BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF008F01

Length=804
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KJB12308.1|  hypothetical protein B456_002G010900                    241   2e-72   Gossypium raimondii
gb|KJB12310.1|  hypothetical protein B456_002G010900                    241   2e-72   Gossypium raimondii
gb|KHG12836.1|  Magnesium transporter MRS2-3 -like protein              241   3e-72   Gossypium arboreum [tree cotton]
ref|XP_010088315.1|  Magnesium transporter MRS2-3                       234   8e-70   Morus notabilis
emb|CBI22425.3|  unnamed protein product                                230   1e-68   Vitis vinifera
ref|XP_010028349.1|  PREDICTED: LOW QUALITY PROTEIN: magnesium tr...    230   5e-68   
ref|XP_010273130.1|  PREDICTED: magnesium transporter MRS2-3            229   8e-68   Nelumbo nucifera [Indian lotus]
ref|XP_002268333.1|  PREDICTED: magnesium transporter MRS2-3            229   1e-67   Vitis vinifera
gb|KDO57931.1|  hypothetical protein CISIN_1g014053mg                   227   1e-67   Citrus sinensis [apfelsine]
gb|KDO57932.1|  hypothetical protein CISIN_1g014053mg                   227   1e-67   Citrus sinensis [apfelsine]
ref|XP_009790318.1|  PREDICTED: magnesium transporter MRS2-3 isof...    228   4e-67   Nicotiana sylvestris
ref|XP_009603566.1|  PREDICTED: magnesium transporter MRS2-3 isof...    228   4e-67   Nicotiana tomentosiformis
ref|XP_006422781.1|  hypothetical protein CICLE_v10028291mg             228   4e-67   Citrus clementina [clementine]
ref|XP_006486899.1|  PREDICTED: magnesium transporter MRS2-3-like       227   5e-67   Citrus sinensis [apfelsine]
ref|XP_004230684.1|  PREDICTED: magnesium transporter MRS2-3            227   6e-67   Solanum lycopersicum
ref|XP_006346286.1|  PREDICTED: magnesium transporter MRS2-3-like       226   2e-66   Solanum tuberosum [potatoes]
gb|KDP44523.1|  hypothetical protein JCGZ_16356                         224   6e-66   Jatropha curcas
ref|XP_008346300.1|  PREDICTED: magnesium transporter MRS2-3-like       214   4e-65   
ref|XP_008455050.1|  PREDICTED: magnesium transporter MRS2-3 isof...    222   6e-65   Cucumis melo [Oriental melon]
ref|XP_007157203.1|  hypothetical protein PHAVU_002G051200g             219   1e-64   Phaseolus vulgaris [French bean]
ref|XP_004136933.1|  PREDICTED: magnesium transporter MRS2-3-like       220   3e-64   Cucumis sativus [cucumbers]
ref|XP_002313918.2|  magnesium transporter CorA-like family protein     219   9e-64   
ref|XP_008455051.1|  PREDICTED: magnesium transporter MRS2-3 isof...    218   1e-63   Cucumis melo [Oriental melon]
ref|XP_011002248.1|  PREDICTED: magnesium transporter MRS2-3-like       218   1e-63   Populus euphratica
ref|XP_007200985.1|  hypothetical protein PRUPE_ppa004809mg             218   3e-63   Prunus persica
ref|XP_009343185.1|  PREDICTED: magnesium transporter MRS2-3-like       216   1e-62   Pyrus x bretschneideri [bai li]
ref|XP_008236295.1|  PREDICTED: magnesium transporter MRS2-3-like       214   6e-62   Prunus mume [ume]
ref|XP_009343908.1|  PREDICTED: magnesium transporter MRS2-3-like...    214   9e-62   Pyrus x bretschneideri [bai li]
gb|KCW55083.1|  hypothetical protein EUGRSUZ_I01045                     207   1e-61   Eucalyptus grandis [rose gum]
ref|XP_009375650.1|  PREDICTED: magnesium transporter MRS2-3-like       213   2e-61   
ref|XP_008351791.1|  PREDICTED: magnesium transporter MRS2-3 isof...    211   7e-61   Malus domestica [apple tree]
gb|EYU42498.1|  hypothetical protein MIMGU_mgv1a007140mg                209   8e-61   Erythranthe guttata [common monkey flower]
ref|XP_008351785.1|  PREDICTED: magnesium transporter MRS2-3 isof...    211   1e-60   Malus domestica [apple tree]
ref|XP_011071765.1|  PREDICTED: magnesium transporter MRS2-3-like       209   2e-60   Sesamum indicum [beniseed]
emb|CAN74927.1|  hypothetical protein VITISV_038594                     202   7e-60   Vitis vinifera
ref|XP_010691547.1|  PREDICTED: magnesium transporter MRS2-3            207   2e-59   Beta vulgaris subsp. vulgaris [field beet]
gb|AFK48474.1|  unknown                                                 205   3e-59   Lotus japonicus
ref|XP_007042675.1|  Magnesium transporter 4 isoform 1                  206   3e-59   
ref|XP_003516767.1|  PREDICTED: magnesium transporter MRS2-3-like       202   1e-58   Glycine max [soybeans]
emb|CDP09701.1|  unnamed protein product                                201   7e-58   Coffea canephora [robusta coffee]
gb|EYU38670.1|  hypothetical protein MIMGU_mgv1a021974mg                201   1e-57   Erythranthe guttata [common monkey flower]
ref|XP_011077822.1|  PREDICTED: magnesium transporter MRS2-3            202   3e-57   Sesamum indicum [beniseed]
ref|XP_004511321.1|  PREDICTED: magnesium transporter MRS2-3-like       201   3e-57   Cicer arietinum [garbanzo]
ref|XP_002522142.1|  RNA splicing protein mrs2, mitochondrial, pu...    199   8e-57   
ref|XP_006857124.1|  hypothetical protein AMTR_s00065p00139210          200   1e-56   Amborella trichopoda
ref|XP_010507876.1|  PREDICTED: magnesium transporter MRS2-3            199   2e-56   Camelina sativa [gold-of-pleasure]
ref|XP_007042676.1|  Magnesium transporter 4 isoform 2                  199   2e-56   
ref|XP_006590388.1|  PREDICTED: magnesium transporter MRS2-3-like       197   3e-56   Glycine max [soybeans]
ref|XP_010466120.1|  PREDICTED: magnesium transporter MRS2-3-like       199   3e-56   Camelina sativa [gold-of-pleasure]
ref|XP_011030312.1|  PREDICTED: magnesium transporter MRS2-3-like...    199   4e-56   Populus euphratica
ref|XP_010487909.1|  PREDICTED: magnesium transporter MRS2-3-like       197   1e-55   Camelina sativa [gold-of-pleasure]
ref|XP_003610633.1|  Magnesium transporter                              196   2e-55   Medicago truncatula
ref|XP_002522143.1|  RNA splicing protein mrs2, mitochondrial, pu...    195   3e-55   
ref|XP_006297595.1|  hypothetical protein CARUB_v10013617mg             194   2e-54   Capsella rubella
gb|KHN35209.1|  Magnesium transporter MRS2-3                            191   2e-54   Glycine soja [wild soybean]
ref|XP_006406476.1|  hypothetical protein EUTSA_v10020646mg             192   7e-54   Eutrema salsugineum [saltwater cress]
gb|KJB79462.1|  hypothetical protein B456_013G051100                    190   3e-53   Gossypium raimondii
ref|NP_188598.2|  magnesium transporter MRS2-3                          190   5e-53   Arabidopsis thaliana [mouse-ear cress]
gb|KFK39291.1|  hypothetical protein AALP_AA3G225600                    189   7e-53   Arabis alpina [alpine rockcress]
gb|KFK39290.1|  hypothetical protein AALP_AA3G225600                    189   8e-53   Arabis alpina [alpine rockcress]
ref|XP_010558892.1|  PREDICTED: magnesium transporter MRS2-3            189   9e-53   
ref|XP_002883195.1|  hypothetical protein ARALYDRAFT_479481             188   3e-52   Arabidopsis lyrata subsp. lyrata
gb|ABR17972.1|  unknown                                                 188   3e-52   Picea sitchensis
ref|XP_006486898.1|  PREDICTED: magnesium transporter MRS2-3-like       188   5e-52   Citrus sinensis [apfelsine]
ref|XP_011094263.1|  PREDICTED: magnesium transporter MRS2-3-like       187   1e-51   
ref|XP_009399090.1|  PREDICTED: magnesium transporter MRS2-3            186   2e-51   
ref|XP_010941938.1|  PREDICTED: magnesium transporter MRS2-3-like       185   4e-51   
ref|XP_009145765.1|  PREDICTED: magnesium transporter MRS2-3-like       183   2e-50   Brassica rapa
ref|XP_008797020.1|  PREDICTED: magnesium transporter MRS2-3-like       181   2e-50   
ref|XP_004292113.1|  PREDICTED: magnesium transporter MRS2-3            179   1e-48   Fragaria vesca subsp. vesca
emb|CDY66275.1|  BnaAnng21960D                                          177   2e-48   Brassica napus [oilseed rape]
gb|KDO57930.1|  hypothetical protein CISIN_1g033601mg                   162   2e-46   Citrus sinensis [apfelsine]
ref|XP_009111645.1|  PREDICTED: magnesium transporter MRS2-3-like...    172   2e-46   Brassica rapa
ref|XP_009111637.1|  PREDICTED: magnesium transporter MRS2-3-like...    172   2e-46   Brassica rapa
ref|XP_007199181.1|  hypothetical protein PRUPE_ppa020091mg             171   3e-46   
ref|XP_008236348.1|  PREDICTED: magnesium transporter MRS2-3-like       172   1e-45   Prunus mume [ume]
gb|KFK40012.1|  hypothetical protein AALP_AA3G318600                    168   4e-45   Arabis alpina [alpine rockcress]
emb|CDX95430.1|  BnaC01g33220D                                          168   5e-45   
gb|KFK31826.1|  hypothetical protein AALP_AA6G163500                    166   3e-44   Arabis alpina [alpine rockcress]
ref|XP_001786202.1|  predicted protein                                  168   4e-44   
ref|XP_004296095.1|  PREDICTED: magnesium transporter MRS2-3-like       166   5e-44   Fragaria vesca subsp. vesca
emb|CDY42196.1|  BnaA01g25990D                                          165   1e-43   Brassica napus [oilseed rape]
ref|XP_002976803.1|  hypothetical protein SELMODRAFT_53758              163   4e-43   
ref|XP_002980531.1|  hypothetical protein SELMODRAFT_53759              163   4e-43   
gb|ABR17877.1|  unknown                                                 163   8e-43   Picea sitchensis
emb|CDY58861.1|  BnaCnng33870D                                          163   2e-42   Brassica napus [oilseed rape]
gb|EPS69517.1|  hypothetical protein M569_05248                         153   7e-40   Genlisea aurea
gb|KCW63394.1|  hypothetical protein EUGRSUZ_G01039                     147   3e-37   Eucalyptus grandis [rose gum]
ref|XP_010065746.1|  PREDICTED: magnesium transporter MRS2-3-like...    147   3e-37   Eucalyptus grandis [rose gum]
ref|XP_010065747.1|  PREDICTED: magnesium transporter MRS2-3-like...    147   4e-37   Eucalyptus grandis [rose gum]
ref|XP_006847049.1|  hypothetical protein AMTR_s00017p00188570          143   6e-36   
ref|XP_010912043.1|  PREDICTED: magnesium transporter MRS2-F-like       142   2e-35   Elaeis guineensis
ref|XP_006847050.1|  hypothetical protein AMTR_s00017p00189670          141   3e-35   
ref|XP_008785924.1|  PREDICTED: magnesium transporter MRS2-F-like       139   1e-34   
dbj|BAK02642.1|  predicted protein                                      138   5e-34   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDM85537.1|  unnamed protein product                                138   6e-34   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010232712.1|  PREDICTED: magnesium transporter MRS2-F-like       137   2e-33   Brachypodium distachyon [annual false brome]
ref|XP_008674680.1|  PREDICTED: magnesium transporter MRS2-F isof...    135   2e-33   Zea mays [maize]
ref|XP_008674679.1|  PREDICTED: magnesium transporter MRS2-F isof...    135   5e-33   Zea mays [maize]
ref|XP_002458951.1|  hypothetical protein SORBIDRAFT_03g043270          135   5e-33   Sorghum bicolor [broomcorn]
ref|NP_001142108.1|  hypothetical protein                               135   5e-33   Zea mays [maize]
ref|XP_004970981.1|  PREDICTED: magnesium transporter MRS2-F-like       134   8e-33   Setaria italica
ref|XP_002310545.2|  hypothetical protein POPTR_0007s04900g             132   3e-32   Populus trichocarpa [western balsam poplar]
ref|XP_006369727.1|  hypothetical protein POPTR_0001s29930g             124   5e-32   
ref|XP_010232713.1|  PREDICTED: magnesium transporter MRS2-F-like       132   6e-32   Brachypodium distachyon [annual false brome]
emb|CDP20392.1|  unnamed protein product                                132   8e-32   Coffea canephora [robusta coffee]
ref|XP_011022848.1|  PREDICTED: magnesium transporter MRS2-F-like       131   8e-32   Populus euphratica
ref|XP_010242772.1|  PREDICTED: magnesium transporter MRS2-F-like...    129   1e-31   
ref|XP_010027558.1|  PREDICTED: magnesium transporter MRS2-F-like       125   1e-31   
ref|XP_009385103.1|  PREDICTED: magnesium transporter MRS2-F-like       130   2e-31   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001045144.2|  Os01g0908500                                       129   2e-31   
gb|EPS72108.1|  hypothetical protein M569_02647                         133   3e-31   Genlisea aurea
ref|XP_006646586.1|  PREDICTED: magnesium transporter MRS2-F-like       130   4e-31   
ref|XP_010242771.1|  PREDICTED: magnesium transporter MRS2-F-like...    130   4e-31   Nelumbo nucifera [Indian lotus]
gb|KEH44009.1|  magnesium transporter 2                                 129   5e-31   Medicago truncatula
gb|KCW54115.1|  hypothetical protein EUGRSUZ_I000931                    126   5e-31   Eucalyptus grandis [rose gum]
gb|KCW54114.1|  hypothetical protein EUGRSUZ_I000931                    127   9e-31   Eucalyptus grandis [rose gum]
sp|Q8L4S2.1|MRS2F_ORYSJ  RecName: Full=Magnesium transporter MRS2-F     129   9e-31   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010242791.1|  PREDICTED: magnesium transporter MRS2-F-like       128   1e-30   Nelumbo nucifera [Indian lotus]
gb|KCW63395.1|  hypothetical protein EUGRSUZ_G01040                     128   1e-30   Eucalyptus grandis [rose gum]
ref|XP_010065748.1|  PREDICTED: magnesium transporter MRS2-3-like       127   3e-30   Eucalyptus grandis [rose gum]
ref|XP_009402632.1|  PREDICTED: magnesium transporter MRS2-F-like       127   4e-30   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010027528.1|  PREDICTED: magnesium transporter MRS2-F-like       127   4e-30   Eucalyptus grandis [rose gum]
ref|XP_004496868.1|  PREDICTED: magnesium transporter MRS2-3-like       126   5e-30   Cicer arietinum [garbanzo]
ref|XP_006847048.1|  hypothetical protein AMTR_s00017p00187240          126   9e-30   
gb|EPS69518.1|  hypothetical protein M569_05249                         125   2e-29   Genlisea aurea
ref|XP_010912044.1|  PREDICTED: LOW QUALITY PROTEIN: magnesium tr...    124   3e-29   Elaeis guineensis
ref|XP_010652955.1|  PREDICTED: magnesium transporter MRS2-F-like       124   4e-29   Vitis vinifera
gb|EMT06500.1|  Endo-1,3(4)-beta-glucanase 1                            127   5e-29   
ref|XP_002446494.1|  hypothetical protein SORBIDRAFT_06g016880          123   7e-29   
ref|XP_010674588.1|  PREDICTED: magnesium transporter MRS2-F-like       122   1e-28   
tpg|DAA37768.1|  TPA: hypothetical protein ZEAMMB73_587233              120   6e-28   
ref|XP_008671295.1|  PREDICTED: putative magnesium transporter MR...    120   7e-28   
ref|XP_002310546.2|  hypothetical protein POPTR_0007s04910g             120   1e-27   
ref|XP_004970719.1|  PREDICTED: magnesium transporter MRS2-E-like...    119   2e-27   Setaria italica
ref|XP_010232616.1|  PREDICTED: magnesium transporter MRS2-E-like...    119   2e-27   Brachypodium distachyon [annual false brome]
ref|XP_006492023.1|  PREDICTED: magnesium transporter MRS2-F-like       119   2e-27   
ref|XP_003630576.1|  Mitochondrial inner membrane magnesium trans...    114   4e-27   
gb|KDO45570.1|  hypothetical protein CISIN_1g015133mg                   117   7e-27   Citrus sinensis [apfelsine]
ref|XP_010526977.1|  PREDICTED: magnesium transporter MRS2-F-like       117   7e-27   Tarenaya hassleriana [spider flower]
gb|EMT25408.1|  Mitochondrial inner membrane magnesium transporte...    117   7e-27   
ref|NP_001044924.1|  Os01g0869200                                       117   1e-26   
ref|XP_004977994.1|  PREDICTED: putative magnesium transporter MR...    116   1e-26   Setaria italica
emb|CDM85161.1|  unnamed protein product                                116   2e-26   Triticum aestivum [Canadian hard winter wheat]
ref|XP_002456989.1|  hypothetical protein SORBIDRAFT_03g046843          110   3e-26   
ref|XP_006646509.1|  PREDICTED: magnesium transporter MRS2-E-like       115   3e-26   Oryza brachyantha
ref|XP_002456702.1|  hypothetical protein SORBIDRAFT_03g041080          115   3e-26   Sorghum bicolor [broomcorn]
emb|CDP20394.1|  unnamed protein product                                115   4e-26   Coffea canephora [robusta coffee]
ref|XP_008663199.1|  PREDICTED: putative magnesium transporter MR...    115   6e-26   
ref|XP_006584667.1|  PREDICTED: magnesium transporter MRS2-F-like       115   6e-26   
gb|KHN16925.1|  Magnesium transporter MRS2-F                            115   6e-26   Glycine soja [wild soybean]
dbj|BAJ88295.1|  predicted protein                                      115   6e-26   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAK05306.1|  predicted protein                                      114   7e-26   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMT25409.1|  Mitochondrial inner membrane magnesium transporte...    113   2e-25   
gb|AFW58264.1|  hypothetical protein ZEAMMB73_583248                    115   2e-25   
ref|XP_008801220.1|  PREDICTED: putative magnesium transporter MR...    113   2e-25   Phoenix dactylifera
emb|CDM85160.1|  unnamed protein product                                113   3e-25   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006595173.1|  PREDICTED: magnesium transporter MRS2-F-like       113   3e-25   Glycine max [soybeans]
ref|XP_006653407.1|  PREDICTED: putative magnesium transporter MR...    112   4e-25   Oryza brachyantha
ref|XP_006411758.1|  hypothetical protein EUTSA_v10027315mg             112   4e-25   
ref|XP_010933184.1|  PREDICTED: putative magnesium transporter MR...    112   8e-25   Elaeis guineensis
ref|XP_010041344.1|  PREDICTED: LOW QUALITY PROTEIN: magnesium tr...    108   2e-24   
gb|KCW44426.1|  hypothetical protein EUGRSUZ_L02078                     109   2e-24   Eucalyptus grandis [rose gum]
ref|XP_004503914.1|  PREDICTED: magnesium transporter MRS2-F-like       110   3e-24   
ref|XP_010061592.1|  PREDICTED: magnesium transporter MRS2-I-like       109   3e-24   
ref|XP_003531296.1|  PREDICTED: magnesium transporter MRS2-4-like       109   5e-24   Glycine max [soybeans]
gb|KHN48092.1|  Magnesium transporter MRS2-4                            109   6e-24   Glycine soja [wild soybean]
ref|XP_002970710.1|  hypothetical protein SELMODRAFT_94109              108   6e-24   
ref|XP_001765484.1|  predicted protein                                  108   7e-24   
ref|XP_002969379.1|  hypothetical protein SELMODRAFT_91491              108   8e-24   
gb|EPS65976.1|  hypothetical protein M569_08801                         108   1e-23   Genlisea aurea
ref|XP_010069171.1|  PREDICTED: magnesium transporter MRS2-I-like...    107   1e-23   
ref|XP_010069170.1|  PREDICTED: magnesium transporter MRS2-I-like...    107   2e-23   Eucalyptus grandis [rose gum]
ref|XP_010649991.1|  PREDICTED: magnesium transporter MRS2-2 isof...    107   2e-23   Vitis vinifera
ref|XP_002284181.1|  PREDICTED: magnesium transporter MRS2-I isof...    107   2e-23   Vitis vinifera
gb|EPS59787.1|  hypothetical protein M569_15018                         105   2e-23   Genlisea aurea
ref|XP_004146255.1|  PREDICTED: magnesium transporter MRS2-4-like       107   2e-23   Cucumis sativus [cucumbers]
ref|XP_001784777.1|  predicted protein                                  107   2e-23   
ref|XP_008802852.1|  PREDICTED: magnesium transporter MRS2-I            105   4e-23   
ref|XP_002980285.1|  hypothetical protein SELMODRAFT_112303             107   5e-23   
ref|XP_002963050.1|  hypothetical protein SELMODRAFT_165647             106   6e-23   
ref|NP_001051228.1|  Os03g0742400                                       103   9e-23   
emb|CDO97582.1|  unnamed protein product                                105   1e-22   Coffea canephora [robusta coffee]
ref|XP_010069167.1|  PREDICTED: magnesium transporter MRS2-I-like       105   1e-22   Eucalyptus grandis [rose gum]
ref|XP_006348684.1|  PREDICTED: magnesium transporter MRS2-5-like       105   2e-22   Solanum tuberosum [potatoes]
ref|XP_004981821.1|  PREDICTED: magnesium transporter MRS2-I-like       105   2e-22   Setaria italica
gb|AET04849.2|  magnesium transporter MRS2-like protein                 105   2e-22   Medicago truncatula
gb|KHN06489.1|  Magnesium transporter MRS2-4                            104   2e-22   Glycine soja [wild soybean]
ref|XP_003630373.1|  Mitochondrial inner membrane magnesium trans...    105   2e-22   
ref|XP_003525004.1|  PREDICTED: magnesium transporter MRS2-4-like       105   2e-22   Glycine max [soybeans]
emb|CBI17947.3|  unnamed protein product                                101   2e-22   Vitis vinifera
ref|XP_004137654.1|  PREDICTED: magnesium transporter MRS2-1-like       105   2e-22   Cucumis sativus [cucumbers]
ref|XP_003554279.1|  PREDICTED: magnesium transporter MRS2-I-like...    104   2e-22   Glycine max [soybeans]
ref|XP_008465136.1|  PREDICTED: magnesium transporter MRS2-1            105   2e-22   Cucumis melo [Oriental melon]
sp|B8AJT9.1|MRS2I_ORYSI  RecName: Full=Magnesium transporter MRS2-I     104   2e-22   Oryza sativa Indica Group [Indian rice]
ref|XP_004160340.1|  PREDICTED: magnesium transporter MRS2-1-like       105   2e-22   
gb|AAR87307.1|  putative CorA-like Mg2+ transporter protein             104   2e-22   Oryza sativa Japonica Group [Japonica rice]
sp|Q10D38.1|MRS2I_ORYSJ  RecName: Full=Magnesium transporter MRS2-I     104   2e-22   Oryza sativa Japonica Group [Japonica rice]
gb|KJB66344.1|  hypothetical protein B456_010G136800                    104   2e-22   Gossypium raimondii
gb|EEE61022.1|  hypothetical protein OsJ_14848                          104   2e-22   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010669638.1|  PREDICTED: magnesium transporter MRS2-I-like       104   3e-22   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010320857.1|  PREDICTED: magnesium transporter MRS2-5 isof...    104   3e-22   Solanum lycopersicum
ref|XP_003559849.1|  PREDICTED: magnesium transporter MRS2-I            104   3e-22   
ref|XP_008228805.1|  PREDICTED: magnesium transporter MRS2-1            104   3e-22   Prunus mume [ume]
ref|XP_004239046.1|  PREDICTED: magnesium transporter MRS2-5 isof...    104   3e-22   Solanum lycopersicum
gb|EMS62342.1|  Magnesium transporter MRS2-I                            103   3e-22   Triticum urartu
ref|XP_007215378.1|  hypothetical protein PRUPE_ppa005729mg             104   3e-22   Prunus persica
gb|EAY94161.1|  hypothetical protein OsI_15936                          104   3e-22   Oryza sativa Indica Group [Indian rice]
ref|XP_002530669.1|  RNA splicing protein mrs2, mitochondrial, pu...    104   4e-22   Ricinus communis
dbj|BAK06708.1|  predicted protein                                      103   4e-22   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_011073486.1|  PREDICTED: magnesium transporter MRS2-I-like       103   4e-22   Sesamum indicum [beniseed]
sp|Q7XQQ1.1|MRS2D_ORYSJ  RecName: Full=Putative magnesium transpo...    104   4e-22   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009367740.1|  PREDICTED: magnesium transporter MRS2-I-like       103   4e-22   Pyrus x bretschneideri [bai li]
ref|XP_006827857.1|  hypothetical protein AMTR_s00008p00066060          104   4e-22   Amborella trichopoda
ref|XP_006845374.1|  hypothetical protein AMTR_s00019p00038520          104   5e-22   Amborella trichopoda
ref|XP_011020585.1|  PREDICTED: magnesium transporter MRS2-1-like       103   5e-22   Populus euphratica
sp|Q01JR9.1|MRS2D_ORYSI  RecName: Full=Putative magnesium transpo...    103   5e-22   Oryza sativa Indica Group [Indian rice]
ref|XP_010932874.1|  PREDICTED: magnesium transporter MRS2-I-like       103   5e-22   Elaeis guineensis
ref|NP_001149859.1|  LOC100283487                                       103   5e-22   Zea mays [maize]
gb|AAN73217.1|  MRS2-7                                                  103   5e-22   Arabidopsis thaliana [mouse-ear cress]
ref|NP_196531.2|  magnesium transporter MRS2-7                          103   6e-22   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010917593.1|  PREDICTED: magnesium transporter MRS2-I-like       103   6e-22   Elaeis guineensis
ref|NP_850802.2|  magnesium transporter MRS2-7                          103   6e-22   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006471213.1|  PREDICTED: magnesium transporter MRS2-4-like       103   6e-22   Citrus sinensis [apfelsine]
gb|ACN31570.1|  unknown                                                 103   6e-22   Zea mays [maize]
gb|KDO43541.1|  hypothetical protein CISIN_1g013287mg                   103   6e-22   Citrus sinensis [apfelsine]
ref|XP_006431749.1|  hypothetical protein CICLE_v10001154mg             103   6e-22   Citrus clementina [clementine]
ref|XP_009764804.1|  PREDICTED: magnesium transporter MRS2-1            102   6e-22   Nicotiana sylvestris
gb|AAK20062.1|AC025783_22  putative CorA-like Mg2+ transporter pr...    102   6e-22   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002463899.1|  hypothetical protein SORBIDRAFT_01g008500          103   6e-22   Sorghum bicolor [broomcorn]
ref|NP_001065204.1|  Os10g0545000                                       102   7e-22   
ref|XP_002282145.1|  PREDICTED: magnesium transporter MRS2-I-like...    102   7e-22   Vitis vinifera
ref|XP_007045856.1|  Magnesium transporter 3 isoform 3                  102   8e-22   
gb|KHN10711.1|  Magnesium transporter MRS2-I                            102   8e-22   Glycine soja [wild soybean]
gb|ACJ83619.1|  unknown                                               99.8    8e-22   Medicago truncatula
ref|XP_011034561.1|  PREDICTED: magnesium transporter MRS2-1 isof...    103   8e-22   Populus euphratica
emb|CDO98239.1|  unnamed protein product                                103   9e-22   Coffea canephora [robusta coffee]
emb|CDY65607.1|  BnaCnng47920D                                          103   9e-22   Brassica napus [oilseed rape]
ref|XP_009407221.1|  PREDICTED: magnesium transporter MRS2-I-like       102   9e-22   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003521272.1|  PREDICTED: magnesium transporter MRS2-I-like...    102   9e-22   Glycine max [soybeans]
ref|XP_010034036.1|  PREDICTED: magnesium transporter MRS2-1-like       103   1e-21   Eucalyptus grandis [rose gum]
gb|AHB08883.1|  magnesium transporter MRS2-I isoform 1                  102   1e-21   Suaeda glauca
sp|A2Z9W7.2|MRS2G_ORYSI  RecName: Full=Putative magnesium transpo...    103   1e-21   Oryza sativa Indica Group [Indian rice]
sp|A3BV82.2|MRS2G_ORYSJ  RecName: Full=Putative magnesium transpo...    103   1e-21   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006368496.1|  magnesium transporter CorA-like family protein     103   1e-21   Populus trichocarpa [western balsam poplar]
ref|XP_007159570.1|  hypothetical protein PHAVU_002G248600g             103   1e-21   Phaseolus vulgaris [French bean]
ref|XP_011034560.1|  PREDICTED: magnesium transporter MRS2-1 isof...    103   1e-21   Populus euphratica
ref|XP_006493378.1|  PREDICTED: magnesium transporter MRS2-1-like...    102   1e-21   Citrus sinensis [apfelsine]
ref|XP_004504196.1|  PREDICTED: magnesium transporter MRS2-4-like...    102   1e-21   Cicer arietinum [garbanzo]
ref|XP_007045858.1|  Magnesium transporter 3 isoform 5                  102   1e-21   
emb|CDX81228.1|  BnaC09g06390D                                          102   1e-21   
ref|XP_004288429.1|  PREDICTED: magnesium transporter MRS2-I-like       102   1e-21   Fragaria vesca subsp. vesca
emb|CDY18706.1|  BnaA09g06890D                                          102   1e-21   Brassica napus [oilseed rape]
ref|XP_010520469.1|  PREDICTED: magnesium transporter MRS2-2 isof...    102   1e-21   Tarenaya hassleriana [spider flower]
ref|XP_002304732.1|  hypothetical protein POPTR_0003s18180g             102   1e-21   Populus trichocarpa [western balsam poplar]
ref|XP_009337295.1|  PREDICTED: magnesium transporter MRS2-2-like       102   1e-21   Pyrus x bretschneideri [bai li]
ref|XP_010520475.1|  PREDICTED: magnesium transporter MRS2-2 isof...    102   1e-21   Tarenaya hassleriana [spider flower]
ref|XP_009112139.1|  PREDICTED: magnesium transporter MRS2-2-like       102   1e-21   
gb|KDP38809.1|  hypothetical protein JCGZ_04966                         102   2e-21   Jatropha curcas
ref|XP_008391050.1|  PREDICTED: magnesium transporter MRS2-I-like       102   2e-21   
ref|XP_009418155.1|  PREDICTED: magnesium transporter MRS2-I-like       102   2e-21   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010537853.1|  PREDICTED: magnesium transporter MRS2-1-like       102   2e-21   Tarenaya hassleriana [spider flower]
gb|KCW62935.1|  hypothetical protein EUGRSUZ_G00531                   98.6    2e-21   Eucalyptus grandis [rose gum]
ref|XP_010087765.1|  Magnesium transporter MRS2-2                       101   2e-21   Morus notabilis
ref|XP_009592707.1|  PREDICTED: magnesium transporter MRS2-5            102   2e-21   Nicotiana tomentosiformis
gb|ACF79336.1|  unknown                                                 101   2e-21   Zea mays [maize]
ref|XP_007045854.1|  Magnesium transporter 3 isoform 1                  101   2e-21   Theobroma cacao [chocolate]
gb|KDO68528.1|  hypothetical protein CISIN_1g045110mg                   101   2e-21   Citrus sinensis [apfelsine]
ref|XP_011070253.1|  PREDICTED: magnesium transporter MRS2-4            101   2e-21   Sesamum indicum [beniseed]
ref|XP_006479586.1|  PREDICTED: magnesium transporter MRS2-I-like...    101   3e-21   Citrus sinensis [apfelsine]
ref|XP_002517021.1|  RNA splicing protein mrs2, mitochondrial, pu...    101   3e-21   Ricinus communis
ref|XP_002520990.1|  RNA splicing protein mrs2, mitochondrial, pu...    101   3e-21   Ricinus communis
ref|XP_009397619.1|  PREDICTED: putative magnesium transporter MR...    102   3e-21   
ref|XP_009348287.1|  PREDICTED: magnesium transporter MRS2-2-like       101   3e-21   Pyrus x bretschneideri [bai li]
ref|XP_010068158.1|  PREDICTED: magnesium transporter MRS2-I-like     99.0    3e-21   
ref|XP_004150432.1|  PREDICTED: magnesium transporter MRS2-2-like       101   3e-21   Cucumis sativus [cucumbers]
emb|CDY49260.1|  BnaA09g55390D                                          101   3e-21   Brassica napus [oilseed rape]
ref|XP_009116569.1|  PREDICTED: magnesium transporter MRS2-4            101   3e-21   Brassica rapa
ref|XP_006356053.1|  PREDICTED: magnesium transporter MRS2-I-like...    101   3e-21   Solanum tuberosum [potatoes]
ref|XP_008810307.1|  PREDICTED: magnesium transporter MRS2-1-like...    101   3e-21   
ref|NP_001140675.1|  hypothetical protein                               102   3e-21   
gb|KJB50542.1|  hypothetical protein B456_008G177000                    100   3e-21   
gb|KJB50537.1|  hypothetical protein B456_008G177000                    101   4e-21   
gb|EYU26957.1|  hypothetical protein MIMGU_mgv1a014933mg              97.8    4e-21   
gb|ACU20087.1|  unknown                                                 100   4e-21   
ref|XP_008658098.1|  PREDICTED: putative magnesium transporter MR...    101   4e-21   
ref|XP_008353298.1|  PREDICTED: magnesium transporter MRS2-I-like       100   4e-21   
ref|XP_004486600.1|  PREDICTED: magnesium transporter MRS2-1-like...    101   4e-21   
ref|XP_008381120.1|  PREDICTED: magnesium transporter MRS2-1-like...    101   4e-21   
ref|XP_004297232.1|  PREDICTED: magnesium transporter MRS2-5            101   4e-21   
ref|XP_010912175.1|  PREDICTED: magnesium transporter MRS2-1-like       101   4e-21   
ref|XP_011091115.1|  PREDICTED: magnesium transporter MRS2-I-like...    100   4e-21   
ref|XP_003637279.1|  Magnesium transporter MRS2-like protein            101   4e-21   
ref|XP_010497574.1|  PREDICTED: magnesium transporter MRS2-1-like       101   4e-21   
ref|XP_006427652.1|  hypothetical protein CICLE_v10025612mg             101   5e-21   
ref|XP_004234030.1|  PREDICTED: magnesium transporter MRS2-I            100   5e-21   
dbj|BAD94839.1|  hypothetical protein                                   100   5e-21   
ref|NP_563988.1|  magnesium transporter MRS2-1                          100   6e-21   
ref|XP_010476702.1|  PREDICTED: magnesium transporter MRS2-1            100   6e-21   
ref|XP_009375489.1|  PREDICTED: magnesium transporter MRS2-1-like...    100   6e-21   
ref|XP_008810857.1|  PREDICTED: magnesium transporter MRS2-1-like       100   6e-21   
ref|XP_002892891.1|  hypothetical protein ARALYDRAFT_471800             100   6e-21   
ref|XP_010547641.1|  PREDICTED: magnesium transporter MRS2-2 isof...    100   6e-21   
ref|XP_006356254.1|  PREDICTED: magnesium transporter MRS2-1-like       100   6e-21   
dbj|BAK01491.1|  predicted protein                                      101   6e-21   
ref|XP_006304371.1|  hypothetical protein CARUB_v10010853mg             100   7e-21   
ref|XP_007042280.1|  Magnesium transporter MRS2-4                       100   7e-21   
ref|XP_003543708.1|  PREDICTED: magnesium transporter MRS2-1-like...    100   7e-21   
gb|KJB35251.1|  hypothetical protein B456_006G106900                    100   7e-21   
gb|ABR16789.1|  unknown                                                 100   7e-21   
gb|KJB72315.1|  hypothetical protein B456_011G170800                  99.0    7e-21   
ref|XP_010274191.1|  PREDICTED: magnesium transporter MRS2-I-like...    100   7e-21   
ref|XP_009779149.1|  PREDICTED: magnesium transporter MRS2-5            100   8e-21   
ref|NP_001131440.1|  uncharacterized protein LOC100192772             97.4    9e-21   
ref|XP_009417452.1|  PREDICTED: magnesium transporter MRS2-1-like       100   9e-21   
ref|XP_006402738.1|  hypothetical protein EUTSA_v10005994mg             100   9e-21   
ref|XP_004983776.1|  PREDICTED: putative magnesium transporter MR...    100   9e-21   
ref|XP_003629954.1|  Magnesium transporter MRS2                         100   9e-21   
ref|XP_006416855.1|  hypothetical protein EUTSA_v10007638mg             100   9e-21   
ref|XP_009627899.1|  PREDICTED: magnesium transporter MRS2-1            100   1e-20   
ref|XP_009602807.1|  PREDICTED: magnesium transporter MRS2-4            100   1e-20   
ref|XP_004493752.1|  PREDICTED: magnesium transporter MRS2-I-like...  99.4    1e-20   
ref|XP_008342817.1|  PREDICTED: magnesium transporter MRS2-1            100   1e-20   
emb|CDY64844.1|  BnaCnng45320D                                        99.8    1e-20   
ref|XP_007023463.1|  Magnesium transporter isoform 3                  99.8    1e-20   
ref|XP_009398380.1|  PREDICTED: magnesium transporter MRS2-I-like     99.8    1e-20   
ref|XP_006420098.1|  hypothetical protein CICLE_v10005128mg           99.8    1e-20   
ref|NP_565247.1|  magnesium transporter MRS2-10                         100   1e-20   
ref|XP_006489510.1|  PREDICTED: magnesium transporter MRS2-2-like     99.8    1e-20   
ref|XP_009125351.1|  PREDICTED: magnesium transporter MRS2-7          99.8    1e-20   
ref|XP_007034963.1|  Magnesium transporter MRS2-2 isoform 1           99.8    1e-20   
gb|KJB72317.1|  hypothetical protein B456_011G170800                  99.4    1e-20   
ref|XP_004493751.1|  PREDICTED: magnesium transporter MRS2-I-like...  99.4    1e-20   
gb|EYU32515.1|  hypothetical protein MIMGU_mgv1a024210mg              99.4    1e-20   
ref|XP_010539542.1|  PREDICTED: magnesium transporter MRS2-1            100   1e-20   
ref|XP_007150818.1|  hypothetical protein PHAVU_005G183100g             100   1e-20   
ref|XP_002878249.1|  hypothetical protein ARALYDRAFT_907386           99.8    1e-20   
gb|KJB72318.1|  hypothetical protein B456_011G170800                  99.4    1e-20   
ref|XP_004303233.1|  PREDICTED: magnesium transporter MRS2-1            100   1e-20   
ref|XP_007023461.1|  Magnesium transporter isoform 1                  99.8    1e-20   
ref|XP_002873417.1|  MRS2-7                                           99.4    1e-20   
gb|AAM62917.1|  unknown                                               99.8    1e-20   
ref|XP_010265563.1|  PREDICTED: magnesium transporter MRS2-1          99.8    1e-20   
ref|XP_006351630.1|  PREDICTED: magnesium transporter MRS2-I-like     99.4    1e-20   
ref|XP_009354204.1|  PREDICTED: magnesium transporter MRS2-1          99.8    1e-20   
ref|XP_010030132.1|  PREDICTED: magnesium transporter MRS2-4            100   2e-20   
gb|EAZ31248.1|  hypothetical protein OsJ_15350                        99.0    2e-20   
ref|XP_006427735.1|  hypothetical protein CICLE_v10027569mg           99.8    2e-20   
ref|XP_010444392.1|  PREDICTED: magnesium transporter MRS2-2          99.0    2e-20   
sp|P0CZ21.1|MRS28_ARATH  RecName: Full=Magnesium transporter MRS2...  99.0    2e-20   
ref|XP_008224183.1|  PREDICTED: LOW QUALITY PROTEIN: magnesium tr...  99.0    2e-20   
ref|XP_010484240.1|  PREDICTED: magnesium transporter MRS2-2-like     99.0    2e-20   
ref|XP_007223020.1|  hypothetical protein PRUPE_ppa006863mg           99.0    2e-20   
ref|XP_004241677.1|  PREDICTED: magnesium transporter MRS2-1          99.8    2e-20   
ref|NP_567076.1|  magnesium transporter 6                             99.4    2e-20   
ref|XP_008341097.1|  PREDICTED: magnesium transporter MRS2-2-like     99.0    2e-20   
ref|XP_010038020.1|  PREDICTED: magnesium transporter MRS2-I-like     99.0    2e-20   
ref|XP_010491608.1|  PREDICTED: magnesium transporter MRS2-7-like     99.0    2e-20   
ref|XP_003591809.1|  Magnesium transporter                            99.0    2e-20   
ref|XP_003546700.1|  PREDICTED: magnesium transporter MRS2-1-like     99.4    2e-20   
gb|KCW49818.1|  hypothetical protein EUGRSUZ_K03298                   98.6    2e-20   
ref|NP_851269.1|  magnesium transporter MRS2-2                        99.0    2e-20   
ref|XP_008785876.1|  PREDICTED: magnesium transporter MRS2-F-like...  99.0    2e-20   
ref|XP_009383004.1|  PREDICTED: magnesium transporter MRS2-5 isof...  99.0    2e-20   
ref|XP_007223289.1|  hypothetical protein PRUPE_ppa005562mg           99.8    2e-20   
ref|XP_008785875.1|  PREDICTED: magnesium transporter MRS2-F-like...  99.0    2e-20   
ref|XP_009383003.1|  PREDICTED: magnesium transporter MRS2-5 isof...  99.0    2e-20   
ref|XP_008218758.1|  PREDICTED: magnesium transporter MRS2-4          99.4    2e-20   
ref|XP_006389845.1|  hypothetical protein EUTSA_v10018562mg           99.4    2e-20   
ref|XP_010273633.1|  PREDICTED: magnesium transporter MRS2-1-like     99.4    2e-20   
ref|XP_004247216.1|  PREDICTED: magnesium transporter MRS2-I isof...  98.6    2e-20   
emb|CDY64845.1|  BnaCnng45330D                                        98.6    2e-20   
ref|XP_002866621.1|  hypothetical protein ARALYDRAFT_496668           98.6    2e-20   
emb|CAB86925.1|  putative protein                                     99.4    2e-20   
ref|XP_002887805.1|  hypothetical protein ARALYDRAFT_895892           99.4    2e-20   
ref|XP_006845843.1|  hypothetical protein AMTR_s00154p00031530        98.6    3e-20   
ref|XP_010906142.1|  PREDICTED: magnesium transporter MRS2-5-like...  99.0    3e-20   
ref|XP_008456044.1|  PREDICTED: magnesium transporter MRS2-4          99.0    3e-20   
ref|XP_010422953.1|  PREDICTED: magnesium transporter MRS2-7          98.6    3e-20   
emb|CDP20393.1|  unnamed protein product                              99.4    3e-20   
ref|XP_004299905.1|  PREDICTED: magnesium transporter MRS2-4          99.0    3e-20   
ref|XP_010942283.1|  PREDICTED: magnesium transporter MRS2-B-like     99.0    3e-20   
ref|XP_008389410.1|  PREDICTED: magnesium transporter MRS2-5          98.6    3e-20   
ref|XP_007199897.1|  hypothetical protein PRUPE_ppa006624mg           98.2    3e-20   
emb|CDP03699.1|  unnamed protein product                              98.2    3e-20   
emb|CDY02984.1|  BnaC07g22430D                                        98.6    3e-20   
ref|XP_002311660.1|  magnesium transporter CorA-like family protein   98.2    4e-20   
sp|Q0JBZ6.3|MRS2C_ORYSJ  RecName: Full=Magnesium transporter MRS2-C   98.6    4e-20   
emb|CDY36615.1|  BnaC06g06680D                                        98.6    4e-20   
ref|XP_009420311.1|  PREDICTED: magnesium transporter MRS2-1-like     98.6    4e-20   
ref|XP_002309039.2|  hypothetical protein POPTR_0006s08170g           98.6    4e-20   
ref|XP_011029888.1|  PREDICTED: magnesium transporter MRS2-2          98.2    4e-20   
ref|XP_006293016.1|  hypothetical protein CARUB_v10019294mg           98.2    4e-20   
emb|CDY51207.1|  BnaA06g39860D                                        98.2    4e-20   
gb|EYU21742.1|  hypothetical protein MIMGU_mgv1a006408mg              98.6    4e-20   
emb|CDY49735.1|  BnaA02g19370D                                        98.2    4e-20   
ref|XP_011019920.1|  PREDICTED: magnesium transporter MRS2-4          98.6    4e-20   
ref|XP_009152159.1|  PREDICTED: magnesium transporter MRS2-5          98.2    4e-20   
ref|XP_004230471.1|  PREDICTED: magnesium transporter MRS2-4          98.2    4e-20   
ref|XP_010063580.1|  PREDICTED: magnesium transporter MRS2-1-like     98.6    4e-20   
emb|CDY22292.1|  BnaC02g25960D                                        97.8    5e-20   
ref|XP_006394137.1|  hypothetical protein EUTSA_v10004289mg           97.8    5e-20   
emb|CDY56489.1|  BnaCnng30470D                                        97.8    5e-20   
ref|XP_006662023.1|  PREDICTED: putative magnesium transporter MR...  99.0    5e-20   
ref|XP_009150538.1|  PREDICTED: magnesium transporter MRS2-2-like...  97.8    5e-20   
emb|CDY33361.1|  BnaC05g12220D                                        97.8    5e-20   
ref|XP_009128382.1|  PREDICTED: magnesium transporter MRS2-10         98.2    5e-20   
emb|CDY51292.1|  BnaA06g23540D                                        97.4    5e-20   
ref|XP_007162502.1|  hypothetical protein PHAVU_001G157300g           97.8    5e-20   
emb|CDY35061.1|  BnaA06g10710D                                        97.8    5e-20   
ref|XP_002464998.1|  hypothetical protein SORBIDRAFT_01g030170        98.6    6e-20   
ref|XP_009799354.1|  PREDICTED: magnesium transporter MRS2-4-like     98.2    6e-20   
ref|XP_006395688.1|  hypothetical protein EUTSA_v10004291mg           97.8    6e-20   
ref|XP_002512736.1|  RNA splicing protein mrs2, mitochondrial, pu...  98.2    6e-20   
ref|XP_010461972.1|  PREDICTED: magnesium transporter MRS2-2-like     97.4    7e-20   
ref|XP_009346365.1|  PREDICTED: magnesium transporter MRS2-4-like     96.7    7e-20   
gb|KDP40276.1|  hypothetical protein JCGZ_02274                       97.4    7e-20   
ref|XP_006385931.1|  hypothetical protein POPTR_0003s18180g           98.2    7e-20   
ref|XP_010927960.1|  PREDICTED: magnesium transporter MRS2-1-like     97.8    7e-20   
ref|XP_010094052.1|  Magnesium transporter MRS2-1                     97.8    7e-20   
ref|XP_009149042.1|  PREDICTED: magnesium transporter MRS2-1          97.8    7e-20   
ref|XP_008235320.1|  PREDICTED: magnesium transporter MRS2-I-like     97.4    7e-20   
ref|XP_011082609.1|  PREDICTED: magnesium transporter MRS2-I-like     97.1    8e-20   
gb|EAY79401.1|  hypothetical protein OsI_34529                        98.2    8e-20   
gb|EAZ43471.1|  hypothetical protein OsJ_28078                        98.2    9e-20   
emb|CBI27292.3|  unnamed protein product                              96.7    9e-20   
ref|XP_010474504.1|  PREDICTED: magnesium transporter MRS2-10-like    97.4    9e-20   
gb|KJB80575.1|  hypothetical protein B456_013G104900                  95.9    1e-19   
ref|XP_004289906.1|  PREDICTED: magnesium transporter MRS2-I-like     96.7    1e-19   
ref|XP_007050410.1|  Magnesium transporter MRS2-2 isoform 1           96.7    1e-19   
ref|XP_010683570.1|  PREDICTED: magnesium transporter MRS2-1          97.4    1e-19   
ref|XP_011073319.1|  PREDICTED: magnesium transporter MRS2-1-like     97.4    1e-19   
ref|XP_009356405.1|  PREDICTED: magnesium transporter MRS2-5          97.1    1e-19   
ref|XP_010417651.1|  PREDICTED: magnesium transporter MRS2-10         97.4    1e-19   
ref|XP_010512113.1|  PREDICTED: magnesium transporter MRS2-4          97.1    1e-19   
ref|XP_010504859.1|  PREDICTED: magnesium transporter MRS2-4-like     97.1    1e-19   
ref|XP_010516553.1|  PREDICTED: magnesium transporter MRS2-4-like     97.1    1e-19   
ref|XP_010278149.1|  PREDICTED: magnesium transporter MRS2-I-like     96.3    1e-19   
ref|XP_008805128.1|  PREDICTED: magnesium transporter MRS2-5-like     96.7    1e-19   
ref|XP_009793322.1|  PREDICTED: magnesium transporter MRS2-I-like...  96.3    1e-19   
ref|XP_009793321.1|  PREDICTED: magnesium transporter MRS2-I-like...  96.3    1e-19   
ref|XP_002274070.1|  PREDICTED: magnesium transporter MRS2-5          96.7    1e-19   
gb|KHG04962.1|  Magnesium transporter MRS2-2 -like protein            96.3    1e-19   
ref|XP_006656308.1|  PREDICTED: magnesium transporter MRS2-B-like     95.9    2e-19   
ref|XP_010523489.1|  PREDICTED: magnesium transporter MRS2-5          96.7    2e-19   
ref|XP_010502379.1|  PREDICTED: magnesium transporter MRS2-5          96.7    2e-19   
gb|KEH23862.1|  magnesium transporter MRS2-like protein               95.5    2e-19   
gb|KDP41956.1|  hypothetical protein JCGZ_26974                       97.1    2e-19   
gb|KJB80577.1|  hypothetical protein B456_013G104900                  96.3    2e-19   
ref|XP_010100088.1|  Magnesium transporter MRS2-I                     96.3    2e-19   
ref|XP_008647347.1|  PREDICTED: uncharacterized protein LOC100192...  96.7    2e-19   
ref|XP_010670835.1|  PREDICTED: magnesium transporter MRS2-I-like     96.3    2e-19   
gb|KDP21359.1|  hypothetical protein JCGZ_21830                       96.3    2e-19   
gb|EMT13058.1|  Mitochondrial inner membrane magnesium transporte...  95.5    2e-19   
gb|KDO70358.1|  hypothetical protein CISIN_1g014976mg                 96.3    2e-19   
ref|XP_010694561.1|  PREDICTED: magnesium transporter MRS2-I-like     95.9    2e-19   
ref|XP_006291160.1|  hypothetical protein CARUB_v10017277mg           96.7    2e-19   
ref|XP_009348758.1|  PREDICTED: magnesium transporter MRS2-4-like     96.7    2e-19   
ref|XP_004145376.1|  PREDICTED: magnesium transporter MRS2-I-like     95.9    2e-19   
ref|XP_003574283.2|  PREDICTED: putative magnesium transporter MR...  97.4    2e-19   
ref|XP_011082443.1|  PREDICTED: magnesium transporter MRS2-1-like     96.7    2e-19   
ref|XP_008449349.1|  PREDICTED: magnesium transporter MRS2-I-like...  95.9    2e-19   
ref|XP_009597388.1|  PREDICTED: magnesium transporter MRS2-I-like...  95.5    2e-19   
ref|XP_009345839.1|  PREDICTED: magnesium transporter MRS2-4-like     96.7    2e-19   
ref|XP_006437920.1|  hypothetical protein CICLE_v10031664mg           95.9    2e-19   
emb|CAB89361.1|  putative protein                                     95.9    3e-19   
ref|XP_009597387.1|  PREDICTED: magnesium transporter MRS2-I-like...  95.5    3e-19   
ref|NP_178460.1|  magnesium transporter 3                             95.9    3e-19   
gb|AAN73215.1|  MRS2-5                                                95.9    3e-19   
ref|XP_006838858.1|  hypothetical protein AMTR_s00002p00265910        95.5    3e-19   
ref|XP_010260014.1|  PREDICTED: magnesium transporter MRS2-5          95.9    3e-19   
ref|XP_002876889.1|  hypothetical protein ARALYDRAFT_904644           95.9    3e-19   
ref|XP_009355273.1|  PREDICTED: magnesium transporter MRS2-4-like     96.3    3e-19   
gb|KEH23860.1|  magnesium transporter MRS2-like protein               95.5    3e-19   
ref|XP_002438762.1|  hypothetical protein SORBIDRAFT_10g025720        95.9    3e-19   
ref|NP_001149635.1|  MRS2-10                                          95.9    3e-19   
gb|KJB22928.1|  hypothetical protein B456_004G074400                  95.1    3e-19   
ref|XP_004495389.1|  PREDICTED: magnesium transporter MRS2-2-like...  95.1    4e-19   
ref|XP_004495386.1|  PREDICTED: magnesium transporter MRS2-2-like...  95.1    4e-19   
gb|KFK35128.1|  hypothetical protein AALP_AA5G240400                  95.5    4e-19   
ref|XP_009346358.1|  PREDICTED: magnesium transporter MRS2-4-like     95.9    4e-19   
gb|KHG29401.1|  Magnesium transporter MRS2-2 -like protein            95.1    4e-19   
ref|XP_009346362.1|  PREDICTED: magnesium transporter MRS2-4-like     95.9    4e-19   
ref|XP_007034964.1|  Magnesium transporter MRS2-2 isoform 2           95.1    4e-19   
ref|XP_004513485.1|  PREDICTED: magnesium transporter MRS2-2-like...  95.1    5e-19   
ref|XP_006349352.1|  PREDICTED: magnesium transporter MRS2-4-like     95.5    5e-19   
ref|XP_010514130.1|  PREDICTED: magnesium transporter MRS2-5-like...  94.7    5e-19   
ref|XP_004514761.1|  PREDICTED: magnesium transporter MRS2-2-like...  94.7    5e-19   
emb|CBI23748.3|  unnamed protein product                              94.7    6e-19   
ref|XP_010651941.1|  PREDICTED: magnesium transporter MRS2-2-like...  94.4    6e-19   
ref|XP_008339504.1|  PREDICTED: magnesium transporter MRS2-4          95.5    6e-19   
ref|XP_002446747.1|  hypothetical protein SORBIDRAFT_06g021670        95.1    6e-19   
ref|NP_001167751.1|  hypothetical protein                             95.1    7e-19   
gb|EYU28866.1|  hypothetical protein MIMGU_mgv1a007092mg              94.7    7e-19   
gb|EEE66132.1|  hypothetical protein OsJ_22179                        94.0    7e-19   
emb|CBI25190.3|  unnamed protein product                              94.0    8e-19   
ref|XP_010425160.1|  PREDICTED: magnesium transporter MRS2-5-like     94.7    8e-19   
ref|XP_010514129.1|  PREDICTED: magnesium transporter MRS2-5-like...  94.7    8e-19   
emb|CDO99158.1|  unnamed protein product                              94.0    9e-19   
gb|KDD72467.1|  hypothetical protein H632_c3305p0                     93.2    9e-19   



