV  476
            RK FRTKF+Q QK KM +FA+R+GWK+QK DE+ + +FCR+IGV++ VLKVWMHNNKN  
Sbjct  182  RKRFRTKFSQFQKEKMHEFADRVGWKMQKRDEDDVREFCRQIGVDKSVLKVWMHNNKNNF  241

Query  475  GKRD  464
             +RD
Sbjct  242  NRRD  245



>ref|XP_010441087.1| PREDICTED: zinc-finger homeodomain protein 10 [Camelina sativa]
Length=342

 Score = 98.2 bits (243),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 42/64 (66%), Positives = 54/64 (84%), Gaps = 0/64 (0%)
 Frame = -1

Query  655  RKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNTV  476
            RK FRTKF+Q QK KM +FAER+GWK+QK D++ + +FCR+IGV++ VLKVWMHNNKNT 
Sbjct  207  RKRFRTKFSQFQKEKMHEFAERLGWKMQKRDDDDVREFCRQIGVDKSVLKVWMHNNKNTF  266

Query  475  GKRD  464
             +RD
Sbjct  267  NRRD  270



>ref|XP_006431432.1| hypothetical protein CICLE_v10003702mg [Citrus clementina]
 gb|ESR44672.1| hypothetical protein CICLE_v10003702mg [Citrus clementina]
Length=314

 Score = 97.8 bits (242),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 42/66 (64%), Positives = 55/66 (83%), Gaps = 0/66 (0%)
 Frame = -1

Query  655  RKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNTV  476
            +K FRTKFTQ QK KM +FAE++GWKIQK +E ++  FC+EIGV+R VLKVWMHNNK+ +
Sbjct  241  KKRFRTKFTQEQKEKMFNFAEKVGWKIQKQEESVVQQFCQEIGVKRRVLKVWMHNNKHNL  300

Query  475  GKRDNI  458
             K++NI
Sbjct  301  AKKNNI  306



>gb|KDO42061.1| hypothetical protein CISIN_1g048741mg [Citrus sinensis]
Length=314

 Score = 97.8 bits (242),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 42/66 (64%), Positives = 55/66 (83%), Gaps = 0/66 (0%)
 Frame = -1

Query  655  RKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNTV  476
            +K FRTKFTQ QK KM +FAE++GWKIQK +E ++  FC+EIGV+R VLKVWMHNNK+ +
Sbjct  241  KKRFRTKFTQEQKEKMFNFAEKVGWKIQKQEESVVQQFCQEIGVKRRVLKVWMHNNKHNL  300

Query  475  GKRDNI  458
             K++NI
Sbjct  301  AKKNNI  306



>sp|A2Z259.1|ZHD1_ORYSI RecName: Full=Zinc-finger homeodomain protein 1 [Oryza sativa 
Indica Group]
 gb|EAZ09420.1| hypothetical protein OsI_31693 [Oryza sativa Indica Group]
Length=279

 Score = 97.4 bits (241),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 42/63 (67%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = -1

Query  655  RKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNTV  476
            +K FRTKFTQ QK KM  FAER+GW+IQK DE  +  FC E+GV+R VLKVWMHNNK+T+
Sbjct  215  KKRFRTKFTQEQKDKMLAFAERVGWRIQKHDEAAVQQFCDEVGVKRHVLKVWMHNNKHTL  274

Query  475  GKR  467
            GK+
Sbjct  275  GKK  277



>ref|XP_007048627.1| Homeobox protein 21, putative [Theobroma cacao]
 gb|EOX92784.1| Homeobox protein 21, putative [Theobroma cacao]
Length=253

 Score = 97.1 bits (240),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 42/67 (63%), Positives = 54/67 (81%), Gaps = 0/67 (0%)
 Frame = -1

Query  661  KGRKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKN  482
            K RK FRTKFTQ QK KM +FAE+ GW+IQK DE ++  FC+EIG++R VLKVWMHNNK 
Sbjct  184  KMRKRFRTKFTQEQKEKMLNFAEKAGWRIQKLDESVVQQFCQEIGIKRRVLKVWMHNNKQ  243

Query  481  TVGKRDN  461
            ++ K+D+
Sbjct  244  SLAKKDS  250



>ref|XP_002877141.1| hypothetical protein ARALYDRAFT_484662 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH53400.1| hypothetical protein ARALYDRAFT_484662 [Arabidopsis lyrata subsp. 
lyrata]
Length=299

 Score = 97.4 bits (241),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 43/59 (73%), Positives = 50/59 (85%), Gaps = 0/59 (0%)
 Frame = -1

Query  655  RKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNT  479
            RK FRTKF+  QK KM +FA RIGWKIQK DE+ + DFCREIGV++GVLKVWMHNNKN+
Sbjct  184  RKRFRTKFSSNQKEKMHEFAARIGWKIQKRDEDEVRDFCREIGVDKGVLKVWMHNNKNS  242



>gb|EYU34567.1| hypothetical protein MIMGU_mgv1a012253mg [Erythranthe guttata]
Length=256

 Score = 96.7 bits (239),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 41/64 (64%), Positives = 54/64 (84%), Gaps = 0/64 (0%)
 Frame = -1

Query  658  GRKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNT  479
            G+K FRTKFT  QK KM +FAER+GW+IQK +EE++  FC E+G++R VLKVWMHNNK+T
Sbjct  192  GKKRFRTKFTAEQKDKMLNFAERLGWRIQKQEEEMVQQFCGEMGIKRHVLKVWMHNNKHT  251

Query  478  VGKR  467
            +GK+
Sbjct  252  LGKK  255



>ref|XP_006660717.1| PREDICTED: ZF-HD homeobox protein At4g24660-like [Oryza brachyantha]
Length=285

 Score = 97.1 bits (240),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 42/63 (67%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = -1

Query  655  RKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNTV  476
            +K FRTKFTQ QK KM  FAER+GW+IQK DE  +  FC E+GV+R VLKVWMHNNK+T+
Sbjct  221  KKRFRTKFTQEQKDKMLAFAERVGWRIQKHDEAAVQQFCDEVGVKRHVLKVWMHNNKHTL  280

Query  475  GKR  467
            GK+
Sbjct  281  GKK  283



>ref|NP_001063419.1| Os09g0466400 [Oryza sativa Japonica Group]
 sp|Q6YXH5.1|ZHD1_ORYSJ RecName: Full=Zinc-finger homeodomain protein 1; Short=OsZHD1 
[Oryza sativa Japonica Group]
 dbj|BAD17515.1| putative ZF-HD homeobox protein [Oryza sativa Japonica Group]
 dbj|BAF25333.1| Os09g0466400 [Oryza sativa Japonica Group]
 dbj|BAG98341.1| unnamed protein product [Oryza sativa Japonica Group]
Length=279

 Score = 97.1 bits (240),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 42/63 (67%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = -1

Query  655  RKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNTV  476
            +K FRTKFTQ QK KM  FAER+GW+IQK DE  +  FC E+GV+R VLKVWMHNNK+T+
Sbjct  215  KKRFRTKFTQEQKDKMLAFAERVGWRIQKHDEAAVQQFCDEVGVKRHVLKVWMHNNKHTL  274

Query  475  GKR  467
            GK+
Sbjct  275  GKK  277



>ref|XP_010552878.1| PREDICTED: LOW QUALITY PROTEIN: zinc-finger homeodomain protein 
10-like [Tarenaya hassleriana]
Length=344

 Score = 97.4 bits (241),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 50/64 (78%), Gaps = 0/64 (0%)
 Frame = -1

Query  655  RKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNTV  476
            RK    KF Q QK KM +FAER+GWK+QK DEE I DFCREIGV++GVLKVWMHNNKN  
Sbjct  201  RKRXXXKFNQFQKDKMHEFAERMGWKMQKRDEEEIRDFCREIGVDKGVLKVWMHNNKNAS  260

Query  475  GKRD  464
             +RD
Sbjct  261  HRRD  264



>ref|XP_006859182.1| hypothetical protein AMTR_s00070p00154800 [Amborella trichopoda]
 gb|ERN20649.1| hypothetical protein AMTR_s00070p00154800 [Amborella trichopoda]
Length=218

 Score = 95.9 bits (237),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 41/70 (59%), Positives = 55/70 (79%), Gaps = 0/70 (0%)
 Frame = -1

Query  658  GRKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNT  479
            G K +RTKFTQ QK KM  FA+++GW+IQK D+  +  FC E+GV+R VLKVWMHNNKNT
Sbjct  148  GTKRYRTKFTQDQKEKMQAFADKLGWRIQKQDDVALQQFCMEVGVKRHVLKVWMHNNKNT  207

Query  478  VGKRDNIXTT  449
            +GK+D++  +
Sbjct  208  LGKKDSLTAS  217



>ref|XP_010527155.1| PREDICTED: zinc-finger homeodomain protein 1 [Tarenaya hassleriana]
Length=179

 Score = 95.1 bits (235),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 50/64 (78%), Gaps = 0/64 (0%)
 Frame = -1

Query  658  GRKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNT  479
            GRK FRTKFT  QK +M   AERIGW+IQ+ DEEL+  FC E GV R VLKVW+HNNK+T
Sbjct  98   GRKRFRTKFTAEQKERMLGLAERIGWRIQRQDEELVQRFCEETGVSRQVLKVWLHNNKHT  157

Query  478  VGKR  467
            +GKR
Sbjct  158  LGKR  161



>ref|XP_010086552.1| hypothetical protein L484_001444 [Morus notabilis]
 gb|EXB20251.1| hypothetical protein L484_001444 [Morus notabilis]
Length=370

 Score = 97.4 bits (241),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 39/64 (61%), Positives = 54/64 (84%), Gaps = 0/64 (0%)
 Frame = -1

Query  658  GRKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNT  479
             RK FRTKF+Q QK KM  FAE++GWK+Q+ +E+++ +FC E+G+ +GVLKVWMHNNK+T
Sbjct  245  ARKRFRTKFSQEQKEKMCLFAEKLGWKMQRSEEKVVEEFCNEVGIRKGVLKVWMHNNKHT  304

Query  478  VGKR  467
            +GKR
Sbjct  305  LGKR  308



>ref|XP_010681042.1| PREDICTED: zinc-finger homeodomain protein 1-like [Beta vulgaris 
subsp. vulgaris]
Length=284

 Score = 96.7 bits (239),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 52/64 (81%), Gaps = 0/64 (0%)
 Frame = -1

Query  658  GRKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNT  479
            G+K FRTKFTQ QK KM D AE++GWKIQK DE +++ FC E GV+R VLKVWMHNNK T
Sbjct  220  GKKRFRTKFTQEQKDKMLDLAEKLGWKIQKQDELVVHQFCHETGVKRHVLKVWMHNNKLT  279

Query  478  VGKR  467
            +GK+
Sbjct  280  LGKK  283



>ref|XP_010514609.1| PREDICTED: zinc-finger homeodomain protein 9-like [Camelina sativa]
Length=323

 Score = 97.1 bits (240),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 43/59 (73%), Positives = 51/59 (86%), Gaps = 0/59 (0%)
 Frame = -1

Query  655  RKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNT  479
            RK FRTKF+  QK KM +FA+RIGWKIQK DE+ + +FCREIGV++GVLKVWMHNNKNT
Sbjct  199  RKRFRTKFSSSQKEKMHEFADRIGWKIQKRDEDDVREFCREIGVDKGVLKVWMHNNKNT  257



>emb|CDP01539.1| unnamed protein product [Coffea canephora]
Length=252

 Score = 96.3 bits (238),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 40/63 (63%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = -1

Query  655  RKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNTV  476
            +K FRTKF+Q QK KM D AE++GWKIQK DEE++   C E+G++R VLKVWMHNNK+T+
Sbjct  189  KKRFRTKFSQEQKEKMSDLAEKLGWKIQKQDEEVVQQLCNELGIKRQVLKVWMHNNKHTL  248

Query  475  GKR  467
            GK+
Sbjct  249  GKK  251



>ref|XP_010425683.1| PREDICTED: zinc-finger homeodomain protein 9-like [Camelina sativa]
Length=323

 Score = 97.1 bits (240),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 43/59 (73%), Positives = 51/59 (86%), Gaps = 0/59 (0%)
 Frame = -1

Query  655  RKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNT  479
            RK FRTKF+  QK KM +FA+RIGWKIQK DE+ + +FCREIGV++GVLKVWMHNNKNT
Sbjct  196  RKRFRTKFSSGQKEKMHEFADRIGWKIQKRDEDDVREFCREIGVDKGVLKVWMHNNKNT  254



>ref|XP_006660219.1| PREDICTED: ZF-HD homeobox protein At4g24660-like [Oryza brachyantha]
Length=290

 Score = 96.7 bits (239),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 42/64 (66%), Positives = 51/64 (80%), Gaps = 0/64 (0%)
 Frame = -1

Query  658  GRKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNT  479
            G+K FRTKFTQ QK KM  FAER+GW+IQK DE  +  FC E+ V+R VLKVWMHNNK+T
Sbjct  226  GKKRFRTKFTQEQKDKMLAFAERLGWRIQKHDEAAVQQFCEEVCVKRHVLKVWMHNNKHT  285