>gb|KJB12308.1| hypothetical protein B456_002G010900 [Gossypium raimondii]
Length=485

 Score =   241 bits (616),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 141/193 (73%), Positives = 162/193 (84%), Gaps = 7/193 (4%)
 Frame = -2

Query  803  SMNEQEDGMDDEVMQSDVNDRVPGEISIEGN--GADPEIDYPMERV----NTLGRDSHtt  642
            SMNE++D MDD+V++ D+N+R P EIS+  N  G   + D P + +    N +GRDSH T
Sbjct  294  SMNERDD-MDDDVLRPDINERTPAEISLAANYEGDIQDSDNPQDNMFGATNAIGRDSHGT  352

Query  641  rtsttrSAISKHLNVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNH  462
             TSTTRSAISKHL+VEELEMLLEAYF+QIDGTLNKLSTLREYVDDTEDYINIMLDDKQNH
Sbjct  353  HTSTTRSAISKHLDVEELEMLLEAYFVQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNH  412

Query  461  LLQMGVMLTAATLvvsafvavagvfGMNITIELFNPDIAGMPEFLWTIGGGSAGCIILYV  282
            LLQMGVMLT ATLV+SAF+ VAG+FGMNI IELF+ D AGMPEFLWTIGGG+AG I LYV
Sbjct  413  LLQMGVMLTTATLVISAFIVVAGIFGMNIHIELFDEDKAGMPEFLWTIGGGAAGSIFLYV  472

Query  281  AVIAWCKHKRLLD  243
              IAWCK+KRLL+
Sbjct  473  IAIAWCKYKRLLE  485



>gb|KJB12310.1| hypothetical protein B456_002G010900 [Gossypium raimondii]
Length=486

 Score =   241 bits (616),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 141/193 (73%), Positives = 162/193 (84%), Gaps = 7/193 (4%)
 Frame = -2

Query  803  SMNEQEDGMDDEVMQSDVNDRVPGEISIEGN--GADPEIDYPMERV----NTLGRDSHtt  642
            SMNE++D MDD+V++ D+N+R P EIS+  N  G   + D P + +    N +GRDSH T
Sbjct  295  SMNERDD-MDDDVLRPDINERTPAEISLAANYEGDIQDSDNPQDNMFGATNAIGRDSHGT  353

Query  641  rtsttrSAISKHLNVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNH  462
             TSTTRSAISKHL+VEELEMLLEAYF+QIDGTLNKLSTLREYVDDTEDYINIMLDDKQNH
Sbjct  354  HTSTTRSAISKHLDVEELEMLLEAYFVQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNH  413

Query  461  LLQMGVMLTAATLvvsafvavagvfGMNITIELFNPDIAGMPEFLWTIGGGSAGCIILYV  282
            LLQMGVMLT ATLV+SAF+ VAG+FGMNI IELF+ D AGMPEFLWTIGGG+AG I LYV
Sbjct  414  LLQMGVMLTTATLVISAFIVVAGIFGMNIHIELFDEDKAGMPEFLWTIGGGAAGSIFLYV  473

Query  281  AVIAWCKHKRLLD  243
              IAWCK+KRLL+
Sbjct  474  IAIAWCKYKRLLE  486



>gb|KHG12836.1| Magnesium transporter MRS2-3 -like protein [Gossypium arboreum]
Length=485

 Score =   241 bits (614),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 141/193 (73%), Positives = 161/193 (83%), Gaps = 7/193 (4%)
 Frame = -2

Query  803  SMNEQEDGMDDEVMQSDVNDRVPGEISIEGN--GADPEIDYPMERV----NTLGRDSHtt  642
            SMNE++D MDD V++ D+N+R P EIS+  N  G   + D P + +    N +GRDSH T
Sbjct  294  SMNERDD-MDDHVLRPDINERTPAEISLAANYEGDIQDSDNPQDNMFGATNAIGRDSHGT  352

Query  641  rtsttrSAISKHLNVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNH  462
             TSTTRSAISKHL+VEELEMLLEAYF+QIDGTLNKLSTLREYVDDTEDYINIMLDDKQNH
Sbjct  353  HTSTTRSAISKHLDVEELEMLLEAYFVQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNH  412

Query  461  LLQMGVMLTAATLvvsafvavagvfGMNITIELFNPDIAGMPEFLWTIGGGSAGCIILYV  282
            LLQMGVMLT ATLV+SAF+ VAG+FGMNI IELF+ D AGMPEFLWTIGGG+AG I LYV
Sbjct  413  LLQMGVMLTTATLVISAFIVVAGIFGMNIHIELFDEDKAGMPEFLWTIGGGAAGSIFLYV  472

Query  281  AVIAWCKHKRLLD  243
              IAWCK+KRLL+
Sbjct  473  IAIAWCKYKRLLE  485



>ref|XP_010088315.1| Magnesium transporter MRS2-3 [Morus notabilis]
 gb|EXB33540.1| Magnesium transporter MRS2-3 [Morus notabilis]
Length=495

 Score =   234 bits (598),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 142/191 (74%), Positives = 160/191 (84%), Gaps = 6/191 (3%)
 Frame = -2

Query  803  SMNEQEDGMDDEVMQSDVNDRVPGEISI-EG---NGADPEIDYPMERVNTLGRDSHttrt  636
            SMNE+ D MDDEV++SD+++RVP EI+  EG   N  +P+ ++     N L RDSH T T
Sbjct  307  SMNER-DEMDDEVLRSDMDERVPTEITTYEGDLQNSDNPQ-NHLFGAPNVLSRDSHGTHT  364

Query  635  sttrSAISKHLNVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLL  456
            STT SAISK+L+VEELEMLLEAYF+QIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLL
Sbjct  365  STTHSAISKNLDVEELEMLLEAYFVQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLL  424

Query  455  QMGVMLTAATLvvsafvavagvfGMNITIELFNPDIAGMPEFLWTIGGGSAGCIILYVAV  276
            QMGVMLT ATLVVSAFV VAG+FGMNI IELF+   AGMPEFLWTIGGG+ GCI LYV  
Sbjct  425  QMGVMLTTATLVVSAFVVVAGIFGMNIHIELFDETKAGMPEFLWTIGGGTTGCIFLYVLA  484

Query  275  IAWCKHKRLLD  243
            IAWCKHKRLL+
Sbjct  485  IAWCKHKRLLE  495



>emb|CBI22425.3| unnamed protein product [Vitis vinifera]
Length=435

 Score =   230 bits (586),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 135/194 (70%), Positives = 154/194 (79%), Gaps = 11/194 (6%)
 Frame = -2

Query  791  QEDGMDDEVMQSDVNDRVPGEISIEGNGADP-------EIDYPMERV----NTLGRDSHt  645
            + DGMDD V+ +D++D +P EIS+E NG           ID P E +    + LGRDSH 
Sbjct  242  ERDGMDDGVLHADMDDGIPDEISLEANGVSATYEGDLQNIDNPQEHLFGTPHALGRDSHG  301

Query  644  trtsttrSAISKHLNVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQN  465
            T TSTT SAISKHL+VEELEMLLEAYF+QIDGTLNKLSTLREYVDDTEDYINIMLDDKQN
Sbjct  302  THTSTTHSAISKHLDVEELEMLLEAYFVQIDGTLNKLSTLREYVDDTEDYINIMLDDKQN  361

Query  464  HLLQMGVMLTAATLvvsafvavagvfGMNITIELFNPDIAGMPEFLWTIGGGSAGCIILY  285
            HLLQMGVMLT ATLVVSAFV VAG+FGMNI IELF+   +G+ EFLWT+GGG+ G I LY
Sbjct  362  HLLQMGVMLTTATLVVSAFVVVAGIFGMNIHIELFDDKKSGVQEFLWTVGGGATGSIFLY  421

Query  284  VAVIAWCKHKRLLD  243
            V  IAWC+HKRLL+
Sbjct  422  VIAIAWCRHKRLLE  435



>ref|XP_010028349.1| PREDICTED: LOW QUALITY PROTEIN: magnesium transporter MRS2-3-like 
[Eucalyptus grandis]
Length=513

 Score =   230 bits (587),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 133/197 (68%), Positives = 155/197 (79%), Gaps = 11/197 (6%)
 Frame = -2

Query  803  SMNEQEDGMDDEVMQSDVNDRVPGEISIEGNGAD------PEIDYPMERV----NTLGRD  654
            S+NE+E G+DDEV+QS++ DRVP EIS++ NG+       P I  P + +    N LGRD
Sbjct  318  SINEKE-GIDDEVLQSEMEDRVPAEISLDANGSSTYEGDMPNIVNPRDHLFGAPNMLGRD  376

Query  653  SHttrtsttrSAISKHLNVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDD  474
            SH T TST  SA+SK L+VEELEMLLEAYF+QIDGTLNKLSTLREYVDDTEDYINIMLDD
Sbjct  377  SHGTHTSTIHSAVSKQLDVEELEMLLEAYFVQIDGTLNKLSTLREYVDDTEDYINIMLDD  436

Query  473  KQNHLLQMGVMLTAATLvvsafvavagvfGMNITIELFNPDIAGMPEFLWTIGGGSAGCI  294
            KQNHLLQMGV+LT ATLVVSAFV +AG+FGMNI IELF  D  G   F WT+GGG+ G +
Sbjct  437  KQNHLLQMGVVLTTATLVVSAFVVMAGLFGMNIQIELFEKDKTGPEAFFWTVGGGATGSL  496

Query  293  ILYVAVIAWCKHKRLLD  243
             LY+  IAWCKHKRLL+
Sbjct  497  FLYIIAIAWCKHKRLLE  513



>ref|XP_010273130.1| PREDICTED: magnesium transporter MRS2-3 [Nelumbo nucifera]
Length=497

 Score =   229 bits (585),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 136/192 (71%), Positives = 151/192 (79%), Gaps = 12/192 (6%)
 Frame = -2

Query  785  DGMDDEVMQSDVNDRVPGEISIEGN-----------GADPEIDYPMERVNTLGRDSHttr  639
            +GMDD V+QS++++R+P EIS E N             D   D+     N L RDSH T 
Sbjct  307  NGMDDGVLQSEMDERIPAEISPEANEVLHSYEGDVHNTDTR-DHLFSISNALSRDSHGTH  365

Query  638  tsttrSAISKHLNVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHL  459
            TSTT SAISKHL+VEELEMLLEAYF+QIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHL
Sbjct  366  TSTTHSAISKHLDVEELEMLLEAYFVQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHL  425

Query  458  LQMGVMLTAATLvvsafvavagvfGMNITIELFNPDIAGMPEFLWTIGGGSAGCIILYVA  279
            LQMGVMLT ATLVVSAFV VAG+FGMNI IELF+   AGMPEFLWT+GGG+ G I LYV 
Sbjct  426  LQMGVMLTTATLVVSAFVVVAGIFGMNINIELFDETKAGMPEFLWTVGGGATGSIFLYVI  485

Query  278  VIAWCKHKRLLD  243
             IAWCKHKRLL+
Sbjct  486  AIAWCKHKRLLE  497



>ref|XP_002268333.1| PREDICTED: magnesium transporter MRS2-3 [Vitis vinifera]
Length=502

 Score =   229 bits (584),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 135/194 (70%), Positives = 154/194 (79%), Gaps = 11/194 (6%)
 Frame = -2

Query  791  QEDGMDDEVMQSDVNDRVPGEISIEGNGADP-------EIDYPMERV----NTLGRDSHt  645
            + DGMDD V+ +D++D +P EIS+E NG           ID P E +    + LGRDSH 
Sbjct  309  ERDGMDDGVLHADMDDGIPDEISLEANGVSATYEGDLQNIDNPQEHLFGTPHALGRDSHG  368

Query  644  trtsttrSAISKHLNVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQN  465
            T TSTT SAISKHL+VEELEMLLEAYF+QIDGTLNKLSTLREYVDDTEDYINIMLDDKQN
Sbjct  369  THTSTTHSAISKHLDVEELEMLLEAYFVQIDGTLNKLSTLREYVDDTEDYINIMLDDKQN  428

Query  464  HLLQMGVMLTAATLvvsafvavagvfGMNITIELFNPDIAGMPEFLWTIGGGSAGCIILY  285
            HLLQMGVMLT ATLVVSAFV VAG+FGMNI IELF+   +G+ EFLWT+GGG+ G I LY
Sbjct  429  HLLQMGVMLTTATLVVSAFVVVAGIFGMNIHIELFDDKKSGVQEFLWTVGGGATGSIFLY  488

Query  284  VAVIAWCKHKRLLD  243
            V  IAWC+HKRLL+
Sbjct  489  VIAIAWCRHKRLLE  502



>gb|KDO57931.1| hypothetical protein CISIN_1g014053mg [Citrus sinensis]
Length=430

 Score =   227 bits (579),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 135/197 (69%), Positives = 153/197 (78%), Gaps = 11/197 (6%)
 Frame = -2

Query  803  SMNEQEDGMDDEVMQSDVNDRVPGEISIEGNGADPEIDYPMERV----------NTLGRD  654
            S+NE++D MDDEV+QS++N+R   EIS+E  G     +   +            N   R 
Sbjct  235  SINERDD-MDDEVLQSNMNNRTTAEISLEATGGSTSYEADFQNTENIHDNLFTQNIHSRA  293

Query  653  SHttrtsttrSAISKHLNVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDD  474
            SH TRTSTT SAISKHL+VEELEMLLEAYF+QIDGTLNKLSTLREYVDDTEDYINIMLDD
Sbjct  294  SHGTRTSTTHSAISKHLDVEELEMLLEAYFVQIDGTLNKLSTLREYVDDTEDYINIMLDD  353

Query  473  KQNHLLQMGVMLTAATLvvsafvavagvfGMNITIELFNPDIAGMPEFLWTIGGGSAGCI  294
            KQNHLLQMGVMLT ATLVVSAFV VAG+FGMNI IELF+   +GM EFLWT+GGG+ G I
Sbjct  354  KQNHLLQMGVMLTTATLVVSAFVVVAGIFGMNINIELFDEHKSGMQEFLWTVGGGATGSI  413

Query  293  ILYVAVIAWCKHKRLLD  243
             LYV  IAWCKHKRLL+
Sbjct  414  FLYVVAIAWCKHKRLLE  430



>gb|KDO57932.1| hypothetical protein CISIN_1g014053mg [Citrus sinensis]
Length=431

 Score =   227 bits (579),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 135/197 (69%), Positives = 153/197 (78%), Gaps = 11/197 (6%)
 Frame = -2

Query  803  SMNEQEDGMDDEVMQSDVNDRVPGEISIEGNGADPEIDYPMERV----------NTLGRD  654
            S+NE++D MDDEV+QS++N+R   EIS+E  G     +   +            N   R 
Sbjct  236  SINERDD-MDDEVLQSNMNNRTTAEISLEATGGSTSYEADFQNTENIHDNLFTQNIHSRA  294

Query  653  SHttrtsttrSAISKHLNVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDD  474
            SH TRTSTT SAISKHL+VEELEMLLEAYF+QIDGTLNKLSTLREYVDDTEDYINIMLDD
Sbjct  295  SHGTRTSTTHSAISKHLDVEELEMLLEAYFVQIDGTLNKLSTLREYVDDTEDYINIMLDD  354

Query  473  KQNHLLQMGVMLTAATLvvsafvavagvfGMNITIELFNPDIAGMPEFLWTIGGGSAGCI  294
            KQNHLLQMGVMLT ATLVVSAFV VAG+FGMNI IELF+   +GM EFLWT+GGG+ G I
Sbjct  355  KQNHLLQMGVMLTTATLVVSAFVVVAGIFGMNINIELFDEHKSGMQEFLWTVGGGATGSI  414

Query  293  ILYVAVIAWCKHKRLLD  243
             LYV  IAWCKHKRLL+
Sbjct  415  FLYVVAIAWCKHKRLLE  431



>ref|XP_009790318.1| PREDICTED: magnesium transporter MRS2-3 isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009790319.1| PREDICTED: magnesium transporter MRS2-3 isoform X2 [Nicotiana 
sylvestris]
Length=499

 Score =   228 bits (581),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 136/193 (70%), Positives = 156/193 (81%), Gaps = 11/193 (6%)
 Frame = -2

Query  788  EDGMDDEVMQSDVNDRVPGEISIEGNGAD-------PEIDYPMERV----NTLGRDSHtt  642
            +DG+++EV+Q +++DRVP EIS++ N          P ID   ER+    N L R S  T
Sbjct  307  QDGINEEVIQLNMDDRVPVEISMDANAGSTSYDADVPHIDNQQERLFGGPNALSRGSRGT  366

Query  641  rtsttrSAISKHLNVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNH  462
             TSTTRSAISKHL+VEELEMLLEAYF+QIDGTLNKL+TLREYVDDTEDYINIMLDDKQNH
Sbjct  367  HTSTTRSAISKHLDVEELEMLLEAYFVQIDGTLNKLNTLREYVDDTEDYINIMLDDKQNH  426

Query  461  LLQMGVMLTAATLvvsafvavagvfGMNITIELFNPDIAGMPEFLWTIGGGSAGCIILYV  282
            LLQMGVMLT ATLVVSAFV VAG+FGMNITIELF+   AGMPEFLWTIGGG+ G + LYV
Sbjct  427  LLQMGVMLTTATLVVSAFVVVAGIFGMNITIELFDEAKAGMPEFLWTIGGGATGSLFLYV  486

Query  281  AVIAWCKHKRLLD  243
              IAWCKHK+LL+
Sbjct  487  IAIAWCKHKQLLE  499



>ref|XP_009603566.1| PREDICTED: magnesium transporter MRS2-3 isoform X1 [Nicotiana 
tomentosiformis]
Length=499

 Score =   228 bits (580),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 136/193 (70%), Positives = 156/193 (81%), Gaps = 11/193 (6%)
 Frame = -2

Query  788  EDGMDDEVMQSDVNDRVPGEISIEGNGAD-------PEIDYPMERV----NTLGRDSHtt  642
            +DG+++EV+Q +++DRVP EIS++ N          P ID   ER+    N L R S  T
Sbjct  307  QDGINEEVIQLNMDDRVPVEISMDANAGSTSYDADIPHIDNQQERLFGGPNALSRGSRGT  366

Query  641  rtsttrSAISKHLNVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNH  462
             TSTTRSAISKHL+VEELEMLLEAYF+QIDGTLNKL+TLREYVDDTEDYINIMLDDKQNH
Sbjct  367  HTSTTRSAISKHLDVEELEMLLEAYFVQIDGTLNKLNTLREYVDDTEDYINIMLDDKQNH  426

Query  461  LLQMGVMLTAATLvvsafvavagvfGMNITIELFNPDIAGMPEFLWTIGGGSAGCIILYV  282
            LLQMGVMLT ATLVVSAFV VAG+FGMNITIELF+   AGMPEFLWTIGGG+ G + LYV
Sbjct  427  LLQMGVMLTTATLVVSAFVVVAGIFGMNITIELFDEAKAGMPEFLWTIGGGATGSLFLYV  486

Query  281  AVIAWCKHKRLLD  243
              IAWCKHK+LL+
Sbjct  487  IAIAWCKHKQLLE  499



>ref|XP_006422781.1| hypothetical protein CICLE_v10028291mg [Citrus clementina]
 gb|ESR36021.1| hypothetical protein CICLE_v10028291mg [Citrus clementina]
Length=493

 Score =   228 bits (580),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 135/197 (69%), Positives = 153/197 (78%), Gaps = 11/197 (6%)
 Frame = -2

Query  803  SMNEQEDGMDDEVMQSDVNDRVPGEISIEGNGADPEIDYPMERV----------NTLGRD  654
            S+NE++D MDDEV+QS++N+R   EIS+E  G     +   +            N   R 
Sbjct  298  SINERDD-MDDEVLQSNMNNRTTAEISLEATGGSTSYEADFQNTENIHDNLFTQNIHSRA  356

Query  653  SHttrtsttrSAISKHLNVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDD  474
            SH TRTSTT SAISKHL+VEELEMLLEAYF+QIDGTLNKLSTLREYVDDTEDYINIMLDD
Sbjct  357  SHGTRTSTTHSAISKHLDVEELEMLLEAYFVQIDGTLNKLSTLREYVDDTEDYINIMLDD  416

Query  473  KQNHLLQMGVMLTAATLvvsafvavagvfGMNITIELFNPDIAGMPEFLWTIGGGSAGCI  294
            KQNHLLQMGVMLT ATLVVSAFV VAG+FGMNI IELF+   +GM EFLWT+GGG+ G I
Sbjct  417  KQNHLLQMGVMLTTATLVVSAFVVVAGIFGMNINIELFDEHKSGMQEFLWTVGGGATGSI  476

Query  293  ILYVAVIAWCKHKRLLD  243
             LYV  IAWCKHKRLL+
Sbjct  477  FLYVVAIAWCKHKRLLE  493



>ref|XP_006486899.1| PREDICTED: magnesium transporter MRS2-3-like [Citrus sinensis]
Length=493

 Score =   227 bits (579),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 135/197 (69%), Positives = 153/197 (78%), Gaps = 11/197 (6%)
 Frame = -2

Query  803  SMNEQEDGMDDEVMQSDVNDRVPGEISIEGNGADPEIDYPMERV----------NTLGRD  654
            S+NE++D MDDEV+QS++N+R   EIS+E  G     +   +            N   R 
Sbjct  298  SINERDD-MDDEVLQSNMNNRTTAEISLEATGGSTSYEADFQNTENIHDNLFTQNLHSRA  356

Query  653  SHttrtsttrSAISKHLNVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDD  474
            SH TRTSTT SAISKHL+VEELEMLLEAYF+QIDGTLNKLSTLREYVDDTEDYINIMLDD
Sbjct  357  SHGTRTSTTHSAISKHLDVEELEMLLEAYFVQIDGTLNKLSTLREYVDDTEDYINIMLDD  416

Query  473  KQNHLLQMGVMLTAATLvvsafvavagvfGMNITIELFNPDIAGMPEFLWTIGGGSAGCI  294
            KQNHLLQMGVMLT ATLVVSAFV VAG+FGMNI IELF+   +GM EFLWT+GGG+ G I
Sbjct  417  KQNHLLQMGVMLTTATLVVSAFVVVAGIFGMNINIELFDEHKSGMQEFLWTVGGGATGSI  476

Query  293  ILYVAVIAWCKHKRLLD  243
             LYV  IAWCKHKRLL+
Sbjct  477  FLYVVAIAWCKHKRLLE  493



>ref|XP_004230684.1| PREDICTED: magnesium transporter MRS2-3 [Solanum lycopersicum]
Length=498

 Score =   227 bits (579),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 136/193 (70%), Positives = 155/193 (80%), Gaps = 11/193 (6%)
 Frame = -2

Query  788  EDGMDDEVMQSDVNDRVPGEISIEGNGAD-------PEIDYPMERV----NTLGRDSHtt  642
            +DG+D+EV+QS+++DRVP EIS++ N          P ID   ER+    N L R S  T
Sbjct  306  QDGIDEEVIQSNMDDRVPVEISMDANAGSTSYDADTPHIDQHQERLYGGPNALSRGSRGT  365

Query  641  rtsttrSAISKHLNVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNH  462
             TSTTRSAISKHL+VEELEMLLEAYF+QIDGTLNKL+TLREYVDDTEDYINIMLDDKQNH
Sbjct  366  HTSTTRSAISKHLDVEELEMLLEAYFVQIDGTLNKLNTLREYVDDTEDYINIMLDDKQNH  425

Query  461  LLQMGVMLTAATLvvsafvavagvfGMNITIELFNPDIAGMPEFLWTIGGGSAGCIILYV  282
            LLQMGVMLT ATLVVSAFV VAG+FGMNI IELF+   AGMPEFLWTIGGG+ G + LYV
Sbjct  426  LLQMGVMLTTATLVVSAFVVVAGIFGMNINIELFDEKKAGMPEFLWTIGGGATGSLFLYV  485

Query  281  AVIAWCKHKRLLD  243
              IAW KHK+LL+
Sbjct  486  VAIAWGKHKQLLE  498



>ref|XP_006346286.1| PREDICTED: magnesium transporter MRS2-3-like [Solanum tuberosum]
Length=498

 Score =   226 bits (576),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 134/193 (69%), Positives = 156/193 (81%), Gaps = 11/193 (6%)
 Frame = -2

Query  788  EDGMDDEVMQSDVNDRVPGEISIEGNGAD-------PEIDYPMERV----NTLGRDSHtt  642
            +DG+D+EV+QS+++DRVP EIS++ N          P ID+  ER+    N L R S  T
Sbjct  306  QDGIDEEVIQSNMDDRVPVEISMDANAGSTSYDADTPHIDHQQERLYGGPNALSRGSRGT  365

Query  641  rtsttrSAISKHLNVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNH  462
             TSTTRSAISKHL+VEELEMLLEAYF+QIDGTLNKL+TLREYVDDTEDYINIMLDDKQNH
Sbjct  366  HTSTTRSAISKHLDVEELEMLLEAYFVQIDGTLNKLNTLREYVDDTEDYINIMLDDKQNH  425

Query  461  LLQMGVMLTAATLvvsafvavagvfGMNITIELFNPDIAGMPEFLWTIGGGSAGCIILYV  282
            LLQMGVMLT ATLVVSAFV VAG+FGMNI I+LF+   +GMPEFLWTIGGG+ G + LYV
Sbjct  426  LLQMGVMLTTATLVVSAFVVVAGIFGMNINIDLFDETKSGMPEFLWTIGGGATGSLFLYV  485

Query  281  AVIAWCKHKRLLD  243
              IAW KHK+LL+
Sbjct  486  VAIAWGKHKQLLE  498



>gb|KDP44523.1| hypothetical protein JCGZ_16356 [Jatropha curcas]
Length=494

 Score =   224 bits (572),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 134/199 (67%), Positives = 157/199 (79%), Gaps = 13/199 (7%)
 Frame = -2

Query  803  SMNEQEDGMDDEVMQSDVNDRVPGEISIEGNGA-----------DPEIDYPMERVNTLGR  657
            S+NE++D MDDE +Q+D+++R+P E+S+E +GA           D   D+     N L R
Sbjct  297  SLNERDD-MDDEYLQADMDNRIPVEVSLEVHGASTSGEADIHNADNPQDHLFSAPNVLSR  355

Query  656  DSHttrtsttrSAISKHLNVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLD  477
            DSH T TSTTRSAISKHL+VEELEMLLEAYF+QIDGTLNKLSTLREYVDDTEDYINIMLD
Sbjct  356  DSHGTHTSTTRSAISKHLDVEELEMLLEAYFVQIDGTLNKLSTLREYVDDTEDYINIMLD  415

Query  476  DKQNHLLQMGVMLTAATLvvsafvavagvfGMNITIELFNPDI-AGMPEFLWTIGGGSAG  300
            DKQNHLLQMGVMLT ATLV+S FV VAG+FGMNI IELFN ++  GM +FLWT+GG   G
Sbjct  416  DKQNHLLQMGVMLTTATLVISCFVVVAGIFGMNINIELFNEEVEVGMRKFLWTVGGSCTG  475

Query  299  CIILYVAVIAWCKHKRLLD  243
             + LYV  IAWCKHKRLL+
Sbjct  476  SVFLYVIAIAWCKHKRLLE  494



>ref|XP_008346300.1| PREDICTED: magnesium transporter MRS2-3-like [Malus domestica]
Length=212

 Score =   214 bits (544),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 132/193 (68%), Positives = 150/193 (78%), Gaps = 8/193 (4%)
 Frame = -2

Query  803  SMNEQEDGMDDEVMQSDVNDRVPGEISIEGNG------ADPEIDYPMERVNTLGRDSHtt  642
            S+ E++D MD E  +SD++DR P EIS+E  G       DP+ +    R   L RDSH T
Sbjct  22   SLGERDD-MDPEAPRSDMDDRGPTEISMETGGDPLNFDGDPQ-NSDNHRHQYLRRDSHVT  79

Query  641  rtsttrSAISKHLNVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNH  462
             TS+T SA+ K L+VEELEMLLEAYF+QIDGTLNKLSTLREYVDDTEDYINIMLDDKQNH
Sbjct  80   TTSSTHSAMGKVLDVEELEMLLEAYFVQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNH  139

Query  461  LLQMGVMLTAATLvvsafvavagvfGMNITIELFNPDIAGMPEFLWTIGGGSAGCIILYV  282
            LLQMGVMLT ATLVVSAFV VAG+FGMNI IELF+ + AGM EFLWTIGG + G I LYV
Sbjct  140  LLQMGVMLTTATLVVSAFVVVAGIFGMNIXIELFDKEKAGMREFLWTIGGSTGGTIFLYV  199

Query  281  AVIAWCKHKRLLD  243
              I WCKHKRLL+
Sbjct  200  IAIGWCKHKRLLE  212



>ref|XP_008455050.1| PREDICTED: magnesium transporter MRS2-3 isoform X1 [Cucumis melo]
Length=495

 Score =   222 bits (565),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 132/190 (69%), Positives = 149/190 (78%), Gaps = 7/190 (4%)
 Frame = -2

Query  791  QEDGMDDEVMQSDVNDRVPGEISIEGNGADPEIDYPMER-------VNTLGRDSHttrts  633
            + D M+++  Q   +D  P EIS++G G     D  M+         + +GRDSH TRTS
Sbjct  306  ERDDMEEDDQQLGKDDSSPTEISMDGGGISANYDGNMDASQDHLFGASHVGRDSHGTRTS  365

Query  632  ttrSAISKHLNVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQ  453
            TT SAISKHL+VEELEMLLEAYF+QIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQ
Sbjct  366  TTHSAISKHLDVEELEMLLEAYFVQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQ  425

Query  452  MGVMLTAATLvvsafvavagvfGMNITIELFNPDIAGMPEFLWTIGGGSAGCIILYVAVI  273
            MGVMLT ATLVVSAFV VAG+FGMNI IELF P+ AGMPEFLWT+GGG+ G I LY   I
Sbjct  426  MGVMLTTATLVVSAFVVVAGIFGMNIHIELFEPEKAGMPEFLWTVGGGATGTIFLYFIAI  485

Query  272  AWCKHKRLLD  243
            AWCKHKRLL+
Sbjct  486  AWCKHKRLLE  495



>ref|XP_007157203.1| hypothetical protein PHAVU_002G051200g [Phaseolus vulgaris]
 gb|ESW29197.1| hypothetical protein PHAVU_002G051200g [Phaseolus vulgaris]
Length=415

 Score =   219 bits (558),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 132/187 (71%), Positives = 145/187 (78%), Gaps = 16/187 (9%)
 Frame = -2

Query  803  SMNEQEDGMDDEVMQSDVNDRVPGEISIEGNGADPEIDYPMERVNTLGRDSHttrtsttr  624
            SMN+Q+        + D+ DR   EIS +    DP   Y     N LGRDSH TR ST  
Sbjct  245  SMNDQD--------EEDIGDRTAPEISFDAE--DPRNAY-----NVLGRDSHGTRGSTYS  289

Query  623  SAISKHLNVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGV  444
             A++K L+VEELEMLLEAYF+QIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGV
Sbjct  290  -AVTKQLDVEELEMLLEAYFVQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGV  348

Query  443  MLTAATLvvsafvavagvfGMNITIELFNPDIAGMPEFLWTIGGGSAGCIILYVAVIAWC  264
            MLT ATLVVSAFV VAGVFGMNI IELF+PD AGMPEFLWT+GG +AG I LYV  IAWC
Sbjct  349  MLTTATLVVSAFVVVAGVFGMNIHIELFDPDKAGMPEFLWTVGGSTAGTIFLYVVAIAWC  408

Query  263  KHKRLLD  243
            KHKRLL+
Sbjct  409  KHKRLLE  415



>ref|XP_004136933.1| PREDICTED: magnesium transporter MRS2-3-like [Cucumis sativus]
 ref|XP_004159919.1| PREDICTED: magnesium transporter MRS2-3-like [Cucumis sativus]
 gb|KGN43840.1| hypothetical protein Csa_7G070800 [Cucumis sativus]
Length=494

 Score =   220 bits (561),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 132/190 (69%), Positives = 149/190 (78%), Gaps = 7/190 (4%)
 Frame = -2

Query  791  QEDGMDDEVMQSDVNDRVPGEISIEGNGADPEIDYPMER-------VNTLGRDSHttrts  633
            + D M+++  Q   +D  P EIS++G G     D  M+         + +GRDSH TRTS
Sbjct  305  ERDDMEEDDQQLGKDDSSPTEISMDGGGISANYDGNMDASQDHLFGASHVGRDSHGTRTS  364

Query  632  ttrSAISKHLNVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQ  453
            TT SAISKHL+VEELEMLLEAYF+QIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQ
Sbjct  365  TTHSAISKHLDVEELEMLLEAYFVQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQ  424

Query  452  MGVMLTAATLvvsafvavagvfGMNITIELFNPDIAGMPEFLWTIGGGSAGCIILYVAVI  273
            MGVMLT ATLVVSAFV VAG+FGMNI IELF  + AGMPEFLWT+GGG+ G I LYV  I
Sbjct  425  MGVMLTTATLVVSAFVVVAGIFGMNIHIELFESEKAGMPEFLWTVGGGATGTIFLYVIAI  484

Query  272  AWCKHKRLLD  243
            AWCKHKRLL+
Sbjct  485  AWCKHKRLLE  494



>ref|XP_002313918.2| magnesium transporter CorA-like family protein [Populus trichocarpa]
 gb|EEE87873.2| magnesium transporter CorA-like family protein [Populus trichocarpa]
Length=493

 Score =   219 bits (557),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 129/196 (66%), Positives = 148/196 (76%), Gaps = 11/196 (6%)
 Frame = -2

Query  803  SMNEQEDGMDDEVMQSDVNDRVPGEISIEG--------NGADPEIDYPMERVNTLGRDSH  648
            S+NE  D MDD+ +Q+D +D +P E+S+          N  D E D+     N LGR SH
Sbjct  300  SLNEGND-MDDDELQADSDDSIPAEVSLGALASHKDDFNNIDNEHDHLFTAPNGLGRYSH  358

Query  647  ttrtsttrSAISKHLNVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQ  468
            T  ++T   AISKHLNVEELEMLLEAYF+QIDGTLNKLSTLREYVDDTEDYINIMLDDKQ
Sbjct  359  THTSTTRS-AISKHLNVEELEMLLEAYFVQIDGTLNKLSTLREYVDDTEDYINIMLDDKQ  417

Query  467  NHLLQMGVMLTAATLvvsafvavagvfGMNITIELFNPDI-AGMPEFLWTIGGGSAGCII  291
            NHLLQMGVMLT ATLVVS FV V G+FGMNI I LF  D+  GMP+FLWT+ GG++G I 
Sbjct  418  NHLLQMGVMLTTATLVVSCFVVVVGIFGMNIKIALFKEDVQTGMPKFLWTLAGGTSGVIF  477

Query  290  LYVAVIAWCKHKRLLD  243
            LYV  IAWCKHKRLL+
Sbjct  478  LYVIAIAWCKHKRLLE  493



>ref|XP_008455051.1| PREDICTED: magnesium transporter MRS2-3 isoform X2 [Cucumis melo]
Length=494

 Score =   218 bits (556),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 134/194 (69%), Positives = 151/194 (78%), Gaps = 9/194 (5%)
 Frame = -2

Query  803  SMNEQEDGMDDEVMQSDVNDRVPGEISIEGNGADPEIDYPMER-------VNTLGRDSHt  645
            S+ E++D  +D+  Q    D  P EIS++G G     D  M+         + +GRDSH 
Sbjct  303  SIPERDDMEEDD--QQLGKDDSPTEISMDGGGISANYDGNMDASQDHLFGASHVGRDSHG  360

Query  644  trtsttrSAISKHLNVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQN  465
            TRTSTT SAISKHL+VEELEMLLEAYF+QIDGTLNKLSTLREYVDDTEDYINIMLDDKQN
Sbjct  361  TRTSTTHSAISKHLDVEELEMLLEAYFVQIDGTLNKLSTLREYVDDTEDYINIMLDDKQN  420

Query  464  HLLQMGVMLTAATLvvsafvavagvfGMNITIELFNPDIAGMPEFLWTIGGGSAGCIILY  285
            HLLQMGVMLT ATLVVSAFV VAG+FGMNI IELF P+ AGMPEFLWT+GGG+ G I LY
Sbjct  421  HLLQMGVMLTTATLVVSAFVVVAGIFGMNIHIELFEPEKAGMPEFLWTVGGGATGTIFLY  480

Query  284  VAVIAWCKHKRLLD  243
               IAWCKHKRLL+
Sbjct  481  FIAIAWCKHKRLLE  494



>ref|XP_011002248.1| PREDICTED: magnesium transporter MRS2-3-like [Populus euphratica]
Length=490

 Score =   218 bits (555),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 128/196 (65%), Positives = 147/196 (75%), Gaps = 11/196 (6%)
 Frame = -2

Query  803  SMNEQEDGMDDEVMQSDVNDRVPGEISIEG--------NGADPEIDYPMERVNTLGRDSH  648
            S+NE  D MDD+ +Q+D +D +P E+S+          N    E D+     N LGR SH
Sbjct  296  SLNEGND-MDDDELQADSDDSIPAEVSLGALASHKDDINNIGNERDHLFTAPNGLGRYSH  354

Query  647  ttrtsttrSAISKHLNVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQ  468
            T  ++T   A SKHLNVEELEMLLEAYF+QIDGTLNKLSTLREYVDDTEDYINIMLDDKQ
Sbjct  355  THTSTTRS-ATSKHLNVEELEMLLEAYFVQIDGTLNKLSTLREYVDDTEDYINIMLDDKQ  413

Query  467  NHLLQMGVMLTAATLvvsafvavagvfGMNITIELFNPDI-AGMPEFLWTIGGGSAGCII  291
            NHLLQMGVMLT ATLVVS FV V G+FGMNI IELF  D+  GMP+FLWT+ GG++G + 
Sbjct  414  NHLLQMGVMLTTATLVVSCFVVVVGIFGMNIKIELFKEDVQTGMPKFLWTLAGGTSGVVF  473

Query  290  LYVAVIAWCKHKRLLD  243
            LYV  IAWCKHKRLLD
Sbjct  474  LYVIAIAWCKHKRLLD  489



>ref|XP_007200985.1| hypothetical protein PRUPE_ppa004809mg [Prunus persica]
 gb|EMJ02184.1| hypothetical protein PRUPE_ppa004809mg [Prunus persica]
Length=490

 Score =   218 bits (554),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 125/192 (65%), Positives = 151/192 (79%), Gaps = 6/192 (3%)
 Frame = -2

Query  803  SMNEQEDGMDDEVMQSDVNDRVPGEISIEGNGADPEIDYPMERVNT-----LGRDSHttr  639
            S++E+ED MD+E  + D++DR+P EIS+E +G     +  ++  +      L RDSH   
Sbjct  300  SLSERED-MDNEAPRRDMDDRIPTEISLEASGGSSNFEGDLQNPDNPQHQFLSRDSHGNT  358

Query  638  tsttrSAISKHLNVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHL  459
            TS+T SA+ K L+VEELEMLLEAYF+QIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHL
Sbjct  359  TSSTHSAMGKDLDVEELEMLLEAYFVQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHL  418

Query  458  LQMGVMLTAATLvvsafvavagvfGMNITIELFNPDIAGMPEFLWTIGGGSAGCIILYVA  279
            LQMGVMLT ATLVVSAFV +AG+FGMNI IELF+ + AGM EF+WT+GG + G I LYV 
Sbjct  419  LQMGVMLTTATLVVSAFVVIAGIFGMNIKIELFDSEKAGMREFMWTVGGSTGGTIFLYVI  478

Query  278  VIAWCKHKRLLD  243
             I WCKHKRLL+
Sbjct  479  AIGWCKHKRLLE  490



>ref|XP_009343185.1| PREDICTED: magnesium transporter MRS2-3-like [Pyrus x bretschneideri]
Length=490

 Score =   216 bits (550),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 133/193 (69%), Positives = 149/193 (77%), Gaps = 8/193 (4%)
 Frame = -2

Query  803  SMNEQEDGMDDEVMQSDVNDRVPGEISIEGNG------ADPEIDYPMERVNTLGRDSHtt  642
            S+ E++D MD E  +SD++DR P EIS E  G       DP+ +    R   L RDSH T
Sbjct  300  SLGERDD-MDPEAPRSDMDDRDPTEISTEAGGDPLNFDGDPQ-NSDNHRHQYLRRDSHVT  357

Query  641  rtsttrSAISKHLNVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNH  462
             TS++ SA+ K L+VEELEMLLEAYF+QIDGTLNKLSTLREYVDDTEDYINIMLDDKQNH
Sbjct  358  TTSSSHSAMGKVLDVEELEMLLEAYFVQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNH  417

Query  461  LLQMGVMLTAATLvvsafvavagvfGMNITIELFNPDIAGMPEFLWTIGGGSAGCIILYV  282
            LLQMGVMLT ATLVVSAFV VAGVFGMNI IELF+ D AGM EFLWTIGG + G I LYV
Sbjct  418  LLQMGVMLTTATLVVSAFVVVAGVFGMNIQIELFDKDKAGMREFLWTIGGSTGGTIFLYV  477

Query  281  AVIAWCKHKRLLD  243
              I WCKHKRLL+
Sbjct  478  IAIGWCKHKRLLE  490



>ref|XP_008236295.1| PREDICTED: magnesium transporter MRS2-3-like [Prunus mume]
Length=490

 Score =   214 bits (544),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 122/184 (66%), Positives = 144/184 (78%), Gaps = 5/184 (3%)
 Frame = -2

Query  779  MDDEVMQSDVNDRVPGEISIEGNGADPEIDYPMERVNT-----LGRDSHttrtsttrSAI  615
            MD E  + D++DR+P EIS+E +G     D  ++  +      L RDSH T +S+T SA+
Sbjct  307  MDHEAPRRDMDDRIPTEISLEASGGSSNFDGDLQNPDNPQHQFLSRDSHGTTSSSTHSAM  366

Query  614  SKHLNVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVMLT  435
             K L+VEELEMLLEAYF+QIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVMLT
Sbjct  367  GKDLDVEELEMLLEAYFVQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVMLT  426

Query  434  AATLvvsafvavagvfGMNITIELFNPDIAGMPEFLWTIGGGSAGCIILYVAVIAWCKHK  255
             ATLVVSAFV +AG+FGMNI IELF+ + AGM EF+WT+GG + G I LYV  I WCKHK
Sbjct  427  TATLVVSAFVVIAGIFGMNIKIELFDSEKAGMREFMWTVGGSTGGTIFLYVIAIGWCKHK  486

Query  254  RLLD  243
            RLL+
Sbjct  487  RLLE  490



>ref|XP_009343908.1| PREDICTED: magnesium transporter MRS2-3-like isoform X1 [Pyrus 
x bretschneideri]
Length=492

 Score =   214 bits (544),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 130/194 (67%), Positives = 149/194 (77%), Gaps = 10/194 (5%)
 Frame = -2

Query  803  SMNEQEDGMDDEVMQSDVNDRVPGEISIEGNG------ADPE-IDYPMERVNTLGRDSHt  645
            S+ E++D MD E   SD++DR P EIS+E  G       DP+  D P  R   L RDS  
Sbjct  302  SLGERDD-MDPEAPGSDMDDRGPTEISMEAGGDHLNFEGDPQNTDDP--RHQFLRRDSLG  358

Query  644  trtsttrSAISKHLNVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQN  465
            T TS+T SA+ K L+VEELEMLLEAYF+QIDGTLNKLSTLREYVDDTEDYINIMLDDKQN
Sbjct  359  TATSSTHSAVGKELDVEELEMLLEAYFVQIDGTLNKLSTLREYVDDTEDYINIMLDDKQN  418

Query  464  HLLQMGVMLTAATLvvsafvavagvfGMNITIELFNPDIAGMPEFLWTIGGGSAGCIILY  285
            +LLQMGVMLT ATL VS+FV VAGV GMNI I+LFN + AGMP+FLWT+GG +AG I LY
Sbjct  419  NLLQMGVMLTTATLAVSSFVVVAGVMGMNIHIDLFNKEKAGMPQFLWTVGGSTAGTIFLY  478

Query  284  VAVIAWCKHKRLLD  243
            V  I WCKHKRLL+
Sbjct  479  VTAIGWCKHKRLLE  492



>gb|KCW55083.1| hypothetical protein EUGRSUZ_I01045 [Eucalyptus grandis]
Length=274

 Score =   207 bits (527),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 125/195 (64%), Positives = 146/195 (75%), Gaps = 13/195 (7%)
 Frame = -2

Query  797  NEQEDGMDDEVMQSDVNDRVPGEISIEGNGAD------PEIDYPMERV----NTLGRDSH  648
            +E E  +DD+    D+ + VP EIS++ NG+       P I  P + +    N LGRDSH
Sbjct  83   DELEHLLDDD---EDMAEMVPAEISLDANGSSTYEGDMPNIVNPRDHLFGAPNMLGRDSH  139

Query  647  ttrtsttrSAISKHLNVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQ  468
             T TST  SA+SK L+VEELEMLLEAYF+QIDGTLNKLSTLREYVDDTEDYINIMLDDKQ
Sbjct  140  GTHTSTIHSAVSKQLDVEELEMLLEAYFVQIDGTLNKLSTLREYVDDTEDYINIMLDDKQ  199

Query  467  NHLLQMGVMLTAATLvvsafvavagvfGMNITIELFNPDIAGMPEFLWTIGGGSAGCIIL  288
            NHLLQMGV+LT ATLVVSAFV +AG+FGMNI IELF  D  G   F WT+GGG+ G + L
Sbjct  200  NHLLQMGVVLTTATLVVSAFVVMAGLFGMNIQIELFEKDKTGPEAFFWTVGGGATGSLFL  259

Query  287  YVAVIAWCKHKRLLD  243
            Y+  IAWCKHKRLL+
Sbjct  260  YIIAIAWCKHKRLLE  274



>ref|XP_009375650.1| PREDICTED: magnesium transporter MRS2-3-like [Pyrus x bretschneideri]
Length=491

 Score =   213 bits (541),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 129/194 (66%), Positives = 149/194 (77%), Gaps = 10/194 (5%)
 Frame = -2

Query  803  SMNEQEDGMDDEVMQSDVNDRVPGEISIEGNG------ADPE-IDYPMERVNTLGRDSHt  645
            S+ E++D MD E   SD++DR P EIS+E  G       DP+  D P  R   L RDS  
Sbjct  301  SLGERDD-MDPEAPGSDMDDRGPTEISMEAGGDHLNFEGDPQNTDDP--RHQFLRRDSPG  357

Query  644  trtsttrSAISKHLNVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQN  465
            T TS+T SA+ K L+VEELEMLLEAYF+QIDGTLNKLSTLREYVDDTEDYINIMLDDKQN
Sbjct  358  TATSSTHSAVGKELDVEELEMLLEAYFVQIDGTLNKLSTLREYVDDTEDYINIMLDDKQN  417

Query  464  HLLQMGVMLTAATLvvsafvavagvfGMNITIELFNPDIAGMPEFLWTIGGGSAGCIILY  285
            +LLQMGVMLT ATL VS+FV VAGV GMNI I+LF+ + AGMP+FLWT+GG +AG I LY
Sbjct  418  NLLQMGVMLTTATLAVSSFVVVAGVMGMNIHIDLFDKEKAGMPQFLWTVGGSTAGTIFLY  477

Query  284  VAVIAWCKHKRLLD  243
            V  I WCKHKRLL+
Sbjct  478  VTAIGWCKHKRLLE  491



>ref|XP_008351791.1| PREDICTED: magnesium transporter MRS2-3 isoform X2 [Malus domestica]
Length=469

 Score =   211 bits (536),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 128/194 (66%), Positives = 146/194 (75%), Gaps = 10/194 (5%)
 Frame = -2

Query  803  SMNEQEDGMDDEVMQSDVNDRVPGEISIEGNG------ADPE-IDYPMERVNTLGRDSHt  645
            S+ E++D MD E   SD++DR P EIS+E  G       DP+  D P  R   L RDSH 
Sbjct  279  SLGERDD-MDPEAPGSDMDDRGPTEISMEAGGDHLNFEGDPQNTDDP--RHQFLRRDSHG  335

Query  644  trtsttrSAISKHLNVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQN  465
            T TS+T SAI K L+VEELEMLLEAYF+QIDGTLNKLSTLREYVDDTEDYINIMLDDKQN
Sbjct  336  TATSSTHSAIGKELDVEELEMLLEAYFVQIDGTLNKLSTLREYVDDTEDYINIMLDDKQN  395

Query  464  HLLQMGVMLTAATLvvsafvavagvfGMNITIELFNPDIAGMPEFLWTIGGGSAGCIILY  285
            +LLQMGVMLT ATL VS  V VAGV GMNI I+LF+ + AGMP+FLWT+GG +AG I LY
Sbjct  396  NLLQMGVMLTTATLAVSGLVVVAGVMGMNIHIDLFDKEKAGMPQFLWTVGGSTAGTIFLY  455

Query  284  VAVIAWCKHKRLLD  243
               I  CKHKRLL+
Sbjct  456  ATAIGCCKHKRLLE  469



>gb|EYU42498.1| hypothetical protein MIMGU_mgv1a007140mg [Erythranthe guttata]
Length=417

 Score =   209 bits (532),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 121/183 (66%), Positives = 146/183 (80%), Gaps = 3/183 (2%)
 Frame = -2

Query  785  DGMDDEVMQSDVNDRVPGEISI-EGNGADPEI-DYPMERVNTLGRDSHttrtsttrSAIS  612
            D +D+E +  D  +R   EI+    N +D +I D  +   + L RDSH T TS      +
Sbjct  236  DAIDEETVMPDSENRTLDEIATGRDNISDNDIRDNIIGESSGLRRDSHRTHTSVQS-VTN  294

Query  611  KHLNVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVMLTA  432
            K+L+VEELEM+LEAYF+QIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVMLT 
Sbjct  295  KNLDVEELEMILEAYFVQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVMLTT  354

Query  431  ATLvvsafvavagvfGMNITIELFNPDIAGMPEFLWTIGGGSAGCIILYVAVIAWCKHKR  252
            AT+V+SAF+A+ GVFGMNITIELF+P+ AGMP+FLWT+ GG+AGCI LYV+ IAWCKHKR
Sbjct  355  ATVVLSAFIALTGVFGMNITIELFDPNKAGMPDFLWTVAGGTAGCIFLYVSAIAWCKHKR  414

Query  251  LLD  243
            LL+
Sbjct  415  LLE  417



>ref|XP_008351785.1| PREDICTED: magnesium transporter MRS2-3 isoform X1 [Malus domestica]
Length=492

 Score =   211 bits (536),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 128/194 (66%), Positives = 146/194 (75%), Gaps = 10/194 (5%)
 Frame = -2

Query  803  SMNEQEDGMDDEVMQSDVNDRVPGEISIEGNG------ADPE-IDYPMERVNTLGRDSHt  645
            S+ E++D MD E   SD++DR P EIS+E  G       DP+  D P  R   L RDSH 
Sbjct  302  SLGERDD-MDPEAPGSDMDDRGPTEISMEAGGDHLNFEGDPQNTDDP--RHQFLRRDSHG  358

Query  644  trtsttrSAISKHLNVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQN  465
            T TS+T SAI K L+VEELEMLLEAYF+QIDGTLNKLSTLREYVDDTEDYINIMLDDKQN
Sbjct  359  TATSSTHSAIGKELDVEELEMLLEAYFVQIDGTLNKLSTLREYVDDTEDYINIMLDDKQN  418

Query  464  HLLQMGVMLTAATLvvsafvavagvfGMNITIELFNPDIAGMPEFLWTIGGGSAGCIILY  285
            +LLQMGVMLT ATL VS  V VAGV GMNI I+LF+ + AGMP+FLWT+GG +AG I LY
Sbjct  419  NLLQMGVMLTTATLAVSGLVVVAGVMGMNIHIDLFDKEKAGMPQFLWTVGGSTAGTIFLY  478

Query  284  VAVIAWCKHKRLLD  243
               I  CKHKRLL+
Sbjct  479  ATAIGCCKHKRLLE  492



>ref|XP_011071765.1| PREDICTED: magnesium transporter MRS2-3-like [Sesamum indicum]
Length=490

 Score =   209 bits (533),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 128/199 (64%), Positives = 152/199 (76%), Gaps = 15/199 (8%)
 Frame = -2

Query  803  SMNEQEDGMDDEVMQSDVNDRVPGEISIEGNGADP--------EIDYPMER----VNTLG  660
            S+NEQ DG+ +EV+   + +R P E ++ G G +         E D   E+     NT  
Sbjct  295  SINEQ-DGIVEEVVPPYLENRAPVE-NLMGCGGNSFVSDADIQETDVQQEQNIGESNTFR  352

Query  659  RDSHttrtsttrSAISKHLNVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIML  480
            R SH T TS    A SK+L+VEELEM+LEAYF+QIDGTLNKLSTLREYVDDTEDYINIML
Sbjct  353  RHSHRTHTSMHS-ATSKNLDVEELEMILEAYFVQIDGTLNKLSTLREYVDDTEDYINIML  411

Query  479  DDKQNHLLQMGVMLTAATLvvsafvavagvfGMNITIELFNPDIAGMPEFLWTIGGGSAG  300
            DDKQNHLLQMGV+L+ AT+VVSAFVA+ GVFGMNITIELF+ D AGMPEFLWT+GGG+ G
Sbjct  412  DDKQNHLLQMGVVLSTATVVVSAFVALTGVFGMNITIELFDSDKAGMPEFLWTVGGGTMG  471

Query  299  CIILYVAVIAWCKHKRLLD  243
            C+ LY+A IAWCKHKRLL+
Sbjct  472  CLFLYIAAIAWCKHKRLLE  490



>emb|CAN74927.1| hypothetical protein VITISV_038594 [Vitis vinifera]
Length=279

 Score =   202 bits (515),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 130/212 (61%), Positives = 144/212 (68%), Gaps = 40/212 (19%)
 Frame = -2

Query  758  SDVNDRVPGEISIEGNGADP-------EIDYPMERV----NTLGRDSHttrtsttrSAIS  612
            S  N R+P EIS+E NG           ID P E +    + LGRDSH T TSTT SAIS
Sbjct  68   SHCNIRIPDEISLEANGVSATYEGDLQNIDNPQEHLFGTPHALGRDSHGTHTSTTHSAIS  127

Query  611  KHLNVEELEMLLEAYFIQIDGTLNKLST-----------------------------LRE  519
            KHL+VEELEMLLEAYF+QIDGTLNKLST                             LRE
Sbjct  128  KHLDVEELEMLLEAYFVQIDGTLNKLSTRITQISETVIMYLMDVINILAVLVVFTHKLRE  187

Query  518  YVDDTEDYINIMLDDKQNHLLQMGVMLTAATLvvsafvavagvfGMNITIELFNPDIAGM  339
            YVDDTEDYINIMLDDKQNHLLQMGVMLT ATLVVSAFV VAG+FGMNI IELF+   +G+
Sbjct  188  YVDDTEDYINIMLDDKQNHLLQMGVMLTTATLVVSAFVVVAGIFGMNIHIELFDDKKSGV  247

Query  338  PEFLWTIGGGSAGCIILYVAVIAWCKHKRLLD  243
             EFLWT+GGG+ G I LYV  IAWC+HKRLL+
Sbjct  248  QEFLWTVGGGATGSIFLYVIAIAWCRHKRLLE  279



>ref|XP_010691547.1| PREDICTED: magnesium transporter MRS2-3 [Beta vulgaris subsp. 
vulgaris]
Length=479

 Score =   207 bits (527),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 119/180 (66%), Positives = 141/180 (78%), Gaps = 9/180 (5%)
 Frame = -2

Query  773  DEVMQSDVNDRVPGEISIEGNGADPEIDY---PMERVNTLGRDSHttrtsttrSAISKHL  603
            DE M++++++   G    E + A+P+  Y   P +   +  R S      TT SAISKHL
Sbjct  306  DERMRAEISEVHGGSGRYESDAANPQDQYFGVPAQLARSATRTS------TTHSAISKHL  359

Query  602  NVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVMLTAATL  423
            +VEELEMLLEAYF+QIDGTLNKL+TLREYVDDTEDYINIMLDDKQNHLLQMGVMLT ATL
Sbjct  360  DVEELEMLLEAYFVQIDGTLNKLTTLREYVDDTEDYINIMLDDKQNHLLQMGVMLTTATL  419

Query  422  vvsafvavagvfGMNITIELFNPDIAGMPEFLWTIGGGSAGCIILYVAVIAWCKHKRLLD  243
            VVSAF+ VAG+FGMNI IELF+ D AG PEFLWT+GGG+ GC+ LYV  +AWCKHKRLL+
Sbjct  420  VVSAFIVVAGIFGMNIHIELFDEDKAGDPEFLWTVGGGATGCLFLYVIAVAWCKHKRLLE  479



>gb|AFK48474.1| unknown [Lotus japonicus]
Length=422

 Score =   205 bits (522),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 125/185 (68%), Positives = 142/185 (77%), Gaps = 8/185 (4%)
 Frame = -2

Query  785  DGMDDEVMQSDVN-DRVPGEISIEGNGA---DPEIDYPMERVNTLGRDSHttrtsttrSA  618
            D MD+ ++Q D++ D    EIS+E  GA   D +        + L RDS  + T +   A
Sbjct  242  DAMDN-LLQPDIDEDGTHPEISLEPGGANTSDEDHQNAQHPSSLLRRDSRASTTYS---A  297

Query  617  ISKHLNVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVML  438
             +K L+VEELEM LEAYF+QIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVML
Sbjct  298  TTKQLDVEELEMPLEAYFVQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVML  357

Query  437  TAATLvvsafvavagvfGMNITIELFNPDIAGMPEFLWTIGGGSAGCIILYVAVIAWCKH  258
            T ATLVVSAFV VAG+FGMNI IELFNPDIAGM EFLWT+GG +AG I LYV  IAWCKH
Sbjct  358  TTATLVVSAFVVVAGIFGMNIKIELFNPDIAGMREFLWTVGGSTAGTIFLYVVAIAWCKH  417

Query  257  KRLLD  243
            KRLL+
Sbjct  418  KRLLE  422



>ref|XP_007042675.1| Magnesium transporter 4 isoform 1 [Theobroma cacao]
 gb|EOX98506.1| Magnesium transporter 4 isoform 1 [Theobroma cacao]
Length=475

 Score =   206 bits (525),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 133/187 (71%), Positives = 151/187 (81%), Gaps = 1/187 (1%)
 Frame = -2

Query  803  SMNEQEDGMDDEVMQSDVNDRVPGEISIEGNGADPEIDYPMERVNTLGRDSHttrtsttr  624
            SMNE +D ++DEV+Q D+ DR P EIS+  N      D    ++N +GRDSH T TSTT 
Sbjct  290  SMNESDD-INDEVLQPDITDRTPVEISLASNYEGDLQDSDNPQLNAIGRDSHGTHTSTTH  348

Query  623  SAISKHLNVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGV  444
            SA+SKHL+VEELEMLLEAYF+QIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGV
Sbjct  349  SAMSKHLDVEELEMLLEAYFVQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGV  408

Query  443  MLTAATLvvsafvavagvfGMNITIELFNPDIAGMPEFLWTIGGGSAGCIILYVAVIAWC  264
            MLT ATLV+SAF+ VAG+FGMNI IELF    AG  EFLWTIGGG+ G I LYV  IAWC
Sbjct  409  MLTTATLVISAFIVVAGIFGMNIHIELFEDGKAGNLEFLWTIGGGTTGTIFLYVIAIAWC  468

Query  263  KHKRLLD  243
            K+KRLL+
Sbjct  469  KYKRLLE  475



>ref|XP_003516767.1| PREDICTED: magnesium transporter MRS2-3-like [Glycine max]
Length=393

 Score =   202 bits (515),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 114/143 (80%), Positives = 125/143 (87%), Gaps = 0/143 (0%)
 Frame = -2

Query  671  NTLGRDSHttrtsttrSAISKHLNVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYI  492
            N +GRDSH TR S T SA++K L+VEELEMLLEAYF+QIDGTLNKLSTLREYVDDTEDYI
Sbjct  251  NVVGRDSHGTRDSATYSAVTKQLDVEELEMLLEAYFVQIDGTLNKLSTLREYVDDTEDYI  310

Query  491  NIMLDDKQNHLLQMGVMLTAATLvvsafvavagvfGMNITIELFNPDIAGMPEFLWTIGG  312
            NIMLDDKQNHLLQMGVMLT ATLVVSAFV VAG+FGMNI IELF+   AGM +FLWT+GG
Sbjct  311  NIMLDDKQNHLLQMGVMLTTATLVVSAFVVVAGIFGMNIHIELFDDQKAGMTQFLWTVGG  370

Query  311  GSAGCIILYVAVIAWCKHKRLLD  243
             +AG I LYV  IAWCKHKRLL+
Sbjct  371  STAGTIFLYVVAIAWCKHKRLLE  393



>emb|CDP09701.1| unnamed protein product [Coffea canephora]
Length=424

 Score =   201 bits (512),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 131/198 (66%), Positives = 153/198 (77%), Gaps = 12/198 (6%)
 Frame = -2

Query  803  SMNEQEDGMDDEVMQSDVNDRVPGEISIEGNGADPEIDYPMERVN-----------TLGR  657
            S+NEQ D +DDE  Q D+++R    IS EGNG     D  ++ ++           TL +
Sbjct  228  SINEQ-DELDDEANQQDIDERTRANISYEGNGGPTSYDAGLQNMDNTREQLIAAARTLSK  286

Query  656  DSHttrtsttrSAISKHLNVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLD  477
            DS  TRTSTT+SAISK L+VEELEMLLEAYF+QIDGTLNKLSTLREYVDDTEDYINIMLD
Sbjct  287  DSRGTRTSTTQSAISKQLDVEELEMLLEAYFVQIDGTLNKLSTLREYVDDTEDYINIMLD  346

Query  476  DKQNHLLQMGVMLTAATLvvsafvavagvfGMNITIELFNPDIAGMPEFLWTIGGGSAGC  297
            DKQNHLLQMGVMLT ATLVVSAFV VAG+FGMNI IELF+PD AGMP+FLWT+GGG+ G 
Sbjct  347  DKQNHLLQMGVMLTTATLVVSAFVVVAGIFGMNIHIELFDPDKAGMPQFLWTVGGGTTGT  406

Query  296  IILYVAVIAWCKHKRLLD  243
            I LYV  + W K +RL++
Sbjct  407  IFLYVIAMIWYKQRRLIE  424



>gb|EYU38670.1| hypothetical protein MIMGU_mgv1a021974mg, partial [Erythranthe 
guttata]
Length=440

 Score =   201 bits (511),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 124/187 (66%), Positives = 141/187 (75%), Gaps = 15/187 (8%)
 Frame = -2

Query  803  SMNEQEDGMDDEVMQSDVNDRVPGEISIEGNGADPEIDYPMERVNTLGRDSHttrtsttr  624
            SM+EQ DG +D    ++++DR P E   E     P +         L R SH T TS   
Sbjct  269  SMDEQ-DGSND----ANIDDRHPIENRQEQLFGGPHL---------LSRGSHGTHTSIHS  314

Query  623  SAISKHLNVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGV  444
             A+SKHL+VEELEMLLEAYF+QIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGV
Sbjct  315  -AVSKHLDVEELEMLLEAYFVQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGV  373

Query  443  MLTAATLvvsafvavagvfGMNITIELFNPDIAGMPEFLWTIGGGSAGCIILYVAVIAWC  264
            MLT ATLVVSAFV VAG+FGMNI IE+FN  + GM  FLWT+GGGSAG + LYV  IAWC
Sbjct  374  MLTTATLVVSAFVVVAGIFGMNIKIEIFNDQVHGMTRFLWTVGGGSAGTLFLYVIAIAWC  433

Query  263  KHKRLLD  243
            KH+RLL+
Sbjct  434  KHRRLLE  440



>ref|XP_011077822.1| PREDICTED: magnesium transporter MRS2-3 [Sesamum indicum]
Length=502

 Score =   202 bits (513),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 127/199 (64%), Positives = 147/199 (74%), Gaps = 15/199 (8%)
 Frame = -2

Query  803  SMNEQEDGMDDEVMQSDVNDR-VPGEISIEGNGADPEIDYPMERV-----------NTLG  660
            SMNE  D +D + +Q++ +DR V   +    NG+    D  ++R+           N L 
Sbjct  307  SMNE--DVLDQDDVQANTDDRHVKLWLVTIRNGSSVVSDAELQRIDSRREQLFGGANALS  364

Query  659  RDSHttrtsttrSAISKHLNVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIML  480
            R SH T TST   AISKHL+VEELEMLLEAYF+QIDGTLNKLSTLREYVDDTEDYINIML
Sbjct  365  RGSHGTHTSTHS-AISKHLDVEELEMLLEAYFVQIDGTLNKLSTLREYVDDTEDYINIML  423

Query  479  DDKQNHLLQMGVMLTAATLvvsafvavagvfGMNITIELFNPDIAGMPEFLWTIGGGSAG  300
            DDKQNHLLQMGVMLT ATLVVSAFV VAG+FGMNI IELF   + GM  F+WT+GGGSAG
Sbjct  424  DDKQNHLLQMGVMLTTATLVVSAFVVVAGIFGMNIRIELFQDQVHGMTRFMWTVGGGSAG  483

Query  299  CIILYVAVIAWCKHKRLLD  243
             + LYV  IAWCKH+RLL+
Sbjct  484  TLFLYVIAIAWCKHRRLLE  502



>ref|XP_004511321.1| PREDICTED: magnesium transporter MRS2-3-like [Cicer arietinum]
Length=454

 Score =   201 bits (510),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 114/144 (79%), Positives = 126/144 (88%), Gaps = 0/144 (0%)
 Frame = -2

Query  674  VNTLGRDSHttrtsttrSAISKHLNVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDY  495
            +N + RDS  TR STT SA +  L+VEELEMLLEAYF+QIDGTLNKLSTLREYVDDTEDY
Sbjct  311  LNIISRDSRGTRASTTYSAATNKLDVEELEMLLEAYFVQIDGTLNKLSTLREYVDDTEDY  370

Query  494  INIMLDDKQNHLLQMGVMLTAATLvvsafvavagvfGMNITIELFNPDIAGMPEFLWTIG  315
            INIMLDDKQNHLLQMGVMLT ATLVVSAFV VAG+FGMNI IELF+P++ GM EFLWT+G
Sbjct  371  INIMLDDKQNHLLQMGVMLTTATLVVSAFVVVAGIFGMNIRIELFDPNLYGMREFLWTVG  430

Query  314  GGSAGCIILYVAVIAWCKHKRLLD  243
            GG+AG I LYV  IAWCKHKRLL+
Sbjct  431  GGTAGTIFLYVVAIAWCKHKRLLE  454



>ref|XP_002522142.1| RNA splicing protein mrs2, mitochondrial, putative [Ricinus communis]
 gb|EEF40342.1| RNA splicing protein mrs2, mitochondrial, putative [Ricinus communis]
Length=456

 Score =   199 bits (507),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 120/188 (64%), Positives = 139/188 (74%), Gaps = 30/188 (16%)
 Frame = -2

Query  803  SMNEQEDGMDDEVMQSDVNDRVPGEISIEGNGADPEIDYPMERVNTLGRDSHttrtsttr  624
            S+NE++D MDDE +Q D ++R                            DSH TR+STT+
Sbjct  298  SLNERDD-MDDEYVQDDFDER----------------------------DSHGTRSSTTQ  328

Query  623  SAISKHLNVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGV  444
            SAISKHL+VEELEMLLEAYF+QIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGV
Sbjct  329  SAISKHLDVEELEMLLEAYFVQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGV  388

Query  443  MLTAATLvvsafvavagvfGMNITIELFNPDI-AGMPEFLWTIGGGSAGCIILYVAVIAW  267
            MLT ATL++S  + VAG+FGMNI IELF   +  GMP+FLWT+GG  AG + LYV  IAW
Sbjct  389  MLTTATLIISFGIVVAGIFGMNIKIELFKEAVETGMPKFLWTVGGSCAGSLFLYVVAIAW  448

Query  266  CKHKRLLD  243
            CKHKRLL+
Sbjct  449  CKHKRLLE  456



>ref|XP_006857124.1| hypothetical protein AMTR_s00065p00139210 [Amborella trichopoda]
 gb|ERN18591.1| hypothetical protein AMTR_s00065p00139210 [Amborella trichopoda]
Length=494

 Score =   200 bits (509),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 120/197 (61%), Positives = 142/197 (72%), Gaps = 13/197 (7%)
 Frame = -2

Query  803  SMNEQEDGMDDEVMQSDVNDRVPGEISIE--------GNGADPEIDYPMERVNTLGR--D  654
            S+NE+ + +D+ V+ SDV D   G I++E         +  D + D   E V  + R   
Sbjct  301  SLNERRESVDNGVVTSDVED---GRIAVEMEAHDVSNNDEGDLQNDDNQESVYAVSRLLS  357

Query  653  SHttrtsttrSAISKHLNVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDD  474
            S     +++  + SKHL+VEELEMLLEAYF+QIDG LN LS LREYVDDTEDYINIMLDD
Sbjct  358  SGHGTRTSSTRSGSKHLDVEELEMLLEAYFVQIDGILNNLSALREYVDDTEDYINIMLDD  417

Query  473  KQNHLLQMGVMLTAATLvvsafvavagvfGMNITIELFNPDIAGMPEFLWTIGGGSAGCI  294
            KQNHLLQMGVMLT ATLVVSAFV V GVFGMNI IELF  + AGMPEFLWT+GGG+ G I
Sbjct  418  KQNHLLQMGVMLTTATLVVSAFVVVVGVFGMNIKIELFTSEKAGMPEFLWTVGGGATGSI  477

Query  293  ILYVAVIAWCKHKRLLD  243
             LY+A I WCKHKRLL+
Sbjct  478  FLYIAAITWCKHKRLLE  494



>ref|XP_010507876.1| PREDICTED: magnesium transporter MRS2-3 [Camelina sativa]
Length=484

 Score =   199 bits (506),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 125/193 (65%), Positives = 145/193 (75%), Gaps = 7/193 (4%)
 Frame = -2

Query  803  SMNEQEDGMDDEVMQSDVNDRVPGEISIEGNG------ADPEIDYPMERVNTLGRDSHtt  642
            SMNE  D  + ++ Q D +DR+P E + E N       A+   D  M   + L R+S  T
Sbjct  293  SMNES-DTFEVDIPQGDEDDRLPPEFASEANRDEGYLRANEAHDLLMSAHSALSRNSRGT  351

Query  641  rtsttrSAISKHLNVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNH  462
             TS+TRSA++  L+VEELEMLLEAYF+QIDGTLNKLSTLREYVDDTEDYINIMLDDKQNH
Sbjct  352  HTSSTRSAMTNKLDVEELEMLLEAYFVQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNH  411

Query  461  LLQMGVMLTAATLvvsafvavagvfGMNITIELFNPDIAGMPEFLWTIGGGSAGCIILYV  282
            LLQMGVMLT ATLV+SAF+AVAGVFGMNITIELF  + AG   FLWT+ GGS G I LYV
Sbjct  412  LLQMGVMLTTATLVMSAFIAVAGVFGMNITIELFKDEKAGPQRFLWTVIGGSVGSIFLYV  471

Query  281  AVIAWCKHKRLLD  243
              I WCK+KRLL+
Sbjct  472  GAIGWCKYKRLLE  484



>ref|XP_007042676.1| Magnesium transporter 4 isoform 2 [Theobroma cacao]
 gb|EOX98507.1| Magnesium transporter 4 isoform 2 [Theobroma cacao]
Length=484

 Score =   199 bits (506),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 133/196 (68%), Positives = 151/196 (77%), Gaps = 10/196 (5%)
 Frame = -2

Query  803  SMNEQEDGMDDEVMQSDVND---------RVPGEISIEGNGADPEIDYPMERVNTLGRDS  651
            SMNE +D ++DEV+Q D+ D         R P EIS+  N      D    ++N +GRDS
Sbjct  290  SMNESDD-INDEVLQPDITDSSDLSLYYVRTPVEISLASNYEGDLQDSDNPQLNAIGRDS  348

Query  650  HttrtsttrSAISKHLNVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDK  471
            H T TSTT SA+SKHL+VEELEMLLEAYF+QIDGTLNKLSTLREYVDDTEDYINIMLDDK
Sbjct  349  HGTHTSTTHSAMSKHLDVEELEMLLEAYFVQIDGTLNKLSTLREYVDDTEDYINIMLDDK  408

Query  470  QNHLLQMGVMLTAATLvvsafvavagvfGMNITIELFNPDIAGMPEFLWTIGGGSAGCII  291
            QNHLLQMGVMLT ATLV+SAF+ VAG+FGMNI IELF    AG  EFLWTIGGG+ G I 
Sbjct  409  QNHLLQMGVMLTTATLVISAFIVVAGIFGMNIHIELFEDGKAGNLEFLWTIGGGTTGTIF  468

Query  290  LYVAVIAWCKHKRLLD  243
            LYV  IAWCK+KRLL+
Sbjct  469  LYVIAIAWCKYKRLLE  484



>ref|XP_006590388.1| PREDICTED: magnesium transporter MRS2-3-like [Glycine max]
Length=399

 Score =   197 bits (500),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 112/153 (73%), Positives = 125/153 (82%), Gaps = 10/153 (7%)
 Frame = -2

Query  701  PEIDYPMERVNTLGRDSHttrtsttrSAISKHLNVEELEMLLEAYFIQIDGTLNKLSTLR  522
            PE+ +     N LGRDS       + SA++K L+VEELEMLLEAYF+QIDGTLNKLSTLR
Sbjct  257  PELSFD----NVLGRDS------ASFSAVTKQLDVEELEMLLEAYFVQIDGTLNKLSTLR  306

Query  521  EYVDDTEDYINIMLDDKQNHLLQMGVMLTAATLvvsafvavagvfGMNITIELFNPDIAG  342
            EYVDDTEDYINIMLDDKQNHLLQMGVMLT ATLVVSAFV VAG+FGMNI IELF+   AG
Sbjct  307  EYVDDTEDYINIMLDDKQNHLLQMGVMLTTATLVVSAFVVVAGIFGMNIHIELFDDQKAG  366

Query  341  MPEFLWTIGGGSAGCIILYVAVIAWCKHKRLLD  243
            M +FLWT+GG +AG I LYV  IAWCKHKRLL+
Sbjct  367  MTQFLWTVGGSTAGTIFLYVVAIAWCKHKRLLE  399



>ref|XP_010466120.1| PREDICTED: magnesium transporter MRS2-3-like [Camelina sativa]
Length=483

 Score =   199 bits (505),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 125/193 (65%), Positives = 145/193 (75%), Gaps = 7/193 (4%)
 Frame = -2

Query  803  SMNEQEDGMDDEVMQSDVNDRVPGEISIEGNG------ADPEIDYPMERVNTLGRDSHtt  642
            SMNE  D  + ++ Q D +DR+P E + E N       A+   D  M   + L R+S  T
Sbjct  292  SMNES-DTFEVDIPQGDEDDRLPPEFASEANRDEGYLRANDAHDLLMSAHSALSRNSRGT  350

Query  641  rtsttrSAISKHLNVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNH  462
             TS+TRSA++  L+VEELEMLLEAYF+QIDGTLNKLSTLREYVDDTEDYINIMLDDKQNH
Sbjct  351  HTSSTRSAMTNKLDVEELEMLLEAYFVQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNH  410

Query  461  LLQMGVMLTAATLvvsafvavagvfGMNITIELFNPDIAGMPEFLWTIGGGSAGCIILYV  282
            LLQMGVMLT ATLV+SAF+AVAGVFGMNITIELF  + AG   FLWT+ GGS G I LYV
Sbjct  411  LLQMGVMLTTATLVMSAFIAVAGVFGMNITIELFKDEKAGPSRFLWTVIGGSVGSIFLYV  470

Query  281  AVIAWCKHKRLLD  243
              I WCK+KRLL+
Sbjct  471  GAIGWCKYKRLLE  483



>ref|XP_011030312.1| PREDICTED: magnesium transporter MRS2-3-like isoform X1 [Populus 
euphratica]
Length=497

 Score =   199 bits (505),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 120/199 (60%), Positives = 147/199 (74%), Gaps = 14/199 (7%)
 Frame = -2

Query  803  SMNEQEDGMDDEVMQSDVNDRVPGEISI----------EG-NGADPEIDYPMERVNTLGR  657
            S+NE  DGMD++ +Q+D++  +P E+S+          +G N  + E D+     N LGR
Sbjct  300  SLNEG-DGMDNDDLQADLDASIPAEVSLGVLEASSSHEDGINNIENEHDHLFSAPNGLGR  358

Query  656  DSHttrtsttrSAISKHLNVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLD  477
             S    ++T   +ISKHL+V ELEMLLEAYF+QIDGTLNKL TLREYVDDTEDYINIMLD
Sbjct  359  YSRVHTSTTRS-SISKHLDVGELEMLLEAYFVQIDGTLNKLCTLREYVDDTEDYINIMLD  417

Query  476  DKQNHLLQMGVMLTAATLvvsafvavagvfGMNITIELFNPDI-AGMPEFLWTIGGGSAG  300
            DKQNHLLQMGVMLT ATLVVS FV V GVFGMNI I++F  ++ AGM +FLWT+ GG+ G
Sbjct  418  DKQNHLLQMGVMLTTATLVVSCFVVVVGVFGMNIGIKMFKEEVQAGMSKFLWTVAGGTTG  477

Query  299  CIILYVAVIAWCKHKRLLD  243
             + LYV  IAWCKH+RLLD
Sbjct  478  SMFLYVIAIAWCKHRRLLD  496



>ref|XP_010487909.1| PREDICTED: magnesium transporter MRS2-3-like [Camelina sativa]
Length=482

 Score =   197 bits (501),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 124/193 (64%), Positives = 145/193 (75%), Gaps = 7/193 (4%)
 Frame = -2

Query  803  SMNEQEDGMDDEVMQSDVNDRVPGEISIEGNG------ADPEIDYPMERVNTLGRDSHtt  642
            SMNE  D  + ++ Q + +DR+P E + E N       A+   D  M   + L R+S  T
Sbjct  291  SMNES-DAFEVDLPQENEDDRLPPEFASEANRDEGYLRANDAHDLLMSAHSALSRNSRGT  349

Query  641  rtsttrSAISKHLNVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNH  462
             TS+TRSA++  L+VEELEMLLEAYF+QIDGTLNKLSTLREYVDDTEDYINIMLDDKQNH
Sbjct  350  HTSSTRSAMTNKLDVEELEMLLEAYFVQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNH  409

Query  461  LLQMGVMLTAATLvvsafvavagvfGMNITIELFNPDIAGMPEFLWTIGGGSAGCIILYV  282
            LLQMGVMLT ATLV+SAF+AVAGVFGMNITIELF  + AG   FLWT+ GGS G I LYV
Sbjct  410  LLQMGVMLTTATLVMSAFIAVAGVFGMNITIELFKDEKAGPSRFLWTVIGGSVGSIFLYV  469

Query  281  AVIAWCKHKRLLD  243
              I WCK+KRLL+
Sbjct  470  GAIGWCKYKRLLE  482



>ref|XP_003610633.1| Magnesium transporter [Medicago truncatula]
 gb|AES93591.1| magnesium transporter 2 [Medicago truncatula]
Length=444

 Score =   196 bits (497),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 123/183 (67%), Positives = 138/183 (75%), Gaps = 13/183 (7%)
 Frame = -2

Query  755  DVNDRVPG-EISIEGNGADPEIDYPME-------RVNTLG----RDSHttrtsttrSAIS  612
            D+N  VP  EIS+E  G    ++Y  E       R    G    RDS  TR STT S  +
Sbjct  263  DINQSVPAAEISLEA-GVGGGVNYVEEDEDNLNSREQMFGASNLRDSRGTRASTTYSVTT  321

Query  611  KHLNVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVMLTA  432
              L+VEELEMLLEAYF+QIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVMLT 
Sbjct  322  TKLDVEELEMLLEAYFVQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVMLTT  381

Query  431  ATLvvsafvavagvfGMNITIELFNPDIAGMPEFLWTIGGGSAGCIILYVAVIAWCKHKR  252
            ATLVVSAFV VAG+FGMNI IELF+ ++ GM EF+WT+GGG+AG I LYV  IAWCKHKR
Sbjct  382  ATLVVSAFVVVAGIFGMNINIELFDKNLYGMREFMWTVGGGTAGTIFLYVVAIAWCKHKR  441

Query  251  LLD  243
            LL+
Sbjct  442  LLE  444



>ref|XP_002522143.1| RNA splicing protein mrs2, mitochondrial, putative [Ricinus communis]
 gb|EEF40343.1| RNA splicing protein mrs2, mitochondrial, putative [Ricinus communis]
Length=451

 Score =   195 bits (496),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 112/140 (80%), Positives = 122/140 (87%), Gaps = 1/140 (1%)
 Frame = -2