Query  478  VGKR  467
            +GK+
Sbjct  286  LGKK  289



>ref|XP_004957068.1| PREDICTED: ZF-HD homeobox protein At4g24660-like [Setaria italica]
Length=281

 Score = 96.7 bits (239),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 41/63 (65%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = -1

Query  655  RKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNTV  476
            +K FRTKFTQ QK +M  FAER+GW+IQK DE  +  FC E+GV+R VLKVWMHNNK+T+
Sbjct  218  KKRFRTKFTQEQKDRMLAFAERVGWRIQKHDEAAVQQFCDEVGVKRHVLKVWMHNNKHTL  277

Query  475  GKR  467
            GK+
Sbjct  278  GKK  280



>gb|KJB30399.1| hypothetical protein B456_005G141400 [Gossypium raimondii]
Length=262

 Score = 96.3 bits (238),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 42/65 (65%), Positives = 52/65 (80%), Gaps = 0/65 (0%)
 Frame = -1

Query  658  GRKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNT  479
            GRK  RTKFT+ QK KM  FAER+GW++ K +E+LI +FC E+GV RGVLKVWMHNNKNT
Sbjct  146  GRKRSRTKFTKEQKEKMHAFAERLGWRMPKGEEKLIQEFCNEVGVNRGVLKVWMHNNKNT  205

Query  478  VGKRD  464
              K++
Sbjct  206  FSKKE  210



>ref|XP_009613099.1| PREDICTED: zinc-finger homeodomain protein 4 [Nicotiana tomentosiformis]
Length=304

 Score = 96.7 bits (239),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 40/70 (57%), Positives = 57/70 (81%), Gaps = 0/70 (0%)
 Frame = -1

Query  655  RKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNTV  476
            +K FRTKFTQ QK KM +FAE++GWKIQK +E ++  FC+E+G++R VLKVWMHNNK+++
Sbjct  231  KKRFRTKFTQEQKEKMFNFAEKVGWKIQKQEETVVQQFCQELGIKRRVLKVWMHNNKHSL  290

Query  475  GKRDNIXTTP  446
             K+++  T P
Sbjct  291  AKKNSNSTIP  300



>ref|XP_010940074.1| PREDICTED: zinc-finger homeodomain protein 6-like [Elaeis guineensis]
Length=302

 Score = 96.7 bits (239),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 41/66 (62%), Positives = 53/66 (80%), Gaps = 0/66 (0%)
 Frame = -1

Query  667  HMKGRKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNN  488
            +M  +K FRTKFT  QK +M DFAER+GW+IQK DE L+++FC E+GV R VLKVW+HNN
Sbjct  226  YMVSKKRFRTKFTTEQKERMLDFAERLGWRIQKQDEALVDEFCAEVGVSRQVLKVWIHNN  285

Query  487  KNTVGK  470
            K++V K
Sbjct  286  KHSVRK  291



>gb|EEE69868.1| hypothetical protein OsJ_29679 [Oryza sativa Japonica Group]
Length=247

 Score = 95.9 bits (237),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 42/63 (67%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = -1

Query  655  RKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNTV  476
            +K FRTKFTQ QK KM  FAER+GW+IQK DE  +  FC E+GV+R VLKVWMHNNK+T+
Sbjct  183  KKRFRTKFTQEQKDKMLAFAERVGWRIQKHDEAAVQQFCDEVGVKRHVLKVWMHNNKHTL  242

Query  475  GKR  467
            GK+
Sbjct  243  GKK  245



>ref|XP_003551238.1| PREDICTED: ZF-HD homeobox protein At4g24660-like [Glycine max]
Length=250

 Score = 95.9 bits (237),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 41/63 (65%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = -1

Query  655  RKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNTV  476
            +K FRTKFTQ QK KM  FAE++GW+IQK DE ++ +FC E GV+R VLKVWMHNNK+T+
Sbjct  187  KKRFRTKFTQQQKDKMLAFAEKLGWRIQKHDEGVVQEFCSETGVQRHVLKVWMHNNKHTL  246

Query  475  GKR  467
            GK+
Sbjct  247  GKK  249



>gb|EMT05330.1| ZF-HD homeobox protein [Aegilops tauschii]
Length=84

 Score = 92.0 bits (227),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 42/63 (67%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = -1

Query  655  RKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNTV  476
            +K FRTKFTQ QK KM  FAER+GW+IQK DE  +  FC E+GV+R VLKVWMHNNK+T+
Sbjct  18   KKRFRTKFTQEQKDKMLAFAERVGWRIQKHDEAAVLQFCDEVGVKRHVLKVWMHNNKHTL  77

Query  475  GKR  467
            GK+
Sbjct  78   GKK  80



>gb|KHN07843.1| ZF-HD homeobox protein [Glycine soja]
Length=166

 Score = 94.4 bits (233),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 48/91 (53%), Positives = 65/91 (71%), Gaps = 4/91 (4%)
 Frame = -1

Query  655  RKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNTV  476
            +K +RTKF++ QK KM  F+E++GW++QK D+ L+ +FC EIGV RGV KVWMHNNKNT+
Sbjct  36   KKRYRTKFSKEQKEKMHGFSEKLGWRMQKGDDGLVQEFCNEIGVSRGVFKVWMHNNKNTL  95

Query  475  GKR--DNIXTTPaaaaaADNGNAH--SXGFD  395
             K+  D I    A  +  D+GNA+  S GFD
Sbjct  96   RKKPEDGIGNANAPQSNNDDGNANGGSGGFD  126



>ref|XP_006878601.1| hypothetical protein AMTR_s00011p00255340 [Amborella trichopoda]
 gb|ERM94746.1| hypothetical protein AMTR_s00011p00255340 [Amborella trichopoda]
Length=242

 Score = 95.5 bits (236),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 42/64 (66%), Positives = 51/64 (80%), Gaps = 0/64 (0%)
 Frame = -1

Query  652  KXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNTVG  473
            K FRTKFTQ QK +M  FAER+GW+IQK DE  +  FC E+GV+R VLKVWMHNNKNT+G
Sbjct  178  KRFRTKFTQEQKERMLGFAERVGWRIQKQDEGAVQRFCDEVGVKRHVLKVWMHNNKNTLG  237

Query  472  KRDN  461
            K+ +
Sbjct  238  KKSS  241



>ref|XP_010502894.1| PREDICTED: zinc-finger homeodomain protein 9 [Camelina sativa]
Length=321

 Score = 96.3 bits (238),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 43/59 (73%), Positives = 51/59 (86%), Gaps = 0/59 (0%)
 Frame = -1

Query  655  RKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNT  479
            RK FRTKF+  QK KM +FA+RIGWKIQK DE+ + +FCREIGV++GVLKVWMHNNKNT
Sbjct  198  RKRFRTKFSSGQKEKMHEFADRIGWKIQKRDEDDVREFCREIGVDKGVLKVWMHNNKNT  256



>emb|CBI27705.3| unnamed protein product [Vitis vinifera]
Length=127

 Score = 92.8 bits (229),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 48/62 (77%), Gaps = 0/62 (0%)
 Frame = -1

Query  655  RKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNTV  476
            +K FRTKFTQ QK KM  FAER GW+IQK +E L+  FC+EIG++R VLKVWMHNNKN  
Sbjct  61   KKRFRTKFTQEQKEKMLSFAERAGWRIQKQEESLVQQFCQEIGIKRRVLKVWMHNNKNLA  120

Query  475  GK  470
             K
Sbjct  121  RK  122



>ref|XP_007154109.1| hypothetical protein PHAVU_003G091100g [Phaseolus vulgaris]
 gb|ESW26103.1| hypothetical protein PHAVU_003G091100g [Phaseolus vulgaris]
Length=271

 Score = 95.9 bits (237),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 41/64 (64%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = -1

Query  655  RKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNTV  476
            +K FRTKFTQ QK KM +FAER+GWKIQK +E ++  FC+EIGV+R VLKVWMHNNK+ +
Sbjct  202  KKRFRTKFTQEQKEKMLNFAERVGWKIQKQEESVVQQFCQEIGVKRRVLKVWMHNNKHNL  261

Query  475  GKRD  464
             K++
Sbjct  262  AKKN  265



>ref|XP_008444722.1| PREDICTED: zinc-finger homeodomain protein 2 [Cucumis melo]
Length=314

 Score = 96.3 bits (238),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 42/64 (66%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = -1

Query  655  RKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNTV  476
            +K FRTKFTQ QK +M +FAE++GW+IQK DEE +  FC E+GV+R VLKVWMHNNKNTV
Sbjct  230  KKRFRTKFTQEQKDRMLEFAEKVGWRIQKQDEEEVERFCTEVGVKRQVLKVWMHNNKNTV  289

Query  475  GKRD  464
             K++
Sbjct  290  KKQN  293



>ref|XP_004165400.1| PREDICTED: ZF-HD homeobox protein At4g24660-like [Cucumis sativus]
 gb|KGN62606.1| hypothetical protein Csa_2G361700 [Cucumis sativus]
Length=320

 Score = 96.3 bits (238),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 42/64 (66%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = -1

Query  655  RKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNTV  476
            +K FRTKFTQ QK +M +FAE++GW+IQK DEE +  FC E+GV+R VLKVWMHNNKNTV
Sbjct  237  KKRFRTKFTQEQKDRMLEFAEKVGWRIQKQDEEEVERFCTEVGVKRQVLKVWMHNNKNTV  296

Query  475  GKRD  464
             K++
Sbjct  297  KKQN  300



>ref|XP_010554331.1| PREDICTED: zinc-finger homeodomain protein 4 [Tarenaya hassleriana]
 ref|XP_010554332.1| PREDICTED: zinc-finger homeodomain protein 4 [Tarenaya hassleriana]
 ref|XP_010554333.1| PREDICTED: zinc-finger homeodomain protein 4 [Tarenaya hassleriana]
 ref|XP_010554334.1| PREDICTED: zinc-finger homeodomain protein 4 [Tarenaya hassleriana]
 ref|XP_010554335.1| PREDICTED: zinc-finger homeodomain protein 4 [Tarenaya hassleriana]
 ref|XP_010554336.1| PREDICTED: zinc-finger homeodomain protein 4 [Tarenaya hassleriana]
Length=322

 Score = 96.3 bits (238),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 41/65 (63%), Positives = 53/65 (82%), Gaps = 0/65 (0%)
 Frame = -1

Query  655  RKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNTV  476
            +K FRTKFTQ QK KM +FAER+GWKIQ+ +E ++  FC+EIGV+R VLKVWMHNNK+ +
Sbjct  232  KKRFRTKFTQEQKEKMMNFAERVGWKIQRQEESVVQQFCQEIGVKRRVLKVWMHNNKHNL  291

Query  475  GKRDN  461
             K+ N
Sbjct  292  AKKKN  296



>gb|ABY61020.1| zinc finger-homeodomain protein 1 [Eschscholzia californica]
Length=267

 Score = 95.9 bits (237),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 43/63 (68%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = -1

Query  655  RKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNTV  476
            +K FRTKFTQ QK KM  FAER+GW+IQK DEE++  FC E GV R VLKVWMHNNK+T+
Sbjct  204  KKRFRTKFTQEQKDKMIVFAERLGWRIQKHDEEIVQQFCNETGVRRQVLKVWMHNNKHTL  263

Query  475  GKR  467
            GK+
Sbjct  264  GKK  266



>emb|CAN60614.1| hypothetical protein VITISV_003253 [Vitis vinifera]
Length=155

 Score = 93.6 bits (231),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 39/69 (57%), Positives = 54/69 (78%), Gaps = 0/69 (0%)
 Frame = -1

Query  655  RKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNTV  476
            +K FRTKF+Q QK KM  FAE++GWKIQK +E ++  FC+EIGV+R VLKVWMHNNK+ +
Sbjct  85   KKRFRTKFSQEQKEKMLSFAEKVGWKIQKQEEAVVQQFCQEIGVKRRVLKVWMHNNKHNL  144

Query  475  GKRDNIXTT  449
             K+  + ++
Sbjct  145  AKKTPLPSS  153



>gb|ADE77597.1| unknown [Picea sitchensis]
Length=249

 Score = 95.5 bits (236),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 41/63 (65%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = -1

Query  655  RKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNTV  476
            +K FRTKFTQ QK KM  FAE++GW+IQK DE  +  FC E+GV+R VLKVWMHNNK+T+
Sbjct  186  KKRFRTKFTQEQKDKMCSFAEKLGWRIQKHDEAAVQQFCMELGVKRHVLKVWMHNNKHTL  245

Query  475  GKR  467
            GK+
Sbjct  246  GKK  248



>ref|XP_004152776.1| PREDICTED: ZF-HD homeobox protein At4g24660-like [Cucumis sativus]
Length=276

 Score = 95.5 bits (236),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 42/64 (66%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = -1

Query  655  RKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNTV  476
            +K FRTKFTQ QK +M +FAE++GW+IQK DEE +  FC E+GV+R VLKVWMHNNKNTV
Sbjct  193  KKRFRTKFTQEQKDRMLEFAEKVGWRIQKQDEEEVERFCTEVGVKRQVLKVWMHNNKNTV  252

Query  475  GKRD  464
             K++
Sbjct  253  KKQN  256



>gb|KHN07994.1| ZF-HD homeobox protein [Glycine soja]
Length=214

 Score = 94.7 bits (234),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 40/63 (63%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = -1

Query  655  RKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNTV  476
            +K FRTKFTQ QK KM  FAE++GW++QK D+ ++ +FC EIGV+R VLKVWMHNNK+T+
Sbjct  151  KKRFRTKFTQHQKDKMLVFAEKLGWRMQKNDDSVVQEFCSEIGVQRHVLKVWMHNNKHTL  210

Query  475  GKR  467
            GK+
Sbjct  211  GKK  213



>ref|XP_008388052.1| PREDICTED: zinc-finger homeodomain protein 2 [Malus domestica]
 ref|XP_008388053.1| PREDICTED: zinc-finger homeodomain protein 2 [Malus domestica]
 ref|XP_008388054.1| PREDICTED: zinc-finger homeodomain protein 2 [Malus domestica]
Length=350

 Score = 96.3 bits (238),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 41/69 (59%), Positives = 54/69 (78%), Gaps = 0/69 (0%)
 Frame = -1

Query  655  RKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNTV  476
            +K FRTKFT  QK +M +FAER+GW+IQK DEE +  FC E+GV+R VL+VWMHNNKNT+
Sbjct  256  KKRFRTKFTVEQKERMMEFAERVGWRIQKQDEEEVERFCAEVGVKRQVLRVWMHNNKNTI  315

Query  475  GKRDNIXTT  449
             K+ ++  T
Sbjct  316  KKQGDVTAT  324



>gb|KHN07993.1| ZF-HD homeobox protein [Glycine soja]
Length=234

 Score = 94.7 bits (234),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 40/63 (63%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = -1

Query  655  RKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNTV  476
            +K FRTKFTQ QK KM  FAE++GW++QK D+ ++ +FC EIGV+R VLKVWMHNNK+T+
Sbjct  171  KKRFRTKFTQHQKDKMLVFAEKLGWRMQKNDDSVVQEFCSEIGVQRHVLKVWMHNNKHTL  230

Query  475  GKR  467
            GK+
Sbjct  231  GKK  233



>ref|XP_009762783.1| PREDICTED: zinc-finger homeodomain protein 4-like [Nicotiana 
sylvestris]
Length=306

 Score = 95.5 bits (236),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 40/70 (57%), Positives = 56/70 (80%), Gaps = 0/70 (0%)
 Frame = -1

Query  655  RKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNTV  476
            +K FRTKFTQ QK KM +FAE++GWKIQK +E ++  FC+E+G++R VLKVWMHNNK+ +
Sbjct  233  KKRFRTKFTQEQKEKMFNFAEKVGWKIQKQEETVVQQFCQELGIKRRVLKVWMHNNKHNL  292

Query  475  GKRDNIXTTP  446
             K+++  T P
Sbjct  293  AKKNSNVTIP  302



>gb|KHN07995.1| ZF-HD homeobox protein [Glycine soja]
Length=234

 Score = 94.7 bits (234),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 40/63 (63%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = -1

Query  655  RKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNTV  476
            +K FRTKFTQ QK KM  FAE++GW++QK D+ ++ +FC EIGV+R VLKVWMHNNK+T+
Sbjct  171  KKRFRTKFTQHQKDKMLVFAEKLGWRMQKNDDSVVQEFCSEIGVQRHVLKVWMHNNKHTL  230

Query  475  GKR  467
            GK+
Sbjct  231  GKK  233



>ref|XP_006827241.1| hypothetical protein AMTR_s00010p00261450 [Amborella trichopoda]
 gb|ERM94478.1| hypothetical protein AMTR_s00010p00261450 [Amborella trichopoda]
Length=232

 Score = 94.7 bits (234),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 41/64 (64%), Positives = 52/64 (81%), Gaps = 0/64 (0%)
 Frame = -1

Query  655  RKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNTV  476
            RK FRTKFT  QK KM  F++++GWK+QK DE LI +FC EIG+ R VLKVWMHNNK+T+
Sbjct  160  RKRFRTKFTAEQKEKMYGFSDKLGWKMQKQDEGLIQEFCDEIGIRRSVLKVWMHNNKSTL  219

Query  475  GKRD  464
            G++D
Sbjct  220  GRKD  223



>ref|XP_009396485.1| PREDICTED: zinc-finger homeodomain protein 6-like [Musa acuminata 
subsp. malaccensis]
Length=380

 Score = 95.9 bits (237),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 42/60 (70%), Positives = 46/60 (77%), Gaps = 0/60 (0%)
 Frame = -1

Query  655  RKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNTV  476
            RK FRTKFT  QK KM  FAERIGW IQ+ D E+I  FC EIGV R VLKVWMHNNK+T+
Sbjct  282  RKRFRTKFTAEQKNKMLAFAERIGWTIQRQDSEMIEQFCAEIGVRRQVLKVWMHNNKHTI  341



>ref|XP_006291497.1| hypothetical protein CARUB_v10017644mg [Capsella rubella]
 gb|EOA24395.1| hypothetical protein CARUB_v10017644mg [Capsella rubella]
Length=323

 Score = 95.5 bits (236),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 42/59 (71%), Positives = 51/59 (86%), Gaps = 0/59 (0%)
 Frame = -1

Query  655  RKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNT  479
            RK FRTKF+  QK KM +FA++IGWKIQK DE+ + +FCREIGV++GVLKVWMHNNKNT
Sbjct  197  RKRFRTKFSSSQKEKMHEFADKIGWKIQKRDEDNVREFCREIGVDKGVLKVWMHNNKNT  255



>emb|CAC34409.1| ZF-HD homeobox protein [Flaveria bidentis]
Length=339

 Score = 95.5 bits (236),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 45/67 (67%), Positives = 54/67 (81%), Gaps = 1/67 (1%)
 Frame = -1

Query  658  GRKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNT  479
            G+K FRTKFTQ QK KM + AER+GWK+QK DE+LI  FC EIGV++GV KVWMHNNK T
Sbjct  219  GKKRFRTKFTQDQKEKMHELAERVGWKMQKKDEDLIIGFCNEIGVDKGVFKVWMHNNKMT  278

Query  478  V-GKRDN  461
              GK+D+
Sbjct  279  FGGKKDS  285



>ref|XP_009381483.1| PREDICTED: zinc-finger homeodomain protein 2-like [Musa acuminata 
subsp. malaccensis]
Length=281

 Score = 95.1 bits (235),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 42/63 (67%), Positives = 49/63 (78%), Gaps = 0/63 (0%)
 Frame = -1

Query  655  RKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNTV  476
            RK FRTKFTQ QK KM  FAER+GW+IQK DE  +  FC E  ++R VLKVWMHNNKNT+
Sbjct  218  RKRFRTKFTQEQKDKMLAFAERLGWRIQKHDEAAVQQFCEETCIKRHVLKVWMHNNKNTL  277

Query  475  GKR  467
            GK+
Sbjct  278  GKK  280



>ref|NP_001062055.1| Os08g0479400 [Oryza sativa Japonica Group]
 sp|Q6ZB90.1|ZHD2_ORYSJ RecName: Full=Zinc-finger homeodomain protein 2; Short=OsZHD2 
[Oryza sativa Japonica Group]
 sp|A2YWA6.1|ZHD2_ORYSI RecName: Full=Zinc-finger homeodomain protein 2 [Oryza sativa 
Indica Group]
 dbj|BAD09750.1| putative ZF-HD homeobox protein [Oryza sativa Japonica Group]
 dbj|BAF23969.1| Os08g0479400 [Oryza sativa Japonica Group]
 gb|EAZ07367.1| hypothetical protein OsI_29618 [Oryza sativa Indica Group]
 dbj|BAG98791.1| unnamed protein product [Oryza sativa Japonica Group]
Length=290

 Score = 95.1 bits (235),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 41/63 (65%), Positives = 50/63 (79%), Gaps = 0/63 (0%)
 Frame = -1

Query  655  RKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNTV  476
            +K FRTKFTQ QK KM  FAER+GW+IQK DE  +  FC E+ V+R VLKVWMHNNK+T+
Sbjct  226  KKRFRTKFTQEQKDKMLAFAERLGWRIQKHDEAAVQQFCEEVCVKRHVLKVWMHNNKHTL  285

Query  475  GKR  467
            GK+
Sbjct  286  GKK  288



>ref|XP_003530620.1| PREDICTED: ZF-HD homeobox protein At4g24660-like [Glycine max]
Length=261

 Score = 94.7 bits (234),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 40/63 (63%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = -1

Query  655  RKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNTV  476
            +K FRTKFTQ QK KM  FAE++GW++QK D+ ++ +FC EIGV+R VLKVWMHNNK+T+
Sbjct  198  KKRFRTKFTQHQKDKMLVFAEKLGWRMQKNDDSVVQEFCSEIGVQRHVLKVWMHNNKHTL  257

Query  475  GKR  467
            GK+
Sbjct  258  GKK  260



>ref|XP_010065227.1| PREDICTED: zinc-finger homeodomain protein 4-like [Eucalyptus 
grandis]
 gb|KCW62572.1| hypothetical protein EUGRSUZ_G00066 [Eucalyptus grandis]
Length=332

 Score = 95.5 bits (236),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 41/68 (60%), Positives = 53/68 (78%), Gaps = 0/68 (0%)
 Frame = -1

Query  667  HMKGRKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNN  488
            H   +K FRTKFTQ QK KM  FAE++GWKIQK +E ++  FC+EIGV+R VLKVWMHNN
Sbjct  254  HQAVKKRFRTKFTQEQKEKMFSFAEKVGWKIQKQEESVVQQFCQEIGVKRRVLKVWMHNN  313

Query  487  KNTVGKRD  464
            K+ + K++
Sbjct  314  KHNLAKKN  321



>gb|EPS61775.1| hypothetical protein M569_13018, partial [Genlisea aurea]
Length=276

 Score = 94.7 bits (234),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 40/64 (63%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = -1

Query  655  RKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNTV  476
            +K FRTKFTQ QK KM  FAE++GWKIQK +E ++  FC+E+GV+R VLKVWMHNNK+T+
Sbjct  213  KKRFRTKFTQEQKEKMLIFAEKVGWKIQKQEESVVQQFCQEVGVKRRVLKVWMHNNKHTL  272

Query  475  GKRD  464
             K++
Sbjct  273  AKKN  276



>gb|KJB80187.1| hypothetical protein B456_013G085500 [Gossypium raimondii]
Length=292

 Score = 95.1 bits (235),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 40/67 (60%), Positives = 53/67 (79%), Gaps = 0/67 (0%)
 Frame = -1

Query  658  GRKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNT  479
            GRK  RTKF++ QK KM DFA R+GW++ K +E+L+ +FC E+GV+RGVLKVWMHNNKN 
Sbjct  189  GRKRSRTKFSKEQKQKMHDFAVRVGWRMPKGEEKLVKEFCDEVGVDRGVLKVWMHNNKNN  248

Query  478  VGKRDNI  458
             GK+  +
Sbjct  249  FGKKLEV  255



>gb|KDO82923.1| hypothetical protein CISIN_1g046396mg [Citrus sinensis]
Length=314

 Score = 95.1 bits (235),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 40/65 (62%), Positives = 49/65 (75%), Gaps = 0/65 (0%)
 Frame = -1

Query  658  GRKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNT  479
            G+K  RTKFTQ QK KM  FAER+GWK+ + +E+L  DFC E+GV R V KVWMHNNKN 
Sbjct  203  GKKRSRTKFTQEQKEKMLSFAERLGWKMNRAEEKLTQDFCSEVGVSRRVFKVWMHNNKNA  262

Query  478  VGKRD  464
             G++D
Sbjct  263  SGRKD  267



>ref|XP_010527865.1| PREDICTED: zinc-finger homeodomain protein 4 [Tarenaya hassleriana]
Length=316

 Score = 95.1 bits (235),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 39/65 (60%), Positives = 54/65 (83%), Gaps = 0/65 (0%)
 Frame = -1

Query  655  RKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNTV  476
            +K FRTKFTQ QK KM +FAER+GWKIQ+ +E ++  FC+E+GV+R VLKVWMHNNK+ +
Sbjct  222  KKRFRTKFTQEQKEKMLNFAERVGWKIQRQEESVVQQFCQEVGVKRRVLKVWMHNNKHNL  281

Query  475  GKRDN  461
             K+++
Sbjct  282  AKKNS  286



>gb|KDP40895.1| hypothetical protein JCGZ_24894 [Jatropha curcas]
Length=262

 Score = 94.7 bits (234),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 40/65 (62%), Positives = 53/65 (82%), Gaps = 0/65 (0%)
 Frame = -1