Query  659  RDSHttrtsttrSAISKHLNVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIML  480
            RDSH T TSTTRSAISKHL+VEELEMLLEAYF+QIDGTLNKLSTLREYVDDTEDYINIML
Sbjct  312  RDSHGTHTSTTRSAISKHLDVEELEMLLEAYFVQIDGTLNKLSTLREYVDDTEDYINIML  371

Query  479  DDKQNHLLQMGVMLTAATLvvsafvavagvfGMNITIELFNPDI-AGMPEFLWTIGGGSA  303
            DDKQNHLLQMGVMLT ATLV+S  V VAG+FGMNI+IELFN  +  GM +FLWT+GG  A
Sbjct  372  DDKQNHLLQMGVMLTTATLVISCCVVVAGIFGMNISIELFNEQMETGMQKFLWTVGGSCA  431

Query  302  GCIILYVAVIAWCKHKRLLD  243
            G + LYV  IAWCK KRLL+
Sbjct  432  GSVFLYVVAIAWCKQKRLLE  451



>ref|XP_006297595.1| hypothetical protein CARUB_v10013617mg [Capsella rubella]
 gb|EOA30493.1| hypothetical protein CARUB_v10013617mg [Capsella rubella]
Length=472

 Score =   194 bits (492),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 123/193 (64%), Positives = 143/193 (74%), Gaps = 7/193 (4%)
 Frame = -2

Query  803  SMNEQEDGMDDEVMQSDVNDRVPGEISIEGNGADPEI------DYPMERVNTLGRDSHtt  642
            SMNE  D  + ++ Q D +DR+P E + E N  +  +      D  M     L R+S  T
Sbjct  281  SMNES-DTFEVDLPQGDEDDRLPTEFASEANRDESYLQAHDAHDLLMSAHGALSRNSRGT  339

Query  641  rtsttrSAISKHLNVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNH  462
             TS+TRSA++  L+VEELEMLLEAYF+QIDGTLNKLSTLREYVDDTEDYINIMLDDKQNH
Sbjct  340  HTSSTRSAMTNKLDVEELEMLLEAYFVQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNH  399

Query  461  LLQMGVMLTAATLvvsafvavagvfGMNITIELFNPDIAGMPEFLWTIGGGSAGCIILYV  282
            LLQMGVMLT ATLV+SAF+AVAGVFGMNI+IELF  D  G   FLWT+ GGS G I LYV
Sbjct  400  LLQMGVMLTTATLVLSAFIAVAGVFGMNISIELFKDDKNGPGRFLWTVIGGSLGSIFLYV  459

Query  281  AVIAWCKHKRLLD  243
              I WCK+KRLL+
Sbjct  460  GAIGWCKYKRLLE  472



>gb|KHN35209.1| Magnesium transporter MRS2-3 [Glycine soja]
Length=375

 Score =   191 bits (485),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 103/126 (82%), Positives = 113/126 (90%), Gaps = 0/126 (0%)
 Frame = -2

Query  620  AISKHLNVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVM  441
            A++K L+VEELEMLLEAYF+QIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVM
Sbjct  250  AVTKQLDVEELEMLLEAYFVQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVM  309

Query  440  LTAATLvvsafvavagvfGMNITIELFNPDIAGMPEFLWTIGGGSAGCIILYVAVIAWCK  261
            LT ATLVVSAFV VAG+FGMNI IELF+   AGM +FLWT+GG +AG I LYV  IAWCK
Sbjct  310  LTTATLVVSAFVVVAGIFGMNIHIELFDDQKAGMTQFLWTVGGSTAGTIFLYVVAIAWCK  369

Query  260  HKRLLD  243
            HKRLL+
Sbjct  370  HKRLLE  375



>ref|XP_006406476.1| hypothetical protein EUTSA_v10020646mg [Eutrema salsugineum]
 gb|ESQ47929.1| hypothetical protein EUTSA_v10020646mg [Eutrema salsugineum]
Length=475

 Score =   192 bits (488),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 123/193 (64%), Positives = 144/193 (75%), Gaps = 7/193 (4%)
 Frame = -2

Query  803  SMNEQEDGMDDEVMQSDVNDRVPGEISIEGNG------ADPEIDYPMERVNTLGRDSHtt  642
            SMNE E  ++ ++ + D +DR+P E + E N       A+   D  M   + L R+S  T
Sbjct  284  SMNESE-SVEIDLPEEDEDDRLPPEFASEANRDESYLRANDAHDLLMSAHSALSRNSRGT  342

Query  641  rtsttrSAISKHLNVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNH  462
             TS+TRSAI+   +VEELEMLLEAYF+QIDGTLNKLSTLREYVDDTEDYINIMLDDKQN 
Sbjct  343  HTSSTRSAITNKFDVEELEMLLEAYFVQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNQ  402

Query  461  LLQMGVMLTAATLvvsafvavagvfGMNITIELFNPDIAGMPEFLWTIGGGSAGCIILYV  282
            LLQMGVMLT ATLV+SAF+AVAGVFGMNITIELFN + AG   FLWT+ GG+ G I LYV
Sbjct  403  LLQMGVMLTTATLVMSAFIAVAGVFGMNITIELFNDEKAGPGRFLWTVIGGTVGSIFLYV  462

Query  281  AVIAWCKHKRLLD  243
              I W KHKRLL+
Sbjct  463  GAIGWWKHKRLLE  475



>gb|KJB79462.1| hypothetical protein B456_013G051100 [Gossypium raimondii]
Length=470

 Score =   190 bits (483),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 109/170 (64%), Positives = 130/170 (76%), Gaps = 4/170 (2%)
 Frame = -2

Query  740  VPGE----ISIEGNGADPEIDYPMERVNTLGRDSHttrtsttrSAISKHLNVEELEMLLE  573
             PGE     S EG+  DP+  +      T+G D+H    S+  S I K +NVEELEMLLE
Sbjct  301  TPGEESLTTSYEGDVQDPDKPHDHSFGATIGGDTHGIHASSCHSLIGKPVNVEELEMLLE  360

Query  572  AYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVMLTAATLvvsafvavag  393
            AYF+Q+DGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVML+ A LV+ AF+ VAG
Sbjct  361  AYFVQVDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVMLSTANLVIGAFIVVAG  420

Query  392  vfGMNITIELFNPDIAGMPEFLWTIGGGSAGCIILYVAVIAWCKHKRLLD  243
            +FGMNI I+LF+ + AG PEFLWTIGG +AG I+LYV  IAWCK++ LL+
Sbjct  421  LFGMNIHIDLFDENKAGTPEFLWTIGGSTAGTILLYVVAIAWCKYEGLLE  470



>ref|NP_188598.2| magnesium transporter MRS2-3 [Arabidopsis thaliana]
 sp|Q9LJN2.1|MRS23_ARATH RecName: Full=Magnesium transporter MRS2-3; AltName: Full=Magnesium 
Transporter 4; Short=AtMGT4 [Arabidopsis thaliana]
 dbj|BAB02549.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAN17435.1| unknown protein [Arabidopsis thaliana]
 gb|AAN73213.1| MRS2-3 [Arabidopsis thaliana]
 gb|AAP31966.1| At3g19640 [Arabidopsis thaliana]
 gb|AEE76270.1| magnesium transporter MRS2-3 [Arabidopsis thaliana]
Length=484

 Score =   190 bits (483),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 121/193 (63%), Positives = 143/193 (74%), Gaps = 7/193 (4%)
 Frame = -2

Query  803  SMNEQEDGMDDEVMQSDVNDRVPGEISIEGN------GADPEIDYPMERVNTLGRDSHtt  642
            SMNE  D  + ++ Q D +DR+P E + E N       A+   +  M   + L R+S  T
Sbjct  293  SMNES-DTFEVDLPQGDEDDRLPPEFASEANRDGRYLQANDAHELLMSTQSALSRNSRGT  351

Query  641  rtsttrSAISKHLNVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNH  462
             TS+TRSA++  L+VEELEMLLEAYF+QIDG LNKLSTLREYVDDTEDYINIMLDDKQNH
Sbjct  352  HTSSTRSAMTNKLDVEELEMLLEAYFVQIDGILNKLSTLREYVDDTEDYINIMLDDKQNH  411

Query  461  LLQMGVMLTAATLvvsafvavagvfGMNITIELFNPDIAGMPEFLWTIGGGSAGCIILYV  282
            LLQMGVMLT ATLV+SAF+AVAGVFGMNITIELF  +  G   F+WT+ GGS G I LYV
Sbjct  412  LLQMGVMLTTATLVMSAFIAVAGVFGMNITIELFTDNKHGPSRFIWTVIGGSIGSICLYV  471

Query  281  AVIAWCKHKRLLD  243
              I WCK+KRLL+
Sbjct  472  GAIGWCKYKRLLE  484



>gb|KFK39291.1| hypothetical protein AALP_AA3G225600 [Arabis alpina]
Length=475

 Score =   189 bits (481),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 117/187 (63%), Positives = 139/187 (74%), Gaps = 6/187 (3%)
 Frame = -2

Query  785  DGMDDEVMQSDVNDRVPGEISIEGNG------ADPEIDYPMERVNTLGRDSHttrtsttr  624
            D ++ ++ + D +D +P E + + N       AD   D  M   + L R+S  T TS+TR
Sbjct  289  DTVEIDLAEGDEDDMLPPEFASDANRDESYLRADDAHDLLMSAHSALSRNSRGTHTSSTR  348

Query  623  SAISKHLNVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGV  444
            SA+S   +VEELEMLLEAYF+QIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGV
Sbjct  349  SAMSNKFDVEELEMLLEAYFVQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGV  408

Query  443  MLTAATLvvsafvavagvfGMNITIELFNPDIAGMPEFLWTIGGGSAGCIILYVAVIAWC  264
            MLT ATLV++AF+AVAGVFGMNI IELF  + AG   FLWT+ GGS G I +YV  I WC
Sbjct  409  MLTTATLVINAFIAVAGVFGMNIKIELFKEEEAGPARFLWTVIGGSVGSIFIYVGAIGWC  468

Query  263  KHKRLLD  243
            KHKRLL+
Sbjct  469  KHKRLLE  475



>gb|KFK39290.1| hypothetical protein AALP_AA3G225600 [Arabis alpina]
Length=474

 Score =   189 bits (481),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 117/187 (63%), Positives = 139/187 (74%), Gaps = 6/187 (3%)
 Frame = -2

Query  785  DGMDDEVMQSDVNDRVPGEISIEGNG------ADPEIDYPMERVNTLGRDSHttrtsttr  624
            D ++ ++ + D +D +P E + + N       AD   D  M   + L R+S  T TS+TR
Sbjct  288  DTVEIDLAEGDEDDMLPPEFASDANRDESYLRADDAHDLLMSAHSALSRNSRGTHTSSTR  347

Query  623  SAISKHLNVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGV  444
            SA+S   +VEELEMLLEAYF+QIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGV
Sbjct  348  SAMSNKFDVEELEMLLEAYFVQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGV  407

Query  443  MLTAATLvvsafvavagvfGMNITIELFNPDIAGMPEFLWTIGGGSAGCIILYVAVIAWC  264
            MLT ATLV++AF+AVAGVFGMNI IELF  + AG   FLWT+ GGS G I +YV  I WC
Sbjct  408  MLTTATLVINAFIAVAGVFGMNIKIELFKEEEAGPARFLWTVIGGSVGSIFIYVGAIGWC  467

Query  263  KHKRLLD  243
            KHKRLL+
Sbjct  468  KHKRLLE  474



>ref|XP_010558892.1| PREDICTED: magnesium transporter MRS2-3 [Tarenaya hassleriana]
Length=458

 Score =   189 bits (480),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 119/189 (63%), Positives = 139/189 (74%), Gaps = 10/189 (5%)
 Frame = -2

Query  779  MDDEVMQSDVNDRVPGEISIEGN------GADPEI----DYPMERVNTLGRDSHttrtst  630
            ++D++   D +DR   E   E N        +P+     D  M   N L R+S  T TST
Sbjct  270  VEDDLPVEDADDRFAPEFGSEVNIDTVSYEGEPQTGNAHDLLMSAHNELSRNSRGTHTST  329

Query  629  trSAISKHLNVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQM  450
            TRSA+SK  +VEELEMLLEAYF+QIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQM
Sbjct  330  TRSAVSKAFDVEELEMLLEAYFVQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQM  389

Query  449  GVMLTAATLvvsafvavagvfGMNITIELFNPDIAGMPEFLWTIGGGSAGCIILYVAVIA  270
            GVMLT ATLV+SAFV VAG+FGMNI IELF  + AG  +FLWT+ GG+ G I LYV  I+
Sbjct  390  GVMLTTATLVLSAFVVVAGIFGMNIRIELFKDEAAGPRKFLWTVLGGALGSICLYVGAIS  449

Query  269  WCKHKRLLD  243
            WCKH+RLL+
Sbjct  450  WCKHQRLLE  458



>ref|XP_002883195.1| hypothetical protein ARALYDRAFT_479481 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59454.1| hypothetical protein ARALYDRAFT_479481 [Arabidopsis lyrata subsp. 
lyrata]
Length=484

 Score =   188 bits (478),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 122/194 (63%), Positives = 142/194 (73%), Gaps = 9/194 (5%)
 Frame = -2

Query  803  SMNEQEDGMDDEVMQSDVNDRVPGEISIEGN-------GADPEIDYPMERVNTLGRDSHt  645
            SMNE  D  + ++ Q D +DR+P E +   N       G D      M   + L R+S  
Sbjct  293  SMNES-DTFEVDLPQGDEDDRLPPEFASLANRDERYLQGTDAH-HLLMSAHSALSRNSRG  350

Query  644  trtsttrSAISKHLNVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQN  465
            T TS+TRSA++  L+VEELEMLLEAYF+QIDG LNKLSTLREYVDDTEDYINIMLDDKQN
Sbjct  351  THTSSTRSAMTNKLDVEELEMLLEAYFVQIDGILNKLSTLREYVDDTEDYINIMLDDKQN  410

Query  464  HLLQMGVMLTAATLvvsafvavagvfGMNITIELFNPDIAGMPEFLWTIGGGSAGCIILY  285
            HLLQMGVMLT ATLV+SAF+AVAGVFGMNITIELF  + AG   F+WT+ GGS G I LY
Sbjct  411  HLLQMGVMLTTATLVMSAFIAVAGVFGMNITIELFKDNEAGPRRFIWTVIGGSVGSIFLY  470

Query  284  VAVIAWCKHKRLLD  243
            V  I WCK+KRLL+
Sbjct  471  VGAIGWCKYKRLLE  484



>gb|ABR17972.1| unknown [Picea sitchensis]
Length=494

 Score =   188 bits (478),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 112/191 (59%), Positives = 139/191 (73%), Gaps = 14/191 (7%)
 Frame = -2

Query  788  EDGMDDEVMQSDVNDRVPGEISIEGNGADPE---------IDYPMERVNTLGRDSHttrt  636
             DGM+ E  QSD  +    E S+     DP+         ++ P+       R+ +++ +
Sbjct  309  RDGMEYEPTQSDAEE----ERSLLERHTDPQNLLSSSGNHVEGPLAATKAPSRNEYSSSS  364

Query  635  sttrSAISKHLNVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLL  456
            S +  + +K L+VEELEMLLEAYF+QID TLNKLS LREYVDDTEDYINIMLDDKQNHLL
Sbjct  365  SGSH-SGTKSLDVEELEMLLEAYFVQIDSTLNKLSALREYVDDTEDYINIMLDDKQNHLL  423

Query  455  QMGVMLTAATLvvsafvavagvfGMNITIELFNPDIAGMPEFLWTIGGGSAGCIILYVAV  276
            QMGVMLT ATLV+SAFV VAG+FGMNITI+LF+ D AG+PEFLWT+GG + G I LY+  
Sbjct  424  QMGVMLTTATLVISAFVVVAGIFGMNITIDLFDEDRAGLPEFLWTVGGCATGSIFLYIVA  483

Query  275  IAWCKHKRLLD  243
            IAWCKH+RLL+
Sbjct  484  IAWCKHRRLLE  494



>ref|XP_006486898.1| PREDICTED: magnesium transporter MRS2-3-like [Citrus sinensis]
Length=490

 Score =   188 bits (477),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 107/145 (74%), Positives = 121/145 (83%), Gaps = 0/145 (0%)
 Frame = -2

Query  677  RVNTLGRDSHttrtsttrSAISKHLNVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTED  498
            R N L  DSH T TST  S +S HL+VEELEMLLEAYF+Q+DG +NKLSTLREYVDDTED
Sbjct  345  RHNVLSNDSHGTHTSTVHSTVSNHLDVEELEMLLEAYFVQVDGIVNKLSTLREYVDDTED  404

Query  497  YINIMLDDKQNHLLQMGVMLTAATLvvsafvavagvfGMNITIELFNPDIAGMPEFLWTI  318
            YINIMLDDKQN+LLQMGVMLT ATLV+SAF+A+ GVFGMNITIELF+   A MPEFLWT+
Sbjct  405  YINIMLDDKQNNLLQMGVMLTTATLVISAFIALVGVFGMNITIELFDHTKARMPEFLWTV  464

Query  317  GGGSAGCIILYVAVIAWCKHKRLLD  243
             GG+ G I LY A IAW K+KRLL+
Sbjct  465  AGGTIGTIFLYAAAIAWYKYKRLLE  489



>ref|XP_011094263.1| PREDICTED: magnesium transporter MRS2-3-like [Sesamum indicum]
Length=489

 Score =   187 bits (474),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 108/182 (59%), Positives = 135/182 (74%), Gaps = 4/182 (2%)
 Frame = -2

Query  788  EDGMDDEVMQSDVNDRVPGEISIEGNGADPEIDYPMERVNTLGRDSHttrtsttrSAISK  609
            +DG D++V  ++++DR   +  ++GN +    D P         D+HT  T +   ++SK
Sbjct  312  QDGTDEDVC-AEMDDRTLAKTLMDGNESSQVCDDPTVLSKDSADDAHTNSTRS---SLSK  367

Query  608  HLNVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVMLTAA  429
             L+VEELEMLLEAYF+QIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLL+MGVMLT A
Sbjct  368  QLDVEELEMLLEAYFVQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLRMGVMLTTA  427

Query  428  TLvvsafvavagvfGMNITIELFNPDIAGMPEFLWTIGGGSAGCIILYVAVIAWCKHKRL  249
            TLV+S  + V+GVFGMNI I++F+    GM  FLWT+G GSAG I LYV  IAW KH+RL
Sbjct  428  TLVLSVLLTVSGVFGMNIKIDIFDDKEHGMTRFLWTVGAGSAGTIFLYVFAIAWYKHRRL  487

Query  248  LD  243
            L+
Sbjct  488  LE  489



>ref|XP_009399090.1| PREDICTED: magnesium transporter MRS2-3 [Musa acuminata subsp. 
malaccensis]
Length=493

 Score =   186 bits (472),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 112/159 (70%), Positives = 129/159 (81%), Gaps = 1/159 (1%)
 Frame = -2

Query  719  EGNGADPEIDYPMERVNTLGRDSHttrtsttrSAISKHLNVEELEMLLEAYFIQIDGTLN  540
            +G+  +  + Y     N +  DSH TRT +TRS+ SKHL+VEELEMLLEAYFIQID TLN
Sbjct  336  DGDSQNINLHYRASEPNIINVDSHGTRTYSTRSS-SKHLDVEELEMLLEAYFIQIDSTLN  394

Query  539  KLSTLREYVDDTEDYINIMLDDKQNHLLQMGVMLTAATLvvsafvavagvfGMNITIELF  360
            KLSTLREYVDDTEDYINIMLDDKQNHLLQMGVMLT ATLVVSAFVA+ GVFGMNI ++LF
Sbjct  395  KLSTLREYVDDTEDYINIMLDDKQNHLLQMGVMLTTATLVVSAFVALVGVFGMNIQVDLF  454

Query  359  NPDIAGMPEFLWTIGGGSAGCIILYVAVIAWCKHKRLLD  243
            +   +GM EFLWTIGGG+ G + LYV  IAWCK +RLL+
Sbjct  455  DKKKSGMLEFLWTIGGGTFGSVFLYVIAIAWCKRRRLLE  493



>ref|XP_010941938.1| PREDICTED: magnesium transporter MRS2-3-like [Elaeis guineensis]
Length=485

 Score =   185 bits (470),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 97/123 (79%), Positives = 110/123 (89%), Gaps = 0/123 (0%)
 Frame = -2

Query  611  KHLNVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVMLTA  432
            KHL+VEELEMLLEAYF+QID TLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVMLT 
Sbjct  363  KHLDVEELEMLLEAYFVQIDSTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVMLTT  422

Query  431  ATLvvsafvavagvfGMNITIELFNPDIAGMPEFLWTIGGGSAGCIILYVAVIAWCKHKR  252
            ATL+VSAFV +AG+FGMNI ++LF+   +GM EFLWT+GGG+ G I LYV  IAWCKH+R
Sbjct  423  ATLIVSAFVVLAGIFGMNIQVDLFDEKKSGMHEFLWTVGGGATGSIFLYVIAIAWCKHRR  482

Query  251  LLD  243
            LL+
Sbjct  483  LLE  485



>ref|XP_009145765.1| PREDICTED: magnesium transporter MRS2-3-like [Brassica rapa]
Length=472

 Score =   183 bits (464),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 119/194 (61%), Positives = 140/194 (72%), Gaps = 8/194 (4%)
 Frame = -2

Query  803  SMNEQEDGMDDEVMQSDVNDRVPGEISIEGNGADPEI-------DYPMERVNTLGRDSHt  645
            SMNE  D ++ ++ + D +DR+P E + E N  +  +       D  M   + L R S  
Sbjct  280  SMNES-DTVEVDLPEGDEDDRLPAESASESNRDESYLRANEDAHDLLMSTHSALSRTSRG  338

Query  644  trtsttrSAISKHLNVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQN  465
            T TS+TRSA++   +VEELEMLLEAYF+QIDGTLNKLSTLREYVDDTEDYINIMLDDKQN
Sbjct  339  THTSSTRSAMTNKFDVEELEMLLEAYFVQIDGTLNKLSTLREYVDDTEDYINIMLDDKQN  398

Query  464  HLLQMGVMLTAATLvvsafvavagvfGMNITIELFNPDIAGMPEFLWTIGGGSAGCIILY  285
            HLLQMGVMLT ATLV+SAF+AVAGVFGMNITIELF  + AG   F WT+ GG  G I LY
Sbjct  399  HLLQMGVMLTTATLVMSAFIAVAGVFGMNITIELFKDEKAGPTRFAWTVIGGFIGSIFLY  458

Query  284  VAVIAWCKHKRLLD  243
            V  I W K KRLL+
Sbjct  459  VGAIGWWKQKRLLE  472



>ref|XP_008797020.1| PREDICTED: magnesium transporter MRS2-3-like [Phoenix dactylifera]
Length=398

 Score =   181 bits (459),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 97/123 (79%), Positives = 109/123 (89%), Gaps = 0/123 (0%)
 Frame = -2

Query  611  KHLNVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVMLTA  432
            KHL+VEELEMLLEAYF+QID TLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVMLT 
Sbjct  276  KHLDVEELEMLLEAYFVQIDSTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVMLTT  335

Query  431  ATLvvsafvavagvfGMNITIELFNPDIAGMPEFLWTIGGGSAGCIILYVAVIAWCKHKR  252
            ATLVVSAFV +AG+FGMNI ++LF+   +GM EFLWT+GGG+ G I LYV  IAWCK +R
Sbjct  336  ATLVVSAFVVLAGIFGMNIQVDLFDEKKSGMNEFLWTVGGGATGSIFLYVIAIAWCKRRR  395

Query  251  LLD  243
            LL+
Sbjct  396  LLE  398



>ref|XP_004292113.1| PREDICTED: magnesium transporter MRS2-3 [Fragaria vesca subsp. 
vesca]
Length=483

 Score =   179 bits (453),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 113/194 (58%), Positives = 141/194 (73%), Gaps = 11/194 (6%)
 Frame = -2

Query  803  SMNEQEDGMDDEVMQSDVNDRVPGEISIEGNGADPEIDYPMERVNTLGRDSHtt------  642
            S+ E++D M+DE  Q+D++ R   EIS++  G    +++  +  NT G  +H +      
Sbjct  294  SLTERDD-MNDEGPQTDIDYRNLTEISLDATGES--MNFEGDLRNT-GNPAHESMDIHGT  349

Query  641  -rtsttrSAISKHLNVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQN  465
              +ST      K L+VEELEMLLEAYF+QIDGTLN LSTLREYVDDTEDYINIMLDDKQN
Sbjct  350  HTSSTRSITTGKTLDVEELEMLLEAYFVQIDGTLNNLSTLREYVDDTEDYINIMLDDKQN  409

Query  464  HLLQMGVMLTAATLvvsafvavagvfGMNITIELFNPDIAGMPEFLWTIGGGSAGCIILY  285
            HLLQMGVMLT ATLVVSAFV VAG+FGMNI I+LF+   AGM ++LWTIGG +   ++LY
Sbjct  410  HLLQMGVMLTTATLVVSAFVVVAGIFGMNIKIDLFDDTKAGMKDWLWTIGGSTIASVVLY  469

Query  284  VAVIAWCKHKRLLD  243
            +  I WCK KRLL+
Sbjct  470  IIAIGWCKQKRLLE  483



>emb|CDY66275.1| BnaAnng21960D [Brassica napus]
Length=441

 Score =   177 bits (448),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 112/185 (61%), Positives = 135/185 (73%), Gaps = 7/185 (4%)
 Frame = -2

Query  776  DDEVMQSDVNDRVPGEISIEGNGADPEI-------DYPMERVNTLGRDSHttrtsttrSA  618
            D+++ +  + +++P E + E N  +  +       D  M   + L R+S  T TS+TRSA
Sbjct  257  DEDMAEMYLTEKLPAESASESNRDESYLRANEDAHDLLMSTHSALSRNSRGTHTSSTRSA  316

Query  617  ISKHLNVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVML  438
            ++   +VEELEMLLEAYF+QIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVML
Sbjct  317  MTNKFDVEELEMLLEAYFVQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVML  376

Query  437  TAATLvvsafvavagvfGMNITIELFNPDIAGMPEFLWTIGGGSAGCIILYVAVIAWCKH  258
            T ATLV+SAF+AVAGVFGMNITIELF  + AG   F WT+ GG  G I LYV  I W K 
Sbjct  377  TTATLVMSAFIAVAGVFGMNITIELFKDEKAGPTRFAWTVIGGFIGSIFLYVGAIGWWKQ  436

Query  257  KRLLD  243
            KRLL+
Sbjct  437  KRLLE  441



>gb|KDO57930.1| hypothetical protein CISIN_1g033601mg [Citrus sinensis]
Length=115

 Score =   162 bits (411),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 88/114 (77%), Positives = 100/114 (88%), Gaps = 0/114 (0%)
 Frame = -2

Query  584  MLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVMLTAATLvvsafv  405
            MLLEAYF+Q+DG +NKLSTLREYVDDTEDYINIMLDDKQN+LLQMGVMLT ATLV+SAF+
Sbjct  1    MLLEAYFVQVDGIVNKLSTLREYVDDTEDYINIMLDDKQNNLLQMGVMLTTATLVISAFI  60

Query  404  avagvfGMNITIELFNPDIAGMPEFLWTIGGGSAGCIILYVAVIAWCKHKRLLD  243
            A+ GVFGMNITIELF+   A MPEFLWT+ GG+ G I LY A IAW K+KRLL+
Sbjct  61   ALVGVFGMNITIELFDHTKARMPEFLWTVAGGTIGTIFLYAAAIAWYKYKRLLE  114



>ref|XP_009111645.1| PREDICTED: magnesium transporter MRS2-3-like isoform X2 [Brassica 
rapa]
Length=453

 Score =   172 bits (436),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 104/175 (59%), Positives = 129/175 (74%), Gaps = 5/175 (3%)
 Frame = -2

Query  761  QSDVNDRVPGEISIEG--NGADPEIDYPMERVNTLGRDSHttrtsttrSAISKHLNVEEL  588
            + D +DR   E+S E    G+D   +  M   + L R+S  T ++ +   ++  LNV+EL
Sbjct  282  EGDEDDRFRAEVSSESCHRGSDAH-NLLMRAHSALSRNSRGTSSTRS--GMTNKLNVQEL  338

Query  587  EMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVMLTAATLvvsaf  408
            EMLLEAYF+QIDGTLNKLSTL EYVDDTEDYINIMLDDKQN+LLQMGVMLT A LV+S F
Sbjct  339  EMLLEAYFVQIDGTLNKLSTLTEYVDDTEDYINIMLDDKQNNLLQMGVMLTTAGLVMSLF  398

Query  407  vavagvfGMNITIELFNPDIAGMPEFLWTIGGGSAGCIILYVAVIAWCKHKRLLD  243
            +AVAGVFGMNI IELFN ++AG  +F+WT+ GG+AG + LY   I W KH RLL+
Sbjct  399  IAVAGVFGMNINIELFNDEVAGPGKFMWTVVGGTAGSLFLYFGAIGWYKHSRLLE  453



>ref|XP_009111637.1| PREDICTED: magnesium transporter MRS2-3-like isoform X1 [Brassica 
rapa]
Length=454

 Score =   172 bits (436),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 104/175 (59%), Positives = 129/175 (74%), Gaps = 5/175 (3%)
 Frame = -2

Query  761  QSDVNDRVPGEISIEG--NGADPEIDYPMERVNTLGRDSHttrtsttrSAISKHLNVEEL  588
            + D +DR   E+S E    G+D   +  M   + L R+S  T ++ +   ++  LNV+EL
Sbjct  283  EGDEDDRFRAEVSSESCHRGSDAH-NLLMRAHSALSRNSRGTSSTRS--GMTNKLNVQEL  339

Query  587  EMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVMLTAATLvvsaf  408
            EMLLEAYF+QIDGTLNKLSTL EYVDDTEDYINIMLDDKQN+LLQMGVMLT A LV+S F
Sbjct  340  EMLLEAYFVQIDGTLNKLSTLTEYVDDTEDYINIMLDDKQNNLLQMGVMLTTAGLVMSLF  399

Query  407  vavagvfGMNITIELFNPDIAGMPEFLWTIGGGSAGCIILYVAVIAWCKHKRLLD  243
            +AVAGVFGMNI IELFN ++AG  +F+WT+ GG+AG + LY   I W KH RLL+
Sbjct  400  IAVAGVFGMNINIELFNDEVAGPGKFMWTVVGGTAGSLFLYFGAIGWYKHSRLLE  454



>ref|XP_007199181.1| hypothetical protein PRUPE_ppa020091mg [Prunus persica]
 gb|EMJ00380.1| hypothetical protein PRUPE_ppa020091mg [Prunus persica]
Length=442

 Score =   171 bits (434),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 93/125 (74%), Positives = 106/125 (85%), Gaps = 1/125 (1%)
 Frame = -2

Query  614  SKHLNVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVMLT  435
            SK L+V+ELEMLLEAYF+QIDG LNKLSTLREYVDDTEDYINIMLDDKQN LLQMGV+L+
Sbjct  318  SKQLDVQELEMLLEAYFVQIDGILNKLSTLREYVDDTEDYINIMLDDKQNQLLQMGVVLS  377

Query  434  AATLvvsafvavagvfGMNITIELFNPDIA-GMPEFLWTIGGGSAGCIILYVAVIAWCKH  258
             ATLVVSA + VAGVFGMN+ I LF  +   GMP+FLWT+GGGS G ++L+V  IAW KH
Sbjct  378  TATLVVSALIVVAGVFGMNVRIALFKEETKIGMPKFLWTVGGGSIGSVVLFVIAIAWYKH  437

Query  257  KRLLD  243
             RLLD
Sbjct  438  SRLLD  442



>ref|XP_008236348.1| PREDICTED: magnesium transporter MRS2-3-like [Prunus mume]
Length=604

 Score =   172 bits (435),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 94/125 (75%), Positives = 106/125 (85%), Gaps = 1/125 (1%)
 Frame = -2

Query  614  SKHLNVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVMLT  435
            SK L+V+ELEMLLEAYF+QIDG LNKLSTLREYVDDTEDYINIMLDDKQN LLQMGV+L+
Sbjct  480  SKQLDVQELEMLLEAYFVQIDGILNKLSTLREYVDDTEDYINIMLDDKQNQLLQMGVVLS  539

Query  434  AATLvvsafvavagvfGMNITIELFNPDIA-GMPEFLWTIGGGSAGCIILYVAVIAWCKH  258
             ATLVVSA + VAGVFGMNI I LF  +   GMP+FLWT+GGGS G ++L+V  IAW KH
Sbjct  540  TATLVVSALIVVAGVFGMNIRIALFEEETKIGMPKFLWTVGGGSIGSVVLFVIAIAWYKH  599

Query  257  KRLLD  243
             RLLD
Sbjct  600  SRLLD  604


 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/31 (77%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = -2

Query  614  SKHLNVEELEMLLEAYFIQIDGTLNKLSTLR  522
            SK L+V+ELEMLLEAYF+QIDG LNKLST +
Sbjct  336  SKQLDVQELEMLLEAYFVQIDGILNKLSTAK  366



>gb|KFK40012.1| hypothetical protein AALP_AA3G318600 [Arabis alpina]
Length=448

 Score =   168 bits (426),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 99/139 (71%), Positives = 112/139 (81%), Gaps = 0/139 (0%)
 Frame = -2

Query  662  GRDSHttrtsttrSAISKHLNVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIM  483
             R+S  T TS+T SA+S   +VEELEMLLEAYF+Q DGTLNKLSTLREYV+DTEDYINIM
Sbjct  309  SRNSRGTHTSSTHSAMSNKYDVEELEMLLEAYFVQFDGTLNKLSTLREYVNDTEDYINIM  368

Query  482  LDDKQNHLLQMGVMLTAATLvvsafvavagvfGMNITIELFNPDIAGMPEFLWTIGGGSA  303
            LDDKQNHLLQMGV L  ATLV++AF+AVAGVFGMNI I LF  D +    F+WT+ GGS 
Sbjct  369  LDDKQNHLLQMGVKLATATLVLNAFIAVAGVFGMNIHINLFVEDKSDPARFVWTVIGGSL  428

Query  302  GCIILYVAVIAWCKHKRLL  246
            GCI LYV  I WCKHK+LL
Sbjct  429  GCIFLYVCAIGWCKHKQLL  447



>emb|CDX95430.1| BnaC01g33220D [Brassica napus]
Length=455

 Score =   168 bits (426),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 91/126 (72%), Positives = 106/126 (84%), Gaps = 0/126 (0%)
 Frame = -2

Query  620  AISKHLNVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVM  441
             ++  LNV+ELEMLLEAYF+QIDGTLNKLSTL+EYVDDTEDYINIMLDDKQN+LLQMGVM
Sbjct  330  GMTNKLNVQELEMLLEAYFVQIDGTLNKLSTLKEYVDDTEDYINIMLDDKQNNLLQMGVM  389

Query  440  LTAATLvvsafvavagvfGMNITIELFNPDIAGMPEFLWTIGGGSAGCIILYVAVIAWCK  261
            LT A LV+S F+AVAGVFGMNI IELFN ++AG   F+WT+ GG+AG + LY   I W K
Sbjct  390  LTTAGLVMSLFIAVAGVFGMNINIELFNDEVAGPGRFIWTVVGGTAGSLFLYFGAIGWYK  449

Query  260  HKRLLD  243
            H RLL+
Sbjct  450  HSRLLE  455



>gb|KFK31826.1| hypothetical protein AALP_AA6G163500 [Arabis alpina]
Length=446

 Score =   166 bits (420),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 101/179 (56%), Positives = 121/179 (68%), Gaps = 12/179 (7%)
 Frame = -2

Query  770  EVMQSDVNDRVPGEISIEGNGADPE----IDYPMERVNTLGRDSHttrtsttrSAISKHL  603
            ++++ D +DR+P E   E N  D       D+      T  R +H+        ++S   
Sbjct  275  DLLEGDEDDRLPPEFVSEANRDDAHDLLMSDHIRNNRGTHTRSTHS--------SMSDKF  326

Query  602  NVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVMLTAATL  423
            NV ELE LLEAYF+QIDGTLNKLS LREYVDDTEDYINIMLDDKQN LLQMGVMLT ATL
Sbjct  327  NVGELERLLEAYFVQIDGTLNKLSILREYVDDTEDYINIMLDDKQNQLLQMGVMLTTATL  386

Query  422  vvsafvavagvfGMNITIELFNPDIAGMPEFLWTIGGGSAGCIILYVAVIAWCKHKRLL  246
            V++A++AVAGVFGMNI IELF    +    F WT+ GGS G + LYV  I WCK+KRLL
Sbjct  387  VINAYIAVAGVFGMNIHIELFENHKSDPTRFFWTVIGGSLGSLFLYVGAIGWCKYKRLL  445



>ref|XP_001786202.1| predicted protein [Physcomitrella patens]
 gb|EDQ48985.1| predicted protein [Physcomitrella patens]
Length=618

 Score =   168 bits (425),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 92/124 (74%), Positives = 106/124 (85%), Gaps = 2/124 (2%)
 Frame = -2

Query  614  SKHLNVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVMLT  435
            +K L+VEELEMLLEAYF+Q+DGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVMLT
Sbjct  497  AKPLDVEELEMLLEAYFVQVDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVMLT  556

Query  434  AATLvvsafvavagvfGMNITIELFNPDIAGMPEFLWTIGGGSAGCIILYVAVIAWCKHK  255
             ATLV+SAF+ V GVFGMNI I LFN  I G P+FL  + G +A C++LY AVI WCK+K
Sbjct  557  TATLVISAFIVVTGVFGMNINIPLFN--IGGTPQFLAIVFGSAAICVVLYFAVIGWCKYK  614

Query  254  RLLD  243
             L++
Sbjct  615  HLIE  618



>ref|XP_004296095.1| PREDICTED: magnesium transporter MRS2-3-like [Fragaria vesca 
subsp. vesca]
Length=452

 Score =   166 bits (419),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 92/125 (74%), Positives = 107/125 (86%), Gaps = 1/125 (1%)
 Frame = -2

Query  614  SKHLNVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVMLT  435
            SK L+VEELEMLLEAYF+QIDGTLN LSTLREYVDDTEDYINIMLDDKQN LLQMGV+L+
Sbjct  328  SKQLDVEELEMLLEAYFVQIDGTLNNLSTLREYVDDTEDYINIMLDDKQNQLLQMGVVLS  387

Query  434  AATLvvsafvavagvfGMNITIELFNPDI-AGMPEFLWTIGGGSAGCIILYVAVIAWCKH  258
             ATLVV+AF+ VAG+FGMNI IELF+ ++  G  +F+WTIGG S GC+ L+V  IAW K+
Sbjct  388  TATLVVNAFIVVAGIFGMNIGIELFDEELKTGNKKFMWTIGGSSMGCVFLFVIAIAWGKY  447

Query  257  KRLLD  243
             RLLD
Sbjct  448  MRLLD  452



>emb|CDY42196.1| BnaA01g25990D [Brassica napus]
Length=456

 Score =   165 bits (417),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 90/126 (71%), Positives = 105/126 (83%), Gaps = 0/126 (0%)
 Frame = -2

Query  620  AISKHLNVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVM  441
             ++  LNV+ELEMLLEAYF+QIDG LNKLSTL EYVDDTEDYINIMLDDKQN+LLQMGVM
Sbjct  331  GMTNKLNVQELEMLLEAYFVQIDGILNKLSTLTEYVDDTEDYINIMLDDKQNNLLQMGVM  390

Query  440  LTAATLvvsafvavagvfGMNITIELFNPDIAGMPEFLWTIGGGSAGCIILYVAVIAWCK  261
            LT A LV+S F+AVAGVFGMNI IELFN ++AG  +F+WT+ GG+AG + LY   I W K
Sbjct  391  LTTAGLVMSLFIAVAGVFGMNINIELFNDEVAGPGKFMWTVVGGTAGSLFLYFGAIGWYK  450

Query  260  HKRLLD  243
            H RLL+
Sbjct  451  HSRLLE  456



>ref|XP_002976803.1| hypothetical protein SELMODRAFT_53758, partial [Selaginella moellendorffii]
 gb|EFJ21913.1| hypothetical protein SELMODRAFT_53758, partial [Selaginella moellendorffii]
Length=442

 Score =   163 bits (412),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 86/124 (69%), Positives = 104/124 (84%), Gaps = 2/124 (2%)
 Frame = -2

Query  614  SKHLNVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVMLT  435
             ++L+VEELEMLLEAYF+QIDGTLNKLSTLR+YV+DTEDYINIMLDDKQNHLLQMGVMLT
Sbjct  321  KQNLDVEELEMLLEAYFVQIDGTLNKLSTLRDYVEDTEDYINIMLDDKQNHLLQMGVMLT  380

Query  434  AATLvvsafvavagvfGMNITIELFNPDIAGMPEFLWTIGGGSAGCIILYVAVIAWCKHK  255
             ATLVVS F+ V G+FGMNI I LFN     + +FLW +GG   G +++Y+ VI WC++K
Sbjct  381  TATLVVSGFIVVTGIFGMNIRISLFNE--GTLTQFLWVVGGAGVGALLVYILVIGWCRYK  438

Query  254  RLLD  243
            RLL+
Sbjct  439  RLLE  442



>ref|XP_002980531.1| hypothetical protein SELMODRAFT_53759, partial [Selaginella moellendorffii]
 gb|EFJ18182.1| hypothetical protein SELMODRAFT_53759, partial [Selaginella moellendorffii]
Length=442

 Score =   163 bits (412),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 86/124 (69%), Positives = 104/124 (84%), Gaps = 2/124 (2%)
 Frame = -2

Query  614  SKHLNVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVMLT  435
             ++L+VEELEMLLEAYF+QIDGTLNKLSTLR+YV+DTEDYINIMLDDKQNHLLQMGVMLT
Sbjct  321  KQNLDVEELEMLLEAYFVQIDGTLNKLSTLRDYVEDTEDYINIMLDDKQNHLLQMGVMLT  380

Query  434  AATLvvsafvavagvfGMNITIELFNPDIAGMPEFLWTIGGGSAGCIILYVAVIAWCKHK  255
             ATLVVS F+ V G+FGMNI I LFN     + +FLW +GG   G +++Y+ VI WC++K
Sbjct  381  TATLVVSGFIVVTGIFGMNIRISLFNE--GTLTQFLWVVGGAGVGALLVYILVIGWCRYK  438

Query  254  RLLD  243
            RLL+
Sbjct  439  RLLE  442



>gb|ABR17877.1| unknown [Picea sitchensis]
Length=483

 Score =   163 bits (412),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 88/126 (70%), Positives = 103/126 (82%), Gaps = 2/126 (2%)
 Frame = -2

Query  620  AISKHLNVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVM  441
            A SK  +VE+LEMLLEAYF+Q D TLNKL TLREYV+DTEDYINIMLDDKQNHLLQMGVM
Sbjct  360  ATSKSHDVEDLEMLLEAYFVQTDSTLNKLFTLREYVEDTEDYINIMLDDKQNHLLQMGVM  419

Query  440  LTAATLvvsafvavagvfGMNITIELFNPDIAGMPEFLWTIGGGSAGCIILYVAVIAWCK  261
            +T  TLV+SAF+ V G+FGMNI I LF  D  G+P+FLW +GG  +  I+ Y+ VIAWCK
Sbjct  420  MTTGTLVMSAFLVVTGIFGMNIQISLF--DDGGLPQFLWVVGGTGSCIILAYILVIAWCK  477

Query  260  HKRLLD  243
            HKRLL+
Sbjct  478  HKRLLE  483



>emb|CDY58861.1| BnaCnng33870D [Brassica napus]
Length=730

 Score =   163 bits (413),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 108/180 (60%), Positives = 125/180 (69%), Gaps = 7/180 (4%)
 Frame = -2

Query  770  EVMQSDVNDRVPGEISIEGN-------GADPEIDYPMERVNTLGRDSHttrtsttrSAIS  612
            E +   + + +P E + E N         D   D  M   + L R+S  T TS+TRSA++
Sbjct  273  EKLAQKLENSLPAESASESNRDESYLRANDDAHDLLMSTHSALSRNSRGTHTSSTRSAMT  332

Query  611  KHLNVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVMLTA  432
               +VEELEMLLEAYF+QIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVMLT 
Sbjct  333  NKFDVEELEMLLEAYFVQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVMLTT  392

Query  431  ATLvvsafvavagvfGMNITIELFNPDIAGMPEFLWTIGGGSAGCIILYVAVIAWCKHKR  252
            ATLV+SAF+AVAGVFGMNITIELF  + AG   F WT+ GG  G I LYV  I     +R
Sbjct  393  ATLVMSAFIAVAGVFGMNITIELFKDEKAGPTRFAWTVIGGFIGSIFLYVGAIGNMSSRR  452



>gb|EPS69517.1| hypothetical protein M569_05248, partial [Genlisea aurea]
Length=400

 Score =   153 bits (387),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 81/125 (65%), Positives = 100/125 (80%), Gaps = 0/125 (0%)
 Frame = -2

Query  617  ISKHLNVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVML  438
            I+K LNVEELE+LLEAYF+Q +G L+K+STLREYVDDTEDYINIMLDDKQN LLQMG+ L
Sbjct  276  ITKRLNVEELEILLEAYFVQAEGILSKMSTLREYVDDTEDYINIMLDDKQNQLLQMGITL  335