Query  655  RKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNTV  476
            +K FRTKFTQ QK KM +FAE++GWKIQK +E ++  FC+EIGV+R VLKVWMHNNK+ +
Sbjct  181  KKRFRTKFTQEQKEKMHNFAEKVGWKIQKQEEAVVQQFCQEIGVKRRVLKVWMHNNKHNL  240

Query  475  GKRDN  461
             K+ +
Sbjct  241  AKKSS  245



>ref|XP_007046103.1| Homeobox protein 34, putative [Theobroma cacao]
 gb|EOY01935.1| Homeobox protein 34, putative [Theobroma cacao]
Length=305

 Score = 95.1 bits (235),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 41/65 (63%), Positives = 51/65 (78%), Gaps = 0/65 (0%)
 Frame = -1

Query  658  GRKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNT  479
            GRK  RTKF++ QK KM  FAER+GW++ K +E LI  FC E+GV+RGVLKVWMHNNKNT
Sbjct  184  GRKRSRTKFSREQKEKMHAFAERLGWRMPKSEERLIEGFCNEVGVDRGVLKVWMHNNKNT  243

Query  478  VGKRD  464
              K++
Sbjct  244  FSKKE  248



>ref|XP_006438687.1| hypothetical protein CICLE_v10032160mg [Citrus clementina]
 ref|XP_006483155.1| PREDICTED: transcription factor HB29-like [Citrus sinensis]
 gb|ESR51927.1| hypothetical protein CICLE_v10032160mg [Citrus clementina]
Length=314

 Score = 95.1 bits (235),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 40/65 (62%), Positives = 49/65 (75%), Gaps = 0/65 (0%)
 Frame = -1

Query  658  GRKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNT  479
            G+K  RTKFTQ QK KM  FAER+GWK+ + +E+L  DFC E+GV R V KVWMHNNKN 
Sbjct  203  GKKRSRTKFTQEQKEKMLSFAERLGWKMNRAEEKLTQDFCSEVGVSRRVFKVWMHNNKNA  262

Query  478  VGKRD  464
             G++D
Sbjct  263  SGRKD  267



>ref|XP_004495441.1| PREDICTED: ZF-HD homeobox protein At4g24660-like [Cicer arietinum]
Length=201

 Score = 93.6 bits (231),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 41/64 (64%), Positives = 51/64 (80%), Gaps = 0/64 (0%)
 Frame = -1

Query  655  RKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNTV  476
            +K  RTKFTQ QK KM DFAE+ GW+IQK +E ++  FC+EIG++R VLKVWMHNNKNT 
Sbjct  134  KKRSRTKFTQEQKEKMQDFAEKAGWRIQKLEESVVQKFCQEIGIKRRVLKVWMHNNKNTF  193

Query  475  GKRD  464
             KR+
Sbjct  194  AKRN  197



>ref|XP_004499360.1| PREDICTED: ZF-HD homeobox protein At4g24660-like [Cicer arietinum]
Length=318

 Score = 95.1 bits (235),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 42/70 (60%), Positives = 52/70 (74%), Gaps = 0/70 (0%)
 Frame = -1

Query  655  RKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNTV  476
            +K FRTKFTQ QK KM  FAE++GWKIQK +E L+  FC+EIGV R VLKVWMHNNK+ +
Sbjct  245  KKRFRTKFTQEQKDKMLSFAEKVGWKIQKQEESLVQQFCQEIGVRRRVLKVWMHNNKHNL  304

Query  475  GKRDNIXTTP  446
             K+ +    P
Sbjct  305  AKKLHTNLPP  314



>ref|XP_010939727.1| PREDICTED: zinc-finger homeodomain protein 2 [Elaeis guineensis]
Length=281

 Score = 94.7 bits (234),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 41/63 (65%), Positives = 50/63 (79%), Gaps = 0/63 (0%)
 Frame = -1

Query  655  RKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNTV  476
            +K FRTKFTQ QK KM  FAER+GW+IQK DE  +  FC E G++R VLKVWMHNNK+T+
Sbjct  218  KKRFRTKFTQEQKDKMLAFAERVGWRIQKHDEAAVQQFCNEAGIKRHVLKVWMHNNKHTL  277

Query  475  GKR  467
            GK+
Sbjct  278  GKK  280



>gb|KJB75536.1| hypothetical protein B456_012G046200 [Gossypium raimondii]
Length=196

 Score = 93.2 bits (230),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 41/71 (58%), Positives = 51/71 (72%), Gaps = 0/71 (0%)
 Frame = -1

Query  661  KGRKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKN  482
            K RK FRTKF+Q QK KM  FAE+ GW+IQK DE  +  FC+EIG++R VLKVWMHNNK 
Sbjct  126  KVRKRFRTKFSQAQKEKMLSFAEKAGWRIQKLDENAVQQFCQEIGIKRRVLKVWMHNNKQ  185

Query  481  TVGKRDNIXTT  449
            +   ++NI   
Sbjct  186  SFANKNNISAA  196



>ref|XP_004156724.1| PREDICTED: LOW QUALITY PROTEIN: ZF-HD homeobox protein At5g65410-like 
[Cucumis sativus]
Length=301

 Score = 94.7 bits (234),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 41/72 (57%), Positives = 54/72 (75%), Gaps = 0/72 (0%)
 Frame = -1

Query  664  MKGRKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNK  485
            M  +K FRTKFT  QK KM  FAE++GWKIQK +E ++  FC+EIGV+R VLKVWMHNNK
Sbjct  222  MMNKKRFRTKFTAEQKEKMLRFAEKVGWKIQKQEESVVQQFCQEIGVKRRVLKVWMHNNK  281

Query  484  NTVGKRDNIXTT  449
            + + K+D +  +
Sbjct  282  HNLAKKDTMSPS  293



>gb|KDP29745.1| hypothetical protein JCGZ_18680 [Jatropha curcas]
Length=246

 Score = 94.0 bits (232),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 41/63 (65%), Positives = 50/63 (79%), Gaps = 0/63 (0%)
 Frame = -1

Query  655  RKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNTV  476
            RK FRTKFTQ QK +M   AER+GW+IQK DE ++  FC E GV+R VLKVWMHNNK+T+
Sbjct  183  RKRFRTKFTQDQKERMLSLAERLGWRIQKHDEAVVQQFCNETGVKRHVLKVWMHNNKHTL  242

Query  475  GKR  467
            GK+
Sbjct  243  GKK  245



>ref|XP_004142854.1| PREDICTED: ZF-HD homeobox protein At4g24660-like [Cucumis sativus]
 gb|KGN51402.1| hypothetical protein Csa_5G527900 [Cucumis sativus]
Length=301

 Score = 94.7 bits (234),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 41/72 (57%), Positives = 54/72 (75%), Gaps = 0/72 (0%)
 Frame = -1

Query  664  MKGRKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNK  485
            M  +K FRTKFT  QK KM  FAE++GWKIQK +E ++  FC+EIGV+R VLKVWMHNNK
Sbjct  222  MMNKKRFRTKFTAEQKEKMLRFAEKVGWKIQKQEESVVQQFCQEIGVKRRVLKVWMHNNK  281

Query  484  NTVGKRDNIXTT  449
            + + K+D +  +
Sbjct  282  HNLAKKDTMSPS  293



>ref|NP_001149424.1| LOC100283050 [Zea mays]
 gb|ACG35395.1| ZF-HD protein dimerisation region containing protein [Zea mays]
Length=308

 Score = 94.7 bits (234),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 40/63 (63%), Positives = 50/63 (79%), Gaps = 0/63 (0%)
 Frame = -1

Query  655  RKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNTV  476
            +K FRTKFTQ QK +M  FAER+GW+IQK DE  +  FC E+ V+R VLKVWMHNNK+T+
Sbjct  245  KKRFRTKFTQEQKXRMLAFAERLGWRIQKHDEAAVQQFCEEVCVKRHVLKVWMHNNKHTL  304

Query  475  GKR  467
            GK+
Sbjct  305  GKK  307



>gb|KHG22175.1| hypothetical protein F383_07505 [Gossypium arboreum]
Length=251

 Score = 94.0 bits (232),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 41/65 (63%), Positives = 50/65 (77%), Gaps = 0/65 (0%)
 Frame = -1

Query  655  RKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNTV  476
            RK FRTKFTQ QK KM   AER+GW+IQK DEE++  FC E GV+R VLKVWMHNNK+T+
Sbjct  176  RKRFRTKFTQEQKEKMLSLAERLGWRIQKHDEEIVQQFCNETGVKRQVLKVWMHNNKHTL  235

Query  475  GKRDN  461
              + +
Sbjct  236  ALKQS  240



>ref|XP_004230410.1| PREDICTED: zinc-finger homeodomain protein 4 [Solanum lycopersicum]
Length=290

 Score = 94.4 bits (233),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 40/70 (57%), Positives = 55/70 (79%), Gaps = 0/70 (0%)
 Frame = -1

Query  655  RKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNTV  476
            +K FRTKFTQ QK KM +FAE++GWKIQK +E ++  FC+E+GV+R VLKVWMHNNK+++
Sbjct  215  KKRFRTKFTQEQKDKMLNFAEKVGWKIQKQEEGVVQQFCQEVGVKRRVLKVWMHNNKHSL  274

Query  475  GKRDNIXTTP  446
             K++     P
Sbjct  275  AKKNITTNIP  284



>gb|KJB18248.1| hypothetical protein B456_003G042700 [Gossypium raimondii]
Length=248

 Score = 93.6 bits (231),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 41/65 (63%), Positives = 50/65 (77%), Gaps = 0/65 (0%)
 Frame = -1

Query  655  RKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNTV  476
            RK FRTKFTQ QK KM   AER+GW+IQK DEE++  FC E GV+R VLKVWMHNNK+T+
Sbjct  173  RKRFRTKFTQEQKEKMLSLAERLGWRIQKHDEEIVQQFCNETGVKRHVLKVWMHNNKHTL  232

Query  475  GKRDN  461
              + +
Sbjct  233  ALKQS  237



>tpg|DAA48505.1| TPA: putative homeobox DNA-binding domain superfamily protein 
[Zea mays]
Length=308

 Score = 94.4 bits (233),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 40/63 (63%), Positives = 50/63 (79%), Gaps = 0/63 (0%)
 Frame = -1

Query  655  RKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNTV  476
            +K FRTKFTQ QK +M  FAER+GW+IQK DE  +  FC E+ V+R VLKVWMHNNK+T+
Sbjct  245  KKRFRTKFTQEQKDRMLAFAERLGWRIQKHDEAAVQQFCEEVCVKRHVLKVWMHNNKHTL  304

Query  475  GKR  467
            GK+
Sbjct  305  GKK  307



>ref|XP_003520078.1| PREDICTED: transcription factor HB29-like [Glycine max]
Length=291

 Score = 94.0 bits (232),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 39/67 (58%), Positives = 51/67 (76%), Gaps = 0/67 (0%)
 Frame = -1

Query  658  GRKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNT  479
            G+K  RTKF+  QK KM +FAE++GW++QK +E L+ DFC EIGV RGV KVWMHNNKNT
Sbjct  194  GKKRHRTKFSHEQKQKMYNFAEKLGWRMQKAEEGLVQDFCNEIGVSRGVFKVWMHNNKNT  253

Query  478  VGKRDNI  458
              +  ++
Sbjct  254  SARNKSL  260



>ref|XP_006349273.1| PREDICTED: ZF-HD homeobox protein At4g24660-like [Solanum tuberosum]
Length=287

 Score = 94.0 bits (232),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 39/65 (60%), Positives = 55/65 (85%), Gaps = 0/65 (0%)
 Frame = -1

Query  655  RKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNTV  476
            +K FRTKFTQ QK KM +FAE++GWKIQK +E ++  FC+E+GV+R VLKVWMHNNK+++
Sbjct  215  KKRFRTKFTQEQKDKMLNFAEKVGWKIQKQEEGVVQQFCQEVGVKRRVLKVWMHNNKHSL  274

Query  475  GKRDN  461
             K+++
Sbjct  275  AKKND  279



>ref|XP_003633412.1| PREDICTED: zinc-finger homeodomain protein 4 [Vitis vinifera]
Length=281

 Score = 93.6 bits (231),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 39/69 (57%), Positives = 54/69 (78%), Gaps = 0/69 (0%)
 Frame = -1

Query  655  RKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNTV  476
            +K FRTKF+Q QK KM  FAE++GWKIQK +E ++  FC+EIGV+R VLKVWMHNNK+ +
Sbjct  211  KKRFRTKFSQEQKEKMLSFAEKVGWKIQKQEEAVVQQFCQEIGVKRRVLKVWMHNNKHNL  270

Query  475  GKRDNIXTT  449
             K+  + ++
Sbjct  271  AKKTPLPSS  279



>ref|XP_006426395.1| hypothetical protein CICLE_v10027184mg [Citrus clementina]
 gb|ESR39635.1| hypothetical protein CICLE_v10027184mg [Citrus clementina]
Length=219

 Score = 92.8 bits (229),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 41/68 (60%), Positives = 51/68 (75%), Gaps = 0/68 (0%)
 Frame = -1