Query  437  TAATLvvsafvavagvfGMNITIELFNPDIAGMPEFLWTIGGGSAGCIILYVAVIAWCKH  258
            T ATLV++ F+ VAG  GMNI I LFN  + G   F+ TI   SAGC+++++  I+WCKH
Sbjct  336  TTATLVITVFIVVAGAMGMNIRIGLFNNTVDGNKNFILTIVVCSAGCLVMFLMAISWCKH  395

Query  257  KRLLD  243
            K LL+
Sbjct  396  KGLLE  400



>gb|KCW63394.1| hypothetical protein EUGRSUZ_G01039 [Eucalyptus grandis]
Length=416

 Score =   147 bits (370),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 84/122 (69%), Positives = 100/122 (82%), Gaps = 0/122 (0%)
 Frame = -2

Query  620  AISKHLNVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVM  441
            A ++H +V ELEMLLEAYF+Q DGTLNKLSTL EYVDDTEDY+NIMLDDKQN+LLQMGV+
Sbjct  291  APARHSDVAELEMLLEAYFVQADGTLNKLSTLGEYVDDTEDYVNIMLDDKQNNLLQMGVL  350

Query  440  LTAATLvvsafvavagvfGMNITIELFNPDIAGMPEFLWTIGGGSAGCIILYVAVIAWCK  261
            LT A LV+S +VA+AGVFGMNITI L++P      +FLWTIG  S G IILYV ++A  K
Sbjct  351  LTTAILVISMYVAIAGVFGMNITINLWHPPDNSQEDFLWTIGACSIGTIILYVGIVALYK  410

Query  260  HK  255
            +K
Sbjct  411  YK  412



>ref|XP_010065746.1| PREDICTED: magnesium transporter MRS2-3-like isoform X1 [Eucalyptus 
grandis]
Length=457

 Score =   147 bits (371),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 84/122 (69%), Positives = 100/122 (82%), Gaps = 0/122 (0%)
 Frame = -2

Query  620  AISKHLNVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVM  441
            A ++H +V ELEMLLEAYF+Q DGTLNKLSTL EYVDDTEDY+NIMLDDKQN+LLQMGV+
Sbjct  332  APARHSDVAELEMLLEAYFVQADGTLNKLSTLGEYVDDTEDYVNIMLDDKQNNLLQMGVL  391

Query  440  LTAATLvvsafvavagvfGMNITIELFNPDIAGMPEFLWTIGGGSAGCIILYVAVIAWCK  261
            LT A LV+S +VA+AGVFGMNITI L++P      +FLWTIG  S G IILYV ++A  K
Sbjct  392  LTTAILVISMYVAIAGVFGMNITINLWHPPDNSQEDFLWTIGACSIGTIILYVGIVALYK  451

Query  260  HK  255
            +K
Sbjct  452  YK  453



>ref|XP_010065747.1| PREDICTED: magnesium transporter MRS2-3-like isoform X2 [Eucalyptus 
grandis]
Length=454

 Score =   147 bits (370),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 84/122 (69%), Positives = 100/122 (82%), Gaps = 0/122 (0%)
 Frame = -2

Query  620  AISKHLNVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVM  441
            A ++H +V ELEMLLEAYF+Q DGTLNKLSTL EYVDDTEDY+NIMLDDKQN+LLQMGV+
Sbjct  329  APARHSDVAELEMLLEAYFVQADGTLNKLSTLGEYVDDTEDYVNIMLDDKQNNLLQMGVL  388

Query  440  LTAATLvvsafvavagvfGMNITIELFNPDIAGMPEFLWTIGGGSAGCIILYVAVIAWCK  261
            LT A LV+S +VA+AGVFGMNITI L++P      +FLWTIG  S G IILYV ++A  K
Sbjct  389  LTTAILVISMYVAIAGVFGMNITINLWHPPDNSQEDFLWTIGACSIGTIILYVGIVALYK  448

Query  260  HK  255
            +K
Sbjct  449  YK  450



>ref|XP_006847049.1| hypothetical protein AMTR_s00017p00188570 [Amborella trichopoda]
 gb|ERN08630.1| hypothetical protein AMTR_s00017p00188570 [Amborella trichopoda]
Length=441

 Score =   143 bits (361),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 77/123 (63%), Positives = 92/123 (75%), Gaps = 3/123 (2%)
 Frame = -2

Query  614  SKHLNVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVMLT  435
            S  L++ +LEMLLEAYF+QI+GTLNKLSTL+EY+DDTEDYINIMLDDKQN LLQMGVMLT
Sbjct  321  SFKLDIGDLEMLLEAYFVQIEGTLNKLSTLKEYMDDTEDYINIMLDDKQNQLLQMGVMLT  380

Query  434  AATLvvsafvavagvfGMNITIELFNPDIAGMPEFLWTIGGGSAGCIILYVAVIAWCKHK  255
             ATL+    + VAG  GMNI I L++    GMP+F  T  G    C++LY   IAW K +
Sbjct  381  TATLITGFGIVVAGTLGMNIHISLYD---TGMPQFYQTTFGIIGACVVLYFVAIAWGKKR  437

Query  254  RLL  246
            RLL
Sbjct  438  RLL  440



>ref|XP_010912043.1| PREDICTED: magnesium transporter MRS2-F-like [Elaeis guineensis]
Length=437

 Score =   142 bits (357),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 83/119 (70%), Positives = 93/119 (78%), Gaps = 3/119 (3%)
 Frame = -2

Query  602  NVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVMLTAATL  423
            N+EELEMLLEAYF+QIDGTLNKLS LREYVDDTEDYINIMLD+KQN LLQMGVML+ AT+
Sbjct  321  NIEELEMLLEAYFVQIDGTLNKLSHLREYVDDTEDYINIMLDEKQNQLLQMGVMLSTATM  380

Query  422  vvsafvavagvfGMNITIELFNPDIAGMPEFLWTIGGGSAGCIILYVAVIAWCKHKRLL  246
            V++A V V G+FGMNITI+LFN   A   +F  T  G   GCIILYV  I W K   LL
Sbjct  381  VLTAGVVVVGIFGMNITIDLFN---APYIKFWETTCGTIGGCIILYVLAIGWGKKSGLL  436



>ref|XP_006847050.1| hypothetical protein AMTR_s00017p00189670 [Amborella trichopoda]
 gb|ERN08631.1| hypothetical protein AMTR_s00017p00189670 [Amborella trichopoda]
Length=424

 Score =   141 bits (355),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 79/121 (65%), Positives = 91/121 (75%), Gaps = 3/121 (2%)
 Frame = -2

Query  608  HLNVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVMLTAA  429
             L++E+LEMLLEAYF+QIDGTLNKLS LREYVDDTEDYINIMLDDKQN LLQMGVMLT A
Sbjct  306  KLDIEDLEMLLEAYFVQIDGTLNKLSALREYVDDTEDYINIMLDDKQNQLLQMGVMLTTA  365

Query  428  TLvvsafvavagvfGMNITIELFNPDIAGMPEFLWTIGGGSAGCIILYVAVIAWCKHKRL  249
            TL+ +A + V G+FGMNI I LF+   AGM +F+    G    C +LYV  I W K   L
Sbjct  366  TLIANAGIVVVGLFGMNIHISLFD---AGMAQFMQATCGTIGACGVLYVMAIGWGKRNGL  422

Query  248  L  246
            L
Sbjct  423  L  423



>ref|XP_008785924.1| PREDICTED: magnesium transporter MRS2-F-like [Phoenix dactylifera]
Length=382

 Score =   139 bits (350),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 80/119 (67%), Positives = 92/119 (77%), Gaps = 1/119 (1%)
 Frame = -2

Query  602  NVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVMLTAATL  423
            N+EELEMLLEAYF+QIDGTLNKLS LREYVDDTEDYINIMLD+KQN LLQMGVML+ AT+
Sbjct  264  NIEELEMLLEAYFVQIDGTLNKLSHLREYVDDTEDYINIMLDEKQNQLLQMGVMLSTATM  323

Query  422  vvsafvavagvfGMNITIELFNPDIAGMPEFLWTIGGGSAGCIILYVAVIAWCKHKRLL  246
            V++A V V G+FGMNI I+LFN     + +F  T  G   GCI+LYV  I W K   LL
Sbjct  324  VLTAGVVVVGLFGMNIQIDLFNAPAPSI-KFWETTFGTIGGCIVLYVFAIGWGKKSGLL  381



>dbj|BAK02642.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=450

 Score =   138 bits (348),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 92/124 (74%), Gaps = 5/124 (4%)
 Frame = -2

Query  602  NVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVMLTAATL  423
            N+EELEMLLEAYF+QIDGTLNKLS LREYVDDTEDYINIMLDDKQN LLQMGVML+ AT+
Sbjct  326  NIEELEMLLEAYFVQIDGTLNKLSHLREYVDDTEDYINIMLDDKQNQLLQMGVMLSTATV  385

Query  422  vvsafvavagvfGMNITIELFNP-----DIAGMPEFLWTIGGGSAGCIILYVAVIAWCKH  258
            V++A VAV G+FGMNI I L+NP           +F  T  G  AGC ILYV  + W K 
Sbjct  386  VITAGVAVVGLFGMNIGISLYNPVGPEQTHEAHVKFWETTFGTIAGCTILYVVAMGWGKR  445

Query  257  KRLL  246
              LL
Sbjct  446  SGLL  449



>emb|CDM85537.1| unnamed protein product [Triticum aestivum]
Length=449

 Score =   138 bits (347),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 92/124 (74%), Gaps = 5/124 (4%)
 Frame = -2

Query  602  NVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVMLTAATL  423
            N+EELEMLLEAYF+QIDGTLNKLS LREYVDDTEDYINIMLDDKQN LLQMGVML+ AT+
Sbjct  325  NIEELEMLLEAYFVQIDGTLNKLSHLREYVDDTEDYINIMLDDKQNQLLQMGVMLSTATV  384

Query  422  vvsafvavagvfGMNITIELFNP-----DIAGMPEFLWTIGGGSAGCIILYVAVIAWCKH  258
            V++A VAV G+FGMNI I L+ P       A   +F  T  G  AGC ILYV  + W K 
Sbjct  385  VITAGVAVVGLFGMNIGISLYTPVGEEQTRAAHVKFWETTFGTIAGCTILYVIAMGWGKR  444

Query  257  KRLL  246
              LL
Sbjct  445  SGLL  448



>ref|XP_010232712.1| PREDICTED: magnesium transporter MRS2-F-like [Brachypodium distachyon]
Length=455

 Score =   137 bits (344),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 80/124 (65%), Positives = 92/124 (74%), Gaps = 5/124 (4%)
 Frame = -2

Query  602  NVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVMLTAATL  423
            ++EELEMLLEAYF+QIDGTLNKLS LREYVDDTEDYINIMLDDKQN LLQMGVML+ AT+
Sbjct  331  DIEELEMLLEAYFVQIDGTLNKLSHLREYVDDTEDYINIMLDDKQNQLLQMGVMLSTATV  390

Query  422  vvsafvavagvfGMNITIELFNPDI----AGMPEFLW-TIGGGSAGCIILYVAVIAWCKH  258
            V++A VAV G+FGMNI I L+NP+     A      W T  G   GC ILY+  + W K 
Sbjct  391  VITAGVAVVGLFGMNIGISLYNPETPEEKAAANVMFWETTWGTVVGCAILYIVAMGWGKR  450

Query  257  KRLL  246
              LL
Sbjct  451  SGLL  454



>ref|XP_008674680.1| PREDICTED: magnesium transporter MRS2-F isoform X2 [Zea mays]
Length=360

 Score =   135 bits (340),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 81/125 (65%), Positives = 94/125 (75%), Gaps = 6/125 (5%)
 Frame = -2

Query  602  NVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVMLTAATL  423
            N+EELEMLLEAYF+QIDGTLNKLS LREYVDDTEDYINIMLDDKQN LLQMGVML+ AT+
Sbjct  235  NIEELEMLLEAYFVQIDGTLNKLSHLREYVDDTEDYINIMLDDKQNQLLQMGVMLSTATV  294

Query  422  vvsafvavagvfGMNITIELF-NPDI-----AGMPEFLWTIGGGSAGCIILYVAVIAWCK  261
            V++A VAV G+FGMNI I L+ +P       A   +F  T  G  AGC+ILY+  + W K
Sbjct  295  VITAGVAVVGLFGMNIGISLYADPTTEEETRAANRKFWETTFGTVAGCVILYIIAMGWGK  354

Query  260  HKRLL  246
               LL
Sbjct  355  RSGLL  359



>ref|XP_008674679.1| PREDICTED: magnesium transporter MRS2-F isoform X1 [Zea mays]
 tpg|DAA56243.1| TPA: hypothetical protein ZEAMMB73_736343 [Zea mays]
Length=443

 Score =   135 bits (340),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 81/125 (65%), Positives = 94/125 (75%), Gaps = 6/125 (5%)
 Frame = -2

Query  602  NVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVMLTAATL  423
            N+EELEMLLEAYF+QIDGTLNKLS LREYVDDTEDYINIMLDDKQN LLQMGVML+ AT+
Sbjct  318  NIEELEMLLEAYFVQIDGTLNKLSHLREYVDDTEDYINIMLDDKQNQLLQMGVMLSTATV  377

Query  422  vvsafvavagvfGMNITIELF-NPDI-----AGMPEFLWTIGGGSAGCIILYVAVIAWCK  261
            V++A VAV G+FGMNI I L+ +P       A   +F  T  G  AGC+ILY+  + W K
Sbjct  378  VITAGVAVVGLFGMNIGISLYADPTTEEETRAANRKFWETTFGTVAGCVILYIIAMGWGK  437

Query  260  HKRLL  246
               LL
Sbjct  438  RSGLL  442



>ref|XP_002458951.1| hypothetical protein SORBIDRAFT_03g043270 [Sorghum bicolor]
 gb|EES04071.1| hypothetical protein SORBIDRAFT_03g043270 [Sorghum bicolor]
Length=443

 Score =   135 bits (340),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 81/125 (65%), Positives = 94/125 (75%), Gaps = 6/125 (5%)
 Frame = -2

Query  602  NVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVMLTAATL  423
            N+EELEMLLEAYF+QIDGTLNKLS LREYVDDTEDYINIMLDDKQN LLQMGVML+ AT+
Sbjct  318  NIEELEMLLEAYFVQIDGTLNKLSHLREYVDDTEDYINIMLDDKQNQLLQMGVMLSTATV  377

Query  422  vvsafvavagvfGMNITIELF-NPDI-----AGMPEFLWTIGGGSAGCIILYVAVIAWCK  261
            V++A VAV G+FGMNI I L+ +P       A   +F  T  G  AGC+ILY+  + W K
Sbjct  378  VITAGVAVVGLFGMNIGISLYTDPTTEEETRAANRKFWETTFGTVAGCVILYIIAMGWGK  437

Query  260  HKRLL  246
               LL
Sbjct  438  RSGLL  442



>ref|NP_001142108.1| hypothetical protein [Zea mays]
 gb|ACF87654.1| unknown [Zea mays]
 gb|ACN35773.1| unknown [Zea mays]
 gb|AFW84240.1| hypothetical protein ZEAMMB73_119664 [Zea mays]
Length=443

 Score =   135 bits (340),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 81/125 (65%), Positives = 94/125 (75%), Gaps = 6/125 (5%)
 Frame = -2

Query  602  NVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVMLTAATL  423
            N+EELEMLLEAYF+QIDGTLNKLS LREYVDDTEDYINIMLDDKQN LLQMGVML+ AT+
Sbjct  318  NIEELEMLLEAYFVQIDGTLNKLSHLREYVDDTEDYINIMLDDKQNQLLQMGVMLSTATV  377

Query  422  vvsafvavagvfGMNITIELF-NPDI-----AGMPEFLWTIGGGSAGCIILYVAVIAWCK  261
            V++A VAV G+FGMNI I L+ +P       A   +F  T  G  AGC+ILY+  + W K
Sbjct  378  VITAGVAVVGLFGMNIGISLYADPTTEEETRAANRKFWETTFGTVAGCVILYIIAMGWGK  437

Query  260  HKRLL  246
               LL
Sbjct  438  RSGLL  442



>ref|XP_004970981.1| PREDICTED: magnesium transporter MRS2-F-like [Setaria italica]
Length=442

 Score =   134 bits (338),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 79/125 (63%), Positives = 92/125 (74%), Gaps = 6/125 (5%)
 Frame = -2

Query  602  NVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVMLTAATL  423
            ++EELEMLLEAYF+QIDGTLNKLS LREYVDDTEDYINIMLDDKQN LLQMGVML+ AT+
Sbjct  317  HIEELEMLLEAYFVQIDGTLNKLSHLREYVDDTEDYINIMLDDKQNQLLQMGVMLSTATV  376

Query  422  vvsafvavagvfGMNITIELFNPDI------AGMPEFLWTIGGGSAGCIILYVAVIAWCK  261
            V++A VAV G+FGMNI I L+          A   +F  T  G  AGC+ILY+  + W K
Sbjct  377  VITAGVAVVGLFGMNIGISLYTTPTTAEETRAANVKFWETTSGTVAGCVILYIIAMGWGK  436

Query  260  HKRLL  246
               LL
Sbjct  437  RSGLL  441



>ref|XP_002310545.2| hypothetical protein POPTR_0007s04900g [Populus trichocarpa]
 gb|EEE90995.2| hypothetical protein POPTR_0007s04900g [Populus trichocarpa]
Length=413

 Score =   132 bits (333),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 75/124 (60%), Positives = 92/124 (74%), Gaps = 5/124 (4%)
 Frame = -2

Query  614  SKHLNVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVMLT  435
            S   NVEELEMLLEAYF QIDGTL KLS +R+YVDDTED+INIMLDDKQN LLQMGVML 
Sbjct  292  SSKPNVEELEMLLEAYFAQIDGTLQKLSHMRDYVDDTEDFINIMLDDKQNQLLQMGVMLG  351

Query  434  AATLvvsafvavagvfGMNITIELFNPDIAGMP-EFLWTIGGGSAGCIILYVAVIAWCKH  258
            AA ++++A + V G+FGMNI IELF+    G P +FL  + G   GC+ L++  + W K 
Sbjct  352  AANMILNAGIVVVGLFGMNIHIELFD----GKPIQFLEAVIGACGGCVALFIVALGWGKK  407

Query  257  KRLL  246
            K +L
Sbjct  408  KNIL  411



>ref|XP_006369727.1| hypothetical protein POPTR_0001s29930g [Populus trichocarpa]
 gb|ERP66296.1| hypothetical protein POPTR_0001s29930g [Populus trichocarpa]
Length=100

 Score =   124 bits (312),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 69/95 (73%), Positives = 77/95 (81%), Gaps = 0/95 (0%)
 Frame = -2

Query  527  LREYVDDTEDYINIMLDDKQNHLLQMGVMLTAATLvvsafvavagvfGMNITIELFNPDI  348
            L EYVDDTEDYINIMLDDKQNHLLQMGV+LT ATLVVS FV V GVFGMN  I++F    
Sbjct  5    LMEYVDDTEDYINIMLDDKQNHLLQMGVVLTTATLVVSCFVVVVGVFGMNFGIKMFKEVQ  64

Query  347  AGMPEFLWTIGGGSAGCIILYVAVIAWCKHKRLLD  243
            AGM +FLWT+ GG+ G + LYV  IAWCKH+RLLD
Sbjct  65   AGMSKFLWTVAGGTTGSMFLYVIAIAWCKHRRLLD  99



>ref|XP_010232713.1| PREDICTED: magnesium transporter MRS2-F-like [Brachypodium distachyon]
Length=452

 Score =   132 bits (332),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 80/124 (65%), Positives = 91/124 (73%), Gaps = 5/124 (4%)
 Frame = -2

Query  602  NVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVMLTAATL  423
            N+EELEMLLEAYF+QIDGTLNKLS LREYVDDTEDYINIMLDDKQN LLQMGVML+ AT+
Sbjct  328  NIEELEMLLEAYFVQIDGTLNKLSHLREYVDDTEDYINIMLDDKQNQLLQMGVMLSTATV  387

Query  422  vvsafvavagvfGMNITIELFNPDI-----AGMPEFLWTIGGGSAGCIILYVAVIAWCKH  258
            V++A VAV G+FGMNI I L+NP+      A    F  T  G  A C ILY+  +   K 
Sbjct  388  VITAGVAVVGLFGMNIGISLYNPETPEEKQAANVMFWETACGTIASCAILYIVAMVLGKR  447

Query  257  KRLL  246
              LL
Sbjct  448  SGLL  451



>emb|CDP20392.1| unnamed protein product [Coffea canephora]
Length=454

 Score =   132 bits (331),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 77/123 (63%), Positives = 94/123 (76%), Gaps = 0/123 (0%)
 Frame = -2

Query  614  SKHLNVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVMLT  435
            SK L+V +LEMLLEAYFIQIDGTLNKLSTLRE++DDTEDY+NI+ DDK+N LLQM VM+ 
Sbjct  332  SKQLHVGDLEMLLEAYFIQIDGTLNKLSTLREHIDDTEDYVNIVQDDKRNQLLQMVVMIM  391

Query  434  AATLvvsafvavagvfGMNITIELFNPDIAGMPEFLWTIGGGSAGCIILYVAVIAWCKHK  255
             ATLV+  F+ V G+FGMNI I+ +    +G   FL  IGGG AG ++LY   IA  +HK
Sbjct  392  TATLVLGVFITVEGIFGMNIHIDAWGDRESGTQNFLRMIGGGIAGTLLLYGVAIACYRHK  451

Query  254  RLL  246
            RLL
Sbjct  452  RLL  454



>ref|XP_011022848.1| PREDICTED: magnesium transporter MRS2-F-like [Populus euphratica]
Length=413

 Score =   131 bits (330),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 74/120 (62%), Positives = 91/120 (76%), Gaps = 5/120 (4%)
 Frame = -2

Query  602  NVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVMLTAATL  423
            NVEELEMLLEAYF QIDGTL KLS +R+YVDDTED+INIMLDDKQN LLQMGVML AA +
Sbjct  296  NVEELEMLLEAYFAQIDGTLQKLSHMRDYVDDTEDFINIMLDDKQNQLLQMGVMLGAANM  355

Query  422  vvsafvavagvfGMNITIELFNPDIAGMP-EFLWTIGGGSAGCIILYVAVIAWCKHKRLL  246
            +++A + V G+FGMNI IELF+    G P +FL  + G   GC+ L++  + W K K +L
Sbjct  356  ILNAGIVVVGLFGMNIHIELFD----GKPIQFLEAVIGACGGCVALFIVALRWGKKKNIL  411



>ref|XP_010242772.1| PREDICTED: magnesium transporter MRS2-F-like isoform X2 [Nelumbo 
nucifera]
Length=301

 Score =   129 bits (324),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 73/120 (61%), Positives = 88/120 (73%), Gaps = 5/120 (4%)
 Frame = -2

Query  602  NVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVMLTAATL  423
            N+EELEMLLEAYF QIDG LNKLST+REYVDDTEDY+NIMLDDKQN LLQMGV+L+ A +
Sbjct  185  NIEELEMLLEAYFAQIDGVLNKLSTMREYVDDTEDYVNIMLDDKQNQLLQMGVILSTANM  244

Query  422  vvsafvavagvfGMNITIELFNPDIAGMPEFLW-TIGGGSAGCIILYVAVIAWCKHKRLL  246
            V++  + + G+FGMNI I LF+    G P+  W T  G   GC+ LY+    W K K LL
Sbjct  245  VLNIGIVIVGLFGMNIHIALFD----GEPKQFWETTFGTIGGCVALYLIAFRWGKTKGLL  300



>ref|XP_010027558.1| PREDICTED: magnesium transporter MRS2-F-like [Eucalyptus grandis]
Length=144

 Score =   125 bits (313),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 74/123 (60%), Positives = 92/123 (75%), Gaps = 3/123 (2%)
 Frame = -2

Query  614  SKHLNVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVMLT  435
            S   N+EELEMLLEAYF+QIDGTL KLS + +YVDDTED INIMLDDKQN LLQMGVML+
Sbjct  23   SYKPNIEELEMLLEAYFVQIDGTLQKLSDMNDYVDDTEDCINIMLDDKQNQLLQMGVMLS  82

Query  434  AATLvvsafvavagvfGMNITIELFNPDIAGMPEFLWTIGGGSAGCIILYVAVIAWCKHK  255
            AAT++V+A +AV G FGMNI I+LF+   A   +F  T+ G   GC++LY+    W   +
Sbjct  83   AATMIVNAGIAVVGFFGMNIEIDLFS---APYIKFWETVIGTVGGCVVLYLIFFGWGMKR  139

Query  254  RLL  246
            +LL
Sbjct  140  KLL  142



>ref|XP_009385103.1| PREDICTED: magnesium transporter MRS2-F-like [Musa acuminata 
subsp. malaccensis]
Length=444

 Score =   130 bits (328),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 77/119 (65%), Positives = 90/119 (76%), Gaps = 3/119 (3%)
 Frame = -2

Query  602  NVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVMLTAATL  423
            N+EELEMLLEAYF+QIDGTLNKL  LREYVDDTEDYINIMLD+KQN LLQMGVML+ AT+
Sbjct  328  NIEELEMLLEAYFVQIDGTLNKLYHLREYVDDTEDYINIMLDEKQNQLLQMGVMLSTATV  387

Query  422  vvsafvavagvfGMNITIELFNPDIAGMPEFLWTIGGGSAGCIILYVAVIAWCKHKRLL  246
            V +A V + G+FGMNI I+L+N   A   +F  T  G   GC+ILYV  I + K   LL
Sbjct  388  VTTAGVVLVGLFGMNIGIDLYN---APYHKFWETTWGTIVGCVILYVLAIGFGKKSGLL  443



>ref|NP_001045144.2| Os01g0908500 [Oryza sativa Japonica Group]
 dbj|BAF07058.2| Os01g0908500 [Oryza sativa Japonica Group]
Length=314

 Score =   129 bits (323),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 78/125 (62%), Positives = 93/125 (74%), Gaps = 6/125 (5%)
 Frame = -2

Query  602  NVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVMLTAATL  423
            ++EELEMLLEAYF+QIDGTLNKLS LREYVDDTEDYINIMLDDKQN LLQMGVML+ AT+
Sbjct  189  HIEELEMLLEAYFVQIDGTLNKLSHLREYVDDTEDYINIMLDDKQNQLLQMGVMLSTATV  248

Query  422  vvsafvavagvfGMNITIELF-NP-----DIAGMPEFLWTIGGGSAGCIILYVAVIAWCK  261
            V++A VAV G+FGMNI I L+ +P       A   +F  T  G  AGC ++Y+  + W K
Sbjct  249  VITAGVAVVGLFGMNIGISLYADPTNEEEKRASNMKFWETTLGTIAGCTVMYIVAMGWGK  308

Query  260  HKRLL  246
               LL
Sbjct  309  RSGLL  313



>gb|EPS72108.1| hypothetical protein M569_02647 [Genlisea aurea]
Length=893

 Score =   133 bits (334),  Expect = 3e-31, Method: Composition-based stats.
 Identities = 76/112 (68%), Positives = 93/112 (83%), Gaps = 0/112 (0%)
 Frame = -2

Query  605  LNVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVMLTAAT  426
             +VEELEMLLEAYF+Q +GTLNKLS LREYVDDTEDY+NIMLDDKQN+LL+MGV+L  AT
Sbjct  365  FDVEELEMLLEAYFVQTEGTLNKLSNLREYVDDTEDYVNIMLDDKQNNLLRMGVLLMTAT  424

Query  425  LvvsafvavagvfGMNITIELFNPDIAGMPEFLWTIGGGSAGCIILYVAVIA  270
            LV+SAFVA+ GVFGMNI IELF  +  GM  F++T+ GG  G ++LY++  A
Sbjct  425  LVLSAFVALVGVFGMNIKIELFMDEEHGMVRFVFTVAGGFIGTVLLYLSAFA  476



>ref|XP_006646586.1| PREDICTED: magnesium transporter MRS2-F-like [Oryza brachyantha]
Length=432

 Score =   130 bits (326),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 78/125 (62%), Positives = 91/125 (73%), Gaps = 6/125 (5%)
 Frame = -2

Query  602  NVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVMLTAATL  423
            ++EELEMLLEAYF+QIDGTLNKLS LREYVDDTEDYINIMLDDKQN LLQMGVML+ AT+
Sbjct  307  HIEELEMLLEAYFVQIDGTLNKLSHLREYVDDTEDYINIMLDDKQNQLLQMGVMLSTATV  366

Query  422  vvsafvavagvfGMNITIELF------NPDIAGMPEFLWTIGGGSAGCIILYVAVIAWCK  261
            V++A VAV G+FGMNI I L+      +   A    F  T  G  AGC I+Y+  + W K
Sbjct  367  VITAGVAVVGIFGMNIGISLYTDPTNDDEKRASNMRFWETTLGTIAGCTIMYIVAMGWGK  426

Query  260  HKRLL  246
               LL
Sbjct  427  RSGLL  431



>ref|XP_010242771.1| PREDICTED: magnesium transporter MRS2-F-like isoform X1 [Nelumbo 
nucifera]
Length=449

 Score =   130 bits (326),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 73/120 (61%), Positives = 88/120 (73%), Gaps = 5/120 (4%)
 Frame = -2

Query  602  NVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVMLTAATL  423
            N+EELEMLLEAYF QIDG LNKLST+REYVDDTEDY+NIMLDDKQN LLQMGV+L+ A +
Sbjct  333  NIEELEMLLEAYFAQIDGVLNKLSTMREYVDDTEDYVNIMLDDKQNQLLQMGVILSTANM  392

Query  422  vvsafvavagvfGMNITIELFNPDIAGMPEFLW-TIGGGSAGCIILYVAVIAWCKHKRLL  246
            V++  + + G+FGMNI I LF+    G P+  W T  G   GC+ LY+    W K K LL
Sbjct  393  VLNIGIVIVGLFGMNIHIALFD----GEPKQFWETTFGTIGGCVALYLIAFRWGKTKGLL  448



>gb|KEH44009.1| magnesium transporter 2 [Medicago truncatula]
Length=419

 Score =   129 bits (325),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 89/185 (48%), Positives = 120/185 (65%), Gaps = 7/185 (4%)
 Frame = -2

Query  797  NEQEDGMDDEVMQSDVNDRVPGEISIEGNGADPEIDYPMERVNTLGRDSHttrtsttrSA  618
            N  +D M + V+Q ++ DR   EIS+E  G D   D+  +  N +G +   T+  T  S 
Sbjct  242  NNGDDMMMNRVLQPNIVDRTGHEISLE-RGGDSTCDHG-DYENVVGEEISGTQAGTVYSG  299

Query  617  ISKHLNVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVML  438
            ++   NV ELEMLL AYF+QI GT+NK+S L +YV+DTEDYINI LDD QN +LQ GV +
Sbjct  300  VT---NVSELEMLLGAYFVQIGGTVNKISALSDYVEDTEDYINITLDDNQNRILQTGVQI  356

Query  437  TAATLvvsafvavagvfGMNITIELFNPDIAGMPEFLWTIGGGSAGCIILYVAVIAWCKH  258
              A+++++ FVAV GVFGMNI I+LF  D  GM EFL TI G +  C+ILY   + W K 
Sbjct  357  GTASVILNCFVAVTGVFGMNIHIQLF--DDGGMKEFLGTIFGCTGACVILYFLAMLWYKK  414

Query  257  KRLLD  243
             R+L+
Sbjct  415  MRMLE  419



>gb|KCW54115.1| hypothetical protein EUGRSUZ_I000931, partial [Eucalyptus grandis]
Length=247

 Score =   126 bits (317),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 83/157 (53%), Positives = 103/157 (66%), Gaps = 10/157 (6%)
 Frame = -2

Query  716  GNGADPEIDYPMERVNTLGRDSHttrtsttrSAISKHLNVEELEMLLEAYFIQIDGTLNK  537
            GN A PEID      +    D +      T    S   N+EELEMLLEAYF+QIDGTL K
Sbjct  99   GNAA-PEID------DERAEDYNEEDELDTVVLTSYKPNIEELEMLLEAYFVQIDGTLQK  151

Query  536  LSTLREYVDDTEDYINIMLDDKQNHLLQMGVMLTAATLvvsafvavagvfGMNITIELFN  357
            LS + +YVDDTED INIMLDDKQN LLQMGVML+AAT++V+A +AV G FGMNI I+LF+
Sbjct  152  LSDMNDYVDDTEDCINIMLDDKQNQLLQMGVMLSAATMIVNAGIAVVGFFGMNIEIDLFS  211

Query  356  PDIAGMPEFLWTIGGGSAGCIILYVAVIAWCKHKRLL  246
               A   +F  T+ G   GC++LY+    W   ++LL
Sbjct  212  ---APYIKFWETVIGTVGGCVVLYLIFFGWGMKRKLL  245



>gb|KCW54114.1| hypothetical protein EUGRSUZ_I000931, partial [Eucalyptus grandis]
Length=290

 Score =   127 bits (318),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 83/157 (53%), Positives = 103/157 (66%), Gaps = 10/157 (6%)
 Frame = -2

Query  716  GNGADPEIDYPMERVNTLGRDSHttrtsttrSAISKHLNVEELEMLLEAYFIQIDGTLNK  537
            GN A PEID      +    D +      T    S   N+EELEMLLEAYF+QIDGTL K
Sbjct  142  GNAA-PEID------DERAEDYNEEDELDTVVLTSYKPNIEELEMLLEAYFVQIDGTLQK  194

Query  536  LSTLREYVDDTEDYINIMLDDKQNHLLQMGVMLTAATLvvsafvavagvfGMNITIELFN  357
            LS + +YVDDTED INIMLDDKQN LLQMGVML+AAT++V+A +AV G FGMNI I+LF+
Sbjct  195  LSDMNDYVDDTEDCINIMLDDKQNQLLQMGVMLSAATMIVNAGIAVVGFFGMNIEIDLFS  254

Query  356  PDIAGMPEFLWTIGGGSAGCIILYVAVIAWCKHKRLL  246
               A   +F  T+ G   GC++LY+    W   ++LL
Sbjct  255  ---APYIKFWETVIGTVGGCVVLYLIFFGWGMKRKLL  288



>sp|Q8L4S2.1|MRS2F_ORYSJ RecName: Full=Magnesium transporter MRS2-F [Oryza sativa Japonica 
Group]
 sp|A2WY50.1|MRS2F_ORYSI RecName: Full=Magnesium transporter MRS2-F [Oryza sativa Indica 
Group]
 dbj|BAB92573.1| P0497A05.17 [Oryza sativa Japonica Group]
 dbj|BAB92606.1| putative MRS2-7 [Oryza sativa Japonica Group]
 dbj|BAD82756.1| putative MRS2-7 [Oryza sativa Japonica Group]
 gb|EAY76896.1| hypothetical protein OsI_04855 [Oryza sativa Indica Group]
 gb|EAZ14556.1| hypothetical protein OsJ_04478 [Oryza sativa Japonica Group]
 dbj|BAH00210.1| unnamed protein product [Oryza sativa Japonica Group]
Length=444

 Score =   129 bits (323),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 78/125 (62%), Positives = 93/125 (74%), Gaps = 6/125 (5%)
 Frame = -2

Query  602  NVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVMLTAATL  423
            ++EELEMLLEAYF+QIDGTLNKLS LREYVDDTEDYINIMLDDKQN LLQMGVML+ AT+
Sbjct  319  HIEELEMLLEAYFVQIDGTLNKLSHLREYVDDTEDYINIMLDDKQNQLLQMGVMLSTATV  378

Query  422  vvsafvavagvfGMNITIELF-NP-----DIAGMPEFLWTIGGGSAGCIILYVAVIAWCK  261
            V++A VAV G+FGMNI I L+ +P       A   +F  T  G  AGC ++Y+  + W K
Sbjct  379  VITAGVAVVGLFGMNIGISLYADPTNEEEKRASNMKFWETTLGTIAGCTVMYIVAMGWGK  438

Query  260  HKRLL  246
               LL
Sbjct  439  RSGLL  443



>ref|XP_010242791.1| PREDICTED: magnesium transporter MRS2-F-like [Nelumbo nucifera]
Length=432

 Score =   128 bits (322),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 74/119 (62%), Positives = 90/119 (76%), Gaps = 2/119 (2%)
 Frame = -2

Query  602  NVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVMLTAATL  423
            N+E+LEMLLEAYF+QI+GTLNKLST+R+YVDDTEDYINIMLDDKQN LLQMGV+L+ ATL
Sbjct  315  NIEDLEMLLEAYFVQIEGTLNKLSTMRDYVDDTEDYINIMLDDKQNQLLQMGVVLSTATL  374

Query  422  vvsafvavagvfGMNITIELFNPDIAGMPEFLWTIGGGSAGCIILYVAVIAWCKHKRLL  246
            + SA + V G+FGMNI I LF  +  G   F  T  G   GC++LYV  I   K + L+
Sbjct  375  LFSAGIVVVGLFGMNIKISLFKTE--GSTAFWETTIGTLGGCLVLYVIAIHLGKKRGLI  431



>gb|KCW63395.1| hypothetical protein EUGRSUZ_G01040, partial [Eucalyptus grandis]
Length=430

 Score =   128 bits (322),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 71/123 (58%), Positives = 94/123 (76%), Gaps = 0/123 (0%)
 Frame = -2

Query  614  SKHLNVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVMLT  435
            SKHL+V ELEMLLEAYF+Q+DGTLN+LS L EY+ DTEDY+NIMLDDKQN+LLQMGV+++
Sbjct  308  SKHLDVAELEMLLEAYFVQLDGTLNELSALSEYIQDTEDYVNIMLDDKQNNLLQMGVVIS  367

Query  434  AATLvvsafvavagvfGMNITIELFNPDIAGMPEFLWTIGGGSAGCIILYVAVIAWCKHK  255
             AT+ ++ F+ V G+FGMN+ I LF      +  F+WT+ G + G I+LY   I   K+K
Sbjct  368  TATIFITMFIVVTGIFGMNVKIWLFLNPNPNINNFIWTVSGCTFGTIVLYAIAITLFKYK  427

Query  254  RLL  246
            RL+
Sbjct  428  RLI  430



>ref|XP_010065748.1| PREDICTED: magnesium transporter MRS2-3-like [Eucalyptus grandis]
Length=473

 Score =   127 bits (320),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 71/123 (58%), Positives = 94/123 (76%), Gaps = 0/123 (0%)
 Frame = -2

Query  614  SKHLNVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVMLT  435
            SKHL+V ELEMLLEAYF+Q+DGTLN+LS L EY+ DTEDY+NIMLDDKQN+LLQMGV+++
Sbjct  351  SKHLDVAELEMLLEAYFVQLDGTLNELSALSEYIQDTEDYVNIMLDDKQNNLLQMGVVIS  410

Query  434  AATLvvsafvavagvfGMNITIELFNPDIAGMPEFLWTIGGGSAGCIILYVAVIAWCKHK  255
             AT+ ++ F+ V G+FGMN+ I LF      +  F+WT+ G + G I+LY   I   K+K
Sbjct  411  TATIFITMFIVVTGIFGMNVKIWLFLNPNPNINNFIWTVSGCTFGTIVLYAIAITLFKYK  470

Query  254  RLL  246
            RL+
Sbjct  471  RLI  473



>ref|XP_009402632.1| PREDICTED: magnesium transporter MRS2-F-like [Musa acuminata 
subsp. malaccensis]
Length=446

 Score =   127 bits (319),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 79/119 (66%), Positives = 91/119 (76%), Gaps = 3/119 (3%)
 Frame = -2

Query  602  NVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVMLTAATL  423
            N+EELEMLLEAYF+QIDGTLNKLS LREYVDDTEDYINIMLD+KQN LLQMGVML+ AT+
Sbjct  330  NIEELEMLLEAYFVQIDGTLNKLSHLREYVDDTEDYINIMLDEKQNQLLQMGVMLSTATV  389

Query  422  vvsafvavagvfGMNITIELFNPDIAGMPEFLWTIGGGSAGCIILYVAVIAWCKHKRLL  246
            V +A V V G+FGMNI I+L+N   A   +F  T  G   GC+ILYV  I + K   LL
Sbjct  390  VTTAGVVVVGLFGMNIGIDLYN---APYRKFWETTLGTIIGCVILYVLAIGFGKKSGLL  445



>ref|XP_010027528.1| PREDICTED: magnesium transporter MRS2-F-like [Eucalyptus grandis]
Length=411

 Score =   127 bits (318),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 83/163 (51%), Positives = 104/163 (64%), Gaps = 9/163 (6%)
 Frame = -2

Query  734  GEISIEGNGADPEIDYPMERVNTLGRDSHttrtsttrSAISKHLNVEELEMLLEAYFIQI  555
              I  E + A PEID      +    D +      T    S   N+EELEMLLEAYF+QI
Sbjct  256  ASIREEVDNAAPEID------DERAEDYNEEDELDTVVLTSYKPNIEELEMLLEAYFVQI  309

Query  554  DGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVMLTAATLvvsafvavagvfGMNI  375
            DGTL KLS + +YVDDTED INIMLDDKQN LLQMGVML+AAT++V+A +AV G FGMNI
Sbjct  310  DGTLQKLSDMNDYVDDTEDCINIMLDDKQNQLLQMGVMLSAATMIVNAGIAVVGFFGMNI  369

Query  374  TIELFNPDIAGMPEFLWTIGGGSAGCIILYVAVIAWCKHKRLL  246
             I+LF+   A   +F  T+ G   GC++LY+    W   ++LL
Sbjct  370  EIDLFS---APYIKFWETVIGTVGGCVVLYLIFFGWGMKRKLL  409



>ref|XP_004496868.1| PREDICTED: magnesium transporter MRS2-3-like [Cicer arietinum]
Length=394

 Score =   126 bits (317),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 73/120 (61%), Positives = 90/120 (75%), Gaps = 2/120 (2%)
 Frame = -2

Query  602  NVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVMLTAATL  423
            NVEELEM+L AYF+QI GTLNKL  LREYV+DTEDYI+I LDD QN +LQ GV +  A++
Sbjct  277  NVEELEMILGAYFVQIGGTLNKLFALREYVEDTEDYIDITLDDTQNRILQTGVKIGTASV  336

Query  422  vvsafvavagvfGMNITIELFNPDIAGMPEFLWTIGGGSAGCIILYVAVIAWCKHKRLLD  243
            V++ F+ V G+FGMNI I L+  D  GMPEF+  I G +A CIILYV  + W K KRLL+
Sbjct  337  VLNMFINVTGIFGMNIHIGLY--DYGGMPEFIGVIFGCTAVCIILYVFAMVWYKKKRLLE  394



>ref|XP_006847048.1| hypothetical protein AMTR_s00017p00187240 [Amborella trichopoda]
 gb|ERN08629.1| hypothetical protein AMTR_s00017p00187240 [Amborella trichopoda]
Length=441

 Score =   126 bits (316),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 65/122 (53%), Positives = 87/122 (71%), Gaps = 3/122 (2%)
 Frame = -2

Query  608  HLNVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVMLTAA  429
             L++ +LEMLLEAYF+QI+GTLNK+STL+EYVDD EDYI I+LDDKQN LLQM VML  A
Sbjct  323  KLDIGDLEMLLEAYFVQIEGTLNKISTLKEYVDDMEDYIKIILDDKQNQLLQMAVMLMTA  382

Query  428  TLvvsafvavagvfGMNITIELFNPDIAGMPEFLWTIGGGSAGCIILYVAVIAWCKHKRL  249
            TL+V+  +   G+  +NI + LF     G+P+FL    G    C++LY+  I W K++ L
Sbjct  383  TLIVTGAIVAVGMLSINIHVPLFE---TGVPQFLQATFGIFGACVVLYLMAIGWGKNRGL  439

Query  248  LD  243
            L+
Sbjct  440  LE  441



>gb|EPS69518.1| hypothetical protein M569_05249 [Genlisea aurea]
Length=448

 Score =   125 bits (314),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 66/122 (54%), Positives = 88/122 (72%), Gaps = 0/122 (0%)
 Frame = -2

Query  611  KHLNVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVMLTA  432
            +  NVEELEM+L+AYF+Q +G LNK+S LREYV+DTEDYIN++LDDKQN +LQMG++LT+
Sbjct  326  RDANVEELEMILDAYFVQSEGILNKMSALREYVEDTEDYINLILDDKQNQMLQMGILLTS  385

Query  431  ATLvvsafvavagvfGMNITIELFNPDIAGMPEFLWTIGGGSAGCIILYVAVIAWCKHKR  252
            AT+ ++ F  V G FGMNI IE+FN +  G   F  T+   S  C+ +YV  + W K   
Sbjct  386  ATISINVFGLVTGAFGMNIDIEIFNDNANGNKNFGLTVAICSVACLSMYVLAVTWWKRIG  445

Query  251  LL  246
            LL
Sbjct  446  LL  447



>ref|XP_010912044.1| PREDICTED: LOW QUALITY PROTEIN: magnesium transporter MRS2-F-like 
[Elaeis guineensis]
Length=397

 Score =   124 bits (311),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 78/119 (66%), Positives = 90/119 (76%), Gaps = 2/119 (2%)
 Frame = -2

Query  602  NVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVMLTAATL  423
            N++ELEMLLEAYF+QIDGTLNKLS L+EYVDDTEDYINIMLD+KQN LLQMGV LT AT+
Sbjct  280  NIQELEMLLEAYFVQIDGTLNKLSHLKEYVDDTEDYINIMLDEKQNQLLQMGVTLTTATV  339

Query  422  vvsafvavagvfGMNITIELFNPDIAGMPEFLWTIGGGSAGCIILYVAVIAWCKHKRLL  246
            VV+A + V  +FGMNI I LF  D+A   +F  T  G  AGCI+LYV  I   K   LL
Sbjct  340  VVTAGIVVVSIFGMNIGISLF--DVATFSQFWETTFGTIAGCIVLYVLAIGLAKRSGLL  396