Query  664  MKGRKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNK  485
            M  RK FRTKFTQ QK KM  FAER  W+IQK DE ++  FC+EIG++R VLKVWMHNNK
Sbjct  148  MMMRKRFRTKFTQEQKEKMLSFAERADWRIQKLDESVVQQFCQEIGIKRRVLKVWMHNNK  207

Query  484  NTVGKRDN  461
             +  K+++
Sbjct  208  QSFAKKNS  215



>ref|XP_003574645.1| PREDICTED: zinc-finger homeodomain protein 1-like [Brachypodium 
distachyon]
Length=304

 Score = 94.0 bits (232),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 39/64 (61%), Positives = 51/64 (80%), Gaps = 0/64 (0%)
 Frame = -1

Query  655  RKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNTV  476
            +K FRTKF+Q QK +M  FA+R+GW+IQK DE  +  FC E+GV+R VLKVWMHNNK+T+
Sbjct  239  KKRFRTKFSQEQKERMQAFADRLGWRIQKHDEAAVQQFCEEVGVKRHVLKVWMHNNKHTL  298

Query  475  GKRD  464
            GK+ 
Sbjct  299  GKKP  302



>ref|XP_011003997.1| PREDICTED: zinc-finger homeodomain protein 2-like [Populus euphratica]
Length=268

 Score = 93.6 bits (231),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 42/65 (65%), Positives = 51/65 (78%), Gaps = 0/65 (0%)
 Frame = -1

Query  652  KXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNTVG  473
            K FRTKFTQ QK +M +FAE+IGW+IQK D+  +N FC EIGV+R VLKVWMHNNKN   
Sbjct  188  KRFRTKFTQEQKERMLEFAEKIGWRIQKHDDMALNQFCNEIGVKRNVLKVWMHNNKNAHR  247

Query  472  KRDNI  458
            +RD +
Sbjct  248  RRDGV  252



>gb|KJB70777.1| hypothetical protein B456_011G090900 [Gossypium raimondii]
Length=297

 Score = 94.0 bits (232),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 39/64 (61%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = -1

Query  655  RKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNTV  476
            +K FRTKFTQ QK KM +FAE++GWKIQK +E ++  FC+EIGV+R VLKVWMHNNK+ +
Sbjct  216  KKRFRTKFTQEQKEKMLNFAEKVGWKIQKQEEAVVQQFCQEIGVKRRVLKVWMHNNKHNL  275

Query  475  GKRD  464
             +++
Sbjct  276  ARKN  279



>ref|XP_004973708.1| PREDICTED: ZF-HD homeobox protein At4g24660-like [Setaria italica]
Length=298

 Score = 94.0 bits (232),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 40/63 (63%), Positives = 50/63 (79%), Gaps = 0/63 (0%)
 Frame = -1

Query  655  RKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNTV  476
            +K FRTKFTQ QK +M  FAER+GW+IQK DE  +  FC E+ V+R VLKVWMHNNK+T+
Sbjct  235  KKRFRTKFTQEQKDRMLAFAERLGWRIQKHDEAAVQQFCEEVCVKRHVLKVWMHNNKHTL  294

Query  475  GKR  467
            GK+
Sbjct  295  GKK  297



>ref|XP_011087615.1| PREDICTED: zinc-finger homeodomain protein 4 [Sesamum indicum]
Length=291

 Score = 93.6 bits (231),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 39/64 (61%), Positives = 52/64 (81%), Gaps = 0/64 (0%)
 Frame = -1

Query  655  RKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNTV  476
            +K FRTKFTQ QK KM  FAE++GWKIQK +E ++  FC+E+GV+R VLKVWMHNNK+ +
Sbjct  218  KKRFRTKFTQEQKEKMLSFAEKVGWKIQKQEESVVQQFCQEVGVKRRVLKVWMHNNKHNL  277

Query  475  GKRD  464
             K++
Sbjct  278  AKKN  281



>ref|NP_001151888.1| ZF-HD protein dimerisation region containing protein [Zea mays]
 gb|ACG44773.1| ZF-HD protein dimerisation region containing protein [Zea mays]
Length=273

 Score = 93.6 bits (231),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 40/63 (63%), Positives = 50/63 (79%), Gaps = 0/63 (0%)
 Frame = -1

Query  655  RKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNTV  476
            +K FRTKFTQ QK +M  FAER+GW+IQK DE  +  FC E+ V+R VLKVWMHNNK+T+
Sbjct  210  KKRFRTKFTQEQKDRMLAFAERVGWRIQKHDEAAVQQFCDEVCVKRHVLKVWMHNNKHTL  269

Query  475  GKR  467
            GK+
Sbjct  270  GKK  272



>ref|XP_009800645.1| PREDICTED: putative F-box/LRR-repeat protein At5g41840 [Nicotiana 
sylvestris]
Length=456

 Score = 95.1 bits (235),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 40/65 (62%), Positives = 52/65 (80%), Gaps = 0/65 (0%)
 Frame = -1

Query  658  GRKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNT  479
            GRK  RT F+Q QK KM +FAER+GWK+QK D+ELI+DFC +IGV++ +LKVWMH+N+NT
Sbjct  11   GRKQIRTIFSQYQKKKMLEFAERVGWKLQKRDDELISDFCSKIGVKKRLLKVWMHDNENT  70

Query  478  VGKRD  464
                D
Sbjct  71   FATAD  75



>ref|XP_011075633.1| PREDICTED: zinc-finger homeodomain protein 10-like [Sesamum indicum]
Length=170

 Score = 91.7 bits (226),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 38/67 (57%), Positives = 51/67 (76%), Gaps = 0/67 (0%)
 Frame = -1

Query  667  HMKGRKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNN  488
            H  GRK  RTKF+Q QK KM  F+E++GWK+ K DE  + +FCR++GV +GVL+VWMHNN
Sbjct  79   HPVGRKRSRTKFSQEQKEKMHSFSEKVGWKLHKSDEAAVEEFCRQVGVAKGVLRVWMHNN  138

Query  487  KNTVGKR  467
            K T G++
Sbjct  139  KTTFGRK  145



>ref|XP_002267747.1| PREDICTED: zinc-finger homeodomain protein 3 [Vitis vinifera]
Length=250

 Score = 93.2 bits (230),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 48/62 (77%), Gaps = 0/62 (0%)
 Frame = -1

Query  655  RKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNTV  476
            +K FRTKFTQ QK KM  FAER GW+IQK +E L+  FC+EIG++R VLKVWMHNNKN  
Sbjct  184  KKRFRTKFTQEQKEKMLSFAERAGWRIQKQEESLVQQFCQEIGIKRRVLKVWMHNNKNLA  243

Query  475  GK  470
             K
Sbjct  244  RK  245



>gb|ABY61023.1| zinc finger homeodomain protein 1 [Saruma henryi]
Length=242

 Score = 92.8 bits (229),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 41/63 (65%), Positives = 50/63 (79%), Gaps = 0/63 (0%)
 Frame = -1

Query  655  RKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNTV  476
            +K FRTKFTQ QK KM  FAER+GW+IQK DE ++  FC E  V+R VLKVWMHNNK+T+
Sbjct  179  KKRFRTKFTQEQKDKMLGFAERVGWRIQKQDEAVVQQFCMETNVKRHVLKVWMHNNKHTL  238

Query  475  GKR  467
            GK+
Sbjct  239  GKK  241



>ref|XP_004299701.1| PREDICTED: zinc-finger homeodomain protein 2-like [Fragaria vesca 
subsp. vesca]
Length=254

 Score = 93.2 bits (230),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 40/63 (63%), Positives = 50/63 (79%), Gaps = 0/63 (0%)
 Frame = -1

Query  655  RKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNTV  476
            RK FRTKFT  QK KM +FAE++GW+IQK DE  + +FC   GV+R VLKVWMHNNK+T+
Sbjct  191  RKRFRTKFTAEQKEKMVEFAEKVGWRIQKHDEAAVEEFCAVTGVKRQVLKVWMHNNKHTI  250

Query  475  GKR  467
            GK+
Sbjct  251  GKK  253



>ref|XP_003518249.1| PREDICTED: ZF-HD homeobox protein At4g24660-like [Glycine max]
Length=258

 Score = 93.2 bits (230),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 41/63 (65%), Positives = 50/63 (79%), Gaps = 0/63 (0%)
 Frame = -1

Query  655  RKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNTV  476
            +K FRTKFTQ QK KM  FAE++GW+IQK DE  +  FC EI V+R VLKVWMHNNK+T+
Sbjct  195  KKRFRTKFTQEQKDKMLAFAEQLGWRIQKHDESAVEQFCAEINVKRNVLKVWMHNNKSTL  254

Query  475  GKR  467
            GK+
Sbjct  255  GKK  257



>gb|KHN40205.1| ZF-HD homeobox protein [Glycine soja]
Length=204

 Score = 92.0 bits (227),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 39/64 (61%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = -1

Query  655  RKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNTV  476
            +K FRTKF+Q QK KM +FAE++GWKIQK +E ++  FC+EIGV+R VLKVWMHNNK+ +
Sbjct  131  KKRFRTKFSQEQKDKMLNFAEKVGWKIQKQEESVVQQFCQEIGVKRRVLKVWMHNNKHNL  190

Query  475  GKRD  464
             K++
Sbjct  191  AKKN  194



>ref|XP_011028421.1| PREDICTED: zinc-finger homeodomain protein 4 [Populus euphratica]
Length=296

 Score = 93.6 bits (231),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 38/64 (59%), Positives = 54/64 (84%), Gaps = 0/64 (0%)
 Frame = -1

Query  655  RKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNTV  476
            +K FRTKF+Q QK KM +FAE++GWK+QK +E ++  FC+EIGV+R VLKVWMHNNK+++
Sbjct  222  KKRFRTKFSQEQKEKMLNFAEKVGWKLQKQEETVVQQFCQEIGVKRRVLKVWMHNNKHSL  281

Query  475  GKRD  464
             K++
Sbjct  282  AKKN  285



>ref|XP_007226172.1| hypothetical protein PRUPE_ppa015411mg [Prunus persica]
 gb|EMJ27371.1| hypothetical protein PRUPE_ppa015411mg [Prunus persica]
Length=341

 Score = 93.6 bits (231),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 39/65 (60%), Positives = 54/65 (83%), Gaps = 0/65 (0%)
 Frame = -1

Query  658  GRKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNT  479
             +K FRTKFTQ QK KM +FAE++GWKIQK ++ ++ +FC+EIGV+R VLKVWMHNNK+ 
Sbjct  268  AKKRFRTKFTQEQKEKMFNFAEKVGWKIQKQEDSVVQNFCQEIGVKRRVLKVWMHNNKHN  327

Query  478  VGKRD  464
            + K++
Sbjct  328  LAKKN  332



>emb|CDP02013.1| unnamed protein product [Coffea canephora]
Length=356

 Score = 93.6 bits (231),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 39/63 (62%), Positives = 49/63 (78%), Gaps = 0/63 (0%)
 Frame = -1

Query  655  RKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNTV  476
            RK FRTKFTQ QK +M +FAE++GWKIQK DE+ +  FC E+GV+R V KVWMHNNK  +
Sbjct  292  RKRFRTKFTQQQKDRMNEFAEKLGWKIQKQDEQEVQQFCSEVGVKRQVFKVWMHNNKQAM  351

Query  475  GKR  467
             K+
Sbjct  352  KKK  354



>ref|XP_008338536.1| PREDICTED: LOW QUALITY PROTEIN: zinc-finger homeodomain protein 
1-like [Malus domestica]
Length=278

 Score = 93.2 bits (230),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 40/64 (63%), Positives = 50/64 (78%), Gaps = 0/64 (0%)
 Frame = -1

Query  658  GRKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNT  479
            G+K FRTKF+Q QK +M   AER+GW+IQK DE  +  FC E GV+R VLKVWMHNNK+T
Sbjct  214  GKKRFRTKFSQEQKERMLSLAERLGWRIQKQDEPAVQQFCNETGVKRHVLKVWMHNNKHT  273

Query  478  VGKR  467
            +GK+
Sbjct  274  LGKK  277



>ref|XP_009393647.1| PREDICTED: zinc-finger homeodomain protein 2-like isoform X3 
[Musa acuminata subsp. malaccensis]
Length=281

 Score = 93.2 bits (230),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 41/63 (65%), Positives = 49/63 (78%), Gaps = 0/63 (0%)
 Frame = -1

Query  655  RKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNTV  476
            RK FRTKFTQ QK KM  FAER+GW+IQK DE  +  FC E  ++R VLKVWMHNNK+T+
Sbjct  218  RKRFRTKFTQEQKEKMLAFAERLGWRIQKHDEAAVQQFCEETCIKRHVLKVWMHNNKHTL  277

Query  475  GKR  467
            GK+
Sbjct  278  GKK  280



>ref|XP_010254805.1| PREDICTED: zinc-finger homeodomain protein 5-like [Nelumbo nucifera]
 ref|XP_010254806.1| PREDICTED: zinc-finger homeodomain protein 5-like [Nelumbo nucifera]
 ref|XP_010254807.1| PREDICTED: zinc-finger homeodomain protein 5-like [Nelumbo nucifera]
Length=363

 Score = 93.6 bits (231),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 40/63 (63%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = -1

Query  655  RKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNTV  476
            +K FRTKFTQ QK +M +FAE+IGWKIQK DE  +  FC E+GV+R VLKVWMHNNK+++
Sbjct  299  KKRFRTKFTQEQKDRMLEFAEKIGWKIQKQDEPEVQQFCAEVGVKRQVLKVWMHNNKHSM  358

Query  475  GKR  467
             K+
Sbjct  359  KKK  361



>ref|XP_003529692.1| PREDICTED: ZF-HD homeobox protein At5g65410-like isoform X1 [Glycine 
max]
 ref|XP_006584131.1| PREDICTED: ZF-HD homeobox protein At5g65410-like isoform X2 [Glycine 
max]
Length=283

 Score = 93.2 bits (230),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 39/64 (61%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = -1

Query  655  RKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNTV  476
            +K FRTKF+Q QK KM +FAE++GWKIQK +E ++  FC+EIGV+R VLKVWMHNNK+ +
Sbjct  210  KKRFRTKFSQEQKDKMLNFAEKVGWKIQKQEESVVQQFCQEIGVKRRVLKVWMHNNKHNL  269

Query  475  GKRD  464
             K++
Sbjct  270  AKKN  273



>ref|XP_008795929.1| PREDICTED: zinc-finger homeodomain protein 6-like [Phoenix dactylifera]
Length=267

 Score = 93.2 bits (230),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 39/59 (66%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = -1

Query  655  RKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNT  479
            +K  RTKFT  QK +M DFAER+GW+IQK DE L+ DFC E+GV R VLKVWMHNNK++
Sbjct  196  KKRVRTKFTTEQKERMLDFAERVGWRIQKQDEALVQDFCAEVGVSRPVLKVWMHNNKHS  254



>ref|XP_003550152.1| PREDICTED: ZF-HD homeobox protein At5g65410-like [Glycine max]
Length=286

 Score = 93.2 bits (230),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 40/65 (62%), Positives = 53/65 (82%), Gaps = 0/65 (0%)
 Frame = -1

Query  655  RKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNTV  476
            +K FRTKF+Q QK KM +FAE++GWKIQK +E ++  FC+EIGV+R VLKVWMHNNK+ +
Sbjct  207  KKRFRTKFSQDQKDKMLNFAEKVGWKIQKQEESVVQHFCQEIGVKRRVLKVWMHNNKHNL  266

Query  475  GKRDN  461
             K+ N
Sbjct  267  AKKIN  271



>ref|XP_007143929.1| hypothetical protein PHAVU_007G114300g [Phaseolus vulgaris]
 gb|ESW15923.1| hypothetical protein PHAVU_007G114300g [Phaseolus vulgaris]
Length=197

 Score = 92.0 bits (227),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 42/66 (64%), Positives = 52/66 (79%), Gaps = 0/66 (0%)
 Frame = -1

Query  661  KGRKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKN  482
            K +K FRTKFTQ QK KM  FAER GW++QK DE ++  FC+EIG++R VLKVW+HNNKN
Sbjct  128  KVKKRFRTKFTQEQKEKMLLFAERAGWRLQKLDESVVQKFCQEIGIKRRVLKVWIHNNKN  187

Query  481  TVGKRD  464
            T  KR+
Sbjct  188  TFVKRN  193



>ref|XP_006466561.1| PREDICTED: ZF-HD homeobox protein At4g24660-like [Citrus sinensis]
Length=219

 Score = 92.4 bits (228),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 40/68 (59%), Positives = 51/68 (75%), Gaps = 0/68 (0%)
 Frame = -1

Query  664  MKGRKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNK  485
            M  RK FRTKFTQ QK KM  FAER  W+IQK DE ++  FC+E+G++R VLKVWMHNNK
Sbjct  148  MMMRKRFRTKFTQEQKEKMLSFAERADWRIQKLDESVVQQFCQEVGIKRRVLKVWMHNNK  207

Query  484  NTVGKRDN  461
             +  K+++
Sbjct  208  QSFAKKNS  215



>ref|XP_007023152.1| Homeobox protein 31 [Theobroma cacao]
 gb|EOY25774.1| Homeobox protein 31 [Theobroma cacao]
Length=292

 Score = 93.2 bits (230),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 40/68 (59%), Positives = 54/68 (79%), Gaps = 0/68 (0%)
 Frame = -1

Query  667  HMKGRKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNN  488
            H   +K FRTKFTQ QK KM +FA+++GWKIQK +E ++  FC+EIGV+R VLKVWMHNN
Sbjct  211  HQLVKKRFRTKFTQEQKEKMLNFADKVGWKIQKQEEAVVQQFCQEIGVKRRVLKVWMHNN  270

Query  487  KNTVGKRD  464
            K+ + K++
Sbjct  271  KHNLAKKN  278



>emb|CDO97666.1| unnamed protein product [Coffea canephora]
Length=299

 Score = 93.2 bits (230),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 39/69 (57%), Positives = 54/69 (78%), Gaps = 0/69 (0%)
 Frame = -1

Query  667  HMKGRKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNN  488
            H   +K FRTKFT  QK KM +FAE++GWKIQK +E ++  FC+E+GV+R VLKVWMHNN
Sbjct  218  HQLVKKRFRTKFTPEQKEKMLNFAEKVGWKIQKQEEAVVQQFCQEVGVKRRVLKVWMHNN  277

Query  487  KNTVGKRDN  461
            K+ + K+++
Sbjct  278  KHNLAKKNH  286



>ref|XP_008460585.1| PREDICTED: zinc-finger homeodomain protein 4 [Cucumis melo]
Length=298

 Score = 93.2 bits (230),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 40/72 (56%), Positives = 54/72 (75%), Gaps = 0/72 (0%)
 Frame = -1

Query  664  MKGRKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNK  485
            M  +K FRTKFT  QK KM  FAE++GWKIQK +E ++  FC+EIGV+R VLKVWMHNNK
Sbjct  219  MMNKKRFRTKFTTEQKEKMLRFAEKVGWKIQKQEESVVQQFCQEIGVKRRVLKVWMHNNK  278

Query  484  NTVGKRDNIXTT  449
            + + K++ +  +
Sbjct  279  HNLAKKETMSPS  290



>ref|XP_008218634.1| PREDICTED: zinc-finger homeodomain protein 4-like [Prunus mume]
Length=347

 Score = 93.6 bits (231),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 39/65 (60%), Positives = 54/65 (83%), Gaps = 0/65 (0%)
 Frame = -1

Query  658  GRKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNT  479
             +K FRTKFTQ QK KM +FAE++GWKIQK ++ ++ +FC+EIGV+R VLKVWMHNNK+ 
Sbjct  272  AKKRFRTKFTQEQKEKMFNFAEKVGWKIQKQEDSVVQNFCQEIGVKRRVLKVWMHNNKHN  331

Query  478  VGKRD  464
            + K++
Sbjct  332  LAKKN  336



>ref|XP_006385095.1| hypothetical protein POPTR_0004s23860g, partial [Populus trichocarpa]
 gb|ERP62892.1| hypothetical protein POPTR_0004s23860g, partial [Populus trichocarpa]
Length=312

 Score = 93.2 bits (230),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 38/64 (59%), Positives = 54/64 (84%), Gaps = 0/64 (0%)
 Frame = -1

Query  655  RKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNTV  476
            +K FRTKF+Q QK KM +FAE++GWK+QK +E ++  FC+EIGV+R VLKVWMHNNK+++
Sbjct  239  KKRFRTKFSQEQKEKMLNFAEKVGWKLQKQEETVVQQFCQEIGVKRRVLKVWMHNNKHSL  298

Query  475  GKRD  464
             K++
Sbjct  299  AKKN  302



>gb|ABY61025.1| zinc finger-homeodomain protein 3, partial [Saruma henryi]
Length=211

 Score = 92.0 bits (227),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 41/67 (61%), Positives = 52/67 (78%), Gaps = 0/67 (0%)
 Frame = -1

Query  664  MKGRKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNK  485
            + G+K FRTKF Q QK KM  FAE++GW+IQK ++  +  FC EIGV+R VLKVWMHNNK
Sbjct  134  VSGKKRFRTKFMQEQKEKMVAFAEKLGWRIQKENDVELEKFCSEIGVKRQVLKVWMHNNK  193

Query  484  NTVGKRD  464
            NT+GK+ 
Sbjct  194  NTLGKKQ  200



>ref|XP_004301574.1| PREDICTED: zinc-finger homeodomain protein 4-like [Fragaria vesca 
subsp. vesca]
Length=383

 Score = 93.6 bits (231),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = -1

Query  655  RKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNTV  476
            +K FRTKFTQ QK KM +FAE++GWKIQK +E ++ +FC EIGV+R VLKVWMHNNK+ +
Sbjct  310  KKRFRTKFTQEQKEKMFNFAEKVGWKIQKQEESVVQNFCHEIGVKRRVLKVWMHNNKHNL  369

Query  475  GK  470
             K
Sbjct  370  AK  371



>ref|XP_009365549.1| PREDICTED: zinc-finger homeodomain protein 2-like [Pyrus x bretschneideri]
Length=344

 Score = 93.2 bits (230),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 39/69 (57%), Positives = 53/69 (77%), Gaps = 0/69 (0%)
 Frame = -1

Query  655  RKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNTV  476
            +K FRTKFT  QK +M +F E++GW+IQK DEE +  FC E+GV+R VL+VWMHNNKNT+
Sbjct  250  KKRFRTKFTVEQKERMMEFGEKVGWRIQKQDEEEVERFCAEVGVKRQVLRVWMHNNKNTI  309

Query  475  GKRDNIXTT  449
             K+ ++  T
Sbjct  310  KKQGDVAAT  318



>ref|XP_009336904.1| PREDICTED: zinc-finger homeodomain protein 2-like [Pyrus x bretschneideri]
Length=351

 Score = 93.2 bits (230),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 40/69 (58%), Positives = 53/69 (77%), Gaps = 0/69 (0%)
 Frame = -1

Query  655  RKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNTV  476
            +K FRTKFT  QK +M +FAER+ W+IQK DEE +  FC E+GV+R VL+VWMHNNKNT+
Sbjct  257  KKRFRTKFTVEQKERMMEFAERVEWRIQKQDEEEVERFCAEVGVKRQVLRVWMHNNKNTI  316

Query  475  GKRDNIXTT  449
             K+ ++  T
Sbjct  317  KKQGDVTAT  325



>gb|KHN03576.1| ZF-HD homeobox protein [Glycine soja]
Length=277

 Score = 92.8 bits (229),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 40/65 (62%), Positives = 53/65 (82%), Gaps = 0/65 (0%)
 Frame = -1

Query  655  RKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNTV  476
            +K FRTKF+Q QK KM +FAE++GWKIQK +E ++  FC+EIGV+R VLKVWMHNNK+ +
Sbjct  198  KKRFRTKFSQDQKDKMLNFAEKVGWKIQKQEESVVQHFCQEIGVKRRVLKVWMHNNKHNL  257

Query  475  GKRDN  461
             K+ N
Sbjct  258  AKKIN  262



>ref|XP_006291509.1| hypothetical protein CARUB_v10017657mg [Capsella rubella]
 gb|EOA24407.1| hypothetical protein CARUB_v10017657mg [Capsella rubella]
Length=320

 Score = 93.2 bits (230),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 39/63 (62%), Positives = 50/63 (79%), Gaps = 0/63 (0%)
 Frame = -1

Query  655  RKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNTV  476
            RK FRTKFTQ QK KM  FAER+GWK+Q+ +E  + +FC+EIG+ R VLKVWMHNNK+ +
Sbjct  225  RKRFRTKFTQEQKEKMVSFAERVGWKMQRQEESAVQEFCQEIGIRRRVLKVWMHNNKHNL  284

Query  475  GKR  467
             K+
Sbjct  285  SKK  287



>ref|XP_004293203.2| PREDICTED: zinc-finger homeodomain protein 6 [Fragaria vesca 
subsp. vesca]
Length=349

 Score = 93.2 bits (230),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 47/87 (54%), Positives = 60/87 (69%), Gaps = 5/87 (6%)
 Frame = -1

Query  655  RKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNTV  476
            +K FRTKFT  QK +M +FAE++GW+IQK DEE +  FC E+GV+R VL+VWMHNNKNTV
Sbjct  250  KKRFRTKFTAEQKVRMVEFAEKVGWRIQKQDEEDVERFCDEVGVKRQVLRVWMHNNKNTV  309

Query  475  GKRD-----NIXTTPaaaaaADNGNAH  410
             K       +I TT +  A  +N  AH
Sbjct  310  KKMQHDHDHDITTTTSQLALENNVEAH  336