>ref|XP_010652955.1| PREDICTED: magnesium transporter MRS2-F-like [Vitis vinifera]
 emb|CBI21632.3| unnamed protein product [Vitis vinifera]
Length=443

 Score =   124 bits (311),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 71/119 (60%), Positives = 86/119 (72%), Gaps = 2/119 (2%)
 Frame = -2

Query  602  NVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVMLTAATL  423
            NVEELEMLLEAYF+Q+DG L KLS + EYV DTED+INIMLDDKQN LLQMGVML+ A +
Sbjct  325  NVEELEMLLEAYFVQVDGILQKLSDMSEYVGDTEDFINIMLDDKQNQLLQMGVMLSTANM  384

Query  422  vvsafvavagvfGMNITIELFNPDIAGMPEFLWTIGGGSAGCIILYVAVIAWCKHKRLL  246
            +++A + V G+FGMNITI LF  D     +FL T  G    C+ LY+    W K K+LL
Sbjct  385  IINAGIVVVGLFGMNITISLF--DGGPSTKFLETTLGTLGSCVALYLIAFVWGKKKKLL  441



>gb|EMT06500.1| Endo-1,3(4)-beta-glucanase 1 [Aegilops tauschii]
Length=1109

 Score =   127 bits (319),  Expect = 5e-29, Method: Composition-based stats.
 Identities = 77/114 (68%), Positives = 87/114 (76%), Gaps = 5/114 (4%)
 Frame = -2

Query  602  NVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVMLTAATL  423
            N+EELEMLLEAYF+QIDGTLNKLS LREYVDDTEDYINIMLDDKQN LLQMGVML+ AT+
Sbjct  291  NIEELEMLLEAYFVQIDGTLNKLSHLREYVDDTEDYINIMLDDKQNQLLQMGVMLSTATV  350

Query  422  vvsafvavagvfGMNITIELFNP-----DIAGMPEFLWTIGGGSAGCIILYVAV  276
            V++A VAV G+FGMNI I L+ P       A   +F  T  G  AGC IL  A+
Sbjct  351  VITAGVAVVGLFGMNIGISLYTPVGEEQTRAAHVKFWETTFGTIAGCTILSTAL  404



>ref|XP_002446494.1| hypothetical protein SORBIDRAFT_06g016880 [Sorghum bicolor]
 gb|EES10822.1| hypothetical protein SORBIDRAFT_06g016880 [Sorghum bicolor]
Length=421

 Score =   123 bits (309),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 70/120 (58%), Positives = 89/120 (74%), Gaps = 4/120 (3%)
 Frame = -2

Query  602  NVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVMLTAATL  423
             ++ELE LLEAYF+Q+DGTLNKLSTLREYVDDTEDYINIMLDDKQN LLQMG++L+ ATL
Sbjct  304  KIDELENLLEAYFVQVDGTLNKLSTLREYVDDTEDYINIMLDDKQNQLLQMGILLSTATL  363

Query  422  vvsafvavagvfGMNITIELFNPDIAGMPEFLWTIGGGSAGCII-LYVAVIAWCKHKRLL  246
            V+S  +A+ GVFGMNITI L+     G+    W + GG  G  + +Y+  + + K   +L
Sbjct  364  VMSCAIAITGVFGMNITIPLYTASTEGV---FWEVTGGIVGATVAIYLVALIFFKRSGIL  420



>ref|XP_010674588.1| PREDICTED: magnesium transporter MRS2-F-like [Beta vulgaris subsp. 
vulgaris]
Length=452

 Score =   122 bits (307),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 72/121 (60%), Positives = 87/121 (72%), Gaps = 5/121 (4%)
 Frame = -2

Query  602  NVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVMLTAATL  423
            NVEELEMLLEAYF Q+DG L KLST+ EYV DTEDYINIMLD KQN LLQMGVML+ A +
Sbjct  335  NVEELEMLLEAYFAQVDGILQKLSTMSEYVRDTEDYINIMLDKKQNKLLQMGVMLSTANM  394

Query  422  vvsafvavagvfGMNITIELFNPDIAGMPEFLWTIGGGSAG-CIILYVAVIAWCKHKRLL  246
            +++A + V G+FGMNI I LF+    G     W    G+ G CIILY+ V++W + K LL
Sbjct  395  IINAGIVVVGIFGMNIHISLFD----GENRQFWETALGTTGSCIILYLLVLSWGRKKYLL  450

Query  245  D  243
             
Sbjct  451  S  451



>tpg|DAA37768.1| TPA: hypothetical protein ZEAMMB73_587233 [Zea mays]
Length=409

 Score =   120 bits (302),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 67/114 (59%), Positives = 87/114 (76%), Gaps = 5/114 (4%)
 Frame = -2

Query  602  NVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVMLTAATL  423
             ++ELE+LLEAYF+Q+DGTLNK+S LREYVDDTEDYINIMLDDKQN LLQMG++L+ ATL
Sbjct  292  KIDELEILLEAYFVQVDGTLNKVSALREYVDDTEDYINIMLDDKQNQLLQMGILLSTATL  351

Query  422  vvsafvavagvfGMNITIELFNPDIAGMPEFLWTIGGGSAGCI--ILYVAVIAW  267
            V+S  +A+ G+FGMNITI L++    G+    W + GG  G    I  VA++ +
Sbjct  352  VMSCAIAITGIFGMNITIPLYDASTEGV---FWQVTGGIVGATAAIYLVALVCY  402



>ref|XP_008671295.1| PREDICTED: putative magnesium transporter MRS2-D [Zea mays]
Length=403

 Score =   120 bits (301),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 67/116 (58%), Positives = 88/116 (76%), Gaps = 5/116 (4%)
 Frame = -2

Query  602  NVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVMLTAATL  423
             ++ELE+LLEAYF+Q+DGTLNK+S LREYVDDTEDYINIMLDDKQN LLQMG++L+ ATL
Sbjct  286  KIDELEILLEAYFVQVDGTLNKVSALREYVDDTEDYINIMLDDKQNQLLQMGILLSTATL  345

Query  422  vvsafvavagvfGMNITIELFNPDIAGMPEFLWTIGGGSAGCI--ILYVAVIAWCK  261
            V+S  +A+ G+FGMNITI L++    G+    W + GG  G    I  VA++ + +
Sbjct  346  VMSCAIAITGIFGMNITIPLYDASTEGV---FWQVTGGIVGATAAIYLVALVCYKR  398



>ref|XP_002310546.2| hypothetical protein POPTR_0007s04910g [Populus trichocarpa]
 gb|EEE90996.2| hypothetical protein POPTR_0007s04910g [Populus trichocarpa]
Length=419

 Score =   120 bits (300),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 68/120 (57%), Positives = 89/120 (74%), Gaps = 5/120 (4%)
 Frame = -2

Query  602  NVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVMLTAATL  423
            ++EELEMLLEAYF QIDG L KLS + EYVDDTED+INIMLDDKQN LLQMGV+L+ A +
Sbjct  302  DIEELEMLLEAYFAQIDGILQKLSGMSEYVDDTEDFINIMLDDKQNQLLQMGVILSTANM  361

Query  422  vvsafvavagvfGMNITIELFNPDIAGMPEFLW-TIGGGSAGCIILYVAVIAWCKHKRLL  246
            +++A +AV G FGMNI + LF+    G P   W T+ G   GCI L++ ++ W K +++L
Sbjct  362  ILNAGIAVVGFFGMNIHVTLFD----GKPIQFWETVIGTCGGCIALFLVLLGWGKREKIL  417



>ref|XP_004970719.1| PREDICTED: magnesium transporter MRS2-E-like isoform X1 [Setaria 
italica]
Length=410

 Score =   119 bits (298),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 74/125 (59%), Positives = 92/125 (74%), Gaps = 6/125 (5%)
 Frame = -2

Query  602  NVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVMLTAATL  423
            ++EELEML+EAYF+QIDGTLNKL  LREYVDDTEDYINIMLD+KQN LLQMGV+LT AT+
Sbjct  285  DIEELEMLVEAYFVQIDGTLNKLYNLREYVDDTEDYINIMLDEKQNQLLQMGVLLTTATV  344

Query  422  vvsafvavagvfGMNITIELF-NPDI---AGMP--EFLWTIGGGSAGCIILYVAVIAWCK  261
            VV+A + V  +FGMNI IEL  +P+    A M   +F  T  G  AGC+ +Y+  I   K
Sbjct  345  VVTAGIVVVSLFGMNIHIELMKDPETDEEARMKNLKFWETTCGTVAGCLAIYLLAIYAGK  404

Query  260  HKRLL  246
              ++L
Sbjct  405  KSKIL  409



>ref|XP_010232616.1| PREDICTED: magnesium transporter MRS2-E-like isoform X1 [Brachypodium 
distachyon]
Length=419

 Score =   119 bits (298),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 74/127 (58%), Positives = 87/127 (69%), Gaps = 10/127 (8%)
 Frame = -2

Query  602  NVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVMLTAATL  423
            N++ELEMLLEAYF+Q+DGTLNKL  LR+YVDDTEDYINIMLD+KQN LLQMGVMLT AT+
Sbjct  294  NIQELEMLLEAYFVQVDGTLNKLCHLRDYVDDTEDYINIMLDEKQNQLLQMGVMLTTATV  353

Query  422  vvsafvavagvfGMNITIELFNPDIAGMPE--------FLWTIGGGSAGCIILYVAVIAW  267
            VV+A + V  +FGMNI IEL   D    PE        F  T  G  AGC  +Y+  I  
Sbjct  354  VVTAGIVVVSLFGMNIQIELM--DDGTTPETKRIKNMKFWETTLGTIAGCAAIYLMAIYA  411

Query  266  CKHKRLL  246
             K  + L
Sbjct  412  GKKSKYL  418



>ref|XP_006492023.1| PREDICTED: magnesium transporter MRS2-F-like [Citrus sinensis]
Length=412

 Score =   119 bits (298),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 71/119 (60%), Positives = 85/119 (71%), Gaps = 3/119 (3%)
 Frame = -2

Query  602  NVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVMLTAATL  423
            NVEELEMLLEAYF QIDG L KLS + EYVDDTED INIMLDD QN LLQMGVML+AA +
Sbjct  295  NVEELEMLLEAYFAQIDGILQKLSDMSEYVDDTEDCINIMLDDTQNQLLQMGVMLSAANM  354

Query  422  vvsafvavagvfGMNITIELFNPDIAGMPEFLWTIGGGSAGCIILYVAVIAWCKHKRLL  246
            +++A + V G+FGMNI I LF+   A   +F  T  G   GC+ LY+  + W K K +L
Sbjct  355  ILNAGIVVVGLFGMNIHITLFD---APTIKFWQTTCGTIGGCLALYLIAVGWGKKKIML  410



>ref|XP_003630576.1| Mitochondrial inner membrane magnesium transporter LPE10 [Medicago 
truncatula]
Length=167

 Score =   114 bits (284),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 67/120 (56%), Positives = 88/120 (73%), Gaps = 5/120 (4%)
 Frame = -2

Query  602  NVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVMLTAATL  423
            +V+ELEMLLEAYF QI+G L KLS+L EYVD+TEDYINIMLDDKQN LLQ+ ++     +
Sbjct  51   DVKELEMLLEAYFAQINGILQKLSSLSEYVDNTEDYINIMLDDKQNQLLQVSIIFNTINM  110

Query  422  vvsafvavagvfGMNITIELFNPDIAGMPEFLW-TIGGGSAGCIILYVAVIAWCKHKRLL  246
            +V+A + V G+FGMNI I+LF+    G P   W TIGG   GC++L++A I + K + LL
Sbjct  111  IVNAGIVVVGLFGMNIHIDLFD----GQPRQFWATIGGTVLGCVLLFLASIWFGKKRYLL  166



>gb|KDO45570.1| hypothetical protein CISIN_1g015133mg [Citrus sinensis]
Length=412

 Score =   117 bits (294),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 70/119 (59%), Positives = 85/119 (71%), Gaps = 3/119 (3%)
 Frame = -2

Query  602  NVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVMLTAATL  423
            NVEELEMLLEAYF QIDG L KLS + EYVDDTED INIMLDD QN LLQMGV+L+AA +
Sbjct  295  NVEELEMLLEAYFAQIDGILQKLSDMSEYVDDTEDCINIMLDDTQNQLLQMGVLLSAANM  354

Query  422  vvsafvavagvfGMNITIELFNPDIAGMPEFLWTIGGGSAGCIILYVAVIAWCKHKRLL  246
            +++A + V G+FGMNI I LF+   A   +F  T  G   GC+ LY+  + W K K +L
Sbjct  355  ILNAGIVVVGLFGMNIHITLFD---APTIKFWQTTCGTIGGCLALYLIAVGWGKKKIML  410



>ref|XP_010526977.1| PREDICTED: magnesium transporter MRS2-F-like [Tarenaya hassleriana]
Length=405

 Score =   117 bits (294),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 69/120 (58%), Positives = 83/120 (69%), Gaps = 5/120 (4%)
 Frame = -2

Query  602  NVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVMLTAATL  423
            N+EELEMLLEAYF QIDG L KLS + E V+DTEDYINIMLDDKQN LLQMGVML+   +
Sbjct  288  NIEELEMLLEAYFAQIDGILQKLSGMSEDVEDTEDYINIMLDDKQNQLLQMGVMLSTGNM  347

Query  422  vvsafvavagvfGMNITIELFNPDIAGMPEFLWTIGGGS-AGCIILYVAVIAWCKHKRLL  246
            +++A + V G+ GMNI I LF+    G P   W    G+  GC+ LY+  I W K K LL
Sbjct  348  ILNAGIVVVGLLGMNIHISLFD----GKPLQFWETALGTIVGCVGLYLVAIGWGKKKNLL  403



>gb|EMT25408.1| Mitochondrial inner membrane magnesium transporter mrs2 [Aegilops 
tauschii]
Length=405

 Score =   117 bits (294),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 71/125 (57%), Positives = 87/125 (70%), Gaps = 6/125 (5%)
 Frame = -2

Query  602  NVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVMLTAATL  423
            +VEELEMLLEAYF+Q DGTLNKL  LR+YVDDTEDYIN+MLD+KQN LLQMGVMLT AT+
Sbjct  280  DVEELEMLLEAYFVQFDGTLNKLCHLRDYVDDTEDYINMMLDEKQNQLLQMGVMLTTATV  339

Query  422  vvsafvavagvfGMNITIEL-FNPDIAGMP-----EFLWTIGGGSAGCIILYVAVIAWCK  261
            V++A + V  +FGMNI IEL  +P+   M      +F  T     AGC  +Y+  I   K
Sbjct  340  VITAGIVVVSLFGMNIHIELTLDPETPEMARIKNRKFWETTWATVAGCAAIYILAIYAGK  399

Query  260  HKRLL  246
              + L
Sbjct  400  KSKYL  404



>ref|NP_001044924.1| Os01g0869200 [Oryza sativa Japonica Group]
 sp|Q8S1N1.1|MRS2E_ORYSJ RecName: Full=Magnesium transporter MRS2-E [Oryza sativa Japonica 
Group]
 sp|A2WXD3.1|MRS2E_ORYSI RecName: Full=Magnesium transporter MRS2-E [Oryza sativa Indica 
Group]
 dbj|BAB89805.1| putative magnesium transporter [Oryza sativa Japonica Group]
 dbj|BAF06838.1| Os01g0869200 [Oryza sativa Japonica Group]
 gb|EAY76629.1| hypothetical protein OsI_04582 [Oryza sativa Indica Group]
 gb|EAZ14294.1| hypothetical protein OsJ_04219 [Oryza sativa Japonica Group]
 dbj|BAM35942.1| Mg transporter [Oryza sativa Japonica Group]
Length=418

 Score =   117 bits (292),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 71/125 (57%), Positives = 88/125 (70%), Gaps = 6/125 (5%)
 Frame = -2

Query  602  NVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVMLTAATL  423
            ++EELEMLLEAYF+QIDGTLN L  +REY DDTEDYINIMLD+KQN LLQMGVMLT AT+
Sbjct  293  DIEELEMLLEAYFVQIDGTLNTLYHIREYADDTEDYINIMLDEKQNQLLQMGVMLTTATV  352

Query  422  vvsafvavagvfGMNITIELFN----PDIAGMP--EFLWTIGGGSAGCIILYVAVIAWCK  261
            VV+A + V  +FGMNI I+L      P++  M    F  T  G  AGCI +Y+  I   +
Sbjct  353  VVTAGIVVVSLFGMNIHIDLMKDPETPEMVRMSNMHFWETTFGTVAGCIAIYLLAIYAGR  412

Query  260  HKRLL  246
              ++L
Sbjct  413  KSKIL  417



>ref|XP_004977994.1| PREDICTED: putative magnesium transporter MRS2-D-like [Setaria 
italica]
Length=406

 Score =   116 bits (291),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 68/116 (59%), Positives = 83/116 (72%), Gaps = 4/116 (3%)
 Frame = -2

Query  602  NVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVMLTAATL  423
             ++ELE+LLE+YF+Q DGTLNKL+TLREYVDDTEDYINIMLD+KQN LLQMG+ML+  TL
Sbjct  290  KIDELEILLESYFVQTDGTLNKLNTLREYVDDTEDYINIMLDEKQNQLLQMGIMLSTGTL  349

Query  422  vvsafvavagvfGMNITIELFNPDIAGMPEFLWTIGGGSAGCIILYVAVIAWCKHK  255
            VVSA +AV GVFGMNITI L++  +       W + GG  G       V   C  +
Sbjct  350  VVSAAIAVTGVFGMNITIPLYDKGVGA----FWQVTGGIVGATAAIYLVALLCYRR  401



>emb|CDM85161.1| unnamed protein product [Triticum aestivum]
Length=405

 Score =   116 bits (291),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 71/125 (57%), Positives = 87/125 (70%), Gaps = 6/125 (5%)
 Frame = -2

Query  602  NVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVMLTAATL  423
            +VEELEMLLEAYF+Q DGTLNKL  LR+YVDDTEDYIN+MLD+KQN LLQMGVMLT AT+
Sbjct  280  DVEELEMLLEAYFVQFDGTLNKLCHLRDYVDDTEDYINMMLDEKQNQLLQMGVMLTTATV  339

Query  422  vvsafvavagvfGMNITIEL-FNPDIAGMP-----EFLWTIGGGSAGCIILYVAVIAWCK  261
            V++A + V  +FGMNI IEL  +P+   M      +F  T     AGC  +Y+  I   K
Sbjct  340  VITAGIVVVSLFGMNIHIELTLDPETPEMARIKNRKFWETTWATVAGCAAIYLLAIYAGK  399

Query  260  HKRLL  246
              + L
Sbjct  400  KSKYL  404



>ref|XP_002456989.1| hypothetical protein SORBIDRAFT_03g046843 [Sorghum bicolor]
 gb|EES02109.1| hypothetical protein SORBIDRAFT_03g046843 [Sorghum bicolor]
Length=122

 Score =   110 bits (275),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 65/112 (58%), Positives = 81/112 (72%), Gaps = 2/112 (2%)
 Frame = -2

Query  602  NVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVMLTAATL  423
             ++ELE LLE YF+QIDGTLNKLSTLREYVDDTEDYINIMLDDKQN LLQMGV+L+  TL
Sbjct  5    KIDELESLLEVYFVQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNQLLQMGVVLSTVTL  64

Query  422  vvsafvavagvfGMNITIELFNPDIAGMPEFLWTIGGGSAGCIILYVAVIAW  267
            +V++ V V  +FG NI I L+   I  +  F   +GG  AG   L++  + +
Sbjct  65   LVTSAVVVTAIFGTNIHITLYR--ITDLNVFWEAVGGTLAGVATLFLGAMLY  114



>ref|XP_006646509.1| PREDICTED: magnesium transporter MRS2-E-like, partial [Oryza 
brachyantha]
Length=387

 Score =   115 bits (289),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 71/125 (57%), Positives = 88/125 (70%), Gaps = 6/125 (5%)
 Frame = -2

Query  602  NVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVMLTAATL  423
            ++EELEMLLEAYF+QIDGTLN L  +REY DDTEDYINIMLD+KQN LLQMGVMLT AT+
Sbjct  262  DIEELEMLLEAYFVQIDGTLNTLYHIREYADDTEDYINIMLDEKQNQLLQMGVMLTTATV  321

Query  422  vvsafvavagvfGMNITIELFN----PDIAGMP--EFLWTIGGGSAGCIILYVAVIAWCK  261
            VV+A + V  +FGMNI I+L      P++A +    F  T  G  A CI +Y+  I   K
Sbjct  322  VVTAGIVVVSLFGMNIHIDLMKDPETPEMARISNMHFWETTLGTVAACITVYLLAIYAGK  381

Query  260  HKRLL  246
              ++L
Sbjct  382  KSKIL  386



>ref|XP_002456702.1| hypothetical protein SORBIDRAFT_03g041080 [Sorghum bicolor]
 gb|EES01822.1| hypothetical protein SORBIDRAFT_03g041080 [Sorghum bicolor]
Length=414

 Score =   115 bits (289),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 72/125 (58%), Positives = 88/125 (70%), Gaps = 6/125 (5%)
 Frame = -2

Query  602  NVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVMLTAATL  423
            +VEELEMLLEAYF+QIDGTLNKL  LREYVDDTEDYINIMLD+KQN LLQMGV+LT AT+
Sbjct  289  DVEELEMLLEAYFVQIDGTLNKLYHLREYVDDTEDYINIMLDEKQNQLLQMGVLLTTATV  348

Query  422  vvsafvavagvfGMNITIELF-NPDIAGMPEF----LWTIGGGSA-GCIILYVAVIAWCK  261
            VV+A + V  +FGMNI IEL  +P+            W    G+  GC+ +Y+  I   K
Sbjct  349  VVTAGIVVVSLFGMNIHIELMKDPETDEQARIKNLNFWEATCGTVFGCLAMYLLAIYAGK  408

Query  260  HKRLL  246
              ++L
Sbjct  409  RSQIL  413



>emb|CDP20394.1| unnamed protein product [Coffea canephora]
Length=403

 Score =   115 bits (288),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 65/125 (52%), Positives = 87/125 (70%), Gaps = 0/125 (0%)
 Frame = -2

Query  620  AISKHLNVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVM  441
            A SK  +V++LEMLLEA+F++ID TLN LSTLREYVDDTEDYI+IMLDDK N+L++M + 
Sbjct  278  ASSKRQSVKDLEMLLEAFFVRIDATLNGLSTLREYVDDTEDYISIMLDDKLNNLMEMVIK  337

Query  440  LTAATLvvsafvavagvfGMNITIELFNPDIAGMPEFLWTIGGGSAGCIILYVAVIAWCK  261
            L  AT+ ++ F+ V  V  +NI I+LFN        FLW I  GS G I +Y+  +   +
Sbjct  338  LMTATVALTCFMIVDAVLAINIHIDLFNDTEPPNKSFLWMICAGSFGTICIYIIAMWLYR  397

Query  260  HKRLL  246
            +K LL
Sbjct  398  YKGLL  402



>ref|XP_008663199.1| PREDICTED: putative magnesium transporter MRS2-D [Zea mays]
Length=453

 Score =   115 bits (287),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 64/98 (65%), Positives = 77/98 (79%), Gaps = 4/98 (4%)
 Frame = -2

Query  602  NVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVMLTAATL  423
             ++ELE LLEAYF+Q DGTLNKLSTLREYVDDTEDYIN+MLDDKQN LLQ+G++L+ ATL
Sbjct  337  KIDELENLLEAYFVQADGTLNKLSTLREYVDDTEDYINVMLDDKQNQLLQVGILLSTATL  396

Query  422  vvsafvavagvfGMNITIELFNPDIAGMPEFLWTIGGG  309
            V+S  +A+ GVFGMNITI L+N          W + GG
Sbjct  397  VMSVAIAITGVFGMNITIPLYNAPTG----VFWQVTGG  430



>ref|XP_006584667.1| PREDICTED: magnesium transporter MRS2-F-like [Glycine max]
Length=417

 Score =   115 bits (287),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 67/121 (55%), Positives = 82/121 (68%), Gaps = 5/121 (4%)
 Frame = -2

Query  605  LNVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVMLTAAT  426
            LNVEELEMLLEAYF Q +G L +L +L EYVDDTEDYIN+MLDDK+N LLQ  ++     
Sbjct  296  LNVEELEMLLEAYFAQTNGILQRLFSLSEYVDDTEDYINMMLDDKRNELLQATIIFNTLN  355

Query  425  LvvsafvavagvfGMNITIELFNPDIAGMPEFLW-TIGGGSAGCIILYVAVIAWCKHKRL  249
            ++++A + V G+FGMNI IELFN    G P   W T GG   GCI+L+     W K K L
Sbjct  356  MILNAGIVVVGLFGMNIQIELFN----GKPRQFWATTGGTFGGCILLFFVFFWWGKKKYL  411

Query  248  L  246
            L
Sbjct  412  L  412



>gb|KHN16925.1| Magnesium transporter MRS2-F [Glycine soja]
Length=411

 Score =   115 bits (287),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 67/121 (55%), Positives = 82/121 (68%), Gaps = 5/121 (4%)
 Frame = -2

Query  605  LNVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVMLTAAT  426
            LNVEELEMLLEAYF Q +G L +L +L EYVDDTEDYIN+MLDDK+N LLQ  ++     
Sbjct  290  LNVEELEMLLEAYFAQTNGILQRLFSLSEYVDDTEDYINMMLDDKRNELLQATIIFNTLN  349

Query  425  LvvsafvavagvfGMNITIELFNPDIAGMPEFLW-TIGGGSAGCIILYVAVIAWCKHKRL  249
            ++++A + V G+FGMNI IELFN    G P   W T GG   GCI+L+     W K K L
Sbjct  350  MILNAGIVVVGLFGMNIQIELFN----GKPRQFWATTGGTFGGCILLFFVFFWWGKKKYL  405

Query  248  L  246
            L
Sbjct  406  L  406



>dbj|BAJ88295.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=406

 Score =   115 bits (287),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 70/125 (56%), Positives = 87/125 (70%), Gaps = 6/125 (5%)
 Frame = -2

Query  602  NVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVMLTAATL  423
            +VEELEMLLEAYF+Q D TLNKL  LR+YVDDTEDYIN+MLD+KQN LLQMGVMLT AT+
Sbjct  281  DVEELEMLLEAYFVQFDSTLNKLCHLRDYVDDTEDYINMMLDEKQNQLLQMGVMLTTATV  340

Query  422  vvsafvavagvfGMNITIELF----NPDIAGMP--EFLWTIGGGSAGCIILYVAVIAWCK  261
            V++A + V  +FGMNI IEL      P++A +   +F  T     AGC  +Y+  I   K
Sbjct  341  VITAGIVVVSLFGMNIHIELTLVPETPEMARIKNRKFWETTWATVAGCAAIYILAIYAGK  400

Query  260  HKRLL  246
              + L
Sbjct  401  KSKYL  405



>dbj|BAK05306.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=411

 Score =   114 bits (286),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 71/125 (57%), Positives = 88/125 (70%), Gaps = 6/125 (5%)
 Frame = -2

Query  602  NVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVMLTAATL  423
            +VEELEMLLEAYF+Q+DGTLNKL  LR+YV++TEDYIN MLD KQN LLQMGVMLT AT+
Sbjct  286  DVEELEMLLEAYFVQVDGTLNKLCHLRDYVENTEDYINFMLDKKQNQLLQMGVMLTTATV  345

Query  422  vvsafvavagvfGMNITIELF----NPDIAGMP--EFLWTIGGGSAGCIILYVAVIAWCK  261
            VV+A + V  +FGMNI IEL      P++A +   +F  T  G  AGC  +Y+  I   K
Sbjct  346  VVTAGIVVVSLFGMNIHIELMADPETPEMARIKNMKFWETTWGTVAGCAAIYLLAIYAGK  405

Query  260  HKRLL  246
              + L
Sbjct  406  KSKYL  410



>gb|EMT25409.1| Mitochondrial inner membrane magnesium transporter mrs2 [Aegilops 
tauschii]
Length=349

 Score =   113 bits (282),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 73/131 (56%), Positives = 90/131 (69%), Gaps = 8/131 (6%)
 Frame = -2

Query  620  AISKHLNVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVM  441
            A  KH  VEELEMLLEAYF++ DGTLNKL  LR+YVD+TE+YIN+MLD KQN LLQMGVM
Sbjct  220  ACVKH--VEELEMLLEAYFVEFDGTLNKLCHLRDYVDNTENYINLMLDKKQNQLLQMGVM  277

Query  440  LTAATLvvsafvavagvfGMNITIELF----NPDIAGMP--EFLWTIGGGSAGCIILYVA  279
            LT AT+VV+A + V  +FGMNI IEL      P++A +   +F  T  G  AGC  +Y+ 
Sbjct  278  LTTATVVVTAGIVVVSLFGMNIHIELMADPETPEMARIKNMKFWETTWGTVAGCAAIYLL  337

Query  278  VIAWCKHKRLL  246
             I   K  + L
Sbjct  338  AIYAGKKSKYL  348



>gb|AFW58264.1| hypothetical protein ZEAMMB73_583248 [Zea mays]
Length=570

 Score =   115 bits (287),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 64/98 (65%), Positives = 77/98 (79%), Gaps = 4/98 (4%)
 Frame = -2

Query  602  NVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVMLTAATL  423
             ++ELE LLEAYF+Q DGTLNKLSTLREYVDDTEDYIN+MLDDKQN LLQ+G++L+ ATL
Sbjct  320  KIDELENLLEAYFVQADGTLNKLSTLREYVDDTEDYINVMLDDKQNQLLQVGILLSTATL  379

Query  422  vvsafvavagvfGMNITIELFNPDIAGMPEFLWTIGGG  309
            V+S  +A+ GVFGMNITI L+N          W + GG
Sbjct  380  VMSVAIAITGVFGMNITIPLYNAPTG----VFWQVTGG  413



>ref|XP_008801220.1| PREDICTED: putative magnesium transporter MRS2-G [Phoenix dactylifera]
Length=456

 Score =   113 bits (283),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 56/119 (47%), Positives = 88/119 (74%), Gaps = 2/119 (2%)
 Frame = -2

Query  602  NVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVMLTAATL  423
            NVE+LEMLLEAYF+Q+DGT NK+ ++REY+DDTEDY+NI LD+++N L+Q+ ++LT A+ 
Sbjct  338  NVEDLEMLLEAYFMQLDGTRNKILSVREYIDDTEDYVNIQLDNQRNELIQLQLILTTASF  397

Query  422  vvsafvavagvfGMNITIELFNPDIAGMPEFLWTIGGGSAGCIILYVAVIAWCKHKRLL  246
            V++    +AG+F MNI  +L+ P     P F   +GG SA C ++++ ++ + + K+LL
Sbjct  398  VIAINTLIAGIFAMNIPCQLYAPKY--QPFFFPFVGGTSAACFLMFLLMLGYARWKKLL  454



>emb|CDM85160.1| unnamed protein product [Triticum aestivum]
Length=407

 Score =   113 bits (282),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 70/125 (56%), Positives = 88/125 (70%), Gaps = 6/125 (5%)
 Frame = -2

Query  602  NVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVMLTAATL  423
            +VEELEMLLEAYF++ DGTLNKL  LR+YVD+TE+YIN+MLD KQN LLQMGVMLT AT+
Sbjct  282  HVEELEMLLEAYFVEFDGTLNKLCHLRDYVDNTENYINLMLDKKQNQLLQMGVMLTTATV  341

Query  422  vvsafvavagvfGMNITIELF----NPDIAGMP--EFLWTIGGGSAGCIILYVAVIAWCK  261
            VV+A + V  +FGMNI IEL      P++A +   +F  T  G  AGC  +Y+  I   K
Sbjct  342  VVTAGIVVVSLFGMNIHIELMADPETPEMARIKNMKFWETTWGTVAGCAAIYLLAIYAGK  401

Query  260  HKRLL  246
              + L
Sbjct  402  KSKYL  406



>ref|XP_006595173.1| PREDICTED: magnesium transporter MRS2-F-like [Glycine max]
 gb|KHN31895.1| Magnesium transporter MRS2-F [Glycine soja]
Length=415

 Score =   113 bits (282),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 64/125 (51%), Positives = 85/125 (68%), Gaps = 5/125 (4%)
 Frame = -2

Query  617  ISKHLNVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVML  438
            +   L+VEELEMLLEAYF Q +G L +L++L EYVDDTEDYINIMLDDKQN LLQ  ++ 
Sbjct  293  LCPKLDVEELEMLLEAYFEQTNGILQRLTSLSEYVDDTEDYINIMLDDKQNELLQAAIIF  352

Query  437  TAATLvvsafvavagvfGMNITIELFNPDIAGMPEFLW-TIGGGSAGCIILYVAVIAWCK  261
                ++++A + V G+FGMNI I+LFN    G P   W T GG   GC++L++  + W K
Sbjct  353  DTINMILNAGIVVVGLFGMNIQIDLFN----GQPRQFWATTGGTFGGCLLLFLVCLWWGK  408

Query  260  HKRLL  246
             +  L
Sbjct  409  KRYFL  413



>ref|XP_006653407.1| PREDICTED: putative magnesium transporter MRS2-D-like [Oryza 
brachyantha]
Length=319

 Score =   112 bits (279),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 62/119 (52%), Positives = 83/119 (70%), Gaps = 2/119 (2%)
 Frame = -2

Query  602  NVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVMLTAATL  423
            N +ELE+LLE++F+QI+GTLNKLSTLREYVDDTEDYIN+MLDDKQN LL+MG++L+ ATL
Sbjct  202  NTDELEILLESFFVQIEGTLNKLSTLREYVDDTEDYINMMLDDKQNQLLEMGILLSTATL  261

Query  422  vvsafvavagvfGMNITIELFNPDIAGMPEFLWTIGGGSAGCIILYVAVIAWCKHKRLL  246
            V++  + V G   +NI I L+  D      F    GG   G + L++A +   K   +L
Sbjct  262  VLTCGITVTGFLALNIHIPLY--DTPPGATFWRATGGIVGGSVALFLAAVLCYKRSGIL  318



>ref|XP_006411758.1| hypothetical protein EUTSA_v10027315mg [Eutrema salsugineum]
 gb|ESQ53211.1| hypothetical protein EUTSA_v10027315mg [Eutrema salsugineum]
Length=448

 Score =   112 bits (281),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 70/120 (58%), Positives = 85/120 (71%), Gaps = 0/120 (0%)
 Frame = -2

Query  620  AISKHLNVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVM  441
            A+S   N++ELEMLLE YF+QIDGTLNKLSTL+E+VDDTEDYI I  D +QN LLQ  V 
Sbjct  325  AMSYKFNIKELEMLLEPYFVQIDGTLNKLSTLKEHVDDTEDYIKIKQDGEQNRLLQSNVK  384

Query  440  LTAATLvvsafvavagvfGMNITIELFNPDIAGMPEFLWTIGGGSAGCIILYVAVIAWCK  261
             T ATL+++AF+ VAGVFGMNI+IELF  +  G   FL    G   G + LY  +I W K
Sbjct  385  ATTATLLLNAFIVVAGVFGMNISIELFKDEKNGPMIFLCISLGSIFGWLFLYAVIIRWFK  444



>ref|XP_010933184.1| PREDICTED: putative magnesium transporter MRS2-G isoform X1 [Elaeis 
guineensis]
Length=459

 Score =   112 bits (279),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 54/119 (45%), Positives = 86/119 (72%), Gaps = 2/119 (2%)
 Frame = -2

Query  602  NVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVMLTAATL  423
            NVE+LEMLLEAYF+Q+DGT NK+ ++REY+DDTEDY+NI LD+++N L+Q+ ++LT A+ 
Sbjct  341  NVEDLEMLLEAYFMQLDGTRNKILSVREYIDDTEDYVNIQLDNQRNELIQLQLILTTASF  400

Query  422  vvsafvavagvfGMNITIELFNPDIAGMPEFLWTIGGGSAGCIILYVAVIAWCKHKRLL  246
             ++    + G+F MNI  +L+  D    P F   +GG S GC ++++ ++ + + K+LL
Sbjct  401  AIAINTLIVGIFAMNIPCQLY--DAKYQPIFFPFVGGTSTGCFLMFLLMLGYARWKKLL  457



>ref|XP_010041344.1| PREDICTED: LOW QUALITY PROTEIN: magnesium transporter MRS2-I-like 
[Eucalyptus grandis]
Length=261

 Score =   108 bits (271),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 62/119 (52%), Positives = 86/119 (72%), Gaps = 3/119 (3%)
 Frame = -2

Query  602  NVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVMLTAATL  423
            +VEELEMLLEAYF+QIDGTLNKL+TLREY+DDTEDYINI LD+ +N L+Q+ + L++ T+
Sbjct  144  DVEELEMLLEAYFMQIDGTLNKLTTLREYIDDTEDYINIQLDNHRNQLIQLELFLSSGTV  203

Query  422  vvsafvavagvfGMNITIELFNPDIAGMPEFLWTIGGGSAGCIILYVAVIAWCKHKRLL  246
             +S +  VA +FGMNI  + +N +   M  F W +      C  L++ VIA+ +HK L+
Sbjct  204  CLSIYSLVAAIFGMNIPYD-WNENHGYM--FKWVVIVTGTACAFLFILVIAYARHKGLV  259



>gb|KCW44426.1| hypothetical protein EUGRSUZ_L02078 [Eucalyptus grandis]
Length=297

 Score =   109 bits (272),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 62/119 (52%), Positives = 86/119 (72%), Gaps = 3/119 (3%)
 Frame = -2

Query  602  NVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVMLTAATL  423
            +VEELEMLLEAYF+QIDGTLNKL+TLREY+DDTEDYINI LD+ +N L+Q+ + L++ T+
Sbjct  180  DVEELEMLLEAYFMQIDGTLNKLTTLREYIDDTEDYINIQLDNHRNQLIQLELFLSSGTV  239

Query  422  vvsafvavagvfGMNITIELFNPDIAGMPEFLWTIGGGSAGCIILYVAVIAWCKHKRLL  246
             +S +  VA +FGMNI  + +N +   M  F W +      C  L++ VIA+ +HK L+
Sbjct  240  CLSIYSLVAAIFGMNIPYD-WNENHGYM--FKWVVIVTGTACAFLFILVIAYARHKGLV  295



>ref|XP_004503914.1| PREDICTED: magnesium transporter MRS2-F-like [Cicer arietinum]
Length=427

 Score =   110 bits (275),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 63/120 (53%), Positives = 84/120 (70%), Gaps = 5/120 (4%)
 Frame = -2

Query  602  NVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVMLTAATL  423
            +VEELEMLLEAYF QI+G L KL++L EYVDDTEDYINIMLDDK+N LL++ + L    +
Sbjct  310  DVEELEMLLEAYFAQINGILQKLTSLSEYVDDTEDYINIMLDDKRNQLLRVSITLNTINM  369

Query  422  vvsafvavagvfGMNITIELFNPDIAGMPEFLW-TIGGGSAGCIILYVAVIAWCKHKRLL  246
            + +A + V G+FGMNI I+LF+    G P   W T  G   GC++L++  + W K + LL
Sbjct  370  IANAGIVVVGLFGMNIHIDLFD----GQPRQFWATTVGTLVGCVLLFLVYVWWGKQRYLL  425



>ref|XP_010061592.1| PREDICTED: magnesium transporter MRS2-I-like [Eucalyptus grandis]
 gb|KCW68574.1| hypothetical protein EUGRSUZ_F02186 [Eucalyptus grandis]
Length=395

 Score =   109 bits (273),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 62/119 (52%), Positives = 86/119 (72%), Gaps = 3/119 (3%)
 Frame = -2

Query  602  NVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVMLTAATL  423
            +VEELEMLLEAYF+QIDGTLNKL+TLREY+DDTEDYINI LD+ +N L+Q+ + L++ T+
Sbjct  278  DVEELEMLLEAYFMQIDGTLNKLTTLREYIDDTEDYINIQLDNHRNQLIQLELFLSSGTV  337

Query  422  vvsafvavagvfGMNITIELFNPDIAGMPEFLWTIGGGSAGCIILYVAVIAWCKHKRLL  246
             +S +  VA +FGMNI  + +N +   M  F W +      C  L++ VIA+ +HK L+
Sbjct  338  CLSIYSLVAAIFGMNIPYD-WNKNHGYM--FKWVVIVTGTACAFLFILVIAYARHKGLV  393



>ref|XP_003531296.1| PREDICTED: magnesium transporter MRS2-4-like [Glycine max]
Length=450

 Score =   109 bits (273),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 58/119 (49%), Positives = 87/119 (73%), Gaps = 4/119 (3%)
 Frame = -2

Query  602  NVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVMLTAATL  423
            NVE+LEMLL+AYF+Q+DGT NK+ ++REY+DDTEDY+NI LD+ +N L+Q+ + LT A+ 
Sbjct  334  NVEDLEMLLDAYFMQLDGTRNKILSVREYIDDTEDYVNIQLDNHRNELIQLQLTLTIASF  393

Query  422  vvsafvavagvfGMNITIELFNPDIAGMPEFLWTIGGGSAGCIILYVAVIAWCKHKRLL  246
             ++    +AG FGMNI   L+N D    P F+WT    SA C++L++ ++A+ + K+LL
Sbjct  394  AIAIETLIAGAFGMNIPCNLYNIDGVFWP-FVWTT---SAACVLLFLLILAYARWKKLL  448



>gb|KHN48092.1| Magnesium transporter MRS2-4 [Glycine soja]
Length=394

 Score =   109 bits (272),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 58/119 (49%), Positives = 87/119 (73%), Gaps = 4/119 (3%)
 Frame = -2

Query  602  NVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVMLTAATL  423
            NVE+LEMLL+AYF+Q+DGT NK+ ++REY+DDTEDY+NI LD+ +N L+Q+ + LT A+ 
Sbjct  278  NVEDLEMLLDAYFMQLDGTRNKILSVREYIDDTEDYVNIQLDNHRNELIQLQLTLTIASF  337

Query  422  vvsafvavagvfGMNITIELFNPDIAGMPEFLWTIGGGSAGCIILYVAVIAWCKHKRLL  246
             ++    +AG FGMNI   L+N D    P F+WT    SA C++L++ ++A+ + K+LL
Sbjct  338  AIAIETLIAGAFGMNIPCNLYNIDGVFWP-FVWTT---SAACVLLFLLILAYARWKKLL  392



>ref|XP_002970710.1| hypothetical protein SELMODRAFT_94109 [Selaginella moellendorffii]
 gb|EFJ28036.1| hypothetical protein SELMODRAFT_94109 [Selaginella moellendorffii]
Length=367

 Score =   108 bits (271),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 63/119 (53%), Positives = 88/119 (74%), Gaps = 3/119 (3%)
 Frame = -2

Query  602  NVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVMLTAATL  423
            +VEE+EMLLE YF+Q+DGTLNKL+TLREY+DDTEDYINI LD+ +N L+Q+ ++L AATL
Sbjct  250  DVEEVEMLLECYFMQVDGTLNKLNTLREYIDDTEDYINIQLDNHRNQLIQLELVLNAATL  309

Query  422  vvsafvavagvfGMNITIELFNPDIAGMPEFLWTIGGGSAGCIILYVAVIAWCKHKRLL  246
             ++ +  VAG+FGMNI    +N D A +  F W +  G   C+ L+  V+A+ +HK L+
Sbjct  310  AMALYSLVAGIFGMNIPYP-WNDDHAYL--FKWVVVAGCMLCVGLFSIVMAYARHKGLV  365



>ref|XP_001765484.1| predicted protein [Physcomitrella patens]
 gb|EDQ69745.1| predicted protein [Physcomitrella patens]
Length=383

 Score =   108 bits (271),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 62/119 (52%), Positives = 91/119 (76%), Gaps = 3/119 (3%)
 Frame = -2

Query  602  NVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVMLTAATL  423
            +VEELEMLLEAYF+QID TLNKL+TLREY+DDTEDYINI LD+ +N L+Q+ ++L++AT+
Sbjct  266  DVEELEMLLEAYFMQIDSTLNKLTTLREYIDDTEDYINIQLDNHRNQLIQLELILSSATV  325

Query  422  vvsafvavagvfGMNITIELFNPDIAGMPEFLWTIGGGSAGCIILYVAVIAWCKHKRLL  246
            VV+ F  VAG+FGMNI  E +N +      F W +   +  C+++++AV+ + ++K L+
Sbjct  326  VVALFSLVAGIFGMNIPYE-WNEN--HEEAFTWVVVTTTIACLVVFIAVLGYARYKHLI  381



>ref|XP_002969379.1| hypothetical protein SELMODRAFT_91491 [Selaginella moellendorffii]
 gb|EFJ29467.1| hypothetical protein SELMODRAFT_91491 [Selaginella moellendorffii]
Length=387

 Score =   108 bits (271),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 63/119 (53%), Positives = 88/119 (74%), Gaps = 3/119 (3%)
 Frame = -2

Query  602  NVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVMLTAATL  423
            +VEE+EMLLE YF+Q+DGTLNKL+TLREY+DDTEDYINI LD+ +N L+Q+ ++L AATL
Sbjct  270  DVEEVEMLLECYFMQVDGTLNKLNTLREYIDDTEDYINIQLDNHRNQLIQLELVLNAATL  329