>ref|XP_008357201.1| PREDICTED: zinc-finger homeodomain protein 5-like [Malus domestica]
 ref|XP_008357202.1| PREDICTED: zinc-finger homeodomain protein 5-like [Malus domestica]
Length=345

 Score = 93.2 bits (230),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 39/69 (57%), Positives = 53/69 (77%), Gaps = 0/69 (0%)
 Frame = -1

Query  655  RKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNTV  476
            +K FRTKFT  QK +M +F E++GW+IQK DEE +  FC E+GV+R VL+VWMHNNKNT+
Sbjct  253  KKRFRTKFTVEQKERMMEFGEKVGWRIQKQDEEEVERFCAEVGVKRQVLRVWMHNNKNTI  312

Query  475  GKRDNIXTT  449
             K+ ++  T
Sbjct  313  KKQGDVTAT  321



>gb|ABY61024.1| zinc finger-homeodomain protein 2 [Saruma henryi]
Length=258

 Score = 92.4 bits (228),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 39/64 (61%), Positives = 52/64 (81%), Gaps = 0/64 (0%)
 Frame = -1

Query  655  RKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNTV  476
            +K FRTKFTQ QK KM  FAE++GW+IQK +E ++  FC+EIGV+R VLKVWMHNNK+ +
Sbjct  190  KKRFRTKFTQEQKEKMLSFAEKVGWRIQKQEESVVQQFCQEIGVKRRVLKVWMHNNKHNL  249

Query  475  GKRD  464
             K++
Sbjct  250  AKKN  253



>ref|XP_006394037.1| hypothetical protein EUTSA_v10005568mg [Eutrema salsugineum]
 dbj|BAJ34581.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ31323.1| hypothetical protein EUTSA_v10005568mg [Eutrema salsugineum]
Length=286

 Score = 92.8 bits (229),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 49/62 (79%), Gaps = 0/62 (0%)
 Frame = -1

Query  655  RKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNTV  476
            RK FRTKFT  QK +M   AERIGW+IQ+ D+ELI  FC+E GV R VLKVW+HNNK+T+
Sbjct  193  RKRFRTKFTAEQKERMLGLAERIGWRIQRQDDELIQRFCQETGVPRQVLKVWLHNNKHTL  252

Query  475  GK  470
            GK
Sbjct  253  GK  254



>ref|XP_006836924.1| hypothetical protein AMTR_s00099p00145100 [Amborella trichopoda]
 gb|ERM99777.1| hypothetical protein AMTR_s00099p00145100 [Amborella trichopoda]
Length=267

 Score = 92.4 bits (228),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 39/63 (62%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = -1

Query  655  RKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNTV  476
            +K FRTKFTQ QK KM  FAE++GW+IQK +E ++  FC+EIGV+R VLKVWMHNNK+ +
Sbjct  202  KKRFRTKFTQEQKEKMLSFAEKVGWRIQKQEEGVVQQFCQEIGVKRRVLKVWMHNNKHNL  261

Query  475  GKR  467
             K+
Sbjct  262  AKK  264



>ref|XP_008789175.1| PREDICTED: zinc-finger homeodomain protein 4-like [Phoenix dactylifera]
Length=253

 Score = 92.4 bits (228),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 38/64 (59%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = -1

Query  655  RKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNTV  476
            RK FRTKFT  QK KM +FA+RIGW++Q+ +E ++  FC+EIGV+R VLKVWMHNNK+++
Sbjct  186  RKRFRTKFTPEQKEKMLNFADRIGWRLQRQEESMVQQFCQEIGVKRRVLKVWMHNNKHSL  245

Query  475  GKRD  464
             K++
Sbjct  246  AKKE  249



>ref|XP_009364948.1| PREDICTED: zinc-finger homeodomain protein 2-like [Pyrus x bretschneideri]
Length=349

 Score = 93.2 bits (230),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 40/69 (58%), Positives = 53/69 (77%), Gaps = 0/69 (0%)
 Frame = -1

Query  655  RKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNTV  476
            +K FRTKFT  QK +M +FAER+ W+IQK DEE +  FC E+GV+R VL+VWMHNNKNT+
Sbjct  255  KKRFRTKFTVEQKERMMEFAERVEWRIQKQDEEEVERFCAEVGVKRQVLRVWMHNNKNTI  314

Query  475  GKRDNIXTT  449
             K+ ++  T
Sbjct  315  KKQGDVTAT  323



>ref|XP_006376247.1| hypothetical protein POPTR_0013s11330g [Populus trichocarpa]
 gb|ERP54044.1| hypothetical protein POPTR_0013s11330g [Populus trichocarpa]
Length=254

 Score = 92.4 bits (228),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 40/65 (62%), Positives = 51/65 (78%), Gaps = 0/65 (0%)
 Frame = -1

Query  652  KXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNTVG  473
            K FRTKFTQ QK +M +FAE+IGW+IQK D+  +N FC E+G++R VLKVWMHNNKN   
Sbjct  167  KRFRTKFTQEQKERMLEFAEKIGWRIQKHDDMALNQFCNEVGIKRNVLKVWMHNNKNAHR  226

Query  472  KRDNI  458
            +RD +
Sbjct  227  RRDGV  231



>ref|XP_010246039.1| PREDICTED: zinc-finger homeodomain protein 1-like [Nelumbo nucifera]
Length=310

 Score = 92.8 bits (229),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 42/64 (66%), Positives = 51/64 (80%), Gaps = 0/64 (0%)
 Frame = -1

Query  652  KXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNTVG  473
            K FRTKFTQ QK KM +FAE++GW+IQK D+  +N FC E+GV+R VLKVWMHNNKN   
Sbjct  228  KRFRTKFTQEQKDKMLEFAEKLGWRIQKHDDVALNQFCSEVGVKRHVLKVWMHNNKNAQR  287

Query  472  KRDN  461
            KR+N
Sbjct  288  KREN  291



>ref|XP_007224511.1| hypothetical protein PRUPE_ppa023369mg [Prunus persica]
 gb|EMJ25710.1| hypothetical protein PRUPE_ppa023369mg [Prunus persica]
Length=310

 Score = 92.8 bits (229),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 39/64 (61%), Positives = 51/64 (80%), Gaps = 0/64 (0%)
 Frame = -1

Query  658  GRKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNT  479
             +K FRTKFTQ QK +M +FAE++GW+IQK DEE +  FC E+GV+R VL+VWMHNNKN+
Sbjct  243  SKKRFRTKFTQEQKERMMEFAEKVGWRIQKQDEEEVERFCAEVGVKRQVLRVWMHNNKNS  302

Query  478  VGKR  467
              K+
Sbjct  303  AKKQ  306



>emb|CDY33960.1| BnaC02g43770D [Brassica napus]
Length=269

 Score = 92.4 bits (228),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 49/62 (79%), Gaps = 0/62 (0%)
 Frame = -1

Query  655  RKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNTV  476
            RK FRTKFT  QK +M   AERIGW+IQ+ D+E+I  FC+E GV R VLKVW+HNNK+T+
Sbjct  179  RKRFRTKFTAEQKERMLGLAERIGWRIQRQDDEVIQRFCQETGVPRQVLKVWLHNNKHTL  238

Query  475  GK  470
            GK
Sbjct  239  GK  240



>ref|XP_002445649.1| hypothetical protein SORBIDRAFT_07g023360 [Sorghum bicolor]
 gb|EES15144.1| hypothetical protein SORBIDRAFT_07g023360 [Sorghum bicolor]
Length=311

 Score = 92.8 bits (229),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 40/63 (63%), Positives = 50/63 (79%), Gaps = 0/63 (0%)
 Frame = -1

Query  655  RKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNTV  476
            +K FRTKFTQ QK +M  FAER+GW+IQK DE  +  FC E+ V+R VLKVWMHNNK+T+
Sbjct  248  KKRFRTKFTQEQKDRMLAFAERLGWRIQKHDEAAVQQFCEEVCVKRHVLKVWMHNNKHTL  307

Query  475  GKR  467
            GK+
Sbjct  308  GKK  310



>gb|KJB48886.1| hypothetical protein B456_008G092000 [Gossypium raimondii]
Length=231

 Score = 92.0 bits (227),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 42/63 (67%), Positives = 49/63 (78%), Gaps = 0/63 (0%)
 Frame = -1

Query  655  RKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNTV  476
            RK FRTKFT  QK KM + AERIGW+IQK DE L+  FC E GV+R V KVWMHNNK+T+
Sbjct  168  RKRFRTKFTHDQKEKMLELAERIGWRIQKHDELLVQQFCNENGVKRQVFKVWMHNNKHTL  227

Query  475  GKR  467
            GK+
Sbjct  228  GKK  230



>ref|NP_178358.1| homeobox protein 21 [Arabidopsis thaliana]
 sp|O64722.1|ZHD3_ARATH RecName: Full=Zinc-finger homeodomain protein 3; Short=AtZHD3; 
AltName: Full=Homeobox protein 21; Short=AtHB-21; AltName: 
Full=Zinc finger homeodomain transcription factor 4 [Arabidopsis 
thaliana]
 gb|AAC18932.1| hypothetical protein [Arabidopsis thaliana]
 gb|AAV63863.1| hypothetical protein At2g02540 [Arabidopsis thaliana]
 gb|AEC05592.1| homeobox protein 21 [Arabidopsis thaliana]
Length=310

 Score = 92.8 bits (229),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 39/65 (60%), Positives = 49/65 (75%), Gaps = 0/65 (0%)
 Frame = -1

Query  655  RKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNTV  476
            +K FRTKFTQ QK KM  FAER+GWKIQ+ +E ++   C+EIG+ R VLKVWMHNNK  +
Sbjct  222  KKRFRTKFTQEQKEKMISFAERVGWKIQRQEESVVQQLCQEIGIRRRVLKVWMHNNKQNL  281

Query  475  GKRDN  461
             K+ N
Sbjct  282  SKKSN  286



>gb|KEH32742.1| homeobox domain, ZF-HD class protein [Medicago truncatula]
Length=365

 Score = 93.2 bits (230),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 39/64 (61%), Positives = 51/64 (80%), Gaps = 0/64 (0%)
 Frame = -1

Query  655  RKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNTV  476
            +K FRTKFTQ QK KM +FAE++GWK QK +E ++  FC+EIGV+R VLKVWMHNNK+ +
Sbjct  284  KKRFRTKFTQEQKEKMLNFAEKVGWKFQKQEESVVQQFCQEIGVKRRVLKVWMHNNKHNL  343

Query  475  GKRD  464
             K+ 
Sbjct  344  AKKQ  347



>gb|KJB64195.1| hypothetical protein B456_010G036300 [Gossypium raimondii]
Length=245

 Score = 92.0 bits (227),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 41/60 (68%), Positives = 47/60 (78%), Gaps = 0/60 (0%)
 Frame = -1

Query  655  RKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNTV  476
            +K FRTKFT  QK KM DFAE++GW+IQK DE  I  FC E GV+R VLKVWMHNNKNT+
Sbjct  183  KKRFRTKFTAEQKEKMLDFAEKLGWRIQKHDEAAIQQFCEETGVKRHVLKVWMHNNKNTL  242



>ref|XP_009395689.1| PREDICTED: zinc-finger homeodomain protein 5-like [Musa acuminata 
subsp. malaccensis]
Length=359

 Score = 92.8 bits (229),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 40/63 (63%), Positives = 47/63 (75%), Gaps = 0/63 (0%)
 Frame = -1

Query  655  RKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNTV  476
            RK FRTKFT  QK KM  FAER GW+IQ+ D  ++  FC EIGV R VLKVWMHNNK+TV
Sbjct  272  RKRFRTKFTAEQKDKMLAFAERAGWRIQRQDSAMVEQFCAEIGVRRQVLKVWMHNNKHTV  331

Query  475  GKR  467
             ++
Sbjct  332  TRK  334



>ref|XP_007158386.1| hypothetical protein PHAVU_002G148900g [Phaseolus vulgaris]
 gb|ESW30380.1| hypothetical protein PHAVU_002G148900g [Phaseolus vulgaris]
Length=236

 Score = 92.0 bits (227),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 40/63 (63%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = -1

Query  655  RKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNTV  476
            +K FRTKFTQ QK KM + AE++GW+IQK DE ++  FC E GV+R VLKVWMHNNK+T+
Sbjct  173  KKRFRTKFTQEQKDKMLELAEKLGWRIQKHDEGVVQAFCNETGVKRHVLKVWMHNNKHTL  232

Query  475  GKR  467
            GK+
Sbjct  233  GKK  235



>ref|XP_008219382.1| PREDICTED: zinc-finger homeodomain protein 2 [Prunus mume]
Length=282

 Score = 92.4 bits (228),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 40/63 (63%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = -1

Query  655  RKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNTV  476
            +K  RTKFTQ QK KM +FAE++GW+IQK DE  + +FC E GV+R VLKVWMHNNK+T+
Sbjct  217  KKRHRTKFTQEQKEKMLEFAEKVGWRIQKHDEAAVEEFCGETGVKRQVLKVWMHNNKHTL  276