Query  422  vvsafvavagvfGMNITIELFNPDIAGMPEFLWTIGGGSAGCIILYVAVIAWCKHKRLL  246
             ++ +  VAG+FGMNI    +N D A +  F W +  G   C+ L+  V+A+ +HK L+
Sbjct  330  AMALYSLVAGIFGMNIPYP-WNDDHAYI--FKWVVVAGCMLCVGLFSIVMAYARHKGLV  385



>gb|EPS65976.1| hypothetical protein M569_08801 [Genlisea aurea]
Length=395

 Score =   108 bits (270),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 63/119 (53%), Positives = 86/119 (72%), Gaps = 3/119 (3%)
 Frame = -2

Query  602  NVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVMLTAATL  423
            +VEELEMLLEAYF+QIDGTLNKLSTLREY+D+TEDYINI LD+ +N L+Q+ ++L+A TL
Sbjct  278  DVEELEMLLEAYFMQIDGTLNKLSTLREYIDNTEDYINIQLDNHRNQLIQLELILSAGTL  337

Query  422  vvsafvavagvfGMNITIELFNPDIAGMPEFLWTIGGGSAGCIILYVAVIAWCKHKRLL  246
             +S +  VAG+FGMNI    +N D   M  F W +      CI +++ ++ W + K L+
Sbjct  338  CLSVYSLVAGIFGMNIPYT-WNADHGYM--FKWVVISTGGLCIAIFMLIVEWARQKGLI  393



>ref|XP_010069171.1| PREDICTED: magnesium transporter MRS2-I-like isoform X2 [Eucalyptus 
grandis]
Length=383

 Score =   107 bits (268),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 61/119 (51%), Positives = 86/119 (72%), Gaps = 3/119 (3%)
 Frame = -2

Query  602  NVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVMLTAATL  423
            +VEELEMLLEAYF+QIDGTLNKL+TLREY+DDTEDYINI LD+ +N L+Q+ + L++ T+
Sbjct  266  DVEELEMLLEAYFMQIDGTLNKLTTLREYIDDTEDYINIQLDNHRNQLIQLELFLSSGTV  325

Query  422  vvsafvavagvfGMNITIELFNPDIAGMPEFLWTIGGGSAGCIILYVAVIAWCKHKRLL  246
             +S +  VA +FGMNI  + +N +   M  F W +      C  L++ +IA+ +HK L+
Sbjct  326  CLSIYSLVAAIFGMNIPYD-WNNNHGYM--FKWVVIVTGIACAFLFILIIAYARHKGLV  381



>ref|XP_010069170.1| PREDICTED: magnesium transporter MRS2-I-like isoform X1 [Eucalyptus 
grandis]
 gb|KCW57434.1| hypothetical protein EUGRSUZ_H00214 [Eucalyptus grandis]
Length=394

 Score =   107 bits (268),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 61/119 (51%), Positives = 86/119 (72%), Gaps = 3/119 (3%)
 Frame = -2

Query  602  NVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVMLTAATL  423
            +VEELEMLLEAYF+QIDGTLNKL+TLREY+DDTEDYINI LD+ +N L+Q+ + L++ T+
Sbjct  277  DVEELEMLLEAYFMQIDGTLNKLTTLREYIDDTEDYINIQLDNHRNQLIQLELFLSSGTV  336

Query  422  vvsafvavagvfGMNITIELFNPDIAGMPEFLWTIGGGSAGCIILYVAVIAWCKHKRLL  246
             +S +  VA +FGMNI  + +N +   M  F W +      C  L++ +IA+ +HK L+
Sbjct  337  CLSIYSLVAAIFGMNIPYD-WNNNHGYM--FKWVVIVTGIACAFLFILIIAYARHKGLV  392



>ref|XP_010649991.1| PREDICTED: magnesium transporter MRS2-2 isoform X2 [Vitis vinifera]
Length=364

 Score =   107 bits (268),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 62/119 (52%), Positives = 87/119 (73%), Gaps = 3/119 (3%)
 Frame = -2

Query  602  NVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVMLTAATL  423
            +VEELEMLLEAYF+QIDGTLNKL+TLREY+DDTEDYINI LD+ +N L+Q+ + L++ T+
Sbjct  247  DVEELEMLLEAYFMQIDGTLNKLTTLREYIDDTEDYINIQLDNHRNQLIQLELFLSSGTV  306

Query  422  vvsafvavagvfGMNITIELFNPDIAGMPEFLWTIGGGSAGCIILYVAVIAWCKHKRLL  246
             +S +  VAG+FGMNI    +N D   M  F W +      C +L+V ++++ +HK L+
Sbjct  307  CLSIYSLVAGIFGMNIPYT-WNDDHGFM--FKWVVIVTGVSCALLFVVIMSYARHKGLV  362



>ref|XP_002284181.1| PREDICTED: magnesium transporter MRS2-I isoform X1 [Vitis vinifera]
 emb|CBI26360.3| unnamed protein product [Vitis vinifera]
Length=389

 Score =   107 bits (268),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 62/119 (52%), Positives = 87/119 (73%), Gaps = 3/119 (3%)
 Frame = -2

Query  602  NVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVMLTAATL  423
            +VEELEMLLEAYF+QIDGTLNKL+TLREY+DDTEDYINI LD+ +N L+Q+ + L++ T+
Sbjct  272  DVEELEMLLEAYFMQIDGTLNKLTTLREYIDDTEDYINIQLDNHRNQLIQLELFLSSGTV  331

Query  422  vvsafvavagvfGMNITIELFNPDIAGMPEFLWTIGGGSAGCIILYVAVIAWCKHKRLL  246
             +S +  VAG+FGMNI    +N D   M  F W +      C +L+V ++++ +HK L+
Sbjct  332  CLSIYSLVAGIFGMNIPYT-WNDDHGFM--FKWVVIVTGVSCALLFVVIMSYARHKGLV  387



>gb|EPS59787.1| hypothetical protein M569_15018, partial [Genlisea aurea]
Length=203

 Score =   105 bits (261),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 62/120 (52%), Positives = 85/120 (71%), Gaps = 6/120 (5%)
 Frame = -2

Query  602  NVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVMLTAATL  423
            N+EELEMLLEAYF+ ID TLNKL++L+EY+DDTED+INI LD+ +N L+Q  ++LT AT 
Sbjct  87   NIEELEMLLEAYFVVIDSTLNKLTSLKEYIDDTEDFINIQLDNVRNQLIQFELVLTTATF  146

Query  422  vvsafvavagvfGMNITIELF-NPDIAGMPEFLWTIGGGSAGCIILYVAVIAWCKHKRLL  246
            VV+ F  VAGVFGMN T+ +F NP       F W +    A   +++ A + + KH+RL+
Sbjct  147  VVAIFGVVAGVFGMNFTLPMFDNPG-----AFKWVLIVTGALGFVIFSAFLGYFKHRRLM  201



>ref|XP_004146255.1| PREDICTED: magnesium transporter MRS2-4-like [Cucumis sativus]
 ref|XP_004159871.1| PREDICTED: magnesium transporter MRS2-4-like [Cucumis sativus]
 gb|KGN57603.1| hypothetical protein Csa_3G225330 [Cucumis sativus]
Length=443

 Score =   107 bits (268),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 57/119 (48%), Positives = 89/119 (75%), Gaps = 4/119 (3%)
 Frame = -2

Query  602  NVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVMLTAATL  423
            +VE+LEMLLEAYF+Q+DGT N++ ++REY+DDTEDY+NI LD+++N L+Q  + LT A+ 
Sbjct  327  DVEDLEMLLEAYFMQLDGTRNRILSVREYIDDTEDYVNIQLDNQRNELIQFQLTLTIASF  386

Query  422  vvsafvavagvfGMNITIELFNPDIAGMPEFLWTIGGGSAGCIILYVAVIAWCKHKRLL  246
             ++    +AG+FGMNI   L+  D  G+  F + +GG SAGC++L++ ++ + K K+LL
Sbjct  387  AIAVETLIAGLFGMNIPCTLYERD--GV--FGYFVGGTSAGCLLLFLVILGYAKWKKLL  441



>ref|XP_001784777.1| predicted protein [Physcomitrella patens]
 gb|EDQ50405.1| predicted protein [Physcomitrella patens]
Length=451

 Score =   107 bits (268),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 64/124 (52%), Positives = 88/124 (71%), Gaps = 6/124 (5%)
 Frame = -2

Query  614  SKHLNVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVMLT  435
            S+   VEELEMLLEAYF+ IDGTLNKL++L+EY+DDTED+INI LD+ +N L+Q  ++LT
Sbjct  331  SRVTGVEELEMLLEAYFVVIDGTLNKLTSLKEYIDDTEDFINIQLDNVRNQLIQFELLLT  390

Query  434  AATLvvsafvavagvfGMNITIELFNPDIAGMPE-FLWTIGGGSAGCIILYVAVIAWCKH  258
             AT V++ +  VAGVFGMNI I LF+      PE F W +     G  ++++A + + K 
Sbjct  391  TATFVLAIYSVVAGVFGMNIPIALFDE-----PESFKWVLIISGVGGFLIFIAFLWFFKQ  445

Query  257  KRLL  246
            KRL+
Sbjct  446  KRLM  449



>ref|XP_008802852.1| PREDICTED: magnesium transporter MRS2-I, partial [Phoenix dactylifera]
Length=251

 Score =   105 bits (261),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 59/119 (50%), Positives = 85/119 (71%), Gaps = 3/119 (3%)
 Frame = -2

Query  602  NVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVMLTAATL  423
            +VEELEMLLEAYF+QIDGTLN+L+TLREY+DDTEDYINI LD+ +N L+Q+ + L++ T+
Sbjct  134  DVEELEMLLEAYFMQIDGTLNRLTTLREYIDDTEDYINIQLDNHRNQLIQLELFLSSGTV  193

Query  422  vvsafvavagvfGMNITIELFNPDIAGMPEFLWTIGGGSAGCIILYVAVIAWCKHKRLL  246
             +S +  V G+FGMNI    +N     +  F W +      C IL++ ++A+ +HK L+
Sbjct  194  CLSLYALVGGIFGMNIPYS-WNDSHGYL--FKWVVIISGLACAILFIVIVAYARHKGLV  249



>ref|XP_002980285.1| hypothetical protein SELMODRAFT_112303 [Selaginella moellendorffii]
 gb|EFJ18545.1| hypothetical protein SELMODRAFT_112303 [Selaginella moellendorffii]
Length=437

 Score =   107 bits (266),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 64/119 (54%), Positives = 85/119 (71%), Gaps = 4/119 (3%)
 Frame = -2

Query  602  NVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVMLTAATL  423
             VEELEMLLEAYF+ IDGTLNKL++L+EY+DDTED+INI LD+ +N L+Q  ++LT AT 
Sbjct  321  RVEELEMLLEAYFVVIDGTLNKLTSLKEYIDDTEDFINIQLDNVRNQLIQFELLLTTATF  380

Query  422  vvsafvavagvfGMNITIELFNPDIAGMPEFLWTIGGGSAGCIILYVAVIAWCKHKRLL  246
            VV+ F  +AGVFGMNI I+LF+   A    F W +       I +++A I + K +RLL
Sbjct  381  VVAIFGVIAGVFGMNIQIDLFDEPRA----FKWILITSGVAGIAIFLAFILFFKQRRLL  435



>ref|XP_002963050.1| hypothetical protein SELMODRAFT_165647 [Selaginella moellendorffii]
 gb|EFJ36513.1| hypothetical protein SELMODRAFT_165647 [Selaginella moellendorffii]
Length=424

 Score =   106 bits (264),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 63/119 (53%), Positives = 85/119 (71%), Gaps = 4/119 (3%)
 Frame = -2

Query  602  NVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVMLTAATL  423
             VEELEMLLEAYF+ IDGTLNKL++L+EY+DDTED+INI LD+ +N L+Q  ++LT AT 
Sbjct  308  RVEELEMLLEAYFVVIDGTLNKLTSLKEYIDDTEDFINIQLDNVRNQLIQFELLLTTATF  367

Query  422  vvsafvavagvfGMNITIELFNPDIAGMPEFLWTIGGGSAGCIILYVAVIAWCKHKRLL  246
            VV+ F  +AGVFGMNI I+LF+   A    F W +       I +++A + + K +RLL
Sbjct  368  VVAIFGVIAGVFGMNIQIDLFDEPRA----FKWILITSGVAGIAIFLAFVLFFKQRRLL  422



>ref|NP_001051228.1| Os03g0742400 [Oryza sativa Japonica Group]
 dbj|BAF13142.1| Os03g0742400, partial [Oryza sativa Japonica Group]
Length=249

 Score =   103 bits (258),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 60/119 (50%), Positives = 87/119 (73%), Gaps = 3/119 (3%)
 Frame = -2

Query  602  NVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVMLTAATL  423
            +VEELEMLLEAYF+QIDGTLNKL+TLREY+DDTEDYINI LD+ +N L+Q+ + L++ T+
Sbjct  132  DVEELEMLLEAYFMQIDGTLNKLTTLREYIDDTEDYINIQLDNHRNQLIQLELFLSSGTV  191

Query  422  vvsafvavagvfGMNITIELFNPDIAGMPEFLWTIGGGSAGCIILYVAVIAWCKHKRLL  246
             +S +  VAG+FGMNI    +N +   +  F W +      C  ++V+++A+ +HK L+
Sbjct  192  CLSLYSLVAGIFGMNIPYT-WNDNHGYV--FKWVVLVSGLFCAFMFVSIVAYARHKGLV  247



>emb|CDO97582.1| unnamed protein product [Coffea canephora]
Length=379

 Score =   105 bits (261),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 56/119 (47%), Positives = 87/119 (73%), Gaps = 4/119 (3%)
 Frame = -2

Query  602  NVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVMLTAATL  423
            +VE+LEMLLEAYF+Q+DGT NK+ ++REY+DDTEDY+NI LD+++N L+Q+ + LT A+ 
Sbjct  263  DVEDLEMLLEAYFMQLDGTRNKILSVREYIDDTEDYVNIQLDNQRNELIQLQLTLTIASF  322

Query  422  vvsafvavagvfGMNITIELFNPDIAGMPEFLWTIGGGSAGCIILYVAVIAWCKHKRLL  246
             V+    +AGVFGMNI   L+  +    P     +GG +AGC++L++ ++ + + K+LL
Sbjct  323  AVAVETLIAGVFGMNIPCTLYQTNGVFWP----LVGGCTAGCMLLFLLILGYARWKKLL  377



>ref|XP_010069167.1| PREDICTED: magnesium transporter MRS2-I-like [Eucalyptus grandis]
 gb|KCW57431.1| hypothetical protein EUGRSUZ_H00212 [Eucalyptus grandis]
Length=413

 Score =   105 bits (261),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 61/119 (51%), Positives = 87/119 (73%), Gaps = 3/119 (3%)
 Frame = -2

Query  602  NVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVMLTAATL  423
            +VEELEMLLEAYF+QIDGTLNKL+TLREY+DDTEDYINI LD+ +N L+Q+ + L++ T+
Sbjct  296  DVEELEMLLEAYFMQIDGTLNKLTTLREYIDDTEDYINIQLDNHRNQLIQLELFLSSGTV  355

Query  422  vvsafvavagvfGMNITIELFNPDIAGMPEFLWTIGGGSAGCIILYVAVIAWCKHKRLL  246
             +S +  VAG+FG+NI  + +N +   M  F W +      C  L++ +IA+ +HK L+
Sbjct  356  CLSIYSLVAGIFGVNIPYD-WNDNHGYM--FKWVVIVTGIACAFLFILIIAYARHKGLV  411



>ref|XP_006348684.1| PREDICTED: magnesium transporter MRS2-5-like [Solanum tuberosum]
Length=418

 Score =   105 bits (261),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 61/120 (51%), Positives = 83/120 (69%), Gaps = 6/120 (5%)
 Frame = -2

Query  602  NVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVMLTAATL  423
            N+++LEMLLEAYF+ +D  LNKLS+L+EY+DDTED INI L + QN L+Q  ++LTAAT 
Sbjct  302  NIDQLEMLLEAYFVVVDSALNKLSSLKEYIDDTEDLINIKLANVQNQLIQFELLLTAATF  361

Query  422  vvsafvavagvfGMNITIELF-NPDIAGMPEFLWTIGGGSAGCIILYVAVIAWCKHKRLL  246
            V + F  V  VFGMN+   +F +PD      F WTI      C++LY+A + + KHK+LL
Sbjct  362  VATIFAMVTAVFGMNLKATVFDDPD-----GFDWTIIITGIFCLVLYIAFMIYFKHKKLL  416



>ref|XP_004981821.1| PREDICTED: magnesium transporter MRS2-I-like [Setaria italica]
Length=386

 Score =   105 bits (261),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 61/119 (51%), Positives = 87/119 (73%), Gaps = 3/119 (3%)
 Frame = -2

Query  602  NVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVMLTAATL  423
            +VEELEMLLEAYF+QIDGTLNKL+TLREY+DDTEDYINI LD+ +N L+Q+ + L++ T+
Sbjct  269  DVEELEMLLEAYFMQIDGTLNKLTTLREYIDDTEDYINIQLDNHRNQLIQLELFLSSGTV  328

Query  422  vvsafvavagvfGMNITIELFNPDIAGMPEFLWTIGGGSAGCIILYVAVIAWCKHKRLL  246
             +S +  VAGVFGMNI    +N +   +  F W +      C  ++V+++A+ +HK L+
Sbjct  329  CLSLYSLVAGVFGMNIPYT-WNDNHGYV--FKWVVLVSGLFCAFMFVSIVAYARHKGLV  384



>gb|AET04849.2| magnesium transporter MRS2-like protein [Medicago truncatula]
 gb|KEH20937.1| magnesium transporter MRS2-like protein [Medicago truncatula]
Length=424

 Score =   105 bits (261),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 63/116 (54%), Positives = 78/116 (67%), Gaps = 5/116 (4%)
 Frame = -2

Query  602  NVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVMLTAATL  423
            +VEELEMLLEAYF QI+G L KLSTL EYV +T+DYINIMLDDKQN LLQ  ++L     
Sbjct  308  DVEELEMLLEAYFAQINGILQKLSTLSEYVGNTKDYINIMLDDKQNQLLQASIILNTMNF  367

Query  422  vvsafvavagvfGMNITIELFNPDIAGMPEFLW-TIGGGSAGCIILYVAVIAWCKH  258
            +V+  + V GVFGMNI I+L+     G P   W T  G   GC++L++  I W K 
Sbjct  368  IVNLGILVVGVFGMNIHIDLYQ----GQPSQFWATTSGTVLGCVLLFLVSIWWGKR  419



>gb|KHN06489.1| Magnesium transporter MRS2-4 [Glycine soja]
Length=379

 Score =   104 bits (260),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 56/119 (47%), Positives = 86/119 (72%), Gaps = 4/119 (3%)
 Frame = -2

Query  602  NVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVMLTAATL  423
            NVE+LEMLL+AYF+Q+DGT NK+ ++REY+DDTEDY+NI LD+ +N L+Q+ + LT A+ 
Sbjct  263  NVEDLEMLLDAYFMQLDGTRNKILSVREYIDDTEDYVNIQLDNHRNELIQLQLTLTIASF  322

Query  422  vvsafvavagvfGMNITIELFNPDIAGMPEFLWTIGGGSAGCIILYVAVIAWCKHKRLL  246
             ++    +AG FGMNI   L++ D    P F+W     SA C++L++ ++A+ + K+LL
Sbjct  323  AIAIETMIAGAFGMNIPCNLYHIDGVFWP-FVWIT---SAACVLLFLLILAYARWKKLL  377



>ref|XP_003630373.1| Mitochondrial inner membrane magnesium transporter mrs2 [Medicago 
truncatula]
Length=429

 Score =   105 bits (261),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 63/116 (54%), Positives = 78/116 (67%), Gaps = 5/116 (4%)
 Frame = -2

Query  602  NVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVMLTAATL  423
            +VEELEMLLEAYF QI+G L KLSTL EYV +T+DYINIMLDDKQN LLQ  ++L     
Sbjct  313  DVEELEMLLEAYFAQINGILQKLSTLSEYVGNTKDYINIMLDDKQNQLLQASIILNTMNF  372

Query  422  vvsafvavagvfGMNITIELFNPDIAGMPEFLW-TIGGGSAGCIILYVAVIAWCKH  258
            +V+  + V GVFGMNI I+L+     G P   W T  G   GC++L++  I W K 
Sbjct  373  IVNLGILVVGVFGMNIHIDLYQ----GQPSQFWATTSGTVLGCVLLFLVSIWWGKR  424



>ref|XP_003525004.1| PREDICTED: magnesium transporter MRS2-4-like [Glycine max]
Length=451

 Score =   105 bits (262),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 56/119 (47%), Positives = 86/119 (72%), Gaps = 4/119 (3%)
 Frame = -2

Query  602  NVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVMLTAATL  423
            NVE+LEMLL+AYF+Q+DGT NK+ ++REY+DDTEDY+NI LD+ +N L+Q+ + LT A+ 
Sbjct  335  NVEDLEMLLDAYFMQLDGTRNKILSVREYIDDTEDYVNIQLDNHRNELIQLQLTLTIASF  394

Query  422  vvsafvavagvfGMNITIELFNPDIAGMPEFLWTIGGGSAGCIILYVAVIAWCKHKRLL  246
             ++    +AG FGMNI   L++ D    P F+W     SA C++L++ ++A+ + K+LL
Sbjct  395  AIAIETMIAGAFGMNIPCNLYHIDGVFWP-FVWIT---SAACVLLFLLILAYARWKKLL  449



>emb|CBI17947.3| unnamed protein product [Vitis vinifera]
Length=169

 Score =   101 bits (251),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 60/119 (50%), Positives = 84/119 (71%), Gaps = 3/119 (3%)
 Frame = -2

Query  602  NVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVMLTAATL  423
            +VEELEMLLEAYF+QIDGTLNKLSTLREY+DDTEDYINI LD+ +N L+Q+ + L++ T+
Sbjct  52   DVEELEMLLEAYFMQIDGTLNKLSTLREYIDDTEDYINIQLDNHRNQLIQLELFLSSGTV  111

Query  422  vvsafvavagvfGMNITIELFNPDIAGMPEFLWTIGGGSAGCIILYVAVIAWCKHKRLL  246
             +S +  VA +FGMNI     N D   M  F W +      C  +++++I++ + K L+
Sbjct  112  CLSIYSLVAAIFGMNIPYTWRN-DHGYM--FKWVVILSGMACASIFLSIISYARSKGLV  167



>ref|XP_004137654.1| PREDICTED: magnesium transporter MRS2-1-like [Cucumis sativus]
 gb|KGN58653.1| hypothetical protein Csa_3G710800 [Cucumis sativus]
Length=447

 Score =   105 bits (261),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 68/155 (44%), Positives = 99/155 (64%), Gaps = 10/155 (6%)
 Frame = -2

Query  707  ADPEIDYPMERVNTLGRDSHttrtsttrSAISKHLNVEELEMLLEAYFIQIDGTLNKLST  528
            + P     +E+  ++ R  H +  S+     S + N+EELEMLLEAYF+ ID TLNKL++
Sbjct  300  SSPPETRRLEKSLSIARSRHESTRSSE----STNENIEELEMLLEAYFVVIDSTLNKLTS  355

Query  527  LREYVDDTEDYINIMLDDKQNHLLQMGVMLTAATLvvsafvavagvfGMNITIELF-NPD  351
            L+EY+DDTED+INI LD+ +N L+Q  ++LT AT VV+ F  VAG+FGMN  I +F NPD
Sbjct  356  LKEYIDDTEDFINIQLDNVRNQLIQFELLLTTATFVVAIFGVVAGIFGMNFEIPMFGNPD  415

Query  350  IAGMPEFLWTIGGGSAGCIILYVAVIAWCKHKRLL  246
                  F W +       II++ A + + ++KRL+
Sbjct  416  -----AFKWVLLITGVSGIIIFSAFVWFFRYKRLM  445



>ref|XP_003554279.1| PREDICTED: magnesium transporter MRS2-I-like isoform X1 [Glycine 
max]
 gb|KHN02533.1| Magnesium transporter MRS2-I [Glycine soja]
Length=388

 Score =   104 bits (260),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 58/124 (47%), Positives = 86/124 (69%), Gaps = 2/124 (2%)
 Frame = -2

Query  617  ISKHLNVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVML  438
            + +  +VEELEMLLEAYF+QIDGTLNKL+TLREY+DDTEDYINI LD+ +N L+Q+ + +
Sbjct  265  VQRENDVEELEMLLEAYFMQIDGTLNKLATLREYIDDTEDYINIQLDNHRNQLIQLELFI  324

Query  437  TAATLvvsafvavagvfGMNITIELFNPDIAGMPEFLWTIGGGSAGCIILYVAVIAWCKH  258
            +A T+ +S +  VA +FGMNI      P    +  F W +  G   C  L+++++++ + 
Sbjct  325  SAGTVCMSLYSLVAAIFGMNIPYTWKAPGHEHV--FKWVVIFGGMVCASLFLSIVSYARR  382

Query  257  KRLL  246
            K L+
Sbjct  383  KGLV  386



>ref|XP_008465136.1| PREDICTED: magnesium transporter MRS2-1 [Cucumis melo]
Length=447

 Score =   105 bits (261),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 68/155 (44%), Positives = 99/155 (64%), Gaps = 10/155 (6%)
 Frame = -2

Query  707  ADPEIDYPMERVNTLGRDSHttrtsttrSAISKHLNVEELEMLLEAYFIQIDGTLNKLST  528
            + P     +E+  ++ R  H +  S+     S + N+EELEMLLEAYF+ ID TLNKL++
Sbjct  300  SSPPETRRLEKSLSIARSRHESTRSSE----STNENIEELEMLLEAYFVVIDSTLNKLTS  355

Query  527  LREYVDDTEDYINIMLDDKQNHLLQMGVMLTAATLvvsafvavagvfGMNITIELF-NPD  351
            L+EY+DDTED+INI LD+ +N L+Q  ++LT AT VV+ F  VAG+FGMN  I +F NPD
Sbjct  356  LKEYIDDTEDFINIQLDNVRNQLIQFELLLTTATFVVAIFGVVAGIFGMNFEIPMFGNPD  415

Query  350  IAGMPEFLWTIGGGSAGCIILYVAVIAWCKHKRLL  246
                  F W +       II++ A + + ++KRL+
Sbjct  416  -----AFKWVLLITGVSGIIIFSAFVWFFRYKRLM  445



>sp|B8AJT9.1|MRS2I_ORYSI RecName: Full=Magnesium transporter MRS2-I [Oryza sativa Indica 
Group]
 gb|EEC76157.1| hypothetical protein OsI_13458 [Oryza sativa Indica Group]
Length=381

 Score =   104 bits (260),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 60/119 (50%), Positives = 87/119 (73%), Gaps = 3/119 (3%)
 Frame = -2

Query  602  NVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVMLTAATL  423
            +VEELEMLLEAYF+QIDGTLNKL+TLREY+DDTEDYINI LD+ +N L+Q+ + L++ T+
Sbjct  264  DVEELEMLLEAYFMQIDGTLNKLTTLREYIDDTEDYINIQLDNHRNQLIQLELFLSSGTV  323

Query  422  vvsafvavagvfGMNITIELFNPDIAGMPEFLWTIGGGSAGCIILYVAVIAWCKHKRLL  246
             +S +  VAG+FGMNI    +N +   +  F W +      C  ++V+++A+ +HK L+
Sbjct  324  CLSLYSLVAGIFGMNIPYT-WNDNHGYV--FKWVVLVSGLFCAFMFVSIVAYARHKGLV  379



>ref|XP_004160340.1| PREDICTED: magnesium transporter MRS2-1-like [Cucumis sativus]
Length=447

 Score =   105 bits (261),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 68/155 (44%), Positives = 99/155 (64%), Gaps = 10/155 (6%)
 Frame = -2

Query  707  ADPEIDYPMERVNTLGRDSHttrtsttrSAISKHLNVEELEMLLEAYFIQIDGTLNKLST  528
            + P     +E+  ++ R  H +  S+     S + N+EELEMLLEAYF+ ID TLNKL++
Sbjct  300  SSPPETRRLEKSLSIARSRHESTRSSE----STNENIEELEMLLEAYFVVIDSTLNKLTS  355

Query  527  LREYVDDTEDYINIMLDDKQNHLLQMGVMLTAATLvvsafvavagvfGMNITIELF-NPD  351
            L+EY+DDTED+INI LD+ +N L+Q  ++LT AT VV+ F  VAG+FGMN  I +F NPD
Sbjct  356  LKEYIDDTEDFINIQLDNVRNQLIQFELLLTTATFVVAIFGVVAGIFGMNFEIPMFGNPD  415

Query  350  IAGMPEFLWTIGGGSAGCIILYVAVIAWCKHKRLL  246
                  F W +       II++ A + + ++KRL+
Sbjct  416  -----AFKWVLLITGVSGIIIFSAFVWFFRYKRLM  445



>gb|AAR87307.1| putative CorA-like Mg2+ transporter protein [Oryza sativa Japonica 
Group]
Length=374

 Score =   104 bits (260),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 60/119 (50%), Positives = 87/119 (73%), Gaps = 3/119 (3%)
 Frame = -2

Query  602  NVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVMLTAATL  423
            +VEELEMLLEAYF+QIDGTLNKL+TLREY+DDTEDYINI LD+ +N L+Q+ + L++ T+
Sbjct  257  DVEELEMLLEAYFMQIDGTLNKLTTLREYIDDTEDYINIQLDNHRNQLIQLELFLSSGTV  316

Query  422  vvsafvavagvfGMNITIELFNPDIAGMPEFLWTIGGGSAGCIILYVAVIAWCKHKRLL  246
             +S +  VAG+FGMNI    +N +   +  F W +      C  ++V+++A+ +HK L+
Sbjct  317  CLSLYSLVAGIFGMNIPYT-WNDNHGYV--FKWVVLVSGLFCAFMFVSIVAYARHKGLV  372



>sp|Q10D38.1|MRS2I_ORYSJ RecName: Full=Magnesium transporter MRS2-I [Oryza sativa Japonica 
Group]
 gb|ABF98804.1| magnesium transporter CorA-like family protein, putative, expressed 
[Oryza sativa Japonica Group]
 gb|EEE59906.1| hypothetical protein OsJ_12521 [Oryza sativa Japonica Group]
Length=384

 Score =   104 bits (260),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 60/119 (50%), Positives = 87/119 (73%), Gaps = 3/119 (3%)
 Frame = -2

Query  602  NVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVMLTAATL  423
            +VEELEMLLEAYF+QIDGTLNKL+TLREY+DDTEDYINI LD+ +N L+Q+ + L++ T+
Sbjct  267  DVEELEMLLEAYFMQIDGTLNKLTTLREYIDDTEDYINIQLDNHRNQLIQLELFLSSGTV  326

Query  422  vvsafvavagvfGMNITIELFNPDIAGMPEFLWTIGGGSAGCIILYVAVIAWCKHKRLL  246
             +S +  VAG+FGMNI    +N +   +  F W +      C  ++V+++A+ +HK L+
Sbjct  327  CLSLYSLVAGIFGMNIPYT-WNDNHGYV--FKWVVLVSGLFCAFMFVSIVAYARHKGLV  382



>gb|KJB66344.1| hypothetical protein B456_010G136800 [Gossypium raimondii]
Length=442

 Score =   104 bits (260),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 71/177 (40%), Positives = 106/177 (60%), Gaps = 9/177 (5%)
 Frame = -2

Query  776  DDEVMQSDVNDRVPGEISIEGNGADPEIDYPMERVNTLGRDSHttrtsttrSAISKHLNV  597
            D  +M    ND +     +    + PE+   +E+  ++ R  H +  S+     S   N+
Sbjct  273  DQSLMGFRSNDGLSASAPVSPVASPPELRR-LEKSLSIARSRHESMRSSE----SATENI  327

Query  596  EELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVMLTAATLvv  417
            EELEMLLEAYF+ ID TLNKL++L+EY+DDTED+INI LD+ +N L+Q  ++LT AT VV
Sbjct  328  EELEMLLEAYFVLIDSTLNKLTSLKEYIDDTEDFINIQLDNVRNQLIQFELLLTTATFVV  387

Query  416  safvavagvfGMNITIELFNPDIAGMPEFLWTIGGGSAGCIILYVAVIAWCKHKRLL  246
            + F  VAG+FGMN  I +F+   A    F W +       II++ A + + K++RL+
Sbjct  388  AIFGVVAGIFGMNFAIPMFDDPGA----FKWVLIITGVCGIIIFCAFVWFFKYRRLM  440



>gb|EEE61022.1| hypothetical protein OsJ_14848 [Oryza sativa Japonica Group]
Length=391

 Score =   104 bits (259),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 61/101 (60%), Positives = 76/101 (75%), Gaps = 1/101 (1%)
 Frame = -2

Query  602  NVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVMLTAATL  423
            N +ELE+LLE+YF+QIDGTLN LSTLREYV+DTEDYIN+MLD+KQN LLQMG++L+  TL
Sbjct  273  NTDELEILLESYFVQIDGTLNSLSTLREYVEDTEDYINMMLDEKQNQLLQMGILLSTGTL  332

Query  422  vvsafvavagvfGMNITIELFNPDIAGMPEFLWTIGGGSAG  300
            V S  +AV GVFG+N+ I L++   A    F     G  AG
Sbjct  333  VSSCAIAVTGVFGINVHISLYDSP-ASSAAFPCAAAGIVAG  372



>ref|XP_010669638.1| PREDICTED: magnesium transporter MRS2-I-like [Beta vulgaris subsp. 
vulgaris]
Length=390

 Score =   104 bits (259),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 62/120 (52%), Positives = 86/120 (72%), Gaps = 5/120 (4%)
 Frame = -2

Query  602  NVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVMLTAATL  423
            +VEELEMLLEAYF+QIDGTLNKL+TLREY+DDTEDYINI LD+ +N L+Q+ + L+A T+
Sbjct  273  DVEELEMLLEAYFMQIDGTLNKLTTLREYIDDTEDYINIQLDNHRNQLIQLELFLSAGTV  332

Query  422  vvsafvavagvfGMNITIELF-NPDIAGMPEFLWTIGGGSAGCIILYVAVIAWCKHKRLL  246
             +S +  VAG+FGMNI      N D      F W +      C++L+V +I++ ++K L+
Sbjct  333  CLSVYSLVAGIFGMNIPFTWMENYDYL----FKWVVILTGFFCVVLFVFIISYARNKGLV  388



>ref|XP_010320857.1| PREDICTED: magnesium transporter MRS2-5 isoform X2 [Solanum lycopersicum]
Length=406

 Score =   104 bits (259),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 61/120 (51%), Positives = 82/120 (68%), Gaps = 6/120 (5%)
 Frame = -2

Query  602  NVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVMLTAATL  423
            N+++LEMLLE YF+ ID  LNKLS+L+EY+DDTED INI L + QN L+Q  ++LTAAT 
Sbjct  290  NIDQLEMLLETYFVVIDSALNKLSSLKEYIDDTEDLINIKLANVQNQLIQFELLLTAATF  349

Query  422  vvsafvavagvfGMNITIELF-NPDIAGMPEFLWTIGGGSAGCIILYVAVIAWCKHKRLL  246
            V + F  V  VFGMN+   +F +PD      F WTI      C++LY+A + + KHK+LL
Sbjct  350  VATIFAMVTAVFGMNLKTTVFDDPD-----GFNWTIIITGIFCLVLYIAFMIYFKHKKLL  404



>ref|XP_003559849.1| PREDICTED: magnesium transporter MRS2-I [Brachypodium distachyon]
 ref|XP_010230167.1| PREDICTED: magnesium transporter MRS2-I [Brachypodium distachyon]
Length=387

 Score =   104 bits (259),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 61/119 (51%), Positives = 87/119 (73%), Gaps = 3/119 (3%)
 Frame = -2

Query  602  NVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVMLTAATL  423
            +VEELEMLLEAYF+QIDGTLNKL+TLREY+DDTEDYINI LD+ +N L+Q+ + L++ T+
Sbjct  270  DVEELEMLLEAYFMQIDGTLNKLTTLREYIDDTEDYINIQLDNHRNQLIQLELFLSSGTV  329

Query  422  vvsafvavagvfGMNITIELFNPDIAGMPEFLWTIGGGSAGCIILYVAVIAWCKHKRLL  246
             +S +  VAG+FGMNI    +N +   +  F W +      C +++V V+A+ +HK L+
Sbjct  330  CLSLYSLVAGIFGMNIPYT-WNENHGYI--FKWVVLISGLVCALMFVFVVAYARHKGLV  385



>ref|XP_008228805.1| PREDICTED: magnesium transporter MRS2-1 [Prunus mume]
 ref|XP_008228806.1| PREDICTED: magnesium transporter MRS2-1 [Prunus mume]
Length=446

 Score =   104 bits (260),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 70/154 (45%), Positives = 101/154 (66%), Gaps = 8/154 (5%)
 Frame = -2

Query  707  ADPEIDYPMERVNTLGRDSHttrtsttrSAISKHLNVEELEMLLEAYFIQIDGTLNKLST  528
            A P     +E+  ++ R  H +  S+     S   ++EELEMLLEAYF+ ID TLNKL++
Sbjct  299  ASPPDGRKLEKSLSIARSRHESMRSSD----SATESIEELEMLLEAYFVVIDSTLNKLTS  354

Query  527  LREYVDDTEDYINIMLDDKQNHLLQMGVMLTAATLvvsafvavagvfGMNITIELFNPDI  348
            L+EY+DDTED+INI LD+ +N L+Q  ++LT AT VV+ F  VAG+FGMN TI LF  D 
Sbjct  355  LKEYIDDTEDFINIQLDNVRNQLIQFELLLTTATFVVAIFGVVAGIFGMNFTIPLF--DN  412

Query  347  AGMPEFLWTIGGGSAGCIILYVAVIAWCKHKRLL  246
            AG  +++  I G +  CI  + A + + K++RL+
Sbjct  413  AGAFKWVLIITGVTGFCI--FSAFVWFFKYRRLM  444



>ref|XP_004239046.1| PREDICTED: magnesium transporter MRS2-5 isoform X1 [Solanum lycopersicum]
Length=415

 Score =   104 bits (259),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 61/120 (51%), Positives = 82/120 (68%), Gaps = 6/120 (5%)
 Frame = -2

Query  602  NVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVMLTAATL  423
            N+++LEMLLE YF+ ID  LNKLS+L+EY+DDTED INI L + QN L+Q  ++LTAAT 
Sbjct  299  NIDQLEMLLETYFVVIDSALNKLSSLKEYIDDTEDLINIKLANVQNQLIQFELLLTAATF  358

Query  422  vvsafvavagvfGMNITIELF-NPDIAGMPEFLWTIGGGSAGCIILYVAVIAWCKHKRLL  246
            V + F  V  VFGMN+   +F +PD      F WTI      C++LY+A + + KHK+LL
Sbjct  359  VATIFAMVTAVFGMNLKTTVFDDPD-----GFNWTIIITGIFCLVLYIAFMIYFKHKKLL  413



>gb|EMS62342.1| Magnesium transporter MRS2-I [Triticum urartu]
Length=334

 Score =   103 bits (258),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 60/119 (50%), Positives = 84/119 (71%), Gaps = 3/119 (3%)
 Frame = -2

Query  602  NVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVMLTAATL  423
            +VEELEMLLEAYF+QIDGTLNKL+TLREY+DDTEDYINI LD+ +N L+Q+ + L++ T+
Sbjct  217  DVEELEMLLEAYFMQIDGTLNKLTTLREYIDDTEDYINIQLDNHRNQLIQLELFLSSGTV  276

Query  422  vvsafvavagvfGMNITIELFNPDIAGMPEFLWTIGGGSAGCIILYVAVIAWCKHKRLL  246
             +S +  VAGVFGMNI    +  +      F W +      C  ++V ++A+ +HK L+
Sbjct  277  CLSLYSLVAGVFGMNIP---YTWNDGHGYVFKWVVIVSGLFCAFMFVTIVAYARHKGLV  332



>ref|XP_007215378.1| hypothetical protein PRUPE_ppa005729mg [Prunus persica]
 gb|EMJ16577.1| hypothetical protein PRUPE_ppa005729mg [Prunus persica]
Length=446

 Score =   104 bits (260),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 70/154 (45%), Positives = 101/154 (66%), Gaps = 8/154 (5%)
 Frame = -2

Query  707  ADPEIDYPMERVNTLGRDSHttrtsttrSAISKHLNVEELEMLLEAYFIQIDGTLNKLST  528
            A P     +E+  ++ R  H +  S+     S   ++EELEMLLEAYF+ ID TLNKL++
Sbjct  299  ASPPDGRKLEKSLSIARSRHESMRSSD----STTESIEELEMLLEAYFVVIDSTLNKLTS  354

Query  527  LREYVDDTEDYINIMLDDKQNHLLQMGVMLTAATLvvsafvavagvfGMNITIELFNPDI  348
            L+EY+DDTED+INI LD+ +N L+Q  ++LT AT VV+ F  VAG+FGMN TI LF  D 
Sbjct  355  LKEYIDDTEDFINIQLDNVRNQLIQFELLLTTATFVVAIFGVVAGIFGMNFTIPLF--DN  412

Query  347  AGMPEFLWTIGGGSAGCIILYVAVIAWCKHKRLL  246
            AG  +++  I G +  CI  + A + + K++RL+
Sbjct  413  AGAFKWVLIITGVTGFCI--FSAFVWFFKYRRLM  444



>gb|EAY94161.1| hypothetical protein OsI_15936 [Oryza sativa Indica Group]
Length=440

 Score =   104 bits (259),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 61/101 (60%), Positives = 76/101 (75%), Gaps = 1/101 (1%)
 Frame = -2

Query  602  NVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVMLTAATL  423
            N +ELE+LLE+YF+QIDGTLN LSTLREYV+DTEDYIN+MLD+KQN LLQMG++L+  TL
Sbjct  322  NTDELEILLESYFVQIDGTLNSLSTLREYVEDTEDYINMMLDEKQNQLLQMGILLSTGTL  381

Query  422  vvsafvavagvfGMNITIELFNPDIAGMPEFLWTIGGGSAG  300
            V S  +AV GVFG+N+ I L++   A    F     G  AG
Sbjct  382  VSSCAIAVTGVFGINVHISLYD-SPASSAAFPCAAAGIVAG  421



>ref|XP_002530669.1| RNA splicing protein mrs2, mitochondrial, putative [Ricinus communis]
 gb|EEF31700.1| RNA splicing protein mrs2, mitochondrial, putative [Ricinus communis]
Length=453

 Score =   104 bits (259),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 55/119 (46%), Positives = 85/119 (71%), Gaps = 4/119 (3%)
 Frame = -2

Query  602  NVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVMLTAATL  423
            +VE+LEMLLEAYF+Q+DGT NK+ ++REY+DDTEDY+NI LD+++N L+Q+ + LT A+ 
Sbjct  337  DVEDLEMLLEAYFMQLDGTRNKILSVREYIDDTEDYVNIQLDNQRNELIQLQLTLTIASF  396

Query  422  vvsafvavagvfGMNITIELFNPDIAGMPEFLWTIGGGSAGCIILYVAVIAWCKHKRLL  246
             ++    +A  FGMNI   L+  D  G+  F + +G  SA C +L++ V+ + + K+LL
Sbjct  397  AIAMDTLLASFFGMNIPCRLYEMD--GV--FGYFVGSTSAACFLLFMLVLGYARWKKLL  451



>dbj|BAK06708.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=388

 Score =   103 bits (258),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 60/119 (50%), Positives = 84/119 (71%), Gaps = 3/119 (3%)
 Frame = -2

Query  602  NVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVMLTAATL  423
            +VEELEMLLEAYF+QIDGTLNKL+TLREY+DDTEDYINI LD+ +N L+Q+ + L++ T+
Sbjct  271  DVEELEMLLEAYFMQIDGTLNKLTTLREYIDDTEDYINIQLDNHRNQLIQLELFLSSGTV  330

Query  422  vvsafvavagvfGMNITIELFNPDIAGMPEFLWTIGGGSAGCIILYVAVIAWCKHKRLL  246
             +S +  VAGVFGMNI    +  +      F W +      C  ++V ++A+ +HK L+
Sbjct  331  CLSLYSLVAGVFGMNIP---YTWNDGHGYVFKWVVIVSGLFCAFMFVTIVAYARHKGLV  386



>ref|XP_011073486.1| PREDICTED: magnesium transporter MRS2-I-like [Sesamum indicum]
Length=395

 Score =   103 bits (258),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 60/119 (50%), Positives = 86/119 (72%), Gaps = 3/119 (3%)
 Frame = -2

Query  602  NVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVMLTAATL  423
            +VEELEMLLEAYF+QIDGT NKL+TLREY+D+TEDYINI LD+ +N L+Q+ + L++ T+
Sbjct  278  DVEELEMLLEAYFMQIDGTFNKLTTLREYIDNTEDYINIQLDNHRNQLIQLELFLSSGTV  337

Query  422  vvsafvavagvfGMNITIELFNPDIAGMPEFLWTIGGGSAGCIILYVAVIAWCKHKRLL  246
             +S +  VAG+FGMNI    +N D   M  F W +      C IL++ +I++ ++K L+
Sbjct  338  CLSIYSLVAGIFGMNIPYT-WNEDHGYM--FKWVVIFAGTFCAILFILIISYARYKGLV  393



>sp|Q7XQQ1.1|MRS2D_ORYSJ RecName: Full=Putative magnesium transporter MRS2-D [Oryza sativa 
Japonica Group]
 emb|CAE03029.1| OSJNBa0084A10.4 [Oryza sativa Japonica Group]
Length=434