Query  475  GKR  467
            GK+
Sbjct  277  GKK  279



>ref|XP_007222197.1| hypothetical protein PRUPE_ppa009679mg [Prunus persica]
 gb|EMJ23396.1| hypothetical protein PRUPE_ppa009679mg [Prunus persica]
Length=282

 Score = 92.4 bits (228),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 40/63 (63%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = -1

Query  655  RKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNTV  476
            +K  RTKFTQ QK KM +FAE++GW+IQK DE  + +FC E GV+R VLKVWMHNNK+T+
Sbjct  217  KKRHRTKFTQEQKEKMLEFAEKVGWRIQKHDEAAVEEFCGETGVKRQVLKVWMHNNKHTL  276

Query  475  GKR  467
            GK+
Sbjct  277  GKK  279



>ref|XP_006426297.1| hypothetical protein CICLE_v10027024mg [Citrus clementina]
 ref|XP_006466284.1| PREDICTED: ZF-HD homeobox protein At4g24660-like [Citrus sinensis]
 gb|ESR39537.1| hypothetical protein CICLE_v10027024mg [Citrus clementina]
 gb|KDO60627.1| hypothetical protein CISIN_1g026161mg [Citrus sinensis]
Length=242

 Score = 92.0 bits (227),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 39/63 (62%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = -1

Query  655  RKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNTV  476
            RK FRTKFT  QK +M + AE++GW+IQK DEE++  FC + GV+R VLKVWMHNNK+T+
Sbjct  179  RKRFRTKFTPEQKDRMLELAEKLGWRIQKHDEEVVQQFCNDTGVKRHVLKVWMHNNKHTL  238

Query  475  GKR  467
            GK+
Sbjct  239  GKK  241



>gb|AAM10791.1| hypothetical protein At2g02540/T822.16 [Arabidopsis thaliana]
Length=310

 Score = 92.4 bits (228),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 39/65 (60%), Positives = 49/65 (75%), Gaps = 0/65 (0%)
 Frame = -1

Query  655  RKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNTV  476
            +K FRTKFTQ QK KM  FAER+GWKIQ+ +E ++   C+EIG+ R VLKVWMHNNK  +
Sbjct  222  KKRFRTKFTQEQKEKMISFAERVGWKIQRQEESVVQQLCQEIGIRRRVLKVWMHNNKQNL  281

Query  475  GKRDN  461
             K+ N
Sbjct  282  SKKSN  286



>ref|XP_003635057.1| PREDICTED: zinc-finger homeodomain protein 2-like [Vitis vinifera]
Length=244

 Score = 92.0 bits (227),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 40/61 (66%), Positives = 48/61 (79%), Gaps = 0/61 (0%)
 Frame = -1

Query  655  RKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNTV  476
            +K FRTKFTQ QK KM   AER+GW+IQK DE ++  FC E GV+R VLKVWMHNNK+T+
Sbjct  164  KKRFRTKFTQEQKDKMFGLAERLGWRIQKHDEAVVQQFCSETGVKRHVLKVWMHNNKHTL  223

Query  475  G  473
            G
Sbjct  224  G  224



>ref|XP_006376248.1| hypothetical protein POPTR_0013s11330g [Populus trichocarpa]
 gb|ERP54045.1| hypothetical protein POPTR_0013s11330g [Populus trichocarpa]
Length=281

 Score = 92.4 bits (228),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 40/65 (62%), Positives = 51/65 (78%), Gaps = 0/65 (0%)
 Frame = -1

Query  652  KXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNTVG  473
            K FRTKFTQ QK +M +FAE+IGW+IQK D+  +N FC E+G++R VLKVWMHNNKN   
Sbjct  194  KRFRTKFTQEQKERMLEFAEKIGWRIQKHDDMALNQFCNEVGIKRNVLKVWMHNNKNAHR  253

Query  472  KRDNI  458
            +RD +
Sbjct  254  RRDGV  258



>ref|XP_002525870.1| transcription factor, putative [Ricinus communis]
 gb|EEF36564.1| transcription factor, putative [Ricinus communis]
Length=311

 Score = 92.4 bits (228),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 38/66 (58%), Positives = 53/66 (80%), Gaps = 0/66 (0%)
 Frame = -1

Query  655  RKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNTV  476
            +K +RTKF+Q QK KM +FAE++GWKIQK +E ++  FC+EIGV+R VLKVWMHNNK+ +
Sbjct  229  KKRYRTKFSQEQKEKMLNFAEKVGWKIQKQEEAVVQQFCQEIGVKRRVLKVWMHNNKHNL  288

Query  475  GKRDNI  458
             K+  +
Sbjct  289  AKKSPL  294



>ref|XP_011001095.1| PREDICTED: zinc-finger homeodomain protein 2-like [Populus euphratica]
Length=281

 Score = 92.4 bits (228),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 40/65 (62%), Positives = 51/65 (78%), Gaps = 0/65 (0%)
 Frame = -1

Query  652  KXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNTVG  473
            K FRTKFTQ QK +M +FAE+IGW+IQK D+  +N FC E+G++R VLKVWMHNNKN   
Sbjct  194  KRFRTKFTQEQKERMLEFAEKIGWRIQKHDDMALNQFCNEVGIKRNVLKVWMHNNKNAHR  253

Query  472  KRDNI  458
            +RD +
Sbjct  254  RRDGV  258



>ref|XP_010060081.1| PREDICTED: zinc-finger homeodomain protein 2-like isoform X2 
[Eucalyptus grandis]
 gb|KCW66609.1| hypothetical protein EUGRSUZ_F00403 [Eucalyptus grandis]
Length=330

 Score = 92.4 bits (228),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 41/63 (65%), Positives = 49/63 (78%), Gaps = 0/63 (0%)
 Frame = -1

Query  655  RKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNTV  476
            +K FRTKFT  QK KM  FAER+GW+IQK DE  +  FC E GV+R VLKVWMHNNK+T+
Sbjct  267  KKRFRTKFTPEQKEKMLGFAERLGWRIQKHDETAVEQFCAETGVKRHVLKVWMHNNKHTL  326

Query  475  GKR  467
            GK+
Sbjct  327  GKK  329



>ref|XP_008810728.1| PREDICTED: zinc-finger homeodomain protein 6-like [Phoenix dactylifera]
Length=344

 Score = 92.4 bits (228),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 39/60 (65%), Positives = 46/60 (77%), Gaps = 0/60 (0%)
 Frame = -1

Query  655  RKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNTV  476
            +K FRTKFT  QK KM  FAER+GW+I K DE L+  FC E+GV R VLKVWMHNNK+T+
Sbjct  258  KKRFRTKFTAEQKEKMLAFAERVGWRIHKQDEALVEQFCAEVGVRRQVLKVWMHNNKHTI  317



>ref|XP_001785616.1| predicted protein [Physcomitrella patens]
 gb|EDQ49563.1| predicted protein [Physcomitrella patens]
Length=315

 Score = 92.4 bits (228),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/63 (63%), Positives = 50/63 (79%), Gaps = 0/63 (0%)
 Frame = -1

Query  655  RKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNTV  476
            +K FRTKFT  QK KM  FAE++GW+IQK DE  + +FC  +GV+R VLKVWMHNNK+TV
Sbjct  252  KKRFRTKFTTEQKDKMCAFAEKLGWRIQKHDEAAVQEFCTTVGVKRHVLKVWMHNNKHTV  311

Query  475  GKR  467
            GK+
Sbjct  312  GKK  314



>ref|XP_011012906.1| PREDICTED: zinc-finger homeodomain protein 4-like [Populus euphratica]
Length=280

 Score = 92.0 bits (227),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 39/69 (57%), Positives = 54/69 (78%), Gaps = 0/69 (0%)
 Frame = -1

Query  655  RKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNTV  476
            +K +RTKFTQ QK KM +FAE++GWK+QK +E ++  FC+EIG++R VLKVWMHNNK  +
Sbjct  211  KKRYRTKFTQEQKEKMLNFAEKVGWKLQKQEETVVQQFCQEIGIKRRVLKVWMHNNKLNL  270

Query  475  GKRDNIXTT  449
             K++   TT
Sbjct  271  AKKNPSTTT  279



>ref|XP_009130511.1| PREDICTED: zinc-finger homeodomain protein 1-like [Brassica rapa]
 emb|CDY37827.1| BnaAnng04880D [Brassica napus]
Length=272

 Score = 92.0 bits (227),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 49/62 (79%), Gaps = 0/62 (0%)
 Frame = -1

Query  655  RKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNTV  476
            RK FRTKFT  QK +M   AERIGW+IQ+ D+E+I  FC+E GV R VLKVW+HNNK+T+
Sbjct  183  RKRFRTKFTAEQKERMLGLAERIGWRIQRQDDEVIQRFCQETGVPRQVLKVWLHNNKHTL  242

Query  475  GK  470
            GK
Sbjct  243  GK  244



>gb|KFK26902.1| hypothetical protein AALP_AA8G308300 [Arabis alpina]
Length=305

 Score = 92.4 bits (228),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/64 (63%), Positives = 49/64 (77%), Gaps = 0/64 (0%)
 Frame = -1

Query  658  GRKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNT  479
             RK FRTKFTQ QK KM +FA+R+ WK+QK DE+ +  FC +IGV++ VLKVWMHNNKNT
Sbjct  184  SRKRFRTKFTQFQKEKMHEFADRVNWKMQKRDEDDVRQFCNQIGVDKSVLKVWMHNNKNT  243

Query  478  VGKR  467
               R
Sbjct  244  FNNR  247



>ref|XP_010098663.1| hypothetical protein L484_026038 [Morus notabilis]
 gb|EXB75566.1| hypothetical protein L484_026038 [Morus notabilis]
Length=258

 Score = 92.0 bits (227),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 41/63 (65%), Positives = 48/63 (76%), Gaps = 0/63 (0%)
 Frame = -1

Query  655  RKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNTV  476
            +K FRTKFTQ QK KM  FAE +GW+IQK DE  +  FC E GV R VLKVWMHNNK+T+
Sbjct  195  KKRFRTKFTQEQKEKMLAFAESVGWRIQKHDEAAVEQFCAETGVRRPVLKVWMHNNKHTL  254

Query  475  GKR  467
            GK+
Sbjct  255  GKK  257



>ref|XP_008385681.1| PREDICTED: zinc-finger homeodomain protein 1-like isoform X2 
[Malus domestica]
Length=274

 Score = 92.0 bits (227),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/64 (63%), Positives = 49/64 (77%), Gaps = 0/64 (0%)
 Frame = -1

Query  658  GRKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNT  479
            G+K FRTKF+Q QK +M   AER+GW+IQK DE  +  FC E GV R VLKVWMHNNK+T
Sbjct  210  GKKRFRTKFSQEQKERMLSLAERLGWRIQKQDEPAVQQFCNETGVNRHVLKVWMHNNKHT  269

Query  478  VGKR  467
            +GK+
Sbjct  270  LGKK  273



>gb|KJB58948.1| hypothetical protein B456_009G231800 [Gossypium raimondii]
Length=255

 Score = 91.7 bits (226),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 41/63 (65%), Positives = 48/63 (76%), Gaps = 0/63 (0%)
 Frame = -1

Query  655  RKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNTV  476
            +K FRTKFT  QK KM  FAER+GW+IQK DE  +  FC E GV+R VLKVWMHNNK T+
Sbjct  192  KKRFRTKFTPEQKDKMLGFAERLGWRIQKHDEAAVEQFCEETGVKRQVLKVWMHNNKYTL  251

Query  475  GKR  467
            GK+
Sbjct  252  GKK  254



>ref|XP_009769511.1| PREDICTED: zinc-finger homeodomain protein 2-like isoform X2 
[Nicotiana sylvestris]
Length=241

 Score = 91.7 bits (226),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 38/63 (60%), Positives = 49/63 (78%), Gaps = 0/63 (0%)
 Frame = -1

Query  655  RKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNTV  476
            +K FRTKF+Q QK KM + A+++GW+IQ+ DEEL+   C E GV R V KVWMHNNKNT+
Sbjct  178  KKRFRTKFSQEQKEKMQELADKLGWRIQREDEELVQQLCNETGVRRQVFKVWMHNNKNTL  237

Query  475  GKR  467
            GK+
Sbjct  238  GKK  240



>ref|XP_009769508.1| PREDICTED: zinc-finger homeodomain protein 2-like isoform X1 
[Nicotiana sylvestris]
Length=242

 Score = 91.7 bits (226),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 38/63 (60%), Positives = 49/63 (78%), Gaps = 0/63 (0%)
 Frame = -1

Query  655  RKXFRTKFTQVQKGKMXDFAERIGWKIQKXDEELINDFCREIGVERGVLKVWMHNNKNTV  476
            +K FRTKF+Q QK KM + A+++GW+IQ+ DEEL+   C E GV R V KVWMHNNKNT+
Sbjct  179  KKRFRTKFSQEQKEKMQELADKLGWRIQREDEELVQQLCNETGVRRQVFKVWMHNNKNTL  238

Query  475  GKR  467
            GK+
Sbjct  239  GKK  241



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1050626367960