 Score =   104 bits (259),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 61/101 (60%), Positives = 76/101 (75%), Gaps = 1/101 (1%)
 Frame = -2

Query  602  NVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVMLTAATL  423
            N +ELE+LLE+YF+QIDGTLN LSTLREYV+DTEDYIN+MLD+KQN LLQMG++L+  TL
Sbjct  316  NTDELEILLESYFVQIDGTLNSLSTLREYVEDTEDYINMMLDEKQNQLLQMGILLSTGTL  375

Query  422  vvsafvavagvfGMNITIELFNPDIAGMPEFLWTIGGGSAG  300
            V S  +AV GVFG+N+ I L++   A    F     G  AG
Sbjct  376  VSSCAIAVTGVFGINVHISLYDSP-ASSAAFPCAAAGIVAG  415



>ref|XP_009367740.1| PREDICTED: magnesium transporter MRS2-I-like [Pyrus x bretschneideri]
Length=407

 Score =   103 bits (258),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 59/119 (50%), Positives = 83/119 (70%), Gaps = 3/119 (3%)
 Frame = -2

Query  602  NVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVMLTAATL  423
            +VEELEMLLEAYF+QIDGTLNKL+TLREY+DDTEDYINI LD+ +N L+Q+ + L++ T+
Sbjct  290  DVEELEMLLEAYFMQIDGTLNKLTTLREYIDDTEDYINIQLDNHRNQLIQLELFLSSGTV  349

Query  422  vvsafvavagvfGMNITIELFNPDIAGMPEFLWTIGGGSAGCIILYVAVIAWCKHKRLL  246
             +S    VA +FGMNI    +  +      F W I G    C  L++ ++++ +HK L+
Sbjct  350  CLSMCSLVAAIFGMNIP---YTWNYGHEYVFKWVIIGTGMVCASLFLLIMSYAQHKGLV  405



>ref|XP_006827857.1| hypothetical protein AMTR_s00008p00066060 [Amborella trichopoda]
 gb|ERM95273.1| hypothetical protein AMTR_s00008p00066060 [Amborella trichopoda]
Length=448

 Score =   104 bits (259),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 59/125 (47%), Positives = 87/125 (70%), Gaps = 4/125 (3%)
 Frame = -2

Query  620  AISKHLNVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVM  441
            A S   +VE+LEMLLEAYF+Q++GT NK+ ++REYVDDTEDY+NI LD+ +N L+Q+ ++
Sbjct  326  AHSDDYDVEDLEMLLEAYFMQLEGTRNKILSVREYVDDTEDYVNIQLDNHRNELIQLQLI  385

Query  440  LTAATLvvsafvavagvfGMNITIELFNPDIAGMPEFLWTIGGGSAGCIILYVAVIAWCK  261
            LT A   ++    +AG FGMNI   L+  DI G+  F   +GG S  C++++  V+ + K
Sbjct  386  LTIAAFSITIETLIAGAFGMNIPCTLY--DIKGI--FGPIVGGTSFACVLIFFFVLGYAK  441

Query  260  HKRLL  246
             K+LL
Sbjct  442  SKKLL  446



>ref|XP_006845374.1| hypothetical protein AMTR_s00019p00038520 [Amborella trichopoda]
 gb|ERN07049.1| hypothetical protein AMTR_s00019p00038520 [Amborella trichopoda]
Length=448

 Score =   104 bits (259),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 68/154 (44%), Positives = 96/154 (62%), Gaps = 8/154 (5%)
 Frame = -2

Query  707  ADPEIDYPMERVNTLGRDSHttrtsttrSAISKHLNVEELEMLLEAYFIQIDGTLNKLST  528
            + P     +E+  +L R  H +  S+     S   N+EELEMLLEAYF+ ID TLNKL++
Sbjct  301  SSPTETRKLEKSFSLARSRHDSMKSSD----STTENIEELEMLLEAYFVVIDSTLNKLTS  356

Query  527  LREYVDDTEDYINIMLDDKQNHLLQMGVMLTAATLvvsafvavagvfGMNITIELFNPDI  348
            L+EY+DDTED+INI LD+ +N L+Q  ++LT AT VV+ F  VAGVFGMN  ++LFN   
Sbjct  357  LKEYIDDTEDFINIQLDNVRNQLIQFELLLTTATFVVAIFGVVAGVFGMNFDVDLFNTPA  416

Query  347  AGMPEFLWTIGGGSAGCIILYVAVIAWCKHKRLL  246
            A    F W +    A    ++   + + +HKRL+
Sbjct  417  A----FKWVLIITGAVGFTIFCGFLWFFRHKRLM  446



>ref|XP_011020585.1| PREDICTED: magnesium transporter MRS2-1-like [Populus euphratica]
 ref|XP_011020586.1| PREDICTED: magnesium transporter MRS2-1-like [Populus euphratica]
 ref|XP_011020587.1| PREDICTED: magnesium transporter MRS2-1-like [Populus euphratica]
 ref|XP_011020588.1| PREDICTED: magnesium transporter MRS2-1-like [Populus euphratica]
 ref|XP_011020589.1| PREDICTED: magnesium transporter MRS2-1-like [Populus euphratica]
 ref|XP_011020590.1| PREDICTED: magnesium transporter MRS2-1-like [Populus euphratica]
 ref|XP_011020591.1| PREDICTED: magnesium transporter MRS2-1-like [Populus euphratica]
 ref|XP_011020592.1| PREDICTED: magnesium transporter MRS2-1-like [Populus euphratica]
Length=444

 Score =   103 bits (258),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 69/155 (45%), Positives = 98/155 (63%), Gaps = 8/155 (5%)
 Frame = -2

Query  710  GADPEIDYPMERVNTLGRDSHttrtsttrSAISKHLNVEELEMLLEAYFIQIDGTLNKLS  531
             + P     +E+  ++ R  H +  ST     S   N+EELEMLLEAYF+ ID TLNKL+
Sbjct  296  SSPPADSRKLEKSLSIARSRHESMKSTE----SATENIEELEMLLEAYFVVIDSTLNKLT  351

Query  530  TLREYVDDTEDYINIMLDDKQNHLLQMGVMLTAATLvvsafvavagvfGMNITIELFNPD  351
            +L+EY+DDTED+INI LD+ +N L+Q  ++LT AT VV+ F  VAG+FGMN  I LF  D
Sbjct  352  SLKEYIDDTEDFINIQLDNVRNQLIQFELLLTTATFVVAIFGVVAGIFGMNFAIPLF--D  409

Query  350  IAGMPEFLWTIGGGSAGCIILYVAVIAWCKHKRLL  246
             AG   F W +       ++++ A I + K++RL+
Sbjct  410  DAGA--FKWVLLITGVTGVVVFCAFIRFFKYRRLM  442



>sp|Q01JR9.1|MRS2D_ORYSI RecName: Full=Putative magnesium transporter MRS2-D [Oryza sativa 
Indica Group]
 emb|CAH67006.1| OSIGBa0160I14.4 [Oryza sativa Indica Group]
Length=434

 Score =   103 bits (258),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 56/82 (68%), Positives = 71/82 (87%), Gaps = 0/82 (0%)
 Frame = -2

Query  602  NVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVMLTAATL  423
            N +ELE+LLE+YF+QIDGTLN LSTLREYV+DTEDYIN+MLD+KQN LLQMG++L+  TL
Sbjct  316  NTDELEILLESYFVQIDGTLNSLSTLREYVEDTEDYINMMLDEKQNQLLQMGILLSTGTL  375

Query  422  vvsafvavagvfGMNITIELFN  357
            V S  +AV GVFG+N+ I L++
Sbjct  376  VSSCAIAVTGVFGINVHISLYD  397



>ref|XP_010932874.1| PREDICTED: magnesium transporter MRS2-I-like [Elaeis guineensis]
Length=389

 Score =   103 bits (257),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 58/119 (49%), Positives = 86/119 (72%), Gaps = 3/119 (3%)
 Frame = -2

Query  602  NVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVMLTAATL  423
            +VEELEMLLE Y++QIDGTLNKL+TLREY+DDTEDYINI LD+ +N L+Q+ + L+++T+
Sbjct  272  DVEELEMLLEVYYMQIDGTLNKLTTLREYIDDTEDYINIQLDNHRNQLIQLELFLSSSTV  331

Query  422  vvsafvavagvfGMNITIELFNPDIAGMPEFLWTIGGGSAGCIILYVAVIAWCKHKRLL  246
             +S +   AG+FGM+I    +N D   +  F W +      C IL++ ++A+ +HK L+
Sbjct  332  CLSLYSLFAGIFGMSIPYS-WNNDHGYI--FKWVVIISGLACAILFILIVAYARHKGLV  387



>ref|NP_001149859.1| LOC100283487 [Zea mays]
 gb|ACG37034.1| metal ion transporter [Zea mays]
Length=384

 Score =   103 bits (257),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 59/119 (50%), Positives = 85/119 (71%), Gaps = 3/119 (3%)
 Frame = -2

Query  602  NVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVMLTAATL  423
            +VEELEMLLEAYF+Q+DGTLNKL+TLREY+DDTEDYINI LD+ +N L+Q+ + L++ T+
Sbjct  267  DVEELEMLLEAYFMQVDGTLNKLTTLREYIDDTEDYINIQLDNHRNQLIQLELFLSSGTV  326

Query  422  vvsafvavagvfGMNITIELFNPDIAGMPEFLWTIGGGSAGCIILYVAVIAWCKHKRLL  246
             +S +  VAGVFGMNI    +  +      F W +      C  ++V+++A+ +HK L+
Sbjct  327  CLSLYSLVAGVFGMNIP---YTWNDGHGYIFKWVVLVSGLFCAFIFVSIVAYARHKGLV  382



>gb|AAN73217.1| MRS2-7 [Arabidopsis thaliana]
Length=386

 Score =   103 bits (256),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 60/119 (50%), Positives = 86/119 (72%), Gaps = 3/119 (3%)
 Frame = -2

Query  602  NVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVMLTAATL  423
            +VEELEMLLEAYF+QID TLNKL+ LREY+DDTEDYINI LD+ +N L+Q+ +ML+A T+
Sbjct  269  DVEELEMLLEAYFMQIDSTLNKLTELREYIDDTEDYINIQLDNHRNQLIQLELMLSAGTV  328

Query  422  vvsafvavagvfGMNITIELFNPDIAGMPEFLWTIGGGSAGCIILYVAVIAWCKHKRLL  246
             VS +  +AG+FGMNI    +N D   +  F W +      CI+L+V ++++ + + L+
Sbjct  329  CVSVYSMIAGIFGMNIP-NTWNHDHGYI--FKWVVSLTGTFCIVLFVIILSYARFRGLI  384



>ref|NP_196531.2| magnesium transporter MRS2-7 [Arabidopsis thaliana]
 sp|Q304A0.1|MRS27_ARATH RecName: Full=Magnesium transporter MRS2-7; AltName: Full=Magnesium 
Transporter 7; Short=AtMGT7 [Arabidopsis thaliana]
 gb|ABD64135.2| Mg2+ transporter protein MGT7 [Arabidopsis thaliana]
 gb|AED91431.1| magnesium transporter MRS2-7 [Arabidopsis thaliana]
Length=386

 Score =   103 bits (256),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 60/119 (50%), Positives = 86/119 (72%), Gaps = 3/119 (3%)
 Frame = -2

Query  602  NVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVMLTAATL  423
            +VEELEMLLEAYF+QID TLNKL+ LREY+DDTEDYINI LD+ +N L+Q+ +ML+A T+
Sbjct  269  DVEELEMLLEAYFMQIDSTLNKLTELREYIDDTEDYINIQLDNHRNQLIQLELMLSAGTV  328

Query  422  vvsafvavagvfGMNITIELFNPDIAGMPEFLWTIGGGSAGCIILYVAVIAWCKHKRLL  246
             VS +  +AG+FGMNI    +N D   +  F W +      CI+L+V ++++ + + L+
Sbjct  329  CVSVYSMIAGIFGMNIP-NTWNHDHGYI--FKWVVSLTGTFCIVLFVIILSYARFRGLI  384



>ref|XP_010917593.1| PREDICTED: magnesium transporter MRS2-I-like [Elaeis guineensis]
Length=390

 Score =   103 bits (256),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 58/119 (49%), Positives = 86/119 (72%), Gaps = 3/119 (3%)
 Frame = -2

Query  602  NVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVMLTAATL  423
            +VEELEMLLEAYF+QIDGTLN+L+TLREY+DDTEDYINI LD+ +N L+Q+ + L++ T+
Sbjct  273  DVEELEMLLEAYFMQIDGTLNRLTTLREYIDDTEDYINIQLDNHRNQLIQLELFLSSGTV  332

Query  422  vvsafvavagvfGMNITIELFNPDIAGMPEFLWTIGGGSAGCIILYVAVIAWCKHKRLL  246
             +S +  V G+FGMNI    ++ + +    F W +      C IL++ ++A+ +HK L+
Sbjct  333  CLSLYALVGGIFGMNIP---YSWNDSHGYVFKWVVIISGLVCAILFILIVAYARHKGLV  388



>ref|NP_850802.2| magnesium transporter MRS2-7 [Arabidopsis thaliana]
 gb|AED91432.1| magnesium transporter MRS2-7 [Arabidopsis thaliana]
Length=397

 Score =   103 bits (257),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 60/119 (50%), Positives = 86/119 (72%), Gaps = 3/119 (3%)
 Frame = -2

Query  602  NVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVMLTAATL  423
            +VEELEMLLEAYF+QID TLNKL+ LREY+DDTEDYINI LD+ +N L+Q+ +ML+A T+
Sbjct  280  DVEELEMLLEAYFMQIDSTLNKLTELREYIDDTEDYINIQLDNHRNQLIQLELMLSAGTV  339

Query  422  vvsafvavagvfGMNITIELFNPDIAGMPEFLWTIGGGSAGCIILYVAVIAWCKHKRLL  246
             VS +  +AG+FGMNI    +N D   +  F W +      CI+L+V ++++ + + L+
Sbjct  340  CVSVYSMIAGIFGMNIP-NTWNHDHGYI--FKWVVSLTGTFCIVLFVIILSYARFRGLI  395



>ref|XP_006471213.1| PREDICTED: magnesium transporter MRS2-4-like [Citrus sinensis]
Length=446

 Score =   103 bits (258),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 55/119 (46%), Positives = 89/119 (75%), Gaps = 4/119 (3%)
 Frame = -2

Query  602  NVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVMLTAATL  423
            +VE+LEMLLEAYF+Q+DGT NK+ ++REY+DDTEDY+NI LD+++N L+Q+ ++LT A+ 
Sbjct  330  DVEDLEMLLEAYFMQLDGTRNKILSVREYIDDTEDYVNIQLDNQRNELIQLQLILTIASF  389

Query  422  vvsafvavagvfGMNITIELFNPDIAGMPEFLWTIGGGSAGCIILYVAVIAWCKHKRLL  246
             ++A   +AG+FGMNI  +L+  D  G+ E    +G  +  C++L++ V+ + + K+LL
Sbjct  390  AIAANTLIAGIFGMNIPCQLYETD--GIFEIF--VGSTTTACVLLFLLVLGYARWKKLL  444



>gb|ACN31570.1| unknown [Zea mays]
 tpg|DAA51272.1| TPA: metal ion transporter [Zea mays]
Length=384

 Score =   103 bits (256),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 59/119 (50%), Positives = 85/119 (71%), Gaps = 3/119 (3%)
 Frame = -2

Query  602  NVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVMLTAATL  423
            +VEELEMLLEAYF+Q+DGTLNKL+TLREY+DDTEDYINI LD+ +N L+Q+ + L++ T+
Sbjct  267  DVEELEMLLEAYFMQVDGTLNKLTTLREYIDDTEDYINIQLDNHRNQLIQLELFLSSGTV  326

Query  422  vvsafvavagvfGMNITIELFNPDIAGMPEFLWTIGGGSAGCIILYVAVIAWCKHKRLL  246
             +S +  VAGVFGMNI    +  +      F W +      C  ++V+++A+ +HK L+
Sbjct  327  CLSLYSLVAGVFGMNIP---YTWNDGHGYIFKWVVLVSGLFCAFIFVSIVAYARHKGLV  382



>gb|KDO43541.1| hypothetical protein CISIN_1g013287mg [Citrus sinensis]
Length=446

 Score =   103 bits (258),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 55/119 (46%), Positives = 89/119 (75%), Gaps = 4/119 (3%)
 Frame = -2

Query  602  NVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVMLTAATL  423
            +VE+LEMLLEAYF+Q+DGT NK+ ++REY+DDTEDY+NI LD+++N L+Q+ ++LT A+ 
Sbjct  330  DVEDLEMLLEAYFMQLDGTRNKILSVREYIDDTEDYVNIQLDNQRNELIQLQLILTIASF  389

Query  422  vvsafvavagvfGMNITIELFNPDIAGMPEFLWTIGGGSAGCIILYVAVIAWCKHKRLL  246
             ++A   +AG+FGMNI  +L+  D  G+ E    +G  +  C++L++ V+ + + K+LL
Sbjct  390  AIAANTLIAGIFGMNIPCQLYETD--GIFEIF--VGSTTTACVLLFLLVLGYARWKKLL  444



>ref|XP_006431749.1| hypothetical protein CICLE_v10001154mg [Citrus clementina]
 gb|ESR44989.1| hypothetical protein CICLE_v10001154mg [Citrus clementina]
Length=446

 Score =   103 bits (258),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 55/119 (46%), Positives = 89/119 (75%), Gaps = 4/119 (3%)
 Frame = -2

Query  602  NVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVMLTAATL  423
            +VE+LEMLLEAYF+Q+DGT NK+ ++REY+DDTEDY+NI LD+++N L+Q+ ++LT A+ 
Sbjct  330  DVEDLEMLLEAYFMQLDGTRNKILSVREYIDDTEDYVNIQLDNQRNELIQLQLILTIASF  389

Query  422  vvsafvavagvfGMNITIELFNPDIAGMPEFLWTIGGGSAGCIILYVAVIAWCKHKRLL  246
             ++A   +AG+FGMNI  +L+  D  G+ E    +G  +  C++L++ V+ + + K+LL
Sbjct  390  AIAANTLIAGIFGMNIPCQLYETD--GIFEIF--VGSTTTACVLLFLLVLGYARWKKLL  444



>ref|XP_009764804.1| PREDICTED: magnesium transporter MRS2-1, partial [Nicotiana sylvestris]
Length=270

 Score =   102 bits (253),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 69/156 (44%), Positives = 101/156 (65%), Gaps = 10/156 (6%)
 Frame = -2

Query  707  ADPEIDYPMERVNTLGRDSHttrtsttrSAISKHLNVEELEMLLEAYFIQIDGTLNKLST  528
            + P     +E+  ++ R  H +  S+   A ++  ++EELEMLLEAYF+ ID TLNKL++
Sbjct  121  SSPPESRRLEKSLSIARSRHESMRSSESGAETQ--SIEELEMLLEAYFVVIDSTLNKLTS  178

Query  527  LREYVDDTEDYINIMLDDKQNHLLQMGVMLTAATLvvsafvavagvfGMNITIELFN-PD  351
            L+EY+DDTED+INI LD+ +N L+Q  ++LT AT VV+ F  VAG+FGMN  I +FN PD
Sbjct  179  LKEYIDDTEDFINIQLDNVRNQLIQFELLLTTATFVVAIFGVVAGIFGMNFEIPMFNQPD  238

Query  350  IAGMPEFLWT-IGGGSAGCIILYVAVIAWCKHKRLL  246
                  F W  I  G  G +I + A + + K++RL+
Sbjct  239  -----AFKWVLIITGVTGAVIFF-AFLWFFKYRRLM  268



>gb|AAK20062.1|AC025783_22 putative CorA-like Mg2+ transporter protein [Oryza sativa Japonica 
Group]
Length=333

 Score =   102 bits (255),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 56/128 (44%), Positives = 89/128 (70%), Gaps = 6/128 (5%)
 Frame = -2

Query  620  AISKHLN--VEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMG  447
            A S HL+  VE+LEMLLEAYF+Q+DG  N++ ++REY+DDTEDY+NI LD+++N L+Q+ 
Sbjct  207  ATSMHLDNDVEDLEMLLEAYFMQLDGIRNRILSVREYIDDTEDYVNIQLDNQRNELIQLQ  266

Query  446  VMLTAATLvvsafvavagvfGMNITIELFNPDIAGMPEFLWT-IGGGSAGCIILYVAVIA  270
            + LT A+  ++    +AG F MNI  +L++ D      F W  +GG S+GC ++ + ++ 
Sbjct  267  LTLTIASFGIAVNTFIAGAFAMNIQSKLYSIDDGS---FFWPFVGGTSSGCFMICIVLLW  323

Query  269  WCKHKRLL  246
            + + K+LL
Sbjct  324  YARWKKLL  331



>ref|XP_002463899.1| hypothetical protein SORBIDRAFT_01g008500 [Sorghum bicolor]
 gb|EER90897.1| hypothetical protein SORBIDRAFT_01g008500 [Sorghum bicolor]
Length=387

 Score =   103 bits (256),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 59/119 (50%), Positives = 85/119 (71%), Gaps = 3/119 (3%)
 Frame = -2

Query  602  NVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVMLTAATL  423
            +VEELEMLLEAYF+QIDGTLNKL+TLREY+DDTEDYINI LD+ +N L+Q+ + L++ T+
Sbjct  270  DVEELEMLLEAYFMQIDGTLNKLTTLREYIDDTEDYINIQLDNHRNQLIQLELFLSSGTV  329

Query  422  vvsafvavagvfGMNITIELFNPDIAGMPEFLWTIGGGSAGCIILYVAVIAWCKHKRLL  246
             +S +  VAGVFGMNI    +  +      F W +      C  ++++++A+ +HK L+
Sbjct  330  CLSLYSLVAGVFGMNIP---YTWNDGHGYIFKWVVIVSGLVCAFMFISIVAYARHKGLV  385



>ref|NP_001065204.1| Os10g0545000 [Oryza sativa Japonica Group]
 gb|ABB47950.1| CorA-like Mg2+ transporter protein, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF27118.1| Os10g0545000 [Oryza sativa Japonica Group]
 dbj|BAG91452.1| unnamed protein product [Oryza sativa Japonica Group]
Length=343

 Score =   102 bits (255),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 56/128 (44%), Positives = 89/128 (70%), Gaps = 6/128 (5%)
 Frame = -2

Query  620  AISKHLN--VEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMG  447
            A S HL+  VE+LEMLLEAYF+Q+DG  N++ ++REY+DDTEDY+NI LD+++N L+Q+ 
Sbjct  217  ATSMHLDNDVEDLEMLLEAYFMQLDGIRNRILSVREYIDDTEDYVNIQLDNQRNELIQLQ  276

Query  446  VMLTAATLvvsafvavagvfGMNITIELFNPDIAGMPEFLWT-IGGGSAGCIILYVAVIA  270
            + LT A+  ++    +AG F MNI  +L++ D      F W  +GG S+GC ++ + ++ 
Sbjct  277  LTLTIASFGIAVNTFIAGAFAMNIQSKLYSIDDGS---FFWPFVGGTSSGCFMICIVLLW  333

Query  269  WCKHKRLL  246
            + + K+LL
Sbjct  334  YARWKKLL  341



>ref|XP_002282145.1| PREDICTED: magnesium transporter MRS2-I-like isoform X1 [Vitis 
vinifera]
Length=389

 Score =   102 bits (255),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 60/119 (50%), Positives = 84/119 (71%), Gaps = 3/119 (3%)
 Frame = -2

Query  602  NVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVMLTAATL  423
            +VEELEMLLEAYF+QIDGTLNKLSTLREY+DDTEDYINI LD+ +N L+Q+ + L++ T+
Sbjct  272  DVEELEMLLEAYFMQIDGTLNKLSTLREYIDDTEDYINIQLDNHRNQLIQLELFLSSGTV  331

Query  422  vvsafvavagvfGMNITIELFNPDIAGMPEFLWTIGGGSAGCIILYVAVIAWCKHKRLL  246
             +S +  VA +FGMNI     N D   M  F W +      C  +++++I++ + K L+
Sbjct  332  CLSIYSLVAAIFGMNIPYTWRN-DHGYM--FKWVVILSGMACASIFLSIISYARSKGLV  387



>ref|XP_007045856.1| Magnesium transporter 3 isoform 3 [Theobroma cacao]
 gb|EOY01688.1| Magnesium transporter 3 isoform 3 [Theobroma cacao]
Length=300

 Score =   102 bits (254),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 60/120 (50%), Positives = 84/120 (70%), Gaps = 6/120 (5%)
 Frame = -2

Query  602  NVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVMLTAATL  423
            N+E+LEMLLEAYF+ ID TL+KL +L+EY+DDTED INI L + QNHL+Q  ++LTAAT 
Sbjct  184  NIEQLEMLLEAYFVVIDHTLSKLFSLKEYIDDTEDLINIKLGNVQNHLIQFELLLTAATF  243

Query  422  vvsafvavagvfGMNITIELFNPDIAGMPE-FLWTIGGGSAGCIILYVAVIAWCKHKRLL  246
            V + F AVAGVFGMN    +F+      P  F W +    AGC++LY + + + ++K++ 
Sbjct  244  VATLFAAVAGVFGMNFAASVFD-----YPSGFSWVLLITGAGCVLLYFSFLLYFRYKKVF  298



>gb|KHN10711.1| Magnesium transporter MRS2-I [Glycine soja]
Length=383

 Score =   102 bits (255),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 57/124 (46%), Positives = 85/124 (69%), Gaps = 2/124 (2%)
 Frame = -2

Query  617  ISKHLNVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVML  438
            + +  +VEELEMLLEAYF+QIDGTLNKL+TLREY+DDTEDYINI LD+ +N L+Q+ + +
Sbjct  260  VQRENDVEELEMLLEAYFMQIDGTLNKLATLREYIDDTEDYINIQLDNHRNQLIQLELFI  319

Query  437  TAATLvvsafvavagvfGMNITIELFNPDIAGMPEFLWTIGGGSAGCIILYVAVIAWCKH  258
            +  T+ +S +  VA +FGMNI      P    +  F W +  G   C  L+++++++ + 
Sbjct  320  SVGTVCMSLYSLVAAIFGMNIPYTWKAPGHEHV--FKWVVIFGGMVCASLFLSIVSYARR  377

Query  257  KRLL  246
            K L+
Sbjct  378  KGLV  381



>gb|ACJ83619.1| unknown [Medicago truncatula]
Length=170

 Score = 99.8 bits (247),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 56/119 (47%), Positives = 85/119 (71%), Gaps = 4/119 (3%)
 Frame = -2

Query  602  NVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVMLTAATL  423
            +VE+LEM+LEAYF+Q+DGT NK+ ++REY+DDTEDY+NI LD+ +N L+Q+ + LT A+ 
Sbjct  54   DVEDLEMMLEAYFMQLDGTRNKILSVREYIDDTEDYVNIQLDNHRNELIQLQLTLTIASF  113

Query  422  vvsafvavagvfGMNITIELFNPDIAGMPEFLWTIGGGSAGCIILYVAVIAWCKHKRLL  246
             +++   VAG FGMNI   L+  +    P     +GG +A  I+L++ V+A+ K K+LL
Sbjct  114  AIASETLVAGAFGMNIPCTLYTQNGIFWP----IVGGMTAVSILLFLVVLAYAKWKKLL  168



>ref|XP_011034561.1| PREDICTED: magnesium transporter MRS2-1 isoform X2 [Populus euphratica]
 ref|XP_011034562.1| PREDICTED: magnesium transporter MRS2-1 isoform X2 [Populus euphratica]
Length=443

 Score =   103 bits (256),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 67/154 (44%), Positives = 98/154 (64%), Gaps = 8/154 (5%)
 Frame = -2

Query  707  ADPEIDYPMERVNTLGRDSHttrtsttrSAISKHLNVEELEMLLEAYFIQIDGTLNKLST  528
            + P     +E+  ++ R  H +  ST     S   N+EELEMLLEAYF+ ID TLNKL++
Sbjct  296  SSPPDSRKLEKSLSIARSRHESMKSTE----SATENIEELEMLLEAYFVVIDSTLNKLTS  351

Query  527  LREYVDDTEDYINIMLDDKQNHLLQMGVMLTAATLvvsafvavagvfGMNITIELFNPDI  348
            L+EY+DDTED+INI LD+ +N L+Q  ++LT AT VV+ F  VAG+FGMN  + LF  D 
Sbjct  352  LKEYIDDTEDFINIQLDNVRNQLIQFELLLTTATFVVAIFGVVAGIFGMNFAVPLF--DD  409

Query  347  AGMPEFLWTIGGGSAGCIILYVAVIAWCKHKRLL  246
            AG   F W +       ++++ A + + K++RL+
Sbjct  410  AG--AFKWVLIITGVAGVVIFCAFVWFFKYRRLM  441



>emb|CDO98239.1| unnamed protein product [Coffea canephora]
Length=442

 Score =   103 bits (256),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 66/153 (43%), Positives = 100/153 (65%), Gaps = 10/153 (7%)
 Frame = -2

Query  701  PEIDYPMERVNTLGRDSHttrtsttrSAISKHLNVEELEMLLEAYFIQIDGTLNKLSTLR  522
            P     +E+  ++ R  H +  S+     S + ++EELEMLLEAYF+ ID TLNKL++L+
Sbjct  297  PPDSRKLEKTLSIARSRHESVRSSE----SANESIEELEMLLEAYFVVIDSTLNKLTSLK  352

Query  521  EYVDDTEDYINIMLDDKQNHLLQMGVMLTAATLvvsafvavagvfGMNITIELF-NPDIA  345
            EY+DDTED+INI LD+ +N L+Q  ++LT AT VV+ F  VAG+FGMN ++ LF NP+  
Sbjct  353  EYIDDTEDFINIQLDNVRNQLIQFELLLTTATFVVAIFGVVAGIFGMNFSVPLFDNPN--  410

Query  344  GMPEFLWTIGGGSAGCIILYVAVIAWCKHKRLL  246
                F W +   +   II++ + + + K+KRL+
Sbjct  411  ---AFKWVLIITAVCGIIIFCSFLWFFKYKRLM  440



>emb|CDY65607.1| BnaCnng47920D [Brassica napus]
Length=429

 Score =   103 bits (256),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 57/120 (48%), Positives = 89/120 (74%), Gaps = 6/120 (5%)
 Frame = -2

Query  602  NVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVMLTAATL  423
            +VE+LEMLLEAYF+Q+DG  NK+ T+REY+DDTEDY+NI LD+++N L+Q+ ++LT A+ 
Sbjct  313  DVEDLEMLLEAYFMQLDGMRNKILTVREYIDDTEDYVNIQLDNQRNQLIQLQLILTMASF  372

Query  422  vvsafvavagvfGMNITIELFNPDIAGMP-EFLWTIGGGSAGCIILYVAVIAWCKHKRLL  246
             ++A   +A +FGMNI   L+N  I G+   F+W+I   +A C +L++ V+ + + K+LL
Sbjct  373  AITAETLLASLFGMNIPCPLYN--IHGIFWYFVWSI---TAFCFVLFMVVLGYARWKKLL  427



>ref|XP_009407221.1| PREDICTED: magnesium transporter MRS2-I-like [Musa acuminata 
subsp. malaccensis]
Length=392

 Score =   102 bits (255),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 61/119 (51%), Positives = 89/119 (75%), Gaps = 3/119 (3%)
 Frame = -2

Query  602  NVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVMLTAATL  423
            +VEELEMLLEAYF+QIDGTLNKL+TLREY+DDTEDYINI LD+ +N L+Q+ + L++ T+
Sbjct  275  DVEELEMLLEAYFMQIDGTLNKLTTLREYIDDTEDYINIQLDNHRNQLIQLELFLSSGTV  334

Query  422  vvsafvavagvfGMNITIELFNPDIAGMPEFLWTIGGGSAGCIILYVAVIAWCKHKRLL  246
             +S +  VAG+FGMNI    +N D   + +++  + G  +G   L++ +IA+ +HK L+
Sbjct  335  SLSIYSLVAGIFGMNIPYS-WNDDHGHVFKWVVILSGLISG--FLFIFIIAYARHKGLI  390



>ref|XP_003521272.1| PREDICTED: magnesium transporter MRS2-I-like isoform X1 [Glycine 
max]
Length=388

 Score =   102 bits (255),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 57/124 (46%), Positives = 85/124 (69%), Gaps = 2/124 (2%)
 Frame = -2

Query  617  ISKHLNVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVML  438
            + +  +VEELEMLLEAYF+QIDGTLNKL+TLREY+DDTEDYINI LD+ +N L+Q+ + +
Sbjct  265  VQRENDVEELEMLLEAYFMQIDGTLNKLATLREYIDDTEDYINIQLDNHRNQLIQLELFI  324

Query  437  TAATLvvsafvavagvfGMNITIELFNPDIAGMPEFLWTIGGGSAGCIILYVAVIAWCKH  258
            +  T+ +S +  VA +FGMNI      P    +  F W +  G   C  L+++++++ + 
Sbjct  325  SVGTVCMSLYSLVAAIFGMNIPYTWKAPGHEHV--FKWVVIFGGMVCASLFLSIVSYARR  382

Query  257  KRLL  246
            K L+
Sbjct  383  KGLV  386



>ref|XP_010034036.1| PREDICTED: magnesium transporter MRS2-1-like [Eucalyptus grandis]
 ref|XP_010034037.1| PREDICTED: magnesium transporter MRS2-1-like [Eucalyptus grandis]
 ref|XP_010034038.1| PREDICTED: magnesium transporter MRS2-1-like [Eucalyptus grandis]
 gb|KCW53907.1| hypothetical protein EUGRSUZ_J03120 [Eucalyptus grandis]
Length=489

 Score =   103 bits (257),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 69/154 (45%), Positives = 98/154 (64%), Gaps = 8/154 (5%)
 Frame = -2

Query  707  ADPEIDYPMERVNTLGRDSHttrtsttrSAISKHLNVEELEMLLEAYFIQIDGTLNKLST  528
            A P     +E+  ++ R  H +  S+  +  S    +EELEMLLEAYF+ ID TLNKL++
Sbjct  342  ASPPDGRKLEKSLSIARSRHESMRSSEGATES----IEELEMLLEAYFVVIDSTLNKLTS  397

Query  527  LREYVDDTEDYINIMLDDKQNHLLQMGVMLTAATLvvsafvavagvfGMNITIELFNPDI  348
            L+EY+DDTED+INI LD+ +N L+Q  ++LT AT VV+ F  VAG+FGMN  I LFN   
Sbjct  398  LKEYIDDTEDFINIQLDNVRNQLIQFELLLTTATFVVAIFGVVAGIFGMNFPIPLFNNAA  457

Query  347  AGMPEFLWTIGGGSAGCIILYVAVIAWCKHKRLL  246
            A    F W +    A  II+++A   + K++RL+
Sbjct  458  A----FGWVLLITGATGIIIFIAFCWFFKYRRLM  487



>gb|AHB08883.1| magnesium transporter MRS2-I isoform 1 [Suaeda glauca]
Length=392

 Score =   102 bits (255),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 62/119 (52%), Positives = 86/119 (72%), Gaps = 3/119 (3%)
 Frame = -2

Query  602  NVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVMLTAATL  423
            +VEELEMLLEAYF+QIDGTLNKL+TLREY+DDTEDYINI LD+ +N L+Q+ + L++ T+
Sbjct  275  DVEELEMLLEAYFMQIDGTLNKLTTLREYIDDTEDYINIQLDNHRNQLIQLELFLSSGTV  334

Query  422  vvsafvavagvfGMNITIELFNPDIAGMPEFLWTIGGGSAGCIILYVAVIAWCKHKRLL  246
             +S +  VAG+FGMNI       D  G   F W +      C +++VAVI++ ++K L+
Sbjct  335  CLSVYSLVAGIFGMNIPYTWM--DHHGY-LFKWVVILTGILCTVVFVAVISYARYKGLV  390



>sp|A2Z9W7.2|MRS2G_ORYSI RecName: Full=Putative magnesium transporter MRS2-G [Oryza sativa 
Indica Group]
Length=468

 Score =   103 bits (257),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 56/128 (44%), Positives = 89/128 (70%), Gaps = 6/128 (5%)
 Frame = -2

Query  620  AISKHLN--VEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMG  447
            A S HL+  VE+LEMLLEAYF+Q+DG  N++ ++REY+DDTEDY+NI LD+++N L+Q+ 
Sbjct  342  ATSMHLDNDVEDLEMLLEAYFMQLDGIRNRILSVREYIDDTEDYVNIQLDNQRNELIQLQ  401

Query  446  VMLTAATLvvsafvavagvfGMNITIELFNPDIAGMPEFLWT-IGGGSAGCIILYVAVIA  270
            + LT A+  ++    +AG F MNI  +L++ D      F W  +GG S+GC ++ + ++ 
Sbjct  402  LTLTIASFGIAVNTFIAGAFAMNIQSKLYSIDDG---SFFWPFVGGTSSGCFMICIVLLW  458

Query  269  WCKHKRLL  246
            + + K+LL
Sbjct  459  YARWKKLL  466



>sp|A3BV82.2|MRS2G_ORYSJ RecName: Full=Putative magnesium transporter MRS2-G [Oryza sativa 
Japonica Group]
Length=468

 Score =   103 bits (257),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 56/128 (44%), Positives = 89/128 (70%), Gaps = 6/128 (5%)
 Frame = -2

Query  620  AISKHLN--VEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMG  447
            A S HL+  VE+LEMLLEAYF+Q+DG  N++ ++REY+DDTEDY+NI LD+++N L+Q+ 
Sbjct  342  ATSMHLDNDVEDLEMLLEAYFMQLDGIRNRILSVREYIDDTEDYVNIQLDNQRNELIQLQ  401

Query  446  VMLTAATLvvsafvavagvfGMNITIELFNPDIAGMPEFLWT-IGGGSAGCIILYVAVIA  270
            + LT A+  ++    +AG F MNI  +L++ D      F W  +GG S+GC ++ + ++ 
Sbjct  402  LTLTIASFGIAVNTFIAGAFAMNIQSKLYSIDDG---SFFWPFVGGTSSGCFMICIVLLW  458

Query  269  WCKHKRLL  246
            + + K+LL
Sbjct  459  YARWKKLL  466



>ref|XP_006368496.1| magnesium transporter CorA-like family protein [Populus trichocarpa]
 gb|ERP65065.1| magnesium transporter CorA-like family protein [Populus trichocarpa]
Length=443

 Score =   103 bits (256),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 67/154 (44%), Positives = 98/154 (64%), Gaps = 8/154 (5%)
 Frame = -2

Query  707  ADPEIDYPMERVNTLGRDSHttrtsttrSAISKHLNVEELEMLLEAYFIQIDGTLNKLST  528
            + P     +E+  ++ R  H +  S+     S   N+EELEMLLEAYF+ ID TLNKL++
Sbjct  296  SSPPESRKLEKSLSIARSRHESMRSSE----SATENIEELEMLLEAYFVVIDSTLNKLTS  351

Query  527  LREYVDDTEDYINIMLDDKQNHLLQMGVMLTAATLvvsafvavagvfGMNITIELFNPDI  348
            L+EY+DDTED+INI LD+ +N L+Q  ++LT AT VV+ F  VAG+FGMN  + LF  D 
Sbjct  352  LKEYIDDTEDFINIQLDNVRNQLIQFELLLTTATFVVAIFGVVAGIFGMNFAVPLF--DD  409

Query  347  AGMPEFLWTIGGGSAGCIILYVAVIAWCKHKRLL  246
            AG   F W +       +I++ A + + K++RL+
Sbjct  410  AG--AFKWVLIITGVTGVIIFCAFVWFFKYRRLM  441



>ref|XP_007159570.1| hypothetical protein PHAVU_002G248600g [Phaseolus vulgaris]
 gb|ESW31564.1| hypothetical protein PHAVU_002G248600g [Phaseolus vulgaris]
Length=451

 Score =   103 bits (256),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 56/119 (47%), Positives = 89/119 (75%), Gaps = 4/119 (3%)
 Frame = -2

Query  602  NVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVMLTAATL  423
            +VE+LEMLL+AYF+Q+DGT NK+ ++REY+DDTEDY+NI LD+ +N L+Q+ + LT A+ 
Sbjct  335  DVEDLEMLLDAYFMQLDGTRNKILSVREYIDDTEDYVNIQLDNHRNELIQLQLTLTIASF  394

Query  422  vvsafvavagvfGMNITIELFNPDIAGMPEFLWTIGGGSAGCIILYVAVIAWCKHKRLL  246
            V++    +AG+FGMNI  +L++ D    P F+W+    SA C++L+  ++A+ + K+LL
Sbjct  395  VIAIDTLIAGIFGMNIPCKLYDIDGIFWP-FVWST---SAACVLLFFLILAYARWKKLL  449



>ref|XP_011034560.1| PREDICTED: magnesium transporter MRS2-1 isoform X1 [Populus euphratica]
Length=452

 Score =   103 bits (256),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 72/155 (46%), Positives = 100/155 (65%), Gaps = 10/155 (6%)
 Frame = -2

Query  707  ADPEIDYPMERVNTLGRDSHttrtsttrSAISKHLNVEELEMLLEAYFIQIDGTLNKLST  528
            + P     +E+  ++ R  H +  ST     S   N+EELEMLLEAYF+ ID TLNKL++
Sbjct  305  SSPPDSRKLEKSLSIARSRHESMKSTE----SATENIEELEMLLEAYFVVIDSTLNKLTS  360

Query  527  LREYVDDTEDYINIMLDDKQNHLLQMGVMLTAATLvvsafvavagvfGMNITIELFNPDI  348
            L+EY+DDTED+INI LD+ +N L+Q  ++LT AT VV+ F  VAG+FGMN  + LF  D 
Sbjct  361  LKEYIDDTEDFINIQLDNVRNQLIQFELLLTTATFVVAIFGVVAGIFGMNFAVPLF--DD  418

Query  347  AGMPEFLWT-IGGGSAGCIILYVAVIAWCKHKRLL  246
            AG   F W  I  G AG +I + A + + K++RL+
Sbjct  419  AG--AFKWVLIITGVAGVVI-FCAFVWFFKYRRLM  450



>ref|XP_006493378.1| PREDICTED: magnesium transporter MRS2-1-like isoform X1 [Citrus 
sinensis]
 ref|XP_006493379.1| PREDICTED: magnesium transporter MRS2-1-like isoform X2 [Citrus 
sinensis]
 ref|XP_006493380.1| PREDICTED: magnesium transporter MRS2-1-like isoform X3 [Citrus 
sinensis]
Length=441

 Score =   102 bits (255),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 61/119 (51%), Positives = 84/119 (71%), Gaps = 4/119 (3%)
 Frame = -2

Query  602  NVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVMLTAATL  423
            +VEELEMLLEAYF+ ID TLNKL++L+EY+DDTED+INI LD+ +N L+Q  ++LT AT 
Sbjct  325  SVEELEMLLEAYFVVIDSTLNKLTSLKEYIDDTEDFINIQLDNVRNQLIQFELLLTTATF  384

Query  422  vvsafvavagvfGMNITIELFNPDIAGMPEFLWTIGGGSAGCIILYVAVIAWCKHKRLL  246
            VV+ F  VAG+FGMN TI  F+   A    F W +       II++ A + + K++RL+
Sbjct  385  VVAIFGVVAGIFGMNFTIPFFDEPAA----FKWVLIITGVCGIIIFCAFVWFFKYRRLM  439



>ref|XP_004504196.1| PREDICTED: magnesium transporter MRS2-4-like isoform X1 [Cicer 
arietinum]
Length=435

 Score =   102 bits (255),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 57/119 (48%), Positives = 84/119 (71%), Gaps = 4/119 (3%)
 Frame = -2

Query  602  NVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVMLTAATL  423
            +VE+LEMLLEAYF+Q+DGT NK+ ++REY+DDTEDY+NI LD+ +N L+Q+ + LT A+ 
Sbjct  319  DVEDLEMLLEAYFMQLDGTRNKILSVREYIDDTEDYVNIQLDNHRNELIQLQLTLTIASF  378

Query  422  vvsafvavagvfGMNITIELFNPDIAGMPEFLWTIGGGSAGCIILYVAVIAWCKHKRLL  246
             ++    +AG FGMNI   L+N D    P     + G +A  I+L++ V+A+ K K+LL
Sbjct  379  AIAFETLIAGAFGMNIPCTLYNQDGIFWP----IVAGMTAVSIVLFLLVLAYAKWKKLL  433



>ref|XP_007045858.1| Magnesium transporter 3 isoform 5 [Theobroma cacao]
 gb|EOY01690.1| Magnesium transporter 3 isoform 5 [Theobroma cacao]
Length=303

 Score =   102 bits (253),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 60/120 (50%), Positives = 84/120 (70%), Gaps = 6/120 (5%)
 Frame = -2

Query  602  NVEELEMLLEAYFIQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVMLTAATL  423
            N+E+LEMLLEAYF+ ID TL+KL +L+EY+DDTED INI L + QNHL+Q  ++LTAAT 
Sbjct  187  NIEQLEMLLEAYFVVIDHTLSKLFSLKEYIDDTEDLINIKLGNVQNHLIQFELLLTAATF  246

Query  422  vvsafvavagvfGMNITIELFNPDIAGMPE-FLWTIGGGSAGCIILYVAVIAWCKHKRLL  246
            V + F AVAGVFGMN    +F+      P  F W +    AGC++LY + + + ++K++ 
Sbjct  247  VATLFAAVAGVFGMNFAASVFD-----YPSGFSWVLLITGAGCVLLYFSFLLYFRYKKVF  301



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1606838546005